4LCTA

Crystal structure and versatile functional roles of the cop9 signalosome subunit 1
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
318
structure length
318
Chain Sequence
EPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGENTQLFREVVNKIGNRLGEKYGMDLAWCEAVDRRAEQKKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMCMNAILVSIEMGQFTHVTSYVNKAEQNPETLEPMVNAKLRCASGLAHLELKKYKLAARKFLDVNPELGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYASCLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKALIQYTLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COP9 signalosome complex subunit 1
publication title Crystal structure and versatile functional roles of the COP9 signalosome subunit 1.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Signaling protein
total genus 129
structure length 318
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10602 RPN7 26S proteasome subunit RPN7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.570 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4lctA00
3TXMA 4LCTA 3TXNA 3T5XA 3CHMA 3JCKC 4D10C 2MRIA
chains in the Genus database with same CATH superfamily
3ESKA 2PQRA 5FINA 3BEEA 5HI7A 4FJZA 4HQDA 2HO1A 3PEUB 3TWQA 4B0ZA 1INZA 5FQ4A 3DSTA 3AU4A 3I5PA 1BI8B 3APFA 4K5BA 3MKRA 5HQ8A 1AP7A 2J9QA 4CGVA 1EDUA 3T8MA 3G2VA 2Y3AA 5EDSA 1KT0A 4A63B 4GYOA 1Z3XA 3DSVA 3BU8A 5CCLA 3FUJA 4RSYA 3IKOB 1BLXB 1HO8A 2VYIA 1JCQA 4JW1A 3GZ2A 2J8SD 5CMWA 1W3BA 2P9PG 3NBNB 3U4TA 1ELWA 3L82A 3OTNA 5G55A 4LG6A 1HH8A 5HKPA 4LEUA 4RG9A 4HOTA 3CVQA 4ILIA 4EHMA 2J49A 3CVYA 3JYSA 4YDWA 3FTUA 3L54A 4WNDA 2HR2A 2BKGA 3KS2A 2E0IA 5FT9A 5JJ7A 2VSYA 3T9KA 2V5FA 2R17C 3UUXA 4UQXA 1YYHA 5ARFA 2VSOE 4XKCA 2WMNA 4G25A 3UINC 3FU6A 4OAUC 3TG5A 3DSXA 3T5XA 4I6EA 2J07A 3Q49B 4BX8A 3D9PA 4ME2A 3L17A 3OXGA 4I6JA 2Y0BG 3VLFA 4CDNA 4GMJA 1OT8A 3C3QA 3JUIA 4GTOA 2C0MA 3CVVA 1DVPA 4BSXA 3MKQA 4C0MA 2DIWA 3AS8A 4G11A 5HS0A 3JQ1A 3RAUA 2NSZA 2X6IA 2VGYA 2EINE 4XZ4A 2QC9A 3OAWA 5D0OD 3CHOA 3C3RA 4DI4A 3ASOE 4U04A 2I2OA 2WXQA 2J09A 2XGSA 4LCTA 1E8ZA 4AV7A 4B8CB 3EUVA 5FZQA 3RU0A 2VSNA 2R02A 4OVUA 2YHCA 3FU0A 1Y8MA 4AEZC 3W9FA 2KCVA 4C0EA 2JABA 1Z5SC 3FP3A 5JHAA 4ABNA 4I1AA 3C72A 5BV1A 4U07A 5CERB 3HYMB 2AXVA 2C2LA 1O1RA 2V8SE 3X2QE 5ANLA 5C1DA 3Q73A 1SW6A 3PRZA 4WNFA 5CECB 1GW6A 2IOLA 3ASNE 2DCPA 5CBNA 3S7JA 3ONLA 3EHRA 3PE3A 3SFYA 1ZU2A 1K1BA 3QWVA 3DEOA 3UKUG 3V30A 3RRUA 5CEAA 2IY0C 2VGEA 2NXPA 1OY3D 5EX0A 2XRYA 3LKUA 3RRNB 2F8YA 2RD0A 1S0PA 3ULQA 4JEUA 1IXVA 4U7EB 4UWLA 5AJLA 4HORA 3FTVA 2LO6A 2OV8A 3AS5A 2EILE 3UPVA 4HOSA 5BNWA 3QJZA 1Y6IA 3B7SA 4HI8A 1YMPA 4BX9A 4L7TA 3CEQA 4ZHBA 1UOHA 4BSZB 2DYSE 1KLXA 3KAEA 2CG3A 4V3IA 3ENEA 1HFAA 3CSFA 2MYOA 1FT1A 2V4HC 4UQZA 3Q9UC 1HZ4A 5AARA 3LY7A 3RO3A 2I9CA 3ISMC 4MLPA 2LSVA 3Q15A 4G26A 3AAAC 3WXXA 2NC9A 1E8YA 1TN6A 4CCAA 1KT1A 2YQ8A 3CVXA 3HDXA 3O48A 3CKBA 5G2NA 3Q78A 2L6JA 4FP7A 4FADA 4BESA 4GA1A 2AXZA 4EZLA 4PH4B 1A17A 3FTWA 2PNNA 4GB9A 1U2VG 2WXIA 2XCCA 2F37A 2GRRB 4G24A 4HLEA 1OWOA 2WXLA 5BW8C 4DUIA 3MEKA 2WXFA 3NOCD 4DLOA 2HM8A 5KJMA 4HS2A 5FIOA 4BFRA 3CSTA 5EKQD 3FUEA 1TJCA 1U3CA 3HG0D 4OAVB 2BKKB 3Q75A 2XPYA 3L16A 4JB8P 2PM7A 3L08A 3G2SA 3LDZA 1OWLA 4B8AA 3U9WA 4N39A 4HFGA 3CVLA 4ACKA 5KNHD 3SHFA 3B7BA 2IF4A 3GW4A 3UX4A 2IO2C 1JUQA 3FUDA 3LJNA 4DX7D 4JA9A 3NQPA 3ZFWA 3K9IA 2FO7A 3C5RA 2IJGX 2J4DA 4OVVA 5ITZF 4NACA 3CLJA 1PC2A 5A7DB 2DBAA 4ATZD 1K1AA 4GTMA 4N3BA 4GTPA 3R9MA 1OCCE 2XENA 2RKKA 5B1BE 3U3WA 4CDRA 2YHEA 4NURA 3AG2E 4XX5A 3J5QB 4UQYA 1IQUA 3KEAA 4GMLA 4CT0A 4N3AA 2A5EA 2KZTB 3ML8A 4U95D 1YA0A 2KC7A 2R05A 5ARGA 4FHJA 4BY6A 4Q69A 5CRUA 2LUHA 4G2VA 5E75A 5LCWJ 4J8EA 2XEVA 3CK9A 2DYRE 2KATA 5AYWD 1SZ9A 2A5UA 4TRQA 5LCWC 3G2WA 4I2WA 4HOQA 4BTBA 1OCRE 5B3SE 3ASFA 4DX1A 4F3VA 3D9NA 2DZNA 3ZYMA 3JUEA 3KSQA 5FZSA 2XGMA 2PQNA 3QARA 5KCMA 1NA3A 4GPKA 4U63A 3QDNA 3BUAA 4IYPA 1LF8A 3RKVA 3DPDA 3QC1A 4A1GA 3APDA 3KEZA 2V0PA 1NI1A 3GYZA 3AS4A 1XGWA 3JXJA 2CG2A 3E34A 1V55E 2QYJA 4GTTA 3JXIA 4Z68A 2CHXA 1N52A 4NQ0A 5KJLA 5CRVA 3ABKE 3LY8A 2WXHA 3E37A 3CK8A 4XI0A 2QZAA 2XHEA 3D9LA 2HYZA 3EHNA 4AY6A 4RQIA 3NB2A 2DWZA 5CHEE 1QBQA 3B7TA 5FZRA 3MA5A 4G23A 4PDXA 2GW1A 5LFAA 5H7PA 3FEXA 3KSLA 3UIOC 4YNDA 1UW4B 5BUZA 3PZ2A 2R03A 3UT4A 2ILRA 2AJAA 4WNEA 1TR4A 5T4YA 1H2VC 2KCLA 4TUUA 4HVBA 5ENSD 3FUKA 3DBSA 1E96B 3FTSA 2QYUA 2L0IA 4C9BB 3P2BA 3UXGA 4TUMA 3HXEA 4WWPA 5J90A 2PL2A 3CGHA 3DSUA 3ASGA 3Q9NC 4GZ3A 3PEVB 1NP7A 3QWWA 4Y6CA 1Q2ZA 3ABME 3D9OA 5CMYA 3LXUX 3G2TA 5A23A 1TNZA 5BPPA 4WAFA 3FY4A 5HRYA 4ANWA 2XEHA 4K5AB 1TN8A 4L2LA 1DC2A 4YDOA 2AXUA 3ASDA 1H2TC 2LSUA 2WQ6A 4B94A 4UWFA 4DX2A 3FU5A 4AVXA 4HRNA 2XZDG 5AJDA 2OVFA 3FUHA 4HLLA 3PVLA 3EDTB 1TNBA 2XCBA 4GTSA 3CHRA 2H6FA 4GAAA 3R9AB 4KZCA 5JJ6A 2X6HA 3MGBA 5J08A 4RLYA 1NFIE 4BT8A 2I1JA 1SQMA 1H6OA 4U0SA 3ESLA 1WM5A 4F1SA 2WVIA 3G2UA 5LOZA 1S70B 4WWNA 4PS3A 4PS8A 3FU3A 1LD7A 1SA4A 2PM6A 3E30A 2QY7A 3S2AA 1QQEA 3TWVA 4KVOA 2XS8A 3FWVA 4UWGA 4I1MA 3PZ1A 4TXPA 1H6PA 4J0UA 2R2LA 1MYOA 4CT4A 1MX2A 3PH0C 2BUGA 1H2UA 5IY5E 1ELRA 2KBXA 1HF8A 4TV3A 2ZGGA 1HE8A 5AIJA 4JHRA 4APOA 3GZ1A 1N4RA 3TWUA 4IRUA 2XZTG 3SQVA 3CVWA 1Z6TA 4U0ZA 3W9GA 3RRMB 3AG1E 2P9NG 1MHQA 4MS6A 5LX8A 1DNPA 4JPSA 2C0LA 3ZHEB 4GTRA 5JHBA 3CHQA 4UI9J 1K8KG 4FLHA 2P58C 5DBKA 1TYQG 5AQ7A 2ZXWE 4UI9C 1IKND 2CHZA 3OXLA 3T5VA 1AWCB 2EIME 3I4RB 4GCNA 2H6HA 5KBAA 1UG3A 3D3MA 3ZGQA 2FULA 4KT6B 2XEEA 2VGXB 4APFA 4C48B 2GROB 3FUFA 3UM0A 1S64A 4AOFA 3Q79A 2CFUA 2VSXE 3SD5A 1BPOA 4J8FA 4JEHA 4NRHB 1BD8A 2WM9A 3PZ3A 1OXJA 4F6RD 4XIFA 4A3TA 4EBAA 3D9HA 3MJWA 1DCEA 3CVUA 3TWTA 3L22A 1TNOA 4URKA 2KZTA 3D9MA 1IQRA 4EBAG 3SZ7A 2XS1A 3EU9A 3LS8A 5CCMA 2ZU6B 2XRZA 3S7BA 3CQCB 4TXQA 2P9SG 4MBGA 5CBOA 4Q94A 3FULA 3KD7A 5ENTD 1FT2A 4EZKA 2X6FA 3VTXA 1N9AA 1P5QA 4Q96A 2VQ2A 3FTZA 3F6QA 4U8VD 3MKQB 3TXNA 4LUNU 3D9IA 2IOSA 4LSZE 4GZ6A 3ASHA 4J6IA 4BT9A 1WY6A 4I43A 3E4BA 3FEYA 3B7UX 4E85A 5EYPF 2RG8A 3SGHA 4CRWA 3TG4A 2X38A 1HG2A 3ZYKA 1N4PA 1NA0A 4J8DA 4RVBA 1SA5A 5JJTA 1V54E 3SBTB 2JEKA 2J08A 3QWPA 3L9TA 2YNQA 3DXMG 3CK7A 3GZSA 2EIKE 3TAXA 3I4GA 3VTYA 3BG1B 2AVPA 3ZIMA 2XPZA 4YVQC 3I3NA 1OCOE 2B0OE 4J7WA 5KJKA 3CHMA 3U66A 3D9JA 3HRAA 4BETA 1UN9A 2LXLA 3V2XA 3L6AA 3RJVA 2IQCA 3TWXA 3CKCA 3LPZA 4GZDA 3QKYA 1JPLA 5JMND 5DIZA 5G05J 5BXOA 1FPPA 2WXJA 3PS6A 3VLEA 2F0YA 5G05C 1N4SA 4DK5A 2V5QC 2CHWA 2E2EA 4ILGA 1HS6A 3ZEFA 4ANUA 1N95A 3Q7FA 3HIZA 3EIJA 5ENNA 2JLBA 2A4ZA 2X3MA 2Y4TA 3SNXA 4K0RA 5T8IA 1A5EA 5KNGA 2L6BA 5B1AE 3HVEB 2P9UG 3PREA 4HBDA 3U64A 1KPSB 4LNGA 2FO1E 4FA6A 1TJFA 1BI7B 3CHSA 2XQ0A 3CHPA 5ENOD 3ZPJA 4FHKA 3UKRG 3P1UA 2GRNB 4QFVA 1B89A 2IO3C 5M72A 5EILA 3SI5A 4GCOA 3CV0A 3FFLA 4L2YA 1JCRA 4M3OA 4LNBA 2BTDA 4YVOA 5AENA 3PNLB 1UN8A 2I1KA 2ZIRA 4HI9A 1D9SA 3EHMA 3ZKJA 2X6KA 4HOUA 2VTBB 1MQSA 2WB2A 1N4QA 2ONDA 4ANXA 3ZVVA 4GU5A 3FDHA 4DPRA 4JL0A 4XEIG 3QK0A 4UI9K 4GZ5A 2LAIA 4LNUD 3TWWA 1TN7A 3Q7AA 3S7FA 2F8XK 4I1OB 3ZYLA 1UJKA 4XKBA 3ZUVB 3B13A 4QQIA 3MZLB 1MX6A 1X5BA 4PS7A 4A3VA 3PE4A 4PUCA 5D66A 2IFUA 3DRAA 3R7QA 4KZ0A 2V4LA 4GYYA 1SZAA 2IEJA 3IBEA 3QNKA 3ZHEA 4H7YA 1NZNA 4L1BA 4XE0A 3SF4A 3DSWA 1S63A 3N71A 3RSEG 2CFZA 3MV2B 3HXFA 1HX8A 4CYMD 1DCQA 3RIBA 2DVWA 2P9KG 4KMOA 1TEZA 3SY2A 3ZYQA 3NOGD 1N54A 4EECA 4LRZA 2P2CP 2WMOA 2R59A 2OCCE 4G8KA 4GYWA 2VGXA 3QOUA 5AQAA 2X6JA 4DX6D 2WQ7A 3LVRE 1RW2A 5CEDB 3LCAA 3BG0B 3B95A 2LXMA 2L0TB 4Y6WA 1U3DA 2Y69E 2RFMA 3UM2A 2P9IG 3IXEA 2ETCA 5LP0A 1IHGA 4HNAD 1JWFA 3BQOA 2UWJG 4X8QA 4JHKA 3LEWA 4H7XA 3MV3B 1FVFA 3AU5A 2Y4UA 3ULYA 5FWQA 2KM4A 2YINA 4A55A 4AY5A 3ZN3A 3DEPA 4WWOA 5FQ6A 1EYHA 2WXGA 5ENPD 1FVHA 1KZPA 4HRMB 2AW6A 1TNYA 1L5JA 3LY9A 3VLDA 2B6CA 4DX5D 4AJWA 3DXKG 3TJPA 3J5PA 4KXKB 4CEMA 5AQ9A 3ULEG 2MOWA 3LYAA 4W9RA 3Q47B 4JVSA 4B93B 3ZRHA 2MHKA 1ZBPA 4HB5A 2GRQB 1RZ4A 1D8EA 4FU3A 3IV0A 4GA2A 4K03A 4I6GA 2R5SA 2XGOA 3IEGA 5D0QD 4AIFA 4ZFHA 2UY1B 4J8SA 3TL5A 3Q4AB 1H0AA 3S7DA 2ETAA 4KVMA 4CDMA 3E33A 2WPVA 4R7LA 3UMVA 4HRLA 1ZB1A 3ZXPA 1ELKA 2WQHA 3WG7E 2H6GA 2LAHA 1G3NB 4P29A 3SFZA 3NAWA 3CR3A 3FUMA 3ZXSA 3CVNA 2LNIA 4N5QA 1WAO1 4UWHA 3FH7A 2GRPB 3O4ZA 1VDYA 4JD2G 5JA4D 1HXIA 5AN8A 5EYLA 4JHJA 4GMRA 4FC8A 3APCA 2P9LG 4EPZA 3HXCA 4GTVA 5AQBA 2BF0X 1FCHA 4TXRA 3FTXA 2WXOA 4DJAA 4U0UA 2VJ8A 1OUVA 3L13A 4U8HA 1X81A 3TGOA 1OWMA 2WXMA 4AXHA 1WDYA 5KWDA 1H19A 3TXMA 3T8KA 1MX4A 3SO8A 1QYMA 5EIDA 4ACLA 3AJIA 3FTYA 4J8YA 1YCSB 5A6CA 3MCXA 3URZA 4KBQA 2MRIA 4DLQA 1O5MA 4GA0A 5ENRD 5FQ7A 3IHVA 4JZYA 5FQ8A 3DPYA 3HVEA 5KJNA 1EPUA 3ABLE 2OEVA 2EIJE 4N3CA 3R7RA 2KCKA 4IULA 4L23A 1LTXA 1Z3YA 3NF1A 4IN3B 1HU3A 3NZSA 4YDYA 3V31A 2Q7FA 3UM1A 3UT8A 4FULA 1OCZE 3SBSA 5BT1A 3TWSA 1IHBA 4ATGA 4N2SA 3FUNA 1WG0A 4WNGA 3QAQA 4ILHB 4F7AA 1H6KA 3ZNGA 1HG5A 3D9KA 4U8YD 3RO2A 4O1PA 2Y1LE 2KXPC 1JCSA 3PUKA 1NL4A 4LERA 4O6FA 2VTBA 2J4BA 5AAOA 2DZOA 5T3RA 4O1OA 4EQFA 2GRLA 3PNTB 4I17A 1O1TA 4D10C 1SVXA 2XPIA 4MKTA 4I9CA 3UT7A 4BERA 5G04J 3E32A 2PZIA 4UWKA 2QFCA 3IHYA 1IYGA 5G04C 1KZOA 1N0RA 4FLBA 3RK6A 3LJ3A 3C3OA 3FHEA 1OWNA 2L9BA 4AP2A 5D2MC 4RG6A 3ONKA 3ZW3A 3UTMA 3QB2A 1D8DA 2WXNA 3V79K 4NIKA 3UI2A 3MX3A 1UJJA 3TWRA 2GRMA 4YDEA 1JWGA 2OOEA 2BEDA 2NYJA 4L9PA 1N94A 4JA7A 1E8XA 4XI9A 3FUIA 4U96D 3ZU7B 2WXRA 2I6HA 3CVPA 4BEPA 3Q5MA 4B89A 5EX3A 4UUCA 4DRXE 3EHQA 3V2OA 1MJ0A 4EZJA 3EU5A 4F53A 3JCKC 4GPMA 3EIQC 4BTAA 2FEZA 3AG4E 5EN5D 1OWPA 5FJYA 2WXPA 4F1PA 1EF1C 3FH8A 2IONA 2H6IA 2M63A 1E7VA 4G1TA 4N2QA 3ML9A 4JC8A 3CQGB 4A1SA 4AM9A 3AG3E 5FTPA 2ETBA 4OYSA 1O1SA 3UQ3A 4WUYA 1K3ZD 4JXTA 4GTQA 4G8LA 5BV0A 4FJYA 5BXUA 1LD8A 3OXFA 3HXBA 5ANRA 1MZCA 3UIPC 1N11A 3LVQE 3DWLG 3SFXA 4CZ2D 4KYOB 4I2ZA 3PZ4A 2IU1A 4O60A 4MRUA 1XNFA 2HE0A 3DSSA 4GZCA 4CGWA 3PDNA 1QNFA 3FH5A 3MYVA 2OVBA 2EQXA 5EIBE 2FI7A 4BWRA 1E7UA 2GGFA 2FBNA 2ZGDA 4I9EA 4E6HA 2WXKA 3B7RL 5ENQD 1PAQA 3UM3A 1E90A 2AWIA 1E8WA 3PUJA 4K5CA 1N0QA 4ANVA 3CIAA 2ZISA 3PZDA 3C98A 3NZUA 4N5CA 2FF4A 1BU9A 4HXIA 2RFAA 2OEWA 5E76A 1TNUA 3HHMA 1QZ2A 3EJNA 2UY1A 3HXDA 4DI3A 1PY1A 5C2YA 4M7CA 3JQ0A
chains in the Genus database with same CATH topology
3L22A 3ESKA 2PQRA 4JA9A 4URKA 2MOWA 3LYAA 3BEEA 3NQPA 4W9RA 2KZTA 3D9MA 3Q47B 5HI7A 4FJZA 3K9IA 2FO7A 4JVSA 3ZFWA 1IQRA 3ZRHA 4EBAG 3SZ7A 2HO1A 2IJGX 3PEUB 2MHKA 4B0ZA 1ZBPA 2J4DA 4OVVA 5FQ4A 1INZA 3LS8A 4NACA 3AU4A 3CLJA 5CCMA 1PC2A 2ZU6B 5A7DB 4FU3A 3IV0A 2DBAA 2XRZA 3I5PA 3MJWA 4GA2A 4K03A 3S7BA 3CQCB 4N3BA 3APFA 4I6GA 2R5SA 4Q94A 3U3WA 4CDRA 3FULA 3MKRA 5HQ8A 2J9QA 3KD7A 4CGVA 1EDUA 2YHEA 2XGOA 3G2VA 3IEGA 4NURA 5D0QD 3T8MA 4AIFA 4EZKA 2Y3AA 5EDSA 1KT0A 4XX5A 2X6FA 2UY1B 4GYOA 4J8SA 3VTXA 3TL5A 1Z3XA 4UQYA 3Q4AB 1IQUA 1P5QA 1H0AA 4GMLA 3S7DA 4CT0A 4N3AA 3FUJA 5CCLA 4Q96A 3IKOB 4RSYA 4KVMA 4CDMA 2KZTB 3ML8A 1HO8A 2VYIA 1YA0A 2KC7A 2VQ2A 2WPVA 4FHJA 4JW1A 5ARGA 3FTZA 4R7LA 4BY6A 3MKQB 4Q69A 3TXNA 4LUNU 3D9IA 2IOSA 3GZ2A 4G2VA 5E75A 4GZ6A 3UMVA 5CMWA 3ASHA 1W3BA 1ELKA 2WQHA 5LCWJ 4J8EA 2XEVA 4J6IA 2LAHA 3CK9A 4BT9A 1WY6A 4I43A 2KATA 3E4BA 3FEYA 4P29A 5AYWD 3SFZA 3B7UX 3CR3A 1SZ9A 3U4TA 1ELWA 2A5UA 3FUMA 3OTNA 5G55A 3ZXSA 4E85A 4TRQA 5LCWC 3CVNA 1HH8A 4LEUA 2LNIA 4RG9A 1WAO1 3G2WA 4UWHA 4I2WA 2RG8A 4HOTA 3FH7A 3O4ZA 3CVQA 1VDYA 4ILIA 4HOQA 3SGHA 3TG4A 4CRWA 1HXIA 4BTBA 2X38A 2J49A 3CVYA 3JYSA 4JHJA 1HG2A 3ZYKA 1NA0A 3ASFA 3FTUA 4J8DA 4RVBA 3L54A 4F3VA 4WNDA 2HR2A 3D9NA 3ZYMA 5JJTA 3SBTB 4FC8A 3KS2A 5FZSA 2E0IA 3APCA 5FT9A 4EPZA 2XGMA 2JEKA 2J08A 2BF0X 2PQNA 1FCHA 5JJ7A 2VSYA 3QWPA 3QARA 2V5FA 5KCMA 1NA3A 2YNQA 3FTXA 4GPKA 2R17C 3UUXA 2WXOA 3CK7A 4DJAA 4UQXA 5ARFA 3GZSA 4U0UA 2VJ8A 4U63A 3TAXA 2VSOE 3I4GA 3QDNA 4IYPA 3VTYA 1OUVA 1LF8A 3BG1B 3L13A 2AVPA 4U8HA 4XKCA 3RKVA 3DPDA 2WMNA 4G25A 3ZIMA 3TGOA 1OWMA 3QC1A 2XPZA 4A1GA 2WXMA 3APDA 3FU6A 3KEZA 4YVQC 2V0PA 3TG5A 4AXHA 3GYZA 3T5XA 3I3NA 3AS4A 4I6EA 1XGWA 1H19A 5KJKA 3TXMA 2J07A 3Q49B 3CHMA 3U66A 3D9JA 2CG2A 4BX8A 3D9PA 1UN9A 4ME2A 3L17A 3OXGA 2CHXA 4ACLA 1N52A 3FTYA 4I6JA 3L6AA 4NQ0A 5KJLA 3RJVA 3LY8A 5A6CA 3MCXA 3VLFA 4CDNA 2WXHA 4GMJA 2IQCA 3URZA 4KBQA 2MRIA 4DLQA 3CK8A 3CKCA 3LPZA 4XI0A 4GZDA 2XHEA 3QKYA 1JPLA 4GA0A 5DIZA 5FQ7A 5G05J 3IHVA 3JUIA 2C0MA 4JZYA 3D9LA 1DVPA 5FQ8A 3CVVA 2WXJA 4BSXA 3PS6A 2HYZA 3HVEA 5KJNA 1EPUA 3MKQA 3VLEA 4C0MA 3EHNA 5G05C 4AY6A 2DIWA 3AS8A 4DK5A 4N3CA 4G11A 3R7RA 2KCKA 4IULA 5CHEE 2CHWA 3JQ1A 2E2EA 2NSZA 3B7TA 2X6IA 2VGYA 4ILGA 1HS6A 4L23A 3ZEFA 4ANUA 4XZ4A 3MA5A 5FZRA 4G23A 3OAWA 1Z3YA 3NF1A 3CHOA 5D0OD 4IN3B 4DI4A 4U04A 2I2OA 2WXQA 4PDXA 2GW1A 1HU3A 3HIZA 3NZSA 5LFAA 3EIJA 5ENNA 2J09A 2XGSA 4LCTA 2JLBA 1E8ZA 2Q7FA 2A4ZA 4B8CB 4AV7A 5FZQA 3FEXA 3RU0A 2VSNA 3UT8A 2X3MA 2Y4TA 4OVUA 2YHCA 3SNXA 4FULA 4K0RA 5T8IA 3SBSA 4YNDA 3FU0A 1UW4B 5BT1A 1Y8MA 5BUZA 4AEZC 2KCVA 3HVEB 4C0EA 3UT4A 2ILRA 4WNEA 3PREA 5T4YA 3FP3A 4ATGA 5JHAA 4N2SA 1H2VC 4ABNA 2KCLA 4TUUA 4I1AA 3U64A 4HVBA 3FUNA 3FUKA 5BV1A 4WNGA 3DBSA 4FA6A 1E96B 3QAQA 4ILHB 1TJFA 4F7AA 1H6KA 3FTSA 3CHSA 1HG5A 4U07A 3D9KA 2XQ0A 3CHPA 2L0IA 3RO2A 4C9BB 3HYMB 3P2BA 3ZPJA 3PUKA 4FHKA 2AXVA 2C2LA 2V8SE 4LERA 4O6FA 3P1UA 5ANLA 5C1DA 2VTBA 2J4BA 4QFVA 1B89A 3PRZA 4WNFA 5M72A 4WWPA 5T3RA 5J90A 1GW6A 3SI5A 2PL2A 3CGHA 4GCOA 3CV0A 3ASGA 4EQFA 4GZ3A 3PEVB 3FFLA 1NP7A 4L2YA 3QWWA 2IOLA 4Y6CA 2GRLA 4M3OA 2BTDA 2DCPA 4YVOA 3PNTB 3S7JA 3ONLA 5AENA 4I17A 3D9OA 3PNLB 1UN8A 2I1KA 4D10C 5CMYA 2XPIA 4MKTA 3LXUX 3PE3A 4I9CA 3EHMA 3UT7A 3G2TA 1ZU2A 5G04J 3QWVA 2X6KA 3RRUA 5A23A 2PZIA 5BPPA 4UWKA 4WAFA 2QFCA 3IHYA 3FY4A 1IYGA 5G04C 4ANWA 4HOUA 2VTBB 1MQSA 2NXPA 5EX0A 2WB2A 4FLBA 3RK6A 2XRYA 2ONDA 4ANXA 4L2LA 3ZVVA 3LJ3A 3LKUA 4GU5A 3RRNB 2AXUA 2RD0A 3ASDA 1H2TC 3FHEA 1OWNA 2L9BA 2LSUA 2WQ6A 4AP2A 1S0PA 4B94A 4RG6A 3FDHA 3ONKA 3ZW3A 3ULQA 4DPRA 3QB2A 4JL0A 4JEUA 3QK0A 4UWFA 4UI9K 2WXNA 3FU5A 4GZ5A 4AVXA 5AJDA 4UWLA 5AJLA 4HORA 3FTVA 2OVFA 2LAIA 3FUHA 3PVLA 2LO6A 3EDTB 2XCBA 3MX3A 1UJJA 2OV8A 3AS5A 2GRMA 3S7FA 1JWGA 4I1OB 2OOEA 3CHRA 3ZYLA 3UPVA 4HOSA 5BNWA 1UJKA 3QJZA 4GAAA 4KZCA 3B13A 4XKBA 5JJ6A 3R9AB 1Y6IA 3B7SA 2X6HA 3MGBA 4BX9A 5J08A 4JA7A 1E8XA 4L7TA 4XI9A 3FUIA 3CEQA 3MZLB 4BT8A 2I1JA 2WXRA 1KLXA 1X5BA 1SQMA 2I6HA 3CVPA 3KAEA 4PS7A 4U0SA 4A3VA 2CG3A 3ESLA 1WM5A 3Q5MA 4B89A 4V3IA 3ENEA 3PE4A 5EX3A 4F1SA 2WVIA 4PUCA 3G2UA 1HFAA 3CSFA 5LOZA 4WWNA 4EZJA 4PS3A 4PS8A 3FU3A 4UQZA 4F53A 3JCKC 1HZ4A 2PM6A 3EIQC 2IFUA 2QY7A 3R7QA 4BTAA 3S2AA 1QQEA 2FEZA 4KZ0A 4KVOA 3FWVA 4UWGA 4I1MA 3LY7A 3RO3A 1OWPA 4J0UA 2V4LA 4GYYA 5FJYA 2WXPA 1SZAA 2I9CA 3IBEA 4MLPA 2LSVA 4CT4A 3Q15A 4G26A 3QNKA 3ZHEA 1EF1C 3FH8A 3PH0C 4H7YA 1NZNA 2BUGA 2IONA 4L1BA 4XE0A 1H2UA 3SF4A 3WXXA 2M63A 1E7VA 2NC9A 1E8YA 3N71A 4G1TA 4N2QA 3ML9A 1ELRA 4JC8A 4CCAA 2CFZA 3MV2B 1KT1A 2YQ8A 1HF8A 3CQGB 4TV3A 3HDXA 3CVXA 3O48A 3CKBA 1HX8A 3RIBA 4A1SA 4AM9A 1HE8A 5G2NA 2L6JA 5FTPA 5AIJA 4FP7A 4KMOA 4OYSA 4JHRA 3UQ3A 4WUYA 1TEZA 4JXTA 5BV0A 3ZYQA 4FADA 4APOA 3GZ1A 4FJYA 1N54A 2AXZA 4GA1A 4IRUA 4LRZA 4EECA 4EZLA 2WMOA 4PH4B 1A17A 2R59A 3CVWA 1Z6TA 4U0ZA 3FTWA 4GB9A 2WXIA 2XCCA 4GYWA 3RRMB 1MHQA 2VGXA 4MS6A 3OXFA 3QOUA 5ANRA 5LX8A 2X6JA 1DNPA 2WQ7A 4JPSA 2C0LA 3LVQE 3ZHEB 3LVRE 4G24A 5JHBA 4KYOB 4I2ZA 4HLEA 1OWOA 2WXLA 3CHQA 5BW8C 2IU1A 4MRUA 1XNFA 4UI9J 3MEKA 2WXFA 4DLOA 4GZCA 4FLHA 3LCAA 2P58C 4CGWA 3BG0B 5DBKA 3PDNA 1QNFA 3FH5A 2HM8A 5KJMA 3MYVA 2L0TB 4Y6WA 2OVBA 4HS2A 4UI9C 1U3DA 2EQXA 4BFRA 3CSTA 2FI7A 5EKQD 4BWRA 1E7UA 2CHZA 3OXLA 3FUEA 5LP0A 1TJCA 1IHGA 1U3CA 2GGFA 2FBNA 3T5VA 4I9EA 1JWFA 2UWJG 3I4RB 4GCNA 4E6HA 1UG3A 2WXKA 3D3MA 3B7RL 3ZGQA 2FULA 4JHKA 4KT6B 3LEWA 1PAQA 2VGXB 2XPYA 4H7XA 3L16A 4APFA 3MV3B 1E90A 2AWIA 1FVFA 1E8WA 3PUJA 3AU5A 2Y4UA 4ANVA 5FWQA 2KM4A 2YINA 2PM7A 3FUFA 3L08A 4A55A 4AY5A 3ZN3A 3CIAA 4AOFA 3G2SA 4WWOA 3PZDA 3C98A 5FQ6A 3LDZA 3NZUA 2CFUA 1EYHA 4N5CA 2FF4A 1OWLA 2VSXE 2WXGA 4B8AA 3U9WA 4HXIA 3SD5A 4N39A 1BPOA 1FVHA 4HFGA 4J8FA 4JEHA 3CVLA 4ACKA 4NRHB 2AW6A 3SHFA 5E76A 1L5JA 2IF4A 2WM9A 3GW4A 3HHMA 3LY9A 3VLDA 1QZ2A 4AJWA 4XIFA 3UX4A 3TJPA 1JUQA 3EJNA 4A3TA 2UY1A 3FUDA 4KXKB 4DI3A 4EBAA 4CEMA 1PY1A 3CVUA 5C2YA 3JQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TXM A;  4LCT A;  3TXN A;  3T5X A;  3CHM A;  3JCK C;  4D10 C;  2MRI A; 
#chains in the Genus database with same CATH topology
 3ESK A;  2PQR A;  5FIN A;  3BEE A;  5HI7 A;  4FJZ A;  4HQD A;  2HO1 A;  3PEU B;  3TWQ A;  4B0Z A;  1INZ A;  5FQ4 A;  3DST A;  3AU4 A;  3I5P A;  1BI8 B;  3APF A;  4K5B A;  3MKR A;  5HQ8 A;  1AP7 A;  2J9Q A;  4CGV A;  1EDU A;  3T8M A;  3G2V A;  2Y3A A;  5EDS A;  1KT0 A;  4A63 B;  4GYO A;  1Z3X A;  3DSV A;  3BU8 A;  5CCL A;  3FUJ A;  4RSY A;  3IKO B;  1BLX B;  1HO8 A;  2VYI A;  1JCQ A;  4JW1 A;  3GZ2 A;  2J8S D;  5CMW A;  1W3B A;  2P9P G;  3NBN B;  3U4T A;  1ELW A;  3L82 A;  3OTN A;  5G55 A;  4LG6 A;  1HH8 A;  5HKP A;  4LEU A;  4RG9 A;  4HOT A;  3CVQ A;  4ILI A;  4EHM A;  2J49 A;  3CVY A;  3JYS A;  4YDW A;  3FTU A;  3L54 A;  4WND A;  2HR2 A;  2BKG A;  3KS2 A;  2E0I A;  5FT9 A;  5JJ7 A;  2VSY A;  3T9K A;  2V5F A;  2R17 C;  3UUX A;  4UQX A;  1YYH A;  5ARF A;  2VSO E;  4XKC A;  2WMN A;  4G25 A;  3UIN C;  3FU6 A;  4OAU C;  3TG5 A;  3DSX A;  3T5X A;  4I6E A;  2J07 A;  3Q49 B;  4BX8 A;  3D9P A;  4ME2 A;  3L17 A;  3OXG A;  4I6J A;  2Y0B G;  3VLF A;  4CDN A;  4GMJ A;  1OT8 A;  3C3Q A;  3JUI A;  4GTO A;  2C0M A;  3CVV A;  1DVP A;  4BSX A;  3MKQ A;  4C0M A;  2DIW A;  3AS8 A;  4G11 A;  5HS0 A;  3JQ1 A;  3RAU A;  2NSZ A;  2X6I A;  2VGY A;  2EIN E;  4XZ4 A;  2QC9 A;  3OAW A;  5D0O D;  3CHO A;  3C3R A;  4DI4 A;  3ASO E;  4U04 A;  2I2O A;  2WXQ A;  2J09 A;  2XGS A;  4LCT A;  1E8Z A;  4AV7 A;  4B8C B;  3EUV A;  5FZQ A;  3RU0 A;  2VSN A;  2R02 A;  4OVU A;  2YHC A;  3FU0 A;  1Y8M A;  4AEZ C;  3W9F A;  2KCV A;  4C0E A;  2JAB A;  1Z5S C;  3FP3 A;  5JHA A;  4ABN A;  4I1A A;  3C72 A;  5BV1 A;  4U07 A;  5CER B;  3HYM B;  2AXV A;  2C2L A;  1O1R A;  2V8S E;  3X2Q E;  5ANL A;  5C1D A;  3Q73 A;  1SW6 A;  3PRZ A;  4WNF A;  5CEC B;  1GW6 A;  2IOL A;  3ASN E;  2DCP A;  5CBN A;  3S7J A;  3ONL A;  3EHR A;  3PE3 A;  3SFY A;  1ZU2 A;  1K1B A;  3QWV A;  3DEO A;  3UKU G;  3V30 A;  3RRU A;  5CEA A;  2IY0 C;  2VGE A;  2NXP A;  1OY3 D;  5EX0 A;  2XRY A;  3LKU A;  3RRN B;  2F8Y A;  2RD0 A;  1S0P A;  3ULQ A;  4JEU A;  1IXV A;  4U7E B;  4UWL A;  5AJL A;  4HOR A;  3FTV A;  2LO6 A;  2OV8 A;  3AS5 A;  2EIL E;  3UPV A;  4HOS A;  5BNW A;  3QJZ A;  1Y6I A;  3B7S A;  4HI8 A;  1YMP A;  4BX9 A;  4L7T A;  3CEQ A;  4ZHB A;  1UOH A;  4BSZ B;  2DYS E;  1KLX A;  3KAE A;  2CG3 A;  4V3I A;  3ENE A;  1HFA A;  3CSF A;  2MYO A;  1FT1 A;  2V4H C;  4UQZ A;  3Q9U C;  1HZ4 A;  5AAR A;  3LY7 A;  3RO3 A;  2I9C A;  3ISM C;  4MLP A;  2LSV A;  3Q15 A;  4G26 A;  3AAA C;  3WXX A;  2NC9 A;  1E8Y A;  1TN6 A;  4CCA A;  1KT1 A;  2YQ8 A;  3CVX A;  3HDX A;  3O48 A;  3CKB A;  5G2N A;  3Q78 A;  2L6J A;  4FP7 A;  4FAD A;  4BES A;  4GA1 A;  2AXZ A;  4EZL A;  4PH4 B;  1A17 A;  3FTW A;  2PNN A;  4GB9 A;  1U2V G;  2WXI A;  2XCC A;  2F37 A;  2GRR B;  4G24 A;  4HLE A;  1OWO A;  2WXL A;  5BW8 C;  4DUI A;  3MEK A;  2WXF A;  3NOC D;  4DLO A;  2HM8 A;  5KJM A;  4HS2 A;  5FIO A;  4BFR A;  3CST A;  5EKQ D;  3FUE A;  1TJC A;  1U3C A;  3HG0 D;  4OAV B;  2BKK B;  3Q75 A;  2XPY A;  3L16 A;  4JB8 P;  2PM7 A;  3L08 A;  3G2S A;  3LDZ A;  1OWL A;  4B8A A;  3U9W A;  4N39 A;  4HFG A;  3CVL A;  4ACK A;  5KNH D;  3SHF A;  3B7B A;  2IF4 A;  3GW4 A;  3UX4 A;  2IO2 C;  1JUQ A;  3FUD A;  3LJN A;  4DX7 D;  4JA9 A;  3NQP A;  3ZFW A;  3K9I A;  2FO7 A;  3C5R A;  2IJG X;  2J4D A;  4OVV A;  5ITZ F;  4NAC A;  3CLJ A;  1PC2 A;  5A7D B;  2DBA A;  4ATZ D;  1K1A A;  4GTM A;  4N3B A;  4GTP A;  3R9M A;  1OCC E;  2XEN A;  2RKK A;  5B1B E;  3U3W A;  4CDR A;  2YHE A;  4NUR A;  3AG2 E;  4XX5 A;  3J5Q B;  4UQY A;  1IQU A;  3KEA A;  4GML A;  4CT0 A;  4N3A A;  2A5E A;  2KZT B;  3ML8 A;  4U95 D;  1YA0 A;  2KC7 A;  2R05 A;  5ARG A;  4FHJ A;  4BY6 A;  4Q69 A;  5CRU A;  2LUH A;  4G2V A;  5E75 A;  5LCW J;  4J8E A;  2XEV A;  3CK9 A;  2DYR E;  2KAT A;  5AYW D;  1SZ9 A;  2A5U A;  4TRQ A;  5LCW C;  3G2W A;  4I2W A;  4HOQ A;  4BTB A;  1OCR E;  5B3S E;  3ASF A;  4DX1 A;  4F3V A;  3D9N A;  2DZN A;  3ZYM A;  3JUE A;  3KSQ A;  5FZS A;  2XGM A;  2PQN A;  3QAR A;  5KCM A;  1NA3 A;  4GPK A;  4U63 A;  3QDN A;  3BUA A;  4IYP A;  1LF8 A;  3RKV A;  3DPD A;  3QC1 A;  4A1G A;  3APD A;  3KEZ A;  2V0P A;  1NI1 A;  3GYZ A;  3AS4 A;  1XGW A;  3JXJ A;  2CG2 A;  3E34 A;  1V55 E;  2QYJ A;  4GTT A;  3JXI A;  4Z68 A;  2CHX A;  1N52 A;  4NQ0 A;  5KJL A;  5CRV A;  3ABK E;  3LY8 A;  2WXH A;  3E37 A;  3CK8 A;  4XI0 A;  2QZA A;  2XHE A;  3D9L A;  2HYZ A;  3EHN A;  4AY6 A;  4RQI A;  3NB2 A;  2DWZ A;  5CHE E;  1QBQ A;  3B7T A;  5FZR A;  3MA5 A;  4G23 A;  4PDX A;  2GW1 A;  5LFA A;  5H7P A;  3FEX A;  3KSL A;  3UIO C;  4YND A;  1UW4 B;  5BUZ A;  3PZ2 A;  2R03 A;  3UT4 A;  2ILR A;  2AJA A;  4WNE A;  1TR4 A;  5T4Y A;  1H2V C;  2KCL A;  4TUU A;  4HVB A;  5ENS D;  3FUK A;  3DBS A;  1E96 B;  3FTS A;  2QYU A;  2L0I A;  4C9B B;  3P2B A;  3UXG A;  4TUM A;  3HXE A;  4WWP A;  5J90 A;  2PL2 A;  3CGH A;  3DSU A;  3ASG A;  3Q9N C;  4GZ3 A;  3PEV B;  1NP7 A;  3QWW A;  4Y6C A;  1Q2Z A;  3ABM E;  3D9O A;  5CMY A;  3LXU X;  3G2T A;  5A23 A;  1TNZ A;  5BPP A;  4WAF A;  3FY4 A;  5HRY A;  4ANW A;  2XEH A;  4K5A B;  1TN8 A;  4L2L A;  1DC2 A;  4YDO A;  2AXU A;  3ASD A;  1H2T C;  2LSU A;  2WQ6 A;  4B94 A;  4UWF A;  4DX2 A;  3FU5 A;  4AVX A;  4HRN A;  2XZD G;  5AJD A;  2OVF A;  3FUH A;  4HLL A;  3PVL A;  3EDT B;  1TNB A;  2XCB A;  4GTS A;  3CHR A;  2H6F A;  4GAA A;  3R9A B;  4KZC A;  5JJ6 A;  2X6H A;  3MGB A;  5J08 A;  4RLY A;  1NFI E;  4BT8 A;  2I1J A;  1SQM A;  1H6O A;  4U0S A;  3ESL A;  1WM5 A;  4F1S A;  2WVI A;  3G2U A;  5LOZ A;  1S70 B;  4WWN A;  4PS3 A;  4PS8 A;  3FU3 A;  1LD7 A;  1SA4 A;  2PM6 A;  3E30 A;  2QY7 A;  3S2A A;  1QQE A;  3TWV A;  4KVO A;  2XS8 A;  3FWV A;  4UWG A;  4I1M A;  3PZ1 A;  4TXP A;  1H6P A;  4J0U A;  2R2L A;  1MYO A;  4CT4 A;  1MX2 A;  3PH0 C;  2BUG A;  1H2U A;  5IY5 E;  1ELR A;  2KBX A;  1HF8 A;  4TV3 A;  2ZGG A;  1HE8 A;  5AIJ A;  4JHR A;  4APO A;  3GZ1 A;  1N4R A;  3TWU A;  4IRU A;  2XZT G;  3SQV A;  3CVW A;  1Z6T A;  4U0Z A;  3W9G A;  3RRM B;  3AG1 E;  2P9N G;  1MHQ A;  4MS6 A;  5LX8 A;  1DNP A;  4JPS A;  2C0L A;  3ZHE B;  4GTR A;  5JHB A;  3CHQ A;  4UI9 J;  1K8K G;  4FLH A;  2P58 C;  5DBK A;  1TYQ G;  5AQ7 A;  2ZXW E;  4UI9 C;  1IKN D;  2CHZ A;  3OXL A;  3T5V A;  1AWC B;  2EIM E;  3I4R B;  4GCN A;  2H6H A;  5KBA A;  1UG3 A;  3D3M A;  3ZGQ A;  2FUL A;  4KT6 B;  2XEE A;  2VGX B;  4APF A;  4C48 B;  2GRO B;  3FUF A;  3UM0 A;  1S64 A;  4AOF A;  3Q79 A;  2CFU A;  2VSX E;  3SD5 A;  1BPO A;  4J8F A;  4JEH A;  4NRH B;  1BD8 A;  2WM9 A;  3PZ3 A;  1OXJ A;  4F6R D;  4XIF A;  4A3T A;  4EBA A;  3D9H A;  3MJW A;  1DCE A;  3CVU A;  3TWT A;  3L22 A;  1TNO A;  4URK A;  2KZT A;  3D9M A;  1IQR A;  4EBA G;  3SZ7 A;  2XS1 A;  3EU9 A;  3LS8 A;  5CCM A;  2ZU6 B;  2XRZ A;  3S7B A;  3CQC B;  4TXQ A;  2P9S G;  4MBG A;  5CBO A;  4Q94 A;  3FUL A;  3KD7 A;  5ENT D;  1FT2 A;  4EZK A;  2X6F A;  3VTX A;  1N9A A;  1P5Q A;  4Q96 A;  2VQ2 A;  3FTZ A;  3F6Q A;  4U8V D;  3MKQ B;  3TXN A;  4LUN U;  3D9I A;  2IOS A;  4LSZ E;  4GZ6 A;  3ASH A;  4J6I A;  4BT9 A;  1WY6 A;  4I43 A;  3E4B A;  3FEY A;  3B7U X;  4E85 A;  5EYP F;  2RG8 A;  3SGH A;  4CRW A;  3TG4 A;  2X38 A;  1HG2 A;  3ZYK A;  1N4P A;  1NA0 A;  4J8D A;  4RVB A;  1SA5 A;  5JJT A;  1V54 E;  3SBT B;  2JEK A;  2J08 A;  3QWP A;  3L9T A;  2YNQ A;  3DXM G;  3CK7 A;  3GZS A;  2EIK E;  3TAX A;  3I4G A;  3VTY A;  3BG1 B;  2AVP A;  3ZIM A;  2XPZ A;  4YVQ C;  3I3N A;  1OCO E;  2B0O E;  4J7W A;  5KJK A;  3CHM A;  3U66 A;  3D9J A;  3HRA A;  4BET A;  1UN9 A;  2LXL A;  3V2X A;  3L6A A;  3RJV A;  2IQC A;  3TWX A;  3CKC A;  3LPZ A;  4GZD A;  3QKY A;  1JPL A;  5JMN D;  5DIZ A;  5G05 J;  5BXO A;  1FPP A;  2WXJ A;  3PS6 A;  3VLE A;  2F0Y A;  5G05 C;  1N4S A;  4DK5 A;  2V5Q C;  2CHW A;  2E2E A;  4ILG A;  1HS6 A;  3ZEF A;  4ANU A;  1N95 A;  3Q7F A;  3HIZ A;  3EIJ A;  5ENN A;  2JLB A;  2A4Z A;  2X3M A;  2Y4T A;  3SNX A;  4K0R A;  5T8I A;  1A5E A;  5KNG A;  2L6B A;  5B1A E;  3HVE B;  2P9U G;  3PRE A;  4HBD A;  3U64 A;  1KPS B;  4LNG A;  2FO1 E;  4FA6 A;  1TJF A;  1BI7 B;  3CHS A;  2XQ0 A;  3CHP A;  5ENO D;  3ZPJ A;  4FHK A;  3UKR G;  3P1U A;  2GRN B;  4QFV A;  1B89 A;  2IO3 C;  5M72 A;  5EIL A;  3SI5 A;  4GCO A;  3CV0 A;  3FFL A;  4L2Y A;  1JCR A;  4M3O A;  4LNB A;  2BTD A;  4YVO A;  5AEN A;  3PNL B;  1UN8 A;  2I1K A;  2ZIR A;  4HI9 A;  1D9S A;  3EHM A;  3ZKJ A;  2X6K A;  4HOU A;  2VTB B;  1MQS A;  2WB2 A;  1N4Q A;  2OND A;  4ANX A;  3ZVV A;  4GU5 A;  3FDH A;  4DPR A;  4JL0 A;  4XEI G;  3QK0 A;  4UI9 K;  4GZ5 A;  2LAI A;  4LNU D;  3TWW A;  1TN7 A;  3Q7A A;  3S7F A;  2F8X K;  4I1O B;  3ZYL A;  1UJK A;  4XKB A;  3ZUV B;  3B13 A;  4QQI A;  3MZL B;  1MX6 A;  1X5B A;  4PS7 A;  4A3V A;  3PE4 A;  4PUC A;  5D66 A;  2IFU A;  3DRA A;  3R7Q A;  4KZ0 A;  2V4L A;  4GYY A;  1SZA A;  2IEJ A;  3IBE A;  3QNK A;  3ZHE A;  4H7Y A;  1NZN A;  4L1B A;  4XE0 A;  3SF4 A;  3DSW A;  1S63 A;  3N71 A;  3RSE G;  2CFZ A;  3MV2 B;  3HXF A;  1HX8 A;  4CYM D;  1DCQ A;  3RIB A;  2DVW A;  2P9K G;  4KMO A;  1TEZ A;  3SY2 A;  3ZYQ A;  3NOG D;  1N54 A;  4EEC A;  4LRZ A;  2P2C P;  2WMO A;  2R59 A;  2OCC E;  4G8K A;  4GYW A;  2VGX A;  3QOU A;  5AQA A;  2X6J A;  4DX6 D;  2WQ7 A;  3LVR E;  1RW2 A;  5CED B;  3LCA A;  3BG0 B;  3B95 A;  2LXM A;  2L0T B;  4Y6W A;  1U3D A;  2Y69 E;  2RFM A;  3UM2 A;  2P9I G;  3IXE A;  2ETC A;  5LP0 A;  1IHG A;  4HNA D;  1JWF A;  3BQO A;  2UWJ G;  4X8Q A;  4JHK A;  3LEW A;  4H7X A;  3MV3 B;  1FVF A;  3AU5 A;  2Y4U A;  3ULY A;  5FWQ A;  2KM4 A;  2YIN A;  4A55 A;  4AY5 A;  3ZN3 A;  3DEP A;  4WWO A;  5FQ6 A;  1EYH A;  2WXG A;  5ENP D;  1FVH A;  1KZP A;  4HRM B;  2AW6 A;  1TNY A;  1L5J A;  3LY9 A;  3VLD A;  2B6C A;  4DX5 D;  4AJW A;  3DXK G;  3TJP A;  3J5P A;  4KXK B;  4CEM A;  5AQ9 A;  3ULE G;  2MOW A;  3LYA A;  4W9R A;  3Q47 B;  4JVS A;  4B93 B;  3ZRH A;  2MHK A;  1ZBP A;  4HB5 A;  2GRQ B;  1RZ4 A;  1D8E A;  4FU3 A;  3IV0 A;  4GA2 A;  4K03 A;  4I6G A;  2R5S A;  2XGO A;  3IEG A;  5D0Q D;  4AIF A;  4ZFH A;  2UY1 B;  4J8S A;  3TL5 A;  3Q4A B;  1H0A A;  3S7D A;  2ETA A;  4KVM A;  4CDM A;  3E33 A;  2WPV A;  4R7L A;  3UMV A;  4HRL A;  1ZB1 A;  3ZXP A;  1ELK A;  2WQH A;  3WG7 E;  2H6G A;  2LAH A;  1G3N B;  4P29 A;  3SFZ A;  3NAW A;  3CR3 A;  3FUM A;  3ZXS A;  3CVN A;  2LNI A;  4N5Q A;  1WAO 1;  4UWH A;  3FH7 A;  2GRP B;  3O4Z A;  1VDY A;  4JD2 G;  5JA4 D;  1HXI A;  5AN8 A;  5EYL A;  4JHJ A;  4GMR A;  4FC8 A;  3APC A;  2P9L G;  4EPZ A;  3HXC A;  4GTV A;  5AQB A;  2BF0 X;  1FCH A;  4TXR A;  3FTX A;  2WXO A;  4DJA A;  4U0U A;  2VJ8 A;  1OUV A;  3L13 A;  4U8H A;  1X81 A;  3TGO A;  1OWM A;  2WXM A;  4AXH A;  1WDY A;  5KWD A;  1H19 A;  3TXM A;  3T8K A;  1MX4 A;  3SO8 A;  1QYM A;  5EID A;  4ACL A;  3AJI A;  3FTY A;  4J8Y A;  1YCS B;  5A6C A;  3MCX A;  3URZ A;  4KBQ A;  2MRI A;  4DLQ A;  1O5M A;  4GA0 A;  5ENR D;  5FQ7 A;  3IHV A;  4JZY A;  5FQ8 A;  3DPY A;  3HVE A;  5KJN A;  1EPU A;  3ABL E;  2OEV A;  2EIJ E;  4N3C A;  3R7R A;  2KCK A;  4IUL A;  4L23 A;  1LTX A;  1Z3Y A;  3NF1 A;  4IN3 B;  1HU3 A;  3NZS A;  4YDY A;  3V31 A;  2Q7F A;  3UM1 A;  3UT8 A;  4FUL A;  1OCZ E;  3SBS A;  5BT1 A;  3TWS A;  1IHB A;  4ATG A;  4N2S A;  3FUN A;  1WG0 A;  4WNG A;  3QAQ A;  4ILH B;  4F7A A;  1H6K A;  3ZNG A;  1HG5 A;  3D9K A;  4U8Y D;  3RO2 A;  4O1P A;  2Y1L E;  2KXP C;  1JCS A;  3PUK A;  1NL4 A;  4LER A;  4O6F A;  2VTB A;  2J4B A;  5AAO A;  2DZO A;  5T3R A;  4O1O A;  4EQF A;  2GRL A;  3PNT B;  4I17 A;  1O1T A;  4D10 C;  1SVX A;  2XPI A;  4MKT A;  4I9C A;  3UT7 A;  4BER A;  5G04 J;  3E32 A;  2PZI A;  4UWK A;  2QFC A;  3IHY A;  1IYG A;  5G04 C;  1KZO A;  1N0R A;  4FLB A;  3RK6 A;  3LJ3 A;  3C3O A;  3FHE A;  1OWN A;  2L9B A;  4AP2 A;  5D2M C;  4RG6 A;  3ONK A;  3ZW3 A;  3UTM A;  3QB2 A;  1D8D A;  2WXN A;  3V79 K;  4NIK A;  3UI2 A;  3MX3 A;  1UJJ A;  3TWR A;  2GRM A;  4YDE A;  1JWG A;  2OOE A;  2BED A;  2NYJ A;  4L9P A;  1N94 A;  4JA7 A;  1E8X A;  4XI9 A;  3FUI A;  4U96 D;  3ZU7 B;  2WXR A;  2I6H A;  3CVP A;  4BEP A;  3Q5M A;  4B89 A;  5EX3 A;  4UUC A;  4DRX E;  3EHQ A;  3V2O A;  1MJ0 A;  4EZJ A;  3EU5 A;  4F53 A;  3JCK C;  4GPM A;  3EIQ C;  4BTA A;  2FEZ A;  3AG4 E;  5EN5 D;  1OWP A;  5FJY A;  2WXP A;  4F1P A;  1EF1 C;  3FH8 A;  2ION A;  2H6I A;  2M63 A;  1E7V A;  4G1T A;  4N2Q A;  3ML9 A;  4JC8 A;  3CQG B;  4A1S A;  4AM9 A;  3AG3 E;  5FTP A;  2ETB A;  4OYS A;  1O1S A;  3UQ3 A;  4WUY A;  1K3Z D;  4JXT A;  4GTQ A;  4G8L A;  5BV0 A;  4FJY A;  5BXU A;  1LD8 A;  3OXF A;  3HXB A;  5ANR A;  1MZC A;  3UIP C;  1N11 A;  3LVQ E;  3DWL G;  3SFX A;  4CZ2 D;  4KYO B;  4I2Z A;  3PZ4 A;  2IU1 A;  4O60 A;  4MRU A;  1XNF A;  2HE0 A;  3DSS A;  4GZC A;  4CGW A;  3PDN A;  1QNF A;  3FH5 A;  3MYV A;  2OVB A;  2EQX A;  5EIB E;  2FI7 A;  4BWR A;  1E7U A;  2GGF A;  2FBN A;  2ZGD A;  4I9E A;  4E6H A;  2WXK A;  3B7R L;  5ENQ D;  1PAQ A;  3UM3 A;  1E90 A;  2AWI A;  1E8W A;  3PUJ A;  4K5C A;  1N0Q A;  4ANV A;  3CIA A;  2ZIS A;  3PZD A;  3C98 A;  3NZU A;  4N5C A;  2FF4 A;  1BU9 A;  4HXI A;  2RFA A;  2OEW A;  5E76 A;  1TNU A;  3HHM A;  1QZ2 A;  3EJN A;  2UY1 A;  3HXD A;  4DI3 A;  1PY1 A;  5C2Y A;  4M7C A;  3JQ0 A; 
#chains in the Genus database with same CATH homology
 3L22 A;  3ESK A;  2PQR A;  4JA9 A;  4URK A;  2MOW A;  3LYA A;  3BEE A;  3NQP A;  4W9R A;  2KZT A;  3D9M A;  3Q47 B;  5HI7 A;  4FJZ A;  3K9I A;  2FO7 A;  4JVS A;  3ZFW A;  1IQR A;  3ZRH A;  4EBA G;  3SZ7 A;  2HO1 A;  2IJG X;  3PEU B;  2MHK A;  4B0Z A;  1ZBP A;  2J4D A;  4OVV A;  5FQ4 A;  1INZ A;  3LS8 A;  4NAC A;  3AU4 A;  3CLJ A;  5CCM A;  1PC2 A;  2ZU6 B;  5A7D B;  4FU3 A;  3IV0 A;  2DBA A;  2XRZ A;  3I5P A;  3MJW A;  4GA2 A;  4K03 A;  3S7B A;  3CQC B;  4N3B A;  3APF A;  4I6G A;  2R5S A;  4Q94 A;  3U3W A;  4CDR A;  3FUL A;  3MKR A;  5HQ8 A;  2J9Q A;  3KD7 A;  4CGV A;  1EDU A;  2YHE A;  2XGO A;  3G2V A;  3IEG A;  4NUR A;  5D0Q D;  3T8M A;  4AIF A;  4EZK A;  2Y3A A;  5EDS A;  1KT0 A;  4XX5 A;  2X6F A;  2UY1 B;  4GYO A;  4J8S A;  3VTX A;  3TL5 A;  1Z3X A;  4UQY A;  3Q4A B;  1IQU A;  1P5Q A;  1H0A A;  4GML A;  3S7D A;  4CT0 A;  4N3A A;  3FUJ A;  5CCL A;  4Q96 A;  3IKO B;  4RSY A;  4KVM A;  4CDM A;  2KZT B;  3ML8 A;  1HO8 A;  2VYI A;  1YA0 A;  2KC7 A;  2VQ2 A;  2WPV A;  4FHJ A;  4JW1 A;  5ARG A;  3FTZ A;  4R7L A;  4BY6 A;  3MKQ B;  4Q69 A;  3TXN A;  4LUN U;  3D9I A;  2IOS A;  3GZ2 A;  4G2V A;  5E75 A;  4GZ6 A;  3UMV A;  5CMW A;  3ASH A;  1W3B A;  1ELK A;  2WQH A;  5LCW J;  4J8E A;  2XEV A;  4J6I A;  2LAH A;  3CK9 A;  4BT9 A;  1WY6 A;  4I43 A;  2KAT A;  3E4B A;  3FEY A;  4P29 A;  5AYW D;  3SFZ A;  3B7U X;  3CR3 A;  1SZ9 A;  3U4T A;  1ELW A;  2A5U A;  3FUM A;  3OTN A;  5G55 A;  3ZXS A;  4E85 A;  4TRQ A;  5LCW C;  3CVN A;  1HH8 A;  4LEU A;  2LNI A;  4RG9 A;  1WAO 1;  3G2W A;  4UWH A;  4I2W A;  2RG8 A;  4HOT A;  3FH7 A;  3O4Z A;  3CVQ A;  1VDY A;  4ILI A;  4HOQ A;  3SGH A;  3TG4 A;  4CRW A;  1HXI A;  4BTB A;  2X38 A;  2J49 A;  3CVY A;  3JYS A;  4JHJ A;  1HG2 A;  3ZYK A;  1NA0 A;  3ASF A;  3FTU A;  4J8D A;  4RVB A;  3L54 A;  4F3V A;  4WND A;  2HR2 A;  3D9N A;  3ZYM A;  5JJT A;  3SBT B;  4FC8 A;  3KS2 A;  5FZS A;  2E0I A;  3APC A;  5FT9 A;  4EPZ A;  2XGM A;  2JEK A;  2J08 A;  2BF0 X;  2PQN A;  1FCH A;  5JJ7 A;  2VSY A;  3QWP A;  3QAR A;  2V5F A;  5KCM A;  1NA3 A;  2YNQ A;  3FTX A;  4GPK A;  2R17 C;  3UUX A;  2WXO A;  3CK7 A;  4DJA A;  4UQX A;  5ARF A;  3GZS A;  4U0U A;  2VJ8 A;  4U63 A;  3TAX A;  2VSO E;  3I4G A;  3QDN A;  4IYP A;  3VTY A;  1OUV A;  1LF8 A;  3BG1 B;  3L13 A;  2AVP A;  4U8H A;  4XKC A;  3RKV A;  3DPD A;  2WMN A;  4G25 A;  3ZIM A;  3TGO A;  1OWM A;  3QC1 A;  2XPZ A;  4A1G A;  2WXM A;  3APD A;  3FU6 A;  3KEZ A;  4YVQ C;  2V0P A;  3TG5 A;  4AXH A;  3GYZ A;  3T5X A;  3I3N A;  3AS4 A;  4I6E A;  1XGW A;  1H19 A;  5KJK A;  3TXM A;  2J07 A;  3Q49 B;  3CHM A;  3U66 A;  3D9J A;  2CG2 A;  4BX8 A;  3D9P A;  1UN9 A;  4ME2 A;  3L17 A;  3OXG A;  2CHX A;  4ACL A;  1N52 A;  3FTY A;  4I6J A;  3L6A A;  4NQ0 A;  5KJL A;  3RJV A;  3LY8 A;  5A6C A;  3MCX A;  3VLF A;  4CDN A;  2WXH A;  4GMJ A;  2IQC A;  3URZ A;  4KBQ A;  2MRI A;  4DLQ A;  3CK8 A;  3CKC A;  3LPZ A;  4XI0 A;  4GZD A;  2XHE A;  3QKY A;  1JPL A;  4GA0 A;  5DIZ A;  5FQ7 A;  5G05 J;  3IHV A;  3JUI A;  2C0M A;  4JZY A;  3D9L A;  1DVP A;  5FQ8 A;  3CVV A;  2WXJ A;  4BSX A;  3PS6 A;  2HYZ A;  3HVE A;  5KJN A;  1EPU A;  3MKQ A;  3VLE A;  4C0M A;  3EHN A;  5G05 C;  4AY6 A;  2DIW A;  3AS8 A;  4DK5 A;  4N3C A;  4G11 A;  3R7R A;  2KCK A;  4IUL A;  5CHE E;  2CHW A;  3JQ1 A;  2E2E A;  2NSZ A;  3B7T A;  2X6I A;  2VGY A;  4ILG A;  1HS6 A;  4L23 A;  3ZEF A;  4ANU A;  4XZ4 A;  3MA5 A;  5FZR A;  4G23 A;  3OAW A;  1Z3Y A;  3NF1 A;  3CHO A;  5D0O D;  4IN3 B;  4DI4 A;  4U04 A;  2I2O A;  2WXQ A;  4PDX A;  2GW1 A;  1HU3 A;  3HIZ A;  3NZS A;  5LFA A;  3EIJ A;  5ENN A;  2J09 A;  2XGS A;  4LCT A;  2JLB A;  1E8Z A;  2Q7F A;  2A4Z A;  4B8C B;  4AV7 A;  5FZQ A;  3FEX A;  3RU0 A;  2VSN A;  3UT8 A;  2X3M A;  2Y4T A;  4OVU A;  2YHC A;  3SNX A;  4FUL A;  4K0R A;  5T8I A;  3SBS A;  4YND A;  3FU0 A;  1UW4 B;  5BT1 A;  1Y8M A;  5BUZ A;  4AEZ C;  2KCV A;  3HVE B;  4C0E A;  3UT4 A;  2ILR A;  4WNE A;  3PRE A;  5T4Y A;  3FP3 A;  4ATG A;  5JHA A;  4N2S A;  1H2V C;  4ABN A;  2KCL A;  4TUU A;  4I1A A;  3U64 A;  4HVB A;  3FUN A;  3FUK A;  5BV1 A;  4WNG A;  3DBS A;  4FA6 A;  1E96 B;  3QAQ A;  4ILH B;  1TJF A;  4F7A A;  1H6K A;  3FTS A;  3CHS A;  1HG5 A;  4U07 A;  3D9K A;  2XQ0 A;  3CHP A;  2L0I A;  3RO2 A;  4C9B B;  3HYM B;  3P2B A;  3ZPJ A;  3PUK A;  4FHK A;  2AXV A;  2C2L A;  2V8S E;  4LER A;  4O6F A;  3P1U A;  5ANL A;  5C1D A;  2VTB A;  2J4B A;  4QFV A;  1B89 A;  3PRZ A;  4WNF A;  5M72 A;  4WWP A;  5T3R A;  5J90 A;  1GW6 A;  3SI5 A;  2PL2 A;  3CGH A;  4GCO A;  3CV0 A;  3ASG A;  4EQF A;  4GZ3 A;  3PEV B;  3FFL A;  1NP7 A;  4L2Y A;  3QWW A;  2IOL A;  4Y6C A;  2GRL A;  4M3O A;  2BTD A;  2DCP A;  4YVO A;  3PNT B;  3S7J A;  3ONL A;  5AEN A;  4I17 A;  3D9O A;  3PNL B;  1UN8 A;  2I1K A;  4D10 C;  5CMY A;  2XPI A;  4MKT A;  3LXU X;  3PE3 A;  4I9C A;  3EHM A;  3UT7 A;  3G2T A;  1ZU2 A;  5G04 J;  3QWV A;  2X6K A;  3RRU A;  5A23 A;  2PZI A;  5BPP A;  4UWK A;  4WAF A;  2QFC A;  3IHY A;  3FY4 A;  1IYG A;  5G04 C;  4ANW A;  4HOU A;  2VTB B;  1MQS A;  2NXP A;  5EX0 A;  2WB2 A;  4FLB A;  3RK6 A;  2XRY A;  2OND A;  4ANX A;  4L2L A;  3ZVV A;  3LJ3 A;  3LKU A;  4GU5 A;  3RRN B;  2AXU A;  2RD0 A;  3ASD A;  1H2T C;  3FHE A;  1OWN A;  2L9B A;  2LSU A;  2WQ6 A;  4AP2 A;  1S0P A;  4B94 A;  4RG6 A;  3FDH A;  3ONK A;  3ZW3 A;  3ULQ A;  4DPR A;  3QB2 A;  4JL0 A;  4JEU A;  3QK0 A;  4UWF A;  4UI9 K;  2WXN A;  3FU5 A;  4GZ5 A;  4AVX A;  5AJD A;  4UWL A;  5AJL A;  4HOR A;  3FTV A;  2OVF A;  2LAI A;  3FUH A;  3PVL A;  2LO6 A;  3EDT B;  2XCB A;  3MX3 A;  1UJJ A;  2OV8 A;  3AS5 A;  2GRM A;  3S7F A;  1JWG A;  4I1O B;  2OOE A;  3CHR A;  3ZYL A;  3UPV A;  4HOS A;  5BNW A;  1UJK A;  3QJZ A;  4GAA A;  4KZC A;  3B13 A;  4XKB A;  5JJ6 A;  3R9A B;  1Y6I A;  3B7S A;  2X6H A;  3MGB A;  4BX9 A;  5J08 A;  4JA7 A;  1E8X A;  4L7T A;  4XI9 A;  3FUI A;  3CEQ A;  3MZL B;  4BT8 A;  2I1J A;  2WXR A;  1KLX A;  1X5B A;  1SQM A;  2I6H A;  3CVP A;  3KAE A;  4PS7 A;  4U0S A;  4A3V A;  2CG3 A;  3ESL A;  1WM5 A;  3Q5M A;  4B89 A;  4V3I A;  3ENE A;  3PE4 A;  5EX3 A;  4F1S A;  2WVI A;  4PUC A;  3G2U A;  1HFA A;  3CSF A;  5LOZ A;  4WWN A;  4EZJ A;  4PS3 A;  4PS8 A;  3FU3 A;  4UQZ A;  4F53 A;  3JCK C;  1HZ4 A;  2PM6 A;  3EIQ C;  2IFU A;  2QY7 A;  3R7Q A;  4BTA A;  3S2A A;  1QQE A;  2FEZ A;  4KZ0 A;  4KVO A;  3FWV A;  4UWG A;  4I1M A;  3LY7 A;  3RO3 A;  1OWP A;  4J0U A;  2V4L A;  4GYY A;  5FJY A;  2WXP A;  1SZA A;  2I9C A;  3IBE A;  4MLP A;  2LSV A;  4CT4 A;  3Q15 A;  4G26 A;  3QNK A;  3ZHE A;  1EF1 C;  3FH8 A;  3PH0 C;  4H7Y A;  1NZN A;  2BUG A;  2ION A;  4L1B A;  4XE0 A;  1H2U A;  3SF4 A;  3WXX A;  2M63 A;  1E7V A;  2NC9 A;  1E8Y A;  3N71 A;  4G1T A;  4N2Q A;  3ML9 A;  1ELR A;  4JC8 A;  4CCA A;  2CFZ A;  3MV2 B;  1KT1 A;  2YQ8 A;  1HF8 A;  3CQG B;  4TV3 A;  3HDX A;  3CVX A;  3O48 A;  3CKB A;  1HX8 A;  3RIB A;  4A1S A;  4AM9 A;  1HE8 A;  5G2N A;  2L6J A;  5FTP A;  5AIJ A;  4FP7 A;  4KMO A;  4OYS A;  4JHR A;  3UQ3 A;  4WUY A;  1TEZ A;  4JXT A;  5BV0 A;  3ZYQ A;  4FAD A;  4APO A;  3GZ1 A;  4FJY A;  1N54 A;  2AXZ A;  4GA1 A;  4IRU A;  4LRZ A;  4EEC A;  4EZL A;  2WMO A;  4PH4 B;  1A17 A;  2R59 A;  3CVW A;  1Z6T A;  4U0Z A;  3FTW A;  4GB9 A;  2WXI A;  2XCC A;  4GYW A;  3RRM B;  1MHQ A;  2VGX A;  4MS6 A;  3OXF A;  3QOU A;  5ANR A;  5LX8 A;  2X6J A;  1DNP A;  2WQ7 A;  4JPS A;  2C0L A;  3LVQ E;  3ZHE B;  3LVR E;  4G24 A;  5JHB A;  4KYO B;  4I2Z A;  4HLE A;  1OWO A;  2WXL A;  3CHQ A;  5BW8 C;  2IU1 A;  4MRU A;  1XNF A;  4UI9 J;  3MEK A;  2WXF A;  4DLO A;  4GZC A;  4FLH A;  3LCA A;  2P58 C;  4CGW A;  3BG0 B;  5DBK A;  3PDN A;  1QNF A;  3FH5 A;  2HM8 A;  5KJM A;  3MYV A;  2L0T B;  4Y6W A;  2OVB A;  4HS2 A;  4UI9 C;  1U3D A;  2EQX A;  4BFR A;  3CST A;  2FI7 A;  5EKQ D;  4BWR A;  1E7U A;  2CHZ A;  3OXL A;  3FUE A;  5LP0 A;  1TJC A;  1IHG A;  1U3C A;  2GGF A;  2FBN A;  3T5V A;  4I9E A;  1JWF A;  2UWJ G;  3I4R B;  4GCN A;  4E6H A;  1UG3 A;  2WXK A;  3D3M A;  3B7R L;  3ZGQ A;  2FUL A;  4JHK A;  4KT6 B;  3LEW A;  1PAQ A;  2VGX B;  2XPY A;  4H7X A;  3L16 A;  4APF A;  3MV3 B;  1E90 A;  2AWI A;  1FVF A;  1E8W A;  3PUJ A;  3AU5 A;  2Y4U A;  4ANV A;  5FWQ A;  2KM4 A;  2YIN A;  2PM7 A;  3FUF A;  3L08 A;  4A55 A;  4AY5 A;  3ZN3 A;  3CIA A;  4AOF A;  3G2S A;  4WWO A;  3PZD A;  3C98 A;  5FQ6 A;  3LDZ A;  3NZU A;  2CFU A;  1EYH A;  4N5C A;  2FF4 A;  1OWL A;  2VSX E;  2WXG A;  4B8A A;  3U9W A;  4HXI A;  3SD5 A;  4N39 A;  1BPO A;  1FVH A;  4HFG A;  4J8F A;  4JEH A;  3CVL A;  4ACK A;  4NRH B;  2AW6 A;  3SHF A;  5E76 A;  1L5J A;  2IF4 A;  2WM9 A;  3GW4 A;  3HHM A;  3LY9 A;  3VLD A;  1QZ2 A;  4AJW A;  4XIF A;  3UX4 A;  3TJP A;  1JUQ A;  3EJN A;  4A3T A;  2UY1 A;  3FUD A;  4KXK B;  4DI3 A;  4EBA A;  4CEM A;  1PY1 A;  3CVU A;  5C2Y A;  3JQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...