3SFXA

Cryptococcus neoformans protein farnesyltransferase in complex with fpt-ii and tipifarnib
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
330
structure length
315
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase/transferase inhibitor
molecule keywords Cryptococcus neoformans protein farnesyltransferase alpha su
total genus 131
structure length 315
sequence length 330
ec nomenclature
pdb deposition date 2011-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3sfxA00
1FPPA 3PZ3A 3Q75A 3HXDA 3Q73A 1D8DA 1FT2A 2ZISA 2H6HA 1JCRA 3HXFA 2IEJA 4GTPA 1TNBA 3E33A 4EHMA 4L9PA 1O1RA 1TNUA 3E34A 4GTMA 3EU5A 1LTXA 1DCEA 3PZ4A 1TN7A 3SFXA 1X81A 2R2LA 3HXEA 3DSXA 1N4PA 1N4QA 1KZPA 3C72A 4GTQA 1S64A 3PZ2A 3E37A 3KSLA 2H6FA 3EUVA 3SFYA 1SA4A 1TN8A 3DSSA 4LNBA 1SA5A 2ZIRA 2H6GA 4GTOA 3Q79A 3E30A 4LNGA 1TNOA 1N9AA 3Q78A 1N4SA 2F0YA 1TN6A 1LD8A 3DSWA 2BEDA 2H6IA 1FT1A 3Q7AA 1D8EA 3PZ1A 1N95A 1NL4A 1TNZA 3DSUA 3Q7FA 3DSVA 1JCQA 1N94A 3DSTA 1QBQA 1LD7A 1N4RA 3HXBA 4GTRA 1KZOA 3KSQA 4YDEA 4YDOA 4GTSA 3E32A 1S63A 3HXCA 1O1SA 1O1TA 4GTTA 4MBGA 1NI1A 1MZCA 3DRAA 1TNYA 1O5MA 3DPYA 4GTVA 1JCSA
chains in the Genus database with same CATH superfamily
3ABLE 1UN9A 3Q15A 5A23A 2WXQA 5KNHD 4UI9J 2J4DA 3SI5A 4L9PA 2ILRA 1O1RA 3AG1E 1Y6IA 4PS8A 1TN7A 3SGHA 4FJZA 4WUYA 2RFAA 1X81A 3B7BA 4Q96A 1S70B 2WXRA 3FUFA 4GTQA 4GB9A 3QKYA 3NOGD 4RG6A 3EUVA 2VGXA 4TXRA 2WXGA 3CKBA 3B7RL 3DSSA 3ZYLA 1WDYA 3FU0A 4GTOA 5FQ4A 3SBTB 3FUHA 1BD8A 1KT0A 2JLBA 4GAAA 4JEUA 3RO3A 3FUMA 4I2ZA 2M63A 3ZRHA 1WAO1 3ZIMA 4B94A 2I9CA 3L82A 1MX6A 2HO1A 4JXTA 4KVMA 4XKCA 5AIJA 2WPVA 4N2QA 3W9FA 3CHRA 3ASGA 4J8YA 5KJLA 3ZXSA 2R05A 4YDOA 2FBNA 2PNNA 4HRMB 2BKKB 3UTMA 4GYYA 4MBGA 4LSZE 1O5MA 3PNLB 1LF8A 3F6QA 4JHRA 4UI9C 3JXJA 3UINC 1UN8A 5CHEE 4EQFA 2P9LG 2QYUA 3MV3B 2PM7A 3DWLG 4CYMD 1H6KA 4EZKA 4ZFHA 2WXMA 3UQ3A 4H7YA 3QARA 3T8KA 1MHQA 3UX4A 1BI8B 1HFAA 5H7PA 3HDXA 3OAWA 3MKQB 4PS7A 3RK6A 3FTZA 3T9KA 4JC8A 3PDNA 3VLDA 3TG4A 2KZTB 2GW1A 3G2VA 4C0MA 4URKA 4WWNA 5ENOD 3LCAA 3D9JA 2X6FA 3JUIA 3ULQA 1K8KG 2NXPA 4V3IA 5AJLA 3Q4AB 2ETCA 3NQPA 4JW1A 2AWIA 3AAAC 5JHBA 3BQOA 3CVXA 2L0IA 3TWWA 5LFAA 2RG8A 4K0RA 4U8HA 2J07A 3UT4A 2QZAA 3E4BA 3DSVA 4FADA 1ELRA 4Q94A 4WWOA 2WVIA 5FZQA 4TRQA 4KZ0A 2AW6A 1QZ2A 3KEZA 2L6BA 2R02A 4UI9K 1NA0A 2OEWA 4HOTA 5ENSD 2OCCE 1H0AA 3T8MA 1U3DA 4WNFA 3B7TA 3MV2B 1FT2A 3C98A 5C2YA 2MOWA 4EHMA 3RKVA 4F1PA 2GRLA 5CMYA 1A17A 3WXXA 3BUAA 5LCWC 3CGHA 2X38A 3FTXA 3KS2A 5EYLA 4UQXA 4HXIA 2LNIA 2R17C 4CEMA 3JQ0A 4CRWA 3ZN3A 5JJTA 2LSUA 2BF0X 1KPSB 5CCMA 3AG4E 4J8FA 4ATGA 2KCLA 3RRNB 1TNZA 3FDHA 5FZRA 1AP7A 2X6KA 1JCQA 3ESKA 2VGEA 2CFZA 3KSQA 4A3VA 2P9PG 4N2SA 3SFZA 2AXVA 2UY1A 2DCPA 2CG3A 2DYSE 3GZSA 3C5RA 4GA1A 3Q75A 5A7DB 4U7EB 5FQ8A 2EILE 2ZISA 3TWXA 5G04J 1G3NB 4I1MA 3ZUVB 4WNGA 3OXLA 3EU5A 4HNAD 3UKUG 3L08A 1GW6A 3AG3E 3CHMA 4F6RD 1HE8A 2ZGGA 4M7CA 3TWVA 2IONA 4AM9A 3D9MA 3KSLA 3JYSA 5ENTD 1INZA 1E8WA 5ENQD 2VTBB 3FEYA 2YHCA 2RKKA 4G25A 2FI7A 3UI2A 3J5PA 4LCTA 5CEAA 3LVQE 4I2WA 4K03A 5LP0A 5ENNA 5AQAA 3MKQA 2KM4A 2IU1A 4AXHA 2Y69E 1IHGA 3P2BA 4BEPA 4EBAG 3Q7AA 2BUGA 3DSUA 1BLXB 1Y8MA 3RIBA 2C0LA 3HYMB 4UQZA 3L22A 4MKTA 3R9AB 3RO2A 1S63A 4BWRA 3ZHEB 3IHVA 3SY2A 4BTBA 2L6JA 3TXNA 1OCRE 5G04C 3FTWA 1HX8A 2IY0C 4J7WA 2EINE 5EDSA 1E90A 4DK5A 3HXFA 1IQUA 4APFA 4DRXE 3HG0D 4I1OB 4U0ZA 3SO8A 3QNKA 5D2MC 5AAOA 4GMLA 4J0UA 5EX3A 5FTPA 3D9LA 1KZPA 3S7DA 3UMVA 3BG0B 4TV3A 4U8VD 2XGOA 5AN8A 2CHXA 3IKOB 1SA4A 4A1SA 2GRQB 3NZUA 1X5BA 2WXKA 4HFGA 2VGYA 4WNEA 5G05J 5AJDA 2MRIA 5FJYA 2GROB 5AARA 3Q78A 2CFUA 4FP7A 4G8LA 2WQ7A 1TN6A 4G24A 4XX5A 4K5AB 3APDA 4KMOA 4UUCA 3DEPA 4HI9A 4G2VA 2VSNA 3QK0A 4MS6A 3PZ1A 1SZAA 1NZNA 4HOSA 1OCZE 2RD0A 4GTRA 1H2UA 3X2QE 2IQCA 4GYWA 3ULYA 1DVPA 3D9PA 2FO7A 2KXPC 3QDNA 3MGBA 1WY6A 1Z3XA 2VJ8A 3CLJA 4KVOA 4BERA 3DRAA 4ME2A 4FHKA 4J8EA 4I6JA 3UPVA 2LO6A 2AJAA 2GGFA 3PZ3A 3NAWA 1RW2A 3FUEA 3LY7A 3Q73A 3S7JA 2MYOA 3C3QA 3ASHA 3P1UA 4GTPA 4UWLA 3ABKE 3CV0A 1Z6TA 5CMWA 4JA9A 3C3RA 1SVXA 4WNDA 3DXKG 3IBEA 4U95D 1H19A 2C0MA 3HHMA 3CHOA 2GRRB 4U96D 2MHKA 2VQ2A 2XPIA 3MZLB 2XS1A 3NZSA 1Z5SC 1K3ZD 5G55A 1OWPA 4ANVA 4AEZC 5BV0A 4LNGA 3IXEA 3PUKA 2J09A 1OWMA 2BTDA 1N4SA 1H2TC 3JQ1A 1LD8A 3UIPC 3SZ7A 1JWFA 4G1TA 3BG1B 1PY1A 3S2AA 4APOA 3L13A 3UM0A 3FUJA 1HG2A 5BUZA 1LD7A 4AIFA 3B7UX 4FU3A 3O48A 3QJZA 3V2OA 4GTSA 5D66A 3FUDA 2V0PA 2XZDG 4A1GA 1PAQA 2KBXA 1E8ZA 3D9KA 4UQYA 5HKPA 4MRUA 3R7RA 4NRHB 2WXIA 2XPZA 3LEWA 3TWRA 3MCXA 3SNXA 2XRYA 3PEUB 3ZU7B 1HG5A 2HE0A 4U8YD 5JHAA 3IV0A 4L7TA 3ESLA 3I3NA 3LJ3A 4HLEA 4FULA 5BT1A 2IOLA 5DBKA 3SBSA 1K1AA 3G2UA 2OVFA 2IF4A 2KCVA 3PZ4A 4ANWA 4DUIA 2PQRA 1EYHA 4OYSA 3ZW3A 2GRMA 5FZSA 3CVLA 1JPLA 3E37A 4LUNU 4GA2A 3JUEA 2WXHA 5T8IA 2J08A 4B8AA 2Y3AA 1TN8A 3L16A 1FCHA 3TJPA 4GZ6A 2UWJG 2P9IG 4J6IA 4OAVB 4HLLA 3PREA 4N3BA 1TNOA 3LYAA 4CGWA 3VLFA 1EF1C 4HRLA 1TR4A 2LAIA 2R03A 3RJVA 4C0EA 3L54A 4IULA 1MJ0A 1D8EA 4I1AA 4XI0A 5KBAA 3BEEA 2WMNA 3VTXA 1L5JA 1NFIE 3MKRA 1KZOA 3Q49B 4XZ4A 2VSYA 4CGVA 2X6JA 2DIWA 5J08A 3ASOE 4I9CA 4NIKA 2PQNA 5ANLA 3V31A 3FTSA 2XHEA 1OWNA 2Q7FA 3EHNA 3PH0C 4N3AA 1E7UA 5EX0A 2Y4UA 1QYMA 4HOUA 1JCRA 3S7FA 3OXGA 4KZCA 1DCEA 2YQ8A 3AU5A 1TJFA 3AJIA 4GU5A 2J9QA 1YCSB 1N4PA 1Z3YA 3RAUA 2I6HA 4BY6A 2KC7A 2PL2A 3D9IA 4N39A 4W9RA 5EIBE 2EIJE 3U9WA 1EDUA 3ASFA 1E8XA 2OV8A 5T3RA 4I17A 4DLQA 4HRNA 5BW8C 4F53A 1HF8A 4XEIG 2WM9A 4IRUA 3PZDA 3GW4A 1MX2A 3FU3A 1ELWA 1U2VG 4RG9A 5AQ7A 2KZTA 2F8YA 1K1BA 1N95A 2XEEA 5CCLA 4HORA 2ZGDA 1N94A 3APFA 5HRYA 2YHEA 4KXKB 4AV7A 5BXOA 4ILIA 3TWSA 5FINA 4Y6WA 3MEKA 4JZYA 3DPYA 4GTVA 4L1BA 3DBSA 3HVEB 4ILGA 1YMPA 3NOCD 4C48B 3IEGA 2XRZA 3C3OA 4GZCA 4ANXA 3L9TA 4KYOB 3OXFA 2XPYA 4EECA 1MYOA 3MJWA 3FUKA 3ZVVA 1IKND 5D0OD 3HXEA 3PE4A 3TWQA 3SD5A 1S64A 5FQ6A 4DLOA 3SFYA 4B93B 2QYJA 3R9MA 3RSEG 4ACKA 3LPZA 3ISMC 1XNFA 5JA4D 3CQCB 4GYOA 3URZA 4MLPA 3CVUA 1YYHA 4I6GA 4OVVA 5BNWA 2XGSA 4U0SA 3GZ2A 5ARGA 4HVBA 2WXFA 3CHQA 4EZJA 1QBQA 1IQRA 4B89A 2P9KG 2GRNB 3CK9A 3PS6A 4DX7D 3FP3A 2VTBA 1TNYA 3Q9UC 3ZYQA 2ZXWE 3ZKJA 3ZFWA 1D8DA 3AS5A 1AWCB 4WAFA 1H2VC 3CHSA 4EZLA 4X8QA 4ZHBA 3TGOA 3E34A 3O4ZA 3PVLA 4WWPA 3TWUA 4N3CA 4CDNA 4LEUA 2FEZA 4BETA 3TAXA 3ASNE 3L6AA 4DX2A 2LXLA 3FUIA 3PNTB 4FA6A 4GA0A 4PDXA 4D10C 1IYGA 2XZTG 4LRZA 2WXJA 4TUUA 3U3WA 1SA5A 1TEZA 4OVUA 2IO3C 5CECB 4ANUA 3APCA 5FT9A 3EJNA 2P9SG 3CK8A 2QC9A 4I9EA 2BEDA 3ZHEA 4GZ3A 4XE0A 2XS8A 2XCCA 3FH8A 3T5XA 2V5FA 1OCCE 5KJMA 3G2TA 2VSOE 4A63B 3FFLA 3LJNA 1B89A 3QWPA 2IFUA 5JJ6A 3DXMG 2J8SD 4DI3A 4RQIA 1D9SA 1MZCA 4Y6CA 4PH4B 2WXLA 4GCOA 4K5BA 1JCSA 3B13A 3ZXPA 2P2CP 1UJJA 4E6HA 4QFVA 2F8XK 3ML9A 5AQ9A 1N11A 2DYRE 1HH8A 3FHEA 5ANRA 2IEJA 4AOFA 2A5EA 3BU8A 3UT7A 1HU3A 3KAEA 3HVEA 4CDMA 4N5CA 2AVPA 4E85A 3ZYMA 2R59A 1KLXA 1V55E 5EN5D 3FUNA 5HI7A 4DJAA 3PEVB 4UWFA 1BU9A 4HI8A 3UT8A 3ZYKA 3QOUA 2H6GA 3Q79A 1OWOA 5AYWD 4OAUC 3VTYA 4IYPA 4DPRA 1KT1A 2WQHA 3Q9NC 1H6PA 2YINA 1SQMA 2H6IA 3I5PA 3CHPA 4BX9A 3T5VA 4F7AA 2JABA 3LS8A 5ARFA 5KJNA 4J8SA 2Y4TA 3EDTB 4ABNA 3CVNA 1VDYA 3DEOA 2I1KA 4PUCA 4K5CA 4YDEA 5BXUA 3AS4A 4BTAA 4CT0A 1N54A 4GZ5A 1ZU2A 3I4RB 3Q5MA 4DX5D 3B95A 4IN3B 4AP2A 4BT8A 5DIZA 1WM5A 2ETBA 4LG6A 2NYJA 5E75A 4JHKA 5JMND 3GYZA 2LXMA 2AXUA 4JPSA 3W9GA 3FH5A 4HS2A 3UM3A 3KD7A 1QNFA 1TNUA 3ONKA 3EHMA 1DC2A 2R2LA 2HR2A 3FULA 4B8CB 1UG3A 4JVSA 3CSTA 5KJKA 2WXPA 1U3CA 3EIJA 2A4ZA 2KATA 4QQIA 1E8YA 4P29A 4EBAA 2PZIA 2J49A 4BT9A 1SZ9A 3LDZA 4XI9A 2PM6A 2DZNA 4L2LA 4N5QA 2HM8A 1DCQA 4G23A 5M72A 3LY9A 1HZ4A 2LSVA 1IXVA 4FLBA 4JHJA 1HS6A 2QFCA 4RLYA 1ZBPA 3EHRA 4KT6B 3ONLA 4ACLA 1NL4A 4NACA 3Q7FA 3JXIA 4KBQA 1JWGA 2ONDA 2V4LA 4F1SA 4YVQC 4AY5A 5BPPA 3AS8A 2E0IA 3D9HA 3B7SA 5CEDB 4G26A 2IO2C 3U4TA 3I4GA 4Z68A 4TUMA 3CKCA 3ZNGA 1UJKA 1FVFA 2XEHA 3LY8A 1SW6A 1H6OA 1TNBA 5G05C 1RZ4A 4LNUD 5JJ7A 4FC8A 2OVBA 1Q2ZA 3SFXA 5ITZF 3UM2A 3NF1A 1OT8A 4DX6D 3RU0A 5FQ7A 2F37A 4GZDA 3C72A 3VLEA 3G2SA 3PZ2A 5IY5E 1TYQG 2XQ0A 3LVRE 4DX1A 1YA0A 3PRZA 2WQ6A 5HS0A 3N71A 4BFRA 2DZOA 5B1BE 3L17A 4U63A 4Q69A 3EHQA 1OUVA 2BKGA 3WG7E 1BI7B 3D3MA 4BESA 4GPMA 2UY1B 1FT1A 1TJCA 4NURA 5T4YA 2B0OE 5KCMA 3RRUA 4L2YA 2CG2A 3TXMA 4CDRA 2DVWA 4H7XA 3NB2A 4YNDA 3LXUX 3SF4A 3CVYA 1N52A 4A3TA 3JCKC 1EPUA 1WG0A 1XGWA 3FTYA 5A6CA 2LUHA 3ML8A 2XENA 2H6HA 3ZEFA 1UOHA 4UWGA 4EPZA 3K9IA 1QQEA 4FHJA 3DSXA 5AENA 2WXOA 5B3SE 3NBNB 2R5SA 3ASDA 3CSFA 4U04A 1NA3A 2EIKE 2P58C 5CRUA 2FULA 2KCKA 3V30A 4DI4A 4ILHB 2EIME 5D0QD 3CVQA 4ATZD 1MX4A 2I1JA 3QWWA 3S7BA 4PS3A 3FEXA 4JL0A 5J90A 4J8DA 3U64A 1N9AA 4B0ZA 2XEVA 2F0YA 5ENPD 3FTUA 2CHWA 5G2NA 2X6HA 4GPKA 2Y1LE 3V2XA 3CQGB 3D9OA 2X6IA 4TXPA 5FWQA 5LX8A 4M3OA 1OCOE 4RSYA 2QY7A 5E76A 4BX8A 1W3BA 3J5QB 3AU4A 2FO1E 3TL5A 5ENRD 5CERB 1O1SA 2GRPB 5AQBA 2XCBA 4YDYA 3QB2A 4A55A 3ZGQA 4G8KA 4UWHA 3CVPA 4AJWA 1JUQA 4HBDA 1UW4B 3HXDA 3CR3A 3ENEA 3HRAA 4JEHA 3R7QA 1ZB1A 2IOSA 5CBNA 2YNQA 1E7VA 4JB8P 3E33A 3CK7A 3GZ1A 4GTMA 3DPDA 1PC2A 1LTXA 3G2WA 3QAQA 3CVWA 1BPOA 4BSZB 2ZU6B 3SQVA 3UUXA 4GMJA 2HYZA 4O60A 1N0RA 2DBAA 5EIDA 5C1DA 3MYVA 1E96B 1HO8A 3ABME 4HB5A 2CHZA 3UKRG 2H6FA 3KEAA 4YVOA 4AVXA 1P5QA 4L23A 4CT4A 4CZ2D 1ELKA 5HQ8A 2ZIRA 3RRMB 3SHFA 4HOQA 2NC9A 3E30A 2C2LA 2L9BA 5EKQD 3FWVA 3EU9A 3OTNA 4CCAA 1MQSA 5FIOA 4U0UA 4YDWA 2VGXB 4JD2G 2A5UA 2L0TB 2RFMA 4F3VA 4O6FA 3D9NA 5CBOA 3U66A 3TWTA 3CEQA 4HQDA 2VSXE 1DNPA 3MA5A 2I2OA 3DSTA 5EYPF 1N4RA 3HXBA 2LAHA 4C9BB 2V8SE 2VYIA 5BV1A 2NSZA 5KWDA 5KNGA 3FY4A 3QC1A 4U07A 2E2EA 3FTVA 5LOZA 3MX3A 1FPPA 4XKBA 2V5QC 2WB2A 3QWVA 2OOEA 2J4BA 3AG2E 2P9UG 5EILA 3PE3A 1IHBA 4RVBA 2WXNA 3PUJA 3ZPJA 1A5EA 1N4QA 4UWKA 3TG5A 3EIQC 1V54E 1S0PA 3ULEG 3CVVA 2Y0BG 3FH7A 1N0QA 4O1PA 4JA7A 2X3MA 2EQXA 4I43A 1NP7A 4LNBA 2XGMA 4LERA 1OWLA 3UIOC 4G11A 1OXJA 2WMOA 4AY6A 3IHYA 3UM1A 2FF4A 3DSWA 5B1AE 4I6EA 3Q47B 3FU6A 3V79K 4GCNA 1OY3D 4TXQA 4NQ0A 3FU5A 4O1OA 4R7LA 4GMRA 3UXGA 2DWZA 2B6CA 4XIFA 2IJGX 3CIAA 1FVHA 2AXZA 4BSXA 3E32A 4FLHA 2V4HC 3HXCA 1O1TA 4GTTA 1HXIA 1NI1A 3HIZA 2JEKA 4FJYA 2P9NG 2ETAA 3LKUA 5CRVA 2OEVA 5LCWJ
chains in the Genus database with same CATH topology
1FPPA 3PZ3A 3Q75A 3HXDA 3Q73A 1D8DA 1FT2A 2ZISA 2H6HA 1JCRA 3HXFA 2IEJA 4GTPA 1TNBA 3E33A 4EHMA 4L9PA 1O1RA 1TNUA 3E34A 4GTMA 3EU5A 1LTXA 1DCEA 3PZ4A 1TN7A 3SFXA 1X81A 2R2LA 3HXEA 3DSXA 1N4PA 1N4QA 1KZPA 3C72A 4GTQA 1S64A 3PZ2A 3E37A 3KSLA 2H6FA 3EUVA 3SFYA 1SA4A 1TN8A 3DSSA 4LNBA 1SA5A 2ZIRA 2H6GA 4GTOA 3Q79A 3E30A 4LNGA 1TNOA 1N9AA 3Q78A 1N4SA 2F0YA 1TN6A 1LD8A 3DSWA 2BEDA 2H6IA 1FT1A 3Q7AA 1D8EA 3PZ1A 1N95A 1NL4A 1TNZA 3DSUA 3Q7FA 3DSVA 1JCQA 1N94A 3DSTA 1QBQA 1LD7A 1N4RA 3HXBA 4GTRA 1KZOA 3KSQA 4YDEA 4YDOA 4GTSA 3E32A 1S63A 3HXCA 1O1SA 1O1TA 4GTTA 4MBGA 1NI1A 1MZCA 3DRAA 1TNYA 1O5MA 3DPYA 4GTVA 1JCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPP A;  3PZ3 A;  3Q75 A;  3HXD A;  3Q73 A;  1D8D A;  1FT2 A;  2ZIS A;  2H6H A;  1JCR A;  3HXF A;  2IEJ A;  4GTP A;  1TNB A;  3E33 A;  4EHM A;  4L9P A;  1O1R A;  1TNU A;  3E34 A;  4GTM A;  3EU5 A;  1LTX A;  1DCE A;  3PZ4 A;  1TN7 A;  3SFX A;  1X81 A;  2R2L A;  3HXE A;  3DSX A;  1N4P A;  1N4Q A;  1KZP A;  3C72 A;  4GTQ A;  1S64 A;  3PZ2 A;  3E37 A;  3KSL A;  2H6F A;  3EUV A;  3SFY A;  1SA4 A;  1TN8 A;  3DSS A;  4LNB A;  1SA5 A;  2ZIR A;  2H6G A;  4GTO A;  3Q79 A;  3E30 A;  4LNG A;  1TNO A;  1N9A A;  3Q78 A;  1N4S A;  2F0Y A;  1TN6 A;  1LD8 A;  3DSW A;  2BED A;  2H6I A;  1FT1 A;  3Q7A A;  1D8E A;  3PZ1 A;  1N95 A;  1NL4 A;  1TNZ A;  3DSU A;  3Q7F A;  3DSV A;  1JCQ A;  1N94 A;  3DST A;  1QBQ A;  1LD7 A;  1N4R A;  3HXB A;  4GTR A;  1KZO A;  3KSQ A;  4YDE A;  4YDO A;  4GTS A;  3E32 A;  1S63 A;  3HXC A;  1O1S A;  1O1T A;  4GTT A;  4MBG A;  1NI1 A;  1MZC A;  3DRA A;  1TNY A;  1O5M A;  3DPY A;  4GTV A;  1JCS A; 
#chains in the Genus database with same CATH topology
 3ABL E;  1UN9 A;  3Q15 A;  5A23 A;  2WXQ A;  5KNH D;  4UI9 J;  2J4D A;  3SI5 A;  4L9P A;  2ILR A;  1O1R A;  3AG1 E;  1Y6I A;  4PS8 A;  1TN7 A;  3SGH A;  4FJZ A;  4WUY A;  2RFA A;  1X81 A;  3B7B A;  4Q96 A;  1S70 B;  2WXR A;  3FUF A;  4GTQ A;  4GB9 A;  3QKY A;  3NOG D;  4RG6 A;  3EUV A;  2VGX A;  4TXR A;  2WXG A;  3CKB A;  3B7R L;  3DSS A;  3ZYL A;  1WDY A;  3FU0 A;  4GTO A;  5FQ4 A;  3SBT B;  3FUH A;  1BD8 A;  1KT0 A;  2JLB A;  4GAA A;  4JEU A;  3RO3 A;  3FUM A;  4I2Z A;  2M63 A;  3ZRH A;  1WAO 1;  3ZIM A;  4B94 A;  2I9C A;  3L82 A;  1MX6 A;  2HO1 A;  4JXT A;  4KVM A;  4XKC A;  5AIJ A;  2WPV A;  4N2Q A;  3W9F A;  3CHR A;  3ASG A;  4J8Y A;  5KJL A;  3ZXS A;  2R05 A;  4YDO A;  2FBN A;  2PNN A;  4HRM B;  2BKK B;  3UTM A;  4GYY A;  4MBG A;  4LSZ E;  1O5M A;  3PNL B;  1LF8 A;  3F6Q A;  4JHR A;  4UI9 C;  3JXJ A;  3UIN C;  1UN8 A;  5CHE E;  4EQF A;  2P9L G;  2QYU A;  3MV3 B;  2PM7 A;  3DWL G;  4CYM D;  1H6K A;  4EZK A;  4ZFH A;  2WXM A;  3UQ3 A;  4H7Y A;  3QAR A;  3T8K A;  1MHQ A;  3UX4 A;  1BI8 B;  1HFA A;  5H7P A;  3HDX A;  3OAW A;  3MKQ B;  4PS7 A;  3RK6 A;  3FTZ A;  3T9K A;  4JC8 A;  3PDN A;  3VLD A;  3TG4 A;  2KZT B;  2GW1 A;  3G2V A;  4C0M A;  4URK A;  4WWN A;  5ENO D;  3LCA A;  3D9J A;  2X6F A;  3JUI A;  3ULQ A;  1K8K G;  2NXP A;  4V3I A;  5AJL A;  3Q4A B;  2ETC A;  3NQP A;  4JW1 A;  2AWI A;  3AAA C;  5JHB A;  3BQO A;  3CVX A;  2L0I A;  3TWW A;  5LFA A;  2RG8 A;  4K0R A;  4U8H A;  2J07 A;  3UT4 A;  2QZA A;  3E4B A;  3DSV A;  4FAD A;  1ELR A;  4Q94 A;  4WWO A;  2WVI A;  5FZQ A;  4TRQ A;  4KZ0 A;  2AW6 A;  1QZ2 A;  3KEZ A;  2L6B A;  2R02 A;  4UI9 K;  1NA0 A;  2OEW A;  4HOT A;  5ENS D;  2OCC E;  1H0A A;  3T8M A;  1U3D A;  4WNF A;  3B7T A;  3MV2 B;  1FT2 A;  3C98 A;  5C2Y A;  2MOW A;  4EHM A;  3RKV A;  4F1P A;  2GRL A;  5CMY A;  1A17 A;  3WXX A;  3BUA A;  5LCW C;  3CGH A;  2X38 A;  3FTX A;  3KS2 A;  5EYL A;  4UQX A;  4HXI A;  2LNI A;  2R17 C;  4CEM A;  3JQ0 A;  4CRW A;  3ZN3 A;  5JJT A;  2LSU A;  2BF0 X;  1KPS B;  5CCM A;  3AG4 E;  4J8F A;  4ATG A;  2KCL A;  3RRN B;  1TNZ A;  3FDH A;  5FZR A;  1AP7 A;  2X6K A;  1JCQ A;  3ESK A;  2VGE A;  2CFZ A;  3KSQ A;  4A3V A;  2P9P G;  4N2S A;  3SFZ A;  2AXV A;  2UY1 A;  2DCP A;  2CG3 A;  2DYS E;  3GZS A;  3C5R A;  4GA1 A;  3Q75 A;  5A7D B;  4U7E B;  5FQ8 A;  2EIL E;  2ZIS A;  3TWX A;  5G04 J;  1G3N B;  4I1M A;  3ZUV B;  4WNG A;  3OXL A;  3EU5 A;  4HNA D;  3UKU G;  3L08 A;  1GW6 A;  3AG3 E;  3CHM A;  4F6R D;  1HE8 A;  2ZGG A;  4M7C A;  3TWV A;  2ION A;  4AM9 A;  3D9M A;  3KSL A;  3JYS A;  5ENT D;  1INZ A;  1E8W A;  5ENQ D;  2VTB B;  3FEY A;  2YHC A;  2RKK A;  4G25 A;  2FI7 A;  3UI2 A;  3J5P A;  4LCT A;  5CEA A;  3LVQ E;  4I2W A;  4K03 A;  5LP0 A;  5ENN A;  5AQA A;  3MKQ A;  2KM4 A;  2IU1 A;  4AXH A;  2Y69 E;  1IHG A;  3P2B A;  4BEP A;  4EBA G;  3Q7A A;  2BUG A;  3DSU A;  1BLX B;  1Y8M A;  3RIB A;  2C0L A;  3HYM B;  4UQZ A;  3L22 A;  4MKT A;  3R9A B;  3RO2 A;  1S63 A;  4BWR A;  3ZHE B;  3IHV A;  3SY2 A;  4BTB A;  2L6J A;  3TXN A;  1OCR E;  5G04 C;  3FTW A;  1HX8 A;  2IY0 C;  4J7W A;  2EIN E;  5EDS A;  1E90 A;  4DK5 A;  3HXF A;  1IQU A;  4APF A;  4DRX E;  3HG0 D;  4I1O B;  4U0Z A;  3SO8 A;  3QNK A;  5D2M C;  5AAO A;  4GML A;  4J0U A;  5EX3 A;  5FTP A;  3D9L A;  1KZP A;  3S7D A;  3UMV A;  3BG0 B;  4TV3 A;  4U8V D;  2XGO A;  5AN8 A;  2CHX A;  3IKO B;  1SA4 A;  4A1S A;  2GRQ B;  3NZU A;  1X5B A;  2WXK A;  4HFG A;  2VGY A;  4WNE A;  5G05 J;  5AJD A;  2MRI A;  5FJY A;  2GRO B;  5AAR A;  3Q78 A;  2CFU A;  4FP7 A;  4G8L A;  2WQ7 A;  1TN6 A;  4G24 A;  4XX5 A;  4K5A B;  3APD A;  4KMO A;  4UUC A;  3DEP A;  4HI9 A;  4G2V A;  2VSN A;  3QK0 A;  4MS6 A;  3PZ1 A;  1SZA A;  1NZN A;  4HOS A;  1OCZ E;  2RD0 A;  4GTR A;  1H2U A;  3X2Q E;  2IQC A;  4GYW A;  3ULY A;  1DVP A;  3D9P A;  2FO7 A;  2KXP C;  3QDN A;  3MGB A;  1WY6 A;  1Z3X A;  2VJ8 A;  3CLJ A;  4KVO A;  4BER A;  3DRA A;  4ME2 A;  4FHK A;  4J8E A;  4I6J A;  3UPV A;  2LO6 A;  2AJA A;  2GGF A;  3PZ3 A;  3NAW A;  1RW2 A;  3FUE A;  3LY7 A;  3Q73 A;  3S7J A;  2MYO A;  3C3Q A;  3ASH A;  3P1U A;  4GTP A;  4UWL A;  3ABK E;  3CV0 A;  1Z6T A;  5CMW A;  4JA9 A;  3C3R A;  1SVX A;  4WND A;  3DXK G;  3IBE A;  4U95 D;  1H19 A;  2C0M A;  3HHM A;  3CHO A;  2GRR B;  4U96 D;  2MHK A;  2VQ2 A;  2XPI A;  3MZL B;  2XS1 A;  3NZS A;  1Z5S C;  1K3Z D;  5G55 A;  1OWP A;  4ANV A;  4AEZ C;  5BV0 A;  4LNG A;  3IXE A;  3PUK A;  2J09 A;  1OWM A;  2BTD A;  1N4S A;  1H2T C;  3JQ1 A;  1LD8 A;  3UIP C;  3SZ7 A;  1JWF A;  4G1T A;  3BG1 B;  1PY1 A;  3S2A A;  4APO A;  3L13 A;  3UM0 A;  3FUJ A;  1HG2 A;  5BUZ A;  1LD7 A;  4AIF A;  3B7U X;  4FU3 A;  3O48 A;  3QJZ A;  3V2O A;  4GTS A;  5D66 A;  3FUD A;  2V0P A;  2XZD G;  4A1G A;  1PAQ A;  2KBX A;  1E8Z A;  3D9K A;  4UQY A;  5HKP A;  4MRU A;  3R7R A;  4NRH B;  2WXI A;  2XPZ A;  3LEW A;  3TWR A;  3MCX A;  3SNX A;  2XRY A;  3PEU B;  3ZU7 B;  1HG5 A;  2HE0 A;  4U8Y D;  5JHA A;  3IV0 A;  4L7T A;  3ESL A;  3I3N A;  3LJ3 A;  4HLE A;  4FUL A;  5BT1 A;  2IOL A;  5DBK A;  3SBS A;  1K1A A;  3G2U A;  2OVF A;  2IF4 A;  2KCV A;  3PZ4 A;  4ANW A;  4DUI A;  2PQR A;  1EYH A;  4OYS A;  3ZW3 A;  2GRM A;  5FZS A;  3CVL A;  1JPL A;  3E37 A;  4LUN U;  4GA2 A;  3JUE A;  2WXH A;  5T8I A;  2J08 A;  4B8A A;  2Y3A A;  1TN8 A;  3L16 A;  1FCH A;  3TJP A;  4GZ6 A;  2UWJ G;  2P9I G;  4J6I A;  4OAV B;  4HLL A;  3PRE A;  4N3B A;  1TNO A;  3LYA A;  4CGW A;  3VLF A;  1EF1 C;  4HRL A;  1TR4 A;  2LAI A;  2R03 A;  3RJV A;  4C0E A;  3L54 A;  4IUL A;  1MJ0 A;  1D8E A;  4I1A A;  4XI0 A;  5KBA A;  3BEE A;  2WMN A;  3VTX A;  1L5J A;  1NFI E;  3MKR A;  1KZO A;  3Q49 B;  4XZ4 A;  2VSY A;  4CGV A;  2X6J A;  2DIW A;  5J08 A;  3ASO E;  4I9C A;  4NIK A;  2PQN A;  5ANL A;  3V31 A;  3FTS A;  2XHE A;  1OWN A;  2Q7F A;  3EHN A;  3PH0 C;  4N3A A;  1E7U A;  5EX0 A;  2Y4U A;  1QYM A;  4HOU A;  1JCR A;  3S7F A;  3OXG A;  4KZC A;  1DCE A;  2YQ8 A;  3AU5 A;  1TJF A;  3AJI A;  4GU5 A;  2J9Q A;  1YCS B;  1N4P A;  1Z3Y A;  3RAU A;  2I6H A;  4BY6 A;  2KC7 A;  2PL2 A;  3D9I A;  4N39 A;  4W9R A;  5EIB E;  2EIJ E;  3U9W A;  1EDU A;  3ASF A;  1E8X A;  2OV8 A;  5T3R A;  4I17 A;  4DLQ A;  4HRN A;  5BW8 C;  4F53 A;  1HF8 A;  4XEI G;  2WM9 A;  4IRU A;  3PZD A;  3GW4 A;  1MX2 A;  3FU3 A;  1ELW A;  1U2V G;  4RG9 A;  5AQ7 A;  2KZT A;  2F8Y A;  1K1B A;  1N95 A;  2XEE A;  5CCL A;  4HOR A;  2ZGD A;  1N94 A;  3APF A;  5HRY A;  2YHE A;  4KXK B;  4AV7 A;  5BXO A;  4ILI A;  3TWS A;  5FIN A;  4Y6W A;  3MEK A;  4JZY A;  3DPY A;  4GTV A;  4L1B A;  3DBS A;  3HVE B;  4ILG A;  1YMP A;  3NOC D;  4C48 B;  3IEG A;  2XRZ A;  3C3O A;  4GZC A;  4ANX A;  3L9T A;  4KYO B;  3OXF A;  2XPY A;  4EEC A;  1MYO A;  3MJW A;  3FUK A;  3ZVV A;  1IKN D;  5D0O D;  3HXE A;  3PE4 A;  3TWQ A;  3SD5 A;  1S64 A;  5FQ6 A;  4DLO A;  3SFY A;  4B93 B;  2QYJ A;  3R9M A;  3RSE G;  4ACK A;  3LPZ A;  3ISM C;  1XNF A;  5JA4 D;  3CQC B;  4GYO A;  3URZ A;  4MLP A;  3CVU A;  1YYH A;  4I6G A;  4OVV A;  5BNW A;  2XGS A;  4U0S A;  3GZ2 A;  5ARG A;  4HVB A;  2WXF A;  3CHQ A;  4EZJ A;  1QBQ A;  1IQR A;  4B89 A;  2P9K G;  2GRN B;  3CK9 A;  3PS6 A;  4DX7 D;  3FP3 A;  2VTB A;  1TNY A;  3Q9U C;  3ZYQ A;  2ZXW E;  3ZKJ A;  3ZFW A;  1D8D A;  3AS5 A;  1AWC B;  4WAF A;  1H2V C;  3CHS A;  4EZL A;  4X8Q A;  4ZHB A;  3TGO A;  3E34 A;  3O4Z A;  3PVL A;  4WWP A;  3TWU A;  4N3C A;  4CDN A;  4LEU A;  2FEZ A;  4BET A;  3TAX A;  3ASN E;  3L6A A;  4DX2 A;  2LXL A;  3FUI A;  3PNT B;  4FA6 A;  4GA0 A;  4PDX A;  4D10 C;  1IYG A;  2XZT G;  4LRZ A;  2WXJ A;  4TUU A;  3U3W A;  1SA5 A;  1TEZ A;  4OVU A;  2IO3 C;  5CEC B;  4ANU A;  3APC A;  5FT9 A;  3EJN A;  2P9S G;  3CK8 A;  2QC9 A;  4I9E A;  2BED A;  3ZHE A;  4GZ3 A;  4XE0 A;  2XS8 A;  2XCC A;  3FH8 A;  3T5X A;  2V5F A;  1OCC E;  5KJM A;  3G2T A;  2VSO E;  4A63 B;  3FFL A;  3LJN A;  1B89 A;  3QWP A;  2IFU A;  5JJ6 A;  3DXM G;  2J8S D;  4DI3 A;  4RQI A;  1D9S A;  1MZC A;  4Y6C A;  4PH4 B;  2WXL A;  4GCO A;  4K5B A;  1JCS A;  3B13 A;  3ZXP A;  2P2C P;  1UJJ A;  4E6H A;  4QFV A;  2F8X K;  3ML9 A;  5AQ9 A;  1N11 A;  2DYR E;  1HH8 A;  3FHE A;  5ANR A;  2IEJ A;  4AOF A;  2A5E A;  3BU8 A;  3UT7 A;  1HU3 A;  3KAE A;  3HVE A;  4CDM A;  4N5C A;  2AVP A;  4E85 A;  3ZYM A;  2R59 A;  1KLX A;  1V55 E;  5EN5 D;  3FUN A;  5HI7 A;  4DJA A;  3PEV B;  4UWF A;  1BU9 A;  4HI8 A;  3UT8 A;  3ZYK A;  3QOU A;  2H6G A;  3Q79 A;  1OWO A;  5AYW D;  4OAU C;  3VTY A;  4IYP A;  4DPR A;  1KT1 A;  2WQH A;  3Q9N C;  1H6P A;  2YIN A;  1SQM A;  2H6I A;  3I5P A;  3CHP A;  4BX9 A;  3T5V A;  4F7A A;  2JAB A;  3LS8 A;  5ARF A;  5KJN A;  4J8S A;  2Y4T A;  3EDT B;  4ABN A;  3CVN A;  1VDY A;  3DEO A;  2I1K A;  4PUC A;  4K5C A;  4YDE A;  5BXU A;  3AS4 A;  4BTA A;  4CT0 A;  1N54 A;  4GZ5 A;  1ZU2 A;  3I4R B;  3Q5M A;  4DX5 D;  3B95 A;  4IN3 B;  4AP2 A;  4BT8 A;  5DIZ A;  1WM5 A;  2ETB A;  4LG6 A;  2NYJ A;  5E75 A;  4JHK A;  5JMN D;  3GYZ A;  2LXM A;  2AXU A;  4JPS A;  3W9G A;  3FH5 A;  4HS2 A;  3UM3 A;  3KD7 A;  1QNF A;  1TNU A;  3ONK A;  3EHM A;  1DC2 A;  2R2L A;  2HR2 A;  3FUL A;  4B8C B;  1UG3 A;  4JVS A;  3CST A;  5KJK A;  2WXP A;  1U3C A;  3EIJ A;  2A4Z A;  2KAT A;  4QQI A;  1E8Y A;  4P29 A;  4EBA A;  2PZI A;  2J49 A;  4BT9 A;  1SZ9 A;  3LDZ A;  4XI9 A;  2PM6 A;  2DZN A;  4L2L A;  4N5Q A;  2HM8 A;  1DCQ A;  4G23 A;  5M72 A;  3LY9 A;  1HZ4 A;  2LSV A;  1IXV A;  4FLB A;  4JHJ A;  1HS6 A;  2QFC A;  4RLY A;  1ZBP A;  3EHR A;  4KT6 B;  3ONL A;  4ACL A;  1NL4 A;  4NAC A;  3Q7F A;  3JXI A;  4KBQ A;  1JWG A;  2OND A;  2V4L A;  4F1S A;  4YVQ C;  4AY5 A;  5BPP A;  3AS8 A;  2E0I A;  3D9H A;  3B7S A;  5CED B;  4G26 A;  2IO2 C;  3U4T A;  3I4G A;  4Z68 A;  4TUM A;  3CKC A;  3ZNG A;  1UJK A;  1FVF A;  2XEH A;  3LY8 A;  1SW6 A;  1H6O A;  1TNB A;  5G05 C;  1RZ4 A;  4LNU D;  5JJ7 A;  4FC8 A;  2OVB A;  1Q2Z A;  3SFX A;  5ITZ F;  3UM2 A;  3NF1 A;  1OT8 A;  4DX6 D;  3RU0 A;  5FQ7 A;  2F37 A;  4GZD A;  3C72 A;  3VLE A;  3G2S A;  3PZ2 A;  5IY5 E;  1TYQ G;  2XQ0 A;  3LVR E;  4DX1 A;  1YA0 A;  3PRZ A;  2WQ6 A;  5HS0 A;  3N71 A;  4BFR A;  2DZO A;  5B1B E;  3L17 A;  4U63 A;  4Q69 A;  3EHQ A;  1OUV A;  2BKG A;  3WG7 E;  1BI7 B;  3D3M A;  4BES A;  4GPM A;  2UY1 B;  1FT1 A;  1TJC A;  4NUR A;  5T4Y A;  2B0O E;  5KCM A;  3RRU A;  4L2Y A;  2CG2 A;  3TXM A;  4CDR A;  2DVW A;  4H7X A;  3NB2 A;  4YND A;  3LXU X;  3SF4 A;  3CVY A;  1N52 A;  4A3T A;  3JCK C;  1EPU A;  1WG0 A;  1XGW A;  3FTY A;  5A6C A;  2LUH A;  3ML8 A;  2XEN A;  2H6H A;  3ZEF A;  1UOH A;  4UWG A;  4EPZ A;  3K9I A;  1QQE A;  4FHJ A;  3DSX A;  5AEN A;  2WXO A;  5B3S E;  3NBN B;  2R5S A;  3ASD A;  3CSF A;  4U04 A;  1NA3 A;  2EIK E;  2P58 C;  5CRU A;  2FUL A;  2KCK A;  3V30 A;  4DI4 A;  4ILH B;  2EIM E;  5D0Q D;  3CVQ A;  4ATZ D;  1MX4 A;  2I1J A;  3QWW A;  3S7B A;  4PS3 A;  3FEX A;  4JL0 A;  5J90 A;  4J8D A;  3U64 A;  1N9A A;  4B0Z A;  2XEV A;  2F0Y A;  5ENP D;  3FTU A;  2CHW A;  5G2N A;  2X6H A;  4GPK A;  2Y1L E;  3V2X A;  3CQG B;  3D9O A;  2X6I A;  4TXP A;  5FWQ A;  5LX8 A;  4M3O A;  1OCO E;  4RSY A;  2QY7 A;  5E76 A;  4BX8 A;  1W3B A;  3J5Q B;  3AU4 A;  2FO1 E;  3TL5 A;  5ENR D;  5CER B;  1O1S A;  2GRP B;  5AQB A;  2XCB A;  4YDY A;  3QB2 A;  4A55 A;  3ZGQ A;  4G8K A;  4UWH A;  3CVP A;  4AJW A;  1JUQ A;  4HBD A;  1UW4 B;  3HXD A;  3CR3 A;  3ENE A;  3HRA A;  4JEH A;  3R7Q A;  1ZB1 A;  2IOS A;  5CBN A;  2YNQ A;  1E7V A;  4JB8 P;  3E33 A;  3CK7 A;  3GZ1 A;  4GTM A;  3DPD A;  1PC2 A;  1LTX A;  3G2W A;  3QAQ A;  3CVW A;  1BPO A;  4BSZ B;  2ZU6 B;  3SQV A;  3UUX A;  4GMJ A;  2HYZ A;  4O60 A;  1N0R A;  2DBA A;  5EID A;  5C1D A;  3MYV A;  1E96 B;  1HO8 A;  3ABM E;  4HB5 A;  2CHZ A;  3UKR G;  2H6F A;  3KEA A;  4YVO A;  4AVX A;  1P5Q A;  4L23 A;  4CT4 A;  4CZ2 D;  1ELK A;  5HQ8 A;  2ZIR A;  3RRM B;  3SHF A;  4HOQ A;  2NC9 A;  3E30 A;  2C2L A;  2L9B A;  5EKQ D;  3FWV A;  3EU9 A;  3OTN A;  4CCA A;  1MQS A;  5FIO A;  4U0U A;  4YDW A;  2VGX B;  4JD2 G;  2A5U A;  2L0T B;  2RFM A;  4F3V A;  4O6F A;  3D9N A;  5CBO A;  3U66 A;  3TWT A;  3CEQ A;  4HQD A;  2VSX E;  1DNP A;  3MA5 A;  2I2O A;  3DST A;  5EYP F;  1N4R A;  3HXB A;  2LAH A;  4C9B B;  2V8S E;  2VYI A;  5BV1 A;  2NSZ A;  5KWD A;  5KNG A;  3FY4 A;  3QC1 A;  4U07 A;  2E2E A;  3FTV A;  5LOZ A;  3MX3 A;  1FPP A;  4XKB A;  2V5Q C;  2WB2 A;  3QWV A;  2OOE A;  2J4B A;  3AG2 E;  2P9U G;  5EIL A;  3PE3 A;  1IHB A;  4RVB A;  2WXN A;  3PUJ A;  3ZPJ A;  1A5E A;  1N4Q A;  4UWK A;  3TG5 A;  3EIQ C;  1V54 E;  1S0P A;  3ULE G;  3CVV A;  2Y0B G;  3FH7 A;  1N0Q A;  4O1P A;  4JA7 A;  2X3M A;  2EQX A;  4I43 A;  1NP7 A;  4LNB A;  2XGM A;  4LER A;  1OWL A;  3UIO C;  4G11 A;  1OXJ A;  2WMO A;  4AY6 A;  3IHY A;  3UM1 A;  2FF4 A;  3DSW A;  5B1A E;  4I6E A;  3Q47 B;  3FU6 A;  3V79 K;  4GCN A;  1OY3 D;  4TXQ A;  4NQ0 A;  3FU5 A;  4O1O A;  4R7L A;  4GMR A;  3UXG A;  2DWZ A;  2B6C A;  4XIF A;  2IJG X;  3CIA A;  1FVH A;  2AXZ A;  4BSX A;  3E32 A;  4FLH A;  2V4H C;  3HXC A;  1O1T A;  4GTT A;  1HXI A;  1NI1 A;  3HIZ A;  2JEK A;  4FJY A;  2P9N G;  2ETA A;  3LKU A;  5CRV A;  2OEV A;  5LCW J; 
#chains in the Genus database with same CATH homology
 1FPP A;  3PZ3 A;  3Q75 A;  3HXD A;  3Q73 A;  1D8D A;  1FT2 A;  2ZIS A;  2H6H A;  1JCR A;  3HXF A;  2IEJ A;  4GTP A;  1TNB A;  3E33 A;  4EHM A;  4L9P A;  1O1R A;  1TNU A;  3E34 A;  4GTM A;  3EU5 A;  1LTX A;  1DCE A;  3PZ4 A;  1TN7 A;  3SFX A;  1X81 A;  2R2L A;  3HXE A;  3DSX A;  1N4P A;  1N4Q A;  1KZP A;  3C72 A;  4GTQ A;  1S64 A;  3PZ2 A;  3E37 A;  3KSL A;  2H6F A;  3EUV A;  3SFY A;  1SA4 A;  1TN8 A;  3DSS A;  4LNB A;  1SA5 A;  2ZIR A;  2H6G A;  4GTO A;  3Q79 A;  3E30 A;  4LNG A;  1TNO A;  1N9A A;  3Q78 A;  1N4S A;  2F0Y A;  1TN6 A;  1LD8 A;  3DSW A;  2BED A;  2H6I A;  1FT1 A;  3Q7A A;  1D8E A;  3PZ1 A;  1N95 A;  1NL4 A;  1TNZ A;  3DSU A;  3Q7F A;  3DSV A;  1JCQ A;  1N94 A;  3DST A;  1QBQ A;  1LD7 A;  1N4R A;  3HXB A;  4GTR A;  1KZO A;  3KSQ A;  4YDE A;  4YDO A;  4GTS A;  3E32 A;  1S63 A;  3HXC A;  1O1S A;  1O1T A;  4GTT A;  4MBG A;  1NI1 A;  1MZC A;  3DRA A;  1TNY A;  1O5M A;  3DPY A;  4GTV A;  1JCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...