4LCTA

Crystal structure and versatile functional roles of the cop9 signalosome subunit 1
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
318
structure length
318
Chain Sequence
EPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMCMNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFLDVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords COP9 signalosome complex subunit 1
publication title Crystal structure and versatile functional roles of the COP9 signalosome subunit 1.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 129
structure length 318
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10602 RPN7 26S proteasome subunit RPN7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4lctA00
3JCKC 3TXNA 3TXMA 3CHMA 3T5XA 2MRIA 4D10C 4LCTA
chains in the Genus database with same CATH superfamily
4NQ0A 3OAWA 1ELWA 4DJAA 3ZEFA 3Q5MA 2NSZA 2WXNA 3T5VA 2IQCA 1OWNA 3IHYA 3LVQE 1UN9A 1HS6A 3FTXA 3CLJA 4JHRA 4HRMB 2CHZA 2ZGDA 5AAOA 3QARA 3O48A 3TAXA 4GB9A 4GMLA 3ML9A 1QQEA 3PNTB 4JZYA 4JA9A 4DX1A 4GZCA 4TRQA 3W9FA 1V54E 4BT8A 3V30A 3ESKA 5AENA 4IYPA 1KLXA 2Y1LE 1TYQG 1WDYA 3FU3A 4J6IA 3C3RA 4HFGA 3FH8A 1WAO1 4MLPA 3DSVA 4ACLA 1KT1A 1OXJA 4BSZB 2XEVA 3EUVA 2MRIA 2R03A 3PRZA 2VSYA 2R5SA 2IOLA 1BPOA 4C0EA 5EYLA 2R17C 3HVEB 3FUEA 3D9HA 4EECA 4GYWA 4U8VD 1TNBA 4XI9A 3T5XA 3UINC 4DX6D 4EQFA 1FT1A 1JCQA 4YDYA 4APOA 1G3NB 3ASFA 3DRAA 2RFMA 5EILA 1MHQA 4KYOB 3ZYQA 3CVVA 3S7DA 3D9MA 2J09A 3V2XA 4CDMA 2B0OE 1BLXB 3VLDA 5FZQA 5ENSD 3CV0A 2IJGX 2LNIA 4EZKA 4ANUA 4JXTA 3TWXA 2C0LA 3S2AA 3RJVA 2CG3A 2Y4UA 5BT1A 5JMND 1JWFA 3RRMB 2RFAA 4HQDA 3MEKA 2PQRA 3NBNB 4AY6A 4XIFA 2PM7A 4ILHB 2LAIA 3CR3A 3UIOC 3SFZA 3SNXA 5ARFA 3UXGA 1S70B 1HZ4A 2V4LA 3LY9A 5FQ4A 5ENNA 4EZJA 1N4RA 1UW4B 2WXHA 3C98A 4URKA 2XPIA 4GPKA 4KT6B 5E76A 1ZU2A 2DYRE 1BI7B 3T9KA 4U7EB 4XX5A 2Y3AA 4YNDA 3P1UA 4WNDA 3O4ZA 2J4BA 3G2TA 3WXXA 4LERA 2UY1B 4LEUA 5KCMA 5JA4D 4A3VA 3CVWA 3CGHA 4KXKB 3Q49B 5LX8A 3E34A 5EKQD 3CKBA 1OCRE 3ESLA 4F7AA 3FU0A 1HE8A 4GTVA 4RG9A 3VTYA 4GTMA 4YVQC 4MBGA 1N52A 3CSFA 4LRZA 1UOHA 1TEZA 3VTXA 2MOWA 3L54A 5T8IA 3TJPA 2XZDG 2OCCE 2PM6A 3RO2A 1RZ4A 5J90A 4UWFA 5ENTD 3QWVA 4RVBA 2A5UA 3AG1E 2FO1E 2XGOA 3IEGA 3U3WA 1LD7A 4R7LA 5FQ7A 4GTOA 3JQ0A 3SGHA 2YHEA 3ZYKA 4Q94A 3B7BA 4AVXA 4X8QA 4FLBA 3CVNA 4XE0A 5A7DB 3S7BA 1A17A 1FVHA 4F3VA 4N3BA 1ZBPA 3OXFA 4BETA 2L6JA 2WXMA 1B89A 4V3IA 1E8WA 2ZIRA 3UQ3A 3LCAA 4OYSA 1E90A 2V5QC 1O5MA 3UIPC 2DCPA 1H2TC 4OAVB 4HOUA 3R9MA 2ZU6B 3AJIA 2IY0C 4TV3A 5AYWD 4BFRA 2OEVA 2KBXA 2IO2C 3AS8A 4FULA 1AWCB 1N4QA 1QZ2A 4DI4A 4U04A 2F8YA 4A55A 3TWWA 2AW6A 4Y6CA 3FU5A 1K1BA 1OWLA 4G2VA 1OWOA 2CHXA 3DPDA 3LJNA 4B94A 2OVFA 2WQHA 2DVWA 4E6HA 3CHOA 2R59A 5FTPA 1UJJA 2ZXWE 2I1KA 3DBSA 2VGXA 3QWWA 4YDWA 2IOSA 3EU5A 2WQ6A 2KM4A 3PREA 2WXRA 2FBNA 3UM3A 1PY1A 1ELRA 3V79K 1OCOE 1X81A 3FH5A 3B7RL 3P2BA 3AS5A 3UM1A 1YYHA 1HH8A 3QB2A 3TL5A 3LPZA 2E2EA 3TXNA 4M3OA 5DIZA 2KZTA 4FA6A 1D8EA 2VJ8A 4UUCA 4HI8A 4FJZA 5BNWA 1E8XA 1UJKA 2LAHA 4G26A 4UQXA 3B13A 4U0SA 4KVOA 1OWMA 4UI9C 4B8AA 3T8KA 1D8DA 4JPSA 4KZCA 3RRNB 5AIJA 4EBAG 1OUVA 2XZTG 3FULA 4HRNA 4JEHA 4JC8A 4UI9J 2AXUA 4I6JA 2EQXA 4DPRA 2QC9A 3I3NA 3PE4A 1MYOA 4AP2A 1N9AA 5KWDA 2XGSA 4ANVA 1DC2A 4O60A 4JL0A 3ONKA 4F1SA 5BW8C 4CT0A 3TWQA 3HXDA 2E0IA 2VGYA 3AG4E 3L08A 4DLQA 3PEUB 2WXIA 1H6KA 1E7VA 1H2VC 2M63A 2Y4TA 2EIKE 1IQRA 2GRPB 3SO8A 2H6IA 2KC7A 5BV0A 4CRWA 4FHJA 2UWJG 2PNNA 3NB2A 2R05A 3JQ1A 1K3ZD 4FHKA 4AEZC 4CEMA 4BWRA 4GTRA 3SFXA 2V0PA 3CEQA 3K9IA 4AV7A 5FT9A 4J8EA 3ZU7B 1UN8A 4DX7D 2MYOA 3IKOB 3ZHEA 3ZUVB 3DXKG 3MV2B 1NA0A 3HDXA 5JJ6A 1SVXA 4I17A 4B89A 4AY5A 1MQSA 2VSOE 3C72A 3RSEG 4XKBA 3ZYMA 4ANWA 3I5PA 4KBQA 4UI9K 2BF0X 4CYMD 3E4BA 5ANRA 4ZHBA 2ETBA 4IRUA 1INZA 4UWKA 5AQ9A 2WB2A 5CEAA 2DYSE 3ABLE 3EDTB 4DUIA 2JLBA 3SBSA 5H7PA 1SZ9A 2RD0A 3FUMA 2QZAA 4OAUC 5CHEE 3RAUA 2V5FA 4QFVA 3W9GA 3GYZA 5KJMA 5ARGA 5G05J 2QY7A 1NA3A 1RW2A 1MZCA 4JVSA 1Y8MA 3Q9UC 2GRMA 3ZN3A 2VYIA 2PZIA 1NZNA 2P9UG 4D10C 3WG7E 2GW1A 1HO8A 4Q96A 1QYMA 3ISMC 4RQIA 2AXZA 4ILIA 5CBNA 3FUFA 4C9BB 3URZA 3ZKJA 3TG4A 3KD7A 3RIBA 2OOEA 1H6OA 3PE3A 4B93B 1O1RA 5FZSA 3L9TA 4TUUA 3ULEG 4G1TA 3FFLA 2BEDA 3UT7A 2GRQB 4JA7A 3MCXA 2V8SE 3Q75A 3PZ2A 5CEDB 1BI8B 2F8XK 2GGFA 3G2WA 1H2UA 2WPVA 3LY7A 3NF1A 5CCMA 1WM5A 4I2WA 2IO3C 3MX3A 1JWGA 3QOUA 4HLEA 3D9LA 3UMVA 2J07A 3FUNA 3G2SA 4YDOA 4ATGA 4U8YD 3FY4A 2XENA 1PC2A 4J8SA 4GA0A 3F6QA 5ENQD 4TXPA 2GRRB 4U8HA 2EINE 4XI0A 3CK7A 2CFUA 3PH0C 3CIAA 3DEPA 3FTYA 2I1JA 2JABA 1DCQA 4F6RD 2HYZA 3UPVA 4EZLA 1EDUA 3E33A 2XCCA 2WM9A 1LF8A 4MS6A 3ASOE 3JXIA 4CDRA 4BT9A 5ENOD 4GAAA 5AQ7A 2IF4A 3UUXA 3CQGB 2ETCA 3D3MA 4LNGA 1TNUA 4UWHA 5KJLA 1IXVA 2CG2A 3HXBA 1V55E 3LVRE 5IY5E 2NC9A 1N11A 5JHBA 4I6GA 3ZHEB 1O1TA 4LUNU 3L13A 4N3CA 4LCTA 2WXGA 3DSSA 3RO3A 4L2YA 3UTMA 5CMYA 4N2SA 4K0RA 3CSTA 5AJLA 3L82A 1HG5A 3FP3A 4DI3A 3KS2A 3C3QA 4A3TA 2FEZA 4NACA 4GZ5A 3SD5A 5FIOA 3E32A 2P9IG 1Z3XA 4MKTA 3CVPA 2WXLA 4U95D 4OVVA 2KCKA 2VGEA 3NZUA 2OV8A 5KJKA 2EILE 3RU0A 5CRUA 3SF4A 2WXJA 3SFYA 4AJWA 3C5RA 1U2VG 3PUJA 3OXGA 2XS1A 4AM9A 3KSQA 4K5BA 3VLFA 2B6CA 2I9CA 5CMWA 2BKKB 3EIQC 1EPUA 3DXMG 3RRUA 4AXHA 3CHMA 2BUGA 5FQ8A 5BPPA 1Z3YA 2AXVA 2P9NG 3TXMA 3RK6A 4RSYA 3Q15A 2P2CP 1QNFA 4U07A 2XCBA 2X6IA 4HVBA 2OEWA 3UI2A 2PQNA 3D9PA 3G2VA 3ABME 3HIZA 4U96D 3BEEA 3LXUX 4HI9A 4DK5A 4EHMA 3FEXA 2Y69E 1TN7A 2YINA 3C3OA 2NYJA 3KEAA 1TN8A 1GW6A 4J8FA 5G04C 1Z6TA 3PZ3A 3AS4A 4JD2G 4HOSA 4BY6A 3FUDA 4TXQA 4I1OB 1FT2A 3EHMA 1E96B 3HYMB 1S64A 5BUZA 2LUHA 4HB5A 5CERB 2DWZA 3MYVA 2L0IA 5LCWJ 2WXOA 3U66A 5G04J 3HXEA 1FPPA 4GYOA 3UM0A 2VSXE 2J4DA 4CZ2D 3EU9A 3CHSA 1MX4A 4JW1A 4BESA 3AU5A 2EIJE 2X6KA 3UM2A 3VLEA 3QAQA 1SW6A 1TN6A 4F53A 5T4YA 3E30A 1WG0A 3NOGD 3EHRA 4B0ZA 3FUJA 3LKUA 3BU8A 4XKCA 2XGMA 1DCEA 4HBDA 4FP7A 3R7RA 1NL4A 2EIME 2BKGA 2CFZA 3I4RB 2GRNB 2F0YA 1H0AA 3HG0D 4GMRA 2HO1A 2JEKA 5FINA 5ITZF 1E7UA 4I9EA 5A6CA 2WXQA 2LO6A 2LXLA 5CBOA 3D9KA 4A63B 3UT8A 1JPLA 2C2LA 2DBAA 4NURA 5AN8A 3TWTA 1LTXA 1K1AA 3JUEA 4U0UA 3QDNA 2KCLA 3SY2A 5KBAA 1IHGA 3LDZA 2ETAA 4UWLA 4HXIA 4AIFA 4O1OA 5KNHD 3ABKE 4FLHA 3QNKA 3LYAA 3LJ3A 2P9SG 1TNYA 1XGWA 4KVMA 5KNGA 4BTAA 1HU3A 2YHCA 4GTPA 3PS6A 2FF4A 3J5QB 4UQYA 2QYUA 4P29A 4I2ZA 4J8YA 3CK8A 3KEZA 2I2OA 3DPYA 3DSWA 4L7TA 3HVEA 1OCZE 3TWUA 4DLOA 4QQIA 4PUCA 2WXPA 3FH7A 5D0OD 2OVBA 3Q7FA 3FTVA 4N2QA 4G25A 4L2LA 3SI5A 2A5EA 1FCHA 1QBQA 4PH4B 2BTDA 3ZW3A 1YCSB 3AAAC 3FTWA 3S7JA 3L6AA 4YDEA 3HXCA 4H7YA 1OCCE 3JYSA 1L5JA 4I1MA 2YQ8A 3ZRHA 3PNLB 3GW4A 3U4TA 2X6JA 4G23A 2ONDA 2FULA 3ASNE 3PEVB 4N3AA 1KZPA 4BERA 2LSVA 2DZNA 4O1PA 3ASDA 3AG3E 5G55A 4GCOA 2XEHA 3Q79A 1D9SA 2UY1A 1AP7A 5G2NA 3MKQA 3L17A 3GZ2A 4CGVA 4UQZA 2VGXB 3GZSA 4DRXE 4HLLA 3ZGQA 4KMOA 3APCA 2WXFA 4GZDA 3HXFA 5FQ6A 5G05C 3ZPJA 3S7FA 4J0UA 3ULYA 3NAWA 3FTSA 4PS8A 4A1SA 4E85A 1N54A 2P58C 3PZDA 1NI1A 3ZYLA 1Q2ZA 2ZISA 4XZ4A 3QC1A 3QWPA 3PDNA 3ENEA 4GZ6A 2FI7A 1TNZA 1SA4A 3SQVA 4I43A 3IXEA 5EIDA 4O6FA 4NRHB 2KZTB 3FUHA 4CT4A 2RKKA 3IHVA 2QFCA 1NFIE 3FDHA 4B8CB 1U3CA 1SZAA 1K8KG 4CCAA 2L0TB 4K5AB 2X38A 3Q7AA 2F37A 2AVPA 5HI7A 5CCLA 4A1GA 3ZFWA 4C0MA 4JHKA 1NP7A 3KSLA 3ZNGA 1E8YA 3EHNA 3QK0A 3D9JA 2WVIA 2MHKA 2X3MA 4HRLA 5AJDA 4LSZE 4G8KA 5D66A 1TJFA 3FUKA 3Q4AB 3Q47B 3EIJA 5ANLA 4GZ3A 1KT0A 4K03A 4ZFHA 1YA0A 5CECB 3TG5A 3U64A 4M7CA 4KZ0A 3LEWA 2XPYA 2J9QA 1TNOA 4I9CA 1JCRA 3Q73A 2DIWA 1LD8A 3PZ1A 2J49A 3CK9A 5A23A 3PVLA 3ZXPA 1ELKA 1H6PA 2HE0A 3Q78A 3GZ1A 4HS2A 5HKPA 1N0RA 3CQCB 4BTBA 2H6GA 4GTSA 2P9LG 3J5PA 2IU1A 3DSUA 2WMNA 4Q69A 1HG2A 2L9BA 3LY8A 5C1DA 2IONA 3DSXA 3FHEA 2VQ2A 3UX4A 1EF1C 3T8MA 5AQBA 2XRYA 4WWNA 1O1SA 3ZXSA 2QYJA 2HM8A 3JUIA 4ABNA 1UG3A 3B7SA 3CVLA 3Q9NC 3LS8A 4FJYA 4GCNA 5E75A 3ZIMA 2Q7FA 3CVXA 3ASGA 4ANXA 3BG1B 5M72A 4BX9A 3NQPA 5HQ8A 3E37A 1E8ZA 3L16A 1TR4A 1HFAA 4NIKA 1SA5A 3HRAA 4H7XA 4WNFA 3FEYA 4N5QA 4FU3A 4APFA 3MKQB 1VDYA 4WNGA 4ILGA 3DWLG 2GROB 2HR2A 5AQAA 2XEEA 4HORA 4RG6A 2X6FA 4PS3A 4YVOA 4WAFA 2I6HA 1FVFA 4GA1A 3CVUA 4DX5D 3BUAA 4LNUD 3B7UX 4HOQA 1HXIA 4L1BA 1Z5SC 3TWRA 2AJAA 5CRVA 3AG2E 3N71A 1HF8A 2IEJA 1HX8A 1BD8A 1N0QA 4CGWA 5JJ7A 3MKRA 5FWQA 1A5EA 3G2UA 5LP0A 2L6BA 4LG6A 4TXRA 2P9PG 3EJNA 2CHWA 1TJCA 1N4SA 4Y6WA 5HRYA 4IN3B 5C2YA 4I1AA 1N95A 5B1BE 2IFUA 3I4GA 4BEPA 5EDSA 5BV1A 4ATZD 3TGOA 1JUQA 3APFA 4FADA 4GPMA 3HHMA 4EBAA 2A4ZA 2XRZA 2AWIA 3UT4A 5LCWC 5JJTA 4ACKA 1OWPA 3ULQA 1OY3D 4J7WA 4G11A 5EN5D 3FTUA 5D0QD 4L23A 5JHAA 2YNQA 3NOCD 3KAEA 4HOTA 2FO7A 3BG0B 2KATA 3CKCA 4RLYA 3L22A 1DVPA 4ME2A 1BU9A 2VTBA 4CDNA 3CVYA 3ASHA 4WWPA 5KJNA 4PDXA 3APDA 3CHRA 2WXKA 4GYYA 5EYPF 4JEUA 4BX8A 3MV3B 3EHQA 3NZSA 3JCKC 1N4PA 2ZGGA 1IQUA 1W3BA 3D9NA 5T3RA 5DBKA 1U3DA 3R9AB 1KZOA 3ZVVA 1IYGA 4G8LA 1P5QA 4IULA 5ENRD 2R02A 1WY6A 3V31A 2GRLA 1H19A 5B1AE 3UKRG 3AU4A 3TWVA 2J08A 4PS7A 3X2QE 5LFAA 1IKND 3IBEA 3OTNA 3U9WA 4U0ZA 3JXJA 3ONLA 5HS0A 3D9OA 1XNFA 3MJWA 2LSUA 3DSTA 1MX2A 4AOFA 2R2LA 1X5BA 5FZRA 3D9IA 4UWGA 2WQ7A 4OVUA 5B3SE 4N5CA 3TWSA 5BXUA 3SZ7A 1Y6IA 3MA5A 4Z68A 2H6FA 3OXLA 1MJ0A 3B95A 4GMJA 2RG8A 3ML8A 4I6EA 4F1PA 3PUKA 5D2MC 2KXPC 1JCSA 4G24A 5EX0A 4J8DA 3CVQA 4BSXA 1YMPA 2ILRA 3SHFA 2PL2A 1S0PA 3MZLB 3UKUG 1N94A 1OT8A 2XPZA 3SBTB 3FTZA 3CHPA 3FWVA 3BQOA 1ZB1A 2DZOA 4GU5A 3B7TA 4WNEA 2NXPA 4JB8P 1S63A 4TUMA 2V4HC 3FUIA 5ENPD 5EX3A 3IV0A 4GA2A 4C48B 5J08A 1PAQA 2VSNA 2XQ0A 2C0MA 3R7QA 4W9RA 5LOZA 4GTQA 5AARA 2XS8A 2LXMA 2XHEA 4XEIG 3MGBA 5FJYA 1SQMA 1DNPA 2J8SD 4WUYA 4LNBA 5EIBE 3PZ4A 4K5CA 3QJZA 3FU6A 1KPSB 4GTTA 4HNAD 1EYHA 4DX2A 4N39A 4JHJA 4U63A 2P9KG 1IHBA 4EPZA 3V2OA 2X6HA 3RKVA 2WMOA 3CHQA 4WWOA 4FC8A 4MRUA 2VTBB 3QKYA 1MX6A 2KCVA 4L9PA 2H6HA 2Y0BG 3DEOA 5BXOA
chains in the Genus database with same CATH topology
3D9PA 4NQ0A 3G2VA 2XRYA 3HIZA 4WWNA 3OAWA 4I6JA 3ZXSA 1ELWA 2HM8A 3JUIA 3BEEA 4ABNA 2EQXA 1UG3A 3LXUX 3ZEFA 3B7SA 3CVLA 2NSZA 3Q5MA 4DJAA 2WXNA 4DK5A 4DPRA 3FEXA 3I3NA 3T5VA 3PE4A 3LS8A 2IQCA 2YINA 4FJYA 1OWNA 4AP2A 3IHYA 1GW6A 3LVQE 4GCNA 1UN9A 1HS6A 5E75A 2XGSA 3ZIMA 3FTXA 4J8FA 4ANVA 5G04C 1Z6TA 3CLJA 2Q7FA 4JHRA 3AS4A 3CVXA 2CHZA 3ASGA 4ANXA 4HOSA 4BY6A 3FUDA 3QARA 3BG1B 4JL0A 5M72A 4I1OB 4BX9A 3O48A 3TAXA 3EHMA 1E96B 3ONKA 4GB9A 4GMLA 3ML9A 1QQEA 3NQPA 3PNTB 4JZYA 3HYMB 5HQ8A 5BUZA 4JA9A 1E8ZA 3L16A 4GZCA 4F1SA 5BW8C 3MYVA 2L0IA 4CT0A 5LCWJ 2WXOA 3U66A 4TRQA 5G04J 1HFAA 4BT8A 2E0IA 4GYOA 4H7XA 3ESKA 2VGYA 5AENA 4IYPA 4WNFA 3FEYA 1KLXA 2VSXE 3L08A 2J4DA 4DLQA 3PEUB 4FU3A 4APFA 3FU3A 3CHSA 2WXIA 1H6KA 1E7VA 1H2VC 4J6IA 3MKQB 2M63A 4HFGA 3FH8A 1WAO1 3AU5A 4JW1A 2Y4TA 4MLPA 1IQRA 1VDYA 2X6KA 4WNGA 4ACLA 1KT1A 3VLEA 4ILGA 3QAQA 2XEVA 4F53A 2HR2A 2KC7A 5T4YA 5BV0A 2MRIA 4CRWA 3PRZA 4HORA 2VSYA 4RG6A 4FHJA 2R5SA 2IOLA 4B0ZA 2UWJG 1BPOA 3FUJA 2X6FA 3LKUA 4PS3A 4YVOA 4WAFA 4C0EA 2I6HA 4XKCA 1FVFA 4GA1A 2XGMA 3CVUA 3JQ1A 2R17C 3HVEB 3FUEA 4FP7A 4FHKA 3R7RA 4AEZC 4CEMA 4BWRA 4EECA 4GYWA 3B7UX 2V0PA 3CEQA 4HOQA 4XI9A 3T5XA 1HXIA 4L1BA 2CFZA 3K9IA 3I4RB 4EQFA 4AV7A 1H0AA 4APOA 5FT9A 4J8EA 2HO1A 2JEKA 1UN8A 3N71A 1E7UA 3ASFA 4I9EA 1HF8A 5A6CA 1HX8A 4CGWA 2WXQA 2LO6A 3IKOB 3ZHEA 1MHQA 4KYOB 5JJ7A 3ZYQA 3CVVA 3S7DA 3MKRA 5FWQA 3D9KA 3MV2B 1NA0A 3D9MA 3HDXA 5JJ6A 2J09A 3UT8A 1JPLA 2C2LA 2DBAA 4NURA 4CDMA 4I17A 3VLDA 3G2UA 5FZQA 5LP0A 4B89A 4AY5A 3CV0A 2IJGX 4U0UA 2LNIA 3QDNA 4EZKA 1MQSA 4ANUA 3EJNA 2KCLA 2CHWA 2VSOE 1IHGA 4JXTA 3LDZA 1TJCA 4XKBA 3ZYMA 4UWLA 2C0LA 4ANWA 4HXIA 3I5PA 3RJVA 3S2AA 4AIFA 4FLHA 2CG3A 4KBQA 2Y4UA 2BF0X 4IN3B 4UI9K 3QNKA 3LYAA 4Y6WA 5C2YA 5BT1A 3LJ3A 4I1AA 1JWFA 3RRMB 3E4BA 1XGWA 4KVMA 5ANRA 2IFUA 4BTAA 3MEKA 3I4GA 2PQRA 4AY6A 1HU3A 4XIFA 4IRUA 3UX4A 5EDSA 1INZA 2YHCA 4UWKA 2PM7A 5BV1A 3PS6A 4ILHB 2WB2A 2LAIA 2FF4A 4UQYA 3TGOA 1JUQA 3CR3A 3EDTB 3SFZA 3APFA 4FADA 3SNXA 2JLBA 5ARFA 3HHMA 4EBAA 2A4ZA 2XRZA 3SBSA 1HZ4A 4P29A 1SZ9A 2AWIA 2RD0A 2V4LA 3FUMA 3LY9A 4I2ZA 5FQ4A 3UT4A 5LCWC 5JJTA 4ACKA 3CK8A 5CHEE 3KEZA 1OWPA 2I2OA 4L7TA 3ULQA 3HVEA 5ENNA 4EZJA 4DLOA 1UW4B 2V5FA 4QFVA 2WXHA 4G11A 4PUCA 3C98A 3GYZA 4URKA 3FTUA 5D0QD 2XPIA 4L23A 5KJMA 4GPKA 5ARGA 4KT6B 2QY7A 5E76A 1NA3A 1ZU2A 5G05J 5JHAA 2WXPA 2YNQA 3FH7A 5D0OD 4JVSA 3KAEA 1Y8MA 4HOTA 2OVBA 2FO7A 3BG0B 3FTVA 2KATA 3CKCA 2GRMA 4N2QA 4G25A 4L2LA 4XX5A 3ZN3A 2VYIA 2Y3AA 2PZIA 3SI5A 4YNDA 1FCHA 1NZNA 3P1UA 4WNDA 4PH4B 3O4ZA 2BTDA 2J4BA 3G2TA 3WXXA 4LERA 4D10C 2UY1B 4LEUA 5KCMA 3ZW3A 3L22A 4A3VA 1DVPA 3CVWA 3CGHA 2GW1A 4KXKB 1HO8A 3Q49B 4ME2A 5LX8A 4Q96A 2VTBA 3FTWA 4CDNA 3CVYA 3ASHA 4WWPA 5EKQD 2AXZA 4ILIA 3CKBA 5KJNA 4PDXA 3ESLA 3FUFA 4C9BB 3APDA 3CHRA 2WXKA 3URZA 4GYYA 4F7AA 4JEUA 4BX8A 3FU0A 3TG4A 3MV3B 3L6AA 3NZSA 1HE8A 3JCKC 3S7JA 3KD7A 1IQUA 4H7YA 1W3BA 3RIBA 2OOEA 3D9NA 5T3RA 4RG9A 5DBKA 1U3DA 3JYSA 1L5JA 3PE3A 3R9AB 5FZSA 3VTYA 3ZVVA 4TUUA 1IYGA 1P5QA 4YVQC 4G1TA 3FFLA 4IULA 4I1MA 2YQ8A 1N52A 3CSFA 3ZRHA 4LRZA 1TEZA 3UT7A 3VTXA 3PNLB 1WY6A 3MCXA 2V8SE 4JA7A 2MOWA 3GW4A 3U4TA 2GRLA 1H19A 3L54A 5T8IA 2X6JA 3AU4A 3TJPA 2J08A 2PM6A 2GGFA 3RO2A 4PS7A 4G23A 5LFAA 3G2WA 2ONDA 1H2UA 5J90A 2FULA 3IBEA 3OTNA 4UWFA 3U9WA 3PEVB 2WPVA 4U0ZA 3LY7A 3QWVA 4RVBA 2A5UA 4N3AA 3ONLA 3NF1A 5CCMA 3D9OA 1XNFA 1WM5A 2XGOA 2LSUA 3IEGA 3MJWA 4I2WA 3U3WA 3MX3A 1JWGA 3QOUA 2LSVA 4AOFA 4HLEA 3D9LA 1X5BA 4R7LA 5FQ7A 5FZRA 3ASDA 3UMVA 2J07A 3D9IA 3FUNA 3G2SA 3JQ0A 4UWGA 3SGHA 2YHEA 5G55A 3ZYKA 2WQ7A 4GCOA 4OVUA 4Q94A 4ATGA 3FY4A 4AVXA 2UY1A 1PC2A 4J8SA 5G2NA 4FLBA 3MKQA 3CVNA 3L17A 3GZ2A 4N5CA 4XE0A 4CGVA 4GA0A 4UQZA 3SZ7A 5A7DB 3S7BA 1A17A 1FVHA 1Y6IA 4F3VA 4N3BA 3MA5A 1ZBPA 4U8HA 2VGXB 3GZSA 3OXFA 4XI0A 2L6JA 2WXMA 1B89A 3ZGQA 4KMOA 3OXLA 3APCA 2CFUA 3CK7A 2WXFA 3PH0C 3CIAA 4GMJA 4GZDA 3FTYA 4V3IA 1E8WA 2I1JA 2RG8A 5FQ6A 5G05C 3UQ3A 3ZPJA 2HYZA 3ML8A 3UPVA 3S7FA 4EZLA 4J0UA 3LCAA 4I6EA 1EDUA 3FTSA 4OYSA 1E90A 4PS8A 2XCCA 3PUKA 1N54A 1LF8A 2P58C 2WM9A 3PZDA 4MS6A 4A1SA 4E85A 3ZYLA 4CDRA 4G24A 3QK0A 5EX0A 4XZ4A 4BT9A 2DCPA 1H2TC 4J8DA 3QC1A 4GAAA 4HOUA 2IF4A 3CVQA 4BSXA 3QWPA 2ZU6B 3PDNA 3ENEA 3UUXA 2ILRA 4GZ6A 3SHFA 2FI7A 3CQGB 2PL2A 4TV3A 1S0PA 3MZLB 5AYWD 4BFRA 3D3MA 4I43A 2XPZA 3AS8A 4UWHA 4FULA 4O6FA 4NRHB 2KZTB 5KJLA 3FUHA 3SBTB 1QZ2A 4DI4A 2CG2A 3FTZA 4U04A 4CT4A 3LVRE 3CHPA 3FWVA 4A55A 2NC9A 3IHVA 5JHBA 4GU5A 2AW6A 4Y6CA 4I6GA 3B7TA 3ZHEB 2QFCA 4LUNU 4WNEA 2NXPA 3FDHA 3FU5A 3L13A 4N3CA 4B8CB 1U3CA 1OWLA 4LCTA 1SZAA 4G2VA 2WXGA 4CCAA 1OWOA 2CHXA 3DPDA 3FUIA 3RO3A 4B94A 2L0TB 4L2YA 5CMYA 2OVFA 2X38A 4N2SA 5EX3A 3IV0A 2WQHA 4E6HA 4GA2A 4K0RA 2AVPA 3CSTA 5AJLA 5HI7A 5J08A 1PAQA 1HG5A 3CHOA 3FP3A 5CCLA 4A1GA 4DI3A 2VSNA 3KS2A 4A3TA 3ZFWA 2FEZA 4NACA 4GZ5A 2R59A 2XQ0A 5FTPA 3SD5A 4C0MA 4JHKA 1NP7A 1UJJA 1E8YA 1Z3XA 2I1KA 2C0MA 3D9JA 3DBSA 2VGXA 2WVIA 3EHNA 2MHKA 3CVPA 2WXLA 4MKTA 2X3MA 3QWWA 5AJDA 3R7QA 4W9RA 5LOZA 4OVVA 1TJFA 3FUKA 3Q4AB 2IOSA 2KCKA 3Q47B 3EIJA 5ANLA 4GZ3A 1KT0A 3NZUA 2WQ6A 2KM4A 4K03A 2OV8A 5KJKA 1YA0A 2XHEA 3PREA 3RU0A 3SF4A 3MGBA 5FJYA 2WXJA 3TG5A 1SQMA 2WXRA 2FBNA 3U64A 1DNPA 4AJWA 1PY1A 1ELRA 4KZ0A 3LEWA 4WUYA 2XPYA 2J9QA 3PUJA 3OXGA 3FH5A 3B7RL 4I9CA 3P2BA 3AS5A 3QJZA 2DIWA 3FU6A 4AM9A 1HH8A 3QB2A 2J49A 3CK9A 3LPZA 3TL5A 5A23A 1EYHA 3PVLA 1ELKA 2E2EA 3TXNA 4M3OA 5DIZA 2KZTA 4FA6A 4N39A 2VJ8A 3VLFA 3GZ1A 4FJZA 4HS2A 5BNWA 2I9CA 1E8XA 1UJKA 2LAHA 4JHJA 4U63A 5CMWA 4G26A 3CQCB 3EIQC 1EPUA 4EPZA 4UQXA 3B13A 4BTBA 3RRUA 4AXHA 2X6HA 4U0SA 3CHMA 2BUGA 3RKVA 2WMOA 4KVOA 5FQ8A 1EF1C 1OWMA 2IU1A 5BPPA 4UI9C 1Z3YA 2AXVA 3CHQA 4B8AA 4WWOA 2WMNA 3RK6A 3TXMA 4Q69A 4FC8A 4MRUA 4RSYA 2VTBB 3QKYA 3Q15A 4JPSA 1HG2A 2L9BA 4KZCA 1QNFA 3LY8A 3RRNB 5AIJA 4U07A 4EBAG 5C1DA 1OUVA 2KCVA 3FULA 2XCBA 2X6IA 4JEHA 4JC8A 4UI9J 4HVBA 2IONA 2AXUA 3FHEA 2VQ2A 3T8MA 2PQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JCK C;  3TXN A;  3TXM A;  3CHM A;  3T5X A;  2MRI A;  4D10 C;  4LCT A; 
#chains in the Genus database with same CATH topology
 4NQ0 A;  3OAW A;  1ELW A;  4DJA A;  3ZEF A;  3Q5M A;  2NSZ A;  2WXN A;  3T5V A;  2IQC A;  1OWN A;  3IHY A;  3LVQ E;  1UN9 A;  1HS6 A;  3FTX A;  3CLJ A;  4JHR A;  4HRM B;  2CHZ A;  2ZGD A;  5AAO A;  3QAR A;  3O48 A;  3TAX A;  4GB9 A;  4GML A;  3ML9 A;  1QQE A;  3PNT B;  4JZY A;  4JA9 A;  4DX1 A;  4GZC A;  4TRQ A;  3W9F A;  1V54 E;  4BT8 A;  3V30 A;  3ESK A;  5AEN A;  4IYP A;  1KLX A;  2Y1L E;  1TYQ G;  1WDY A;  3FU3 A;  4J6I A;  3C3R A;  4HFG A;  3FH8 A;  1WAO 1;  4MLP A;  3DSV A;  4ACL A;  1KT1 A;  1OXJ A;  4BSZ B;  2XEV A;  3EUV A;  2MRI A;  2R03 A;  3PRZ A;  2VSY A;  2R5S A;  2IOL A;  1BPO A;  4C0E A;  5EYL A;  2R17 C;  3HVE B;  3FUE A;  3D9H A;  4EEC A;  4GYW A;  4U8V D;  1TNB A;  4XI9 A;  3T5X A;  3UIN C;  4DX6 D;  4EQF A;  1FT1 A;  1JCQ A;  4YDY A;  4APO A;  1G3N B;  3ASF A;  3DRA A;  2RFM A;  5EIL A;  1MHQ A;  4KYO B;  3ZYQ A;  3CVV A;  3S7D A;  3D9M A;  2J09 A;  3V2X A;  4CDM A;  2B0O E;  1BLX B;  3VLD A;  5FZQ A;  5ENS D;  3CV0 A;  2IJG X;  2LNI A;  4EZK A;  4ANU A;  4JXT A;  3TWX A;  2C0L A;  3S2A A;  3RJV A;  2CG3 A;  2Y4U A;  5BT1 A;  5JMN D;  1JWF A;  3RRM B;  2RFA A;  4HQD A;  3MEK A;  2PQR A;  3NBN B;  4AY6 A;  4XIF A;  2PM7 A;  4ILH B;  2LAI A;  3CR3 A;  3UIO C;  3SFZ A;  3SNX A;  5ARF A;  3UXG A;  1S70 B;  1HZ4 A;  2V4L A;  3LY9 A;  5FQ4 A;  5ENN A;  4EZJ A;  1N4R A;  1UW4 B;  2WXH A;  3C98 A;  4URK A;  2XPI A;  4GPK A;  4KT6 B;  5E76 A;  1ZU2 A;  2DYR E;  1BI7 B;  3T9K A;  4U7E B;  4XX5 A;  2Y3A A;  4YND A;  3P1U A;  4WND A;  3O4Z A;  2J4B A;  3G2T A;  3WXX A;  4LER A;  2UY1 B;  4LEU A;  5KCM A;  5JA4 D;  4A3V A;  3CVW A;  3CGH A;  4KXK B;  3Q49 B;  5LX8 A;  3E34 A;  5EKQ D;  3CKB A;  1OCR E;  3ESL A;  4F7A A;  3FU0 A;  1HE8 A;  4GTV A;  4RG9 A;  3VTY A;  4GTM A;  4YVQ C;  4MBG A;  1N52 A;  3CSF A;  4LRZ A;  1UOH A;  1TEZ A;  3VTX A;  2MOW A;  3L54 A;  5T8I A;  3TJP A;  2XZD G;  2OCC E;  2PM6 A;  3RO2 A;  1RZ4 A;  5J90 A;  4UWF A;  5ENT D;  3QWV A;  4RVB A;  2A5U A;  3AG1 E;  2FO1 E;  2XGO A;  3IEG A;  3U3W A;  1LD7 A;  4R7L A;  5FQ7 A;  4GTO A;  3JQ0 A;  3SGH A;  2YHE A;  3ZYK A;  4Q94 A;  3B7B A;  4AVX A;  4X8Q A;  4FLB A;  3CVN A;  4XE0 A;  5A7D B;  3S7B A;  1A17 A;  1FVH A;  4F3V A;  4N3B A;  1ZBP A;  3OXF A;  4BET A;  2L6J A;  2WXM A;  1B89 A;  4V3I A;  1E8W A;  2ZIR A;  3UQ3 A;  3LCA A;  4OYS A;  1E90 A;  2V5Q C;  1O5M A;  3UIP C;  2DCP A;  1H2T C;  4OAV B;  4HOU A;  3R9M A;  2ZU6 B;  3AJI A;  2IY0 C;  4TV3 A;  5AYW D;  4BFR A;  2OEV A;  2KBX A;  2IO2 C;  3AS8 A;  4FUL A;  1AWC B;  1N4Q A;  1QZ2 A;  4DI4 A;  4U04 A;  2F8Y A;  4A55 A;  3TWW A;  2AW6 A;  4Y6C A;  3FU5 A;  1K1B A;  1OWL A;  4G2V A;  1OWO A;  2CHX A;  3DPD A;  3LJN A;  4B94 A;  2OVF A;  2WQH A;  2DVW A;  4E6H A;  3CHO A;  2R59 A;  5FTP A;  1UJJ A;  2ZXW E;  2I1K A;  3DBS A;  2VGX A;  3QWW A;  4YDW A;  2IOS A;  3EU5 A;  2WQ6 A;  2KM4 A;  3PRE A;  2WXR A;  2FBN A;  3UM3 A;  1PY1 A;  1ELR A;  3V79 K;  1OCO E;  1X81 A;  3FH5 A;  3B7R L;  3P2B A;  3AS5 A;  3UM1 A;  1YYH A;  1HH8 A;  3QB2 A;  3TL5 A;  3LPZ A;  2E2E A;  3TXN A;  4M3O A;  5DIZ A;  2KZT A;  4FA6 A;  1D8E A;  2VJ8 A;  4UUC A;  4HI8 A;  4FJZ A;  5BNW A;  1E8X A;  1UJK A;  2LAH A;  4G26 A;  4UQX A;  3B13 A;  4U0S A;  4KVO A;  1OWM A;  4UI9 C;  4B8A A;  3T8K A;  1D8D A;  4JPS A;  4KZC A;  3RRN B;  5AIJ A;  4EBA G;  1OUV A;  2XZT G;  3FUL A;  4HRN A;  4JEH A;  4JC8 A;  4UI9 J;  2AXU A;  4I6J A;  2EQX A;  4DPR A;  2QC9 A;  3I3N A;  3PE4 A;  1MYO A;  4AP2 A;  1N9A A;  5KWD A;  2XGS A;  4ANV A;  1DC2 A;  4O60 A;  4JL0 A;  3ONK A;  4F1S A;  5BW8 C;  4CT0 A;  3TWQ A;  3HXD A;  2E0I A;  2VGY A;  3AG4 E;  3L08 A;  4DLQ A;  3PEU B;  2WXI A;  1H6K A;  1E7V A;  1H2V C;  2M63 A;  2Y4T A;  2EIK E;  1IQR A;  2GRP B;  3SO8 A;  2H6I A;  2KC7 A;  5BV0 A;  4CRW A;  4FHJ A;  2UWJ G;  2PNN A;  3NB2 A;  2R05 A;  3JQ1 A;  1K3Z D;  4FHK A;  4AEZ C;  4CEM A;  4BWR A;  4GTR A;  3SFX A;  2V0P A;  3CEQ A;  3K9I A;  4AV7 A;  5FT9 A;  4J8E A;  3ZU7 B;  1UN8 A;  4DX7 D;  2MYO A;  3IKO B;  3ZHE A;  3ZUV B;  3DXK G;  3MV2 B;  1NA0 A;  3HDX A;  5JJ6 A;  1SVX A;  4I17 A;  4B89 A;  4AY5 A;  1MQS A;  2VSO E;  3C72 A;  3RSE G;  4XKB A;  3ZYM A;  4ANW A;  3I5P A;  4KBQ A;  4UI9 K;  2BF0 X;  4CYM D;  3E4B A;  5ANR A;  4ZHB A;  2ETB A;  4IRU A;  1INZ A;  4UWK A;  5AQ9 A;  2WB2 A;  5CEA A;  2DYS E;  3ABL E;  3EDT B;  4DUI A;  2JLB A;  3SBS A;  5H7P A;  1SZ9 A;  2RD0 A;  3FUM A;  2QZA A;  4OAU C;  5CHE E;  3RAU A;  2V5F A;  4QFV A;  3W9G A;  3GYZ A;  5KJM A;  5ARG A;  5G05 J;  2QY7 A;  1NA3 A;  1RW2 A;  1MZC A;  4JVS A;  1Y8M A;  3Q9U C;  2GRM A;  3ZN3 A;  2VYI A;  2PZI A;  1NZN A;  2P9U G;  4D10 C;  3WG7 E;  2GW1 A;  1HO8 A;  4Q96 A;  1QYM A;  3ISM C;  4RQI A;  2AXZ A;  4ILI A;  5CBN A;  3FUF A;  4C9B B;  3URZ A;  3ZKJ A;  3TG4 A;  3KD7 A;  3RIB A;  2OOE A;  1H6O A;  3PE3 A;  4B93 B;  1O1R A;  5FZS A;  3L9T A;  4TUU A;  3ULE G;  4G1T A;  3FFL A;  2BED A;  3UT7 A;  2GRQ B;  4JA7 A;  3MCX A;  2V8S E;  3Q75 A;  3PZ2 A;  5CED B;  1BI8 B;  2F8X K;  2GGF A;  3G2W A;  1H2U A;  2WPV A;  3LY7 A;  3NF1 A;  5CCM A;  1WM5 A;  4I2W A;  2IO3 C;  3MX3 A;  1JWG A;  3QOU A;  4HLE A;  3D9L A;  3UMV A;  2J07 A;  3FUN A;  3G2S A;  4YDO A;  4ATG A;  4U8Y D;  3FY4 A;  2XEN A;  1PC2 A;  4J8S A;  4GA0 A;  3F6Q A;  5ENQ D;  4TXP A;  2GRR B;  4U8H A;  2EIN E;  4XI0 A;  3CK7 A;  2CFU A;  3PH0 C;  3CIA A;  3DEP A;  3FTY A;  2I1J A;  2JAB A;  1DCQ A;  4F6R D;  2HYZ A;  3UPV A;  4EZL A;  1EDU A;  3E33 A;  2XCC A;  2WM9 A;  1LF8 A;  4MS6 A;  3ASO E;  3JXI A;  4CDR A;  4BT9 A;  5ENO D;  4GAA A;  5AQ7 A;  2IF4 A;  3UUX A;  3CQG B;  2ETC A;  3D3M A;  4LNG A;  1TNU A;  4UWH A;  5KJL A;  1IXV A;  2CG2 A;  3HXB A;  1V55 E;  3LVR E;  5IY5 E;  2NC9 A;  1N11 A;  5JHB A;  4I6G A;  3ZHE B;  1O1T A;  4LUN U;  3L13 A;  4N3C A;  4LCT A;  2WXG A;  3DSS A;  3RO3 A;  4L2Y A;  3UTM A;  5CMY A;  4N2S A;  4K0R A;  3CST A;  5AJL A;  3L82 A;  1HG5 A;  3FP3 A;  4DI3 A;  3KS2 A;  3C3Q A;  4A3T A;  2FEZ A;  4NAC A;  4GZ5 A;  3SD5 A;  5FIO A;  3E32 A;  2P9I G;  1Z3X A;  4MKT A;  3CVP A;  2WXL A;  4U95 D;  4OVV A;  2KCK A;  2VGE A;  3NZU A;  2OV8 A;  5KJK A;  2EIL E;  3RU0 A;  5CRU A;  3SF4 A;  2WXJ A;  3SFY A;  4AJW A;  3C5R A;  1U2V G;  3PUJ A;  3OXG A;  2XS1 A;  4AM9 A;  3KSQ A;  4K5B A;  3VLF A;  2B6C A;  2I9C A;  5CMW A;  2BKK B;  3EIQ C;  1EPU A;  3DXM G;  3RRU A;  4AXH A;  3CHM A;  2BUG A;  5FQ8 A;  5BPP A;  1Z3Y A;  2AXV A;  2P9N G;  3TXM A;  3RK6 A;  4RSY A;  3Q15 A;  2P2C P;  1QNF A;  4U07 A;  2XCB A;  2X6I A;  4HVB A;  2OEW A;  3UI2 A;  2PQN A;  3D9P A;  3G2V A;  3ABM E;  3HIZ A;  4U96 D;  3BEE A;  3LXU X;  4HI9 A;  4DK5 A;  4EHM A;  3FEX A;  2Y69 E;  1TN7 A;  2YIN A;  3C3O A;  2NYJ A;  3KEA A;  1TN8 A;  1GW6 A;  4J8F A;  5G04 C;  1Z6T A;  3PZ3 A;  3AS4 A;  4JD2 G;  4HOS A;  4BY6 A;  3FUD A;  4TXQ A;  4I1O B;  1FT2 A;  3EHM A;  1E96 B;  3HYM B;  1S64 A;  5BUZ A;  2LUH A;  4HB5 A;  5CER B;  2DWZ A;  3MYV A;  2L0I A;  5LCW J;  2WXO A;  3U66 A;  5G04 J;  3HXE A;  1FPP A;  4GYO A;  3UM0 A;  2VSX E;  2J4D A;  4CZ2 D;  3EU9 A;  3CHS A;  1MX4 A;  4JW1 A;  4BES A;  3AU5 A;  2EIJ E;  2X6K A;  3UM2 A;  3VLE A;  3QAQ A;  1SW6 A;  1TN6 A;  4F53 A;  5T4Y A;  3E30 A;  1WG0 A;  3NOG D;  3EHR A;  4B0Z A;  3FUJ A;  3LKU A;  3BU8 A;  4XKC A;  2XGM A;  1DCE A;  4HBD A;  4FP7 A;  3R7R A;  1NL4 A;  2EIM E;  2BKG A;  2CFZ A;  3I4R B;  2GRN B;  2F0Y A;  1H0A A;  3HG0 D;  4GMR A;  2HO1 A;  2JEK A;  5FIN A;  5ITZ F;  1E7U A;  4I9E A;  5A6C A;  2WXQ A;  2LO6 A;  2LXL A;  5CBO A;  3D9K A;  4A63 B;  3UT8 A;  1JPL A;  2C2L A;  2DBA A;  4NUR A;  5AN8 A;  3TWT A;  1LTX A;  1K1A A;  3JUE A;  4U0U A;  3QDN A;  2KCL A;  3SY2 A;  5KBA A;  1IHG A;  3LDZ A;  2ETA A;  4UWL A;  4HXI A;  4AIF A;  4O1O A;  5KNH D;  3ABK E;  4FLH A;  3QNK A;  3LYA A;  3LJ3 A;  2P9S G;  1TNY A;  1XGW A;  4KVM A;  5KNG A;  4BTA A;  1HU3 A;  2YHC A;  4GTP A;  3PS6 A;  2FF4 A;  3J5Q B;  4UQY A;  2QYU A;  4P29 A;  4I2Z A;  4J8Y A;  3CK8 A;  3KEZ A;  2I2O A;  3DPY A;  3DSW A;  4L7T A;  3HVE A;  1OCZ E;  3TWU A;  4DLO A;  4QQI A;  4PUC A;  2WXP A;  3FH7 A;  5D0O D;  2OVB A;  3Q7F A;  3FTV A;  4N2Q A;  4G25 A;  4L2L A;  3SI5 A;  2A5E A;  1FCH A;  1QBQ A;  4PH4 B;  2BTD A;  3ZW3 A;  1YCS B;  3AAA C;  3FTW A;  3S7J A;  3L6A A;  4YDE A;  3HXC A;  4H7Y A;  1OCC E;  3JYS A;  1L5J A;  4I1M A;  2YQ8 A;  3ZRH A;  3PNL B;  3GW4 A;  3U4T A;  2X6J A;  4G23 A;  2OND A;  2FUL A;  3ASN E;  3PEV B;  4N3A A;  1KZP A;  4BER A;  2LSV A;  2DZN A;  4O1P A;  3ASD A;  3AG3 E;  5G55 A;  4GCO A;  2XEH A;  3Q79 A;  1D9S A;  2UY1 A;  1AP7 A;  5G2N A;  3MKQ A;  3L17 A;  3GZ2 A;  4CGV A;  4UQZ A;  2VGX B;  3GZS A;  4DRX E;  4HLL A;  3ZGQ A;  4KMO A;  3APC A;  2WXF A;  4GZD A;  3HXF A;  5FQ6 A;  5G05 C;  3ZPJ A;  3S7F A;  4J0U A;  3ULY A;  3NAW A;  3FTS A;  4PS8 A;  4A1S A;  4E85 A;  1N54 A;  2P58 C;  3PZD A;  1NI1 A;  3ZYL A;  1Q2Z A;  2ZIS A;  4XZ4 A;  3QC1 A;  3QWP A;  3PDN A;  3ENE A;  4GZ6 A;  2FI7 A;  1TNZ A;  1SA4 A;  3SQV A;  4I43 A;  3IXE A;  5EID A;  4O6F A;  4NRH B;  2KZT B;  3FUH A;  4CT4 A;  2RKK A;  3IHV A;  2QFC A;  1NFI E;  3FDH A;  4B8C B;  1U3C A;  1SZA A;  1K8K G;  4CCA A;  2L0T B;  4K5A B;  2X38 A;  3Q7A A;  2F37 A;  2AVP A;  5HI7 A;  5CCL A;  4A1G A;  3ZFW A;  4C0M A;  4JHK A;  1NP7 A;  3KSL A;  3ZNG A;  1E8Y A;  3EHN A;  3QK0 A;  3D9J A;  2WVI A;  2MHK A;  2X3M A;  4HRL A;  5AJD A;  4LSZ E;  4G8K A;  5D66 A;  1TJF A;  3FUK A;  3Q4A B;  3Q47 B;  3EIJ A;  5ANL A;  4GZ3 A;  1KT0 A;  4K03 A;  4ZFH A;  1YA0 A;  5CEC B;  3TG5 A;  3U64 A;  4M7C A;  4KZ0 A;  3LEW A;  2XPY A;  2J9Q A;  1TNO A;  4I9C A;  1JCR A;  3Q73 A;  2DIW A;  1LD8 A;  3PZ1 A;  2J49 A;  3CK9 A;  5A23 A;  3PVL A;  3ZXP A;  1ELK A;  1H6P A;  2HE0 A;  3Q78 A;  3GZ1 A;  4HS2 A;  5HKP A;  1N0R A;  3CQC B;  4BTB A;  2H6G A;  4GTS A;  2P9L G;  3J5P A;  2IU1 A;  3DSU A;  2WMN A;  4Q69 A;  1HG2 A;  2L9B A;  3LY8 A;  5C1D A;  2ION A;  3DSX A;  3FHE A;  2VQ2 A;  3UX4 A;  1EF1 C;  3T8M A;  5AQB A;  2XRY A;  4WWN A;  1O1S A;  3ZXS A;  2QYJ A;  2HM8 A;  3JUI A;  4ABN A;  1UG3 A;  3B7S A;  3CVL A;  3Q9N C;  3LS8 A;  4FJY A;  4GCN A;  5E75 A;  3ZIM A;  2Q7F A;  3CVX A;  3ASG A;  4ANX A;  3BG1 B;  5M72 A;  4BX9 A;  3NQP A;  5HQ8 A;  3E37 A;  1E8Z A;  3L16 A;  1TR4 A;  1HFA A;  4NIK A;  1SA5 A;  3HRA A;  4H7X A;  4WNF A;  3FEY A;  4N5Q A;  4FU3 A;  4APF A;  3MKQ B;  1VDY A;  4WNG A;  4ILG A;  3DWL G;  2GRO B;  2HR2 A;  5AQA A;  2XEE A;  4HOR A;  4RG6 A;  2X6F A;  4PS3 A;  4YVO A;  4WAF A;  2I6H A;  1FVF A;  4GA1 A;  3CVU A;  4DX5 D;  3BUA A;  4LNU D;  3B7U X;  4HOQ A;  1HXI A;  4L1B A;  1Z5S C;  3TWR A;  2AJA A;  5CRV A;  3AG2 E;  3N71 A;  1HF8 A;  2IEJ A;  1HX8 A;  1BD8 A;  1N0Q A;  4CGW A;  5JJ7 A;  3MKR A;  5FWQ A;  1A5E A;  3G2U A;  5LP0 A;  2L6B A;  4LG6 A;  4TXR A;  2P9P G;  3EJN A;  2CHW A;  1TJC A;  1N4S A;  4Y6W A;  5HRY A;  4IN3 B;  5C2Y A;  4I1A A;  1N95 A;  5B1B E;  2IFU A;  3I4G A;  4BEP A;  5EDS A;  5BV1 A;  4ATZ D;  3TGO A;  1JUQ A;  3APF A;  4FAD A;  4GPM A;  3HHM A;  4EBA A;  2A4Z A;  2XRZ A;  2AWI A;  3UT4 A;  5LCW C;  5JJT A;  4ACK A;  1OWP A;  3ULQ A;  1OY3 D;  4J7W A;  4G11 A;  5EN5 D;  3FTU A;  5D0Q D;  4L23 A;  5JHA A;  2YNQ A;  3NOC D;  3KAE A;  4HOT A;  2FO7 A;  3BG0 B;  2KAT A;  3CKC A;  4RLY A;  3L22 A;  1DVP A;  4ME2 A;  1BU9 A;  2VTB A;  4CDN A;  3CVY A;  3ASH A;  4WWP A;  5KJN A;  4PDX A;  3APD A;  3CHR A;  2WXK A;  4GYY A;  5EYP F;  4JEU A;  4BX8 A;  3MV3 B;  3EHQ A;  3NZS A;  3JCK C;  1N4P A;  2ZGG A;  1IQU A;  1W3B A;  3D9N A;  5T3R A;  5DBK A;  1U3D A;  3R9A B;  1KZO A;  3ZVV A;  1IYG A;  4G8L A;  1P5Q A;  4IUL A;  5ENR D;  2R02 A;  1WY6 A;  3V31 A;  2GRL A;  1H19 A;  5B1A E;  3UKR G;  3AU4 A;  3TWV A;  2J08 A;  4PS7 A;  3X2Q E;  5LFA A;  1IKN D;  3IBE A;  3OTN A;  3U9W A;  4U0Z A;  3JXJ A;  3ONL A;  5HS0 A;  3D9O A;  1XNF A;  3MJW A;  2LSU A;  3DST A;  1MX2 A;  4AOF A;  2R2L A;  1X5B A;  5FZR A;  3D9I A;  4UWG A;  2WQ7 A;  4OVU A;  5B3S E;  4N5C A;  3TWS A;  5BXU A;  3SZ7 A;  1Y6I A;  3MA5 A;  4Z68 A;  2H6F A;  3OXL A;  1MJ0 A;  3B95 A;  4GMJ A;  2RG8 A;  3ML8 A;  4I6E A;  4F1P A;  3PUK A;  5D2M C;  2KXP C;  1JCS A;  4G24 A;  5EX0 A;  4J8D A;  3CVQ A;  4BSX A;  1YMP A;  2ILR A;  3SHF A;  2PL2 A;  1S0P A;  3MZL B;  3UKU G;  1N94 A;  1OT8 A;  2XPZ A;  3SBT B;  3FTZ A;  3CHP A;  3FWV A;  3BQO A;  1ZB1 A;  2DZO A;  4GU5 A;  3B7T A;  4WNE A;  2NXP A;  4JB8 P;  1S63 A;  4TUM A;  2V4H C;  3FUI A;  5ENP D;  5EX3 A;  3IV0 A;  4GA2 A;  4C48 B;  5J08 A;  1PAQ A;  2VSN A;  2XQ0 A;  2C0M A;  3R7Q A;  4W9R A;  5LOZ A;  4GTQ A;  5AAR A;  2XS8 A;  2LXM A;  2XHE A;  4XEI G;  3MGB A;  5FJY A;  1SQM A;  1DNP A;  2J8S D;  4WUY A;  4LNB A;  5EIB E;  3PZ4 A;  4K5C A;  3QJZ A;  3FU6 A;  1KPS B;  4GTT A;  4HNA D;  1EYH A;  4DX2 A;  4N39 A;  4JHJ A;  4U63 A;  2P9K G;  1IHB A;  4EPZ A;  3V2O A;  2X6H A;  3RKV A;  2WMO A;  3CHQ A;  4WWO A;  4FC8 A;  4MRU A;  2VTB B;  3QKY A;  1MX6 A;  2KCV A;  4L9P A;  2H6H A;  2Y0B G;  3DEO A;  5BXO A; 
#chains in the Genus database with same CATH homology
 3D9P A;  4NQ0 A;  3G2V A;  2XRY A;  3HIZ A;  4WWN A;  3OAW A;  4I6J A;  3ZXS A;  1ELW A;  2HM8 A;  3JUI A;  3BEE A;  4ABN A;  2EQX A;  1UG3 A;  3LXU X;  3ZEF A;  3B7S A;  3CVL A;  2NSZ A;  3Q5M A;  4DJA A;  2WXN A;  4DK5 A;  4DPR A;  3FEX A;  3I3N A;  3T5V A;  3PE4 A;  3LS8 A;  2IQC A;  2YIN A;  4FJY A;  1OWN A;  4AP2 A;  3IHY A;  1GW6 A;  3LVQ E;  4GCN A;  1UN9 A;  1HS6 A;  5E75 A;  2XGS A;  3ZIM A;  3FTX A;  4J8F A;  4ANV A;  5G04 C;  1Z6T A;  3CLJ A;  2Q7F A;  4JHR A;  3AS4 A;  3CVX A;  2CHZ A;  3ASG A;  4ANX A;  4HOS A;  4BY6 A;  3FUD A;  3QAR A;  3BG1 B;  4JL0 A;  5M72 A;  4I1O B;  4BX9 A;  3O48 A;  3TAX A;  3EHM A;  1E96 B;  3ONK A;  4GB9 A;  4GML A;  3ML9 A;  1QQE A;  3NQP A;  3PNT B;  4JZY A;  3HYM B;  5HQ8 A;  5BUZ A;  4JA9 A;  1E8Z A;  3L16 A;  4GZC A;  4F1S A;  5BW8 C;  3MYV A;  2L0I A;  4CT0 A;  5LCW J;  2WXO A;  3U66 A;  4TRQ A;  5G04 J;  1HFA A;  4BT8 A;  2E0I A;  4GYO A;  4H7X A;  3ESK A;  2VGY A;  5AEN A;  4IYP A;  4WNF A;  3FEY A;  1KLX A;  2VSX E;  3L08 A;  2J4D A;  4DLQ A;  3PEU B;  4FU3 A;  4APF A;  3FU3 A;  3CHS A;  2WXI A;  1H6K A;  1E7V A;  1H2V C;  4J6I A;  3MKQ B;  2M63 A;  4HFG A;  3FH8 A;  1WAO 1;  3AU5 A;  4JW1 A;  2Y4T A;  4MLP A;  1IQR A;  1VDY A;  2X6K A;  4WNG A;  4ACL A;  1KT1 A;  3VLE A;  4ILG A;  3QAQ A;  2XEV A;  4F53 A;  2HR2 A;  2KC7 A;  5T4Y A;  5BV0 A;  2MRI A;  4CRW A;  3PRZ A;  4HOR A;  2VSY A;  4RG6 A;  4FHJ A;  2R5S A;  2IOL A;  4B0Z A;  2UWJ G;  1BPO A;  3FUJ A;  2X6F A;  3LKU A;  4PS3 A;  4YVO A;  4WAF A;  4C0E A;  2I6H A;  4XKC A;  1FVF A;  4GA1 A;  2XGM A;  3CVU A;  3JQ1 A;  2R17 C;  3HVE B;  3FUE A;  4FP7 A;  4FHK A;  3R7R A;  4AEZ C;  4CEM A;  4BWR A;  4EEC A;  4GYW A;  3B7U X;  2V0P A;  3CEQ A;  4HOQ A;  4XI9 A;  3T5X A;  1HXI A;  4L1B A;  2CFZ A;  3K9I A;  3I4R B;  4EQF A;  4AV7 A;  1H0A A;  4APO A;  5FT9 A;  4J8E A;  2HO1 A;  2JEK A;  1UN8 A;  3N71 A;  1E7U A;  3ASF A;  4I9E A;  1HF8 A;  5A6C A;  1HX8 A;  4CGW A;  2WXQ A;  2LO6 A;  3IKO B;  3ZHE A;  1MHQ A;  4KYO B;  5JJ7 A;  3ZYQ A;  3CVV A;  3S7D A;  3MKR A;  5FWQ A;  3D9K A;  3MV2 B;  1NA0 A;  3D9M A;  3HDX A;  5JJ6 A;  2J09 A;  3UT8 A;  1JPL A;  2C2L A;  2DBA A;  4NUR A;  4CDM A;  4I17 A;  3VLD A;  3G2U A;  5FZQ A;  5LP0 A;  4B89 A;  4AY5 A;  3CV0 A;  2IJG X;  4U0U A;  2LNI A;  3QDN A;  4EZK A;  1MQS A;  4ANU A;  3EJN A;  2KCL A;  2CHW A;  2VSO E;  1IHG A;  4JXT A;  3LDZ A;  1TJC A;  4XKB A;  3ZYM A;  4UWL A;  2C0L A;  4ANW A;  4HXI A;  3I5P A;  3RJV A;  3S2A A;  4AIF A;  4FLH A;  2CG3 A;  4KBQ A;  2Y4U A;  2BF0 X;  4IN3 B;  4UI9 K;  3QNK A;  3LYA A;  4Y6W A;  5C2Y A;  5BT1 A;  3LJ3 A;  4I1A A;  1JWF A;  3RRM B;  3E4B A;  1XGW A;  4KVM A;  5ANR A;  2IFU A;  4BTA A;  3MEK A;  3I4G A;  2PQR A;  4AY6 A;  1HU3 A;  4XIF A;  4IRU A;  3UX4 A;  5EDS A;  1INZ A;  2YHC A;  4UWK A;  2PM7 A;  5BV1 A;  3PS6 A;  4ILH B;  2WB2 A;  2LAI A;  2FF4 A;  4UQY A;  3TGO A;  1JUQ A;  3CR3 A;  3EDT B;  3SFZ A;  3APF A;  4FAD A;  3SNX A;  2JLB A;  5ARF A;  3HHM A;  4EBA A;  2A4Z A;  2XRZ A;  3SBS A;  1HZ4 A;  4P29 A;  1SZ9 A;  2AWI A;  2RD0 A;  2V4L A;  3FUM A;  3LY9 A;  4I2Z A;  5FQ4 A;  3UT4 A;  5LCW C;  5JJT A;  4ACK A;  3CK8 A;  5CHE E;  3KEZ A;  1OWP A;  2I2O A;  4L7T A;  3ULQ A;  3HVE A;  5ENN A;  4EZJ A;  4DLO A;  1UW4 B;  2V5F A;  4QFV A;  2WXH A;  4G11 A;  4PUC A;  3C98 A;  3GYZ A;  4URK A;  3FTU A;  5D0Q D;  2XPI A;  4L23 A;  5KJM A;  4GPK A;  5ARG A;  4KT6 B;  2QY7 A;  5E76 A;  1NA3 A;  1ZU2 A;  5G05 J;  5JHA A;  2WXP A;  2YNQ A;  3FH7 A;  5D0O D;  4JVS A;  3KAE A;  1Y8M A;  4HOT A;  2OVB A;  2FO7 A;  3BG0 B;  3FTV A;  2KAT A;  3CKC A;  2GRM A;  4N2Q A;  4G25 A;  4L2L A;  4XX5 A;  3ZN3 A;  2VYI A;  2Y3A A;  2PZI A;  3SI5 A;  4YND A;  1FCH A;  1NZN A;  3P1U A;  4WND A;  4PH4 B;  3O4Z A;  2BTD A;  2J4B A;  3G2T A;  3WXX A;  4LER A;  4D10 C;  2UY1 B;  4LEU A;  5KCM A;  3ZW3 A;  3L22 A;  4A3V A;  1DVP A;  3CVW A;  3CGH A;  2GW1 A;  4KXK B;  1HO8 A;  3Q49 B;  4ME2 A;  5LX8 A;  4Q96 A;  2VTB A;  3FTW A;  4CDN A;  3CVY A;  3ASH A;  4WWP A;  5EKQ D;  2AXZ A;  4ILI A;  3CKB A;  5KJN A;  4PDX A;  3ESL A;  3FUF A;  4C9B B;  3APD A;  3CHR A;  2WXK A;  3URZ A;  4GYY A;  4F7A A;  4JEU A;  4BX8 A;  3FU0 A;  3TG4 A;  3MV3 B;  3L6A A;  3NZS A;  1HE8 A;  3JCK C;  3S7J A;  3KD7 A;  1IQU A;  4H7Y A;  1W3B A;  3RIB A;  2OOE A;  3D9N A;  5T3R A;  4RG9 A;  5DBK A;  1U3D A;  3JYS A;  1L5J A;  3PE3 A;  3R9A B;  5FZS A;  3VTY A;  3ZVV A;  4TUU A;  1IYG A;  1P5Q A;  4YVQ C;  4G1T A;  3FFL A;  4IUL A;  4I1M A;  2YQ8 A;  1N52 A;  3CSF A;  3ZRH A;  4LRZ A;  1TEZ A;  3UT7 A;  3VTX A;  3PNL B;  1WY6 A;  3MCX A;  2V8S E;  4JA7 A;  2MOW A;  3GW4 A;  3U4T A;  2GRL A;  1H19 A;  3L54 A;  5T8I A;  2X6J A;  3AU4 A;  3TJP A;  2J08 A;  2PM6 A;  2GGF A;  3RO2 A;  4PS7 A;  4G23 A;  5LFA A;  3G2W A;  2OND A;  1H2U A;  5J90 A;  2FUL A;  3IBE A;  3OTN A;  4UWF A;  3U9W A;  3PEV B;  2WPV A;  4U0Z A;  3LY7 A;  3QWV A;  4RVB A;  2A5U A;  4N3A A;  3ONL A;  3NF1 A;  5CCM A;  3D9O A;  1XNF A;  1WM5 A;  2XGO A;  2LSU A;  3IEG A;  3MJW A;  4I2W A;  3U3W A;  3MX3 A;  1JWG A;  3QOU A;  2LSV A;  4AOF A;  4HLE A;  3D9L A;  1X5B A;  4R7L A;  5FQ7 A;  5FZR A;  3ASD A;  3UMV A;  2J07 A;  3D9I A;  3FUN A;  3G2S A;  3JQ0 A;  4UWG A;  3SGH A;  2YHE A;  5G55 A;  3ZYK A;  2WQ7 A;  4GCO A;  4OVU A;  4Q94 A;  4ATG A;  3FY4 A;  4AVX A;  2UY1 A;  1PC2 A;  4J8S A;  5G2N A;  4FLB A;  3MKQ A;  3CVN A;  3L17 A;  3GZ2 A;  4N5C A;  4XE0 A;  4CGV A;  4GA0 A;  4UQZ A;  3SZ7 A;  5A7D B;  3S7B A;  1A17 A;  1FVH A;  1Y6I A;  4F3V A;  4N3B A;  3MA5 A;  1ZBP A;  4U8H A;  2VGX B;  3GZS A;  3OXF A;  4XI0 A;  2L6J A;  2WXM A;  1B89 A;  3ZGQ A;  4KMO A;  3OXL A;  3APC A;  2CFU A;  3CK7 A;  2WXF A;  3PH0 C;  3CIA A;  4GMJ A;  4GZD A;  3FTY A;  4V3I A;  1E8W A;  2I1J A;  2RG8 A;  5FQ6 A;  5G05 C;  3UQ3 A;  3ZPJ A;  2HYZ A;  3ML8 A;  3UPV A;  3S7F A;  4EZL A;  4J0U A;  3LCA A;  4I6E A;  1EDU A;  3FTS A;  4OYS A;  1E90 A;  4PS8 A;  2XCC A;  3PUK A;  1N54 A;  1LF8 A;  2P58 C;  2WM9 A;  3PZD A;  4MS6 A;  4A1S A;  4E85 A;  3ZYL A;  4CDR A;  4G24 A;  3QK0 A;  5EX0 A;  4XZ4 A;  4BT9 A;  2DCP A;  1H2T C;  4J8D A;  3QC1 A;  4GAA A;  4HOU A;  2IF4 A;  3CVQ A;  4BSX A;  3QWP A;  2ZU6 B;  3PDN A;  3ENE A;  3UUX A;  2ILR A;  4GZ6 A;  3SHF A;  2FI7 A;  3CQG B;  2PL2 A;  4TV3 A;  1S0P A;  3MZL B;  5AYW D;  4BFR A;  3D3M A;  4I43 A;  2XPZ A;  3AS8 A;  4UWH A;  4FUL A;  4O6F A;  4NRH B;  2KZT B;  5KJL A;  3FUH A;  3SBT B;  1QZ2 A;  4DI4 A;  2CG2 A;  3FTZ A;  4U04 A;  4CT4 A;  3LVR E;  3CHP A;  3FWV A;  4A55 A;  2NC9 A;  3IHV A;  5JHB A;  4GU5 A;  2AW6 A;  4Y6C A;  4I6G A;  3B7T A;  3ZHE B;  2QFC A;  4LUN U;  4WNE A;  2NXP A;  3FDH A;  3FU5 A;  3L13 A;  4N3C A;  4B8C B;  1U3C A;  1OWL A;  4LCT A;  1SZA A;  4G2V A;  2WXG A;  4CCA A;  1OWO A;  2CHX A;  3DPD A;  3FUI A;  3RO3 A;  4B94 A;  2L0T B;  4L2Y A;  5CMY A;  2OVF A;  2X38 A;  4N2S A;  5EX3 A;  3IV0 A;  2WQH A;  4E6H A;  4GA2 A;  4K0R A;  2AVP A;  3CST A;  5AJL A;  5HI7 A;  5J08 A;  1PAQ A;  1HG5 A;  3CHO A;  3FP3 A;  5CCL A;  4A1G A;  4DI3 A;  2VSN A;  3KS2 A;  4A3T A;  3ZFW A;  2FEZ A;  4NAC A;  4GZ5 A;  2R59 A;  2XQ0 A;  5FTP A;  3SD5 A;  4C0M A;  4JHK A;  1NP7 A;  1UJJ A;  1E8Y A;  1Z3X A;  2I1K A;  2C0M A;  3D9J A;  3DBS A;  2VGX A;  2WVI A;  3EHN A;  2MHK A;  3CVP A;  2WXL A;  4MKT A;  2X3M A;  3QWW A;  5AJD A;  3R7Q A;  4W9R A;  5LOZ A;  4OVV A;  1TJF A;  3FUK A;  3Q4A B;  2IOS A;  2KCK A;  3Q47 B;  3EIJ A;  5ANL A;  4GZ3 A;  1KT0 A;  3NZU A;  2WQ6 A;  2KM4 A;  4K03 A;  2OV8 A;  5KJK A;  1YA0 A;  2XHE A;  3PRE A;  3RU0 A;  3SF4 A;  3MGB A;  5FJY A;  2WXJ A;  3TG5 A;  1SQM A;  2WXR A;  2FBN A;  3U64 A;  1DNP A;  4AJW A;  1PY1 A;  1ELR A;  4KZ0 A;  3LEW A;  4WUY A;  2XPY A;  2J9Q A;  3PUJ A;  3OXG A;  3FH5 A;  3B7R L;  4I9C A;  3P2B A;  3AS5 A;  3QJZ A;  2DIW A;  3FU6 A;  4AM9 A;  1HH8 A;  3QB2 A;  2J49 A;  3CK9 A;  3LPZ A;  3TL5 A;  5A23 A;  1EYH A;  3PVL A;  1ELK A;  2E2E A;  3TXN A;  4M3O A;  5DIZ A;  2KZT A;  4FA6 A;  4N39 A;  2VJ8 A;  3VLF A;  3GZ1 A;  4FJZ A;  4HS2 A;  5BNW A;  2I9C A;  1E8X A;  1UJK A;  2LAH A;  4JHJ A;  4U63 A;  5CMW A;  4G26 A;  3CQC B;  3EIQ C;  1EPU A;  4EPZ A;  4UQX A;  3B13 A;  4BTB A;  3RRU A;  4AXH A;  2X6H A;  4U0S A;  3CHM A;  2BUG A;  3RKV A;  2WMO A;  4KVO A;  5FQ8 A;  1EF1 C;  1OWM A;  2IU1 A;  5BPP A;  4UI9 C;  1Z3Y A;  2AXV A;  3CHQ A;  4B8A A;  4WWO A;  2WMN A;  3RK6 A;  3TXM A;  4Q69 A;  4FC8 A;  4MRU A;  4RSY A;  2VTB B;  3QKY A;  3Q15 A;  4JPS A;  1HG2 A;  2L9B A;  4KZC A;  1QNF A;  3LY8 A;  3RRN B;  5AIJ A;  4U07 A;  4EBA G;  5C1D A;  1OUV A;  2KCV A;  3FUL A;  2XCB A;  2X6I A;  4JEH A;  4JC8 A;  4UI9 J;  4HVB A;  2ION A;  2AXU A;  3FHE A;  2VQ2 A;  3T8M A;  2PQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...