3SFXA

Cryptococcus neoformans protein farnesyltransferase in complex with fpt-ii and tipifarnib
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
330
structure length
315
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase/transferase inhibitor
molecule keywords Cryptococcus neoformans protein farnesyltransferase alpha su
total genus 131
structure length 315
sequence length 330
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3sfxA00
3KSLA 3PZ1A 3HXDA 1S63A 1JCQA 1TN6A 1FPPA 3DSTA 1NI1A 4YDOA 3E30A 3E34A 1FT2A 3Q73A 2IEJA 3Q75A 2H6FA 3DSVA 3PZ4A 1TN7A 3Q7FA 1MZCA 1LD7A 2H6IA 1KZPA 4GTMA 4GTTA 4GTPA 1TN8A 3SFYA 1FT1A 3HXBA 3DSSA 3DRAA 4GTOA 1LD8A 1TNUA 2H6GA 2R2LA 1N9AA 1S64A 3SFXA 1TNOA 1SA4A 4MBGA 3PZ2A 1JCRA 1N95A 3E33A 4GTRA 1N4SA 1O1TA 1NL4A 1KZOA 1D8DA 3DSXA 1N4RA 2ZISA 3PZ3A 1LTXA 4GTSA 1TNBA 3HXCA 1N4PA 1JCSA 1SA5A 1TNZA 2H6HA 3E32A 1X81A 4LNBA 1QBQA 1N94A 2BEDA 4L9PA 3E37A 4EHMA 1D8EA 2F0YA 1TNYA 1O1SA 3Q78A 4LNGA 3DPYA 3KSQA 3HXEA 4YDEA 1O1RA 3C72A 4GTVA 2ZIRA 3HXFA 1N4QA 4GTQA 1O5MA 1DCEA 3EUVA 3Q7AA 3EU5A 3DSUA 3Q79A 3DSWA
chains in the Genus database with same CATH superfamily
3KSLA 1S63A 1TN6A 2J4DA 4JW1A 4JD2G 2GW1A 4G2VA 3V2OA 4LRZA 1WAO1 3FTUA 1ZB1A 5DBKA 2I2OA 3FUEA 3RK6A 4IULA 4HQDA 3ZW3A 2KC7A 1UJKA 4GTTA 3W9FA 1FT1A 1RZ4A 4ILIA 3U64A 4I1MA 1E8XA 3IEGA 2KM4A 2XZDG 2NC9A 4I9CA 4G24A 2PZIA 5HRYA 4YNDA 4HLEA 4HRNA 2DYSE 2FEZA 4B8AA 2VTBA 1MJ0A 4TUUA 3B7SA 5D66A 3ULEG 5CCLA 4TXRA 4XZ4A 4CDMA 4GTSA 2C2LA 2AVPA 3SI5A 3D9NA 4WWPA 2DBAA 3ZYMA 4OYSA 5ENSD 2MOWA 4A1GA 4J0UA 4A55A 2XEHA 5EX3A 5G05J 4GA1A 3MZLB 1TJCA 4GTVA 3UX4A 4N5QA 3FU0A 3QWVA 3CQCB 2CFUA 3W9GA 4AIFA 2WPVA 4H7YA 1EPUA 3CGHA 3NB2A 3JQ0A 2WB2A 2VJ8A 4JA7A 3ONLA 5KJKA 5CMYA 1LD7A 2ZGGA 4KZ0A 3QKYA 3HXBA 1Z3XA 2H6GA 1S64A 2WXQA 2L0TB 2GRLA 4XX5A 2OVBA 1S70B 1PC2A 5C2YA 1EF1C 5CBNA 3FHEA 4U0SA 4UUCA 1EDUA 1OXJA 2AXZA 2KATA 3CV0A 1KPSB 3C3RA 2R02A 3DSXA 4RVBA 5ENPD 2QFCA 3FFLA 5G04J 5A7DB 3D9HA 1N0QA 4UI9J 3MEKA 3ML9A 1TNZA 3Q49B 3TWSA 4APOA 4B0ZA 4LNBA 1QBQA 2RFMA 2OVFA 1OWPA 4F53A 2IU1A 3EU9A 2LAHA 4BSZB 5H7PA 4PH4B 4KZCA 3IXEA 2HE0A 2CFZA 5KWDA 3ASOE 4J8EA 3ZGQA 4AY5A 3VTYA 5FQ8A 2Y3AA 3CKBA 4TUMA 4JB8P 1H2TC 3ML8A 2J08A 2L6BA 4NACA 4LG6A 4AOFA 3LS8A 2H6FA 3B95A 4A3VA 3HIZA 4GTMA 4ANUA 4EZKA 3SFYA 1TN8A 3S2AA 5BV1A 4TRQA 1BPOA 2IONA 2WXPA 3EJNA 5ANLA 3DRAA 5EYLA 5FZQA 1TNUA 2V4LA 3G2UA 1N9AA 3F6QA 5KJNA 3CHSA 3UTMA 4WWNA 3NZUA 4ILGA 2IQCA 4FU3A 2HYZA 3ZU7B 4PS8A 1KZOA 4K0RA 1HH8A 2ZU6B 3J5PA 2Q7FA 3U4TA 3P2BA 2DYRE 1E96B 4XKCA 3AS4A 3JYSA 3KD7A 3UIPC 3B13A 3FP3A 4UI9C 5CCMA 2R5SA 3OXLA 4K5BA 4CEMA 3MYVA 3EHQA 3DXKG 4YDEA 1U3DA 3T8MA 4GZDA 4YVQC 3PEUB 4B93B 3FTVA 2CG2A 1N4QA 3VTXA 3V79K 5B1BE 1OCRE 2EIJE 4HI8A 2ETAA 3L54A 5T3RA 1MQSA 1B89A 4A1SA 1A17A 2VQ2A 4L2YA 3CQGB 3NBNB 3GW4A 5AQ9A 2HR2A 3UM0A 5JHAA 4HBDA 5CRUA 3ZYLA 5C1DA 3HG0D 3PNLB 2XQ0A 3SBSA 2CHZA 3SFXA 5ENTD 2PM7A 3QOUA 2E2EA 1E7UA 3ZYKA 5JA4D 4I43A 4GMRA 2FBNA 4HB5A 4TV3A 3G2TA 4HXIA 3S7FA 2LNIA 2QYUA 3RKVA 1X5BA 5A6CA 2R59A 3LEWA 4JHJA 5LCWC 3WXXA 4UWKA 1H19A 3ZYQA 3FY4A 3T9KA 2IY0C 4ZFHA 4ZHBA 5LX8A 1IXVA 3AAAC 1AWCB 3Q9NC 3SO8A 4RLYA 5AQ7A 4WNFA 3DSWA 3ZXPA 1JUQA 4ABNA 3HXDA 5AN8A 3JXJA 4A3TA 3LY9A 3FH7A 1XNFA 1HXIA 4C0EA 3D9LA 4LNUD 3EDTB 5CERB 2IEJA 2IJGX 3ESKA 2VYIA 4GAAA 1IHGA 2BKGA 4HOUA 3APFA 4N3BA 2EQXA 4RG9A 3TWUA 2WXFA 3JQ1A 4Y6CA 4F3VA 4MBGA 3G2WA 3SQVA 5J90A 2XEEA 2Y69E 1OUVA 1V55E 2LO6A 3ABLE 5FT9A 3R9AB 5KNGA 2FO7A 3NAWA 3RO2A 4BETA 2BUGA 2LAIA 2PM6A 1FVFA 1UN8A 4FP7A 3E32A 2AW6A 4L9PA 5AYWD 2WQ7A 2V4HC 2ILRA 2VSOE 2X6IA 4I6EA 4J8FA 2J09A 5B1AE 4WWOA 2AJAA 3CK8A 2PNNA 3HXEA 3CHQA 4CT0A 4YDWA 3C72A 2ZIRA 3GYZA 3Q15A 4I2ZA 1BI8B 2PL2A 5M72A 4GYOA 2EILE 2QZAA 3QWWA 2J07A 4DLOA 3IHYA 2EINE 3S7JA 3DSTA 2XCBA 1SVXA 4Z68A 2NXPA 2XEVA 1K1AA 3AG1E 2I9CA 1Z6TA 4DX5D 5CRVA 5ENQD 2VSYA 1HZ4A 4AY6A 3DPDA 4ACKA 5FIOA 5JJ6A 1IYGA 3BEEA 3B7UX 3CK9A 3ZUVB 3PZ2A 2P9KG 2R05A 1JCRA 2J49A 3I5PA 1KT1A 4JA9A 4GMJA 3ASFA 3EIQC 1N4SA 3LYAA 2YHCA 3SNXA 1D8DA 3PE3A 2ZISA 4BWRA 3LPZA 4R7LA 2QC9A 3ZEFA 5CBOA 3HXCA 3SHFA 3C3QA 2H6HA 3R7QA 5D2MC 3CVPA 4ATZD 4XE0A 2XCCA 2J4BA 2XGMA 4UQZA 2EIME 2UY1A 3CVYA 1EYHA 2P9IG 4M7CA 3CLJA 3QNKA 3ABKE 2VGXB 1IHBA 3IV0A 2X38A 5CECB 2OEWA 1SZ9A 2Y0BG 1K1BA 3EU5A 3Q79A 3EHRA 4WNGA 1MYOA 4AP2A 4C0MA 3ASNE 4F6RD 3CVVA 2WXKA 2P58C 5ITZF 3G2SA 4U8VD 2OCCE 4UWLA 4BEPA 4GU5A 3ZFWA 3FEYA 2JABA 3PZ4A 4N2QA 2E0IA 3UIOC 1UW4B 1HU3A 1IQRA 4AXHA 4K5CA 4IN3B 2IOLA 2P9LG 5E76A 4G8KA 3FH5A 4EZLA 4I9EA 4HORA 1N95A 3L22A 3OXGA 3E33A 2DIWA 2GRNB 4Q96A 4O6FA 4N3CA 5J08A 3APDA 1N4RA 1PY1A 2LSVA 3U9WA 3GZSA 3CVLA 4JC8A 2EIKE 3SD5A 5E75A 4AVXA 3TWRA 3QB2A 5JJTA 1X81A 3RAUA 3UM3A 3E37A 3EIJA 3QDNA 4FJZA 3ESLA 4LEUA 4G8LA 3UQ3A 3CVQA 1O1SA 4LNGA 1QNFA 3DPYA 4GA2A 3D9KA 4ACLA 3Q9UC 5D0QD 5AAOA 2R03A 1DCEA 3PZDA 2CHWA 2NYJA 1E8YA 3AG2E 5D0OD 3SBTB 4KXKB 4EZJA 5G2NA 1NP7A 4HOTA 2V8SE 2JLBA 4BY6A 3CVUA 3CHMA 5EN5D 4AV7A 2Y4TA 5ENNA 4P29A 2FULA 3OAWA 3EHNA 4G1TA 2H6IA 3ASDA 4KYOB 3JXIA 4GTPA 4JVSA 3TXNA 1MHQA 1N11A 2V5QC 3DXMG 3CK7A 2WXGA 2WVIA 4DPRA 4CGWA 2M63A 3ZN3A 3EHMA 5HI7A 2WXMA 2AXUA 3CSTA 1TJFA 2RD0A 2X3MA 1S0PA 3I4GA 4O1PA 4GYWA 5ARFA 3U66A 1HG2A 4W9RA 1NA3A 4F1SA 1HG5A 2ZGDA 2WQHA 5CMWA 1P5QA 3CIAA 3KAEA 2X6FA 1ELKA 4FLHA 4L2LA 1ZU2A 1WY6A 3FU3A 3FWVA 2A4ZA 1IQUA 4G26A 2MHKA 4U8YD 4U96D 2XRZA 2FI7A 1OWLA 5AQBA 3CSFA 5BT1A 2UWJG 4BESA 3NF1A 3E30A 2KCKA 1BU9A 3QAQA 3V30A 3ZHEA 4HRMB 3Q75A 3S7BA 4JXTA 4EECA 3TAXA 3MKRA 4BFRA 1MX2A 3BU8A 4U95D 4HVBA 4M3OA 1L5JA 2C0LA 3CHRA 3DWLG 3RRUA 2VGYA 1KLXA 3SF4A 5EIDA 2WXJA 2F8XK 4BX8A 1O1TA 3MX3A 4OAVB 5JJ7A 4B94A 3GZ2A 4PS7A 1ZBPA 2L9BA 5FTPA 3LY7A 2IO3C 5FQ6A 3AS8A 1KT0A 5FQ7A 4MKTA 3BUAA 4LCTA 3FEXA 4ANVA 4EHMA 4CZ2D 5HQ8A 4GMLA 4O1OA 4BSXA 5AENA 4K03A 3KEAA 1K8KG 3QJZA 3I4RB 1WG0A 4FJYA 3V2XA 1HFAA 2DVWA 2XPYA 3AG4E 4UWHA 3HDXA 4UQYA 3LXUX 3C98A 2YHEA 4F1PA 5BXUA 3HHMA 4DX7D 3RJVA 3CVXA 4XEIG 3C5RA 3FU5A 4YDOA 3DBSA 1SQMA 2L6JA 4JEHA 3R9MA 1V54E 4HOQA 3FTYA 2HO1A 1OY3D 5FQ4A 2LSUA 4U0UA 1LD8A 3UM1A 3U3WA 1A5EA 1TNOA 5EIBE 4NQ0A 1N54A 1SA4A 3Q47B 3PH0C 4WAFA 5LOZA 3UUXA 1WM5A 3PREA 5LP0A 4BT8A 4N39A 3L82A 5ARGA 2BKKB 1NL4A 4J6IA 3HVEB 3WG7E 1HX8A 2P9SG 5BPPA 3FTWA 5ANRA 3NQPA 2P2CP 3TXMA 4GB9A 1YA0A 4MRUA 1H6KA 4CYMD 2KCVA 3CHPA 1N94A 2MRIA 3ENEA 2PQNA 5LCWJ 2F0YA 1RW2A 2DZOA 3FUMA 4V3IA 2XS8A 4DX2A 3FDHA 4FC8A 2IF4A 4GCOA 2LXMA 4XKBA 3ONKA 1HS6A 4WUYA 1HO8A 3ZXSA 2F8YA 4DX1A 2GRQB 2WMOA 2FF4A 2BF0X 4DI3A 3CHOA 2J8SD 5DIZA 5EILA 2KZTB 3MA5A 3CVNA 3O48A 3BG0B 4HS2A 3NOCD 2X6JA 4J8YA 4DI4A 5HS0A 2WQ6A 1FVHA 1H6PA 2XGOA 3Q73A 3MKQA 4I1OB 4E85A 4OVVA 1N0RA 5AJDA 3OTNA 4GYYA 3ULQA 1U2VG 3PS6A 4GTOA 3L17A 3FTSA 2AXVA 4RSYA 4CDNA 4URKA 3FU6A 3B7RL 3FUFA 4DX6D 1UN9A 4GTRA 4FHKA 4BERA 4EPZA 5CEAA 3MV3B 3MKQB 2MYOA 3BG1B 3B7TA 1MX6A 2XZTG 3FUKA 3UKUG 4BX9A 1XGWA 4UWFA 4XIFA 4MLPA 1G3NB 3T8KA 3D9MA 3AU5A 4AM9A 4ME2A 5AIJA 2IFUA 4L1BA 5FWQA 3R7RA 4BT9A 4CDRA 2I1JA 3AJIA 3FUJA 1H6OA 2XS1A 3MCXA 2VTBB 4GTQA 1O5MA 2WXRA 3SFZA 2IOSA 4GZ5A 3TWXA 2ETBA 2LUHA 3DEPA 1INZA 1Z3YA 1NZNA 5IY5E 1GW6A 1DVPA 4N5CA 1Q2ZA 2VSNA 3PEVB 4BTBA 2XRYA 3RSEG 3SY2A 4BTAA 3J5QB 2QYJA 5EDSA 1MZCA 4HI9A 1TYQG 3LCAA 5T8IA 3FH8A 2JEKA 2KXPC 2WM9A 3CKCA 4I6JA 4JHKA 1H2UA 2BTDA 4B8CB 5A23A 2ZXWE 3CEQA 3N71A 3JUIA 5EX0A 4DUIA 4KVOA 4RQIA 3ASHA 3ABME 2ETCA 2QY7A 4ATGA 3ZPJA 3ZVVA 1N4PA 1DNPA 2XENA 1PAQA 3ZKJA 4U63A 2GRMA 2BEDA 2DCPA 3PE4A 3UT8A 1UOHA 3VLFA 4WNDA 3TWTA 3QC1A 2DZNA 4HFGA 3ZRHA 4FLBA 5JHBA 3KSQA 4PUCA 3ZNGA 3X2QE 2WXLA 2F37A 3K9IA 4Q69A 3O4ZA 2HM8A 2C0MA 4UQXA 3L6AA 2YNQA 1H0AA 4PS3A 1HE8A 1N52A 1SW6A 1LF8A 1JPLA 4JL0A 3AU4A 2XHEA 2P9PG 3RRMB 4OVUA 4AJWA 2XPZA 3FTZA 3HYMB 3LJNA 3QWPA 4LUNU 3IHVA 3PVLA 4D10C 1FT2A 4O60A 3UT7A 5BNWA 1TR4A 2CG3A 3FUIA 3CR3A 3DSVA 3Q7FA 5KJMA 1OWNA 5G05C 2OV8A 5KBAA 4YDYA 3UXGA 1AP7A 2A5EA 4ANXA 3TGOA 3DSSA 4J7WA 4EBAA 5JMND 4JEUA 3TG5A 3RIBA 4K5AB 4IRUA 4XI0A 3QK0A 4ILHB 2I6HA 3TWVA 3FTXA 1OCOE 1W3BA 5KNHD 4LSZE 3D3MA 4N3AA 4NIKA 1UG3A 3ZIMA 1D9SA 3PZ3A 2X6KA 3HRAA 1E90A 2VSXE 4F7AA 4A63B 5BUZA 4L23A 1Y6IA 4OAUC 3L08A 3TG4A 5KCMA 1OWMA 3ULYA 2LXLA 3RO3A 4UI9K 3T5VA 5EKQD 2WMNA 1D8EA 4UWGA 3T5XA 4U04A 3AG3E 3Q78A 3UT4A 2B6CA 1MX4A 4GZCA 4KMOA 4U8HA 1IKND 2KZTA 3LJ3A 1VDYA 3G2VA 1O1RA 1SZAA 1YCSB 5FINA 3EUVA 4L7TA 3FUDA 3E4BA 3C3OA 3PZ1A 1FCHA 4FADA 5EYPF 3MGBA 4I17A 3UM2A 1FPPA 3D9JA 3DEOA 4U7EB 4EBAG 1HF8A 2A5UA 3PUKA 3ZHEB 3RRNB 3FUHA 3FULA 3LDZA 5BXOA 5AARA 1BD8A 4YVOA 4AEZC 4KVMA 5G55A 1QQEA 2R2LA 4U0ZA 1JWFA 3LY8A 3S7DA 3AS5A 3D9PA 5CEDB 3ASGA 3NOGD 2VGEA 1QYMA 4JHRA 1YYHA 3HVEA 4QFVA 2CHXA 4XI9A 2WXNA 1TNBA 4IYPA 5HKPA 1QZ2A 4GZ6A 4B89A 4C48B 4APFA 2L0IA 3MJWA 3KEZA 1DCQA 1SA5A 1OWOA 2YINA 2OOEA 4J8DA 4CCAA 3UI2A 1E7VA 2ONDA 3APCA 4KBQA 1BLXB 2Y4UA 4PDXA 4MS6A 2NSZA 3TL5A 4I2WA 3VLDA 3VLEA 4HOSA 4I1AA 2GROB 3DSUA 1U3CA 2Y1LE 3Q5MA 4NURA 5FZRA 1JCQA 4GPKA 3TWWA 2IO2C 2X6HA 5KJLA 3FUNA 3PUJA 3E34A 1TN7A 4G25A 4JZYA 2VGXA 3PDNA 3URZA 2GRRB 3CVWA 3LVQE 3SGHA 4G11A 3P1UA 1YMPA 2XPIA 5ENRD 3JCKC 4I6GA 1H2VC 4CGVA 3L13A 3UKRG 3L16A 4GA0A 4RG6A 4DK5A 3PNTB 1OT8A 3L9TA 3B7BA 4DRXE 4TXQA 2B0OE 4CRWA 5FZSA 4GCNA 5BW8C 1LTXA 3RU0A 2FO1E 3TJPA 2PQRA 1OCZE 3QARA 3TWQA 4E6HA 2KCLA 1NFIE 5BV0A 2R17C 2P9UG 4Q94A 3D9IA 4DJAA 2UY1B 2XGSA 2WXOA 3IKOB 4QQIA 3MV2B 4ANWA 3GZ1A 2GGFA 3HXFA 3BQOA 3UPVA 2OEVA 2P9NG 4HNAD 4Y6WA 4LERA 1NI1A 1WDYA 2GRPB 4EQFA 3V31A 4NRHB 1E8WA 4KT6B 3LVRE 5B3SE 1NA0A 1KZPA 3KS2A 3OXFA 4HLLA 2WXHA 5AJLA 1K3ZD 2V0PA 2RG8A 3PRZA 3IBEA 3UINC 4FHJA 4DLQA 3I3NA 1JWGA 2AWIA 1OCCE 1ELWA 4H7XA 3NZSA 5ENOD 4HRLA 3ISMC 5G04C 5LFAA 1E8ZA 4U07A 3JUEA 4X8QA 4C9BB 4J8SA 3LKUA 1ELRA 1Z5SC 1JCSA 4TXPA 4GPMA 4GZ3A 4G23A 2DWZA 3Q4AB 2I1KA 1DC2A 4FULA 1UJJA 2RKKA 2RFAA 5CHEE 4CT4A 4WNEA 4JPSA 1TEZA 1TNYA 2YQ8A 5T4YA 2V5FA 3SZ7A 5AQAA 2J9QA 5FJYA 1BI7B 4FA6A 1Y8MA 3UMVA 3Q7AA 2WXIA 4N2SA 3D9OA 2KBXA
chains in the Genus database with same CATH topology
3KSLA 3PZ1A 3HXDA 1S63A 1JCQA 1TN6A 1FPPA 3DSTA 1NI1A 4YDOA 3E30A 3E34A 1FT2A 3Q73A 2IEJA 3Q75A 2H6FA 3DSVA 3PZ4A 1TN7A 3Q7FA 1MZCA 1LD7A 2H6IA 1KZPA 4GTMA 4GTTA 4GTPA 1TN8A 3SFYA 1FT1A 3HXBA 3DSSA 3DRAA 4GTOA 1LD8A 1TNUA 2H6GA 2R2LA 1N9AA 1S64A 3SFXA 1TNOA 1SA4A 4MBGA 3PZ2A 1JCRA 1N95A 3E33A 4GTRA 1N4SA 1O1TA 1NL4A 1KZOA 1D8DA 3DSXA 1N4RA 2ZISA 3PZ3A 1LTXA 4GTSA 1TNBA 3HXCA 1N4PA 1JCSA 1SA5A 1TNZA 2H6HA 3E32A 1X81A 4LNBA 1QBQA 1N94A 2BEDA 4L9PA 3E37A 4EHMA 1D8EA 2F0YA 1TNYA 1O1SA 3Q78A 4LNGA 3DPYA 3KSQA 3HXEA 4YDEA 1O1RA 3C72A 4GTVA 2ZIRA 3HXFA 1N4QA 4GTQA 1O5MA 1DCEA 3EUVA 3Q7AA 3EU5A 3DSUA 3Q79A 3DSWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KSL A;  3PZ1 A;  3HXD A;  1S63 A;  1JCQ A;  1TN6 A;  1FPP A;  3DST A;  1NI1 A;  4YDO A;  3E30 A;  3E34 A;  1FT2 A;  3Q73 A;  2IEJ A;  3Q75 A;  2H6F A;  3DSV A;  3PZ4 A;  1TN7 A;  3Q7F A;  1MZC A;  1LD7 A;  2H6I A;  1KZP A;  4GTM A;  4GTT A;  4GTP A;  1TN8 A;  3SFY A;  1FT1 A;  3HXB A;  3DSS A;  3DRA A;  4GTO A;  1LD8 A;  1TNU A;  2H6G A;  2R2L A;  1N9A A;  1S64 A;  3SFX A;  1TNO A;  1SA4 A;  4MBG A;  3PZ2 A;  1JCR A;  1N95 A;  3E33 A;  4GTR A;  1N4S A;  1O1T A;  1NL4 A;  1KZO A;  1D8D A;  3DSX A;  1N4R A;  2ZIS A;  3PZ3 A;  1LTX A;  4GTS A;  1TNB A;  3HXC A;  1N4P A;  1JCS A;  1SA5 A;  1TNZ A;  2H6H A;  3E32 A;  1X81 A;  4LNB A;  1QBQ A;  1N94 A;  2BED A;  4L9P A;  3E37 A;  4EHM A;  1D8E A;  2F0Y A;  1TNY A;  1O1S A;  3Q78 A;  4LNG A;  3DPY A;  3KSQ A;  3HXE A;  4YDE A;  1O1R A;  3C72 A;  4GTV A;  2ZIR A;  3HXF A;  1N4Q A;  4GTQ A;  1O5M A;  1DCE A;  3EUV A;  3Q7A A;  3EU5 A;  3DSU A;  3Q79 A;  3DSW A; 
#chains in the Genus database with same CATH topology
 3KSL A;  1S63 A;  1TN6 A;  2J4D A;  4JW1 A;  4JD2 G;  2GW1 A;  4G2V A;  3V2O A;  4LRZ A;  1WAO 1;  3FTU A;  1ZB1 A;  5DBK A;  2I2O A;  3FUE A;  3RK6 A;  4IUL A;  4HQD A;  3ZW3 A;  2KC7 A;  1UJK A;  4GTT A;  3W9F A;  1FT1 A;  1RZ4 A;  4ILI A;  3U64 A;  4I1M A;  1E8X A;  3IEG A;  2KM4 A;  2XZD G;  2NC9 A;  4I9C A;  4G24 A;  2PZI A;  5HRY A;  4YND A;  4HLE A;  4HRN A;  2DYS E;  2FEZ A;  4B8A A;  2VTB A;  1MJ0 A;  4TUU A;  3B7S A;  5D66 A;  3ULE G;  5CCL A;  4TXR A;  4XZ4 A;  4CDM A;  4GTS A;  2C2L A;  2AVP A;  3SI5 A;  3D9N A;  4WWP A;  2DBA A;  3ZYM A;  4OYS A;  5ENS D;  2MOW A;  4A1G A;  4J0U A;  4A55 A;  2XEH A;  5EX3 A;  5G05 J;  4GA1 A;  3MZL B;  1TJC A;  4GTV A;  3UX4 A;  4N5Q A;  3FU0 A;  3QWV A;  3CQC B;  2CFU A;  3W9G A;  4AIF A;  2WPV A;  4H7Y A;  1EPU A;  3CGH A;  3NB2 A;  3JQ0 A;  2WB2 A;  2VJ8 A;  4JA7 A;  3ONL A;  5KJK A;  5CMY A;  1LD7 A;  2ZGG A;  4KZ0 A;  3QKY A;  3HXB A;  1Z3X A;  2H6G A;  1S64 A;  2WXQ A;  2L0T B;  2GRL A;  4XX5 A;  2OVB A;  1S70 B;  1PC2 A;  5C2Y A;  1EF1 C;  5CBN A;  3FHE A;  4U0S A;  4UUC A;  1EDU A;  1OXJ A;  2AXZ A;  2KAT A;  3CV0 A;  1KPS B;  3C3R A;  2R02 A;  3DSX A;  4RVB A;  5ENP D;  2QFC A;  3FFL A;  5G04 J;  5A7D B;  3D9H A;  1N0Q A;  4UI9 J;  3MEK A;  3ML9 A;  1TNZ A;  3Q49 B;  3TWS A;  4APO A;  4B0Z A;  4LNB A;  1QBQ A;  2RFM A;  2OVF A;  1OWP A;  4F53 A;  2IU1 A;  3EU9 A;  2LAH A;  4BSZ B;  5H7P A;  4PH4 B;  4KZC A;  3IXE A;  2HE0 A;  2CFZ A;  5KWD A;  3ASO E;  4J8E A;  3ZGQ A;  4AY5 A;  3VTY A;  5FQ8 A;  2Y3A A;  3CKB A;  4TUM A;  4JB8 P;  1H2T C;  3ML8 A;  2J08 A;  2L6B A;  4NAC A;  4LG6 A;  4AOF A;  3LS8 A;  2H6F A;  3B95 A;  4A3V A;  3HIZ A;  4GTM A;  4ANU A;  4EZK A;  3SFY A;  1TN8 A;  3S2A A;  5BV1 A;  4TRQ A;  1BPO A;  2ION A;  2WXP A;  3EJN A;  5ANL A;  3DRA A;  5EYL A;  5FZQ A;  1TNU A;  2V4L A;  3G2U A;  1N9A A;  3F6Q A;  5KJN A;  3CHS A;  3UTM A;  4WWN A;  3NZU A;  4ILG A;  2IQC A;  4FU3 A;  2HYZ A;  3ZU7 B;  4PS8 A;  1KZO A;  4K0R A;  1HH8 A;  2ZU6 B;  3J5P A;  2Q7F A;  3U4T A;  3P2B A;  2DYR E;  1E96 B;  4XKC A;  3AS4 A;  3JYS A;  3KD7 A;  3UIP C;  3B13 A;  3FP3 A;  4UI9 C;  5CCM A;  2R5S A;  3OXL A;  4K5B A;  4CEM A;  3MYV A;  3EHQ A;  3DXK G;  4YDE A;  1U3D A;  3T8M A;  4GZD A;  4YVQ C;  3PEU B;  4B93 B;  3FTV A;  2CG2 A;  1N4Q A;  3VTX A;  3V79 K;  5B1B E;  1OCR E;  2EIJ E;  4HI8 A;  2ETA A;  3L54 A;  5T3R A;  1MQS A;  1B89 A;  4A1S A;  1A17 A;  2VQ2 A;  4L2Y A;  3CQG B;  3NBN B;  3GW4 A;  5AQ9 A;  2HR2 A;  3UM0 A;  5JHA A;  4HBD A;  5CRU A;  3ZYL A;  5C1D A;  3HG0 D;  3PNL B;  2XQ0 A;  3SBS A;  2CHZ A;  3SFX A;  5ENT D;  2PM7 A;  3QOU A;  2E2E A;  1E7U A;  3ZYK A;  5JA4 D;  4I43 A;  4GMR A;  2FBN A;  4HB5 A;  4TV3 A;  3G2T A;  4HXI A;  3S7F A;  2LNI A;  2QYU A;  3RKV A;  1X5B A;  5A6C A;  2R59 A;  3LEW A;  4JHJ A;  5LCW C;  3WXX A;  4UWK A;  1H19 A;  3ZYQ A;  3FY4 A;  3T9K A;  2IY0 C;  4ZFH A;  4ZHB A;  5LX8 A;  1IXV A;  3AAA C;  1AWC B;  3Q9N C;  3SO8 A;  4RLY A;  5AQ7 A;  4WNF A;  3DSW A;  3ZXP A;  1JUQ A;  4ABN A;  3HXD A;  5AN8 A;  3JXJ A;  4A3T A;  3LY9 A;  3FH7 A;  1XNF A;  1HXI A;  4C0E A;  3D9L A;  4LNU D;  3EDT B;  5CER B;  2IEJ A;  2IJG X;  3ESK A;  2VYI A;  4GAA A;  1IHG A;  2BKG A;  4HOU A;  3APF A;  4N3B A;  2EQX A;  4RG9 A;  3TWU A;  2WXF A;  3JQ1 A;  4Y6C A;  4F3V A;  4MBG A;  3G2W A;  3SQV A;  5J90 A;  2XEE A;  2Y69 E;  1OUV A;  1V55 E;  2LO6 A;  3ABL E;  5FT9 A;  3R9A B;  5KNG A;  2FO7 A;  3NAW A;  3RO2 A;  4BET A;  2BUG A;  2LAI A;  2PM6 A;  1FVF A;  1UN8 A;  4FP7 A;  3E32 A;  2AW6 A;  4L9P A;  5AYW D;  2WQ7 A;  2V4H C;  2ILR A;  2VSO E;  2X6I A;  4I6E A;  4J8F A;  2J09 A;  5B1A E;  4WWO A;  2AJA A;  3CK8 A;  2PNN A;  3HXE A;  3CHQ A;  4CT0 A;  4YDW A;  3C72 A;  2ZIR A;  3GYZ A;  3Q15 A;  4I2Z A;  1BI8 B;  2PL2 A;  5M72 A;  4GYO A;  2EIL E;  2QZA A;  3QWW A;  2J07 A;  4DLO A;  3IHY A;  2EIN E;  3S7J A;  3DST A;  2XCB A;  1SVX A;  4Z68 A;  2NXP A;  2XEV A;  1K1A A;  3AG1 E;  2I9C A;  1Z6T A;  4DX5 D;  5CRV A;  5ENQ D;  2VSY A;  1HZ4 A;  4AY6 A;  3DPD A;  4ACK A;  5FIO A;  5JJ6 A;  1IYG A;  3BEE A;  3B7U X;  3CK9 A;  3ZUV B;  3PZ2 A;  2P9K G;  2R05 A;  1JCR A;  2J49 A;  3I5P A;  1KT1 A;  4JA9 A;  4GMJ A;  3ASF A;  3EIQ C;  1N4S A;  3LYA A;  2YHC A;  3SNX A;  1D8D A;  3PE3 A;  2ZIS A;  4BWR A;  3LPZ A;  4R7L A;  2QC9 A;  3ZEF A;  5CBO A;  3HXC A;  3SHF A;  3C3Q A;  2H6H A;  3R7Q A;  5D2M C;  3CVP A;  4ATZ D;  4XE0 A;  2XCC A;  2J4B A;  2XGM A;  4UQZ A;  2EIM E;  2UY1 A;  3CVY A;  1EYH A;  2P9I G;  4M7C A;  3CLJ A;  3QNK A;  3ABK E;  2VGX B;  1IHB A;  3IV0 A;  2X38 A;  5CEC B;  2OEW A;  1SZ9 A;  2Y0B G;  1K1B A;  3EU5 A;  3Q79 A;  3EHR A;  4WNG A;  1MYO A;  4AP2 A;  4C0M A;  3ASN E;  4F6R D;  3CVV A;  2WXK A;  2P58 C;  5ITZ F;  3G2S A;  4U8V D;  2OCC E;  4UWL A;  4BEP A;  4GU5 A;  3ZFW A;  3FEY A;  2JAB A;  3PZ4 A;  4N2Q A;  2E0I A;  3UIO C;  1UW4 B;  1HU3 A;  1IQR A;  4AXH A;  4K5C A;  4IN3 B;  2IOL A;  2P9L G;  5E76 A;  4G8K A;  3FH5 A;  4EZL A;  4I9E A;  4HOR A;  1N95 A;  3L22 A;  3OXG A;  3E33 A;  2DIW A;  2GRN B;  4Q96 A;  4O6F A;  4N3C A;  5J08 A;  3APD A;  1N4R A;  1PY1 A;  2LSV A;  3U9W A;  3GZS A;  3CVL A;  4JC8 A;  2EIK E;  3SD5 A;  5E75 A;  4AVX A;  3TWR A;  3QB2 A;  5JJT A;  1X81 A;  3RAU A;  3UM3 A;  3E37 A;  3EIJ A;  3QDN A;  4FJZ A;  3ESL A;  4LEU A;  4G8L A;  3UQ3 A;  3CVQ A;  1O1S A;  4LNG A;  1QNF A;  3DPY A;  4GA2 A;  3D9K A;  4ACL A;  3Q9U C;  5D0Q D;  5AAO A;  2R03 A;  1DCE A;  3PZD A;  2CHW A;  2NYJ A;  1E8Y A;  3AG2 E;  5D0O D;  3SBT B;  4KXK B;  4EZJ A;  5G2N A;  1NP7 A;  4HOT A;  2V8S E;  2JLB A;  4BY6 A;  3CVU A;  3CHM A;  5EN5 D;  4AV7 A;  2Y4T A;  5ENN A;  4P29 A;  2FUL A;  3OAW A;  3EHN A;  4G1T A;  2H6I A;  3ASD A;  4KYO B;  3JXI A;  4GTP A;  4JVS A;  3TXN A;  1MHQ A;  1N11 A;  2V5Q C;  3DXM G;  3CK7 A;  2WXG A;  2WVI A;  4DPR A;  4CGW A;  2M63 A;  3ZN3 A;  3EHM A;  5HI7 A;  2WXM A;  2AXU A;  3CST A;  1TJF A;  2RD0 A;  2X3M A;  1S0P A;  3I4G A;  4O1P A;  4GYW A;  5ARF A;  3U66 A;  1HG2 A;  4W9R A;  1NA3 A;  4F1S A;  1HG5 A;  2ZGD A;  2WQH A;  5CMW A;  1P5Q A;  3CIA A;  3KAE A;  2X6F A;  1ELK A;  4FLH A;  4L2L A;  1ZU2 A;  1WY6 A;  3FU3 A;  3FWV A;  2A4Z A;  1IQU A;  4G26 A;  2MHK A;  4U8Y D;  4U96 D;  2XRZ A;  2FI7 A;  1OWL A;  5AQB A;  3CSF A;  5BT1 A;  2UWJ G;  4BES A;  3NF1 A;  3E30 A;  2KCK A;  1BU9 A;  3QAQ A;  3V30 A;  3ZHE A;  4HRM B;  3Q75 A;  3S7B A;  4JXT A;  4EEC A;  3TAX A;  3MKR A;  4BFR A;  1MX2 A;  3BU8 A;  4U95 D;  4HVB A;  4M3O A;  1L5J A;  2C0L A;  3CHR A;  3DWL G;  3RRU A;  2VGY A;  1KLX A;  3SF4 A;  5EID A;  2WXJ A;  2F8X K;  4BX8 A;  1O1T A;  3MX3 A;  4OAV B;  5JJ7 A;  4B94 A;  3GZ2 A;  4PS7 A;  1ZBP A;  2L9B A;  5FTP A;  3LY7 A;  2IO3 C;  5FQ6 A;  3AS8 A;  1KT0 A;  5FQ7 A;  4MKT A;  3BUA A;  4LCT A;  3FEX A;  4ANV A;  4EHM A;  4CZ2 D;  5HQ8 A;  4GML A;  4O1O A;  4BSX A;  5AEN A;  4K03 A;  3KEA A;  1K8K G;  3QJZ A;  3I4R B;  1WG0 A;  4FJY A;  3V2X A;  1HFA A;  2DVW A;  2XPY A;  3AG4 E;  4UWH A;  3HDX A;  4UQY A;  3LXU X;  3C98 A;  2YHE A;  4F1P A;  5BXU A;  3HHM A;  4DX7 D;  3RJV A;  3CVX A;  4XEI G;  3C5R A;  3FU5 A;  4YDO A;  3DBS A;  1SQM A;  2L6J A;  4JEH A;  3R9M A;  1V54 E;  4HOQ A;  3FTY A;  2HO1 A;  1OY3 D;  5FQ4 A;  2LSU A;  4U0U A;  1LD8 A;  3UM1 A;  3U3W A;  1A5E A;  1TNO A;  5EIB E;  4NQ0 A;  1N54 A;  1SA4 A;  3Q47 B;  3PH0 C;  4WAF A;  5LOZ A;  3UUX A;  1WM5 A;  3PRE A;  5LP0 A;  4BT8 A;  4N39 A;  3L82 A;  5ARG A;  2BKK B;  1NL4 A;  4J6I A;  3HVE B;  3WG7 E;  1HX8 A;  2P9S G;  5BPP A;  3FTW A;  5ANR A;  3NQP A;  2P2C P;  3TXM A;  4GB9 A;  1YA0 A;  4MRU A;  1H6K A;  4CYM D;  2KCV A;  3CHP A;  1N94 A;  2MRI A;  3ENE A;  2PQN A;  5LCW J;  2F0Y A;  1RW2 A;  2DZO A;  3FUM A;  4V3I A;  2XS8 A;  4DX2 A;  3FDH A;  4FC8 A;  2IF4 A;  4GCO A;  2LXM A;  4XKB A;  3ONK A;  1HS6 A;  4WUY A;  1HO8 A;  3ZXS A;  2F8Y A;  4DX1 A;  2GRQ B;  2WMO A;  2FF4 A;  2BF0 X;  4DI3 A;  3CHO A;  2J8S D;  5DIZ A;  5EIL A;  2KZT B;  3MA5 A;  3CVN A;  3O48 A;  3BG0 B;  4HS2 A;  3NOC D;  2X6J A;  4J8Y A;  4DI4 A;  5HS0 A;  2WQ6 A;  1FVH A;  1H6P A;  2XGO A;  3Q73 A;  3MKQ A;  4I1O B;  4E85 A;  4OVV A;  1N0R A;  5AJD A;  3OTN A;  4GYY A;  3ULQ A;  1U2V G;  3PS6 A;  4GTO A;  3L17 A;  3FTS A;  2AXV A;  4RSY A;  4CDN A;  4URK A;  3FU6 A;  3B7R L;  3FUF A;  4DX6 D;  1UN9 A;  4GTR A;  4FHK A;  4BER A;  4EPZ A;  5CEA A;  3MV3 B;  3MKQ B;  2MYO A;  3BG1 B;  3B7T A;  1MX6 A;  2XZT G;  3FUK A;  3UKU G;  4BX9 A;  1XGW A;  4UWF A;  4XIF A;  4MLP A;  1G3N B;  3T8K A;  3D9M A;  3AU5 A;  4AM9 A;  4ME2 A;  5AIJ A;  2IFU A;  4L1B A;  5FWQ A;  3R7R A;  4BT9 A;  4CDR A;  2I1J A;  3AJI A;  3FUJ A;  1H6O A;  2XS1 A;  3MCX A;  2VTB B;  4GTQ A;  1O5M A;  2WXR A;  3SFZ A;  2IOS A;  4GZ5 A;  3TWX A;  2ETB A;  2LUH A;  3DEP A;  1INZ A;  1Z3Y A;  1NZN A;  5IY5 E;  1GW6 A;  1DVP A;  4N5C A;  1Q2Z A;  2VSN A;  3PEV B;  4BTB A;  2XRY A;  3RSE G;  3SY2 A;  4BTA A;  3J5Q B;  2QYJ A;  5EDS A;  1MZC A;  4HI9 A;  1TYQ G;  3LCA A;  5T8I A;  3FH8 A;  2JEK A;  2KXP C;  2WM9 A;  3CKC A;  4I6J A;  4JHK A;  1H2U A;  2BTD A;  4B8C B;  5A23 A;  2ZXW E;  3CEQ A;  3N71 A;  3JUI A;  5EX0 A;  4DUI A;  4KVO A;  4RQI A;  3ASH A;  3ABM E;  2ETC A;  2QY7 A;  4ATG A;  3ZPJ A;  3ZVV A;  1N4P A;  1DNP A;  2XEN A;  1PAQ A;  3ZKJ A;  4U63 A;  2GRM A;  2BED A;  2DCP A;  3PE4 A;  3UT8 A;  1UOH A;  3VLF A;  4WND A;  3TWT A;  3QC1 A;  2DZN A;  4HFG A;  3ZRH A;  4FLB A;  5JHB A;  3KSQ A;  4PUC A;  3ZNG A;  3X2Q E;  2WXL A;  2F37 A;  3K9I A;  4Q69 A;  3O4Z A;  2HM8 A;  2C0M A;  4UQX A;  3L6A A;  2YNQ A;  1H0A A;  4PS3 A;  1HE8 A;  1N52 A;  1SW6 A;  1LF8 A;  1JPL A;  4JL0 A;  3AU4 A;  2XHE A;  2P9P G;  3RRM B;  4OVU A;  4AJW A;  2XPZ A;  3FTZ A;  3HYM B;  3LJN A;  3QWP A;  4LUN U;  3IHV A;  3PVL A;  4D10 C;  1FT2 A;  4O60 A;  3UT7 A;  5BNW A;  1TR4 A;  2CG3 A;  3FUI A;  3CR3 A;  3DSV A;  3Q7F A;  5KJM A;  1OWN A;  5G05 C;  2OV8 A;  5KBA A;  4YDY A;  3UXG A;  1AP7 A;  2A5E A;  4ANX A;  3TGO A;  3DSS A;  4J7W A;  4EBA A;  5JMN D;  4JEU A;  3TG5 A;  3RIB A;  4K5A B;  4IRU A;  4XI0 A;  3QK0 A;  4ILH B;  2I6H A;  3TWV A;  3FTX A;  1OCO E;  1W3B A;  5KNH D;  4LSZ E;  3D3M A;  4N3A A;  4NIK A;  1UG3 A;  3ZIM A;  1D9S A;  3PZ3 A;  2X6K A;  3HRA A;  1E90 A;  2VSX E;  4F7A A;  4A63 B;  5BUZ A;  4L23 A;  1Y6I A;  4OAU C;  3L08 A;  3TG4 A;  5KCM A;  1OWM A;  3ULY A;  2LXL A;  3RO3 A;  4UI9 K;  3T5V A;  5EKQ D;  2WMN A;  1D8E A;  4UWG A;  3T5X A;  4U04 A;  3AG3 E;  3Q78 A;  3UT4 A;  2B6C A;  1MX4 A;  4GZC A;  4KMO A;  4U8H A;  1IKN D;  2KZT A;  3LJ3 A;  1VDY A;  3G2V A;  1O1R A;  1SZA A;  1YCS B;  5FIN A;  3EUV A;  4L7T A;  3FUD A;  3E4B A;  3C3O A;  3PZ1 A;  1FCH A;  4FAD A;  5EYP F;  3MGB A;  4I17 A;  3UM2 A;  1FPP A;  3D9J A;  3DEO A;  4U7E B;  4EBA G;  1HF8 A;  2A5U A;  3PUK A;  3ZHE B;  3RRN B;  3FUH A;  3FUL A;  3LDZ A;  5BXO A;  5AAR A;  1BD8 A;  4YVO A;  4AEZ C;  4KVM A;  5G55 A;  1QQE A;  2R2L A;  4U0Z A;  1JWF A;  3LY8 A;  3S7D A;  3AS5 A;  3D9P A;  5CED B;  3ASG A;  3NOG D;  2VGE A;  1QYM A;  4JHR A;  1YYH A;  3HVE A;  4QFV A;  2CHX A;  4XI9 A;  2WXN A;  1TNB A;  4IYP A;  5HKP A;  1QZ2 A;  4GZ6 A;  4B89 A;  4C48 B;  4APF A;  2L0I A;  3MJW A;  3KEZ A;  1DCQ A;  1SA5 A;  1OWO A;  2YIN A;  2OOE A;  4J8D A;  4CCA A;  3UI2 A;  1E7V A;  2OND A;  3APC A;  4KBQ A;  1BLX B;  2Y4U A;  4PDX A;  4MS6 A;  2NSZ A;  3TL5 A;  4I2W A;  3VLD A;  3VLE A;  4HOS A;  4I1A A;  2GRO B;  3DSU A;  1U3C A;  2Y1L E;  3Q5M A;  4NUR A;  5FZR A;  1JCQ A;  4GPK A;  3TWW A;  2IO2 C;  2X6H A;  5KJL A;  3FUN A;  3PUJ A;  3E34 A;  1TN7 A;  4G25 A;  4JZY A;  2VGX A;  3PDN A;  3URZ A;  2GRR B;  3CVW A;  3LVQ E;  3SGH A;  4G11 A;  3P1U A;  1YMP A;  2XPI A;  5ENR D;  3JCK C;  4I6G A;  1H2V C;  4CGV A;  3L13 A;  3UKR G;  3L16 A;  4GA0 A;  4RG6 A;  4DK5 A;  3PNT B;  1OT8 A;  3L9T A;  3B7B A;  4DRX E;  4TXQ A;  2B0O E;  4CRW A;  5FZS A;  4GCN A;  5BW8 C;  1LTX A;  3RU0 A;  2FO1 E;  3TJP A;  2PQR A;  1OCZ E;  3QAR A;  3TWQ A;  4E6H A;  2KCL A;  1NFI E;  5BV0 A;  2R17 C;  2P9U G;  4Q94 A;  3D9I A;  4DJA A;  2UY1 B;  2XGS A;  2WXO A;  3IKO B;  4QQI A;  3MV2 B;  4ANW A;  3GZ1 A;  2GGF A;  3HXF A;  3BQO A;  3UPV A;  2OEV A;  2P9N G;  4HNA D;  4Y6W A;  4LER A;  1NI1 A;  1WDY A;  2GRP B;  4EQF A;  3V31 A;  4NRH B;  1E8W A;  4KT6 B;  3LVR E;  5B3S E;  1NA0 A;  1KZP A;  3KS2 A;  3OXF A;  4HLL A;  2WXH A;  5AJL A;  1K3Z D;  2V0P A;  2RG8 A;  3PRZ A;  3IBE A;  3UIN C;  4FHJ A;  4DLQ A;  3I3N A;  1JWG A;  2AWI A;  1OCC E;  1ELW A;  4H7X A;  3NZS A;  5ENO D;  4HRL A;  3ISM C;  5G04 C;  5LFA A;  1E8Z A;  4U07 A;  3JUE A;  4X8Q A;  4C9B B;  4J8S A;  3LKU A;  1ELR A;  1Z5S C;  1JCS A;  4TXP A;  4GPM A;  4GZ3 A;  4G23 A;  2DWZ A;  3Q4A B;  2I1K A;  1DC2 A;  4FUL A;  1UJJ A;  2RKK A;  2RFA A;  5CHE E;  4CT4 A;  4WNE A;  4JPS A;  1TEZ A;  1TNY A;  2YQ8 A;  5T4Y A;  2V5F A;  3SZ7 A;  5AQA A;  2J9Q A;  5FJY A;  1BI7 B;  4FA6 A;  1Y8M A;  3UMV A;  3Q7A A;  2WXI A;  4N2S A;  3D9O A;  2KBX A; 
#chains in the Genus database with same CATH homology
 3KSL A;  3PZ1 A;  3HXD A;  1S63 A;  1JCQ A;  1TN6 A;  1FPP A;  3DST A;  1NI1 A;  4YDO A;  3E30 A;  3E34 A;  1FT2 A;  3Q73 A;  2IEJ A;  3Q75 A;  2H6F A;  3DSV A;  3PZ4 A;  1TN7 A;  3Q7F A;  1MZC A;  1LD7 A;  2H6I A;  1KZP A;  4GTM A;  4GTT A;  4GTP A;  1TN8 A;  3SFY A;  1FT1 A;  3HXB A;  3DSS A;  3DRA A;  4GTO A;  1LD8 A;  1TNU A;  2H6G A;  2R2L A;  1N9A A;  1S64 A;  3SFX A;  1TNO A;  1SA4 A;  4MBG A;  3PZ2 A;  1JCR A;  1N95 A;  3E33 A;  4GTR A;  1N4S A;  1O1T A;  1NL4 A;  1KZO A;  1D8D A;  3DSX A;  1N4R A;  2ZIS A;  3PZ3 A;  1LTX A;  4GTS A;  1TNB A;  3HXC A;  1N4P A;  1JCS A;  1SA5 A;  1TNZ A;  2H6H A;  3E32 A;  1X81 A;  4LNB A;  1QBQ A;  1N94 A;  2BED A;  4L9P A;  3E37 A;  4EHM A;  1D8E A;  2F0Y A;  1TNY A;  1O1S A;  3Q78 A;  4LNG A;  3DPY A;  3KSQ A;  3HXE A;  4YDE A;  1O1R A;  3C72 A;  4GTV A;  2ZIR A;  3HXF A;  1N4Q A;  4GTQ A;  1O5M A;  1DCE A;  3EUV A;  3Q7A A;  3EU5 A;  3DSU A;  3Q79 A;  3DSW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...