3RK6A

Crystal structure of the middle domain of human paip1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
217
structure length
217
Chain Sequence
TLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLKLVELR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Translation regulator
molecule keywords Polyadenylate-binding protein-interacting protein 1
publication title Crystal structure of the middle domain of human poly(A)-binding protein-interacting protein 1.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rk6A00
4CT4A 3FEXA 2I2OA 3EIJA 1HU3A 4B8AA 2HM8A 3L6AA 4JHJA 2IOSA 2IOLA 1UG3A 4GMJA 4GMLA 4JHKA 2ZU6B 1H2VC 2KZTA 1H2TC 1H2UA 3EIQC 2RG8A 3FEYA 2FULA 4C9BB 3JUIA 1H6KA 3RK6A 2NSZA 1UW4B 1N52A 3D3MA 5ANRA 4CEMA 4B89A 4CRWA 2VSOE 2KZTB 1PAQA 2VSXE 2IU1A 2IONA 4B8CB 4IULA 4LUNU 2GGFA 1N54A
chains in the Genus database with same CATH superfamily
2AJAA 2P9LG 2JEKA 2CG2A 4EZKA 3MKRA 3Q15A 5HI7A 5HKPA 5BT1A 5KCMA 5BV1A 2AVPA 4BETA 3QWWA 3UINC 1IYGA 1S0PA 5G04J 2QY7A 1N4RA 4N5CA 3SGHA 1NP7A 1N0RA 2V4HC 2VGXA 5FQ8A 3UXGA 3TWUA 1E90A 4QFVA 1MZCA 3CHPA 1SA4A 4GYWA 3ZRHA 3ASDA 4ACLA 1BI8B 3AG3E 5KBAA 3SF4A 1BU9A 1KZPA 2ZXWE 3SBTB 4XIFA 1TJCA 2J49A 1D9SA 2WXNA 3FHEA 4M3OA 1AWCB 2Y1LE 4URKA 2IQCA 3MCXA 2XRZA 3CK8A 2XCCA 2I2OA 3KEAA 5AENA 3ABKE 1G3NB 4OYSA 3UIPC 2XCBA 3Q9NC 3CVYA 2KCLA 4H7YA 2BKGA 5HS0A 2VSOE 4L2LA 5IY5E 2M63A 2PL2A 1KZOA 4O6FA 3URZA 5FT9A 2GRNB 3CHMA 3L17A 2GGFA 4HRNA 5AARA 1OY3D 4W9RA 4N3CA 5FJYA 4J8SA 5EILA 3PH0C 3U66A 3ZVVA 3GZ2A 4A3TA 2DBAA 3CVNA 5FZSA 4J7WA 3L22A 3IHVA 5KJLA 2B0OE 2VQ2A 2RFAA 3DRAA 2RFMA 1O1RA 4AY6A 1QQEA 4ATGA 5FQ6A 2X6HA 3UM2A 2WXMA 1HF8A 4L7TA 3P2BA 3B7RL 1KLXA 3R7QA 3AG2E 5FWQA 2MOWA 2QYJA 4I1AA 2C2LA 4NACA 4ZHBA 3DSTA 4F1PA 2Y4TA 5FINA 2IOSA 2R17C 1RW2A 1KT0A 3FEYA 3CKCA 2E0IA 4HQDA 5AQ7A 4C0MA 3FUDA 4ILIA 3ZEFA 2BEDA 4EBAG 4DPRA 3AG1E 2MYOA 2X6JA 4F7AA 2FO7A 1OWOA 2EIME 5B3SE 5ENSD 5ENOD 3FY4A 4XI0A 4I6EA 2J09A 1XGWA 3KSLA 2UY1B 2H6IA 3W9GA 4O60A 4ABNA 1E7UA 3B95A 5FIOA 4K5AB 3JXIA 1SW6A 1Z3XA 2IONA 4HVBA 2A4ZA 5LX8A 4BESA 2XZDG 4X8QA 2JABA 3RSEG 3ZNGA 3IV0A 4XI9A 4AM9A 1QZ2A 3BG1B 5AN8A 1B89A 1YYHA 1MX4A 4UWFA 3SFXA 3GZ1A 2AXZA 4ANUA 1N9AA 4N3AA 4BY6A 4EZJA 1DVPA 3RU0A 4GPMA 1GW6A 3Q47B 3SQVA 3DBSA 1L5JA 3UUXA 4JXTA 3AG4E 1H19A 3U64A 4F53A 2J4DA 3TWQA 2DYSE 3TG5A 3PRZA 4G23A 3IKOB 2ZISA 4M7CA 4MBGA 5LOZA 1W3BA 3E32A 4FHKA 4UQZA 4LERA 5EX0A 1FVHA 4I9EA 2GRQB 3PE4A 4XEIG 3ZUVB 3Q7AA 5KJKA 5G2NA 1A17A 1A5EA 3QDNA 2WXQA 3D9MA 4YVQC 2YQ8A 3DEOA 1K3ZD 2AXVA 4IN3B 4Q94A 4Q69A 4RSYA 2J4BA 3APCA 2WB2A 3QWPA 2IEJA 3D9JA 1E8YA 4YDWA 4FP7A 1NL4A 1Y6IA 2XHEA 1JCRA 3VTYA 4AEZC 4YNDA 1UJKA 4F1SA 4BX9A 3LYAA 5G04C 3UPVA 1EF1C 2DZNA 5AQBA 4DUIA 1H2TC 2LAHA 2NXPA 2F37A 5E76A 4EPZA 4ATZD 4OVVA 3HHMA 5BV0A 2ONDA 2PM6A 4EECA 4U0UA 1OXJA 4LCTA 3E34A 2HE0A 2LO6A 3J5QB 2NC9A 4HORA 3EU5A 3NOCD 5EN5D 5FZQA 4H7XA 3G2WA 4J8YA 3RO3A 4Y6CA 3IBEA 2ZU6B 3TG4A 3QWVA 3T5VA 3ABME 4AIFA 4TXQA 4GZ3A 3SD5A 4DI4A 3QC1A 3ULYA 3HXBA 1UN9A 4GU5A 1D8EA 2XGMA 3ONLA 4E85A 2IOLA 4L9PA 5EDSA 4EQFA 3FTWA 3Q73A 5JJ6A 2Y3AA 5A23A 3RK6A 1N52A 4U8YD 1HS6A 3ZHEA 4EBAA 4GA1A 3PNTB 2GW1A 1DNPA 4KMOA 3D9IA 3TWWA 3CVWA 1E8XA 3DPYA 3TWRA 3RIBA 2OV8A 3KEZA 2XGOA 4I2WA 2OCCE 3UIOC 3MZLB 3QARA 1ELRA 2IU1A 3CIAA 4GTSA 4FLBA 4DX5D 2XRYA 3C5RA 1HZ4A 3AU4A 4CZ2D 5CHEE 5ANLA 3SBSA 3KSQA 5JHBA 1DC2A 5D0QD 3ULQA 5ENQD 3ZYMA 3KS2A 4HOUA 2MRIA 4HI9A 4L23A 2X3MA 2KCVA 2V4LA 4CDRA 3ZPJA 4WNFA 2LAIA 1MQSA 1Z6TA 4MLPA 1EYHA 3OAWA 1EPUA 4AY5A 1HO8A 4GB9A 3TGOA 4FJZA 2UWJG 5BW8C 2GRRB 2X38A 3UT7A 4B93B 3ZIMA 3PEVB 3HG0D 2L6BA 4A3VA 1KT1A 1N4SA 3R7RA 1D8DA 3HXEA 4JZYA 2CHXA 3KAEA 4ZFHA 3FUIA 5LCWJ 3HVEB 4DK5A 3B7BA 3ESKA 2KZTB 3BQOA 3L16A 4HBDA 3MV3B 2H6GA 5JA4D 3APDA 4XZ4A 4NQ0A 1K1BA 2E2EA 4F3VA 3ONKA 3Q78A 4A1GA 3OXLA 3S7JA 4PUCA 4GZCA 4JW1A 3ASFA 5BUZA 2OOEA 1OT8A 1JPLA 5BXUA 1TN8A 3AS8A 1V54E 3LS8A 1N4PA 2FULA 2LNIA 1DCQA 4C9BB 3RAUA 4N3BA 4GTTA 5EKQD 4CDMA 2C0LA 4CT0A 5B1BE 4E6HA 5HRYA 1NI1A 3TWSA 4B8AA 2R05A 2R59A 4KZ0A 3HXCA 3FUMA 3NF1A 2PQNA 2IY0C 3QK0A 1H2UA 4RLYA 3CVVA 3UKUG 2CFUA 4P29A 2IO2C 1UN8A 2WXHA 2EILE 1JWFA 1E96B 3QOUA 2XEHA 1E8WA 2RD0A 4NRHB 3DSWA 1U3CA 3CQGB 3FWVA 5FQ7A 3UTMA 2FO1E 3FTUA 4PS3A 4U0ZA 2XPZA 1QBQA 2UY1A 1O1SA 3FU6A 5CECB 1YCSB 3PZ1A 2XGSA 3JUIA 4LEUA 3S2AA 1TNZA 4TXRA 4WUYA 5EIBE 3V2XA 4IULA 3UM3A 3CLJA 3MX3A 4I17A 4LNGA 3VLEA 3UMVA 4PDXA 5AQAA 4JEUA 2NYJA 5E75A 2VGEA 3D9HA 4BTBA 4U96D 1Q2ZA 3SY2A 2Y4UA 3T9KA 2A5EA 3E4BA 2EQXA 3EUVA 4JEHA 1MYOA 2VGYA 3BEEA 3EDTB 2WQHA 3ABLE 3PZDA 4GCOA 3LKUA 2I1JA 1IXVA 3LCAA 2P9UG 1N0QA 4CDNA 5G05J 2I6HA 3FU3A 3AS5A 1N11A 1NFIE 3FUNA 1TYQG 2R2LA 1Z3YA 3Q7FA 2WVIA 3MJWA 4WWPA 3J5PA 1S64A 1LD7A 4B89A 1ZB1A 3DSVA 3CVUA 3SNXA 2YHEA 3AJIA 3HRAA 3AAAC 4GYOA 4BT9A 2ZGDA 4Q96A 4ILGA 3Q79A 1QYMA 3DPDA 4U63A 3PREA 2F0YA 3UQ3A 4JD2G 3C3OA 4JPSA 3ZGQA 1QNFA 5CMYA 1VDYA 3FTVA 2QFCA 5T4YA 4HLLA 3EIQC 4DLQA 4TUUA 4LNUD 3TWTA 4HOTA 4DI3A 3MKQB 2CG3A 2ETBA 1OCZE 5CBOA 4U7EB 4JB8P 4K0RA 2ZIRA 1WY6A 5EYPF 2QYUA 4FU3A 5KWDA 3DXKG 2KC7A 4GA0A 3CVPA 1PAQA 4D10C 4IYPA 3FTXA 4BWRA 4YDEA 4BERA 4PH4B 3NQPA 5J90A 3S7FA 4FULA 2DCPA 3EHQA 1AP7A 5LP0A 1IQRA 3D9LA 3CHOA 2MHKA 5CEAA 3ML8A 1TN7A 3PEUB 1RZ4A 3FUFA 4J8DA 2ZGGA 3T5XA 5LCWC 3ZN3A 2WXOA 4OAUC 3ZW3A 3T8MA 1OWNA 5C1DA 3WXXA 3P1UA 5D66A 1BI7B 4ILHB 1MHQA 3BU8A 4AOFA 2GRLA 2R03A 3SI5A 4DX6D 4HI8A 1OWLA 4LRZA 4TUMA 1YA0A 1UJJA 1SZAA 5KNGA 4KT6B 3L82A 2WXIA 4N5QA 3FU0A 3HYMB 4MS6A 3LJNA 3Q49B 3JUEA 3U9WA 4CYMD 5EIDA 3S7BA 3ZFWA 3CGHA 3DSSA 5EX3A 1E8ZA 4O1OA 1WDYA 5BXOA 2LXMA 4J8EA 4KVOA 2KCKA 3JQ1A 1XNFA 2I9CA 2EINE 2WM9A 2HO1A 4I43A 4NIKA 3PDNA 4XE0A 5HQ8A 3D9PA 2R02A 5KNHD 4JA9A 3DXMG 3MGBA 4GPKA 3GZSA 1V55E 3B7TA 1U3DA 2IJGX 1TNBA 5BNWA 3C3RA 3JYSA 2VTBB 2XEEA 3NBNB 2BTDA 5AJLA 3HVEA 1TJFA 2EIJE 3FUJA 4JHKA 2CHWA 2KZTA 4BFRA 4I9CA 1S70B 4LNBA 1JWGA 4KBQA 4YDOA 2VYIA 2IFUA 4RVBA 1HH8A 4BSXA 3LY7A 3NAWA 1MX6A 2WXFA 2LXLA 4UI9K 4GA2A 4V3IA 2AXUA 4TRQA 1TN6A 3PE3A 1FCHA 1BPOA 3V79K 2GRMA 3F6QA 4HRMB 5FTPA 2KBXA 2V0PA 5ENTD 5G05C 3OTNA 2V8SE 3Q4AB 4OAVB 4FA6A 1H0AA 3N71A 2XS8A 4GCNA 4U8VD 3D3MA 4AP2A 3PVLA 3CV0A 4GYYA 1JCSA 3C72A 3S7DA 2X6KA 3LDZA 3Q5MA 4HXIA 1MX2A 3CSTA 5ARGA 4AXHA 4J0UA 2DYRE 3RRMB 4BTAA 2BF0X 2R5SA 1FT1A 3ZYKA 3FULA 1NA0A 1WG0A 2QZAA 3PZ2A 4WWOA 3FH5A 4G1TA 5CCLA 2B6CA 3FFLA 4OVUA 3U4TA 4UQYA 1OCRE 2L6JA 3I5PA 4U95D 4TXPA 4I6GA 3TAXA 2FI7A 3C98A 1PC2A 3D9OA 4HOSA 3V30A 1SA5A 3JXJA 3L54A 5H7PA 3ZU7B 3AU5A 4WAFA 5CRUA 3ZKJA 4HNAD 5AJDA 3ZYLA 3QB2A 3WG7E 4Z68A 1TR4A 1KPSB 1JUQA 1ZU2A 4GTMA 4IRUA 4DLOA 4N2SA 4PS7A 3PZ4A 2AWIA 3FUKA 2H6HA 4CCAA 1OWMA 4XKBA 3HXDA 2KATA 2YINA 2H6FA 3ENEA 4ANVA 4G24A 2XS1A 1P5QA 4GTVA 2V5FA 4GZ5A 5A6CA 3D9KA 3FUEA 3I3NA 3ASNE 4UWKA 3ASGA 4K03A 4FC8A 3MA5A 4NURA 2KM4A 4GTRA 1HG2A 2XENA 3EHRA 1HU3A 1TNOA 4G8KA 2GROB 3ULEG 1LF8A 2P9IG 2I1KA 3ESLA 2Y0BG 1INZA 5CEDB 5ITZF 1H6PA 3TXNA 1H6KA 4CRWA 3MKQA 2LUHA 1H6OA 4EHMA 5JHAA 3E30A 4B94A 5M72A 3TWXA 4DRXE 3RO2A 2HM8A 4XX5A 4C48B 2IF4A 2P58C 4I1OB 2ETCA 3UI2A 4GMRA 3CEQA 1IHGA 4GTPA 1FT2A 3E33A 2BKKB 2PNNA 4XKCA 3UX4A 3DEPA 2P9PG 5B1AE 1LD8A 4G26A 5AQ9A 3FDHA 3EHNA 2J8SD 3EHMA 4L1BA 3NOGD 4G11A 5ENPD 4J6IA 4FJYA 3JQ0A 3L08A 4K5BA 4AVXA 3B7UX 3U3WA 2LSUA 3G2VA 3TL5A 4GTQA 3GW4A 3FH8A 4QQIA 4G2VA 3ASHA 5FQ4A 4U8HA 3G2SA 1IQUA 3V2OA 3VLFA 2L9BA 2RKKA 2J07A 4U07A 4LUNU 2OVFA 2QC9A 4JC8A 1K1AA 2PQRA 2WQ7A 4DX1A 3CSFA 3HXFA 2DZOA 4A1SA 2WXJA 2P9NG 3MYVA 1SQMA 5T8IA 2YHCA 2VSXE 2OVBA 2JLBA 4CGWA 1K8KG 4UUCA 1HXIA 1NA3A 4CGVA 3IEGA 4JL0A 2VGXB 2FEZA 2FF4A 1DCEA 3AS4A 2XPYA 3MV2B 4UQXA 4UI9J 4FADA 4WNGA 4A55A 4YDYA 5JJ7A 1HX8A 3CQCB 4A63B 2F8YA 2XEVA 3CKBA 1MJ0A 5CMWA 2L0IA 4CT4A 1BLXB 3LXUX 1X81A 2P9KG 3RJVA 1ZBPA 5DBKA 4GMJA 3CVLA 2X6IA 3NZSA 1HFAA 1NZNA 3LJ3A 5EYLA 2HYZA 4APFA 4HB5A 2KXPC 2WXLA 3CHQA 3OXFA 4KXKB 2VTBA 4RQIA 4WNDA 2P2CP 1TEZA 3B13A 3LVRE 2CFZA 5KJMA 4RG6A 4I1MA 3SFYA 3X2QE 3SZ7A 1HG5A 3JCKC 4UWLA 4G8LA 1Y8MA 4R7LA 4MKTA 4TV3A 5ENRD 4G25A 4GZ6A 3E37A 4HRLA 4YVOA 2WXPA 3CHSA 1SZ9A 5CBNA 3CK9A 4O1PA 3VLDA 5DIZA 4JHRA 2HR2A 5ARFA 1OCCE 3FTZA 3TXMA 4GZDA 3W9FA 2L0TB 3UT4A 4WWNA 2WMOA 3NZUA 1JCQA 3O4ZA 5JMND 4AJWA 1U2VG 2FBNA 3ASOE 4BT8A 3GYZA 4F6RD 4WNEA 3C3QA 4BSZB 4KVMA 3ZYQA 2CHZA 3FH7A 4JHJA 4GTOA 3DSXA 3UKRG 2OEWA 5ANRA 4HS2A 3RKVA 2AW6A 2Q7FA 4UWGA 2WXKA 2DWZA 2BUGA 4B8CB 4GAAA 4JVSA 4U04A 5AAOA 3FU5A 4I2ZA 3ZXPA 5CERB 3SFZA 1SVXA 1O1TA 5CCMA 1TNYA 2ETAA 3CR3A 3OXGA 3FP3A 5AIJA 3K9IA 1ELWA 1WM5A 4J8FA 3QAQA 2A5UA 4L2YA 2OEVA 3IHYA 3EIJA 4APOA 3L6AA 3TJPA 1S63A 4GMLA 3PUKA 4DX2A 5G55A 1H2VC 3G2UA 3LY8A 1IHBA 4UWHA 4RG9A 4LSZE 3TWVA 4U0SA 3EJNA 3Q75A 1N54A 3RRUA 3L13A 3HDXA 1HE8A 2WPVA 4AV7A 4ACKA 2XPIA 3LPZA 4K5CA 1WAO1 3LEWA 4C0EA 2NSZA 3CK7A 1OCOE 3DSUA 3CHRA 3UT8A 2LSVA 4N2QA 3I4GA 4HOQA 2PM7A 3O48A 4EZLA 2EIKE 4DJAA 3QJZA 1UG3A 1FPPA 3LVQE 3CVXA 1N4QA 2WQ6A 1N94A 2J9QA 2VJ8A 3FTSA 4JA7A 1E7VA 5FZRA 3VTXA 2F8XK 4BX8A 2VSNA 3PUJA 4ANWA 1TNUA 2ILRA 4DX7D 3APFA 3L9TA 3QNKA 1PY1A 3R9AB 4HFGA 4HLEA 3UM1A 1UOHA 3RRNB 2X6FA 4FLHA 2Y69E 3CVQA 3SHFA 2IO3C 5KJNA 3PS6A 3HIZA 3PZ3A 3FEXA 2VSYA 4BEPA 1IKND 4N39A 2RG8A 3B7SA 3G2TA 3BG0B 3NB2A 3ISMC 2DIWA 2WMNA 5JJTA 3DWLG 5A7DB 5ENNA 1ELKA 4B0ZA 1Z5SC 4UI9C 1O5MA 4ME2A 3ML9A 2YNQA 2GRPB 2DVWA 3KD7A 2XZTG 5AYWD 5T3RA 4Y6WA 4LG6A 2WXRA 3D9NA 3ZXSA 4I6JA 1YMPA 4MRUA 5CRVA 3EU9A 5D0OD 5D2MC 3SO8A 1EDUA 3Q9UC 2C0MA 5J08A 4FHJA 3I4RB 1UW4B 4CEMA 4KYOB 5C2YA 3T8KA 4PS8A 5LFAA 3BUAA 1FVFA 3FTYA 1BD8A 1OUVA 3LY9A 3UM0A 1OWPA 2P9SG 2J08A 3V31A 2WXGA 1LTXA 2XQ0A 3R9MA 3FUHA 1N95A 5BPPA 4ANXA 4KZCA 1X5BA 2PZIA 3MEKA 2V5QC 3IXEA 3QKYA 3ZHEB 3PNLB
chains in the Genus database with same CATH topology
4JC8A 3RIBA 2OV8A 2JEKA 2PQRA 3KEZA 4KT6B 2CG2A 2WQ7A 3CSFA 4EZKA 3MKRA 2XGOA 3Q15A 5HI7A 4I2WA 4A1SA 2WXJA 5BT1A 2WXIA 3MYVA 5KCMA 5BV1A 2AVPA 1SQMA 3QWWA 3FU0A 1IYGA 3MZLB 1S0PA 5G04J 3HYMB 2QY7A 4MS6A 5T8IA 2YHCA 2VSXE 3Q49B 3QARA 1ELRA 2IU1A 2OVBA 3CIAA 2JLBA 4N5CA 3SGHA 3U9WA 4CGWA 4FLBA 1NP7A 3S7BA 3ZFWA 2XRYA 2VGXA 3CGHA 1HZ4A 1HXIA 3AU4A 5FQ8A 1NA3A 5EX3A 4CGVA 1E8ZA 1E90A 5CHEE 5ANLA 3IEGA 4JL0A 2VGXB 4QFVA 4J8EA 4KVOA 3SBSA 5JHBA 2FEZA 2FF4A 2KCKA 3CHPA 3JQ1A 3AS4A 2XPYA 3MV2B 4UQXA 5D0QD 4GYWA 3ULQA 1XNFA 2I9CA 3ZRHA 3ZYMA 3ASDA 4UI9J 4ACLA 4FADA 4WNGA 3KS2A 4A55A 5JJ7A 4HOUA 2WM9A 2HO1A 2MRIA 4I43A 1HX8A 4L23A 2X3MA 2KCVA 3SF4A 3CQCB 2XEVA 3PDNA 2V4LA 4XE0A 4CDRA 3ZPJA 5HQ8A 4WNFA 3D9PA 2LAIA 3CKBA 1MQSA 1Z6TA 5CMWA 2L0IA 3SBTB 3LXUX 4CT4A 4MLPA 1EYHA 3RJVA 4XIFA 1TJCA 4JA9A 1ZBPA 5DBKA 4GMJA 3CVLA 3OAWA 1EPUA 2X6IA 1HO8A 3MGBA 3NZSA 3GZSA 4GB9A 4AY5A 4GPKA 2J49A 3TGOA 1HFAA 1NZNA 2UWJG 2WXNA 3FHEA 3LJ3A 4FJZA 5BW8C 2HYZA 2X38A 4M3OA 4APFA 3UT7A 3B7TA 1U3DA 4URKA 2VTBA 2WXLA 2IJGX 3CHQA 3OXFA 3PEVB 4KXKB 3ZIMA 2IQCA 3MCXA 4WNDA 5BNWA 2XRZA 4A3VA 3JYSA 1KT1A 3CK8A 2VTBB 3R7RA 1TEZA 2XCCA 3B13A 2I2OA 2BTDA 4JZYA 5AENA 4OYSA 2CHXA 3HVEA 5AJLA 2XCBA 1TJFA 3KAEA 3FUJA 3LVRE 2CFZA 4JHKA 3FUIA 5KJMA 5LCWJ 2CHWA 2KZTA 4BFRA 4RG6A 3CVYA 2KCLA 4I1MA 4I9CA 3HVEB 4DK5A 4H7YA 3SZ7A 1HG5A 3ESKA 3JCKC 2VSOE 4L2LA 1JWGA 2KZTB 4UWLA 3L16A 2M63A 2PL2A 4KBQA 1Y8MA 4O6FA 3URZA 3MV3B 2VYIA 5FT9A 2IFUA 3CHMA 1HH8A 4RVBA 3APDA 3L17A 2GGFA 4R7LA 4MKTA 4TV3A 4BSXA 3LY7A 4XZ4A 4NQ0A 4G25A 4W9RA 2E2EA 4GZ6A 4F3VA 4YVOA 2WXPA 3ONKA 4N3CA 4A1GA 2WXFA 5FJYA 3OXLA 4J8SA 3S7JA 4UI9K 3CHSA 1SZ9A 3PH0C 4GA2A 3CK9A 4PUCA 3ZVVA 3U66A 3GZ2A 4GZCA 4A3TA 4V3IA 4JW1A 2DBAA 2AXUA 3CVNA 3VLDA 4TRQA 5FZSA 5DIZA 3ASFA 4JHRA 3PE3A 2HR2A 3L22A 3IHVA 1FCHA 5BUZA 1BPOA 5ARFA 5KJLA 2OOEA 3FTZA 2GRMA 3TXMA 2VQ2A 4GZDA 5FTPA 2V0PA 1JPLA 5G05C 3OTNA 2L0TB 3AS8A 3UT4A 2V8SE 3Q4AB 4AY6A 1QQEA 4WWNA 4ATGA 4FA6A 5FQ6A 2WMOA 2X6HA 3LS8A 3NZUA 1H0AA 2WXMA 2FULA 2LNIA 3N71A 3O4ZA 4GCNA 4AJWA 4C9BB 1HF8A 2FBNA 3D3MA 4AP2A 3PVLA 4N3BA 4L7TA 3CV0A 3P2BA 5EKQD 4CDMA 2C0LA 3B7RL 4GYYA 4BT8A 4CT0A 1KLXA 3GYZA 3R7QA 3S7DA 4E6HA 5FWQA 2MOWA 2X6KA 4WNEA 4I1AA 2C2LA 3LDZA 4NACA 3Q5MA 4HXIA 4B8AA 2Y4TA 4KVMA 3ZYQA 2CHZA 3FH7A 2R59A 4JHJA 2IOSA 3CSTA 4KZ0A 3FUMA 2R17C 3NF1A 2PQNA 1KT0A 5ARGA 3QK0A 1H2UA 3CVVA 3FEYA 3CKCA 4AXHA 2CFUA 4P29A 2E0IA 4J0UA 5ANRA 3RRMB 4C0MA 4HS2A 3RKVA 1UN8A 3FUDA 2AW6A 2Q7FA 2WXHA 4ILIA 4UWGA 3ZEFA 4BTAA 1JWFA 4EBAG 1E96B 2WXKA 3QOUA 4DPRA 2BUGA 1E8WA 2RD0A 4GAAA 4JVSA 4NRHB 2X6JA 4U04A 4B8CB 4F7AA 1U3CA 3CQGB 3FWVA 5FQ7A 2FO7A 2BF0X 3FTUA 4PS3A 4U0ZA 2XPZA 2R5SA 3FU5A 4I2ZA 3ZYKA 2UY1A 3SFZA 1OWOA 3FULA 3FU6A 1NA0A 3FY4A 4XI0A 4I6EA 2J09A 5CCMA 1XGWA 2UY1B 2XGSA 3CR3A 3JUIA 4ABNA 1E7UA 4LEUA 4WWOA 3S2AA 3OXGA 3FP3A 5AIJA 3FH5A 4G1TA 1Z3XA 4WUYA 5CCLA 3K9IA 2IONA 4HVBA 1ELWA 2A4ZA 5LX8A 4IULA 1WM5A 4J8FA 3CLJA 3QAQA 2A5UA 3FFLA 4L2YA 3MX3A 4OVUA 4I17A 3IHYA 3EIJA 4APOA 3L6AA 3TJPA 4GMLA 4UQYA 3PUKA 3U4TA 3VLEA 3IV0A 2L6JA 5G55A 1H2VC 3I5PA 4XI9A 3UMVA 4AM9A 1QZ2A 3G2UA 3BG1B 4PDXA 1B89A 4JEUA 3LY8A 4UWHA 5E75A 4RG9A 4BTBA 4I6GA 3TAXA 2FI7A 3C98A 1PC2A 3D9OA 4U0SA 4HOSA 4UWFA 3EJNA 2Y4UA 1N54A 3RRUA 3L13A 3HDXA 1HE8A 2WPVA 3E4BA 2EQXA 2AXZA 3GZ1A 3L54A 4JEHA 4AV7A 2VGYA 3BEEA 4ANUA 4N3AA 3EDTB 2WQHA 3AU5A 4ACKA 4BY6A 3PZDA 4GCOA 1DVPA 3LKUA 4WAFA 4EZJA 2I1JA 3RU0A 2XPIA 1GW6A 3LPZA 3Q47B 5AJDA 3ZYLA 3LCAA 3QB2A 1WAO1 3LEWA 4CDNA 4C0EA 2NSZA 3CK7A 5G05J 1JUQA 3DBSA 1L5JA 1ZU2A 2I6HA 3UUXA 3CHRA 4JXTA 3FU3A 4IRUA 3UT8A 2LSVA 4DLOA 4N2SA 4N2QA 1H19A 3AS5A 4PS7A 3I4GA 4HOQA 2PM7A 2AWIA 3FUKA 3FUNA 3O48A 4EZLA 4CCAA 1OWMA 3U64A 4DJAA 3QJZA 1Z3YA 4F53A 1UG3A 2J4DA 4XKBA 3TG5A 3PRZA 4G23A 2WVIA 2KATA 3LVQE 3MJWA 3IKOB 2YINA 4WWPA 5LOZA 1W3BA 4FHKA 3CVXA 4UQZA 3ENEA 4LERA 4ANVA 4B89A 5EX0A 4G24A 1FVHA 4I9EA 3CVUA 3SNXA 3PE4A 1P5QA 2WQ6A 2J9QA 2VJ8A 5KJKA 3FTSA 5G2NA 4JA7A 1A17A 1E7VA 5FZRA 2V5FA 3VTXA 4GZ5A 3QDNA 4BX8A 2VSNA 3PUJA 2YHEA 4ANWA 2WXQA 3D9MA 4YVQC 2ILRA 2YQ8A 5A6CA 3APFA 3D9KA 4GYOA 4BT9A 2AXVA 3QNKA 3FUEA 3I3NA 4IN3B 4Q94A 1PY1A 3ASGA 4UWKA 4Q69A 3R9AB 4HFGA 2J4BA 4RSYA 3APCA 4Q96A 4ILGA 3QWPA 2WB2A 3D9JA 4K03A 4HLEA 3DPDA 4U63A 2X6FA 4FLHA 1E8YA 3RRNB 3PREA 3MA5A 4FC8A 4FP7A 1Y6IA 4NURA 2XHEA 3UQ3A 3CVQA 2KM4A 4JPSA 3VTYA 3SHFA 3ZGQA 1QNFA 4AEZC 4YNDA 5KJNA 3PS6A 3HIZA 1HG2A 3FEXA 1UJKA 1HU3A 5CMYA 4F1SA 4BX9A 2VSYA 3LYAA 1LF8A 1VDYA 3FTVA 5G04C 2QFCA 3UPVA 1EF1C 5T4YA 2I1KA 3ESLA 4N39A 1H2TC 3EIQC 4DLQA 2RG8A 3B7SA 1INZA 3G2TA 3BG0B 2LAHA 2DIWA 4TUUA 2NXPA 5E76A 3TXNA 1H6KA 4EPZA 4CRWA 3MKQA 4OVVA 3HHMA 2WMNA 5JJTA 4HOTA 5BV0A 5JHAA 2ONDA 5A7DB 4DI3A 3MKQB 4B94A 2CG3A 5M72A 5ENNA 1ELKA 2PM6A 4B0ZA 4EECA 3RO2A 4U0UA 4UI9C 4K0RA 2HM8A 4ME2A 4XX5A 1WY6A 3ML9A 2YNQA 2IF4A 2P58C 4FU3A 4LCTA 3KD7A 4I1OB 5AYWD 2LO6A 5T3RA 4Y6WA 3CEQA 2KC7A 4GA0A 2WXRA 3CVPA 1IHGA 2NC9A 4HORA 3D9NA 1PAQA 3QKYA 4D10C 4IYPA 3ZXSA 3FTXA 4I6JA 4BWRA 4MRUA 4XKCA 3UX4A 4PH4B 5FZQA 3NQPA 3G2WA 4G26A 4H7XA 5J90A 3FDHA 3RO3A 3EHNA 3S7FA 4Y6CA 4FULA 2DCPA 3EHMA 5D0OD 3IBEA 4L1BA 1EDUA 4G11A 5LP0A 4J6IA 1IQRA 2ZU6B 4FJYA 3TG4A 3QWVA 3T5VA 4AIFA 3D9LA 3CHOA 2MHKA 3JQ0A 2C0MA 4GZ3A 5J08A 4FHJA 3SD5A 3I4RB 1UW4B 3L08A 3ML8A 3PEUB 4CEMA 4KYOB 5C2YA 3FUFA 4J8DA 4DI4A 3QC1A 4PS8A 5LFAA 4AVXA 1FVFA 3B7UX 3U3WA 2LSUA 1UN9A 3FTYA 3T5XA 5LCWC 3ZN3A 2WXOA 4GU5A 1OUVA 3LY9A 3G2VA 1OWPA 2XGMA 3TL5A 3ONLA 3ZW3A 2J08A 3T8MA 2WXGA 4E85A 3GW4A 3FH8A 1OWNA 2IOLA 4G2VA 4AOFA 5C1DA 3WXXA 3P1UA 3ASHA 5FQ4A 4U8HA 4ILHB 2XQ0A 5EDSA 4EQFA 3FTWA 3FUHA 5JJ6A 2Y3AA 5A23A 3RK6A 1N52A 5BPPA 3G2SA 1IQUA 4ANXA 4KZCA 1MHQA 1HS6A 2L9BA 3VLFA 2GRLA 1X5BA 2PZIA 2J07A 4LRZA 1OWLA 3SI5A 3ZHEA 4GA1A 4EBAA 3PNTB 1YA0A 2GW1A 4U07A 1DNPA 3MEKA 4KMOA 3D9IA 3CVWA 1UJJA 1E8XA 4LUNU 1SZAA 2OVFA 3ZHEB 3PNLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CT4 A;  3FEX A;  2I2O A;  3EIJ A;  1HU3 A;  4B8A A;  2HM8 A;  3L6A A;  4JHJ A;  2IOS A;  2IOL A;  1UG3 A;  4GMJ A;  4GML A;  4JHK A;  2ZU6 B;  1H2V C;  2KZT A;  1H2T C;  1H2U A;  3EIQ C;  2RG8 A;  3FEY A;  2FUL A;  4C9B B;  3JUI A;  1H6K A;  3RK6 A;  2NSZ A;  1UW4 B;  1N52 A;  3D3M A;  5ANR A;  4CEM A;  4B89 A;  4CRW A;  2VSO E;  2KZT B;  1PAQ A;  2VSX E;  2IU1 A;  2ION A;  4B8C B;  4IUL A;  4LUN U;  2GGF A;  1N54 A; 
#chains in the Genus database with same CATH topology
 2AJA A;  2P9L G;  2JEK A;  2CG2 A;  4EZK A;  3MKR A;  3Q15 A;  5HI7 A;  5HKP A;  5BT1 A;  5KCM A;  5BV1 A;  2AVP A;  4BET A;  3QWW A;  3UIN C;  1IYG A;  1S0P A;  5G04 J;  2QY7 A;  1N4R A;  4N5C A;  3SGH A;  1NP7 A;  1N0R A;  2V4H C;  2VGX A;  5FQ8 A;  3UXG A;  3TWU A;  1E90 A;  4QFV A;  1MZC A;  3CHP A;  1SA4 A;  4GYW A;  3ZRH A;  3ASD A;  4ACL A;  1BI8 B;  3AG3 E;  5KBA A;  3SF4 A;  1BU9 A;  1KZP A;  2ZXW E;  3SBT B;  4XIF A;  1TJC A;  2J49 A;  1D9S A;  2WXN A;  3FHE A;  4M3O A;  1AWC B;  2Y1L E;  4URK A;  2IQC A;  3MCX A;  2XRZ A;  3CK8 A;  2XCC A;  2I2O A;  3KEA A;  5AEN A;  3ABK E;  1G3N B;  4OYS A;  3UIP C;  2XCB A;  3Q9N C;  3CVY A;  2KCL A;  4H7Y A;  2BKG A;  5HS0 A;  2VSO E;  4L2L A;  5IY5 E;  2M63 A;  2PL2 A;  1KZO A;  4O6F A;  3URZ A;  5FT9 A;  2GRN B;  3CHM A;  3L17 A;  2GGF A;  4HRN A;  5AAR A;  1OY3 D;  4W9R A;  4N3C A;  5FJY A;  4J8S A;  5EIL A;  3PH0 C;  3U66 A;  3ZVV A;  3GZ2 A;  4A3T A;  2DBA A;  3CVN A;  5FZS A;  4J7W A;  3L22 A;  3IHV A;  5KJL A;  2B0O E;  2VQ2 A;  2RFA A;  3DRA A;  2RFM A;  1O1R A;  4AY6 A;  1QQE A;  4ATG A;  5FQ6 A;  2X6H A;  3UM2 A;  2WXM A;  1HF8 A;  4L7T A;  3P2B A;  3B7R L;  1KLX A;  3R7Q A;  3AG2 E;  5FWQ A;  2MOW A;  2QYJ A;  4I1A A;  2C2L A;  4NAC A;  4ZHB A;  3DST A;  4F1P A;  2Y4T A;  5FIN A;  2IOS A;  2R17 C;  1RW2 A;  1KT0 A;  3FEY A;  3CKC A;  2E0I A;  4HQD A;  5AQ7 A;  4C0M A;  3FUD A;  4ILI A;  3ZEF A;  2BED A;  4EBA G;  4DPR A;  3AG1 E;  2MYO A;  2X6J A;  4F7A A;  2FO7 A;  1OWO A;  2EIM E;  5B3S E;  5ENS D;  5ENO D;  3FY4 A;  4XI0 A;  4I6E A;  2J09 A;  1XGW A;  3KSL A;  2UY1 B;  2H6I A;  3W9G A;  4O60 A;  4ABN A;  1E7U A;  3B95 A;  5FIO A;  4K5A B;  3JXI A;  1SW6 A;  1Z3X A;  2ION A;  4HVB A;  2A4Z A;  5LX8 A;  4BES A;  2XZD G;  4X8Q A;  2JAB A;  3RSE G;  3ZNG A;  3IV0 A;  4XI9 A;  4AM9 A;  1QZ2 A;  3BG1 B;  5AN8 A;  1B89 A;  1YYH A;  1MX4 A;  4UWF A;  3SFX A;  3GZ1 A;  2AXZ A;  4ANU A;  1N9A A;  4N3A A;  4BY6 A;  4EZJ A;  1DVP A;  3RU0 A;  4GPM A;  1GW6 A;  3Q47 B;  3SQV A;  3DBS A;  1L5J A;  3UUX A;  4JXT A;  3AG4 E;  1H19 A;  3U64 A;  4F53 A;  2J4D A;  3TWQ A;  2DYS E;  3TG5 A;  3PRZ A;  4G23 A;  3IKO B;  2ZIS A;  4M7C A;  4MBG A;  5LOZ A;  1W3B A;  3E32 A;  4FHK A;  4UQZ A;  4LER A;  5EX0 A;  1FVH A;  4I9E A;  2GRQ B;  3PE4 A;  4XEI G;  3ZUV B;  3Q7A A;  5KJK A;  5G2N A;  1A17 A;  1A5E A;  3QDN A;  2WXQ A;  3D9M A;  4YVQ C;  2YQ8 A;  3DEO A;  1K3Z D;  2AXV A;  4IN3 B;  4Q94 A;  4Q69 A;  4RSY A;  2J4B A;  3APC A;  2WB2 A;  3QWP A;  2IEJ A;  3D9J A;  1E8Y A;  4YDW A;  4FP7 A;  1NL4 A;  1Y6I A;  2XHE A;  1JCR A;  3VTY A;  4AEZ C;  4YND A;  1UJK A;  4F1S A;  4BX9 A;  3LYA A;  5G04 C;  3UPV A;  1EF1 C;  2DZN A;  5AQB A;  4DUI A;  1H2T C;  2LAH A;  2NXP A;  2F37 A;  5E76 A;  4EPZ A;  4ATZ D;  4OVV A;  3HHM A;  5BV0 A;  2OND A;  2PM6 A;  4EEC A;  4U0U A;  1OXJ A;  4LCT A;  3E34 A;  2HE0 A;  2LO6 A;  3J5Q B;  2NC9 A;  4HOR A;  3EU5 A;  3NOC D;  5EN5 D;  5FZQ A;  4H7X A;  3G2W A;  4J8Y A;  3RO3 A;  4Y6C A;  3IBE A;  2ZU6 B;  3TG4 A;  3QWV A;  3T5V A;  3ABM E;  4AIF A;  4TXQ A;  4GZ3 A;  3SD5 A;  4DI4 A;  3QC1 A;  3ULY A;  3HXB A;  1UN9 A;  4GU5 A;  1D8E A;  2XGM A;  3ONL A;  4E85 A;  2IOL A;  4L9P A;  5EDS A;  4EQF A;  3FTW A;  3Q73 A;  5JJ6 A;  2Y3A A;  5A23 A;  3RK6 A;  1N52 A;  4U8Y D;  1HS6 A;  3ZHE A;  4EBA A;  4GA1 A;  3PNT B;  2GW1 A;  1DNP A;  4KMO A;  3D9I A;  3TWW A;  3CVW A;  1E8X A;  3DPY A;  3TWR A;  3RIB A;  2OV8 A;  3KEZ A;  2XGO A;  4I2W A;  2OCC E;  3UIO C;  3MZL B;  3QAR A;  1ELR A;  2IU1 A;  3CIA A;  4GTS A;  4FLB A;  4DX5 D;  2XRY A;  3C5R A;  1HZ4 A;  3AU4 A;  4CZ2 D;  5CHE E;  5ANL A;  3SBS A;  3KSQ A;  5JHB A;  1DC2 A;  5D0Q D;  3ULQ A;  5ENQ D;  3ZYM A;  3KS2 A;  4HOU A;  2MRI A;  4HI9 A;  4L23 A;  2X3M A;  2KCV A;  2V4L A;  4CDR A;  3ZPJ A;  4WNF A;  2LAI A;  1MQS A;  1Z6T A;  4MLP A;  1EYH A;  3OAW A;  1EPU A;  4AY5 A;  1HO8 A;  4GB9 A;  3TGO A;  4FJZ A;  2UWJ G;  5BW8 C;  2GRR B;  2X38 A;  3UT7 A;  4B93 B;  3ZIM A;  3PEV B;  3HG0 D;  2L6B A;  4A3V A;  1KT1 A;  1N4S A;  3R7R A;  1D8D A;  3HXE A;  4JZY A;  2CHX A;  3KAE A;  4ZFH A;  3FUI A;  5LCW J;  3HVE B;  4DK5 A;  3B7B A;  3ESK A;  2KZT B;  3BQO A;  3L16 A;  4HBD A;  3MV3 B;  2H6G A;  5JA4 D;  3APD A;  4XZ4 A;  4NQ0 A;  1K1B A;  2E2E A;  4F3V A;  3ONK A;  3Q78 A;  4A1G A;  3OXL A;  3S7J A;  4PUC A;  4GZC A;  4JW1 A;  3ASF A;  5BUZ A;  2OOE A;  1OT8 A;  1JPL A;  5BXU A;  1TN8 A;  3AS8 A;  1V54 E;  3LS8 A;  1N4P A;  2FUL A;  2LNI A;  1DCQ A;  4C9B B;  3RAU A;  4N3B A;  4GTT A;  5EKQ D;  4CDM A;  2C0L A;  4CT0 A;  5B1B E;  4E6H A;  5HRY A;  1NI1 A;  3TWS A;  4B8A A;  2R05 A;  2R59 A;  4KZ0 A;  3HXC A;  3FUM A;  3NF1 A;  2PQN A;  2IY0 C;  3QK0 A;  1H2U A;  4RLY A;  3CVV A;  3UKU G;  2CFU A;  4P29 A;  2IO2 C;  1UN8 A;  2WXH A;  2EIL E;  1JWF A;  1E96 B;  3QOU A;  2XEH A;  1E8W A;  2RD0 A;  4NRH B;  3DSW A;  1U3C A;  3CQG B;  3FWV A;  5FQ7 A;  3UTM A;  2FO1 E;  3FTU A;  4PS3 A;  4U0Z A;  2XPZ A;  1QBQ A;  2UY1 A;  1O1S A;  3FU6 A;  5CEC B;  1YCS B;  3PZ1 A;  2XGS A;  3JUI A;  4LEU A;  3S2A A;  1TNZ A;  4TXR A;  4WUY A;  5EIB E;  3V2X A;  4IUL A;  3UM3 A;  3CLJ A;  3MX3 A;  4I17 A;  4LNG A;  3VLE A;  3UMV A;  4PDX A;  5AQA A;  4JEU A;  2NYJ A;  5E75 A;  2VGE A;  3D9H A;  4BTB A;  4U96 D;  1Q2Z A;  3SY2 A;  2Y4U A;  3T9K A;  2A5E A;  3E4B A;  2EQX A;  3EUV A;  4JEH A;  1MYO A;  2VGY A;  3BEE A;  3EDT B;  2WQH A;  3ABL E;  3PZD A;  4GCO A;  3LKU A;  2I1J A;  1IXV A;  3LCA A;  2P9U G;  1N0Q A;  4CDN A;  5G05 J;  2I6H A;  3FU3 A;  3AS5 A;  1N11 A;  1NFI E;  3FUN A;  1TYQ G;  2R2L A;  1Z3Y A;  3Q7F A;  2WVI A;  3MJW A;  4WWP A;  3J5P A;  1S64 A;  1LD7 A;  4B89 A;  1ZB1 A;  3DSV A;  3CVU A;  3SNX A;  2YHE A;  3AJI A;  3HRA A;  3AAA C;  4GYO A;  4BT9 A;  2ZGD A;  4Q96 A;  4ILG A;  3Q79 A;  1QYM A;  3DPD A;  4U63 A;  3PRE A;  2F0Y A;  3UQ3 A;  4JD2 G;  3C3O A;  4JPS A;  3ZGQ A;  1QNF A;  5CMY A;  1VDY A;  3FTV A;  2QFC A;  5T4Y A;  4HLL A;  3EIQ C;  4DLQ A;  4TUU A;  4LNU D;  3TWT A;  4HOT A;  4DI3 A;  3MKQ B;  2CG3 A;  2ETB A;  1OCZ E;  5CBO A;  4U7E B;  4JB8 P;  4K0R A;  2ZIR A;  1WY6 A;  5EYP F;  2QYU A;  4FU3 A;  5KWD A;  3DXK G;  2KC7 A;  4GA0 A;  3CVP A;  1PAQ A;  4D10 C;  4IYP A;  3FTX A;  4BWR A;  4YDE A;  4BER A;  4PH4 B;  3NQP A;  5J90 A;  3S7F A;  4FUL A;  2DCP A;  3EHQ A;  1AP7 A;  5LP0 A;  1IQR A;  3D9L A;  3CHO A;  2MHK A;  5CEA A;  3ML8 A;  1TN7 A;  3PEU B;  1RZ4 A;  3FUF A;  4J8D A;  2ZGG A;  3T5X A;  5LCW C;  3ZN3 A;  2WXO A;  4OAU C;  3ZW3 A;  3T8M A;  1OWN A;  5C1D A;  3WXX A;  3P1U A;  5D66 A;  1BI7 B;  4ILH B;  1MHQ A;  3BU8 A;  4AOF A;  2GRL A;  2R03 A;  3SI5 A;  4DX6 D;  4HI8 A;  1OWL A;  4LRZ A;  4TUM A;  1YA0 A;  1UJJ A;  1SZA A;  5KNG A;  4KT6 B;  3L82 A;  2WXI A;  4N5Q A;  3FU0 A;  3HYM B;  4MS6 A;  3LJN A;  3Q49 B;  3JUE A;  3U9W A;  4CYM D;  5EID A;  3S7B A;  3ZFW A;  3CGH A;  3DSS A;  5EX3 A;  1E8Z A;  4O1O A;  1WDY A;  5BXO A;  2LXM A;  4J8E A;  4KVO A;  2KCK A;  3JQ1 A;  1XNF A;  2I9C A;  2EIN E;  2WM9 A;  2HO1 A;  4I43 A;  4NIK A;  3PDN A;  4XE0 A;  5HQ8 A;  3D9P A;  2R02 A;  5KNH D;  4JA9 A;  3DXM G;  3MGB A;  4GPK A;  3GZS A;  1V55 E;  3B7T A;  1U3D A;  2IJG X;  1TNB A;  5BNW A;  3C3R A;  3JYS A;  2VTB B;  2XEE A;  3NBN B;  2BTD A;  5AJL A;  3HVE A;  1TJF A;  2EIJ E;  3FUJ A;  4JHK A;  2CHW A;  2KZT A;  4BFR A;  4I9C A;  1S70 B;  4LNB A;  1JWG A;  4KBQ A;  4YDO A;  2VYI A;  2IFU A;  4RVB A;  1HH8 A;  4BSX A;  3LY7 A;  3NAW A;  1MX6 A;  2WXF A;  2LXL A;  4UI9 K;  4GA2 A;  4V3I A;  2AXU A;  4TRQ A;  1TN6 A;  3PE3 A;  1FCH A;  1BPO A;  3V79 K;  2GRM A;  3F6Q A;  4HRM B;  5FTP A;  2KBX A;  2V0P A;  5ENT D;  5G05 C;  3OTN A;  2V8S E;  3Q4A B;  4OAV B;  4FA6 A;  1H0A A;  3N71 A;  2XS8 A;  4GCN A;  4U8V D;  3D3M A;  4AP2 A;  3PVL A;  3CV0 A;  4GYY A;  1JCS A;  3C72 A;  3S7D A;  2X6K A;  3LDZ A;  3Q5M A;  4HXI A;  1MX2 A;  3CST A;  5ARG A;  4AXH A;  4J0U A;  2DYR E;  3RRM B;  4BTA A;  2BF0 X;  2R5S A;  1FT1 A;  3ZYK A;  3FUL A;  1NA0 A;  1WG0 A;  2QZA A;  3PZ2 A;  4WWO A;  3FH5 A;  4G1T A;  5CCL A;  2B6C A;  3FFL A;  4OVU A;  3U4T A;  4UQY A;  1OCR E;  2L6J A;  3I5P A;  4U95 D;  4TXP A;  4I6G A;  3TAX A;  2FI7 A;  3C98 A;  1PC2 A;  3D9O A;  4HOS A;  3V30 A;  1SA5 A;  3JXJ A;  3L54 A;  5H7P A;  3ZU7 B;  3AU5 A;  4WAF A;  5CRU A;  3ZKJ A;  4HNA D;  5AJD A;  3ZYL A;  3QB2 A;  3WG7 E;  4Z68 A;  1TR4 A;  1KPS B;  1JUQ A;  1ZU2 A;  4GTM A;  4IRU A;  4DLO A;  4N2S A;  4PS7 A;  3PZ4 A;  2AWI A;  3FUK A;  2H6H A;  4CCA A;  1OWM A;  4XKB A;  3HXD A;  2KAT A;  2YIN A;  2H6F A;  3ENE A;  4ANV A;  4G24 A;  2XS1 A;  1P5Q A;  4GTV A;  2V5F A;  4GZ5 A;  5A6C A;  3D9K A;  3FUE A;  3I3N A;  3ASN E;  4UWK A;  3ASG A;  4K03 A;  4FC8 A;  3MA5 A;  4NUR A;  2KM4 A;  4GTR A;  1HG2 A;  2XEN A;  3EHR A;  1HU3 A;  1TNO A;  4G8K A;  2GRO B;  3ULE G;  1LF8 A;  2P9I G;  2I1K A;  3ESL A;  2Y0B G;  1INZ A;  5CED B;  5ITZ F;  1H6P A;  3TXN A;  1H6K A;  4CRW A;  3MKQ A;  2LUH A;  1H6O A;  4EHM A;  5JHA A;  3E30 A;  4B94 A;  5M72 A;  3TWX A;  4DRX E;  3RO2 A;  2HM8 A;  4XX5 A;  4C48 B;  2IF4 A;  2P58 C;  4I1O B;  2ETC A;  3UI2 A;  4GMR A;  3CEQ A;  1IHG A;  4GTP A;  1FT2 A;  3E33 A;  2BKK B;  2PNN A;  4XKC A;  3UX4 A;  3DEP A;  2P9P G;  5B1A E;  1LD8 A;  4G26 A;  5AQ9 A;  3FDH A;  3EHN A;  2J8S D;  3EHM A;  4L1B A;  3NOG D;  4G11 A;  5ENP D;  4J6I A;  4FJY A;  3JQ0 A;  3L08 A;  4K5B A;  4AVX A;  3B7U X;  3U3W A;  2LSU A;  3G2V A;  3TL5 A;  4GTQ A;  3GW4 A;  3FH8 A;  4QQI A;  4G2V A;  3ASH A;  5FQ4 A;  4U8H A;  3G2S A;  1IQU A;  3V2O A;  3VLF A;  2L9B A;  2RKK A;  2J07 A;  4U07 A;  4LUN U;  2OVF A;  2QC9 A;  4JC8 A;  1K1A A;  2PQR A;  2WQ7 A;  4DX1 A;  3CSF A;  3HXF A;  2DZO A;  4A1S A;  2WXJ A;  2P9N G;  3MYV A;  1SQM A;  5T8I A;  2YHC A;  2VSX E;  2OVB A;  2JLB A;  4CGW A;  1K8K G;  4UUC A;  1HXI A;  1NA3 A;  4CGV A;  3IEG A;  4JL0 A;  2VGX B;  2FEZ A;  2FF4 A;  1DCE A;  3AS4 A;  2XPY A;  3MV2 B;  4UQX A;  4UI9 J;  4FAD A;  4WNG A;  4A55 A;  4YDY A;  5JJ7 A;  1HX8 A;  3CQC B;  4A63 B;  2F8Y A;  2XEV A;  3CKB A;  1MJ0 A;  5CMW A;  2L0I A;  4CT4 A;  1BLX B;  3LXU X;  1X81 A;  2P9K G;  3RJV A;  1ZBP A;  5DBK A;  4GMJ A;  3CVL A;  2X6I A;  3NZS A;  1HFA A;  1NZN A;  3LJ3 A;  5EYL A;  2HYZ A;  4APF A;  4HB5 A;  2KXP C;  2WXL A;  3CHQ A;  3OXF A;  4KXK B;  2VTB A;  4RQI A;  4WND A;  2P2C P;  1TEZ A;  3B13 A;  3LVR E;  2CFZ A;  5KJM A;  4RG6 A;  4I1M A;  3SFY A;  3X2Q E;  3SZ7 A;  1HG5 A;  3JCK C;  4UWL A;  4G8L A;  1Y8M A;  4R7L A;  4MKT A;  4TV3 A;  5ENR D;  4G25 A;  4GZ6 A;  3E37 A;  4HRL A;  4YVO A;  2WXP A;  3CHS A;  1SZ9 A;  5CBN A;  3CK9 A;  4O1P A;  3VLD A;  5DIZ A;  4JHR A;  2HR2 A;  5ARF A;  1OCC E;  3FTZ A;  3TXM A;  4GZD A;  3W9F A;  2L0T B;  3UT4 A;  4WWN A;  2WMO A;  3NZU A;  1JCQ A;  3O4Z A;  5JMN D;  4AJW A;  1U2V G;  2FBN A;  3ASO E;  4BT8 A;  3GYZ A;  4F6R D;  4WNE A;  3C3Q A;  4BSZ B;  4KVM A;  3ZYQ A;  2CHZ A;  3FH7 A;  4JHJ A;  4GTO A;  3DSX A;  3UKR G;  2OEW A;  5ANR A;  4HS2 A;  3RKV A;  2AW6 A;  2Q7F A;  4UWG A;  2WXK A;  2DWZ A;  2BUG A;  4B8C B;  4GAA A;  4JVS A;  4U04 A;  5AAO A;  3FU5 A;  4I2Z A;  3ZXP A;  5CER B;  3SFZ A;  1SVX A;  1O1T A;  5CCM A;  1TNY A;  2ETA A;  3CR3 A;  3OXG A;  3FP3 A;  5AIJ A;  3K9I A;  1ELW A;  1WM5 A;  4J8F A;  3QAQ A;  2A5U A;  4L2Y A;  2OEV A;  3IHY A;  3EIJ A;  4APO A;  3L6A A;  3TJP A;  1S63 A;  4GML A;  3PUK A;  4DX2 A;  5G55 A;  1H2V C;  3G2U A;  3LY8 A;  1IHB A;  4UWH A;  4RG9 A;  4LSZ E;  3TWV A;  4U0S A;  3EJN A;  3Q75 A;  1N54 A;  3RRU A;  3L13 A;  3HDX A;  1HE8 A;  2WPV A;  4AV7 A;  4ACK A;  2XPI A;  3LPZ A;  4K5C A;  1WAO 1;  3LEW A;  4C0E A;  2NSZ A;  3CK7 A;  1OCO E;  3DSU A;  3CHR A;  3UT8 A;  2LSV A;  4N2Q A;  3I4G A;  4HOQ A;  2PM7 A;  3O48 A;  4EZL A;  2EIK E;  4DJA A;  3QJZ A;  1UG3 A;  1FPP A;  3LVQ E;  3CVX A;  1N4Q A;  2WQ6 A;  1N94 A;  2J9Q A;  2VJ8 A;  3FTS A;  4JA7 A;  1E7V A;  5FZR A;  3VTX A;  2F8X K;  4BX8 A;  2VSN A;  3PUJ A;  4ANW A;  1TNU A;  2ILR A;  4DX7 D;  3APF A;  3L9T A;  3QNK A;  1PY1 A;  3R9A B;  4HFG A;  4HLE A;  3UM1 A;  1UOH A;  3RRN B;  2X6F A;  4FLH A;  2Y69 E;  3CVQ A;  3SHF A;  2IO3 C;  5KJN A;  3PS6 A;  3HIZ A;  3PZ3 A;  3FEX A;  2VSY A;  4BEP A;  1IKN D;  4N39 A;  2RG8 A;  3B7S A;  3G2T A;  3BG0 B;  3NB2 A;  3ISM C;  2DIW A;  2WMN A;  5JJT A;  3DWL G;  5A7D B;  5ENN A;  1ELK A;  4B0Z A;  1Z5S C;  4UI9 C;  1O5M A;  4ME2 A;  3ML9 A;  2YNQ A;  2GRP B;  2DVW A;  3KD7 A;  2XZT G;  5AYW D;  5T3R A;  4Y6W A;  4LG6 A;  2WXR A;  3D9N A;  3ZXS A;  4I6J A;  1YMP A;  4MRU A;  5CRV A;  3EU9 A;  5D0O D;  5D2M C;  3SO8 A;  1EDU A;  3Q9U C;  2C0M A;  5J08 A;  4FHJ A;  3I4R B;  1UW4 B;  4CEM A;  4KYO B;  5C2Y A;  3T8K A;  4PS8 A;  5LFA A;  3BUA A;  1FVF A;  3FTY A;  1BD8 A;  1OUV A;  3LY9 A;  3UM0 A;  1OWP A;  2P9S G;  2J08 A;  3V31 A;  2WXG A;  1LTX A;  2XQ0 A;  3R9M A;  3FUH A;  1N95 A;  5BPP A;  4ANX A;  4KZC A;  1X5B A;  2PZI A;  3MEK A;  2V5Q C;  3IXE A;  3QKY A;  3ZHE B;  3PNL B; 
#chains in the Genus database with same CATH homology
 4JC8 A;  3RIB A;  2OV8 A;  2JEK A;  2PQR A;  3KEZ A;  4KT6 B;  2CG2 A;  2WQ7 A;  3CSF A;  4EZK A;  3MKR A;  2XGO A;  3Q15 A;  5HI7 A;  4I2W A;  4A1S A;  2WXJ A;  5BT1 A;  2WXI A;  3MYV A;  5KCM A;  5BV1 A;  2AVP A;  1SQM A;  3QWW A;  3FU0 A;  1IYG A;  3MZL B;  1S0P A;  5G04 J;  3HYM B;  2QY7 A;  4MS6 A;  5T8I A;  2YHC A;  2VSX E;  3Q49 B;  3QAR A;  1ELR A;  2IU1 A;  2OVB A;  3CIA A;  2JLB A;  4N5C A;  3SGH A;  3U9W A;  4CGW A;  4FLB A;  1NP7 A;  3S7B A;  3ZFW A;  2XRY A;  2VGX A;  3CGH A;  1HZ4 A;  1HXI A;  3AU4 A;  5FQ8 A;  1NA3 A;  5EX3 A;  4CGV A;  1E8Z A;  1E90 A;  5CHE E;  5ANL A;  3IEG A;  4JL0 A;  2VGX B;  4QFV A;  4J8E A;  4KVO A;  3SBS A;  5JHB A;  2FEZ A;  2FF4 A;  2KCK A;  3CHP A;  3JQ1 A;  3AS4 A;  2XPY A;  3MV2 B;  4UQX A;  5D0Q D;  4GYW A;  3ULQ A;  1XNF A;  2I9C A;  3ZRH A;  3ZYM A;  3ASD A;  4UI9 J;  4ACL A;  4FAD A;  4WNG A;  3KS2 A;  4A55 A;  5JJ7 A;  4HOU A;  2WM9 A;  2HO1 A;  2MRI A;  4I43 A;  1HX8 A;  4L23 A;  2X3M A;  2KCV A;  3SF4 A;  3CQC B;  2XEV A;  3PDN A;  2V4L A;  4XE0 A;  4CDR A;  3ZPJ A;  5HQ8 A;  4WNF A;  3D9P A;  2LAI A;  3CKB A;  1MQS A;  1Z6T A;  5CMW A;  2L0I A;  3SBT B;  3LXU X;  4CT4 A;  4MLP A;  1EYH A;  3RJV A;  4XIF A;  1TJC A;  4JA9 A;  1ZBP A;  5DBK A;  4GMJ A;  3CVL A;  3OAW A;  1EPU A;  2X6I A;  1HO8 A;  3MGB A;  3NZS A;  3GZS A;  4GB9 A;  4AY5 A;  4GPK A;  2J49 A;  3TGO A;  1HFA A;  1NZN A;  2UWJ G;  2WXN A;  3FHE A;  3LJ3 A;  4FJZ A;  5BW8 C;  2HYZ A;  2X38 A;  4M3O A;  4APF A;  3UT7 A;  3B7T A;  1U3D A;  4URK A;  2VTB A;  2WXL A;  2IJG X;  3CHQ A;  3OXF A;  3PEV B;  4KXK B;  3ZIM A;  2IQC A;  3MCX A;  4WND A;  5BNW A;  2XRZ A;  4A3V A;  3JYS A;  1KT1 A;  3CK8 A;  2VTB B;  3R7R A;  1TEZ A;  2XCC A;  3B13 A;  2I2O A;  2BTD A;  4JZY A;  5AEN A;  4OYS A;  2CHX A;  3HVE A;  5AJL A;  2XCB A;  1TJF A;  3KAE A;  3FUJ A;  3LVR E;  2CFZ A;  4JHK A;  3FUI A;  5KJM A;  5LCW J;  2CHW A;  2KZT A;  4BFR A;  4RG6 A;  3CVY A;  2KCL A;  4I1M A;  4I9C A;  3HVE B;  4DK5 A;  4H7Y A;  3SZ7 A;  1HG5 A;  3ESK A;  3JCK C;  2VSO E;  4L2L A;  1JWG A;  2KZT B;  4UWL A;  3L16 A;  2M63 A;  2PL2 A;  4KBQ A;  1Y8M A;  4O6F A;  3URZ A;  3MV3 B;  2VYI A;  5FT9 A;  2IFU A;  3CHM A;  1HH8 A;  4RVB A;  3APD A;  3L17 A;  2GGF A;  4R7L A;  4MKT A;  4TV3 A;  4BSX A;  3LY7 A;  4XZ4 A;  4NQ0 A;  4G25 A;  4W9R A;  2E2E A;  4GZ6 A;  4F3V A;  4YVO A;  2WXP A;  3ONK A;  4N3C A;  4A1G A;  2WXF A;  5FJY A;  3OXL A;  4J8S A;  3S7J A;  4UI9 K;  3CHS A;  1SZ9 A;  3PH0 C;  4GA2 A;  3CK9 A;  4PUC A;  3ZVV A;  3U66 A;  3GZ2 A;  4GZC A;  4A3T A;  4V3I A;  4JW1 A;  2DBA A;  2AXU A;  3CVN A;  3VLD A;  4TRQ A;  5FZS A;  5DIZ A;  3ASF A;  4JHR A;  3PE3 A;  2HR2 A;  3L22 A;  3IHV A;  1FCH A;  5BUZ A;  1BPO A;  5ARF A;  5KJL A;  2OOE A;  3FTZ A;  2GRM A;  3TXM A;  2VQ2 A;  4GZD A;  5FTP A;  2V0P A;  1JPL A;  5G05 C;  3OTN A;  2L0T B;  3AS8 A;  3UT4 A;  2V8S E;  3Q4A B;  4AY6 A;  1QQE A;  4WWN A;  4ATG A;  4FA6 A;  5FQ6 A;  2WMO A;  2X6H A;  3LS8 A;  3NZU A;  1H0A A;  2WXM A;  2FUL A;  2LNI A;  3N71 A;  3O4Z A;  4GCN A;  4AJW A;  4C9B B;  1HF8 A;  2FBN A;  3D3M A;  4AP2 A;  3PVL A;  4N3B A;  4L7T A;  3CV0 A;  3P2B A;  5EKQ D;  4CDM A;  2C0L A;  3B7R L;  4GYY A;  4BT8 A;  4CT0 A;  1KLX A;  3GYZ A;  3R7Q A;  3S7D A;  4E6H A;  5FWQ A;  2MOW A;  2X6K A;  4WNE A;  4I1A A;  2C2L A;  3LDZ A;  4NAC A;  3Q5M A;  4HXI A;  4B8A A;  2Y4T A;  4KVM A;  3ZYQ A;  2CHZ A;  3FH7 A;  2R59 A;  4JHJ A;  2IOS A;  3CST A;  4KZ0 A;  3FUM A;  2R17 C;  3NF1 A;  2PQN A;  1KT0 A;  5ARG A;  3QK0 A;  1H2U A;  3CVV A;  3FEY A;  3CKC A;  4AXH A;  2CFU A;  4P29 A;  2E0I A;  4J0U A;  5ANR A;  3RRM B;  4C0M A;  4HS2 A;  3RKV A;  1UN8 A;  3FUD A;  2AW6 A;  2Q7F A;  2WXH A;  4ILI A;  4UWG A;  3ZEF A;  4BTA A;  1JWF A;  4EBA G;  1E96 B;  2WXK A;  3QOU A;  4DPR A;  2BUG A;  1E8W A;  2RD0 A;  4GAA A;  4JVS A;  4NRH B;  2X6J A;  4U04 A;  4B8C B;  4F7A A;  1U3C A;  3CQG B;  3FWV A;  5FQ7 A;  2FO7 A;  2BF0 X;  3FTU A;  4PS3 A;  4U0Z A;  2XPZ A;  2R5S A;  3FU5 A;  4I2Z A;  3ZYK A;  2UY1 A;  3SFZ A;  1OWO A;  3FUL A;  3FU6 A;  1NA0 A;  3FY4 A;  4XI0 A;  4I6E A;  2J09 A;  5CCM A;  1XGW A;  2UY1 B;  2XGS A;  3CR3 A;  3JUI A;  4ABN A;  1E7U A;  4LEU A;  4WWO A;  3S2A A;  3OXG A;  3FP3 A;  5AIJ A;  3FH5 A;  4G1T A;  1Z3X A;  4WUY A;  5CCL A;  3K9I A;  2ION A;  4HVB A;  1ELW A;  2A4Z A;  5LX8 A;  4IUL A;  1WM5 A;  4J8F A;  3CLJ A;  3QAQ A;  2A5U A;  3FFL A;  4L2Y A;  3MX3 A;  4OVU A;  4I17 A;  3IHY A;  3EIJ A;  4APO A;  3L6A A;  3TJP A;  4GML A;  4UQY A;  3PUK A;  3U4T A;  3VLE A;  3IV0 A;  2L6J A;  5G55 A;  1H2V C;  3I5P A;  4XI9 A;  3UMV A;  4AM9 A;  1QZ2 A;  3G2U A;  3BG1 B;  4PDX A;  1B89 A;  4JEU A;  3LY8 A;  4UWH A;  5E75 A;  4RG9 A;  4BTB A;  4I6G A;  3TAX A;  2FI7 A;  3C98 A;  1PC2 A;  3D9O A;  4U0S A;  4HOS A;  4UWF A;  3EJN A;  2Y4U A;  1N54 A;  3RRU A;  3L13 A;  3HDX A;  1HE8 A;  2WPV A;  3E4B A;  2EQX A;  2AXZ A;  3GZ1 A;  3L54 A;  4JEH A;  4AV7 A;  2VGY A;  3BEE A;  4ANU A;  4N3A A;  3EDT B;  2WQH A;  3AU5 A;  4ACK A;  4BY6 A;  3PZD A;  4GCO A;  1DVP A;  3LKU A;  4WAF A;  4EZJ A;  2I1J A;  3RU0 A;  2XPI A;  1GW6 A;  3LPZ A;  3Q47 B;  5AJD A;  3ZYL A;  3LCA A;  3QB2 A;  1WAO 1;  3LEW A;  4CDN A;  4C0E A;  2NSZ A;  3CK7 A;  5G05 J;  1JUQ A;  3DBS A;  1L5J A;  1ZU2 A;  2I6H A;  3UUX A;  3CHR A;  4JXT A;  3FU3 A;  4IRU A;  3UT8 A;  2LSV A;  4DLO A;  4N2S A;  4N2Q A;  1H19 A;  3AS5 A;  4PS7 A;  3I4G A;  4HOQ A;  2PM7 A;  2AWI A;  3FUK A;  3FUN A;  3O48 A;  4EZL A;  4CCA A;  1OWM A;  3U64 A;  4DJA A;  3QJZ A;  1Z3Y A;  4F53 A;  1UG3 A;  2J4D A;  4XKB A;  3TG5 A;  3PRZ A;  4G23 A;  2WVI A;  2KAT A;  3LVQ E;  3MJW A;  3IKO B;  2YIN A;  4WWP A;  5LOZ A;  1W3B A;  4FHK A;  3CVX A;  4UQZ A;  3ENE A;  4LER A;  4ANV A;  4B89 A;  5EX0 A;  4G24 A;  1FVH A;  4I9E A;  3CVU A;  3SNX A;  3PE4 A;  1P5Q A;  2WQ6 A;  2J9Q A;  2VJ8 A;  5KJK A;  3FTS A;  5G2N A;  4JA7 A;  1A17 A;  1E7V A;  5FZR A;  2V5F A;  3VTX A;  4GZ5 A;  3QDN A;  4BX8 A;  2VSN A;  3PUJ A;  2YHE A;  4ANW A;  2WXQ A;  3D9M A;  4YVQ C;  2ILR A;  2YQ8 A;  5A6C A;  3APF A;  3D9K A;  4GYO A;  4BT9 A;  2AXV A;  3QNK A;  3FUE A;  3I3N A;  4IN3 B;  4Q94 A;  1PY1 A;  3ASG A;  4UWK A;  4Q69 A;  3R9A B;  4HFG A;  2J4B A;  4RSY A;  3APC A;  4Q96 A;  4ILG A;  3QWP A;  2WB2 A;  3D9J A;  4K03 A;  4HLE A;  3DPD A;  4U63 A;  2X6F A;  4FLH A;  1E8Y A;  3RRN B;  3PRE A;  3MA5 A;  4FC8 A;  4FP7 A;  1Y6I A;  4NUR A;  2XHE A;  3UQ3 A;  3CVQ A;  2KM4 A;  4JPS A;  3VTY A;  3SHF A;  3ZGQ A;  1QNF A;  4AEZ C;  4YND A;  5KJN A;  3PS6 A;  3HIZ A;  1HG2 A;  3FEX A;  1UJK A;  1HU3 A;  5CMY A;  4F1S A;  4BX9 A;  2VSY A;  3LYA A;  1LF8 A;  1VDY A;  3FTV A;  5G04 C;  2QFC A;  3UPV A;  1EF1 C;  5T4Y A;  2I1K A;  3ESL A;  4N39 A;  1H2T C;  3EIQ C;  4DLQ A;  2RG8 A;  3B7S A;  1INZ A;  3G2T A;  3BG0 B;  2LAH A;  2DIW A;  4TUU A;  2NXP A;  5E76 A;  3TXN A;  1H6K A;  4EPZ A;  4CRW A;  3MKQ A;  4OVV A;  3HHM A;  2WMN A;  5JJT A;  4HOT A;  5BV0 A;  5JHA A;  2OND A;  5A7D B;  4DI3 A;  3MKQ B;  4B94 A;  2CG3 A;  5M72 A;  5ENN A;  1ELK A;  2PM6 A;  4B0Z A;  4EEC A;  3RO2 A;  4U0U A;  4UI9 C;  4K0R A;  2HM8 A;  4ME2 A;  4XX5 A;  1WY6 A;  3ML9 A;  2YNQ A;  2IF4 A;  2P58 C;  4FU3 A;  4LCT A;  3KD7 A;  4I1O B;  5AYW D;  2LO6 A;  5T3R A;  4Y6W A;  3CEQ A;  2KC7 A;  4GA0 A;  2WXR A;  3CVP A;  1IHG A;  2NC9 A;  4HOR A;  3D9N A;  1PAQ A;  3QKY A;  4D10 C;  4IYP A;  3ZXS A;  3FTX A;  4I6J A;  4BWR A;  4MRU A;  4XKC A;  3UX4 A;  4PH4 B;  5FZQ A;  3NQP A;  3G2W A;  4G26 A;  4H7X A;  5J90 A;  3FDH A;  3RO3 A;  3EHN A;  3S7F A;  4Y6C A;  4FUL A;  2DCP A;  3EHM A;  5D0O D;  3IBE A;  4L1B A;  1EDU A;  4G11 A;  5LP0 A;  4J6I A;  1IQR A;  2ZU6 B;  4FJY A;  3TG4 A;  3QWV A;  3T5V A;  4AIF A;  3D9L A;  3CHO A;  2MHK A;  3JQ0 A;  2C0M A;  4GZ3 A;  5J08 A;  4FHJ A;  3SD5 A;  3I4R B;  1UW4 B;  3L08 A;  3ML8 A;  3PEU B;  4CEM A;  4KYO B;  5C2Y A;  3FUF A;  4J8D A;  4DI4 A;  3QC1 A;  4PS8 A;  5LFA A;  4AVX A;  1FVF A;  3B7U X;  3U3W A;  2LSU A;  1UN9 A;  3FTY A;  3T5X A;  5LCW C;  3ZN3 A;  2WXO A;  4GU5 A;  1OUV A;  3LY9 A;  3G2V A;  1OWP A;  2XGM A;  3TL5 A;  3ONL A;  3ZW3 A;  2J08 A;  3T8M A;  2WXG A;  4E85 A;  3GW4 A;  3FH8 A;  1OWN A;  2IOL A;  4G2V A;  4AOF A;  5C1D A;  3WXX A;  3P1U A;  3ASH A;  5FQ4 A;  4U8H A;  4ILH B;  2XQ0 A;  5EDS A;  4EQF A;  3FTW A;  3FUH A;  5JJ6 A;  2Y3A A;  5A23 A;  3RK6 A;  1N52 A;  5BPP A;  3G2S A;  1IQU A;  4ANX A;  4KZC A;  1MHQ A;  1HS6 A;  2L9B A;  3VLF A;  2GRL A;  1X5B A;  2PZI A;  2J07 A;  4LRZ A;  1OWL A;  3SI5 A;  3ZHE A;  4GA1 A;  4EBA A;  3PNT B;  1YA0 A;  2GW1 A;  4U07 A;  1DNP A;  3MEK A;  4KMO A;  3D9I A;  3CVW A;  1UJJ A;  1E8X A;  4LUN U;  1SZA A;  2OVF A;  3ZHE B;  3PNL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...