3RK6A

Crystal structure of the middle domain of human paip1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
217
structure length
217
Chain Sequence
TLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLKLVELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the middle domain of human poly(A)-binding protein-interacting protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation regulator
molecule keywords Polyadenylate-binding protein-interacting protein 1
total genus 85
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rk6A00
3FEYA 1H6KA 5ANRA 2KZTB 3EIQC 2IU1A 4CT4A 4JHKA 3JUIA 1N54A 2VSOE 1N52A 2ZU6B 1H2VC 2GGFA 2HM8A 2I2OA 4B89A 2IOSA 2NSZA 3RK6A 4B8AA 2IOLA 2VSXE 4IULA 4GMJA 1HU3A 2IONA 1UW4B 4LUNU 3D3MA 4CRWA 4JHJA 3EIJA 3FEXA 4C9BB 4B8CB 1PAQA 2FULA 1H2TC 1UG3A 3L6AA 4CEMA 4GMLA 1H2UA 2KZTA 2RG8A
chains in the Genus database with same CATH superfamily
1RW2A 3IEGA 2LXMA 3F6QA 1KT1A 2ILRA 4HOSA 2XCCA 3FU3A 4CDNA 2WXLA 2PL2A 4UWFA 2WQ7A 4A3VA 1N95A 4OVUA 3L22A 4FP7A 2XZDG 5KJMA 1PC2A 3ZYMA 1NA0A 1TNZA 3CVYA 3ZXSA 5CECB 1O1RA 3FDHA 1TJCA 3KD7A 4GAAA 1HO8A 2XPZA 3OAWA 1BLXB 3UX4A 5CEDB 3CVXA 3P1UA 1UJKA 2C2LA 3EDTB 5IY5E 3LJNA 4PS3A 2YQ8A 4C9BB 5BV0A 3RKVA 3UKRG 3RRUA 3ZYLA 3QWVA 3CGHA 3MKRA 2KZTB 4LNGA 3ZUVB 3BUAA 1HX8A 3FTZA 1QNFA 2MRIA 2OVBA 1E8WA 2HE0A 5FQ8A 4GA0A 5CHEE 3W9FA 4XIFA 4HFGA 4DLQA 2P9IG 2J07A 1OCCE 5AJLA 4EPZA 2VTBA 4RG6A 4A1SA 2HM8A 2I2OA 3HXCA 3JQ1A 3SFYA 1HZ4A 2J09A 4ILIA 4F1SA 2GRLA 3DSXA 1UJJA 4LUNU 3RU0A 4L7TA 3SZ7A 4HORA 5KWDA 4CGWA 4H7XA 2DIWA 1U3CA 4FULA 5EILA 3LDZA 3TGOA 2XPIA 2XQ0A 2XENA 3CKCA 3FUDA 2HYZA 3FY4A 4WNFA 2L6BA 1WY6A 4M3OA 4QQIA 3GYZA 5A7DB 3LS8A 1FT1A 3Q9UC 3JYSA 3GZ1A 4I2ZA 1MQSA 3Q15A 5B1BE 4BEPA 2WXIA 1TEZA 3ISMC 3CHOA 2X6KA 3EHMA 4UQXA 4B8CB 4JW1A 4KZ0A 2X3MA 1GW6A 1ZB1A 5BT1A 5E75A 1D9SA 4L2YA 2Y1LE 2ETCA 3UM2A 4GMJA 3O4ZA 2JLBA 2I6HA 2OVFA 4U95D 3BG1B 5EX0A 3VTXA 4CCAA 4Q69A 2PM6A 4C0EA 1A17A 3C3QA 3FEYA 4E6HA 1ELWA 1XGWA 1OUVA 2DBAA 3UMVA 4HLEA 2JEKA 2I1JA 5C2YA 2J4BA 5CRVA 4AVXA 4L23A 3UT4A 3CVLA 2BTDA 1WG0A 2A4ZA 4A3TA 1N11A 3R9AB 3CHQA 2WXQA 2L9BA 4GA2A 3CV0A 3Q4AB 2F37A 3B7TA 3HIZA 2ZGGA 4U0SA 2BEDA 3MGBA 5CEAA 3QDNA 3QWWA 1HH8A 1BI8B 3ABKE 2YNQA 2DCPA 2JABA 3VLFA 3KS2A 4GZ5A 2V5QC 5CMWA 3V30A 2Y69E 2DYSE 2V5FA 4LSZE 4J8EA 3MV3B 4N3BA 4FC8A 2EINE 3PNLB 3HRAA 3KSLA 4CRWA 4JHJA 3HXDA 3APFA 4O1PA 2LAHA 3PUJA 5G05C 3D9JA 3BG0B 3QB2A 2YINA 3LYAA 2WXPA 2J08A 3MCXA 2J4DA 1HS6A 4PS7A 3CEQA 3RJVA 4DUIA 2EQXA 2GROB 2KXPC 1UG3A 3D9IA 3RSEG 3C3OA 3AG2E 3FUFA 4PH4B 4JXTA 3ZVVA 5J90A 2KCKA 1E8ZA 3L9TA 1MX4A 2ETBA 2FBNA 2KCVA 2IO3C 1OCRE 2CG3A 2XEVA 4GTTA 2X6IA 3LEWA 3PZDA 3CHMA 2AXVA 4N2SA 2H6HA 3B95A 3TG5A 2QY7A 4WWPA 4NRHB 3ZHEB 5EIDA 3ZFWA 3C98A 4I2WA 5BXOA 3AU4A 4URKA 1DCQA 3PZ3A 3B7UX 2WQ6A 4YVQC 3QAQA 3CHRA 4UWHA 1HG2A 3SO8A 3D9NA 4DI4A 3WXXA 3EHQA 2LO6A 3CQGB 2IQCA 4LERA 4IYPA 3AAAC 4P29A 3FP3A 3FTVA 3B7RL 3PEUB 1Y8MA 4U07A 2X6JA 1U3DA 3CR3A 4TXRA 1OXJA 4CDMA 2LAIA 3ESLA 4PS8A 2FO1E 3AJIA 3AG1E 4JA7A 1JWGA 4I6EA 3HXBA 3PZ1A 4J0UA 4GZ3A 2C0LA 4F7AA 3DSSA 4GYOA 4XI9A 2UY1B 1TJFA 1WAO1 4LNBA 2BKGA 2MOWA 1JPLA 2Y3AA 2H6IA 4Q96A 4BSXA 5E76A 2Y4UA 1BPOA 4BWRA 4N5CA 2R05A 3HHMA 4KMOA 4JC8A 1OWPA 4XE0A 3L82A 3Q75A 2DYRE 4X8QA 3LKUA 2GRQB 3FFLA 3TWTA 5FQ6A 1LTXA 4DX7D 2OOEA 5DBKA 1H6OA 2R5SA 3AG3E 5ARGA 4LNUD 4LRZA 1IHBA 4AXHA 4ILGA 3C3RA 3Q49B 2XPYA 4DX5D 4EBAG 3NOCD 2AJAA 1UOHA 2MYOA 3CLJA 4RVBA 2CFZA 2VSNA 2CHZA 1KZOA 4HOTA 4F6RD 3FU5A 4DX6D 3OTNA 4EZJA 4JVSA 4TRQA 4YVOA 2EIKE 4G11A 4N3AA 3ZU7B 5EKQD 4FLHA 4AV7A 3L16A 1OWOA 3ONKA 1L5JA 3PNTB 3JXIA 1DNPA 4J8YA 3MA5A 4GPMA 3IXEA 4Q94A 5FINA 1N9AA 3UM0A 5FQ7A 3L17A 3UKUG 2CHXA 1QQEA 3SNXA 1FT2A 3Q7FA 5LFAA 5ITZF 5CCLA 4DLOA 4U8VD 5JHAA 3CVVA 4HOUA 3URZA 1VDYA 2CFUA 3I5PA 5ENPD 4ANUA 2UY1A 1N94A 1HXIA 1IXVA 3TWRA 2RG8A 2IEJA 3FH8A 5CRUA 4D10C 3HYMB 3PZ4A 2WXKA 5FT9A 4I6JA 4AOFA 2F8XK 2V0PA 3I3NA 4HRMB 3Q9NC 4BETA 2GRRB 3TJPA 1X5BA 3ASFA 3VLEA 4ANVA 1Z3YA 5T8IA 5FQ4A 4HRNA 1JCSA 2A5EA 4J8DA 1OWNA 4CDRA 4I1AA 5H7PA 1H2TC 4FJZA 4AEZC 3LVQE 4B0ZA 1E8XA 1KPSB 2XZTG 4W9RA 4XKBA 1NP7A 3ONLA 2XGMA 1LD8A 4U8YD 5JJ7A 2H6FA 4NURA 4U04A 5B3SE 2ETAA 2L0TB 3TXNA 4XKCA 5BXUA 3GZSA 3L13A 1E8YA 5A23A 2OEWA 1JUQA 1IHGA 5HI7A 4O6FA 1EYHA 3C72A 3EJNA 5A6CA 4MKTA 3UQ3A 4WWNA 3CHSA 1OWMA 3FTWA 1HF8A 3DPYA 3KAEA 4XI0A 1W3BA 2IO2C 3AS8A 2LUHA 4KT6B 4MRUA 4YDWA 3KEAA 5M72A 2RFMA 3DPDA 3CVNA 5BPPA 2I9CA 2IJGX 1H2UA 3Q47B 4BESA 5AAOA 1Z3XA 3W9GA 3LY7A 3QC1A 3SGHA 4MBGA 4EHMA 3V2XA 3E30A 4HXIA 4A1GA 2R59A 4UI9J 1JWFA 3K9IA 2E0IA 2FF4A 5AYWD 5D0QD 4GTQA 2F8YA 4K03A 5JMND 2HO1A 5ENQD 3DEPA 2XGSA 3S7BA 4FLBA 3KEZA 3I4GA 2P9PG 3MJWA 5CERB 3E33A 3TG4A 4C48B 2V4HC 5ENOD 3OXFA 2H6GA 1X81A 3EHRA 3U9WA 1H19A 3CSFA 2B6CA 1YA0A 4IRUA 5JJ6A 5EX3A 4L9PA 5CBOA 5FWQA 1TNOA 3E4BA 4GTOA 4J8FA 1S0PA 3CK9A 4BX9A 4GZ6A 2P9SG 3DBSA 4L1BA 4NACA 2ZGDA 1N4SA 3S7JA 4ME2A 4GB9A 3CSTA 3G2TA 5AQBA 1OY3D 2P9KG 3ULQA 2QC9A 4L2LA 2X6HA 4UWGA 2P9LG 3QOUA 5KCMA 4AY6A 1FVFA 1SW6A 3T8KA 3ZN3A 4Y6WA 2L6JA 2WVIA 1NL4A 1YYHA 2DZNA 3C5RA 4HNAD 3GZ2A 3V2OA 3TWVA 1S63A 4TXQA 1UN8A 4G24A 4BERA 3CKBA 5FZRA 3UIOC 3FWVA 4JEUA 1KLXA 1TN7A 5G2NA 2WXJA 4QFVA 2NSZA 3RO2A 2AXZA 2WXRA 3AS4A 1TN6A 2GRNB 3IKOB 1TYQG 4K0RA 1IYGA 1B89A 5CCMA 4CZ2D 4GTSA 2PNNA 3SQVA 3HXFA 3PE3A 4DJAA 2Y4TA 3G2SA 4GCNA 1NA3A 2PM7A 1NFIE 3FUHA 3EU9A 1O1SA 2AVPA 5FZQA 5G55A 3AS5A 2Y0BG 1BU9A 2Q7FA 3UTMA 3FUIA 4I1OB 4CGVA 4N39A 3U66A 5G05J 3CK8A 4F1PA 4I1MA 2WXGA 1JCQA 3T8MA 4ZHBA 1K1BA 3UIPC 4U8HA 3ABME 3E34A 4GYYA 3L6AA 4R7LA 3SF4A 1MX6A 4FADA 3I4RB 5D2MC 4DRXE 1P5QA 2XGOA 2VYIA 5FTPA 5LCWC 3FTUA 4ATZD 4Z68A 2BKKB 5BUZA 3ENEA 4DX1A 4XEIG 3ESKA 1H6KA 4HRLA 3UT7A 3CVPA 3PS6A 2MHKA 2LSUA 4HVBA 2VTBB 3ZYQA 2BUGA 1OCZE 3B7BA 1HU3A 3CK7A 4K5BA 3D9KA 2I1KA 5B1AE 1AWCB 3BU8A 4FA6A 1HG5A 1E90A 1N4RA 2EIME 3D9MA 4I6GA 4E85A 2VGEA 3FULA 1N0RA 2X6FA 1H2VC 3D9HA 4I9CA 3FU6A 5J08A 2P2CP 4UWKA 2WB2A 4YDYA 5ANLA 4U0UA 4GCOA 3R7RA 3PREA 2GRMA 3CVUA 2A5UA 2VSYA 1MYOA 5DIZA 3CVWA 2VGXA 3QJZA 3PH0C 3DSWA 3ASDA 3IHYA 3NF1A 4TUUA 2LXLA 2ZISA 3PDNA 2GW1A 4U96D 2ZXWE 5AQ9A 2R2LA 4MLPA 4I9EA 1EF1C 5D66A 4BX8A 3NZUA 4GPKA 3QNKA 3FUNA 3X2QE 3G2VA 1ELKA 4HLLA 2P58C 1BI7B 3JQ0A 5KJNA 4XZ4A 5KBAA 4U63A 2XHEA 3TWSA 2QZAA 2R02A 3DXKG 2KBXA 4BFRA 4RSYA 5LX8A 5ENTD 4KVOA 4G26A 3ZIMA 4GTRA 4HI8A 3R9MA 3QKYA 3GW4A 4CEMA 2WXHA 3Q73A 2VGYA 2WQHA 2WXNA 2PQNA 5ANRA 5EYPF 5AJDA 5AIJA 3CHPA 4KXKB 1TNUA 5KJLA 1UW4B 1FPPA 4N2QA 4B93B 3U3WA 2XRZA 5LP0A 2YHCA 4HBDA 1ZBPA 3DRAA 3TXMA 4JA9A 3ZNGA 2FEZA 2OV8A 1N52A 2LSVA 2J9QA 5ENSD 2R17C 2XS1A 3LCAA 3RAUA 1ZU2A 1H0AA 4IN3B 2C0MA 3QARA 4Y6CA 3LJ3A 4PUCA 3PVLA 3AU5A 3CQCB 4UI9K 4O1OA 4DI3A 2ONDA 3PZ2A 3T9KA 3Q79A 5HS0A 4KVMA 3QWPA 4TV3A 2FO7A 1TN8A 4IULA 1Z6TA 4BTAA 1QYMA 4AM9A 3HXEA 3ASOE 3SBSA 3PEVB 3ABLE 3FH5A 3ZEFA 5EDSA 4RLYA 3PE4A 4JZYA 1SQMA 4HQDA 3ZRHA 5KJKA 4EECA 4B89A 3SI5A 1O5MA 2R03A 4PDXA 3ZHEA 2GRPB 2WXMA 2KC7A 3CVQA 3B7SA 3FTXA 2WPVA 4HOQA 2KATA 2QFCA 4BSZB 4UQZA 2IU1A 4FHJA 1AP7A 3FUMA 4AP2A 3UINC 3E37A 2V8SE 3P2BA 3UPVA 3S7DA 1FVHA 4J6IA 4M7CA 1E7UA 1DVPA 3FUEA 3ASNE 3RO3A 5CMYA 4I17A 2NXPA 5JA4D 3QK0A 2AW6A 1IQRA 1XNFA 1FCHA 5FJYA 1JCRA 1S70B 4RQIA 2AWIA 3LY8A 1SA5A 4AIFA 3V79K 1K1AA 1SVXA 4GYWA 2NC9A 4G23A 5AN8A 3BEEA 3SHFA 3L54A 3MZLB 4ACKA 2AXUA 4TXPA 4G2VA 2DZOA 5G04J 5T3RA 1V54E 4GTMA 4A63B 3ULYA 2M63A 2E2EA 2B0OE 4KYOB 3ULEG 3UM1A 2PQRA 3D9PA 1N4QA 1EPUA 5CBNA 5JJTA 2EILE 3EIQC 5HRYA 3VLDA 2XEHA 3J5QB 5BV1A 1BD8A 1KZPA 1ELRA 4BY6A 1WM5A 5ARFA 2WMNA 4TUMA 3APDA 2XEEA 2WXFA 4ABNA 3IV0A 3HVEB 3HVEA 4BTBA 4WAFA 2RKKA 3LPZA 2HR2A 4GTVA 3MV2B 1MX2A 1TNBA 4DX2A 3FEXA 4LCTA 1H6PA 2UWJG 4NQ0A 3BQOA 4XX5A 2VQ2A 1U2VG 3G2WA 2IY0C 3MEKA 4ZFHA 3UUXA 3V31A 3JCKC 2WMOA 4EZLA 3EIJA 1YCSB 3MKQB 4G8LA 3TWWA 3MX3A 4GZDA 4KZCA 3ML9A 2ZU6B 5ENNA 1MJ0A 4ANWA 1MHQA 5AQ7A 1KT0A 4AY5A 3SFZA 4F53A 1D8EA 1RZ4A 3R7QA 2VSXE 4OVVA 3ZGQA 1NZNA 1UN9A 2BF0X 1D8DA 3JUIA 1N54A 1G3NB 1A5EA 3NZSA 3RK6A 2OCCE 4N5QA 3D3MA 3NBNB 1HFAA 4GMRA 3RRMB 3OXGA 1S64A 4H7YA 3NOGD 4FU3A 3UT8A 3O48A 1DCEA 3EHNA 3IBEA 4EQFA 3FUKA 3FTSA 3NB2A 4LG6A 1MZCA 2P9NG 4BT9A 4DPRA 1Z5SC 4WUYA 3SY2A 4ILHB 1INZA 1O1TA 2F0YA 4JHRA 2FI7A 3LXUX 3ZYKA 2IONA 3KSQA 4EZKA 3HDXA 4JD2G 2EIJE 2XRYA 2J49A 4WNDA 3DSTA 2DWZA 1TNYA 5LCWJ 3WG7E 4A55A 4GZCA 3T5VA 2KZTA 3U4TA 5EIBE 1TR4A 1Q2ZA 4G1TA 4OAUC 2VJ8A 5HKPA 2GGFA 3ASGA 5HQ8A 3DWLG 3ZPJA 4F3VA 3DSVA 5AQAA 3TAXA 4ATGA 4JEHA 4BT8A 5BW8C 5KNHD 3LVRE 2V4LA 2FULA 3TWQA 3Q5MA 4K5AB 1Y6IA 4I43A 5D0OD 2LNIA 4UI9C 4C0MA 2NYJA 1V55E 4GU5A 3LY9A 4J8SA 2XS8A 2X38A 1K8KG 1SZ9A 4RG9A 3ASHA 1K3ZD 3L08A 2J8SD 4HS2A 4CT0A 4CT4A 3B13A 3G2UA 3HG0D 3EUVA 1QZ2A 4YDEA 4ACLA 4APFA 3AG4E 4NIKA 5T4YA 4FHKA 4UQYA 2VGXB 4OYSA 4GA1A 3UXGA 3SFXA 2OEVA 5BNWA 2L0IA 1E7VA 3RIBA 4U0ZA 5AARA 2IFUA 4WNEA 2RD0A 3D9LA 5LOZA 1IQUA 1LD7A 1LF8A 1HE8A 1DC2A 4JB8P 4K5CA 1NI1A 2ZIRA 5JHBA 3OXLA 4DK5A 1OT8A 1SA4A 3FTYA 3PRZA 4YDOA 2KCLA 3SD5A 4J7WA 3EU5A 3VTYA 4G25A 3DXMG 4O60A 4N3CA 3S2AA 1QBQA 2CHWA 3T5XA 2IOLA 3NQPA 5ENRD 3RRNB 3S7FA 4HI9A 4U7EB 1IKND 4KBQA 5FIOA 3U64A 3CIAA 1OWLA 4WWOA 3E32A 1SZAA 4HB5A 3UM3A 4JPSA 5KNGA 2VSOE 3DEOA 4YNDA 2WM9A 2IOSA 2YHEA 4B8AA 3UI2A 3SBTB 3ML8A 4JL0A 3D9OA 2IF4A 1EDUA 1WDYA 1E96B 3ZXPA 4EBAA 4AJWA 4GTPA 2P9UG 1PY1A 3FH7A 4ANXA 3Q78A 4MS6A 3ZW3A 2WXOA 4JHKA 3Q7AA 3TWUA 3IHVA 4WNGA 2KM4A 1N0QA 2CG2A 2QYUA 5C1DA 3ZKJA 3NAWA 5FZSA 3MKQA 5EYLA 5EN5D 1OCOE 5AENA 3FHEA 3APCA 4UWLA 4B94A 1YMPA 2RFAA 4UUCA 4LEUA 5G04C 1PAQA 3FU0A 4FJYA 2PZIA 4CYMD 3TL5A 3J5PA 3N71A 3FUJA 3TWXA 3DSUA 2DVWA 3JUEA 1N4PA 4G8KA 2XCBA 4APOA 4V3IA 3MYVA 3PUKA 3JXJA 4OAVB 2QYJA 4GMLA
chains in the Genus database with same CATH topology
5JJTA 2WVIA 3IEGA 3EIQC 1KT1A 2ILRA 3VLDA 2XCCA 4HOSA 4JA7A 1JWGA 3GZ2A 4I6EA 5BV1A 3FU3A 4J0UA 4CDNA 2WXLA 4GZ3A 2C0LA 4F7AA 2PL2A 4GYOA 4UWFA 1ELRA 2WQ7A 1UN8A 4BY6A 1WM5A 4XI9A 2UY1B 5ARFA 4A3VA 1TJFA 2WMNA 4G24A 3APDA 1WAO1 2WXFA 4ABNA 3CKBA 2MOWA 5FZRA 4OVUA 3L22A 4FP7A 1JPLA 3FWVA 3IV0A 2Y3AA 5KJMA 4Q96A 4BSXA 3HVEB 3HVEA 4BTBA 5E76A 1PC2A 4JEUA 1KLXA 4WAFA 3ZYMA 5G2NA 3LPZA 2WXJA 2HR2A 4QFVA 1NA0A 2NSZA 3RO2A 2AXZA 2WXRA 2Y4UA 3MV2B 3AS4A 1BPOA 4BWRA 3ZXSA 4N5CA 3IKOB 3HHMA 3CVYA 4K0RA 4KMOA 1IYGA 3FEXA 3FDHA 4JC8A 1B89A 2UWJG 4LCTA 1OWPA 5CCMA 4XE0A 1TJCA 4NQ0A 3KD7A 4GAAA 4XX5A 1HO8A 2VQ2A 2XPZA 3PE3A 4DJAA 2Y4TA 3OAWA 3G2SA 4GCNA 3UX4A 1NA3A 2PM7A 3CVXA 3LKUA 3G2WA 3MEKA 3FUHA 3P1UA 3FFLA 2AVPA 5FQ6A 5FZQA 3UUXA 2OOEA 1UJKA 5G55A 3AS5A 5DBKA 2C2LA 2R5SA 3EDTB 3JCKC 2WMOA 4PS3A 4EZLA 2YQ8A 3EIJA 4C9BB 3MKQB 5ARGA 5BV0A 2Q7FA 3RKVA 3RRUA 3ZYLA 3FUIA 3QWVA 4I1OB 3CGHA 3MKRA 4CGVA 4LRZA 4N39A 3U66A 2KZTB 5G05J 3MX3A 4AXHA 4GZDA 4ILGA 3CK8A 4KZCA 3Q49B 1HX8A 3FTZA 1QNFA 2XPYA 3ML9A 4I1MA 2ZU6B 2WXGA 2MRIA 5ENNA 4EBAG 4ANWA 2OVBA 3T8MA 1MHQA 3CLJA 1E8WA 1KT0A 5FQ8A 4GA0A 4RVBA 2CFZA 5CHEE 2VSNA 2CHZA 4XIFA 4AY5A 3SFZA 4F53A 4HFGA 4U8HA 4HOTA 4GYYA 3L6AA 4R7LA 3SF4A 4DLQA 3R7QA 2VSXE 4OVVA 2J07A 4FADA 3FU5A 3I4RB 3ZGQA 1NZNA 5AJLA 4EPZA 1UN9A 2BF0X 3OTNA 2VTBA 4EZJA 4JVSA 4RG6A 4TRQA 1P5QA 1N54A 3JUIA 2XGOA 4YVOA 4A1SA 2HM8A 2I2OA 2VYIA 3JQ1A 5FTPA 3NZSA 3RK6A 4G11A 4N3AA 1HZ4A 2J09A 5LCWC 5EKQD 3FTUA 4ILIA 4F1SA 2GRLA 1UJJA 4LUNU 4FLHA 3D3MA 4AV7A 3RU0A 3L16A 1OWOA 3ONKA 1L5JA 4L7TA 3SZ7A 1HFAA 4HORA 5BUZA 3PNTB 3ENEA 3RRMB 3OXGA 1DNPA 4H7YA 3MA5A 3ESKA 1H6KA 4FU3A 3UT8A 4CGWA 4H7XA 4Q94A 3O48A 3UT7A 3CVPA 3PS6A 2MHKA 2DIWA 2LSUA 3EHNA 4HVBA 2VTBB 3ZYQA 2BUGA 5FQ7A 1U3CA 4FULA 3LDZA 3IBEA 3L17A 4EQFA 3FUKA 3FTSA 3TGOA 2XPIA 1HU3A 2XQ0A 3CKCA 3CK7A 3FUDA 2HYZA 3D9KA 2I1KA 3FY4A 4WNFA 2CHXA 1QQEA 1WY6A 4FA6A 1HG5A 4M3OA 4BT9A 1E90A 4DPRA 3SNXA 3GYZA 3D9MA 5A7DB 4WUYA 4ILHB 1INZA 3LS8A 4I6GA 5LFAA 4E85A 4JHRA 5CCLA 3FULA 4DLOA 2FI7A 3LXUX 5JHAA 3CVVA 2X6FA 3JYSA 3GZ1A 1H2VC 4HOUA 4I9CA 4I2ZA 3URZA 1MQSA 1VDYA 3FU6A 5J08A 3Q15A 3ZYKA 2IONA 4UWKA 2WB2A 3HDXA 4EZKA 2WXIA 2CFUA 3I5PA 4U0UA 5ANLA 1TEZA 2XRYA 2J49A 4WNDA 4GCOA 3R7RA 2UY1A 3PREA 4ANUA 2GRMA 3CHOA 2X6KA 3EHMA 1HXIA 4UQXA 4B8CB 5LCWJ 3CVUA 4JW1A 2A5UA 2VSYA 4A55A 4KZ0A 4GZCA 3T5VA 2X3MA 2KZTA 2RG8A 1GW6A 3U4TA 3FH8A 5DIZA 5BT1A 5E75A 3CVWA 4D10C 2VGXA 3QJZA 3PH0C 3HYMB 4G1TA 3ASDA 2VJ8A 2WXKA 4L2YA 3IHYA 3NF1A 5FT9A 2GGFA 4I6JA 3ASGA 4TUUA 4AOFA 5HQ8A 4GMJA 3O4ZA 3ZPJA 2JLBA 4F3VA 4ATGA 3TAXA 2I6HA 4JEHA 3PDNA 2GW1A 4BT8A 2OVFA 3BG1B 5BW8C 3LVRE 4MLPA 5EX0A 2V4LA 2FULA 3VTXA 4I9EA 2V0PA 1EF1C 4CCAA 4Q69A 4BX8A 3NZUA 4GPKA 3QNKA 2PM6A 3FUNA 4C0EA 3I3NA 1A17A 3FEYA 3G2VA 1ELKA 3Q5MA 1Y6IA 4E6HA 1ELWA 4I43A 1XGWA 1OUVA 2P58C 3JQ0A 5KJNA 5D0OD 2LNIA 4XZ4A 4UI9C 2DBAA 1X5BA 3ASFA 3TJPA 3UMVA 3VLEA 4C0MA 4U63A 2XHEA 4ANVA 4HLEA 1Z3YA 2I1JA 2JEKA 5C2YA 4GU5A 5T8IA 4BFRA 4RSYA 2J4BA 3LY9A 5FQ4A 5LX8A 4KVOA 4G26A 4L23A 4AVXA 4J8SA 4J8DA 3ZIMA 3UT4A 1OWNA 3CVLA 4CDRA 2BTDA 2A4ZA 2X38A 4I1AA 1SZ9A 4A3TA 4RG9A 3ASHA 1H2TC 3QKYA 3GW4A 3L08A 3CHQA 4FJZA 3R9AB 4AEZC 4CEMA 2WXHA 3LVQE 2VGYA 2WQHA 2WXNA 2WXQA 4B0ZA 2L9BA 4GA2A 2PQNA 1E8XA 3CV0A 3Q4AB 4HS2A 3B7TA 5ANRA 3HIZA 4U0SA 4CT0A 4CT4A 5AJDA 3B13A 3G2UA 3MGBA 4W9RA 3CHPA 4XKBA 5AIJA 4KXKB 1NP7A 3ONLA 2XGMA 3QDNA 1QZ2A 5KJLA 5JJ7A 3QWWA 4ACLA 4APFA 1HH8A 4NURA 4U04A 1UW4B 5T4YA 2L0TB 4FHKA 2YNQA 3TXNA 2DCPA 4UQYA 2VGXB 4XKCA 4N2QA 3GZSA 4OYSA 3U3WA 4GA1A 3L13A 1E8YA 3VLFA 2XRZA 3KS2A 4GZ5A 5LP0A 5BNWA 5A23A 2YHCA 2L0IA 1E7VA 3RIBA 4U0ZA 5CMWA 1JUQA 1IHGA 5HI7A 1ZBPA 3TXMA 4O6FA 4JA9A 2IFUA 2V5FA 2FEZA 4J8EA 2OV8A 1N52A 2LSVA 2J9QA 4WNEA 2RD0A 2R17C 3LCAA 3MV3B 3D9LA 4N3BA 5LOZA 1IQUA 1EYHA 1ZU2A 4FC8A 1H0AA 3EJNA 4IN3B 3PNLB 2C0MA 3QARA 1LF8A 1HE8A 3LJ3A 4Y6CA 4CRWA 4JHJA 4PUCA 3PVLA 3AU5A 3CQCB 4UI9K 5A6CA 4MKTA 3UQ3A 3APFA 4DI3A 4WWNA 5JHBA 2ONDA 2LAHA 3PUJA 4Y6WA 3CHSA 3OXLA 4DK5A 5G05C 1OWMA 3D9JA 3FTWA 4KVMA 3FTYA 3PRZA 1HF8A 3BG0B 2KCLA 3QB2A 3KAEA 3SD5A 3VTYA 3QWPA 2YINA 3LYAA 4G25A 4TV3A 2WXPA 2J08A 3MCXA 4N3CA 4XI0A 2FO7A 3S2AA 2CHWA 1W3BA 2J4DA 1HS6A 3AS8A 3T5XA 2IOLA 4KT6B 4MRUA 4IULA 4PS7A 3CEQA 3NQPA 1Z6TA 3RJVA 3RRNB 4BTAA 3S7FA 4AM9A 5M72A 3DPDA 3CVNA 2EQXA 3SBSA 3PEVB 5BPPA 2I9CA 2IJGX 4KBQA 1UG3A 3FH5A 3ZEFA 3U64A 3D9IA 5EDSA 3CIAA 1H2UA 1OWLA 3PE4A 3Q47B 4WWOA 1SZAA 4JZYA 1Z3XA 1SQMA 3LY7A 4JPSA 3QC1A 3ZRHA 5KJKA 2VSOE 3FUFA 3SGHA 4EECA 4YNDA 4PH4B 2WM9A 4B89A 3SI5A 2IOSA 2YHEA 4JXTA 4B8AA 4PDXA 3ZHEA 3ZVVA 5J90A 3SBTB 3ML8A 4JL0A 3D9OA 2WXMA 2IF4A 2KCKA 1E8ZA 1EDUA 2KC7A 1E96B 2FBNA 2KCVA 4EBAA 3CVQA 3B7SA 2CG3A 4AJWA 2XEVA 4HXIA 4A1GA 3FTXA 2R59A 1PY1A 2WPVA 2X6IA 4UI9J 4HOQA 3FH7A 4ANXA 2KATA 2QFCA 4MS6A 2IU1A 4FHJA 4UQZA 1JWFA 3LEWA 3ZW3A 3PZDA 2WXOA 3CHMA 3K9IA 3FUMA 4JHKA 2E0IA 2FF4A 5AYWD 4AP2A 2AXVA 5D0QD 2V8SE 3P2BA 3UPVA 4N2SA 4K03A 3IHVA 2HO1A 2QY7A 4NRHB 4WWPA 3S7DA 3TG5A 1FVHA 4WNGA 4J6IA 3ZHEB 2KM4A 1E7UA 3ZFWA 2CG2A 3C98A 2XGSA 3S7BA 4I2WA 1DVPA 3FUEA 3AU4A 3KEZA 4FLBA 5C1DA 4URKA 3I4GA 5FZSA 3B7UX 3MJWA 3MKQA 4YVQC 3RO3A 2WQ6A 5CMYA 3QAQA 3CHRA 4I17A 2NXPA 3TG4A 4UWHA 1HG2A 3D9NA 3OXFA 3QK0A 5AENA 2AW6A 3FHEA 1IQRA 3APCA 3U9WA 4DI4A 4UWLA 4B94A 3WXXA 1XNFA 2LO6A 3CQGB 1H19A 2IQCA 3CSFA 4LERA 1YA0A 1FCHA 5FJYA 4IRUA 5EX3A 5JJ6A 4IYPA 4LEUA 5G04C 5FWQA 3E4BA 4J8FA 1S0PA 2AWIA 3CK9A 3LY8A 1PAQA 3FU0A 4P29A 4FJYA 4AIFA 2PZIA 3TL5A 3FP3A 3FTVA 3B7RL 3N71A 3FUJA 3PEUB 4GYWA 4BX9A 2NC9A 1Y8MA 4G23A 4GZ6A 3BEEA 3DBSA 4L1BA 4NACA 3SHFA 3L54A 3MZLB 3S7JA 4ACKA 4ME2A 2AXUA 4U07A 4GB9A 2X6JA 1U3DA 3CSTA 4G2VA 5G04J 3CR3A 3G2TA 5T3RA 4CDMA 2E2EA 2M63A 2LAIA 3ULQA 4L2LA 2X6HA 4UWGA 4KYOB 3QOUA 3ESLA 2XCBA 5KCMA 4APOA 4V3IA 3MYVA 4AY6A 4PS8A 1FVFA 3PUKA 2PQRA 4GMLA 3D9PA 3ZN3A 1EPUA 2L6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEY A;  1H6K A;  5ANR A;  2KZT B;  3EIQ C;  2IU1 A;  4CT4 A;  4JHK A;  3JUI A;  1N54 A;  2VSO E;  1N52 A;  2ZU6 B;  1H2V C;  2GGF A;  2HM8 A;  2I2O A;  4B89 A;  2IOS A;  2NSZ A;  3RK6 A;  4B8A A;  2IOL A;  2VSX E;  4IUL A;  4GMJ A;  1HU3 A;  2ION A;  1UW4 B;  4LUN U;  3D3M A;  4CRW A;  4JHJ A;  3EIJ A;  3FEX A;  4C9B B;  4B8C B;  1PAQ A;  2FUL A;  1H2T C;  1UG3 A;  3L6A A;  4CEM A;  4GML A;  1H2U A;  2KZT A;  2RG8 A; 
#chains in the Genus database with same CATH topology
 1RW2 A;  3IEG A;  2LXM A;  3F6Q A;  1KT1 A;  2ILR A;  4HOS A;  2XCC A;  3FU3 A;  4CDN A;  2WXL A;  2PL2 A;  4UWF A;  2WQ7 A;  4A3V A;  1N95 A;  4OVU A;  3L22 A;  4FP7 A;  2XZD G;  5KJM A;  1PC2 A;  3ZYM A;  1NA0 A;  1TNZ A;  3CVY A;  3ZXS A;  5CEC B;  1O1R A;  3FDH A;  1TJC A;  3KD7 A;  4GAA A;  1HO8 A;  2XPZ A;  3OAW A;  1BLX B;  3UX4 A;  5CED B;  3CVX A;  3P1U A;  1UJK A;  2C2L A;  3EDT B;  5IY5 E;  3LJN A;  4PS3 A;  2YQ8 A;  4C9B B;  5BV0 A;  3RKV A;  3UKR G;  3RRU A;  3ZYL A;  3QWV A;  3CGH A;  3MKR A;  2KZT B;  4LNG A;  3ZUV B;  3BUA A;  1HX8 A;  3FTZ A;  1QNF A;  2MRI A;  2OVB A;  1E8W A;  2HE0 A;  5FQ8 A;  4GA0 A;  5CHE E;  3W9F A;  4XIF A;  4HFG A;  4DLQ A;  2P9I G;  2J07 A;  1OCC E;  5AJL A;  4EPZ A;  2VTB A;  4RG6 A;  4A1S A;  2HM8 A;  2I2O A;  3HXC A;  3JQ1 A;  3SFY A;  1HZ4 A;  2J09 A;  4ILI A;  4F1S A;  2GRL A;  3DSX A;  1UJJ A;  4LUN U;  3RU0 A;  4L7T A;  3SZ7 A;  4HOR A;  5KWD A;  4CGW A;  4H7X A;  2DIW A;  1U3C A;  4FUL A;  5EIL A;  3LDZ A;  3TGO A;  2XPI A;  2XQ0 A;  2XEN A;  3CKC A;  3FUD A;  2HYZ A;  3FY4 A;  4WNF A;  2L6B A;  1WY6 A;  4M3O A;  4QQI A;  3GYZ A;  5A7D B;  3LS8 A;  1FT1 A;  3Q9U C;  3JYS A;  3GZ1 A;  4I2Z A;  1MQS A;  3Q15 A;  5B1B E;  4BEP A;  2WXI A;  1TEZ A;  3ISM C;  3CHO A;  2X6K A;  3EHM A;  4UQX A;  4B8C B;  4JW1 A;  4KZ0 A;  2X3M A;  1GW6 A;  1ZB1 A;  5BT1 A;  5E75 A;  1D9S A;  4L2Y A;  2Y1L E;  2ETC A;  3UM2 A;  4GMJ A;  3O4Z A;  2JLB A;  2I6H A;  2OVF A;  4U95 D;  3BG1 B;  5EX0 A;  3VTX A;  4CCA A;  4Q69 A;  2PM6 A;  4C0E A;  1A17 A;  3C3Q A;  3FEY A;  4E6H A;  1ELW A;  1XGW A;  1OUV A;  2DBA A;  3UMV A;  4HLE A;  2JEK A;  2I1J A;  5C2Y A;  2J4B A;  5CRV A;  4AVX A;  4L23 A;  3UT4 A;  3CVL A;  2BTD A;  1WG0 A;  2A4Z A;  4A3T A;  1N11 A;  3R9A B;  3CHQ A;  2WXQ A;  2L9B A;  4GA2 A;  3CV0 A;  3Q4A B;  2F37 A;  3B7T A;  3HIZ A;  2ZGG A;  4U0S A;  2BED A;  3MGB A;  5CEA A;  3QDN A;  3QWW A;  1HH8 A;  1BI8 B;  3ABK E;  2YNQ A;  2DCP A;  2JAB A;  3VLF A;  3KS2 A;  4GZ5 A;  2V5Q C;  5CMW A;  3V30 A;  2Y69 E;  2DYS E;  2V5F A;  4LSZ E;  4J8E A;  3MV3 B;  4N3B A;  4FC8 A;  2EIN E;  3PNL B;  3HRA A;  3KSL A;  4CRW A;  4JHJ A;  3HXD A;  3APF A;  4O1P A;  2LAH A;  3PUJ A;  5G05 C;  3D9J A;  3BG0 B;  3QB2 A;  2YIN A;  3LYA A;  2WXP A;  2J08 A;  3MCX A;  2J4D A;  1HS6 A;  4PS7 A;  3CEQ A;  3RJV A;  4DUI A;  2EQX A;  2GRO B;  2KXP C;  1UG3 A;  3D9I A;  3RSE G;  3C3O A;  3AG2 E;  3FUF A;  4PH4 B;  4JXT A;  3ZVV A;  5J90 A;  2KCK A;  1E8Z A;  3L9T A;  1MX4 A;  2ETB A;  2FBN A;  2KCV A;  2IO3 C;  1OCR E;  2CG3 A;  2XEV A;  4GTT A;  2X6I A;  3LEW A;  3PZD A;  3CHM A;  2AXV A;  4N2S A;  2H6H A;  3B95 A;  3TG5 A;  2QY7 A;  4WWP A;  4NRH B;  3ZHE B;  5EID A;  3ZFW A;  3C98 A;  4I2W A;  5BXO A;  3AU4 A;  4URK A;  1DCQ A;  3PZ3 A;  3B7U X;  2WQ6 A;  4YVQ C;  3QAQ A;  3CHR A;  4UWH A;  1HG2 A;  3SO8 A;  3D9N A;  4DI4 A;  3WXX A;  3EHQ A;  2LO6 A;  3CQG B;  2IQC A;  4LER A;  4IYP A;  3AAA C;  4P29 A;  3FP3 A;  3FTV A;  3B7R L;  3PEU B;  1Y8M A;  4U07 A;  2X6J A;  1U3D A;  3CR3 A;  4TXR A;  1OXJ A;  4CDM A;  2LAI A;  3ESL A;  4PS8 A;  2FO1 E;  3AJI A;  3AG1 E;  4JA7 A;  1JWG A;  4I6E A;  3HXB A;  3PZ1 A;  4J0U A;  4GZ3 A;  2C0L A;  4F7A A;  3DSS A;  4GYO A;  4XI9 A;  2UY1 B;  1TJF A;  1WAO 1;  4LNB A;  2BKG A;  2MOW A;  1JPL A;  2Y3A A;  2H6I A;  4Q96 A;  4BSX A;  5E76 A;  2Y4U A;  1BPO A;  4BWR A;  4N5C A;  2R05 A;  3HHM A;  4KMO A;  4JC8 A;  1OWP A;  4XE0 A;  3L82 A;  3Q75 A;  2DYR E;  4X8Q A;  3LKU A;  2GRQ B;  3FFL A;  3TWT A;  5FQ6 A;  1LTX A;  4DX7 D;  2OOE A;  5DBK A;  1H6O A;  2R5S A;  3AG3 E;  5ARG A;  4LNU D;  4LRZ A;  1IHB A;  4AXH A;  4ILG A;  3C3R A;  3Q49 B;  2XPY A;  4DX5 D;  4EBA G;  3NOC D;  2AJA A;  1UOH A;  2MYO A;  3CLJ A;  4RVB A;  2CFZ A;  2VSN A;  2CHZ A;  1KZO A;  4HOT A;  4F6R D;  3FU5 A;  4DX6 D;  3OTN A;  4EZJ A;  4JVS A;  4TRQ A;  4YVO A;  2EIK E;  4G11 A;  4N3A A;  3ZU7 B;  5EKQ D;  4FLH A;  4AV7 A;  3L16 A;  1OWO A;  3ONK A;  1L5J A;  3PNT B;  3JXI A;  1DNP A;  4J8Y A;  3MA5 A;  4GPM A;  3IXE A;  4Q94 A;  5FIN A;  1N9A A;  3UM0 A;  5FQ7 A;  3L17 A;  3UKU G;  2CHX A;  1QQE A;  3SNX A;  1FT2 A;  3Q7F A;  5LFA A;  5ITZ F;  5CCL A;  4DLO A;  4U8V D;  5JHA A;  3CVV A;  4HOU A;  3URZ A;  1VDY A;  2CFU A;  3I5P A;  5ENP D;  4ANU A;  2UY1 A;  1N94 A;  1HXI A;  1IXV A;  3TWR A;  2RG8 A;  2IEJ A;  3FH8 A;  5CRU A;  4D10 C;  3HYM B;  3PZ4 A;  2WXK A;  5FT9 A;  4I6J A;  4AOF A;  2F8X K;  2V0P A;  3I3N A;  4HRM B;  3Q9N C;  4BET A;  2GRR B;  3TJP A;  1X5B A;  3ASF A;  3VLE A;  4ANV A;  1Z3Y A;  5T8I A;  5FQ4 A;  4HRN A;  1JCS A;  2A5E A;  4J8D A;  1OWN A;  4CDR A;  4I1A A;  5H7P A;  1H2T C;  4FJZ A;  4AEZ C;  3LVQ E;  4B0Z A;  1E8X A;  1KPS B;  2XZT G;  4W9R A;  4XKB A;  1NP7 A;  3ONL A;  2XGM A;  1LD8 A;  4U8Y D;  5JJ7 A;  2H6F A;  4NUR A;  4U04 A;  5B3S E;  2ETA A;  2L0T B;  3TXN A;  4XKC A;  5BXU A;  3GZS A;  3L13 A;  1E8Y A;  5A23 A;  2OEW A;  1JUQ A;  1IHG A;  5HI7 A;  4O6F A;  1EYH A;  3C72 A;  3EJN A;  5A6C A;  4MKT A;  3UQ3 A;  4WWN A;  3CHS A;  1OWM A;  3FTW A;  1HF8 A;  3DPY A;  3KAE A;  4XI0 A;  1W3B A;  2IO2 C;  3AS8 A;  2LUH A;  4KT6 B;  4MRU A;  4YDW A;  3KEA A;  5M72 A;  2RFM A;  3DPD A;  3CVN A;  5BPP A;  2I9C A;  2IJG X;  1H2U A;  3Q47 B;  4BES A;  5AAO A;  1Z3X A;  3W9G A;  3LY7 A;  3QC1 A;  3SGH A;  4MBG A;  4EHM A;  3V2X A;  3E30 A;  4HXI A;  4A1G A;  2R59 A;  4UI9 J;  1JWF A;  3K9I A;  2E0I A;  2FF4 A;  5AYW D;  5D0Q D;  4GTQ A;  2F8Y A;  4K03 A;  5JMN D;  2HO1 A;  5ENQ D;  3DEP A;  2XGS A;  3S7B A;  4FLB A;  3KEZ A;  3I4G A;  2P9P G;  3MJW A;  5CER B;  3E33 A;  3TG4 A;  4C48 B;  2V4H C;  5ENO D;  3OXF A;  2H6G A;  1X81 A;  3EHR A;  3U9W A;  1H19 A;  3CSF A;  2B6C A;  1YA0 A;  4IRU A;  5JJ6 A;  5EX3 A;  4L9P A;  5CBO A;  5FWQ A;  1TNO A;  3E4B A;  4GTO A;  4J8F A;  1S0P A;  3CK9 A;  4BX9 A;  4GZ6 A;  2P9S G;  3DBS A;  4L1B A;  4NAC A;  2ZGD A;  1N4S A;  3S7J A;  4ME2 A;  4GB9 A;  3CST A;  3G2T A;  5AQB A;  1OY3 D;  2P9K G;  3ULQ A;  2QC9 A;  4L2L A;  2X6H A;  4UWG A;  2P9L G;  3QOU A;  5KCM A;  4AY6 A;  1FVF A;  1SW6 A;  3T8K A;  3ZN3 A;  4Y6W A;  2L6J A;  2WVI A;  1NL4 A;  1YYH A;  2DZN A;  3C5R A;  4HNA D;  3GZ2 A;  3V2O A;  3TWV A;  1S63 A;  4TXQ A;  1UN8 A;  4G24 A;  4BER A;  3CKB A;  5FZR A;  3UIO C;  3FWV A;  4JEU A;  1KLX A;  1TN7 A;  5G2N A;  2WXJ A;  4QFV A;  2NSZ A;  3RO2 A;  2AXZ A;  2WXR A;  3AS4 A;  1TN6 A;  2GRN B;  3IKO B;  1TYQ G;  4K0R A;  1IYG A;  1B89 A;  5CCM A;  4CZ2 D;  4GTS A;  2PNN A;  3SQV A;  3HXF A;  3PE3 A;  4DJA A;  2Y4T A;  3G2S A;  4GCN A;  1NA3 A;  2PM7 A;  1NFI E;  3FUH A;  3EU9 A;  1O1S A;  2AVP A;  5FZQ A;  5G55 A;  3AS5 A;  2Y0B G;  1BU9 A;  2Q7F A;  3UTM A;  3FUI A;  4I1O B;  4CGV A;  4N39 A;  3U66 A;  5G05 J;  3CK8 A;  4F1P A;  4I1M A;  2WXG A;  1JCQ A;  3T8M A;  4ZHB A;  1K1B A;  3UIP C;  4U8H A;  3ABM E;  3E34 A;  4GYY A;  3L6A A;  4R7L A;  3SF4 A;  1MX6 A;  4FAD A;  3I4R B;  5D2M C;  4DRX E;  1P5Q A;  2XGO A;  2VYI A;  5FTP A;  5LCW C;  3FTU A;  4ATZ D;  4Z68 A;  2BKK B;  5BUZ A;  3ENE A;  4DX1 A;  4XEI G;  3ESK A;  1H6K A;  4HRL A;  3UT7 A;  3CVP A;  3PS6 A;  2MHK A;  2LSU A;  4HVB A;  2VTB B;  3ZYQ A;  2BUG A;  1OCZ E;  3B7B A;  1HU3 A;  3CK7 A;  4K5B A;  3D9K A;  2I1K A;  5B1A E;  1AWC B;  3BU8 A;  4FA6 A;  1HG5 A;  1E90 A;  1N4R A;  2EIM E;  3D9M A;  4I6G A;  4E85 A;  2VGE A;  3FUL A;  1N0R A;  2X6F A;  1H2V C;  3D9H A;  4I9C A;  3FU6 A;  5J08 A;  2P2C P;  4UWK A;  2WB2 A;  4YDY A;  5ANL A;  4U0U A;  4GCO A;  3R7R A;  3PRE A;  2GRM A;  3CVU A;  2A5U A;  2VSY A;  1MYO A;  5DIZ A;  3CVW A;  2VGX A;  3QJZ A;  3PH0 C;  3DSW A;  3ASD A;  3IHY A;  3NF1 A;  4TUU A;  2LXL A;  2ZIS A;  3PDN A;  2GW1 A;  4U96 D;  2ZXW E;  5AQ9 A;  2R2L A;  4MLP A;  4I9E A;  1EF1 C;  5D66 A;  4BX8 A;  3NZU A;  4GPK A;  3QNK A;  3FUN A;  3X2Q E;  3G2V A;  1ELK A;  4HLL A;  2P58 C;  1BI7 B;  3JQ0 A;  5KJN A;  4XZ4 A;  5KBA A;  4U63 A;  2XHE A;  3TWS A;  2QZA A;  2R02 A;  3DXK G;  2KBX A;  4BFR A;  4RSY A;  5LX8 A;  5ENT D;  4KVO A;  4G26 A;  3ZIM A;  4GTR A;  4HI8 A;  3R9M A;  3QKY A;  3GW4 A;  4CEM A;  2WXH A;  3Q73 A;  2VGY A;  2WQH A;  2WXN A;  2PQN A;  5ANR A;  5EYP F;  5AJD A;  5AIJ A;  3CHP A;  4KXK B;  1TNU A;  5KJL A;  1UW4 B;  1FPP A;  4N2Q A;  4B93 B;  3U3W A;  2XRZ A;  5LP0 A;  2YHC A;  4HBD A;  1ZBP A;  3DRA A;  3TXM A;  4JA9 A;  3ZNG A;  2FEZ A;  2OV8 A;  1N52 A;  2LSV A;  2J9Q A;  5ENS D;  2R17 C;  2XS1 A;  3LCA A;  3RAU A;  1ZU2 A;  1H0A A;  4IN3 B;  2C0M A;  3QAR A;  4Y6C A;  3LJ3 A;  4PUC A;  3PVL A;  3AU5 A;  3CQC B;  4UI9 K;  4O1O A;  4DI3 A;  2OND A;  3PZ2 A;  3T9K A;  3Q79 A;  5HS0 A;  4KVM A;  3QWP A;  4TV3 A;  2FO7 A;  1TN8 A;  4IUL A;  1Z6T A;  4BTA A;  1QYM A;  4AM9 A;  3HXE A;  3ASO E;  3SBS A;  3PEV B;  3ABL E;  3FH5 A;  3ZEF A;  5EDS A;  4RLY A;  3PE4 A;  4JZY A;  1SQM A;  4HQD A;  3ZRH A;  5KJK A;  4EEC A;  4B89 A;  3SI5 A;  1O5M A;  2R03 A;  4PDX A;  3ZHE A;  2GRP B;  2WXM A;  2KC7 A;  3CVQ A;  3B7S A;  3FTX A;  2WPV A;  4HOQ A;  2KAT A;  2QFC A;  4BSZ B;  4UQZ A;  2IU1 A;  4FHJ A;  1AP7 A;  3FUM A;  4AP2 A;  3UIN C;  3E37 A;  2V8S E;  3P2B A;  3UPV A;  3S7D A;  1FVH A;  4J6I A;  4M7C A;  1E7U A;  1DVP A;  3FUE A;  3ASN E;  3RO3 A;  5CMY A;  4I17 A;  2NXP A;  5JA4 D;  3QK0 A;  2AW6 A;  1IQR A;  1XNF A;  1FCH A;  5FJY A;  1JCR A;  1S70 B;  4RQI A;  2AWI A;  3LY8 A;  1SA5 A;  4AIF A;  3V79 K;  1K1A A;  1SVX A;  4GYW A;  2NC9 A;  4G23 A;  5AN8 A;  3BEE A;  3SHF A;  3L54 A;  3MZL B;  4ACK A;  2AXU A;  4TXP A;  4G2V A;  2DZO A;  5G04 J;  5T3R A;  1V54 E;  4GTM A;  4A63 B;  3ULY A;  2M63 A;  2E2E A;  2B0O E;  4KYO B;  3ULE G;  3UM1 A;  2PQR A;  3D9P A;  1N4Q A;  1EPU A;  5CBN A;  5JJT A;  2EIL E;  3EIQ C;  5HRY A;  3VLD A;  2XEH A;  3J5Q B;  5BV1 A;  1BD8 A;  1KZP A;  1ELR A;  4BY6 A;  1WM5 A;  5ARF A;  2WMN A;  4TUM A;  3APD A;  2XEE A;  2WXF A;  4ABN A;  3IV0 A;  3HVE B;  3HVE A;  4BTB A;  4WAF A;  2RKK A;  3LPZ A;  2HR2 A;  4GTV A;  3MV2 B;  1MX2 A;  1TNB A;  4DX2 A;  3FEX A;  4LCT A;  1H6P A;  2UWJ G;  4NQ0 A;  3BQO A;  4XX5 A;  2VQ2 A;  1U2V G;  3G2W A;  2IY0 C;  3MEK A;  4ZFH A;  3UUX A;  3V31 A;  3JCK C;  2WMO A;  4EZL A;  3EIJ A;  1YCS B;  3MKQ B;  4G8L A;  3TWW A;  3MX3 A;  4GZD A;  4KZC A;  3ML9 A;  2ZU6 B;  5ENN A;  1MJ0 A;  4ANW A;  1MHQ A;  5AQ7 A;  1KT0 A;  4AY5 A;  3SFZ A;  4F53 A;  1D8E A;  1RZ4 A;  3R7Q A;  2VSX E;  4OVV A;  3ZGQ A;  1NZN A;  1UN9 A;  2BF0 X;  1D8D A;  3JUI A;  1N54 A;  1G3N B;  1A5E A;  3NZS A;  3RK6 A;  2OCC E;  4N5Q A;  3D3M A;  3NBN B;  1HFA A;  4GMR A;  3RRM B;  3OXG A;  1S64 A;  4H7Y A;  3NOG D;  4FU3 A;  3UT8 A;  3O48 A;  1DCE A;  3EHN A;  3IBE A;  4EQF A;  3FUK A;  3FTS A;  3NB2 A;  4LG6 A;  1MZC A;  2P9N G;  4BT9 A;  4DPR A;  1Z5S C;  4WUY A;  3SY2 A;  4ILH B;  1INZ A;  1O1T A;  2F0Y A;  4JHR A;  2FI7 A;  3LXU X;  3ZYK A;  2ION A;  3KSQ A;  4EZK A;  3HDX A;  4JD2 G;  2EIJ E;  2XRY A;  2J49 A;  4WND A;  3DST A;  2DWZ A;  1TNY A;  5LCW J;  3WG7 E;  4A55 A;  4GZC A;  3T5V A;  2KZT A;  3U4T A;  5EIB E;  1TR4 A;  1Q2Z A;  4G1T A;  4OAU C;  2VJ8 A;  5HKP A;  2GGF A;  3ASG A;  5HQ8 A;  3DWL G;  3ZPJ A;  4F3V A;  3DSV A;  5AQA A;  3TAX A;  4ATG A;  4JEH A;  4BT8 A;  5BW8 C;  5KNH D;  3LVR E;  2V4L A;  2FUL A;  3TWQ A;  3Q5M A;  4K5A B;  1Y6I A;  4I43 A;  5D0O D;  2LNI A;  4UI9 C;  4C0M A;  2NYJ A;  1V55 E;  4GU5 A;  3LY9 A;  4J8S A;  2XS8 A;  2X38 A;  1K8K G;  1SZ9 A;  4RG9 A;  3ASH A;  1K3Z D;  3L08 A;  2J8S D;  4HS2 A;  4CT0 A;  4CT4 A;  3B13 A;  3G2U A;  3HG0 D;  3EUV A;  1QZ2 A;  4YDE A;  4ACL A;  4APF A;  3AG4 E;  4NIK A;  5T4Y A;  4FHK A;  4UQY A;  2VGX B;  4OYS A;  4GA1 A;  3UXG A;  3SFX A;  2OEV A;  5BNW A;  2L0I A;  1E7V A;  3RIB A;  4U0Z A;  5AAR A;  2IFU A;  4WNE A;  2RD0 A;  3D9L A;  5LOZ A;  1IQU A;  1LD7 A;  1LF8 A;  1HE8 A;  1DC2 A;  4JB8 P;  4K5C A;  1NI1 A;  2ZIR A;  5JHB A;  3OXL A;  4DK5 A;  1OT8 A;  1SA4 A;  3FTY A;  3PRZ A;  4YDO A;  2KCL A;  3SD5 A;  4J7W A;  3EU5 A;  3VTY A;  4G25 A;  3DXM G;  4O60 A;  4N3C A;  3S2A A;  1QBQ A;  2CHW A;  3T5X A;  2IOL A;  3NQP A;  5ENR D;  3RRN B;  3S7F A;  4HI9 A;  4U7E B;  1IKN D;  4KBQ A;  5FIO A;  3U64 A;  3CIA A;  1OWL A;  4WWO A;  3E32 A;  1SZA A;  4HB5 A;  3UM3 A;  4JPS A;  5KNG A;  2VSO E;  3DEO A;  4YND A;  2WM9 A;  2IOS A;  2YHE A;  4B8A A;  3UI2 A;  3SBT B;  3ML8 A;  4JL0 A;  3D9O A;  2IF4 A;  1EDU A;  1WDY A;  1E96 B;  3ZXP A;  4EBA A;  4AJW A;  4GTP A;  2P9U G;  1PY1 A;  3FH7 A;  4ANX A;  3Q78 A;  4MS6 A;  3ZW3 A;  2WXO A;  4JHK A;  3Q7A A;  3TWU A;  3IHV A;  4WNG A;  2KM4 A;  1N0Q A;  2CG2 A;  2QYU A;  5C1D A;  3ZKJ A;  3NAW A;  5FZS A;  3MKQ A;  5EYL A;  5EN5 D;  1OCO E;  5AEN A;  3FHE A;  3APC A;  4UWL A;  4B94 A;  1YMP A;  2RFA A;  4UUC A;  4LEU A;  5G04 C;  1PAQ A;  3FU0 A;  4FJY A;  2PZI A;  4CYM D;  3TL5 A;  3J5P A;  3N71 A;  3FUJ A;  3TWX A;  3DSU A;  2DVW A;  3JUE A;  1N4P A;  4G8K A;  2XCB A;  4APO A;  4V3I A;  3MYV A;  3PUK A;  3JXJ A;  4OAV B;  2QYJ A;  4GML A; 
#chains in the Genus database with same CATH homology
 5JJT A;  2WVI A;  3IEG A;  3EIQ C;  1KT1 A;  2ILR A;  3VLD A;  2XCC A;  4HOS A;  4JA7 A;  1JWG A;  3GZ2 A;  4I6E A;  5BV1 A;  3FU3 A;  4J0U A;  4CDN A;  2WXL A;  4GZ3 A;  2C0L A;  4F7A A;  2PL2 A;  4GYO A;  4UWF A;  1ELR A;  2WQ7 A;  1UN8 A;  4BY6 A;  1WM5 A;  4XI9 A;  2UY1 B;  5ARF A;  4A3V A;  1TJF A;  2WMN A;  4G24 A;  3APD A;  1WAO 1;  2WXF A;  4ABN A;  3CKB A;  2MOW A;  5FZR A;  4OVU A;  3L22 A;  4FP7 A;  1JPL A;  3FWV A;  3IV0 A;  2Y3A A;  5KJM A;  4Q96 A;  4BSX A;  3HVE B;  3HVE A;  4BTB A;  5E76 A;  1PC2 A;  4JEU A;  1KLX A;  4WAF A;  3ZYM A;  5G2N A;  3LPZ A;  2WXJ A;  2HR2 A;  4QFV A;  1NA0 A;  2NSZ A;  3RO2 A;  2AXZ A;  2WXR A;  2Y4U A;  3MV2 B;  3AS4 A;  1BPO A;  4BWR A;  3ZXS A;  4N5C A;  3IKO B;  3HHM A;  3CVY A;  4K0R A;  4KMO A;  1IYG A;  3FEX A;  3FDH A;  4JC8 A;  1B89 A;  2UWJ G;  4LCT A;  1OWP A;  5CCM A;  4XE0 A;  1TJC A;  4NQ0 A;  3KD7 A;  4GAA A;  4XX5 A;  1HO8 A;  2VQ2 A;  2XPZ A;  3PE3 A;  4DJA A;  2Y4T A;  3OAW A;  3G2S A;  4GCN A;  3UX4 A;  1NA3 A;  2PM7 A;  3CVX A;  3LKU A;  3G2W A;  3MEK A;  3FUH A;  3P1U A;  3FFL A;  2AVP A;  5FQ6 A;  5FZQ A;  3UUX A;  2OOE A;  1UJK A;  5G55 A;  3AS5 A;  5DBK A;  2C2L A;  2R5S A;  3EDT B;  3JCK C;  2WMO A;  4PS3 A;  4EZL A;  2YQ8 A;  3EIJ A;  4C9B B;  3MKQ B;  5ARG A;  5BV0 A;  2Q7F A;  3RKV A;  3RRU A;  3ZYL A;  3FUI A;  3QWV A;  4I1O B;  3CGH A;  3MKR A;  4CGV A;  4LRZ A;  4N39 A;  3U66 A;  2KZT B;  5G05 J;  3MX3 A;  4AXH A;  4GZD A;  4ILG A;  3CK8 A;  4KZC A;  3Q49 B;  1HX8 A;  3FTZ A;  1QNF A;  2XPY A;  3ML9 A;  4I1M A;  2ZU6 B;  2WXG A;  2MRI A;  5ENN A;  4EBA G;  4ANW A;  2OVB A;  3T8M A;  1MHQ A;  3CLJ A;  1E8W A;  1KT0 A;  5FQ8 A;  4GA0 A;  4RVB A;  2CFZ A;  5CHE E;  2VSN A;  2CHZ A;  4XIF A;  4AY5 A;  3SFZ A;  4F53 A;  4HFG A;  4U8H A;  4HOT A;  4GYY A;  3L6A A;  4R7L A;  3SF4 A;  4DLQ A;  3R7Q A;  2VSX E;  4OVV A;  2J07 A;  4FAD A;  3FU5 A;  3I4R B;  3ZGQ A;  1NZN A;  5AJL A;  4EPZ A;  1UN9 A;  2BF0 X;  3OTN A;  2VTB A;  4EZJ A;  4JVS A;  4RG6 A;  4TRQ A;  1P5Q A;  1N54 A;  3JUI A;  2XGO A;  4YVO A;  4A1S A;  2HM8 A;  2I2O A;  2VYI A;  3JQ1 A;  5FTP A;  3NZS A;  3RK6 A;  4G11 A;  4N3A A;  1HZ4 A;  2J09 A;  5LCW C;  5EKQ D;  3FTU A;  4ILI A;  4F1S A;  2GRL A;  1UJJ A;  4LUN U;  4FLH A;  3D3M A;  4AV7 A;  3RU0 A;  3L16 A;  1OWO A;  3ONK A;  1L5J A;  4L7T A;  3SZ7 A;  1HFA A;  4HOR A;  5BUZ A;  3PNT B;  3ENE A;  3RRM B;  3OXG A;  1DNP A;  4H7Y A;  3MA5 A;  3ESK A;  1H6K A;  4FU3 A;  3UT8 A;  4CGW A;  4H7X A;  4Q94 A;  3O48 A;  3UT7 A;  3CVP A;  3PS6 A;  2MHK A;  2DIW A;  2LSU A;  3EHN A;  4HVB A;  2VTB B;  3ZYQ A;  2BUG A;  5FQ7 A;  1U3C A;  4FUL A;  3LDZ A;  3IBE A;  3L17 A;  4EQF A;  3FUK A;  3FTS A;  3TGO A;  2XPI A;  1HU3 A;  2XQ0 A;  3CKC A;  3CK7 A;  3FUD A;  2HYZ A;  3D9K A;  2I1K A;  3FY4 A;  4WNF A;  2CHX A;  1QQE A;  1WY6 A;  4FA6 A;  1HG5 A;  4M3O A;  4BT9 A;  1E90 A;  4DPR A;  3SNX A;  3GYZ A;  3D9M A;  5A7D B;  4WUY A;  4ILH B;  1INZ A;  3LS8 A;  4I6G A;  5LFA A;  4E85 A;  4JHR A;  5CCL A;  3FUL A;  4DLO A;  2FI7 A;  3LXU X;  5JHA A;  3CVV A;  2X6F A;  3JYS A;  3GZ1 A;  1H2V C;  4HOU A;  4I9C A;  4I2Z A;  3URZ A;  1MQS A;  1VDY A;  3FU6 A;  5J08 A;  3Q15 A;  3ZYK A;  2ION A;  4UWK A;  2WB2 A;  3HDX A;  4EZK A;  2WXI A;  2CFU A;  3I5P A;  4U0U A;  5ANL A;  1TEZ A;  2XRY A;  2J49 A;  4WND A;  4GCO A;  3R7R A;  2UY1 A;  3PRE A;  4ANU A;  2GRM A;  3CHO A;  2X6K A;  3EHM A;  1HXI A;  4UQX A;  4B8C B;  5LCW J;  3CVU A;  4JW1 A;  2A5U A;  2VSY A;  4A55 A;  4KZ0 A;  4GZC A;  3T5V A;  2X3M A;  2KZT A;  2RG8 A;  1GW6 A;  3U4T A;  3FH8 A;  5DIZ A;  5BT1 A;  5E75 A;  3CVW A;  4D10 C;  2VGX A;  3QJZ A;  3PH0 C;  3HYM B;  4G1T A;  3ASD A;  2VJ8 A;  2WXK A;  4L2Y A;  3IHY A;  3NF1 A;  5FT9 A;  2GGF A;  4I6J A;  3ASG A;  4TUU A;  4AOF A;  5HQ8 A;  4GMJ A;  3O4Z A;  3ZPJ A;  2JLB A;  4F3V A;  4ATG A;  3TAX A;  2I6H A;  4JEH A;  3PDN A;  2GW1 A;  4BT8 A;  2OVF A;  3BG1 B;  5BW8 C;  3LVR E;  4MLP A;  5EX0 A;  2V4L A;  2FUL A;  3VTX A;  4I9E A;  2V0P A;  1EF1 C;  4CCA A;  4Q69 A;  4BX8 A;  3NZU A;  4GPK A;  3QNK A;  2PM6 A;  3FUN A;  4C0E A;  3I3N A;  1A17 A;  3FEY A;  3G2V A;  1ELK A;  3Q5M A;  1Y6I A;  4E6H A;  1ELW A;  4I43 A;  1XGW A;  1OUV A;  2P58 C;  3JQ0 A;  5KJN A;  5D0O D;  2LNI A;  4XZ4 A;  4UI9 C;  2DBA A;  1X5B A;  3ASF A;  3TJP A;  3UMV A;  3VLE A;  4C0M A;  4U63 A;  2XHE A;  4ANV A;  4HLE A;  1Z3Y A;  2I1J A;  2JEK A;  5C2Y A;  4GU5 A;  5T8I A;  4BFR A;  4RSY A;  2J4B A;  3LY9 A;  5FQ4 A;  5LX8 A;  4KVO A;  4G26 A;  4L23 A;  4AVX A;  4J8S A;  4J8D A;  3ZIM A;  3UT4 A;  1OWN A;  3CVL A;  4CDR A;  2BTD A;  2A4Z A;  2X38 A;  4I1A A;  1SZ9 A;  4A3T A;  4RG9 A;  3ASH A;  1H2T C;  3QKY A;  3GW4 A;  3L08 A;  3CHQ A;  4FJZ A;  3R9A B;  4AEZ C;  4CEM A;  2WXH A;  3LVQ E;  2VGY A;  2WQH A;  2WXN A;  2WXQ A;  4B0Z A;  2L9B A;  4GA2 A;  2PQN A;  1E8X A;  3CV0 A;  3Q4A B;  4HS2 A;  3B7T A;  5ANR A;  3HIZ A;  4U0S A;  4CT0 A;  4CT4 A;  5AJD A;  3B13 A;  3G2U A;  3MGB A;  4W9R A;  3CHP A;  4XKB A;  5AIJ A;  4KXK B;  1NP7 A;  3ONL A;  2XGM A;  3QDN A;  1QZ2 A;  5KJL A;  5JJ7 A;  3QWW A;  4ACL A;  4APF A;  1HH8 A;  4NUR A;  4U04 A;  1UW4 B;  5T4Y A;  2L0T B;  4FHK A;  2YNQ A;  3TXN A;  2DCP A;  4UQY A;  2VGX B;  4XKC A;  4N2Q A;  3GZS A;  4OYS A;  3U3W A;  4GA1 A;  3L13 A;  1E8Y A;  3VLF A;  2XRZ A;  3KS2 A;  4GZ5 A;  5LP0 A;  5BNW A;  5A23 A;  2YHC A;  2L0I A;  1E7V A;  3RIB A;  4U0Z A;  5CMW A;  1JUQ A;  1IHG A;  5HI7 A;  1ZBP A;  3TXM A;  4O6F A;  4JA9 A;  2IFU A;  2V5F A;  2FEZ A;  4J8E A;  2OV8 A;  1N52 A;  2LSV A;  2J9Q A;  4WNE A;  2RD0 A;  2R17 C;  3LCA A;  3MV3 B;  3D9L A;  4N3B A;  5LOZ A;  1IQU A;  1EYH A;  1ZU2 A;  4FC8 A;  1H0A A;  3EJN A;  4IN3 B;  3PNL B;  2C0M A;  3QAR A;  1LF8 A;  1HE8 A;  3LJ3 A;  4Y6C A;  4CRW A;  4JHJ A;  4PUC A;  3PVL A;  3AU5 A;  3CQC B;  4UI9 K;  5A6C A;  4MKT A;  3UQ3 A;  3APF A;  4DI3 A;  4WWN A;  5JHB A;  2OND A;  2LAH A;  3PUJ A;  4Y6W A;  3CHS A;  3OXL A;  4DK5 A;  5G05 C;  1OWM A;  3D9J A;  3FTW A;  4KVM A;  3FTY A;  3PRZ A;  1HF8 A;  3BG0 B;  2KCL A;  3QB2 A;  3KAE A;  3SD5 A;  3VTY A;  3QWP A;  2YIN A;  3LYA A;  4G25 A;  4TV3 A;  2WXP A;  2J08 A;  3MCX A;  4N3C A;  4XI0 A;  2FO7 A;  3S2A A;  2CHW A;  1W3B A;  2J4D A;  1HS6 A;  3AS8 A;  3T5X A;  2IOL A;  4KT6 B;  4MRU A;  4IUL A;  4PS7 A;  3CEQ A;  3NQP A;  1Z6T A;  3RJV A;  3RRN B;  4BTA A;  3S7F A;  4AM9 A;  5M72 A;  3DPD A;  3CVN A;  2EQX A;  3SBS A;  3PEV B;  5BPP A;  2I9C A;  2IJG X;  4KBQ A;  1UG3 A;  3FH5 A;  3ZEF A;  3U64 A;  3D9I A;  5EDS A;  3CIA A;  1H2U A;  1OWL A;  3PE4 A;  3Q47 B;  4WWO A;  1SZA A;  4JZY A;  1Z3X A;  1SQM A;  3LY7 A;  4JPS A;  3QC1 A;  3ZRH A;  5KJK A;  2VSO E;  3FUF A;  3SGH A;  4EEC A;  4YND A;  4PH4 B;  2WM9 A;  4B89 A;  3SI5 A;  2IOS A;  2YHE A;  4JXT A;  4B8A A;  4PDX A;  3ZHE A;  3ZVV A;  5J90 A;  3SBT B;  3ML8 A;  4JL0 A;  3D9O A;  2WXM A;  2IF4 A;  2KCK A;  1E8Z A;  1EDU A;  2KC7 A;  1E96 B;  2FBN A;  2KCV A;  4EBA A;  3CVQ A;  3B7S A;  2CG3 A;  4AJW A;  2XEV A;  4HXI A;  4A1G A;  3FTX A;  2R59 A;  1PY1 A;  2WPV A;  2X6I A;  4UI9 J;  4HOQ A;  3FH7 A;  4ANX A;  2KAT A;  2QFC A;  4MS6 A;  2IU1 A;  4FHJ A;  4UQZ A;  1JWF A;  3LEW A;  3ZW3 A;  3PZD A;  2WXO A;  3CHM A;  3K9I A;  3FUM A;  4JHK A;  2E0I A;  2FF4 A;  5AYW D;  4AP2 A;  2AXV A;  5D0Q D;  2V8S E;  3P2B A;  3UPV A;  4N2S A;  4K03 A;  3IHV A;  2HO1 A;  2QY7 A;  4NRH B;  4WWP A;  3S7D A;  3TG5 A;  1FVH A;  4WNG A;  4J6I A;  3ZHE B;  2KM4 A;  1E7U A;  3ZFW A;  2CG2 A;  3C98 A;  2XGS A;  3S7B A;  4I2W A;  1DVP A;  3FUE A;  3AU4 A;  3KEZ A;  4FLB A;  5C1D A;  4URK A;  3I4G A;  5FZS A;  3B7U X;  3MJW A;  3MKQ A;  4YVQ C;  3RO3 A;  2WQ6 A;  5CMY A;  3QAQ A;  3CHR A;  4I17 A;  2NXP A;  3TG4 A;  4UWH A;  1HG2 A;  3D9N A;  3OXF A;  3QK0 A;  5AEN A;  2AW6 A;  3FHE A;  1IQR A;  3APC A;  3U9W A;  4DI4 A;  4UWL A;  4B94 A;  3WXX A;  1XNF A;  2LO6 A;  3CQG B;  1H19 A;  2IQC A;  3CSF A;  4LER A;  1YA0 A;  1FCH A;  5FJY A;  4IRU A;  5EX3 A;  5JJ6 A;  4IYP A;  4LEU A;  5G04 C;  5FWQ A;  3E4B A;  4J8F A;  1S0P A;  2AWI A;  3CK9 A;  3LY8 A;  1PAQ A;  3FU0 A;  4P29 A;  4FJY A;  4AIF A;  2PZI A;  3TL5 A;  3FP3 A;  3FTV A;  3B7R L;  3N71 A;  3FUJ A;  3PEU B;  4GYW A;  4BX9 A;  2NC9 A;  1Y8M A;  4G23 A;  4GZ6 A;  3BEE A;  3DBS A;  4L1B A;  4NAC A;  3SHF A;  3L54 A;  3MZL B;  3S7J A;  4ACK A;  4ME2 A;  2AXU A;  4U07 A;  4GB9 A;  2X6J A;  1U3D A;  3CST A;  4G2V A;  5G04 J;  3CR3 A;  3G2T A;  5T3R A;  4CDM A;  2E2E A;  2M63 A;  2LAI A;  3ULQ A;  4L2L A;  2X6H A;  4UWG A;  4KYO B;  3QOU A;  3ESL A;  2XCB A;  5KCM A;  4APO A;  4V3I A;  3MYV A;  4AY6 A;  4PS8 A;  1FVF A;  3PUK A;  2PQR A;  4GML A;  3D9P A;  3ZN3 A;  1EPU A;  2L6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...