3SFXA

Cryptococcus neoformans protein farnesyltransferase in complex with fpt-ii and tipifarnib
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
330
structure length
315
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Cryptococcus neoformans protein farnesyltransferase alpha su
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
total genus 131
structure length 315
sequence length 330
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3sfxA00
4GTMA 1D8DA 1N4RA 2BEDA 1JCQA 4GTSA 3Q73A 4GTPA 2R2LA 3PZ2A 1DCEA 1LD7A 1X81A 1NL4A 3HXCA 3HXBA 3SFXA 3EU5A 3KSQA 4GTVA 3E30A 1TN6A 1NI1A 3DSTA 2F0YA 3PZ3A 3DSSA 1N94A 1N9AA 1FPPA 3Q78A 1JCRA 1KZOA 3E32A 1O1TA 2H6FA 4MBGA 3PZ1A 4YDOA 1D8EA 1N4QA 1TN8A 3DRAA 4YDEA 1TNZA 3DSXA 4GTOA 1JCSA 1N95A 3E34A 3Q7FA 1TN7A 1O5MA 1TNUA 4EHMA 4GTRA 1QBQA 3E37A 3E33A 4L9PA 3DSVA 2ZIRA 1O1SA 1S64A 1TNYA 3HXFA 3DSWA 1SA4A 4LNBA 1KZPA 2H6HA 1FT1A 1LTXA 3Q75A 3HXEA 4GTQA 1N4SA 1S63A 3SFYA 3KSLA 3Q7AA 2H6GA 1N4PA 3EUVA 2IEJA 2H6IA 1O1RA 3HXDA 4LNGA 3PZ4A 1MZCA 1TNBA 3C72A 1SA5A 4GTTA 2ZISA 1TNOA 3DSUA 3DPYA 1FT2A 3Q79A 1LD8A
chains in the Genus database with same CATH superfamily
3X2QE 3QC1A 3CHPA 4G8KA 4FLHA 3UI2A 4XIFA 1V54E 1JCQA 3T9KA 2J8SD 3I3NA 2I2OA 3WXXA 1OT8A 3G2UA 2VSXE 4HRLA 3PZ3A 1HO8A 5FZRA 2X6HA 3KEZA 4LRZA 4F7AA 4GYYA 4U8VD 4U04A 3DRAA 4UWLA 5CHEE 3PVLA 3APDA 2VSNA 3FUKA 1IQRA 2J4BA 3UIPC 4YDWA 3SGHA 2QFCA 3FHEA 4NURA 2WQ6A 4K5AB 4BTAA 3LY7A 3HHMA 3DSWA 4RQIA 2I6HA 5BPPA 5LFAA 5ANLA 5JA4D 3UT4A 4WWOA 2WXOA 3CGHA 1HFAA 4ANXA 3CIAA 3JUIA 3ZHEB 3IKOB 4GZ6A 2V8SE 2WXKA 3MZLB 1ELWA 2GRMA 4F1SA 4GTTA 4PUCA 5BNWA 3SBSA 2XEEA 3EJNA 4HOQA 2ILRA 4UI9J 4GTMA 1MX6A 2BTDA 5DIZA 3APCA 1PY1A 4LG6A 4N39A 3T8KA 2Q7FA 3MX3A 3S2AA 3HVEA 3K9IA 5EIDA 3MEKA 5HRYA 5DBKA 3R7QA 3CHSA 4APFA 5C1DA 2P58C 4K5BA 4FJYA 2JLBA 4WNEA 3UXGA 2LXLA 4L23A 4URKA 1TJCA 3FEXA 5EX3A 4PH4B 4IYPA 4FHJA 3FUEA 3JCKC 4LSZE 2F8XK 4XI0A 3SHFA 2A4ZA 3UT8A 2NXPA 1MYOA 3EHQA 2Y1LE 4L7TA 4W9RA 1YMPA 5ENOD 1K1AA 4BETA 4C9BB 1DCQA 2VGEA 2FI7A 2UY1B 4RG9A 2NC9A 3UPVA 4I1AA 3TXNA 2WVIA 2X38A 4GB9A 2ETBA 5AIJA 2KCLA 3SF4A 4FHKA 4KBQA 1D8DA 1EPUA 4K5CA 3T5XA 4GTPA 4JA7A 2VTBA 4UI9C 1HF8A 2WXNA 2L0IA 3CV0A 3SO8A 3HXBA 1QQEA 2JEKA 3ZYQA 3IHYA 3RO2A 1TN6A 4ILIA 2HR2A 4EECA 3ZYLA 2FBNA 3J5QB 4U0SA 5AQBA 3ULEG 5CBOA 1MX4A 4ILGA 4DPRA 4L2LA 3CQGB 3RK6A 3FP3A 4B89A 4LNUD 4APOA 3ML8A 2XGOA 2OEWA 2OV8A 2RD0A 2WPVA 2MOWA 1TJFA 3E33A 1OCCE 4HLLA 4LUNU 3NF1A 5ARFA 4A3TA 2HM8A 2J49A 3ASHA 4F53A 3QWPA 4OVUA 5G55A 3HXEA 3MA5A 3PNLB 4EBAG 3UT7A 1X5BA 1IXVA 4I17A 3Q7AA 2H6GA 2MRIA 4MS6A 4U0UA 2DIWA 1UJKA 4LNGA 3GZ1A 4AM9A 3ZYKA 4G24A 2IF4A 1VDYA 4RG6A 1N0RA 4ANVA 3TAXA 4KYOB 5A7DB 3KS2A 2IJGX 3QWWA 3PS6A 3CLJA 3Q15A 3LDZA 4PS3A 1WAO1 3PUKA 4O60A 5HS0A 3CK8A 5G2NA 4BESA 2NYJA 3CVPA 2XZDG 3SD5A 3NZSA 4O1PA 5CRUA 1NI1A 3ULYA 3LCAA 1NA0A 5FQ8A 4ATGA 1O1TA 3P1UA 2H6FA 2DZNA 3ASDA 3PZ1A 3L22A 4H7XA 3B7SA 2WMOA 3FULA 4UWHA 2EIJE 3Q47B 3Q7FA 4DX6D 1QBQA 3FH8A 5FQ4A 3CHRA 5B3SE 3UM3A 4TXRA 4KXKB 2KM4A 2HYZA 3FH7A 5ANRA 1EYHA 3OTNA 3S7DA 3QNKA 3RU0A 2IO2C 1S0PA 4B93B 1V55E 3IBEA 2GRNB 5FJYA 1IHBA 1BI8B 2ETAA 3CEQA 4BSZB 5KBAA 2EIKE 2VSYA 3QDNA 1YYHA 2PQRA 4GMLA 4MLPA 5H7PA 4F6RD 3HYMB 5ENTD 5G05J 1WY6A 1Z6TA 2KZTA 3DPYA 4I6JA 4D10C 5EIBE 2I1KA 5CRVA 2IOSA 4JL0A 1INZA 3TL5A 3ONLA 3VLEA 5KJKA 4EQFA 3PZ2A 3EDTB 4XKCA 2WQ7A 3HRAA 4LERA 2QY7A 2BKGA 4CT0A 1JWFA 3KSQA 4ACLA 3ZU7B 4G1TA 1JCRA 4YVOA 4BT9A 3S7FA 4CEMA 2BKKB 4RLYA 3B7UX 3NB2A 3FUNA 1AP7A 1NP7A 3NBNB 1TNZA 4TXQA 2ETCA 5LX8A 4GTOA 4I6EA 2X6FA 1DC2A 2LUHA 3ZIMA 4NQ0A 3CVNA 4P29A 3AS8A 5HKPA 4JXTA 4O6FA 2ZU6B 3EIJA 3IEGA 2XCBA 5T3RA 3ONKA 2WMNA 1Y6IA 4L1BA 3TXMA 1O1RA 4GAAA 3LPZA 1NFIE 4DLOA 4UWKA 3ZNGA 5CCLA 3LKUA 3HVEB 3TG4A 3JQ0A 2AWIA 2LO6A 3P2BA 1E96B 3BG1B 4OAVB 4ZHBA 2L6BA 3PREA 2PM7A 3AS5A 4KZCA 2LXMA 5ENNA 4FP7A 3PH0C 4KT6B 4EBAA 1ELRA 3CKCA 4HB5A 4UQYA 4J8DA 4OAUC 4GTVA 3RJVA 4JW1A 1FVHA 5FWQA 2WXRA 3UQ3A 2A5UA 4GZ5A 5D0QD 2XS1A 1OY3D 3UTMA 1SW6A 3JYSA 1E90A 2AXZA 4YNDA 1HG5A 2OVFA 4HBDA 1TR4A 4EZKA 4GTRA 2XRYA 3E37A 4EZLA 2WXGA 3L16A 2P2CP 1O1SA 1Z3XA 2ONDA 3ASNE 3UUXA 4G25A 3FTVA 5EYLA 5FQ6A 3N71A 2A5EA 2QC9A 2GRRB 2Y69E 3KSLA 1SVXA 2WXHA 4YDYA 3R9AB 5FZQA 5AENA 2VTBB 4WNGA 1BI7B 3BUAA 1MQSA 4JHJA 4ME2A 4JZYA 3PE3A 2XZTG 2Y4TA 4N2SA 3R7RA 3F6QA 3W9GA 3RSEG 2DYSE 2DZOA 4Q69A 3CQCB 3IV0A 3UM0A 3DBSA 2IO3C 3SFXA 1OWMA 3ZGQA 1K8KG 3EHRA 3DWLG 3T8MA 4G8LA 4HQDA 2AXVA 5KCMA 4L2YA 1N0QA 4M3OA 3B7TA 3ZEFA 1E7VA 3V79K 1BU9A 3DSXA 4TRQA 4I9EA 4ZFHA 1TEZA 4UQXA 5LOZA 3DSVA 5J08A 1EDUA 4JEUA 1ELKA 4JHKA 5KJLA 3MKQB 3QK0A 1DNPA 1SA4A 3LJ3A 1UW4B 4CDRA 1FT1A 3NQPA 3L08A 4GMRA 4ANWA 2R02A 4E85A 3LEWA 1IQUA 4JC8A 3SFYA 4HNAD 5JHBA 5B1BE 2IEJA 3QWVA 5BXUA 2J07A 1KLXA 1H0AA 4JPSA 5JJ6A 4TUUA 3CVWA 4XZ4A 4NRHB 2P9KG 2XEHA 5T8IA 4DX1A 3BG0B 3FUHA 4FADA 4DRXE 1OUVA 1JUQA 1BLXB 1OCRE 3FH5A 3FU5A 3AG3E 1U2VG 2R2LA 3AG1E 1X81A 3G2VA 4OVVA 5CECB 3MYVA 1E7UA 2AJAA 2CHXA 4DJAA 4UQZA 1QZ2A 3U4TA 4BTBA 3CVQA 4HLEA 2KC7A 1QYMA 3UX4A 1QNFA 1RW2A 4FULA 1N11A 1H6OA 3PEVB 3TWVA 2LAHA 2ZXWE 1ZU2A 4CDNA 1H2TC 2PQNA 4IN3B 1UN9A 1H6KA 4UWGA 5D66A 3AU4A 1JCSA 1N95A 3E34A 5ENQD 5AQ9A 4BFRA 5AAOA 3QJZA 4HXIA 4B8CB 4JD2G 3D9HA 3AG2E 4Q94A 2VJ8A 3D9JA 3UINC 4HI9A 3Q75A 4BX9A 3ZHEA 2P9LG 4CGWA 3MKRA 4N5QA 3JXIA 5CMYA 2DBAA 2KZTB 3FUFA 4I2WA 2L0TB 3ASOE 1A5EA 3RIBA 2YQ8A 4GA0A 3SNXA 5EKQD 3CHOA 3SBTB 2FO1E 4CYMD 3FTZA 3L13A 5JJTA 4K0RA 4GYOA 2OOEA 4J8EA 3UIOC 1YCSB 4GYWA 3L54A 4HOTA 3RAUA 4A63B 4EPZA 4IRUA 3FUMA 4AP2A 4C48B 3D9IA 4AEZC 2X6KA 5KWDA 3UM1A 4DI4A 2OEVA 2F0YA 4KZ0A 1IHGA 3SZ7A 4Y6WA 1FPPA 4G2VA 4HS2A 3D9LA 2V0PA 1RZ4A 3IHVA 4GCOA 2Y4UA 4I1MA 4DI3A 1HS6A 5E75A 2V4LA 2IY0C 3NOGD 1S70B 4DLQA 2FEZA 1SZAA 1O5MA 4EHMA 3TWQA 4GPMA 2WM9A 3AS4A 2ZIRA 2KBXA 3QKYA 3PUJA 3HXFA 3ULQA 5HI7A 4JB8P 3V2XA 4XKBA 2UY1A 2QYJA 2V5QC 3B7RL 3HG0D 1UN8A 2PL2A 2XGSA 4BX8A 2FO7A 2VGXA 4WWNA 3ASFA 4IULA 3DSUA 4R7LA 3APFA 4WAFA 4TUMA 2P9NG 3ASGA 2CG3A 3DXKG 2CFZA 4Y6CA 2AVPA 3LY9A 3BQOA 5IY5E 3B13A 3T5VA 2IONA 2QZAA 4F1PA 3FU3A 3G2SA 2XCCA 3WG7E 3TWXA 1HU3A 4G23A 2C0MA 5M72A 4HVBA 1Q2ZA 4MRUA 3C3OA 2RG8A 4J8FA 2X6JA 2P9SG 1U3CA 1E8XA 2IOLA 1UJJA 2LSVA 3OAWA 4GZCA 2YINA 3PZDA 4WNDA 4ANUA 3ZKJA 1ZBPA 3CKBA 4N5CA 3ZRHA 1TYQG 4DX7D 3CHMA 4FJZA 4HOSA 3QOUA 2F37A 2DWZA 3EUVA 3LVRE 1N52A 4J8SA 4UWFA 2VSOE 1MX2A 3NZUA 3OXFA 4U95D 1TNOA 5KNHD 3RRMB 2VQ2A 1B89A 1K3ZD 1U3DA 4PDXA 2YHEA 3U9WA 4AY5A 5CEAA 1N54A 3IXEA 1HE8A 3S7JA 1OXJA 1LD7A 3SI5A 2R05A 2R59A 4BEPA 3TG5A 1N9AA 4G26A 3CR3A 3Q9NC 3QARA 1H2UA 3HIZA 3FTXA 2P9IG 5FZSA 2GRLA 3RRUA 1D8EA 4E6HA 4I9CA 2LAIA 3O4ZA 1A17A 3U3WA 5AQAA 2GROB 4TV3A 2WXIA 2UWJG 3OXLA 2XPYA 2M63A 2Y3AA 4HFGA 5LCWJ 2E2EA 4FLBA 2WXMA 5AYWD 3MGBA 4KMOA 2RKKA 1H19A 3ZVVA 1HG2A 4B8AA 4PS7A 1FCHA 3RRNB 4GMJA 3C5RA 3CVVA 4OYSA 1SZ9A 3FY4A 3QB2A 4AY6A 2R03A 2KCVA 3HXDA 4AOFA 2AW6A 3JQ1A 1GW6A 3Q79A 4NIKA 5BT1A 4ILHB 3FU0A 3DXMG 3C3RA 3KD7A 3EHNA 2BEDA 4O1OA 2E0IA 3HXCA 5CERB 5AN8A 2VGYA 5KNGA 5BW8C 3B7BA 2DCPA 2QYUA 3UKRG 5BV0A 3RKVA 3R9MA 2V4HC 2MYOA 4Q96A 2B6CA 5KJNA 1JPLA 5EN5D 1NZNA 2PZIA 2XGMA 2NSZA 2XPZA 1YA0A 1Z5SC 1H6PA 2CG2A 4U07A 1OCOE 3BU8A 3FEYA 1UOHA 5C2YA 5ENRD 2WXLA 5LCWC 1KZPA 3FUJA 5BXOA 3VLFA 3DEOA 4XX5A 1N4SA 3VTYA 1S63A 5JMND 3ISMC 4GCNA 2KATA 3EHMA 3VTXA 4AVXA 3ESKA 2H6IA 4MKTA 1EF1C 2XS8A 2J09A 2PNNA 2I1JA 3U64A 3C72A 4AXHA 4X8QA 1SA5A 1E8WA 5KJMA 3KEAA 4ABNA 2L9BA 2X6IA 2P9PG 1Z3YA 4CCAA 3EU9A 5BV1A 1JWGA 1XGWA 3ZN3A 2YHCA 3ZXSA 3UM2A 5FINA 4K03A 4J6IA 3V30A 3G2WA 1DCEA 2WXJA 1ZB1A 5FIOA 3CSTA 3L17A 3ZUVB 3EU5A 3NAWA 4HOUA 4GA1A 2JABA 3ML9A 3JUEA 3DSSA 1N94A 2C2LA 4JVSA 5AQ7A 1KZOA 5AARA 3AU5A 3KAEA 1HX8A 3FU6A 1OWLA 5FT9A 3UMVA 5JHAA 2DYRE 2C0LA 5FQ7A 4AJWA 2CFUA 1H2VC 3DPDA 5E76A 4A1GA 4GZ3A 4G11A 1IKND 4A3VA 2CHZA 3SQVA 3L82A 3Q49B 1S64A 3D9KA 3ZPJA 4B0ZA 5D0OD 4LNBA 3TGOA 2WXQA 3MCXA 3LVQE 3CK9A 1LTXA 5J90A 4WWPA 3FWVA 5ENSD 3PNTB 1BPOA 2VGXB 1L5JA 4BERA 3CK7A 4XEIG 3TWWA 3G2TA 4GPKA 4XI9A 4U0ZA 4RSYA 4CRWA 4BY6A 4J7WA 3L9TA 3FUIA 1OWNA 1PC2A 4JEHA 1MZCA 1KT0A 1E8ZA 4N3AA 3TWSA 3AAAC 3NOCD 2LSUA 3LS8A 3MJWA 4I1OB 2R17C 4J0UA 4GZDA 1MHQA 4RVBA 3ABKE 1K1BA 4H7YA 5JJ7A 4KVOA 3PRZA 3Q9UC 2ZGGA 5A23A 3GW4A 3DEPA 4A55A 4UUCA 1PAQA 5CMWA 4BWRA 1SQMA 2X3MA 3PE4A 3LY8A 1OCZE 5CBNA 2XPIA 3JXJA 3SFZA 5LP0A 1AWCB 4Z68A 2GW1A 3L6AA 4HI8A 2EILE 5EX0A 1LF8A 3D9NA 4FC8A 4JHRA 2AXUA 4NACA 4CZ2D 1KT1A 2GRQB 3E4BA 2FULA 3ZW3A 3MKQA 4L9PA 4CDMA 4FA6A 4YVQC 3D9OA 4V3IA 4B94A 4LEUA 2R5SA 3FTWA 3B95A 4XE0A 3U66A 4QFVA 3PEUB 3V2OA 5HQ8A 3CSFA 3ZXPA 4HRNA 3Q4AB 5AJDA 5G04J 3CVUA 3PZ4A 1D9SA 1XNFA 4I43A 2I9CA 3FFLA 3ZFWA 3ABLE 3CHQA 3OXGA 2HE0A 3J5PA 5FTPA 1LD8A 4QQIA 2RFMA 2Y0BG 2F8YA 3LJNA 5BUZA 3GZ2A 1NL4A 2DVWA 3D9MA 3TWRA 4BSXA 3HDXA 4U7EB 4AV7A 2IQCA 3I4RB 2WB2A 3FTUA 1KPSB 5ITZF 2KXPC 3Q78A 5ARGA 4HORA 3MV2B 3ENEA 2GRPB 5EYPF 2VYIA 3D9PA 4MBGA 3LXUX 3RO3A 2XHEA 3C3QA 1TN8A 2PM6A 4J8YA 4YDEA 2P9UG 5ENPD 3FDHA 3CVXA 2WXFA 3GZSA 4U8YD 4U96D 5AJLA 1TNYA 2OVBA 5D2MC 2YNQA 3GYZA 4N3BA 4ATZD 5EILA 3CVYA 3BEEA 3URZA 3TWUA 4GTQA 3CVLA 3D3MA 3V31A 2BF0X 4TXPA 3S7BA 4U8HA 4ACKA 4CGVA 2OCCE 1BD8A 1NA3A 2LNIA 5CEDB 1W3BA 4I2ZA 4I6GA 3FUDA 1TNBA 2ZGDA 2GGFA 3O48A 1G3NB 2IU1A 2ZISA 5G04C 4WUYA 3MV3B 3ZYMA 4CT4A 4FU3A 5A6CA 4DX5D 1N4RA 3EIQC 2L6JA 3ABME 4GTSA 3Q73A 2XENA 1HZ4A 2EQXA 2WXPA 4DX2A 4N3CA 2RFAA 4U63A 3AG4E 2V5FA 3ESLA 1HH8A 2HO1A 3Q5MA 3E30A 1WM5A 4C0EA 3DSTA 4F3VA 4EZJA 2XRZA 1HXIA 5CCMA 1WDYA 4PS8A 3E32A 4LCTA 4HRMB 2WQHA 1Y8MA 3LYAA 4YDOA 1N4QA 4A1SA 1P5QA 2EIME 2CHWA 2XQ0A 2J08A 2MHKA 4JA9A 4KVMA 5EDSA 1TN7A 1TNUA 2EINE 3VLDA 3PDNA 3UKUG 1FVFA 1IYGA 5T4YA 4GA2A 2H6HA 2J4DA 4DK5A 2XEVA 4BT8A 2BUGA 1OWPA 4DUIA 2IFUA 4N2QA 5B1AE 1UG3A 5G05C 4C0MA 3TJPA 2B0OE 1N4PA 4M7CA 3QAQA 3W9FA 4UI9K 2FF4A 3FTSA 3C98A 1OWOA 3I5PA 3I4GA 1WG0A 4AIFA 1MJ0A 3AJIA 1DVPA 3SY2A 1E8YA 4WNFA 4GU5A 2J9QA 3FTYA 3TWTA 2KCKA 1FT2A
chains in the Genus database with same CATH topology
4GTMA 1D8DA 1N4RA 2BEDA 1JCQA 4GTSA 3Q73A 4GTPA 2R2LA 3PZ2A 1DCEA 1LD7A 1X81A 1NL4A 3HXCA 3HXBA 3SFXA 3EU5A 3KSQA 4GTVA 3E30A 1TN6A 1NI1A 3DSTA 2F0YA 3PZ3A 3DSSA 1N94A 1N9AA 1FPPA 3Q78A 1JCRA 1KZOA 3E32A 1O1TA 2H6FA 4MBGA 3PZ1A 4YDOA 1D8EA 1N4QA 1TN8A 3DRAA 4YDEA 1TNZA 3DSXA 4GTOA 1JCSA 1N95A 3E34A 3Q7FA 1TN7A 1O5MA 1TNUA 4EHMA 4GTRA 1QBQA 3E37A 3E33A 4L9PA 3DSVA 2ZIRA 1O1SA 1S64A 1TNYA 3HXFA 3DSWA 1SA4A 4LNBA 1KZPA 2H6HA 1FT1A 1LTXA 3Q75A 3HXEA 4GTQA 1N4SA 1S63A 3SFYA 3KSLA 3Q7AA 2H6GA 1N4PA 3EUVA 2IEJA 2H6IA 1O1RA 3HXDA 4LNGA 3PZ4A 1MZCA 1TNBA 3C72A 1SA5A 4GTTA 2ZISA 1TNOA 3DSUA 3DPYA 1FT2A 3Q79A 1LD8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTM A;  1D8D A;  1N4R A;  2BED A;  1JCQ A;  4GTS A;  3Q73 A;  4GTP A;  2R2L A;  3PZ2 A;  1DCE A;  1LD7 A;  1X81 A;  1NL4 A;  3HXC A;  3HXB A;  3SFX A;  3EU5 A;  3KSQ A;  4GTV A;  3E30 A;  1TN6 A;  1NI1 A;  3DST A;  2F0Y A;  3PZ3 A;  3DSS A;  1N94 A;  1N9A A;  1FPP A;  3Q78 A;  1JCR A;  1KZO A;  3E32 A;  1O1T A;  2H6F A;  4MBG A;  3PZ1 A;  4YDO A;  1D8E A;  1N4Q A;  1TN8 A;  3DRA A;  4YDE A;  1TNZ A;  3DSX A;  4GTO A;  1JCS A;  1N95 A;  3E34 A;  3Q7F A;  1TN7 A;  1O5M A;  1TNU A;  4EHM A;  4GTR A;  1QBQ A;  3E37 A;  3E33 A;  4L9P A;  3DSV A;  2ZIR A;  1O1S A;  1S64 A;  1TNY A;  3HXF A;  3DSW A;  1SA4 A;  4LNB A;  1KZP A;  2H6H A;  1FT1 A;  1LTX A;  3Q75 A;  3HXE A;  4GTQ A;  1N4S A;  1S63 A;  3SFY A;  3KSL A;  3Q7A A;  2H6G A;  1N4P A;  3EUV A;  2IEJ A;  2H6I A;  1O1R A;  3HXD A;  4LNG A;  3PZ4 A;  1MZC A;  1TNB A;  3C72 A;  1SA5 A;  4GTT A;  2ZIS A;  1TNO A;  3DSU A;  3DPY A;  1FT2 A;  3Q79 A;  1LD8 A; 
#chains in the Genus database with same CATH topology
 3X2Q E;  3QC1 A;  3CHP A;  4G8K A;  4FLH A;  3UI2 A;  4XIF A;  1V54 E;  1JCQ A;  3T9K A;  2J8S D;  3I3N A;  2I2O A;  3WXX A;  1OT8 A;  3G2U A;  2VSX E;  4HRL A;  3PZ3 A;  1HO8 A;  5FZR A;  2X6H A;  3KEZ A;  4LRZ A;  4F7A A;  4GYY A;  4U8V D;  4U04 A;  3DRA A;  4UWL A;  5CHE E;  3PVL A;  3APD A;  2VSN A;  3FUK A;  1IQR A;  2J4B A;  3UIP C;  4YDW A;  3SGH A;  2QFC A;  3FHE A;  4NUR A;  2WQ6 A;  4K5A B;  4BTA A;  3LY7 A;  3HHM A;  3DSW A;  4RQI A;  2I6H A;  5BPP A;  5LFA A;  5ANL A;  5JA4 D;  3UT4 A;  4WWO A;  2WXO A;  3CGH A;  1HFA A;  4ANX A;  3CIA A;  3JUI A;  3ZHE B;  3IKO B;  4GZ6 A;  2V8S E;  2WXK A;  3MZL B;  1ELW A;  2GRM A;  4F1S A;  4GTT A;  4PUC A;  5BNW A;  3SBS A;  2XEE A;  3EJN A;  4HOQ A;  2ILR A;  4UI9 J;  4GTM A;  1MX6 A;  2BTD A;  5DIZ A;  3APC A;  1PY1 A;  4LG6 A;  4N39 A;  3T8K A;  2Q7F A;  3MX3 A;  3S2A A;  3HVE A;  3K9I A;  5EID A;  3MEK A;  5HRY A;  5DBK A;  3R7Q A;  3CHS A;  4APF A;  5C1D A;  2P58 C;  4K5B A;  4FJY A;  2JLB A;  4WNE A;  3UXG A;  2LXL A;  4L23 A;  4URK A;  1TJC A;  3FEX A;  5EX3 A;  4PH4 B;  4IYP A;  4FHJ A;  3FUE A;  3JCK C;  4LSZ E;  2F8X K;  4XI0 A;  3SHF A;  2A4Z A;  3UT8 A;  2NXP A;  1MYO A;  3EHQ A;  2Y1L E;  4L7T A;  4W9R A;  1YMP A;  5ENO D;  1K1A A;  4BET A;  4C9B B;  1DCQ A;  2VGE A;  2FI7 A;  2UY1 B;  4RG9 A;  2NC9 A;  3UPV A;  4I1A A;  3TXN A;  2WVI A;  2X38 A;  4GB9 A;  2ETB A;  5AIJ A;  2KCL A;  3SF4 A;  4FHK A;  4KBQ A;  1D8D A;  1EPU A;  4K5C A;  3T5X A;  4GTP A;  4JA7 A;  2VTB A;  4UI9 C;  1HF8 A;  2WXN A;  2L0I A;  3CV0 A;  3SO8 A;  3HXB A;  1QQE A;  2JEK A;  3ZYQ A;  3IHY A;  3RO2 A;  1TN6 A;  4ILI A;  2HR2 A;  4EEC A;  3ZYL A;  2FBN A;  3J5Q B;  4U0S A;  5AQB A;  3ULE G;  5CBO A;  1MX4 A;  4ILG A;  4DPR A;  4L2L A;  3CQG B;  3RK6 A;  3FP3 A;  4B89 A;  4LNU D;  4APO A;  3ML8 A;  2XGO A;  2OEW A;  2OV8 A;  2RD0 A;  2WPV A;  2MOW A;  1TJF A;  3E33 A;  1OCC E;  4HLL A;  4LUN U;  3NF1 A;  5ARF A;  4A3T A;  2HM8 A;  2J49 A;  3ASH A;  4F53 A;  3QWP A;  4OVU A;  5G55 A;  3HXE A;  3MA5 A;  3PNL B;  4EBA G;  3UT7 A;  1X5B A;  1IXV A;  4I17 A;  3Q7A A;  2H6G A;  2MRI A;  4MS6 A;  4U0U A;  2DIW A;  1UJK A;  4LNG A;  3GZ1 A;  4AM9 A;  3ZYK A;  4G24 A;  2IF4 A;  1VDY A;  4RG6 A;  1N0R A;  4ANV A;  3TAX A;  4KYO B;  5A7D B;  3KS2 A;  2IJG X;  3QWW A;  3PS6 A;  3CLJ A;  3Q15 A;  3LDZ A;  4PS3 A;  1WAO 1;  3PUK A;  4O60 A;  5HS0 A;  3CK8 A;  5G2N A;  4BES A;  2NYJ A;  3CVP A;  2XZD G;  3SD5 A;  3NZS A;  4O1P A;  5CRU A;  1NI1 A;  3ULY A;  3LCA A;  1NA0 A;  5FQ8 A;  4ATG A;  1O1T A;  3P1U A;  2H6F A;  2DZN A;  3ASD A;  3PZ1 A;  3L22 A;  4H7X A;  3B7S A;  2WMO A;  3FUL A;  4UWH A;  2EIJ E;  3Q47 B;  3Q7F A;  4DX6 D;  1QBQ A;  3FH8 A;  5FQ4 A;  3CHR A;  5B3S E;  3UM3 A;  4TXR A;  4KXK B;  2KM4 A;  2HYZ A;  3FH7 A;  5ANR A;  1EYH A;  3OTN A;  3S7D A;  3QNK A;  3RU0 A;  2IO2 C;  1S0P A;  4B93 B;  1V55 E;  3IBE A;  2GRN B;  5FJY A;  1IHB A;  1BI8 B;  2ETA A;  3CEQ A;  4BSZ B;  5KBA A;  2EIK E;  2VSY A;  3QDN A;  1YYH A;  2PQR A;  4GML A;  4MLP A;  5H7P A;  4F6R D;  3HYM B;  5ENT D;  5G05 J;  1WY6 A;  1Z6T A;  2KZT A;  3DPY A;  4I6J A;  4D10 C;  5EIB E;  2I1K A;  5CRV A;  2IOS A;  4JL0 A;  1INZ A;  3TL5 A;  3ONL A;  3VLE A;  5KJK A;  4EQF A;  3PZ2 A;  3EDT B;  4XKC A;  2WQ7 A;  3HRA A;  4LER A;  2QY7 A;  2BKG A;  4CT0 A;  1JWF A;  3KSQ A;  4ACL A;  3ZU7 B;  4G1T A;  1JCR A;  4YVO A;  4BT9 A;  3S7F A;  4CEM A;  2BKK B;  4RLY A;  3B7U X;  3NB2 A;  3FUN A;  1AP7 A;  1NP7 A;  3NBN B;  1TNZ A;  4TXQ A;  2ETC A;  5LX8 A;  4GTO A;  4I6E A;  2X6F A;  1DC2 A;  2LUH A;  3ZIM A;  4NQ0 A;  3CVN A;  4P29 A;  3AS8 A;  5HKP A;  4JXT A;  4O6F A;  2ZU6 B;  3EIJ A;  3IEG A;  2XCB A;  5T3R A;  3ONK A;  2WMN A;  1Y6I A;  4L1B A;  3TXM A;  1O1R A;  4GAA A;  3LPZ A;  1NFI E;  4DLO A;  4UWK A;  3ZNG A;  5CCL A;  3LKU A;  3HVE B;  3TG4 A;  3JQ0 A;  2AWI A;  2LO6 A;  3P2B A;  1E96 B;  3BG1 B;  4OAV B;  4ZHB A;  2L6B A;  3PRE A;  2PM7 A;  3AS5 A;  4KZC A;  2LXM A;  5ENN A;  4FP7 A;  3PH0 C;  4KT6 B;  4EBA A;  1ELR A;  3CKC A;  4HB5 A;  4UQY A;  4J8D A;  4OAU C;  4GTV A;  3RJV A;  4JW1 A;  1FVH A;  5FWQ A;  2WXR A;  3UQ3 A;  2A5U A;  4GZ5 A;  5D0Q D;  2XS1 A;  1OY3 D;  3UTM A;  1SW6 A;  3JYS A;  1E90 A;  2AXZ A;  4YND A;  1HG5 A;  2OVF A;  4HBD A;  1TR4 A;  4EZK A;  4GTR A;  2XRY A;  3E37 A;  4EZL A;  2WXG A;  3L16 A;  2P2C P;  1O1S A;  1Z3X A;  2OND A;  3ASN E;  3UUX A;  4G25 A;  3FTV A;  5EYL A;  5FQ6 A;  3N71 A;  2A5E A;  2QC9 A;  2GRR B;  2Y69 E;  3KSL A;  1SVX A;  2WXH A;  4YDY A;  3R9A B;  5FZQ A;  5AEN A;  2VTB B;  4WNG A;  1BI7 B;  3BUA A;  1MQS A;  4JHJ A;  4ME2 A;  4JZY A;  3PE3 A;  2XZT G;  2Y4T A;  4N2S A;  3R7R A;  3F6Q A;  3W9G A;  3RSE G;  2DYS E;  2DZO A;  4Q69 A;  3CQC B;  3IV0 A;  3UM0 A;  3DBS A;  2IO3 C;  3SFX A;  1OWM A;  3ZGQ A;  1K8K G;  3EHR A;  3DWL G;  3T8M A;  4G8L A;  4HQD A;  2AXV A;  5KCM A;  4L2Y A;  1N0Q A;  4M3O A;  3B7T A;  3ZEF A;  1E7V A;  3V79 K;  1BU9 A;  3DSX A;  4TRQ A;  4I9E A;  4ZFH A;  1TEZ A;  4UQX A;  5LOZ A;  3DSV A;  5J08 A;  1EDU A;  4JEU A;  1ELK A;  4JHK A;  5KJL A;  3MKQ B;  3QK0 A;  1DNP A;  1SA4 A;  3LJ3 A;  1UW4 B;  4CDR A;  1FT1 A;  3NQP A;  3L08 A;  4GMR A;  4ANW A;  2R02 A;  4E85 A;  3LEW A;  1IQU A;  4JC8 A;  3SFY A;  4HNA D;  5JHB A;  5B1B E;  2IEJ A;  3QWV A;  5BXU A;  2J07 A;  1KLX A;  1H0A A;  4JPS A;  5JJ6 A;  4TUU A;  3CVW A;  4XZ4 A;  4NRH B;  2P9K G;  2XEH A;  5T8I A;  4DX1 A;  3BG0 B;  3FUH A;  4FAD A;  4DRX E;  1OUV A;  1JUQ A;  1BLX B;  1OCR E;  3FH5 A;  3FU5 A;  3AG3 E;  1U2V G;  2R2L A;  3AG1 E;  1X81 A;  3G2V A;  4OVV A;  5CEC B;  3MYV A;  1E7U A;  2AJA A;  2CHX A;  4DJA A;  4UQZ A;  1QZ2 A;  3U4T A;  4BTB A;  3CVQ A;  4HLE A;  2KC7 A;  1QYM A;  3UX4 A;  1QNF A;  1RW2 A;  4FUL A;  1N11 A;  1H6O A;  3PEV B;  3TWV A;  2LAH A;  2ZXW E;  1ZU2 A;  4CDN A;  1H2T C;  2PQN A;  4IN3 B;  1UN9 A;  1H6K A;  4UWG A;  5D66 A;  3AU4 A;  1JCS A;  1N95 A;  3E34 A;  5ENQ D;  5AQ9 A;  4BFR A;  5AAO A;  3QJZ A;  4HXI A;  4B8C B;  4JD2 G;  3D9H A;  3AG2 E;  4Q94 A;  2VJ8 A;  3D9J A;  3UIN C;  4HI9 A;  3Q75 A;  4BX9 A;  3ZHE A;  2P9L G;  4CGW A;  3MKR A;  4N5Q A;  3JXI A;  5CMY A;  2DBA A;  2KZT B;  3FUF A;  4I2W A;  2L0T B;  3ASO E;  1A5E A;  3RIB A;  2YQ8 A;  4GA0 A;  3SNX A;  5EKQ D;  3CHO A;  3SBT B;  2FO1 E;  4CYM D;  3FTZ A;  3L13 A;  5JJT A;  4K0R A;  4GYO A;  2OOE A;  4J8E A;  3UIO C;  1YCS B;  4GYW A;  3L54 A;  4HOT A;  3RAU A;  4A63 B;  4EPZ A;  4IRU A;  3FUM A;  4AP2 A;  4C48 B;  3D9I A;  4AEZ C;  2X6K A;  5KWD A;  3UM1 A;  4DI4 A;  2OEV A;  2F0Y A;  4KZ0 A;  1IHG A;  3SZ7 A;  4Y6W A;  1FPP A;  4G2V A;  4HS2 A;  3D9L A;  2V0P A;  1RZ4 A;  3IHV A;  4GCO A;  2Y4U A;  4I1M A;  4DI3 A;  1HS6 A;  5E75 A;  2V4L A;  2IY0 C;  3NOG D;  1S70 B;  4DLQ A;  2FEZ A;  1SZA A;  1O5M A;  4EHM A;  3TWQ A;  4GPM A;  2WM9 A;  3AS4 A;  2ZIR A;  2KBX A;  3QKY A;  3PUJ A;  3HXF A;  3ULQ A;  5HI7 A;  4JB8 P;  3V2X A;  4XKB A;  2UY1 A;  2QYJ A;  2V5Q C;  3B7R L;  3HG0 D;  1UN8 A;  2PL2 A;  2XGS A;  4BX8 A;  2FO7 A;  2VGX A;  4WWN A;  3ASF A;  4IUL A;  3DSU A;  4R7L A;  3APF A;  4WAF A;  4TUM A;  2P9N G;  3ASG A;  2CG3 A;  3DXK G;  2CFZ A;  4Y6C A;  2AVP A;  3LY9 A;  3BQO A;  5IY5 E;  3B13 A;  3T5V A;  2ION A;  2QZA A;  4F1P A;  3FU3 A;  3G2S A;  2XCC A;  3WG7 E;  3TWX A;  1HU3 A;  4G23 A;  2C0M A;  5M72 A;  4HVB A;  1Q2Z A;  4MRU A;  3C3O A;  2RG8 A;  4J8F A;  2X6J A;  2P9S G;  1U3C A;  1E8X A;  2IOL A;  1UJJ A;  2LSV A;  3OAW A;  4GZC A;  2YIN A;  3PZD A;  4WND A;  4ANU A;  3ZKJ A;  1ZBP A;  3CKB A;  4N5C A;  3ZRH A;  1TYQ G;  4DX7 D;  3CHM A;  4FJZ A;  4HOS A;  3QOU A;  2F37 A;  2DWZ A;  3EUV A;  3LVR E;  1N52 A;  4J8S A;  4UWF A;  2VSO E;  1MX2 A;  3NZU A;  3OXF A;  4U95 D;  1TNO A;  5KNH D;  3RRM B;  2VQ2 A;  1B89 A;  1K3Z D;  1U3D A;  4PDX A;  2YHE A;  3U9W A;  4AY5 A;  5CEA A;  1N54 A;  3IXE A;  1HE8 A;  3S7J A;  1OXJ A;  1LD7 A;  3SI5 A;  2R05 A;  2R59 A;  4BEP A;  3TG5 A;  1N9A A;  4G26 A;  3CR3 A;  3Q9N C;  3QAR A;  1H2U A;  3HIZ A;  3FTX A;  2P9I G;  5FZS A;  2GRL A;  3RRU A;  1D8E A;  4E6H A;  4I9C A;  2LAI A;  3O4Z A;  1A17 A;  3U3W A;  5AQA A;  2GRO B;  4TV3 A;  2WXI A;  2UWJ G;  3OXL A;  2XPY A;  2M63 A;  2Y3A A;  4HFG A;  5LCW J;  2E2E A;  4FLB A;  2WXM A;  5AYW D;  3MGB A;  4KMO A;  2RKK A;  1H19 A;  3ZVV A;  1HG2 A;  4B8A A;  4PS7 A;  1FCH A;  3RRN B;  4GMJ A;  3C5R A;  3CVV A;  4OYS A;  1SZ9 A;  3FY4 A;  3QB2 A;  4AY6 A;  2R03 A;  2KCV A;  3HXD A;  4AOF A;  2AW6 A;  3JQ1 A;  1GW6 A;  3Q79 A;  4NIK A;  5BT1 A;  4ILH B;  3FU0 A;  3DXM G;  3C3R A;  3KD7 A;  3EHN A;  2BED A;  4O1O A;  2E0I A;  3HXC A;  5CER B;  5AN8 A;  2VGY A;  5KNG A;  5BW8 C;  3B7B A;  2DCP A;  2QYU A;  3UKR G;  5BV0 A;  3RKV A;  3R9M A;  2V4H C;  2MYO A;  4Q96 A;  2B6C A;  5KJN A;  1JPL A;  5EN5 D;  1NZN A;  2PZI A;  2XGM A;  2NSZ A;  2XPZ A;  1YA0 A;  1Z5S C;  1H6P A;  2CG2 A;  4U07 A;  1OCO E;  3BU8 A;  3FEY A;  1UOH A;  5C2Y A;  5ENR D;  2WXL A;  5LCW C;  1KZP A;  3FUJ A;  5BXO A;  3VLF A;  3DEO A;  4XX5 A;  1N4S A;  3VTY A;  1S63 A;  5JMN D;  3ISM C;  4GCN A;  2KAT A;  3EHM A;  3VTX A;  4AVX A;  3ESK A;  2H6I A;  4MKT A;  1EF1 C;  2XS8 A;  2J09 A;  2PNN A;  2I1J A;  3U64 A;  3C72 A;  4AXH A;  4X8Q A;  1SA5 A;  1E8W A;  5KJM A;  3KEA A;  4ABN A;  2L9B A;  2X6I A;  2P9P G;  1Z3Y A;  4CCA A;  3EU9 A;  5BV1 A;  1JWG A;  1XGW A;  3ZN3 A;  2YHC A;  3ZXS A;  3UM2 A;  5FIN A;  4K03 A;  4J6I A;  3V30 A;  3G2W A;  1DCE A;  2WXJ A;  1ZB1 A;  5FIO A;  3CST A;  3L17 A;  3ZUV B;  3EU5 A;  3NAW A;  4HOU A;  4GA1 A;  2JAB A;  3ML9 A;  3JUE A;  3DSS A;  1N94 A;  2C2L A;  4JVS A;  5AQ7 A;  1KZO A;  5AAR A;  3AU5 A;  3KAE A;  1HX8 A;  3FU6 A;  1OWL A;  5FT9 A;  3UMV A;  5JHA A;  2DYR E;  2C0L A;  5FQ7 A;  4AJW A;  2CFU A;  1H2V C;  3DPD A;  5E76 A;  4A1G A;  4GZ3 A;  4G11 A;  1IKN D;  4A3V A;  2CHZ A;  3SQV A;  3L82 A;  3Q49 B;  1S64 A;  3D9K A;  3ZPJ A;  4B0Z A;  5D0O D;  4LNB A;  3TGO A;  2WXQ A;  3MCX A;  3LVQ E;  3CK9 A;  1LTX A;  5J90 A;  4WWP A;  3FWV A;  5ENS D;  3PNT B;  1BPO A;  2VGX B;  1L5J A;  4BER A;  3CK7 A;  4XEI G;  3TWW A;  3G2T A;  4GPK A;  4XI9 A;  4U0Z A;  4RSY A;  4CRW A;  4BY6 A;  4J7W A;  3L9T A;  3FUI A;  1OWN A;  1PC2 A;  4JEH A;  1MZC A;  1KT0 A;  1E8Z A;  4N3A A;  3TWS A;  3AAA C;  3NOC D;  2LSU A;  3LS8 A;  3MJW A;  4I1O B;  2R17 C;  4J0U A;  4GZD A;  1MHQ A;  4RVB A;  3ABK E;  1K1B A;  4H7Y A;  5JJ7 A;  4KVO A;  3PRZ A;  3Q9U C;  2ZGG A;  5A23 A;  3GW4 A;  3DEP A;  4A55 A;  4UUC A;  1PAQ A;  5CMW A;  4BWR A;  1SQM A;  2X3M A;  3PE4 A;  3LY8 A;  1OCZ E;  5CBN A;  2XPI A;  3JXJ A;  3SFZ A;  5LP0 A;  1AWC B;  4Z68 A;  2GW1 A;  3L6A A;  4HI8 A;  2EIL E;  5EX0 A;  1LF8 A;  3D9N A;  4FC8 A;  4JHR A;  2AXU A;  4NAC A;  4CZ2 D;  1KT1 A;  2GRQ B;  3E4B A;  2FUL A;  3ZW3 A;  3MKQ A;  4L9P A;  4CDM A;  4FA6 A;  4YVQ C;  3D9O A;  4V3I A;  4B94 A;  4LEU A;  2R5S A;  3FTW A;  3B95 A;  4XE0 A;  3U66 A;  4QFV A;  3PEU B;  3V2O A;  5HQ8 A;  3CSF A;  3ZXP A;  4HRN A;  3Q4A B;  5AJD A;  5G04 J;  3CVU A;  3PZ4 A;  1D9S A;  1XNF A;  4I43 A;  2I9C A;  3FFL A;  3ZFW A;  3ABL E;  3CHQ A;  3OXG A;  2HE0 A;  3J5P A;  5FTP A;  1LD8 A;  4QQI A;  2RFM A;  2Y0B G;  2F8Y A;  3LJN A;  5BUZ A;  3GZ2 A;  1NL4 A;  2DVW A;  3D9M A;  3TWR A;  4BSX A;  3HDX A;  4U7E B;  4AV7 A;  2IQC A;  3I4R B;  2WB2 A;  3FTU A;  1KPS B;  5ITZ F;  2KXP C;  3Q78 A;  5ARG A;  4HOR A;  3MV2 B;  3ENE A;  2GRP B;  5EYP F;  2VYI A;  3D9P A;  4MBG A;  3LXU X;  3RO3 A;  2XHE A;  3C3Q A;  1TN8 A;  2PM6 A;  4J8Y A;  4YDE A;  2P9U G;  5ENP D;  3FDH A;  3CVX A;  2WXF A;  3GZS A;  4U8Y D;  4U96 D;  5AJL A;  1TNY A;  2OVB A;  5D2M C;  2YNQ A;  3GYZ A;  4N3B A;  4ATZ D;  5EIL A;  3CVY A;  3BEE A;  3URZ A;  3TWU A;  4GTQ A;  3CVL A;  3D3M A;  3V31 A;  2BF0 X;  4TXP A;  3S7B A;  4U8H A;  4ACK A;  4CGV A;  2OCC E;  1BD8 A;  1NA3 A;  2LNI A;  5CED B;  1W3B A;  4I2Z A;  4I6G A;  3FUD A;  1TNB A;  2ZGD A;  2GGF A;  3O48 A;  1G3N B;  2IU1 A;  2ZIS A;  5G04 C;  4WUY A;  3MV3 B;  3ZYM A;  4CT4 A;  4FU3 A;  5A6C A;  4DX5 D;  1N4R A;  3EIQ C;  2L6J A;  3ABM E;  4GTS A;  3Q73 A;  2XEN A;  1HZ4 A;  2EQX A;  2WXP A;  4DX2 A;  4N3C A;  2RFA A;  4U63 A;  3AG4 E;  2V5F A;  3ESL A;  1HH8 A;  2HO1 A;  3Q5M A;  3E30 A;  1WM5 A;  4C0E A;  3DST A;  4F3V A;  4EZJ A;  2XRZ A;  1HXI A;  5CCM A;  1WDY A;  4PS8 A;  3E32 A;  4LCT A;  4HRM B;  2WQH A;  1Y8M A;  3LYA A;  4YDO A;  1N4Q A;  4A1S A;  1P5Q A;  2EIM E;  2CHW A;  2XQ0 A;  2J08 A;  2MHK A;  4JA9 A;  4KVM A;  5EDS A;  1TN7 A;  1TNU A;  2EIN E;  3VLD A;  3PDN A;  3UKU G;  1FVF A;  1IYG A;  5T4Y A;  4GA2 A;  2H6H A;  2J4D A;  4DK5 A;  2XEV A;  4BT8 A;  2BUG A;  1OWP A;  4DUI A;  2IFU A;  4N2Q A;  5B1A E;  1UG3 A;  5G05 C;  4C0M A;  3TJP A;  2B0O E;  1N4P A;  4M7C A;  3QAQ A;  3W9F A;  4UI9 K;  2FF4 A;  3FTS A;  3C98 A;  1OWO A;  3I5P A;  3I4G A;  1WG0 A;  4AIF A;  1MJ0 A;  3AJI A;  1DVP A;  3SY2 A;  1E8Y A;  4WNF A;  4GU5 A;  2J9Q A;  3FTY A;  3TWT A;  2KCK A;  1FT2 A; 
#chains in the Genus database with same CATH homology
 4GTM A;  1D8D A;  1N4R A;  2BED A;  1JCQ A;  4GTS A;  3Q73 A;  4GTP A;  2R2L A;  3PZ2 A;  1DCE A;  1LD7 A;  1X81 A;  1NL4 A;  3HXC A;  3HXB A;  3SFX A;  3EU5 A;  3KSQ A;  4GTV A;  3E30 A;  1TN6 A;  1NI1 A;  3DST A;  2F0Y A;  3PZ3 A;  3DSS A;  1N94 A;  1N9A A;  1FPP A;  3Q78 A;  1JCR A;  1KZO A;  3E32 A;  1O1T A;  2H6F A;  4MBG A;  3PZ1 A;  4YDO A;  1D8E A;  1N4Q A;  1TN8 A;  3DRA A;  4YDE A;  1TNZ A;  3DSX A;  4GTO A;  1JCS A;  1N95 A;  3E34 A;  3Q7F A;  1TN7 A;  1O5M A;  1TNU A;  4EHM A;  4GTR A;  1QBQ A;  3E37 A;  3E33 A;  4L9P A;  3DSV A;  2ZIR A;  1O1S A;  1S64 A;  1TNY A;  3HXF A;  3DSW A;  1SA4 A;  4LNB A;  1KZP A;  2H6H A;  1FT1 A;  1LTX A;  3Q75 A;  3HXE A;  4GTQ A;  1N4S A;  1S63 A;  3SFY A;  3KSL A;  3Q7A A;  2H6G A;  1N4P A;  3EUV A;  2IEJ A;  2H6I A;  1O1R A;  3HXD A;  4LNG A;  3PZ4 A;  1MZC A;  1TNB A;  3C72 A;  1SA5 A;  4GTT A;  2ZIS A;  1TNO A;  3DSU A;  3DPY A;  1FT2 A;  3Q79 A;  1LD8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...