3RK6A

Crystal structure of the middle domain of human paip1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
217
structure length
217
Chain Sequence
b'TLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLKLVELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyadenylate-binding protein-interacting protein 1
publication title Crystal structure of the middle domain of human poly(A)-binding protein-interacting protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation regulator
total genus 85
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rk6A00
2I2OA 2FULA 1PAQA 1UG3A 5ANRA 2HM8A 4B8CB 4GMLA 4JHKA 1N52A 3D3MA 3FEXA 2IOLA 2VSOE 4CEMA 2KZTA 4C9BB 4IULA 2KZTB 4B89A 4LUNU 3EIJA 2VSXE 2IONA 1HU3A 1UW4B 1H2VC 1H6KA 4GMJA 2RG8A 2IU1A 3JUIA 2GGFA 1N54A 4CT4A 1H2TC 3RK6A 4CRWA 2IOSA 1H2UA 2NSZA 4B8AA 3EIQC 3L6AA 4JHJA 3FEYA 2ZU6B
chains in the Genus database with same CATH superfamily
4YDWA 5AQ9A 4A3TA 5AJLA 4NIKA 3MCXA 5FZSA 4XZ4A 2WB2A 3NB2A 3ZKJA 1S64A 2QFCA 5AYWD 1S70B 5HQ8A 2LNIA 4GZDA 1BI7B 3Q7FA 1FT1A 3NOGD 2I1JA 2EILE 3E33A 4JEUA 4JB8P 3TL5A 3QDNA 4JL0A 1MQSA 3ML8A 4B89A 2P9LG 3APDA 4PUCA 4U0UA 1N4PA 3IHVA 2PZIA 2LXMA 2XPYA 1H0AA 4BTBA 1NI1A 4F6RD 4WWNA 5FZRA 1IYGA 3CKBA 4JXTA 2R05A 1YMPA 1IHGA 4CT0A 3Q79A 3CHOA 1OCOE 5LCWC 5CERB 4A55A 2P58C 3TWVA 4ABNA 2QYJA 3I3NA 5ENQD 2PL2A 3PREA 3ABLE 4P29A 3TXMA 5E76A 4FLHA 2R5SA 4XKBA 2ZGDA 3HXCA 2VJ8A 3ZN3A 3ZYMA 2KC7A 3CQCB 3L9TA 3QKYA 3G2UA 4JVSA 4G25A 2BEDA 3R7RA 4C9BB 4IULA 2EINE 4GCNA 3NZUA 3HYMB 1ELKA 2Y4UA 2XGSA 1N0RA 1DCEA 3FUJA 4JHJA 3RRNB 5G05J 2J4BA 2GW1A 2HM8A 2V8SE 4JPSA 5ARGA 2ETCA 3FUDA 1JCSA 4BSXA 3LEWA 5BT1A 3UKUG 2IO3C 3ZRHA 3HHMA 4NACA 4XKCA 3T9KA 2DCPA 3EHMA 4J8FA 3BUAA 1H6OA 4UQYA 3DSXA 3WG7E 4DK5A 4AY6A 3UT7A 4UWFA 2AVPA 4E6HA 4ANUA 3RRMB 4I2WA 3E32A 2UY1A 4O60A 1S0PA 2PM7A 3DRAA 4DI4A 1KPSB 4LNUD 3FUKA 1HU3A 4K5CA 1OWLA 4TXPA 1H6KA 5CEAA 3UX4A 3B7UX 3MZLB 3TG4A 3AS5A 4PS7A 3BQOA 5KJLA 3AAAC 2BKGA 4CGVA 3UM0A 3ZYLA 2XEEA 4FADA 1HZ4A 2IJGX 2FBNA 5ANLA 3SBTB 4JZYA 4DX6D 3C3RA 4HB5A 3LY7A 3PNTB 3PE3A 3KD7A 4LCTA 4GZ5A 1TJCA 5FZQA 3U3WA 3ZYQA 5BV1A 3L16A 3DSVA 3FTSA 3AG3E 1SA5A 3OXLA 1DCQA 3ZXSA 3W9GA 2MOWA 3QWWA 4ILHB 2JEKA 2H6FA 4FJYA 5CRUA 2VSOE 2AWIA 2EIJE 4RVBA 1MX6A 2XRYA 1OY3D 3PZDA 3SQVA 4N2QA 2YHEA 3EU9A 5G05C 1HG2A 1OCCE 2IOSA 1WG0A 3HXFA 3IV0A 4KZCA 4YVOA 2WMNA 4O6FA 3PNLB 1OT8A 2ETBA 2ZGGA 2KXPC 3EHQA 4U7EB 4F53A 4JC8A 4TXRA 3FUEA 2C0MA 4XX5A 1FT2A 1P5QA 4HORA 2P2CP 2KCVA 2NSZA 5JHAA 3QC1A 2L6JA 3NAWA 3PZ3A 1Z3XA 1N52A 4HOQA 4I9EA 3T8MA 4L23A 3V2OA 3ZUVB 2VYIA 3I4RB 5CMYA 2FO1E 1KT0A 3FY4A 1U3CA 2UY1B 2WXHA 3LS8A 4HVBA 2R02A 3CK9A 3CHRA 3GYZA 3QB2A 3D9LA 3MYVA 4HLEA 1TJFA 4DX5D 3TWRA 3PDNA 3PUJA 2OEWA 5A7DB 1QYMA 1IHBA 2VSNA 2LSVA 5LX8A 3NBNB 2H6HA 3HG0D 5IY5E 2CG3A 3RO2A 3UI2A 2L0TB 3RO3A 3FTYA 2C2LA 4UWLA 1MJ0A 2KCLA 2XS1A 1EPUA 1N95A 3CEQA 2M63A 4K0RA 3VLFA 2LO6A 3PE4A 4ACLA 1PC2A 3L6AA 1O1RA 3VTYA 2JLBA 4U04A 5AAOA 2P9NG 4GMLA 3U64A 5FQ7A 1WAO1 3LY8A 5AIJA 3QNKA 1DNPA 5BUZA 1RW2A 3DSSA 2Y3AA 4RQIA 5BXOA 2P9IG 3L54A 1K1AA 1AP7A 1UN9A 3FDHA 1JPLA 1HS6A 3D9MA 2V5QC 1Z3YA 3PH0C 5M72A 4ATZD 4I2ZA 3ASGA 2VQ2A 4I6EA 5T3RA 4AOFA 2YHCA 4GA2A 3L08A 3QJZA 3DXKG 2LXLA 3L13A 1NP7A 2LUHA 3IXEA 3WXXA 3LJNA 1LD8A 4U95D 2J8SD 3PEVB 4HBDA 1VDYA 4AY5A 2JABA 2XHEA 3B7BA 4WWPA 4EBAA 2GRRB 2IFUA 1QQEA 4C0EA 1N94A 2GRPB 1FVHA 2B6CA 4ATGA 5KJMA 4FULA 3FHEA 4BSZB 4W9RA 3IBEA 3ZEFA 2HYZA 5D66A 2H6IA 3ZPJA 3B7TA 5CCMA 4UWKA 2C0LA 3DPYA 3Q73A 4UQZA 1TN7A 3Q9UC 1NZNA 3PVLA 3SFZA 4OVVA 4GTPA 2YQ8A 4FP7A 3C3QA 3Q47B 2X6HA 3NF1A 3ZU7B 4R7LA 4FU3A 1U2VG 3ZXPA 4J7WA 3DSTA 5KBAA 3CR3A 3NOCD 2KATA 1N54A 3ULQA 4BY6A 3TAXA 3CHMA 5ARFA 4XE0A 5ENSD 5JJ7A 2AXVA 3FP3A 1V55E 4ME2A 3JQ1A 2E0IA 2WQHA 4HS2A 3S7BA 2CFUA 5KNGA 2F0YA 2F8YA 3KSLA 5CBNA 3OAWA 3CVPA 4FLBA 3KEAA 4GB9A 2L9BA 2Q7FA 5FQ8A 2OCCE 3ASDA 2AXZA 2MYOA 3LVRE 3E34A 5JJ6A 1HE8A 2H6GA 4AIFA 3ISMC 4FC8A 2OOEA 4EZKA 2GRMA 3CIAA 3EIQC 2ZU6B 5LP0A 3P2BA 2QY7A 2VGXA 4GTQA 1XNFA 4TUMA 3FU6A 3KAEA 5JMND 1H2UA 2IO2C 5ENOD 1HF8A 4UI9K 4V3IA 2Y69E 3LPZA 3GW4A 3ULYA 5JJTA 3D9PA 3AS8A 1D8EA 3RAUA 1MX2A 1ELRA 4O1OA 5KJNA 4KT6B 1DVPA 1N4RA 1DC2A 3G2TA 4ILGA 4PH4B 3HVEA 4HQDA 4Y6CA 1RZ4A 4G23A 1BPOA 1HH8A 2P9SG 3D9JA 3FTXA 2J08A 5JHBA 3B7SA 3CHQA 2OEVA 3DEPA 1TNBA 4AVXA 1QBQA 2P9KG 3FEYA 5J08A 1GW6A 3EU5A 5A6CA 3FEXA 3MA5A 2B0OE 2X6JA 4G2VA 3MGBA 4AXHA 2WM9A 2X3MA 4X8QA 4BTAA 3LDZA 1BU9A 5CRVA 2FULA 5EX0A 3VLEA 4MRUA 5B1BE 4ILIA 3OTNA 2IQCA 4F1SA 3UM1A 4MKTA 3UIOC 4CRWA 2J07A 1SA4A 3GZ1A 3FULA 2NYJA 3JUEA 3CV0A 3Q75A 1E7VA 3DPDA 4G8KA 1X81A 3AJIA 2I1KA 4Z68A 1N11A 3HDXA 2WQ6A 4ACKA 1PAQA 2DIWA 3MKQA 3D9HA 2RD0A 4LNBA 3FU5A 3UT8A 4I1AA 1W3BA 2VGXB 4UI9J 3S7FA 2BTDA 4HXIA 4DPRA 1IKND 1E8XA 1YYHA 3ZHEA 1HG5A 3RU0A 3X2QE 5BV0A 4M7CA 5AQAA 2MRIA 4GYWA 2X38A 3QAQA 1PY1A 3PRZA 2RFMA 4GPKA 3E37A 3DXMG 4XI9A 3KEZA 3HXBA 1V54E 1JCQA 1U3DA 2KM4A 3K9IA 2YNQA 1EF1C 4AEZC 1D8DA 3HVEB 2I6HA 4I43A 3URZA 2XGOA 4DX1A 2KBXA 1KZOA 4YNDA 2ZISA 4OYSA 1TNOA 4FHJA 5B1AE 5EDSA 3O48A 4BEPA 3CVUA 3CVVA 5D0QD 3QARA 1HXIA 1TNYA 3JQ0A 3P1UA 4F7AA 2WMOA 3G2WA 2EQXA 3MKRA 4GTSA 2A5UA 1ELWA 3W9FA 3TWXA 2HE0A 1OWOA 4G24A 4M3OA 4XEIG 2EIME 3G2SA 4HRMB 3ZW3A 1LF8A 5BPPA 1UN8A 4H7YA 5T8IA 1A17A 4FHKA 4MLPA 2IY0C 4F3VA 3FU3A 2NXPA 4L2YA 1UG3A 2GRQB 2P9PG 2XEHA 3ASHA 1KZPA 3SZ7A 3SI5A 1MZCA 5G04J 3DWLG 2QC9A 1S63A 3V31A 2FI7A 4ZHBA 5HKPA 5AQBA 4TXQA 3LYAA 5T4YA 2AXUA 4D10C 3Q4AB 4PS8A 4YDEA 2VGEA 3B13A 4GTVA 2A4ZA 3VTXA 1JWFA 1YCSB 4IN3B 4B0ZA 4GZCA 3CVWA 5E75A 2LAHA 2QZAA 1B89A 3R7QA 4BX8A 3OXFA 2A5EA 4UI9C 2L6BA 5CEDB 3PEUB 3MKQB 4DLQA 3MJWA 4F1PA 3AU4A 1L5JA 5ENRD 5EIBE 3ZHEB 2J9QA 4DRXE 4PDXA 3S7DA 3ZIMA 2DYSE 3SY2A 2WXIA 1TYQG 2OVBA 3FUFA 4JHKA 5DIZA 4BT8A 3U4TA 3FU0A 4GU5A 4DX2A 3APCA 2OVFA 3GZ2A 1UJKA 4OVUA 5FQ4A 4TUUA 3CSFA 3FWVA 3C98A 3ABKE 1Q2ZA 1IXVA 4OAUC 1FPPA 4MS6A 3ASFA 4B8CB 3CHSA 4WNGA 3TGOA 3MV3B 4KZ0A 3SD5A 1H6PA 4U8VD 3UXGA 2ILRA 1QNFA 3BG0B 1N4QA 4CT4A 2XS8A 1BI8B 4Q96A 2XGMA 3SF4A 3CVLA 4UWGA 2WXKA 5G2NA 3TJPA 3DSWA 1MX4A 4LG6A 2R17C 3V30A 3ESLA 4JA7A 2CHZA 4TV3A 3MV2B 5KWDA 4H7XA 4CDMA 3ULEG 3L82A 4N3AA 4BERA 3ZYKA 5AENA 3Q9NC 4JA9A 3FTZA 2X6IA 4U0ZA 5G55A 4EBAG 4U63A 1ZB1A 3PZ4A 4KVOA 3NQPA 4GZ3A 3MX3A 5LFAA 4ZFHA 1OUVA 4CYMD 2MHKA 1K1BA 2HO1A 4MBGA 4BWRA 2I2OA 2Y4TA 4HRLA 5J90A 2UWJG 1E96B 3D9OA 4YVQC 5EILA 3BU8A 3TWSA 3Q7AA 5FIOA 2AJAA 3UM2A 4GZ6A 1BLXB 3FUMA 1OCRE 1E7UA 1HO8A 4AJWA 4XI0A 4QQIA 3LJ3A 1O5MA 4URKA 4G26A 4WUYA 3RKVA 4WNEA 4HI9A 3C72A 4J8SA 4HNAD 2QYUA 4TRQA 3S2AA 3ML9A 1LD7A 4GA0A 1MYOA 3CHPA 3RIBA 3T5XA 4UQXA 3O4ZA 5FQ6A 3RJVA 3N71A 2ETAA 3AS4A 2P9UG 3Q78A 2J09A 2XPIA 3AG4E 1E90A 4RSYA 4AM9A 3CVXA 4GMRA 3RRUA 3RSEG 2BKKB 2VTBA 3PZ1A 4WWOA 2XQ0A 3HXEA 5EX3A 4UWHA 4YDYA 3SGHA 2J4DA 1ZU2A 3CK8A 4GMJA 3D9NA 4J8YA 3ZGQA 1OWMA 2NC9A 1OXJA 2XZTG 1OWNA 3LKUA 3ENEA 4J8DA 2AW6A 1TNUA 3GZSA 4LSZE 4JW1A 3L22A 3LVQE 4L7TA 4EECA 5CMWA 1JWGA 3PZ2A 2BF0X 3ESKA 4CCAA 2XCBA 4KXKB 4J6IA 4ANVA 4U8HA 4WAFA 2WXLA 1YA0A 1QZ2A 4CEMA 2V5FA 1TNZA 4HLLA 2L0IA 2WXQA 1KT1A 2VSXE 5ITZF 1UW4B 5AJDA 2RFAA 2CHWA 3HIZA 3FH8A 4I6GA 4C48B 2DWZA 3JYSA 4ANXA 4IRUA 3APFA 4HFGA 4AP2A 4PS3A 4APFA 2Y0BG 4A1SA 4APOA 4ANWA 3ONKA 1K8KG 4HRNA 3ONLA 4EZJA 2XZDG 2FO7A 3L17A 2PQNA 2WXNA 1HX8A 2RKKA 4RLYA 4N3CA 2J49A 1IQRA 2R2LA 4DUIA 4DI3A 3KSQA 2IEJA 1WDYA 4AV7A 2XENA 3UT4A 1HFAA 3BG1B 4E85A 4GAAA 1Z6TA 4N3BA 1N4SA 5FWQA 3SHFA 2WXFA 3V79K 5AARA 3QK0A 3Q15A 3B7RL 2OV8A 2EIKE 3FTVA 1Y8MA 1NL4A 3R9AB 3TWWA 3ASOE 1G3NB 3UMVA 4B93B 3ABME 2WXGA 5CCLA 3S7JA 1H19A 2WXPA 5FT9A 1LTXA 4B94A 2VTBB 4L9PA 4BT9A 2I9CA 5KCMA 3EIJA 3MEKA 1K3ZD 1SVXA 4DJAA 2PNNA 4A1GA 2GRNB 1D9SA 2GROB 2R59A 2ONDA 5D2MC 3ZVVA 3EHRA 1AWCB 4JEHA 2ZIRA 4J8EA 4GTTA 4GPMA 3DEOA 4I6JA 1ZBPA 1KLXA 5BNWA 4HOUA 1SZ9A 2IF4A 4HOTA 3ASNE 3CQGB 5LOZA 3CLJA 4BFRA 2WQ7A 3CVNA 4N2SA 4L2LA 5A23A 4WNFA 1FVFA 4LUNU 5DBKA 2IONA 3LCAA 1NFIE 2RG8A 3CVYA 3QOUA 2FEZA 5CECB 4U07A 4KMOA 1SQMA 5EN5D 4LRZA 2DBAA 3CSTA 1A5EA 1EDUA 3FH5A 3HXDA 4U96D 2WXRA 2V4HC 1MHQA 2F37A 3Q5MA 4G1TA 4K03A 5H7PA 1N0QA 2CFZA 3Q49B 4GCOA 1E8YA 5FJYA 2PQRA 2V4LA 1TEZA 2Y1LE 3EUVA 5AQ7A 3SO8A 1WM5A 3D3MA 2PM6A 3JXJA 3IHYA 2KZTA 5CBOA 1XGWA 4EQFA 3AU5A 5EIDA 1X5BA 2IU1A 3AG2E 4GTOA 1TN8A 3UKRG 5KNHD 4DLOA 5ENTD 4N39A 3TXNA 4I9CA 4KVMA 4EZLA 4UUCA 2DZNA 1FCHA 3FH7A 4RG6A 2WXMA 3U66A 2WXJA 1TN6A 3QWVA 4IYPA 1H2TC 2XRZA 1NA0A 3J5QB 2DVWA 2DYRE 3E30A 4LEUA 4WNDA 3E4BA 1TR4A 1OWPA 3FUHA 5C1DA 5KJKA 2X6FA 4C0MA 1N9AA 2X6KA 1UJJA 4GTMA 4GA1A 1IQUA 4Y6WA 2IOLA 1O1TA 4NRHB 3HRAA 3G2VA 4LNGA 3F6QA 4LERA 4RG9A 3UUXA 3PUKA 4BETA 2LAIA 3ZFWA 4GYYA 3DBSA 4CDNA 3I5PA 4OAVB 4CGWA 4A3VA 3T8KA 4K5BA 3TWTA 5C2YA 3SNXA 2GRLA 3UM3A 2VGYA 1H2VC 1Z5SC 2CHXA 4YDOA 3EJNA 3UPVA 3UQ3A 4O1PA 5ENNA 5AN8A 1WY6A 3D9KA 3LY9A 5ANRA 3VLDA 4CZ2D 3SFYA 1UOHA 3SBSA 4FJZA 3CVQA 4A63B 3TWUA 1OCZE 5CHEE 4K5AB 3C5RA 3V2XA 3FFLA 4Q69A 4GYOA 4KYOB 3UIPC 3FTUA 3LXUX 4EPZA 1E8ZA 2V0PA 4QFVA 5EKQD 4N5QA 4EHMA 2KZTB 3UINC 4G8LA 1SZAA 4KBQA 5D0OD 3IEGA 2ZXWE 3CK7A 1SW6A 2FF4A 2YINA 3OXGA 5HRYA 4J0UA 5G04C 3DSUA 1NA3A 4Q94A 3R9MA 4NQ0A 1EYHA 2XEVA 3BEEA 5EYLA 4L1BA 2HR2A 3RK6A 4N5CA 4BESA 4FA6A 3NZSA 3PS6A 5HI7A 3TG5A 5B3SE 2BUGA 3U9WA 5LCWJ 4GTRA 3SFXA 3FUIA 3IKOB 3B95A 1INZA 2F8XK 3I4GA 4HI8A 4BX9A 2R03A 3JUIA 2GGFA 2VSYA 3EHNA 5EYPF 3JCKC 3FTWA 3JXIA 2XCCA 4B8AA 2WPVA 4I1MA 4XIFA 5BW8C 1Y6IA 4I1OB 3UTMA 5FTPA 4JD2G 4CDRA 2KCKA 4I17A 2DZOA 3KS2A 3CKCA 3QWPA 3FUNA 1E8WA 3D9IA 4JHRA 2CG2A 2LSUA 5ENPD 5BXUA 2WXOA 3CGHA 4G11A 4NURA 5HS0A 1O1SA 4U0SA 3TWQA 2E2EA 3EDTB 5JA4D 1JUQA 3ZNGA 5FINA 3C3OA 2WVIA 3T5VA 1BD8A 4DX7D 1JCRA 3AG1E 3J5PA 4U8YD 2XPZA 4HOSA
chains in the Genus database with same CATH topology
5FWQA 1UN9A 3FDHA 2WXFA 3SHFA 1OWOA 4A3TA 4G24A 5AJLA 1JPLA 1HS6A 3D9MA 1Z3YA 3MCXA 5FZSA 3PH0C 3QK0A 4M3OA 5M72A 3Q15A 3G2SA 3B7RL 4XZ4A 2OV8A 4I2ZA 3ZW3A 2WB2A 3FTVA 1LF8A 3ASGA 5BPPA 2QFCA 5AYWD 1UN8A 1Y8MA 4H7YA 5HQ8A 2LNIA 5T8IA 3R9AB 2VQ2A 1A17A 4FHKA 3UMVA 4MLPA 4GZDA 4I6EA 5T3RA 4F3VA 2WXGA 5CCLA 3FU3A 3S7JA 1H19A 4AOFA 2NXPA 2I1JA 2WXPA 5FT9A 4L2YA 2YHCA 1UG3A 4B94A 4GA2A 2VTBB 4JEUA 3L08A 3QJZA 3TL5A 3L13A 3ASHA 3QDNA 4BT9A 1NP7A 4JL0A 2I9CA 5KCMA 1MQSA 3ML8A 3SZ7A 3EIJA 3SI5A 4B89A 3MEKA 3WXXA 5G04J 3APDA 4PUCA 4U0UA 4DJAA 3PEVB 2FI7A 4A1GA 3IHVA 2PZIA 1VDYA 2XPYA 4AY5A 1H0AA 2R59A 3LYAA 2XHEA 5T4YA 4BTBA 2ONDA 4WWPA 4EBAA 2AXUA 4D10C 4WWNA 3ZVVA 3Q4AB 5FZRA 4PS8A 2IFUA 1IYGA 3B13A 3VTXA 2A4ZA 1JWFA 3CKBA 1QQEA 4JEHA 4JXTA 4C0EA 4J8EA 1IHGA 4IN3B 4B0ZA 1FVHA 4GZCA 4I6JA 3CVWA 5E75A 1ZBPA 1KLXA 4ATGA 4CT0A 5BNWA 2LAHA 4HOUA 5KJMA 4FULA 3CHOA 3FHEA 1SZ9A 5LCWC 2IF4A 4HOTA 3CQGB 4W9RA 1B89A 3IBEA 3R7QA 4BX8A 4A55A 5LOZA 3CLJA 3ZEFA 2P58C 3OXFA 2HYZA 4BFRA 2WQ7A 3CVNA 4ABNA 4UI9C 3I3NA 3ZPJA 4N2SA 3B7TA 4L2LA 3PEUB 5CCMA 4UWKA 5A23A 2PL2A 3MKQB 4WNFA 2C0LA 1FVFA 3PREA 4DLQA 4LUNU 4P29A 3TXMA 5DBKA 5E76A 2IONA 3LCAA 3MJWA 4UQZA 1NZNA 2R5SA 3PVLA 4FLHA 4XKBA 3SFZA 2RG8A 3AU4A 1L5JA 4OVVA 3CVYA 3QOUA 2YQ8A 4FP7A 3ZHEB 2J9QA 2FEZA 4PDXA 3S7DA 3ZIMA 3Q47B 2VJ8A 3ZN3A 2X6HA 3ZYMA 2WXIA 2KC7A 3NF1A 4U07A 3CQCB 4KMOA 1SQMA 3QKYA 2OVBA 3FUFA 4R7LA 3G2UA 4JHKA 4FU3A 5DIZA 4LRZA 4JVSA 2DBAA 3U4TA 4BT8A 4G25A 3CSTA 3FU0A 1EDUA 4GU5A 3APCA 2OVFA 3GZ2A 3R7RA 4C9BB 3FH5A 4IULA 2WXRA 1UJKA 4OVUA 5FQ4A 1MHQA 4GCNA 3NZUA 3CR3A 3HYMB 4TUUA 1ELKA 3CSFA 2Y4UA 3Q5MA 3FWVA 2XGSA 4G1TA 2KATA 3C98A 4K03A 2CFZA 1N54A 3ULQA 3Q49B 4BY6A 4GCOA 1E8YA 3FUJA 5FJYA 3TAXA 2PQRA 2V4LA 4JHJA 3RRNB 1TEZA 5G05J 3CHMA 5ARFA 2J4BA 4MS6A 1WM5A 3ASFA 2GW1A 2HM8A 2V8SE 4JPSA 5ARGA 4B8CB 4XE0A 3D3MA 2PM6A 5JJ7A 3FUDA 3CHSA 3IHYA 2KZTA 4WNGA 3TGOA 2AXVA 3FP3A 3MV3B 4KZ0A 4ME2A 1XGWA 3JQ1A 2E0IA 3SD5A 3AU5A 4EQFA 2WQHA 4HS2A 3S7BA 2CFUA 2ILRA 1X5BA 4BSXA 2IU1A 1QNFA 3OAWA 3CVPA 3BG0B 4FLBA 4CT4A 3LEWA 5BT1A 4HOSA 3ZRHA 3HHMA 4GB9A 4Q96A 4DLOA 2XGMA 2L9BA 2Q7FA 4N39A 3SF4A 5FQ8A 3CVLA 4UWGA 2WXKA 4NACA 3TXNA 3ASDA 2AXZA 5G2NA 4XKCA 3LVRE 4I9CA 3TJPA 4KVMA 4EZLA 5JJ6A 2DCPA 1HE8A 3EHMA 1FCHA 2R17C 4J8FA 3FH7A 4AIFA 3ESLA 4JA7A 2CHZA 4UQYA 4FC8A 4RG6A 2OOEA 2WXMA 4TV3A 3MV2B 4DK5A 3U66A 4AY6A 2WXJA 3UT7A 4UWFA 3QWVA 4H7XA 4CDMA 4EZKA 2AVPA 4IYPA 1H2TC 4N3AA 4E6HA 2GRMA 4ANUA 3RRMB 3CIAA 3ZYKA 3EIQC 5AENA 4I2WA 2XRZA 2UY1A 2ZU6B 4JA9A 5LP0A 3FTZA 1NA0A 2X6IA 4U0ZA 5G55A 3P2BA 1S0PA 2PM7A 2QY7A 4EBAG 4LEUA 4DI4A 2VGXA 4U63A 1XNFA 3FUKA 4WNDA 4KVOA 1HU3A 3NQPA 1OWLA 3FU6A 4GZ3A 1H6KA 3E4BA 1OWPA 3FUHA 5C1DA 3KAEA 3MX3A 5LFAA 3UX4A 1H2UA 3B7UX 1OUVA 5KJKA 2X6FA 3MZLB 3TG4A 3AS5A 4PS7A 2X6KA 2MHKA 2HO1A 1HF8A 4C0MA 4BWRA 2I2OA 2Y4TA 4UI9K 5KJLA 1UJJA 4V3IA 4CGVA 4GA1A 5J90A 2UWJG 1IQUA 3ZYLA 4FADA 3LPZA 1HZ4A 4Y6WA 2IOLA 3GW4A 5JJTA 2IJGX 3D9PA 3AS8A 2FBNA 1ELRA 5ANLA 4NRHB 4KT6B 1E96B 1DVPA 3D9OA 5KJNA 4YVQC 3SBTB 4JZYA 3G2TA 4ILGA 3G2VA 4PH4B 4LERA 3HVEA 4RG9A 3LY7A 3PNTB 3PE3A 3KD7A 4LCTA 3UUXA 4Y6CA 3PUKA 4GZ5A 2LAIA 1TJCA 4GZ6A 5FZQA 4G23A 3FUMA 1BPOA 3ZFWA 4GYYA 1E7UA 1HO8A 1HH8A 4AJWA 3U3WA 3DBSA 4CDNA 4XI0A 3ZYQA 3I5PA 5BV1A 3LJ3A 4CGWA 4A3VA 3L16A 4URKA 3FTSA 4G26A 4WUYA 3D9JA 5C2YA 3RKVA 4WNEA 3FTXA 4J8SA 3SNXA 2GRLA 3OXLA 2VGYA 1H2VC 2J08A 4TRQA 5JHBA 3B7SA 2CHXA 3CHQA 3S2AA 3ML9A 3ZXSA 4AVXA 4GA0A 3EJNA 3CHPA 3UPVA 2MOWA 3RIBA 3T5XA 3UQ3A 3QWWA 4ILHB 3FEYA 4UQXA 3O4ZA 5ENNA 5FQ6A 3RJVA 2JEKA 1WY6A 5J08A 1GW6A 3D9KA 3LY9A 4FJYA 5ANRA 3VLDA 3N71A 5A6CA 3FEXA 3MA5A 2VSOE 3AS4A 2AWIA 4RVBA 2J09A 2X6JA 2XRYA 3SBSA 2XPIA 4FJZA 3CVQA 3PZDA 4G2VA 3MGBA 5CHEE 4N2QA 2YHEA 1E90A 3FFLA 5G05C 4AXHA 2WM9A 2X3MA 4RSYA 4Q69A 1HG2A 4AM9A 4GYOA 4KYOB 2IOSA 3CVXA 3RRUA 4BTAA 3LDZA 3IV0A 4KZCA 3FTUA 3LXUX 4YVOA 2VTBA 2FULA 4EPZA 1E8ZA 2WMNA 4O6FA 3PNLB 2V0PA 4QFVA 4WWOA 2XQ0A 5EKQD 5EX0A 3VLEA 5EX3A 2KZTB 4UWHA 3SGHA 4MRUA 2J4DA 4ILIA 3OTNA 2IQCA 4F53A 1ZU2A 4JC8A 3CK8A 4GMJA 4F1SA 3D9NA 1SZAA 4KBQA 3FUEA 2C0MA 4MKTA 4XX5A 5D0OD 3IEGA 4CRWA 1P5QA 4HORA 2KCVA 2J07A 2NSZA 3CK7A 5JHAA 3QC1A 2L6JA 2FF4A 2YINA 3ZGQA 1OWMA 3OXGA 4J0UA 1Z3XA 2NC9A 3GZ1A 3FULA 5G04C 1N52A 4HOQA 1OWNA 3CV0A 4I9EA 1NA3A 3LKUA 3ENEA 4Q94A 1E7VA 3DPDA 4J8DA 2AW6A 3GZSA 4L23A 3T8MA 4NQ0A 1EYHA 2XEVA 3BEEA 2I1KA 4JW1A 4L1BA 2HR2A 3L22A 2VYIA 3HDXA 3I4RB 5CMYA 2WQ6A 3RK6A 3LVQE 4L7TA 4EECA 5CMWA 1JWGA 4N5CA 2BF0X 4FA6A 3ESKA 4CCAA 3NZSA 3PS6A 5HI7A 2XCBA 4KXKB 3TG5A 4ACKA 4J6IA 4ANVA 2BUGA 4U8HA 1KT0A 3FY4A 3U9WA 1U3CA 1PAQA 2WXHA 2UY1B 3LS8A 4HVBA 4WAFA 2DIWA 5LCWJ 3CK9A 2WXLA 1YA0A 1QZ2A 3CHRA 3FUIA 3MKQA 2RD0A 3GYZA 4CEMA 2V5FA 3IKOB 3D9LA 3QB2A 3FU5A 3UT8A 1INZA 3MYVA 4I1AA 2L0IA 4HLEA 1W3BA 2VGXB 2WXQA 3I4GA 1KT1A 2VSXE 1UW4B 1TJFA 4UI9J 2BTDA 4HXIA 3S7FA 5AJDA 4BX9A 4DPRA 3PDNA 3HIZA 2CHWA 1E8XA 2GGFA 3JUIA 3ZHEA 3FH8A 4I6GA 2VSYA 3PUJA 3EHNA 1HG5A 3FTWA 3JCKC 3RU0A 5BV0A 2XCCA 5A7DB 3JYSA 2VSNA 4B8AA 4ANXA 2WPVA 2MRIA 4I1MA 2LSVA 4IRUA 3APFA 4HFGA 5LX8A 4XIFA 5BW8C 4GYWA 4AP2A 4PS3A 2X38A 1Y6IA 4I1OB 2CG3A 3QAQA 4APFA 1PY1A 3PRZA 4GPKA 3RO2A 4A1SA 4APOA 4ANWA 5FTPA 3ONKA 2L0TB 3RO3A 3FTYA 4CDRA 4XI9A 2C2LA 3KEZA 3ONLA 4UWLA 4EZJA 2KCKA 2KCLA 4I17A 1U3DA 1EPUA 2FO7A 2KM4A 3L17A 3K9IA 3KS2A 2PQNA 3CEQA 2YNQA 3CKCA 2M63A 1EF1C 3QWPA 4K0RA 3VLFA 2WXNA 4AEZC 2LO6A 3HVEB 3FUNA 1E8WA 1HX8A 2I6HA 3PE4A 4I43A 4ACLA 3D9IA 2XGOA 4JHRA 3URZA 2CG2A 2LSUA 4N3CA 1PC2A 4OYSA 3L6AA 4YNDA 2WXOA 3VTYA 2JLBA 4FHJA 4U04A 3CGHA 5EDSA 2J49A 4G11A 3O48A 4NURA 1IQRA 3CVUA 4GMLA 4U0SA 3CVVA 3U64A 5D0QD 5FQ7A 4DI3A 2E2EA 3EDTB 1HXIA 3QARA 1JUQA 1WAO1 3JQ0A 3P1UA 3LY8A 4AV7A 5AIJA 3QNKA 1DNPA 4F7AA 2WVIA 3UT4A 5BUZA 3T5VA 2WMOA 3G2WA 2EQXA 3MKRA 1HFAA 2A5UA 3BG1B 4E85A 1ELWA 2Y3AA 4GAAA 1Z6TA 3L54A 2XPZA 4N3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I2O A;  2FUL A;  1PAQ A;  1UG3 A;  5ANR A;  2HM8 A;  4B8C B;  4GML A;  4JHK A;  1N52 A;  3D3M A;  3FEX A;  2IOL A;  2VSO E;  4CEM A;  2KZT A;  4C9B B;  4IUL A;  2KZT B;  4B89 A;  4LUN U;  3EIJ A;  2VSX E;  2ION A;  1HU3 A;  1UW4 B;  1H2V C;  1H6K A;  4GMJ A;  2RG8 A;  2IU1 A;  3JUI A;  2GGF A;  1N54 A;  4CT4 A;  1H2T C;  3RK6 A;  4CRW A;  2IOS A;  1H2U A;  2NSZ A;  4B8A A;  3EIQ C;  3L6A A;  4JHJ A;  3FEY A;  2ZU6 B; 
#chains in the Genus database with same CATH topology
 4YDW A;  5AQ9 A;  4A3T A;  5AJL A;  4NIK A;  3MCX A;  5FZS A;  4XZ4 A;  2WB2 A;  3NB2 A;  3ZKJ A;  1S64 A;  2QFC A;  5AYW D;  1S70 B;  5HQ8 A;  2LNI A;  4GZD A;  1BI7 B;  3Q7F A;  1FT1 A;  3NOG D;  2I1J A;  2EIL E;  3E33 A;  4JEU A;  4JB8 P;  3TL5 A;  3QDN A;  4JL0 A;  1MQS A;  3ML8 A;  4B89 A;  2P9L G;  3APD A;  4PUC A;  4U0U A;  1N4P A;  3IHV A;  2PZI A;  2LXM A;  2XPY A;  1H0A A;  4BTB A;  1NI1 A;  4F6R D;  4WWN A;  5FZR A;  1IYG A;  3CKB A;  4JXT A;  2R05 A;  1YMP A;  1IHG A;  4CT0 A;  3Q79 A;  3CHO A;  1OCO E;  5LCW C;  5CER B;  4A55 A;  2P58 C;  3TWV A;  4ABN A;  2QYJ A;  3I3N A;  5ENQ D;  2PL2 A;  3PRE A;  3ABL E;  4P29 A;  3TXM A;  5E76 A;  4FLH A;  2R5S A;  4XKB A;  2ZGD A;  3HXC A;  2VJ8 A;  3ZN3 A;  3ZYM A;  2KC7 A;  3CQC B;  3L9T A;  3QKY A;  3G2U A;  4JVS A;  4G25 A;  2BED A;  3R7R A;  4C9B B;  4IUL A;  2EIN E;  4GCN A;  3NZU A;  3HYM B;  1ELK A;  2Y4U A;  2XGS A;  1N0R A;  1DCE A;  3FUJ A;  4JHJ A;  3RRN B;  5G05 J;  2J4B A;  2GW1 A;  2HM8 A;  2V8S E;  4JPS A;  5ARG A;  2ETC A;  3FUD A;  1JCS A;  4BSX A;  3LEW A;  5BT1 A;  3UKU G;  2IO3 C;  3ZRH A;  3HHM A;  4NAC A;  4XKC A;  3T9K A;  2DCP A;  3EHM A;  4J8F A;  3BUA A;  1H6O A;  4UQY A;  3DSX A;  3WG7 E;  4DK5 A;  4AY6 A;  3UT7 A;  4UWF A;  2AVP A;  4E6H A;  4ANU A;  3RRM B;  4I2W A;  3E32 A;  2UY1 A;  4O60 A;  1S0P A;  2PM7 A;  3DRA A;  4DI4 A;  1KPS B;  4LNU D;  3FUK A;  1HU3 A;  4K5C A;  1OWL A;  4TXP A;  1H6K A;  5CEA A;  3UX4 A;  3B7U X;  3MZL B;  3TG4 A;  3AS5 A;  4PS7 A;  3BQO A;  5KJL A;  3AAA C;  2BKG A;  4CGV A;  3UM0 A;  3ZYL A;  2XEE A;  4FAD A;  1HZ4 A;  2IJG X;  2FBN A;  5ANL A;  3SBT B;  4JZY A;  4DX6 D;  3C3R A;  4HB5 A;  3LY7 A;  3PNT B;  3PE3 A;  3KD7 A;  4LCT A;  4GZ5 A;  1TJC A;  5FZQ A;  3U3W A;  3ZYQ A;  5BV1 A;  3L16 A;  3DSV A;  3FTS A;  3AG3 E;  1SA5 A;  3OXL A;  1DCQ A;  3ZXS A;  3W9G A;  2MOW A;  3QWW A;  4ILH B;  2JEK A;  2H6F A;  4FJY A;  5CRU A;  2VSO E;  2AWI A;  2EIJ E;  4RVB A;  1MX6 A;  2XRY A;  1OY3 D;  3PZD A;  3SQV A;  4N2Q A;  2YHE A;  3EU9 A;  5G05 C;  1HG2 A;  1OCC E;  2IOS A;  1WG0 A;  3HXF A;  3IV0 A;  4KZC A;  4YVO A;  2WMN A;  4O6F A;  3PNL B;  1OT8 A;  2ETB A;  2ZGG A;  2KXP C;  3EHQ A;  4U7E B;  4F53 A;  4JC8 A;  4TXR A;  3FUE A;  2C0M A;  4XX5 A;  1FT2 A;  1P5Q A;  4HOR A;  2P2C P;  2KCV A;  2NSZ A;  5JHA A;  3QC1 A;  2L6J A;  3NAW A;  3PZ3 A;  1Z3X A;  1N52 A;  4HOQ A;  4I9E A;  3T8M A;  4L23 A;  3V2O A;  3ZUV B;  2VYI A;  3I4R B;  5CMY A;  2FO1 E;  1KT0 A;  3FY4 A;  1U3C A;  2UY1 B;  2WXH A;  3LS8 A;  4HVB A;  2R02 A;  3CK9 A;  3CHR A;  3GYZ A;  3QB2 A;  3D9L A;  3MYV A;  4HLE A;  1TJF A;  4DX5 D;  3TWR A;  3PDN A;  3PUJ A;  2OEW A;  5A7D B;  1QYM A;  1IHB A;  2VSN A;  2LSV A;  5LX8 A;  3NBN B;  2H6H A;  3HG0 D;  5IY5 E;  2CG3 A;  3RO2 A;  3UI2 A;  2L0T B;  3RO3 A;  3FTY A;  2C2L A;  4UWL A;  1MJ0 A;  2KCL A;  2XS1 A;  1EPU A;  1N95 A;  3CEQ A;  2M63 A;  4K0R A;  3VLF A;  2LO6 A;  3PE4 A;  4ACL A;  1PC2 A;  3L6A A;  1O1R A;  3VTY A;  2JLB A;  4U04 A;  5AAO A;  2P9N G;  4GML A;  3U64 A;  5FQ7 A;  1WAO 1;  3LY8 A;  5AIJ A;  3QNK A;  1DNP A;  5BUZ A;  1RW2 A;  3DSS A;  2Y3A A;  4RQI A;  5BXO A;  2P9I G;  3L54 A;  1K1A A;  1AP7 A;  1UN9 A;  3FDH A;  1JPL A;  1HS6 A;  3D9M A;  2V5Q C;  1Z3Y A;  3PH0 C;  5M72 A;  4ATZ D;  4I2Z A;  3ASG A;  2VQ2 A;  4I6E A;  5T3R A;  4AOF A;  2YHC A;  4GA2 A;  3L08 A;  3QJZ A;  3DXK G;  2LXL A;  3L13 A;  1NP7 A;  2LUH A;  3IXE A;  3WXX A;  3LJN A;  1LD8 A;  4U95 D;  2J8S D;  3PEV B;  4HBD A;  1VDY A;  4AY5 A;  2JAB A;  2XHE A;  3B7B A;  4WWP A;  4EBA A;  2GRR B;  2IFU A;  1QQE A;  4C0E A;  1N94 A;  2GRP B;  1FVH A;  2B6C A;  4ATG A;  5KJM A;  4FUL A;  3FHE A;  4BSZ B;  4W9R A;  3IBE A;  3ZEF A;  2HYZ A;  5D66 A;  2H6I A;  3ZPJ A;  3B7T A;  5CCM A;  4UWK A;  2C0L A;  3DPY A;  3Q73 A;  4UQZ A;  1TN7 A;  3Q9U C;  1NZN A;  3PVL A;  3SFZ A;  4OVV A;  4GTP A;  2YQ8 A;  4FP7 A;  3C3Q A;  3Q47 B;  2X6H A;  3NF1 A;  3ZU7 B;  4R7L A;  4FU3 A;  1U2V G;  3ZXP A;  4J7W A;  3DST A;  5KBA A;  3CR3 A;  3NOC D;  2KAT A;  1N54 A;  3ULQ A;  4BY6 A;  3TAX A;  3CHM A;  5ARF A;  4XE0 A;  5ENS D;  5JJ7 A;  2AXV A;  3FP3 A;  1V55 E;  4ME2 A;  3JQ1 A;  2E0I A;  2WQH A;  4HS2 A;  3S7B A;  2CFU A;  5KNG A;  2F0Y A;  2F8Y A;  3KSL A;  5CBN A;  3OAW A;  3CVP A;  4FLB A;  3KEA A;  4GB9 A;  2L9B A;  2Q7F A;  5FQ8 A;  2OCC E;  3ASD A;  2AXZ A;  2MYO A;  3LVR E;  3E34 A;  5JJ6 A;  1HE8 A;  2H6G A;  4AIF A;  3ISM C;  4FC8 A;  2OOE A;  4EZK A;  2GRM A;  3CIA A;  3EIQ C;  2ZU6 B;  5LP0 A;  3P2B A;  2QY7 A;  2VGX A;  4GTQ A;  1XNF A;  4TUM A;  3FU6 A;  3KAE A;  5JMN D;  1H2U A;  2IO2 C;  5ENO D;  1HF8 A;  4UI9 K;  4V3I A;  2Y69 E;  3LPZ A;  3GW4 A;  3ULY A;  5JJT A;  3D9P A;  3AS8 A;  1D8E A;  3RAU A;  1MX2 A;  1ELR A;  4O1O A;  5KJN A;  4KT6 B;  1DVP A;  1N4R A;  1DC2 A;  3G2T A;  4ILG A;  4PH4 B;  3HVE A;  4HQD A;  4Y6C A;  1RZ4 A;  4G23 A;  1BPO A;  1HH8 A;  2P9S G;  3D9J A;  3FTX A;  2J08 A;  5JHB A;  3B7S A;  3CHQ A;  2OEV A;  3DEP A;  1TNB A;  4AVX A;  1QBQ A;  2P9K G;  3FEY A;  5J08 A;  1GW6 A;  3EU5 A;  5A6C A;  3FEX A;  3MA5 A;  2B0O E;  2X6J A;  4G2V A;  3MGB A;  4AXH A;  2WM9 A;  2X3M A;  4X8Q A;  4BTA A;  3LDZ A;  1BU9 A;  5CRV A;  2FUL A;  5EX0 A;  3VLE A;  4MRU A;  5B1B E;  4ILI A;  3OTN A;  2IQC A;  4F1S A;  3UM1 A;  4MKT A;  3UIO C;  4CRW A;  2J07 A;  1SA4 A;  3GZ1 A;  3FUL A;  2NYJ A;  3JUE A;  3CV0 A;  3Q75 A;  1E7V A;  3DPD A;  4G8K A;  1X81 A;  3AJI A;  2I1K A;  4Z68 A;  1N11 A;  3HDX A;  2WQ6 A;  4ACK A;  1PAQ A;  2DIW A;  3MKQ A;  3D9H A;  2RD0 A;  4LNB A;  3FU5 A;  3UT8 A;  4I1A A;  1W3B A;  2VGX B;  4UI9 J;  3S7F A;  2BTD A;  4HXI A;  4DPR A;  1IKN D;  1E8X A;  1YYH A;  3ZHE A;  1HG5 A;  3RU0 A;  3X2Q E;  5BV0 A;  4M7C A;  5AQA A;  2MRI A;  4GYW A;  2X38 A;  3QAQ A;  1PY1 A;  3PRZ A;  2RFM A;  4GPK A;  3E37 A;  3DXM G;  4XI9 A;  3KEZ A;  3HXB A;  1V54 E;  1JCQ A;  1U3D A;  2KM4 A;  3K9I A;  2YNQ A;  1EF1 C;  4AEZ C;  1D8D A;  3HVE B;  2I6H A;  4I43 A;  3URZ A;  2XGO A;  4DX1 A;  2KBX A;  1KZO A;  4YND A;  2ZIS A;  4OYS A;  1TNO A;  4FHJ A;  5B1A E;  5EDS A;  3O48 A;  4BEP A;  3CVU A;  3CVV A;  5D0Q D;  3QAR A;  1HXI A;  1TNY A;  3JQ0 A;  3P1U A;  4F7A A;  2WMO A;  3G2W A;  2EQX A;  3MKR A;  4GTS A;  2A5U A;  1ELW A;  3W9F A;  3TWX A;  2HE0 A;  1OWO A;  4G24 A;  4M3O A;  4XEI G;  2EIM E;  3G2S A;  4HRM B;  3ZW3 A;  1LF8 A;  5BPP A;  1UN8 A;  4H7Y A;  5T8I A;  1A17 A;  4FHK A;  4MLP A;  2IY0 C;  4F3V A;  3FU3 A;  2NXP A;  4L2Y A;  1UG3 A;  2GRQ B;  2P9P G;  2XEH A;  3ASH A;  1KZP A;  3SZ7 A;  3SI5 A;  1MZC A;  5G04 J;  3DWL G;  2QC9 A;  1S63 A;  3V31 A;  2FI7 A;  4ZHB A;  5HKP A;  5AQB A;  4TXQ A;  3LYA A;  5T4Y A;  2AXU A;  4D10 C;  3Q4A B;  4PS8 A;  4YDE A;  2VGE A;  3B13 A;  4GTV A;  2A4Z A;  3VTX A;  1JWF A;  1YCS B;  4IN3 B;  4B0Z A;  4GZC A;  3CVW A;  5E75 A;  2LAH A;  2QZA A;  1B89 A;  3R7Q A;  4BX8 A;  3OXF A;  2A5E A;  4UI9 C;  2L6B A;  5CED B;  3PEU B;  3MKQ B;  4DLQ A;  3MJW A;  4F1P A;  3AU4 A;  1L5J A;  5ENR D;  5EIB E;  3ZHE B;  2J9Q A;  4DRX E;  4PDX A;  3S7D A;  3ZIM A;  2DYS E;  3SY2 A;  2WXI A;  1TYQ G;  2OVB A;  3FUF A;  4JHK A;  5DIZ A;  4BT8 A;  3U4T A;  3FU0 A;  4GU5 A;  4DX2 A;  3APC A;  2OVF A;  3GZ2 A;  1UJK A;  4OVU A;  5FQ4 A;  4TUU A;  3CSF A;  3FWV A;  3C98 A;  3ABK E;  1Q2Z A;  1IXV A;  4OAU C;  1FPP A;  4MS6 A;  3ASF A;  4B8C B;  3CHS A;  4WNG A;  3TGO A;  3MV3 B;  4KZ0 A;  3SD5 A;  1H6P A;  4U8V D;  3UXG A;  2ILR A;  1QNF A;  3BG0 B;  1N4Q A;  4CT4 A;  2XS8 A;  1BI8 B;  4Q96 A;  2XGM A;  3SF4 A;  3CVL A;  4UWG A;  2WXK A;  5G2N A;  3TJP A;  3DSW A;  1MX4 A;  4LG6 A;  2R17 C;  3V30 A;  3ESL A;  4JA7 A;  2CHZ A;  4TV3 A;  3MV2 B;  5KWD A;  4H7X A;  4CDM A;  3ULE G;  3L82 A;  4N3A A;  4BER A;  3ZYK A;  5AEN A;  3Q9N C;  4JA9 A;  3FTZ A;  2X6I A;  4U0Z A;  5G55 A;  4EBA G;  4U63 A;  1ZB1 A;  3PZ4 A;  4KVO A;  3NQP A;  4GZ3 A;  3MX3 A;  5LFA A;  4ZFH A;  1OUV A;  4CYM D;  2MHK A;  1K1B A;  2HO1 A;  4MBG A;  4BWR A;  2I2O A;  2Y4T A;  4HRL A;  5J90 A;  2UWJ G;  1E96 B;  3D9O A;  4YVQ C;  5EIL A;  3BU8 A;  3TWS A;  3Q7A A;  5FIO A;  2AJA A;  3UM2 A;  4GZ6 A;  1BLX B;  3FUM A;  1OCR E;  1E7U A;  1HO8 A;  4AJW A;  4XI0 A;  4QQI A;  3LJ3 A;  1O5M A;  4URK A;  4G26 A;  4WUY A;  3RKV A;  4WNE A;  4HI9 A;  3C72 A;  4J8S A;  4HNA D;  2QYU A;  4TRQ A;  3S2A A;  3ML9 A;  1LD7 A;  4GA0 A;  1MYO A;  3CHP A;  3RIB A;  3T5X A;  4UQX A;  3O4Z A;  5FQ6 A;  3RJV A;  3N71 A;  2ETA A;  3AS4 A;  2P9U G;  3Q78 A;  2J09 A;  2XPI A;  3AG4 E;  1E90 A;  4RSY A;  4AM9 A;  3CVX A;  4GMR A;  3RRU A;  3RSE G;  2BKK B;  2VTB A;  3PZ1 A;  4WWO A;  2XQ0 A;  3HXE A;  5EX3 A;  4UWH A;  4YDY A;  3SGH A;  2J4D A;  1ZU2 A;  3CK8 A;  4GMJ A;  3D9N A;  4J8Y A;  3ZGQ A;  1OWM A;  2NC9 A;  1OXJ A;  2XZT G;  1OWN A;  3LKU A;  3ENE A;  4J8D A;  2AW6 A;  1TNU A;  3GZS A;  4LSZ E;  4JW1 A;  3L22 A;  3LVQ E;  4L7T A;  4EEC A;  5CMW A;  1JWG A;  3PZ2 A;  2BF0 X;  3ESK A;  4CCA A;  2XCB A;  4KXK B;  4J6I A;  4ANV A;  4U8H A;  4WAF A;  2WXL A;  1YA0 A;  1QZ2 A;  4CEM A;  2V5F A;  1TNZ A;  4HLL A;  2L0I A;  2WXQ A;  1KT1 A;  2VSX E;  5ITZ F;  1UW4 B;  5AJD A;  2RFA A;  2CHW A;  3HIZ A;  3FH8 A;  4I6G A;  4C48 B;  2DWZ A;  3JYS A;  4ANX A;  4IRU A;  3APF A;  4HFG A;  4AP2 A;  4PS3 A;  4APF A;  2Y0B G;  4A1S A;  4APO A;  4ANW A;  3ONK A;  1K8K G;  4HRN A;  3ONL A;  4EZJ A;  2XZD G;  2FO7 A;  3L17 A;  2PQN A;  2WXN A;  1HX8 A;  2RKK A;  4RLY A;  4N3C A;  2J49 A;  1IQR A;  2R2L A;  4DUI A;  4DI3 A;  3KSQ A;  2IEJ A;  1WDY A;  4AV7 A;  2XEN A;  3UT4 A;  1HFA A;  3BG1 B;  4E85 A;  4GAA A;  1Z6T A;  4N3B A;  1N4S A;  5FWQ A;  3SHF A;  2WXF A;  3V79 K;  5AAR A;  3QK0 A;  3Q15 A;  3B7R L;  2OV8 A;  2EIK E;  3FTV A;  1Y8M A;  1NL4 A;  3R9A B;  3TWW A;  3ASO E;  1G3N B;  3UMV A;  4B93 B;  3ABM E;  2WXG A;  5CCL A;  3S7J A;  1H19 A;  2WXP A;  5FT9 A;  1LTX A;  4B94 A;  2VTB B;  4L9P A;  4BT9 A;  2I9C A;  5KCM A;  3EIJ A;  3MEK A;  1K3Z D;  1SVX A;  4DJA A;  2PNN A;  4A1G A;  2GRN B;  1D9S A;  2GRO B;  2R59 A;  2OND A;  5D2M C;  3ZVV A;  3EHR A;  1AWC B;  4JEH A;  2ZIR A;  4J8E A;  4GTT A;  4GPM A;  3DEO A;  4I6J A;  1ZBP A;  1KLX A;  5BNW A;  4HOU A;  1SZ9 A;  2IF4 A;  4HOT A;  3ASN E;  3CQG B;  5LOZ A;  3CLJ A;  4BFR A;  2WQ7 A;  3CVN A;  4N2S A;  4L2L A;  5A23 A;  4WNF A;  1FVF A;  4LUN U;  5DBK A;  2ION A;  3LCA A;  1NFI E;  2RG8 A;  3CVY A;  3QOU A;  2FEZ A;  5CEC B;  4U07 A;  4KMO A;  1SQM A;  5EN5 D;  4LRZ A;  2DBA A;  3CST A;  1A5E A;  1EDU A;  3FH5 A;  3HXD A;  4U96 D;  2WXR A;  2V4H C;  1MHQ A;  2F37 A;  3Q5M A;  4G1T A;  4K03 A;  5H7P A;  1N0Q A;  2CFZ A;  3Q49 B;  4GCO A;  1E8Y A;  5FJY A;  2PQR A;  2V4L A;  1TEZ A;  2Y1L E;  3EUV A;  5AQ7 A;  3SO8 A;  1WM5 A;  3D3M A;  2PM6 A;  3JXJ A;  3IHY A;  2KZT A;  5CBO A;  1XGW A;  4EQF A;  3AU5 A;  5EID A;  1X5B A;  2IU1 A;  3AG2 E;  4GTO A;  1TN8 A;  3UKR G;  5KNH D;  4DLO A;  5ENT D;  4N39 A;  3TXN A;  4I9C A;  4KVM A;  4EZL A;  4UUC A;  2DZN A;  1FCH A;  3FH7 A;  4RG6 A;  2WXM A;  3U66 A;  2WXJ A;  1TN6 A;  3QWV A;  4IYP A;  1H2T C;  2XRZ A;  1NA0 A;  3J5Q B;  2DVW A;  2DYR E;  3E30 A;  4LEU A;  4WND A;  3E4B A;  1TR4 A;  1OWP A;  3FUH A;  5C1D A;  5KJK A;  2X6F A;  4C0M A;  1N9A A;  2X6K A;  1UJJ A;  4GTM A;  4GA1 A;  1IQU A;  4Y6W A;  2IOL A;  1O1T A;  4NRH B;  3HRA A;  3G2V A;  4LNG A;  3F6Q A;  4LER A;  4RG9 A;  3UUX A;  3PUK A;  4BET A;  2LAI A;  3ZFW A;  4GYY A;  3DBS A;  4CDN A;  3I5P A;  4OAV B;  4CGW A;  4A3V A;  3T8K A;  4K5B A;  3TWT A;  5C2Y A;  3SNX A;  2GRL A;  3UM3 A;  2VGY A;  1H2V C;  1Z5S C;  2CHX A;  4YDO A;  3EJN A;  3UPV A;  3UQ3 A;  4O1P A;  5ENN A;  5AN8 A;  1WY6 A;  3D9K A;  3LY9 A;  5ANR A;  3VLD A;  4CZ2 D;  3SFY A;  1UOH A;  3SBS A;  4FJZ A;  3CVQ A;  4A63 B;  3TWU A;  1OCZ E;  5CHE E;  4K5A B;  3C5R A;  3V2X A;  3FFL A;  4Q69 A;  4GYO A;  4KYO B;  3UIP C;  3FTU A;  3LXU X;  4EPZ A;  1E8Z A;  2V0P A;  4QFV A;  5EKQ D;  4N5Q A;  4EHM A;  2KZT B;  3UIN C;  4G8L A;  1SZA A;  4KBQ A;  5D0O D;  3IEG A;  2ZXW E;  3CK7 A;  1SW6 A;  2FF4 A;  2YIN A;  3OXG A;  5HRY A;  4J0U A;  5G04 C;  3DSU A;  1NA3 A;  4Q94 A;  3R9M A;  4NQ0 A;  1EYH A;  2XEV A;  3BEE A;  5EYL A;  4L1B A;  2HR2 A;  3RK6 A;  4N5C A;  4BES A;  4FA6 A;  3NZS A;  3PS6 A;  5HI7 A;  3TG5 A;  5B3S E;  2BUG A;  3U9W A;  5LCW J;  4GTR A;  3SFX A;  3FUI A;  3IKO B;  3B95 A;  1INZ A;  2F8X K;  3I4G A;  4HI8 A;  4BX9 A;  2R03 A;  3JUI A;  2GGF A;  2VSY A;  3EHN A;  5EYP F;  3JCK C;  3FTW A;  3JXI A;  2XCC A;  4B8A A;  2WPV A;  4I1M A;  4XIF A;  5BW8 C;  1Y6I A;  4I1O B;  3UTM A;  5FTP A;  4JD2 G;  4CDR A;  2KCK A;  4I17 A;  2DZO A;  3KS2 A;  3CKC A;  3QWP A;  3FUN A;  1E8W A;  3D9I A;  4JHR A;  2CG2 A;  2LSU A;  5ENP D;  5BXU A;  2WXO A;  3CGH A;  4G11 A;  4NUR A;  5HS0 A;  1O1S A;  4U0S A;  3TWQ A;  2E2E A;  3EDT B;  5JA4 D;  1JUQ A;  3ZNG A;  5FIN A;  3C3O A;  2WVI A;  3T5V A;  1BD8 A;  4DX7 D;  1JCR A;  3AG1 E;  3J5P A;  4U8Y D;  2XPZ A;  4HOS A; 
#chains in the Genus database with same CATH homology
 5FWQ A;  1UN9 A;  3FDH A;  2WXF A;  3SHF A;  1OWO A;  4A3T A;  4G24 A;  5AJL A;  1JPL A;  1HS6 A;  3D9M A;  1Z3Y A;  3MCX A;  5FZS A;  3PH0 C;  3QK0 A;  4M3O A;  5M72 A;  3Q15 A;  3G2S A;  3B7R L;  4XZ4 A;  2OV8 A;  4I2Z A;  3ZW3 A;  2WB2 A;  3FTV A;  1LF8 A;  3ASG A;  5BPP A;  2QFC A;  5AYW D;  1UN8 A;  1Y8M A;  4H7Y A;  5HQ8 A;  2LNI A;  5T8I A;  3R9A B;  2VQ2 A;  1A17 A;  4FHK A;  3UMV A;  4MLP A;  4GZD A;  4I6E A;  5T3R A;  4F3V A;  2WXG A;  5CCL A;  3FU3 A;  3S7J A;  1H19 A;  4AOF A;  2NXP A;  2I1J A;  2WXP A;  5FT9 A;  4L2Y A;  2YHC A;  1UG3 A;  4B94 A;  4GA2 A;  2VTB B;  4JEU A;  3L08 A;  3QJZ A;  3TL5 A;  3L13 A;  3ASH A;  3QDN A;  4BT9 A;  1NP7 A;  4JL0 A;  2I9C A;  5KCM A;  1MQS A;  3ML8 A;  3SZ7 A;  3EIJ A;  3SI5 A;  4B89 A;  3MEK A;  3WXX A;  5G04 J;  3APD A;  4PUC A;  4U0U A;  4DJA A;  3PEV B;  2FI7 A;  4A1G A;  3IHV A;  2PZI A;  1VDY A;  2XPY A;  4AY5 A;  1H0A A;  2R59 A;  3LYA A;  2XHE A;  5T4Y A;  4BTB A;  2OND A;  4WWP A;  4EBA A;  2AXU A;  4D10 C;  4WWN A;  3ZVV A;  3Q4A B;  5FZR A;  4PS8 A;  2IFU A;  1IYG A;  3B13 A;  3VTX A;  2A4Z A;  1JWF A;  3CKB A;  1QQE A;  4JEH A;  4JXT A;  4C0E A;  4J8E A;  1IHG A;  4IN3 B;  4B0Z A;  1FVH A;  4GZC A;  4I6J A;  3CVW A;  5E75 A;  1ZBP A;  1KLX A;  4ATG A;  4CT0 A;  5BNW A;  2LAH A;  4HOU A;  5KJM A;  4FUL A;  3CHO A;  3FHE A;  1SZ9 A;  5LCW C;  2IF4 A;  4HOT A;  3CQG B;  4W9R A;  1B89 A;  3IBE A;  3R7Q A;  4BX8 A;  4A55 A;  5LOZ A;  3CLJ A;  3ZEF A;  2P58 C;  3OXF A;  2HYZ A;  4BFR A;  2WQ7 A;  3CVN A;  4ABN A;  4UI9 C;  3I3N A;  3ZPJ A;  4N2S A;  3B7T A;  4L2L A;  3PEU B;  5CCM A;  4UWK A;  5A23 A;  2PL2 A;  3MKQ B;  4WNF A;  2C0L A;  1FVF A;  3PRE A;  4DLQ A;  4LUN U;  4P29 A;  3TXM A;  5DBK A;  5E76 A;  2ION A;  3LCA A;  3MJW A;  4UQZ A;  1NZN A;  2R5S A;  3PVL A;  4FLH A;  4XKB A;  3SFZ A;  2RG8 A;  3AU4 A;  1L5J A;  4OVV A;  3CVY A;  3QOU A;  2YQ8 A;  4FP7 A;  3ZHE B;  2J9Q A;  2FEZ A;  4PDX A;  3S7D A;  3ZIM A;  3Q47 B;  2VJ8 A;  3ZN3 A;  2X6H A;  3ZYM A;  2WXI A;  2KC7 A;  3NF1 A;  4U07 A;  3CQC B;  4KMO A;  1SQM A;  3QKY A;  2OVB A;  3FUF A;  4R7L A;  3G2U A;  4JHK A;  4FU3 A;  5DIZ A;  4LRZ A;  4JVS A;  2DBA A;  3U4T A;  4BT8 A;  4G25 A;  3CST A;  3FU0 A;  1EDU A;  4GU5 A;  3APC A;  2OVF A;  3GZ2 A;  3R7R A;  4C9B B;  3FH5 A;  4IUL A;  2WXR A;  1UJK A;  4OVU A;  5FQ4 A;  1MHQ A;  4GCN A;  3NZU A;  3CR3 A;  3HYM B;  4TUU A;  1ELK A;  3CSF A;  2Y4U A;  3Q5M A;  3FWV A;  2XGS A;  4G1T A;  2KAT A;  3C98 A;  4K03 A;  2CFZ A;  1N54 A;  3ULQ A;  3Q49 B;  4BY6 A;  4GCO A;  1E8Y A;  3FUJ A;  5FJY A;  3TAX A;  2PQR A;  2V4L A;  4JHJ A;  3RRN B;  1TEZ A;  5G05 J;  3CHM A;  5ARF A;  2J4B A;  4MS6 A;  1WM5 A;  3ASF A;  2GW1 A;  2HM8 A;  2V8S E;  4JPS A;  5ARG A;  4B8C B;  4XE0 A;  3D3M A;  2PM6 A;  5JJ7 A;  3FUD A;  3CHS A;  3IHY A;  2KZT A;  4WNG A;  3TGO A;  2AXV A;  3FP3 A;  3MV3 B;  4KZ0 A;  4ME2 A;  1XGW A;  3JQ1 A;  2E0I A;  3SD5 A;  3AU5 A;  4EQF A;  2WQH A;  4HS2 A;  3S7B A;  2CFU A;  2ILR A;  1X5B A;  4BSX A;  2IU1 A;  1QNF A;  3OAW A;  3CVP A;  3BG0 B;  4FLB A;  4CT4 A;  3LEW A;  5BT1 A;  4HOS A;  3ZRH A;  3HHM A;  4GB9 A;  4Q96 A;  4DLO A;  2XGM A;  2L9B A;  2Q7F A;  4N39 A;  3SF4 A;  5FQ8 A;  3CVL A;  4UWG A;  2WXK A;  4NAC A;  3TXN A;  3ASD A;  2AXZ A;  5G2N A;  4XKC A;  3LVR E;  4I9C A;  3TJP A;  4KVM A;  4EZL A;  5JJ6 A;  2DCP A;  1HE8 A;  3EHM A;  1FCH A;  2R17 C;  4J8F A;  3FH7 A;  4AIF A;  3ESL A;  4JA7 A;  2CHZ A;  4UQY A;  4FC8 A;  4RG6 A;  2OOE A;  2WXM A;  4TV3 A;  3MV2 B;  4DK5 A;  3U66 A;  4AY6 A;  2WXJ A;  3UT7 A;  4UWF A;  3QWV A;  4H7X A;  4CDM A;  4EZK A;  2AVP A;  4IYP A;  1H2T C;  4N3A A;  4E6H A;  2GRM A;  4ANU A;  3RRM B;  3CIA A;  3ZYK A;  3EIQ C;  5AEN A;  4I2W A;  2XRZ A;  2UY1 A;  2ZU6 B;  4JA9 A;  5LP0 A;  3FTZ A;  1NA0 A;  2X6I A;  4U0Z A;  5G55 A;  3P2B A;  1S0P A;  2PM7 A;  2QY7 A;  4EBA G;  4LEU A;  4DI4 A;  2VGX A;  4U63 A;  1XNF A;  3FUK A;  4WND A;  4KVO A;  1HU3 A;  3NQP A;  1OWL A;  3FU6 A;  4GZ3 A;  1H6K A;  3E4B A;  1OWP A;  3FUH A;  5C1D A;  3KAE A;  3MX3 A;  5LFA A;  3UX4 A;  1H2U A;  3B7U X;  1OUV A;  5KJK A;  2X6F A;  3MZL B;  3TG4 A;  3AS5 A;  4PS7 A;  2X6K A;  2MHK A;  2HO1 A;  1HF8 A;  4C0M A;  4BWR A;  2I2O A;  2Y4T A;  4UI9 K;  5KJL A;  1UJJ A;  4V3I A;  4CGV A;  4GA1 A;  5J90 A;  2UWJ G;  1IQU A;  3ZYL A;  4FAD A;  3LPZ A;  1HZ4 A;  4Y6W A;  2IOL A;  3GW4 A;  5JJT A;  2IJG X;  3D9P A;  3AS8 A;  2FBN A;  1ELR A;  5ANL A;  4NRH B;  4KT6 B;  1E96 B;  1DVP A;  3D9O A;  5KJN A;  4YVQ C;  3SBT B;  4JZY A;  3G2T A;  4ILG A;  3G2V A;  4PH4 B;  4LER A;  3HVE A;  4RG9 A;  3LY7 A;  3PNT B;  3PE3 A;  3KD7 A;  4LCT A;  3UUX A;  4Y6C A;  3PUK A;  4GZ5 A;  2LAI A;  1TJC A;  4GZ6 A;  5FZQ A;  4G23 A;  3FUM A;  1BPO A;  3ZFW A;  4GYY A;  1E7U A;  1HO8 A;  1HH8 A;  4AJW A;  3U3W A;  3DBS A;  4CDN A;  4XI0 A;  3ZYQ A;  3I5P A;  5BV1 A;  3LJ3 A;  4CGW A;  4A3V A;  3L16 A;  4URK A;  3FTS A;  4G26 A;  4WUY A;  3D9J A;  5C2Y A;  3RKV A;  4WNE A;  3FTX A;  4J8S A;  3SNX A;  2GRL A;  3OXL A;  2VGY A;  1H2V C;  2J08 A;  4TRQ A;  5JHB A;  3B7S A;  2CHX A;  3CHQ A;  3S2A A;  3ML9 A;  3ZXS A;  4AVX A;  4GA0 A;  3EJN A;  3CHP A;  3UPV A;  2MOW A;  3RIB A;  3T5X A;  3UQ3 A;  3QWW A;  4ILH B;  3FEY A;  4UQX A;  3O4Z A;  5ENN A;  5FQ6 A;  3RJV A;  2JEK A;  1WY6 A;  5J08 A;  1GW6 A;  3D9K A;  3LY9 A;  4FJY A;  5ANR A;  3VLD A;  3N71 A;  5A6C A;  3FEX A;  3MA5 A;  2VSO E;  3AS4 A;  2AWI A;  4RVB A;  2J09 A;  2X6J A;  2XRY A;  3SBS A;  2XPI A;  4FJZ A;  3CVQ A;  3PZD A;  4G2V A;  3MGB A;  5CHE E;  4N2Q A;  2YHE A;  1E90 A;  3FFL A;  5G05 C;  4AXH A;  2WM9 A;  2X3M A;  4RSY A;  4Q69 A;  1HG2 A;  4AM9 A;  4GYO A;  4KYO B;  2IOS A;  3CVX A;  3RRU A;  4BTA A;  3LDZ A;  3IV0 A;  4KZC A;  3FTU A;  3LXU X;  4YVO A;  2VTB A;  2FUL A;  4EPZ A;  1E8Z A;  2WMN A;  4O6F A;  3PNL B;  2V0P A;  4QFV A;  4WWO A;  2XQ0 A;  5EKQ D;  5EX0 A;  3VLE A;  5EX3 A;  2KZT B;  4UWH A;  3SGH A;  4MRU A;  2J4D A;  4ILI A;  3OTN A;  2IQC A;  4F53 A;  1ZU2 A;  4JC8 A;  3CK8 A;  4GMJ A;  4F1S A;  3D9N A;  1SZA A;  4KBQ A;  3FUE A;  2C0M A;  4MKT A;  4XX5 A;  5D0O D;  3IEG A;  4CRW A;  1P5Q A;  4HOR A;  2KCV A;  2J07 A;  2NSZ A;  3CK7 A;  5JHA A;  3QC1 A;  2L6J A;  2FF4 A;  2YIN A;  3ZGQ A;  1OWM A;  3OXG A;  4J0U A;  1Z3X A;  2NC9 A;  3GZ1 A;  3FUL A;  5G04 C;  1N52 A;  4HOQ A;  1OWN A;  3CV0 A;  4I9E A;  1NA3 A;  3LKU A;  3ENE A;  4Q94 A;  1E7V A;  3DPD A;  4J8D A;  2AW6 A;  3GZS A;  4L23 A;  3T8M A;  4NQ0 A;  1EYH A;  2XEV A;  3BEE A;  2I1K A;  4JW1 A;  4L1B A;  2HR2 A;  3L22 A;  2VYI A;  3HDX A;  3I4R B;  5CMY A;  2WQ6 A;  3RK6 A;  3LVQ E;  4L7T A;  4EEC A;  5CMW A;  1JWG A;  4N5C A;  2BF0 X;  4FA6 A;  3ESK A;  4CCA A;  3NZS A;  3PS6 A;  5HI7 A;  2XCB A;  4KXK B;  3TG5 A;  4ACK A;  4J6I A;  4ANV A;  2BUG A;  4U8H A;  1KT0 A;  3FY4 A;  3U9W A;  1U3C A;  1PAQ A;  2WXH A;  2UY1 B;  3LS8 A;  4HVB A;  4WAF A;  2DIW A;  5LCW J;  3CK9 A;  2WXL A;  1YA0 A;  1QZ2 A;  3CHR A;  3FUI A;  3MKQ A;  2RD0 A;  3GYZ A;  4CEM A;  2V5F A;  3IKO B;  3D9L A;  3QB2 A;  3FU5 A;  3UT8 A;  1INZ A;  3MYV A;  4I1A A;  2L0I A;  4HLE A;  1W3B A;  2VGX B;  2WXQ A;  3I4G A;  1KT1 A;  2VSX E;  1UW4 B;  1TJF A;  4UI9 J;  2BTD A;  4HXI A;  3S7F A;  5AJD A;  4BX9 A;  4DPR A;  3PDN A;  3HIZ A;  2CHW A;  1E8X A;  2GGF A;  3JUI A;  3ZHE A;  3FH8 A;  4I6G A;  2VSY A;  3PUJ A;  3EHN A;  1HG5 A;  3FTW A;  3JCK C;  3RU0 A;  5BV0 A;  2XCC A;  5A7D B;  3JYS A;  2VSN A;  4B8A A;  4ANX A;  2WPV A;  2MRI A;  4I1M A;  2LSV A;  4IRU A;  3APF A;  4HFG A;  5LX8 A;  4XIF A;  5BW8 C;  4GYW A;  4AP2 A;  4PS3 A;  2X38 A;  1Y6I A;  4I1O B;  2CG3 A;  3QAQ A;  4APF A;  1PY1 A;  3PRZ A;  4GPK A;  3RO2 A;  4A1S A;  4APO A;  4ANW A;  5FTP A;  3ONK A;  2L0T B;  3RO3 A;  3FTY A;  4CDR A;  4XI9 A;  2C2L A;  3KEZ A;  3ONL A;  4UWL A;  4EZJ A;  2KCK A;  2KCL A;  4I17 A;  1U3D A;  1EPU A;  2FO7 A;  2KM4 A;  3L17 A;  3K9I A;  3KS2 A;  2PQN A;  3CEQ A;  2YNQ A;  3CKC A;  2M63 A;  1EF1 C;  3QWP A;  4K0R A;  3VLF A;  2WXN A;  4AEZ C;  2LO6 A;  3HVE B;  3FUN A;  1E8W A;  1HX8 A;  2I6H A;  3PE4 A;  4I43 A;  4ACL A;  3D9I A;  2XGO A;  4JHR A;  3URZ A;  2CG2 A;  2LSU A;  4N3C A;  1PC2 A;  4OYS A;  3L6A A;  4YND A;  2WXO A;  3VTY A;  2JLB A;  4FHJ A;  4U04 A;  3CGH A;  5EDS A;  2J49 A;  4G11 A;  3O48 A;  4NUR A;  1IQR A;  3CVU A;  4GML A;  4U0S A;  3CVV A;  3U64 A;  5D0Q D;  5FQ7 A;  4DI3 A;  2E2E A;  3EDT B;  1HXI A;  3QAR A;  1JUQ A;  1WAO 1;  3JQ0 A;  3P1U A;  3LY8 A;  4AV7 A;  5AIJ A;  3QNK A;  1DNP A;  4F7A A;  2WVI A;  3UT4 A;  5BUZ A;  3T5V A;  2WMO A;  3G2W A;  2EQX A;  3MKR A;  1HFA A;  2A5U A;  3BG1 B;  4E85 A;  1ELW A;  2Y3A A;  4GAA A;  1Z6T A;  3L54 A;  2XPZ A;  4N3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...