3RK6A

Crystal structure of the middle domain of human paip1
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
217
structure length
217
Chain Sequence
b'TLSEYVQDFLNHLTEQPGSFETEIEQFAETLNGCVTTDDALQELVELIYQQATSIPNFSYMGARLCNYLSHHLTISPQSGNFRQLLLQRCRTEYEVKDQAAKGDEVTRKRFHAFVLFLGELYLNLEIKGTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLKLVELR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyadenylate-binding protein-interacting protein 1
publication title Crystal structure of the middle domain of human poly(A)-binding protein-interacting protein 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Translation regulator
total genus 85
structure length 217
sequence length 217
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-04-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3rk6A00
2FULA 2IOSA 4C9BB 1H6KA 2HM8A 2IONA 4JHKA 5ANRA 4B89A 1UG3A 1N54A 1HU3A 2I2OA 2KZTA 1H2UA 4GMJA 2RG8A 3EIQC 3FEXA 2IOLA 3JUIA 4GMLA 4CRWA 1UW4B 3L6AA 4B8AA 2GGFA 3D3MA 2NSZA 2VSXE 2IU1A 3EIJA 1PAQA 1N52A 4JHJA 3FEYA 4LUNU 4B8CB 4CT4A 2ZU6B 4IULA 3RK6A 4CEMA 1H2TC 2VSOE 2KZTB 1H2VC
chains in the Genus database with same CATH superfamily
3C3RA 4HLLA 3UM2A 2H6IA 2ZGDA 2F8YA 2VTBB 2JEKA 2KZTA 4H7XA 3DRAA 5A23A 1TNBA 4JVSA 1EF1C 4BESA 4FHJA 4TXRA 5HQ8A 5AJDA 3CHSA 3JXJA 3FUIA 4JW1A 4ANWA 1KPSB 1TN8A 1YMPA 3V31A 4JHKA 3I3NA 4CDNA 5E76A 1MYOA 3TG5A 4O1OA 4BX8A 2XPIA 3EU9A 3ML8A 1UN9A 3QNKA 2XZDG 4DUIA 4BTAA 4HI8A 4I9EA 5HKPA 3RSEG 4XKCA 3AU5A 1OUVA 3AAAC 5AQ7A 4IYPA 4A55A 2XRYA 3UI2A 2HYZA 4AY6A 1LTXA 1OCZE 3V30A 2B6CA 4DK5A 4I6GA 4G11A 5B3SE 4WUYA 3LY8A 1E7VA 3UIPC 5C2YA 5LCWC 4F3VA 3IBEA 3G2VA 3B7BA 2WXQA 3SY2A 4HS2A 3FU6A 3TL5A 1TYQG 3SFZA 4A3VA 3CHMA 2BKKB 3D9OA 1N0QA 2DZNA 3WG7E 3AG3E 4HLEA 4GYYA 4TXQA 1N4QA 3FUJA 5KNHD 1XNFA 4HB5A 2GRRB 4EZJA 3PEUB 3UM0A 3SZ7A 4GTTA 4U8VD 5AQ9A 5A6CA 3E37A 1TNYA 1K3ZD 3E4BA 4RVBA 3L22A 3Q75A 5JHBA 2DVWA 3HXEA 3CGHA 2KATA 3FUKA 2R03A 4HBDA 3TWUA 3D9NA 4UWHA 2CFUA 4YNDA 3HVEB 2NYJA 4AEZC 5KJKA 2AXVA 4KBQA 3NF1A 4CGVA 2EINE 4EQFA 3QB2A 4AIFA 3CK7A 1MJ0A 1N4RA 4HRMB 3SI5A 4HFGA 2R05A 3LY9A 3ZEFA 3FHEA 5CMYA 4DX1A 5D2MC 2VTBA 3ABME 1H19A 1UJKA 1KLXA 3ZN3A 4PS8A 5AENA 1OWLA 3BQOA 2GRLA 3QAQA 5J90A 4BT8A 2XCBA 4EHMA 3OXFA 4F53A 2ZISA 4KVMA 2XRZA 4ATZD 4K03A 2WXJA 2XPYA 2J8SD 1NL4A 2AVPA 3V2XA 3KAEA 3EIQC 5A7DB 3VLEA 4R7LA 4F6RD 4MRUA 1HG2A 3SD5A 3B95A 2L6BA 3C3QA 3FUEA 3D9HA 2R2LA 2PM7A 3PE3A 5ENOD 1E90A 5B1BE 4U8YD 4KZ0A 3KEZA 2P2CP 2OEWA 3ML9A 4TRQA 2WXNA 4GYOA 3AG4E 5EDSA 2CFZA 3AS5A 3V2OA 4CZ2D 3OXLA 3RJVA 4ILIA 2AW6A 5G04C 3UQ3A 3LYAA 3CKBA 1N52A 4LRZA 3HXBA 4B8CB 2FO1E 1QZ2A 4M3OA 3EUVA 4WNEA 4GZDA 5CEDB 2VQ2A 2OCCE 3JXIA 1SA4A 3HXFA 4N3AA 4GZ6A 5CRVA 5FT9A 3NBNB 5FJYA 2DZOA 3RAUA 3R7RA 1O1TA 4PUCA 1HXIA 5DIZA 2XGOA 3DEOA 1X5BA 3UIOC 2HM8A 4URKA 3DSVA 1DCEA 3NQPA 4DI3A 3E30A 1TN6A 2CG2A 2PQNA 4GZ3A 3SFXA 4JHJA 3G2WA 4JB8P 3DSTA 2LSUA 3RRUA 2HE0A 1ELRA 2KXPC 5DBKA 1OXJA 5IY5E 5AQAA 4E6HA 1H2UA 4KT6B 4GTOA 3CVLA 3AG1E 3TWVA 3FY4A 1Z6TA 1JPLA 3G2SA 5H7PA 2RFAA 4OVUA 1NFIE 4CYMD 1HO8A 3PZ3A 4ME2A 2I1JA 3VLFA 4P29A 4HXIA 3NB2A 1K1BA 4DX7D 1BU9A 3EIJA 1O1SA 2A5EA 3PEVB 1JWFA 4L1BA 4ATGA 5FQ6A 1H0AA 2X6JA 3UKRG 3FTYA 4BT9A 3GZSA 5KBAA 1ZU2A 1QQEA 5CEAA 1YCSB 2BKGA 3SFYA 1IXVA 2M63A 4I2ZA 3L6AA 3PUKA 2EIKE 4UQXA 3LDZA 2RFMA 1FT2A 1S63A 4TUUA 1JCSA 3OXGA 3PNLB 3ZUVB 3L17A 4KVOA 3T9KA 2C0MA 2I2OA 4YDEA 2XZTG 4DJAA 4GA2A 4LCTA 3CK9A 1UOHA 1EDUA 2V4HC 2ONDA 4G8KA 5B1AE 3FP3A 5EIBE 2WXMA 2GW1A 4N39A 5LCWJ 3ASHA 2QFCA 4GTRA 1N0RA 4HVBA 4PS3A 4YVOA 2VGEA 1TEZA 2WXLA 3LVRE 2H6HA 1JCQA 4XEIG 4WAFA 4KYOB 4ANVA 4ANUA 4Q96A 5FQ8A 3APCA 2VSOE 3RRNB 4I43A 1H2VC 5CRUA 3BUAA 4AJWA 3D9MA 2WMNA 3HRAA 4G25A 3Q73A 4GU5A 5T4YA 3D9JA 4GPMA 3GZ1A 2VGXB 4UI9C 3UX4A 1SZAA 5ENTD 3AJIA 3QKYA 4UI9K 2Y4TA 3S7FA 2KC7A 4HOSA 1OWPA 1IYGA 2JLBA 1OWNA 4YDOA 2WVIA 5M72A 3PE4A 4Q94A 5C1DA 3NOGD 4CT0A 3UTMA 4WNFA 5BV1A 4AM9A 5AJLA 3JQ0A 5J08A 3DSUA 4CDMA 4C0MA 2GRPB 2B0OE 2L0TB 2FO7A 4OVVA 1O5MA 1DCQA 2GRQB 3D3MA 3R9AB 1SW6A 3ABKE 3I4GA 3J5QB 3ASOE 4UWKA 3U66A 4N2SA 5ARGA 3MV2B 4C9BB 4GTSA 1OT8A 4AV7A 5AAOA 5ENQD 1HU3A 4AY5A 3KSQA 4CCAA 4OAVB 2DYSE 5AIJA 4EPZA 3LS8A 3EHQA 4TV3A 2KCKA 3CVYA 2V8SE 3VTYA 3RO2A 5FQ4A 4I6JA 3FDHA 2WMOA 3EDTB 3EHNA 3JCKC 5KJMA 3JYSA 3TWTA 1K8KG 3Q7FA 1SZ9A 3B7TA 4XX5A 4BX9A 4GZ5A 4JPSA 2P9PG 3TG4A 3CEQA 1BD8A 4DRXE 1V54E 3Q79A 3FTZA 1S70B 2C0LA 3FU5A 2EQXA 2QC9A 2VGYA 3IKOB 3ZNGA 3QOUA 4Y6WA 2Y4UA 4N5QA 4RLYA 4U8HA 2PQRA 1DNPA 5EKQD 1FVFA 4UQYA 4F7AA 2P58C 1SQMA 2EIJE 1SVXA 3UPVA 4FP7A 1V55E 5BUZA 2IEJA 4G23A 2R17C 3DXKG 3S7BA 2MRIA 3HXCA 5G04J 3DEPA 3KS2A 3U64A 3J5PA 3MKQB 3QC1A 1INZA 2DBAA 2PM6A 4BETA 5FZQA 4QQIA 3ZHEA 2IONA 4A1GA 3FH5A 4I1AA 4UQZA 3Q9UC 4B94A 1Y8MA 2AXZA 4GYWA 2X3MA 1FCHA 2NC9A 1JUQA 4CEMA 2VGXA 1HS6A 3ULQA 2QYJA 2AJAA 5LOZA 5AYWD 5ANRA 4E85A 3UM3A 3CK8A 3MJWA 2DCPA 3ASDA 3B7UX 3QWVA 3KD7A 4N5CA 5T3RA 4FU3A 3B7RL 1SA5A 4BWRA 4KMOA 2ETAA 4UWFA 4AXHA 4MS6A 4CRWA 1PY1A 4KXKB 2X6KA 3ASFA 4DPRA 2IFUA 3F6QA 3FTXA 2VSXE 3FTSA 4J8EA 2WXKA 1ZBPA 4JEHA 3QJZA 3PH0C 4AP2A 2P9LG 3ZW3A 1PC2A 3JQ1A 2VYIA 1JWGA 3PZ4A 3HYMB 4DX6D 5G05C 3FEXA 5FIOA 1NI1A 3PZ2A 2YHEA 3LCAA 4A1SA 2P9NG 3IHVA 1IQUA 2J07A 1N95A 3NOCD 2F37A 4B93B 2Y69E 4I6EA 3ULEG 3CVQA 3G2TA 3P1UA 4M7CA 1D8DA 3GZ2A 4B8AA 1TR4A 4GAAA 3FFLA 1JCRA 4RG6A 4B0ZA 4PH4B 3EHRA 5FWQA 3DWLG 4LNUD 1FVHA 3L13A 4TUMA 4Z68A 2BUGA 3ULYA 5CMWA 2YNQA 3TAXA 3KEAA 1K1AA 4HRLA 3QDNA 4WWNA 5ITZF 2XGMA 4J8YA 3NZSA 3O4ZA 3T5VA 4LNBA 2ZIRA 4AVXA 2LUHA 2FBNA 2XS8A 4FA6A 3IXEA 3Q49B 2KCLA 4FADA 5CERB 3SHFA 4IRUA 3L54A 3TWRA 3CHOA 1L5JA 3B13A 4CGWA 2IOLA 3UT4A 4JXTA 2DWZA 4J6IA 3IEGA 1AP7A 2FEZA 2WM9A 2CG3A 3RK6A 4HQDA 1YA0A 5JJ6A 2HO1A 1E96B 3V79K 4GPKA 4MLPA 2FI7A 4UUCA 3FU0A 1WY6A 3FTUA 3Q9NC 2PNNA 1U3DA 2IF4A 3FH7A 2R02A 2XEHA 3FEYA 3NAWA 3ZXPA 2GROB 3AU4A 3MGBA 4GA0A 4GZCA 5KNGA 2VJ8A 2GRMA 4U0ZA 4UI9J 1EYHA 3AG2E 1E7UA 1BI8B 3BG1B 4AOFA 1FPPA 3C98A 3ESKA 3E34A 3PUJA 4FULA 2VSYA 4JZYA 3Q47B 2A4ZA 4LNGA 4N3BA 3MA5A 2XENA 3HVEA 1XGWA 3UMVA 4J8SA 1U2VG 1AWCB 4APFA 3T8MA 5ENNA 3PZ1A 2LNIA 2BEDA 4HOUA 4NURA 3Q15A 4HOTA 1H6PA 4WNDA 5ENSD 4C48B 1HH8A 4GB9A 4FJYA 4FHKA 1KT0A 5AQBA 3FU3A 3B7SA 2DYRE 4I17A 5EN5D 4GTVA 1WM5A 4JA7A 4EZKA 4L2LA 2IO2C 3CHRA 2J08A 3DBSA 4V3IA 2GGFA 4GTQA 3LKUA 1MZCA 1Z5SC 4J0UA 4LERA 4BEPA 1Z3YA 3ZVVA 2WXOA 1S0PA 5EX3A 3FUMA 2Q7FA 4Q69A 3PDNA 3ZYMA 3LPZA 3AS8A 3ZYQA 3KSLA 3QARA 3I4RB 4WNGA 4IULA 2GRNB 5JMND 3CV0A 3TWWA 2WXIA 3S7DA 3SF4A 4UWGA 2IJGX 3HXDA 5HRYA 1H6OA 2YINA 4RQIA 2HR2A 2DIWA 4MKTA 3MEKA 3D9PA 4O6FA 4U0SA 3TWQA 1RW2A 3SBTB 2XS1A 2L9BA 2AWIA 3TWXA 3DPYA 3IHYA 5BT1A 5ARFA 2OVBA 3C3OA 4LG6A 3ZGQA 4ABNA 1MHQA 2KBXA 1PAQA 4JA9A 4DX2A 3ZYLA 4U7EB 4U0UA 4L9PA 2WXGA 3RU0A 2BTDA 3JUIA 1HF8A 4XZ4A 4K5CA 1LD8A 4YDYA 3FWVA 3FTWA 3R9MA 3CHQA 4GTMA 3IV0A 4JC8A 4PDXA 3UXGA 4EBAA 2I6HA 3NZUA 4QFVA 1NA0A 4LSZE 4G26A 2C2LA 2OEVA 5JJ7A 2L0IA 2LAHA 3I5PA 1P5QA 3HIZA 3VTXA 1N4SA 2CHWA 3MX3A 2J4BA 3L82A 3FUFA 3U3WA 3FUNA 3AS4A 5FQ7A 2YQ8A 4HORA 4F1SA 1ZB1A 4HRNA 5G2NA 3CVUA 2WXPA 4K5BA 3MV3B 2L6JA 1TNUA 2ZU6B 4BSXA 3CLJA 4G1TA 5KWDA 1UJJA 2KCVA 4IN3B 3MYVA 1VDYA 4EZLA 3ZYKA 1WDYA 3Q78A 1RZ4A 3N71A 2E2EA 5G05J 1TNOA 2WXFA 4O60A 4XI0A 1KZPA 1IHBA 2FULA 1Q2ZA 4K5AB 4A3TA 1NP7A 3SQVA 2WQ7A 2J4DA 4RG9A 3CVXA 4I1MA 3ZIMA 4GMRA 1QBQA 4APOA 4CDRA 4NIKA 1S64A 4G2VA 5D0OD 4Y6CA 3SGHA 4DLOA 3PREA 3VLDA 3CKCA 4ZHBA 4MBGA 3UKUG 3DSSA 1HZ4A 3CVPA 5BNWA 3O48A 1TN7A 3EU5A 1E8WA 3APFA 3G2UA 3L9TA 3ENEA 3EJNA 2PL2A 4XI9A 1OCCE 3UM1A 4JL0A 2NXPA 4OYSA 3CVNA 2J49A 1GW6A 2VSNA 4YVQC 1ELWA 2JABA 4GA1A 2IO3C 3URZA 4I2WA 1DVPA 4FC8A 4BERA 2MOWA 2CHZA 4LEUA 1OCOE 1LD7A 4W9RA 1NZNA 3DSXA 3CSTA 5BW8C 3PZDA 3WXXA 4J8DA 3CVWA 3LJNA 3ZKJA 5BPPA 1NA3A 3RRMB 3ZXSA 1KT1A 1MX2A 5LX8A 2UWJG 4GTPA 3C5RA 2F0YA 1HX8A 5JA4D 3Q5MA 3Q4AB 2Y0BG 4L2YA 3ASNE 2H6GA 3T5XA 1BLXB 2WQHA 3FUHA 2P9IG 3TXNA 4I9CA 3BG0B 4A63B 3TJPA 4XIFA 4U07A 4FLHA 3X2QE 3FH8A 4O1PA 4G24A 5HI7A 1E8YA 3ASGA 4L23A 1IHGA 5LFAA 3E32A 3U9WA 5EYLA 4BY6A 1OY3D 3D9LA 3ABLE 3HG0D 5CHEE 5BXOA 1DC2A 4OAUC 5FINA 5ANLA 3PRZA 3MZLB 3CIAA 2R5SA 4FJZA 3ISMC 2XPZA 2P9SG 2F8XK 2WB2A 2XEEA 2ETCA 4GCNA 3HDXA 2QY7A 2LXMA 2IY0C 4H7YA 1B89A 3PVLA 1OCRE 4XE0A 2FF4A 1FT1A 4DX5D 2EILE 3MKRA 2X38A 3TGOA 5ENPD 1WAO1 3PS6A 2WQ6A 2LO6A 5FTPA 2IU1A 3D9KA 4ILGA 1QNFA 3UINC 3ESLA 3PNTB 3L08A 3QWPA 1E8ZA 4JEUA 3OAWA 3ZFWA 1N11A 4N3CA 5KJLA 3MCXA 2KM4A 3DPDA 4KZCA 3SBSA 2Y3AA 4J7WA 3S7JA 1LF8A 1MX4A 5LP0A 1Y6IA 4L7TA 5FZRA 3CVVA 3EHMA 4ACKA 1ELKA 3W9GA 2Y1LE 5CECB 2UY1B 1N4PA 1HG5A 4U95D 3MKQA 4TXPA 4RSYA 2ZXWE 3K9IA 4ANXA 3TXMA 2NSZA 4DLQA 3CHPA 2MHKA 3DSWA 3QK0A 4NQ0A 3LEWA 3Q7AA 4J8FA 2RG8A 2QZAA 4BFRA 1OWOA 4YDWA 1KZOA 3UUXA 3OTNA 1MX6A 2XCCA 2IOSA 1H6KA 4HNAD 1TJCA 3RO3A 3ONKA 3APDA 5EILA 5ENRD 4PS7A 4NRHB 3CQGB 2KZTB 2V0PA 4XKBA 1A17A 1IQRA 3C72A 4I1OB 1WG0A 1O1RA 3UT7A 4U04A 2XGSA 3LY7A 5EYPF 3GW4A 4G8LA 3W9FA 3CR3A 4EBAG 2J09A 5AARA 2OV8A 2PZIA 2X6FA 4UWLA 3DXMG 1U3CA 2AXUA 2WXHA 4JD2G 1YYHA 1TJFA 1UG3A 3SNXA 4N2QA 2RD0A 3ZRHA 4ACLA 1MQSA 2LSVA 2LAIA 2ZGGA 3ZPJA 4F1PA 2MYOA 2X6IA 3E33A 5BXUA 1TNZA 1IKND 5G55A 1BI7B 4EECA 3LXUX 1D9SA 5CBNA 2E0IA 1EPUA 2P9KG 3BU8A 2WXRA 2ILRA 3RIBA 1BPOA 3P2BA 1X81A 3RKVA 4GMJA 2R59A 4ZFHA 2P9UG 1OWMA 3CSFA 2I1KA 2WPVA 4WWPA 1A5EA 2V5QC 1W3BA 4K0RA 2QYUA 5AN8A 3TWSA 5CCMA 4CT4A 2J9QA 1HFAA 1D8EA 3FTVA 2I9CA 4U96D 5EIDA 2OVFA 5KJNA 4U63A 2BF0X 3R7QA 3CQCB 2V4LA 2A5UA 4X8QA 3U4TA 3BEEA 2RKKA 3LJ3A 3ZU7B 3D9IA 4DI4A 2UY1A 3JUEA 4ILHB 3LVQE 3UT8A 2LXLA 4D10C 4GMLA 5BV0A 5CBOA 1UW4B 4C0EA 5HS0A 5FZSA 4NACA 2IQCA 5D0QD 3ZHEB 1UN8A 2EIME 4BSZB 4FLBA 3FULA 3QWWA 4JHRA 2X6HA 4HI9A 3SO8A 4B89A 2H6FA 5JJTA 1N94A 1N54A 1HE8A 1G3NB 5T8IA 3T8KA 2XEVA 3HHMA 2OOEA 2XQ0A 1QYMA 1H2TC 3S2AA 4BTBA 5KCMA 5EX0A 2CHXA 5CCLA 2V5FA 2YHCA 5D66A 2ETBA 5E75A 3ONLA 2XHEA 4WWOA 1N9AA 3GYZA 4GCOA 3L16A 1Z3XA 4LUNU 1E8XA 5JHAA 4HOQA 3FUDA
chains in the Genus database with same CATH topology
4IRUA 3L54A 2VTBB 3CHOA 1L5JA 2JEKA 2KZTA 1HX8A 3B13A 4CGWA 4H7XA 2IOLA 2M63A 3Q4AB 3Q5MA 4I2ZA 3L6AA 3UT4A 4JXTA 4L2YA 4J6IA 5A23A 3IEGA 3PUKA 3T5XA 2FEZA 2WM9A 2WQHA 4UQXA 3FUHA 3LDZA 4JVSA 1EF1C 2CG3A 3RK6A 4FHJA 1YA0A 5JJ6A 2HO1A 3TXNA 4TUUA 1E96B 3OXGA 5HQ8A 5AJDA 3CHSA 3PNLB 3FUIA 4GPKA 4JW1A 4ANWA 4I9CA 3BG0B 4JHKA 4MLPA 3I3NA 3L17A 4CDNA 4KVOA 2C0MA 2FI7A 5E76A 2I2OA 3TG5A 3TJPA 4DJAA 3FU0A 4GA2A 4LCTA 1WY6A 3CK9A 2XPIA 3FTUA 4BX8A 4XIFA 1U3DA 1EDUA 3ML8A 4U07A 4FLHA 2IF4A 2ONDA 1UN9A 3FH7A 3FH8A 4G24A 5HI7A 3FEYA 3FP3A 3QNKA 3AU4A 1E8YA 2GW1A 2WXMA 3MGBA 4I9EA 4BTAA 3ASGA 4N39A 5LCWJ 3ASHA 4GA0A 2QFCA 4GZCA 4L23A 4XKCA 1IHGA 2VJ8A 2GRMA 4U0ZA 4UI9J 1EYHA 1E7UA 5LFAA 3BG1B 3AU5A 1OUVA 4HVBA 4AOFA 3C98A 3ESKA 4PS3A 4YVOA 3U9WA 4BY6A 4IYPA 1TEZA 2WXLA 3LVRE 4A55A 2XRYA 3PUJA 3D9LA 2HYZA 4FULA 5CHEE 2VSYA 4JZYA 4AY6A 3Q47B 2A4ZA 4WAFA 4KYOB 5ANLA 3PRZA 3MZLB 4N3BA 4ANVA 3MA5A 3CIAA 4Q96A 5FQ8A 4ANUA 2R5SA 4DK5A 3APCA 2VSOE 3HVEA 3RRNB 4I6GA 1XGWA 3UMVA 4I43A 4G11A 4J8SA 4WUYA 4FJZA 1H2VC 4APFA 4AJWA 3T8MA 3D9MA 5ENNA 2WMNA 2XPZA 2LNIA 4HOUA 3LY8A 2WB2A 1E7VA 4NURA 3Q15A 4G25A 4GU5A 5T4YA 3D9JA 5C2YA 5LCWC 4HOTA 4WNDA 4F3VA 3GZ1A 1HH8A 2VGXB 3IBEA 4UI9C 3G2VA 3UX4A 4GCNA 2WXQA 1SZAA 3HDXA 2QY7A 3FU6A 4HS2A 3QKYA 3TL5A 4H7YA 1B89A 4GB9A 3PVLA 3SFZA 4UI9K 4A3VA 3CHMA 4FJYA 2Y4TA 4FHKA 1KT0A 3FU3A 4XE0A 3B7SA 3D9OA 4I17A 3S7FA 2KC7A 4HOSA 2FF4A 1OWPA 1IYGA 1WM5A 4JA7A 4HLEA 2JLBA 3MKRA 1OWNA 4L2LA 4EZKA 3CHRA 2J08A 4GYYA 2WVIA 2X38A 3TGOA 3DBSA 5M72A 1WAO1 3FUJA 3PS6A 3PE4A 2GGFA 4V3IA 2WQ6A 3LKUA 4Q94A 2LO6A 1XNFA 5FTPA 4J0UA 2IU1A 3D9KA 4ILGA 4LERA 1QNFA 5C1DA 1Z3YA 4CT0A 4WNFA 3PEUB 4EZJA 3ZVVA 3ESLA 3PNTB 5BV1A 2WXOA 3L08A 1S0PA 4AM9A 5AJLA 3JQ0A 3QWPA 5EX3A 1E8ZA 3FUMA 4JEUA 3SZ7A 5J08A 5A6CA 4CDMA 3OAWA 3ZFWA 4C0MA 2Q7FA 3E4BA 4N3CA 5KJLA 3MCXA 2L0TB 2KM4A 2FO7A 3DPDA 4KZCA 4OVVA 4Q69A 4RVBA 3L22A 3PDNA 3SBSA 2Y3AA 3S7JA 3ZYMA 1LF8A 3LPZA 3AS8A 3D3MA 3R9AB 3ZYQA 3I4GA 5JHBA 5LP0A 1Y6IA 4L7TA 5FZRA 3CVVA 3QARA 4UWKA 3EHMA 3I4RB 4WNGA 4ACKA 1ELKA 4IULA 3CGHA 2KATA 2UY1B 3FUKA 3CV0A 3U66A 2WXIA 1HG5A 4N2SA 5ARGA 3D9NA 3S7DA 3SF4A 3MV2B 4C9BB 4UWGA 2IJGX 3MKQA 4RSYA 2YINA 4UWHA 4AV7A 1HU3A 2HR2A 3K9IA 4AY5A 2DIWA 4MKTA 3MEKA 4CCAA 5AIJA 3D9PA 4EPZA 4ANXA 2CFUA 4O6FA 4U0SA 3TXMA 4YNDA 2NSZA 3HVEB 3SBTB 3LS8A 4DLQA 3CHPA 4AEZC 2L9BA 2AWIA 2MHKA 5KJKA 2AXVA 4KBQA 2KCKA 4TV3A 3NF1A 3QK0A 4NQ0A 2V8SE 4CGVA 3CVYA 4EQFA 3QB2A 4AIFA 3LEWA 3VTYA 3CK7A 3RO2A 3IHYA 5FQ4A 5BT1A 4I6JA 3SI5A 3FDHA 4HFGA 2WMOA 3EDTB 3EHNA 3JCKC 5KJMA 3JYSA 4J8FA 5ARFA 2RG8A 1SZ9A 2OVBA 3B7TA 4XX5A 3LY9A 3ZGQA 3ZEFA 1MHQA 3FHEA 4ABNA 4BX9A 4BFRA 1OWOA 5CMYA 2VTBA 4GZ5A 1PAQA 4JPSA 3TG4A 1H19A 3CEQA 1UJKA 4JA9A 1KLXA 3ZN3A 4PS8A 3ZYLA 5AENA 3UUXA 3OTNA 4U0UA 3FTZA 2C0LA 2XCCA 2IOSA 1H6KA 1TJCA 3FU5A 2EQXA 1OWLA 2WXGA 2VGYA 3IKOB 3RU0A 2BTDA 3RO3A 3ONKA 2GRLA 3QAQA 3JUIA 3APDA 5J90A 3QOUA 4PS7A 4BT8A 2XCBA 4NRHB 3CQGB 3OXFA 4Y6WA 2Y4UA 1HF8A 4XZ4A 4F53A 3FWVA 3FTWA 4U8HA 4KVMA 2PQRA 3CHQA 1DNPA 2XRZA 5EKQD 1FVFA 3IV0A 4K03A 2WXJA 4UQYA 4F7AA 4JC8A 2KZTB 2V0PA 2XPYA 4PDXA 2P58C 4EBAA 4XKBA 1SQMA 2I6HA 1A17A 2AVPA 1IQRA 3UPVA 3NZUA 4I1OB 4QFVA 1NA0A 3KAEA 3EIQC 4FP7A 4G26A 3UT7A 5LX8A 2C2LA 4U04A 5BUZA 5A7DB 5JJ7A 2XGSA 3VLEA 2L0IA 2LAHA 3LY7A 4G23A 3I5PA 3GW4A 4R7LA 2R17C 1P5QA 3HIZA 3VTXA 3S7BA 2MRIA 4MRUA 1HG2A 3KS2A 5G04J 2CHWA 3CR3A 3SD5A 3U64A 3MX3A 3MKQB 4EBAG 2J09A 2J4BA 3FUEA 3QC1A 1INZA 2OV8A 2PZIA 2DBAA 2X6FA 2PM6A 1U3CA 4UWLA 2AXUA 3FUFA 2PM7A 2WXHA 3PE3A 5FZQA 3U3WA 3FUNA 3ZHEA 2IONA 1TJFA 4A1GA 1E90A 1UG3A 4KZ0A 3SNXA 4N2QA 3FH5A 3AS4A 3KEZA 2RD0A 5FQ7A 2YQ8A 4I1AA 3ZRHA 1MQSA 2LSVA 4ACLA 4F1SA 4HORA 2LAIA 3ZPJA 4UQZA 4B94A 1Y8MA 2AXZA 5G2NA 2X6IA 3ML9A 4GYWA 3CVUA 2WXPA 3MV3B 4TRQA 2L6JA 2WXNA 2X3MA 2ZU6B 4GYOA 1FCHA 5G55A 2NC9A 4BSXA 5EDSA 1JUQA 4CEMA 2VGXA 4EECA 2CFZA 3AS5A 1HS6A 3LXUX 3ULQA 2E0IA 1EPUA 3CLJA 4G1TA 2WXRA 1UJJA 2ILRA 2KCVA 3RIBA 4IN3B 1BPOA 5LOZA 3MYVA 3OXLA 3P2BA 3RJVA 5AYWD 5ANRA 1VDYA 3RKVA 4E85A 4EZLA 4ILIA 2AW6A 3ZYKA 3CK8A 3MJWA 5G04C 4GMJA 2R59A 3UQ3A 2DCPA 3ASDA 1OWMA 3CSFA 3B7UX 2I1KA 3LYAA 2WPVA 4WWPA 1W3BA 3N71A 2E2EA 3CKBA 4K0RA 1N52A 4LRZA 5CCMA 3QWVA 4B8CB 4CT4A 5G05J 2J9QA 2WXFA 3KD7A 4N5CA 1HFAA 1QZ2A 4M3OA 4XI0A 4FU3A 4WNEA 5T3RA 4GZDA 3B7RL 2VQ2A 3FTVA 2I9CA 2OVFA 4BWRA 4KMOA 2FULA 4A3TA 1NP7A 5KJNA 4N3AA 2WQ7A 2J4DA 4U63A 4GZ6A 4UWFA 4AXHA 2BF0X 5FT9A 4MS6A 4RG9A 4CRWA 3R7QA 1PY1A 3CQCB 4I1MA 4KXKB 5FJYA 2X6KA 3CVXA 2V4LA 3ASFA 3ZIMA 4DPRA 2A5UA 2IFUA 3FTXA 2VSXE 3FTSA 4J8EA 2WXKA 1ZBPA 4JEHA 4APOA 4CDRA 3QJZA 3U4TA 3PH0C 4AP2A 4G2VA 5D0OD 4Y6CA 3BEEA 3R7RA 3LJ3A 3ZW3A 3D9IA 1PC2A 3SHFA 4DI4A 4PUCA 3JQ1A 3SGHA 2VYIA 1HXIA 5DIZA 2XGOA 4DLOA 1X5BA 3PREA 1JWGA 3VLDA 3HYMB 2HM8A 4URKA 3CKCA 2UY1A 3NQPA 4ILHB 3LVQE 4DI3A 3UT8A 5G05C 1HZ4A 2CG2A 3CVPA 3FEXA 4GMLA 4D10C 5BV0A 1UW4B 4C0EA 2PQNA 5BNWA 3O48A 2YHEA 3LCAA 5FZSA 4A1SA 4GZ3A 4NACA 4JHJA 1E8WA 3G2WA 2IQCA 3APFA 3IHVA 1IQUA 5D0QD 3G2UA 3ZHEB 2J07A 1UN8A 2LSUA 4FLBA 3RRUA 3ENEA 3EJNA 3FULA 3QWWA 1ELRA 2PL2A 4JHRA 4XI9A 5DBKA 2X6HA 4I6EA 4JL0A 2NXPA 4B89A 3CVQA 4OYSA 5JJTA 3G2TA 3P1UA 1N54A 3CVNA 4E6HA 1H2UA 4KT6B 1HE8A 3GZ2A 5T8IA 2J49A 4B8AA 3CVLA 4GAAA 2XEVA 3FFLA 3HHMA 4RG6A 2OOEA 1GW6A 2XQ0A 2VSNA 3FY4A 4B0ZA 1Z6TA 4PH4B 4YVQC 1JPLA 1ELWA 3URZA 4GA1A 4I2WA 1DVPA 5FWQA 3G2SA 4FC8A 1H2TC 3S2AA 1FVHA 4BTBA 4OVUA 3L13A 5KCMA 5EX0A 2CHXA 2BUGA 5CMWA 2MOWA 5CCLA 2CHZA 2YNQA 3TAXA 4LEUA 2V5FA 2YHCA 3QDNA 4WWNA 1HO8A 4W9RA 5E75A 3ONLA 4ME2A 2I1JA 2XHEA 3VLFA 4P29A 1NZNA 2XGMA 4HXIA 3NZSA 3CSTA 5BW8C 3PZDA 4WWOA 3O4ZA 4J8DA 3WXXA 3T5VA 3CVWA 3GYZA 4GCOA 3L16A 3EIJA 1Z3XA 3PEVB 4LUNU 1JWFA 4L1BA 4AVXA 4ATGA 5FQ6A 2FBNA 1E8XA 1H0AA 2X6JA 5BPPA 1NA3A 5JHAA 3RRMB 4FA6A 3ZXSA 3FTYA 4HOQA 1KT1A 2KCLA 3FUDA 3GZSA 3Q49B 4BT9A 4FADA 1ZU2A 1QQEA 2UWJG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FUL A;  2IOS A;  4C9B B;  1H6K A;  2HM8 A;  2ION A;  4JHK A;  5ANR A;  4B89 A;  1UG3 A;  1N54 A;  1HU3 A;  2I2O A;  2KZT A;  1H2U A;  4GMJ A;  2RG8 A;  3EIQ C;  3FEX A;  2IOL A;  3JUI A;  4GML A;  4CRW A;  1UW4 B;  3L6A A;  4B8A A;  2GGF A;  3D3M A;  2NSZ A;  2VSX E;  2IU1 A;  3EIJ A;  1PAQ A;  1N52 A;  4JHJ A;  3FEY A;  4LUN U;  4B8C B;  4CT4 A;  2ZU6 B;  4IUL A;  3RK6 A;  4CEM A;  1H2T C;  2VSO E;  2KZT B;  1H2V C; 
#chains in the Genus database with same CATH topology
 3C3R A;  4HLL A;  3UM2 A;  2H6I A;  2ZGD A;  2F8Y A;  2VTB B;  2JEK A;  2KZT A;  4H7X A;  3DRA A;  5A23 A;  1TNB A;  4JVS A;  1EF1 C;  4BES A;  4FHJ A;  4TXR A;  5HQ8 A;  5AJD A;  3CHS A;  3JXJ A;  3FUI A;  4JW1 A;  4ANW A;  1KPS B;  1TN8 A;  1YMP A;  3V31 A;  4JHK A;  3I3N A;  4CDN A;  5E76 A;  1MYO A;  3TG5 A;  4O1O A;  4BX8 A;  2XPI A;  3EU9 A;  3ML8 A;  1UN9 A;  3QNK A;  2XZD G;  4DUI A;  4BTA A;  4HI8 A;  4I9E A;  5HKP A;  3RSE G;  4XKC A;  3AU5 A;  1OUV A;  3AAA C;  5AQ7 A;  4IYP A;  4A55 A;  2XRY A;  3UI2 A;  2HYZ A;  4AY6 A;  1LTX A;  1OCZ E;  3V30 A;  2B6C A;  4DK5 A;  4I6G A;  4G11 A;  5B3S E;  4WUY A;  3LY8 A;  1E7V A;  3UIP C;  5C2Y A;  5LCW C;  4F3V A;  3IBE A;  3G2V A;  3B7B A;  2WXQ A;  3SY2 A;  4HS2 A;  3FU6 A;  3TL5 A;  1TYQ G;  3SFZ A;  4A3V A;  3CHM A;  2BKK B;  3D9O A;  1N0Q A;  2DZN A;  3WG7 E;  3AG3 E;  4HLE A;  4GYY A;  4TXQ A;  1N4Q A;  3FUJ A;  5KNH D;  1XNF A;  4HB5 A;  2GRR B;  4EZJ A;  3PEU B;  3UM0 A;  3SZ7 A;  4GTT A;  4U8V D;  5AQ9 A;  5A6C A;  3E37 A;  1TNY A;  1K3Z D;  3E4B A;  4RVB A;  3L22 A;  3Q75 A;  5JHB A;  2DVW A;  3HXE A;  3CGH A;  2KAT A;  3FUK A;  2R03 A;  4HBD A;  3TWU A;  3D9N A;  4UWH A;  2CFU A;  4YND A;  3HVE B;  2NYJ A;  4AEZ C;  5KJK A;  2AXV A;  4KBQ A;  3NF1 A;  4CGV A;  2EIN E;  4EQF A;  3QB2 A;  4AIF A;  3CK7 A;  1MJ0 A;  1N4R A;  4HRM B;  3SI5 A;  4HFG A;  2R05 A;  3LY9 A;  3ZEF A;  3FHE A;  5CMY A;  4DX1 A;  5D2M C;  2VTB A;  3ABM E;  1H19 A;  1UJK A;  1KLX A;  3ZN3 A;  4PS8 A;  5AEN A;  1OWL A;  3BQO A;  2GRL A;  3QAQ A;  5J90 A;  4BT8 A;  2XCB A;  4EHM A;  3OXF A;  4F53 A;  2ZIS A;  4KVM A;  2XRZ A;  4ATZ D;  4K03 A;  2WXJ A;  2XPY A;  2J8S D;  1NL4 A;  2AVP A;  3V2X A;  3KAE A;  3EIQ C;  5A7D B;  3VLE A;  4R7L A;  4F6R D;  4MRU A;  1HG2 A;  3SD5 A;  3B95 A;  2L6B A;  3C3Q A;  3FUE A;  3D9H A;  2R2L A;  2PM7 A;  3PE3 A;  5ENO D;  1E90 A;  5B1B E;  4U8Y D;  4KZ0 A;  3KEZ A;  2P2C P;  2OEW A;  3ML9 A;  4TRQ A;  2WXN A;  4GYO A;  3AG4 E;  5EDS A;  2CFZ A;  3AS5 A;  3V2O A;  4CZ2 D;  3OXL A;  3RJV A;  4ILI A;  2AW6 A;  5G04 C;  3UQ3 A;  3LYA A;  3CKB A;  1N52 A;  4LRZ A;  3HXB A;  4B8C B;  2FO1 E;  1QZ2 A;  4M3O A;  3EUV A;  4WNE A;  4GZD A;  5CED B;  2VQ2 A;  2OCC E;  3JXI A;  1SA4 A;  3HXF A;  4N3A A;  4GZ6 A;  5CRV A;  5FT9 A;  3NBN B;  5FJY A;  2DZO A;  3RAU A;  3R7R A;  1O1T A;  4PUC A;  1HXI A;  5DIZ A;  2XGO A;  3DEO A;  1X5B A;  3UIO C;  2HM8 A;  4URK A;  3DSV A;  1DCE A;  3NQP A;  4DI3 A;  3E30 A;  1TN6 A;  2CG2 A;  2PQN A;  4GZ3 A;  3SFX A;  4JHJ A;  3G2W A;  4JB8 P;  3DST A;  2LSU A;  3RRU A;  2HE0 A;  1ELR A;  2KXP C;  5DBK A;  1OXJ A;  5IY5 E;  5AQA A;  4E6H A;  1H2U A;  4KT6 B;  4GTO A;  3CVL A;  3AG1 E;  3TWV A;  3FY4 A;  1Z6T A;  1JPL A;  3G2S A;  5H7P A;  2RFA A;  4OVU A;  1NFI E;  4CYM D;  1HO8 A;  3PZ3 A;  4ME2 A;  2I1J A;  3VLF A;  4P29 A;  4HXI A;  3NB2 A;  1K1B A;  4DX7 D;  1BU9 A;  3EIJ A;  1O1S A;  2A5E A;  3PEV B;  1JWF A;  4L1B A;  4ATG A;  5FQ6 A;  1H0A A;  2X6J A;  3UKR G;  3FTY A;  4BT9 A;  3GZS A;  5KBA A;  1ZU2 A;  1QQE A;  5CEA A;  1YCS B;  2BKG A;  3SFY A;  1IXV A;  2M63 A;  4I2Z A;  3L6A A;  3PUK A;  2EIK E;  4UQX A;  3LDZ A;  2RFM A;  1FT2 A;  1S63 A;  4TUU A;  1JCS A;  3OXG A;  3PNL B;  3ZUV B;  3L17 A;  4KVO A;  3T9K A;  2C0M A;  2I2O A;  4YDE A;  2XZT G;  4DJA A;  4GA2 A;  4LCT A;  3CK9 A;  1UOH A;  1EDU A;  2V4H C;  2OND A;  4G8K A;  5B1A E;  3FP3 A;  5EIB E;  2WXM A;  2GW1 A;  4N39 A;  5LCW J;  3ASH A;  2QFC A;  4GTR A;  1N0R A;  4HVB A;  4PS3 A;  4YVO A;  2VGE A;  1TEZ A;  2WXL A;  3LVR E;  2H6H A;  1JCQ A;  4XEI G;  4WAF A;  4KYO B;  4ANV A;  4ANU A;  4Q96 A;  5FQ8 A;  3APC A;  2VSO E;  3RRN B;  4I43 A;  1H2V C;  5CRU A;  3BUA A;  4AJW A;  3D9M A;  2WMN A;  3HRA A;  4G25 A;  3Q73 A;  4GU5 A;  5T4Y A;  3D9J A;  4GPM A;  3GZ1 A;  2VGX B;  4UI9 C;  3UX4 A;  1SZA A;  5ENT D;  3AJI A;  3QKY A;  4UI9 K;  2Y4T A;  3S7F A;  2KC7 A;  4HOS A;  1OWP A;  1IYG A;  2JLB A;  1OWN A;  4YDO A;  2WVI A;  5M72 A;  3PE4 A;  4Q94 A;  5C1D A;  3NOG D;  4CT0 A;  3UTM A;  4WNF A;  5BV1 A;  4AM9 A;  5AJL A;  3JQ0 A;  5J08 A;  3DSU A;  4CDM A;  4C0M A;  2GRP B;  2B0O E;  2L0T B;  2FO7 A;  4OVV A;  1O5M A;  1DCQ A;  2GRQ B;  3D3M A;  3R9A B;  1SW6 A;  3ABK E;  3I4G A;  3J5Q B;  3ASO E;  4UWK A;  3U66 A;  4N2S A;  5ARG A;  3MV2 B;  4C9B B;  4GTS A;  1OT8 A;  4AV7 A;  5AAO A;  5ENQ D;  1HU3 A;  4AY5 A;  3KSQ A;  4CCA A;  4OAV B;  2DYS E;  5AIJ A;  4EPZ A;  3LS8 A;  3EHQ A;  4TV3 A;  2KCK A;  3CVY A;  2V8S E;  3VTY A;  3RO2 A;  5FQ4 A;  4I6J A;  3FDH A;  2WMO A;  3EDT B;  3EHN A;  3JCK C;  5KJM A;  3JYS A;  3TWT A;  1K8K G;  3Q7F A;  1SZ9 A;  3B7T A;  4XX5 A;  4BX9 A;  4GZ5 A;  4JPS A;  2P9P G;  3TG4 A;  3CEQ A;  1BD8 A;  4DRX E;  1V54 E;  3Q79 A;  3FTZ A;  1S70 B;  2C0L A;  3FU5 A;  2EQX A;  2QC9 A;  2VGY A;  3IKO B;  3ZNG A;  3QOU A;  4Y6W A;  2Y4U A;  4N5Q A;  4RLY A;  4U8H A;  2PQR A;  1DNP A;  5EKQ D;  1FVF A;  4UQY A;  4F7A A;  2P58 C;  1SQM A;  2EIJ E;  1SVX A;  3UPV A;  4FP7 A;  1V55 E;  5BUZ A;  2IEJ A;  4G23 A;  2R17 C;  3DXK G;  3S7B A;  2MRI A;  3HXC A;  5G04 J;  3DEP A;  3KS2 A;  3U64 A;  3J5P A;  3MKQ B;  3QC1 A;  1INZ A;  2DBA A;  2PM6 A;  4BET A;  5FZQ A;  4QQI A;  3ZHE A;  2ION A;  4A1G A;  3FH5 A;  4I1A A;  4UQZ A;  3Q9U C;  4B94 A;  1Y8M A;  2AXZ A;  4GYW A;  2X3M A;  1FCH A;  2NC9 A;  1JUQ A;  4CEM A;  2VGX A;  1HS6 A;  3ULQ A;  2QYJ A;  2AJA A;  5LOZ A;  5AYW D;  5ANR A;  4E85 A;  3UM3 A;  3CK8 A;  3MJW A;  2DCP A;  3ASD A;  3B7U X;  3QWV A;  3KD7 A;  4N5C A;  5T3R A;  4FU3 A;  3B7R L;  1SA5 A;  4BWR A;  4KMO A;  2ETA A;  4UWF A;  4AXH A;  4MS6 A;  4CRW A;  1PY1 A;  4KXK B;  2X6K A;  3ASF A;  4DPR A;  2IFU A;  3F6Q A;  3FTX A;  2VSX E;  3FTS A;  4J8E A;  2WXK A;  1ZBP A;  4JEH A;  3QJZ A;  3PH0 C;  4AP2 A;  2P9L G;  3ZW3 A;  1PC2 A;  3JQ1 A;  2VYI A;  1JWG A;  3PZ4 A;  3HYM B;  4DX6 D;  5G05 C;  3FEX A;  5FIO A;  1NI1 A;  3PZ2 A;  2YHE A;  3LCA A;  4A1S A;  2P9N G;  3IHV A;  1IQU A;  2J07 A;  1N95 A;  3NOC D;  2F37 A;  4B93 B;  2Y69 E;  4I6E A;  3ULE G;  3CVQ A;  3G2T A;  3P1U A;  4M7C A;  1D8D A;  3GZ2 A;  4B8A A;  1TR4 A;  4GAA A;  3FFL A;  1JCR A;  4RG6 A;  4B0Z A;  4PH4 B;  3EHR A;  5FWQ A;  3DWL G;  4LNU D;  1FVH A;  3L13 A;  4TUM A;  4Z68 A;  2BUG A;  3ULY A;  5CMW A;  2YNQ A;  3TAX A;  3KEA A;  1K1A A;  4HRL A;  3QDN A;  4WWN A;  5ITZ F;  2XGM A;  4J8Y A;  3NZS A;  3O4Z A;  3T5V A;  4LNB A;  2ZIR A;  4AVX A;  2LUH A;  2FBN A;  2XS8 A;  4FA6 A;  3IXE A;  3Q49 B;  2KCL A;  4FAD A;  5CER B;  3SHF A;  4IRU A;  3L54 A;  3TWR A;  3CHO A;  1L5J A;  3B13 A;  4CGW A;  2IOL A;  3UT4 A;  4JXT A;  2DWZ A;  4J6I A;  3IEG A;  1AP7 A;  2FEZ A;  2WM9 A;  2CG3 A;  3RK6 A;  4HQD A;  1YA0 A;  5JJ6 A;  2HO1 A;  1E96 B;  3V79 K;  4GPK A;  4MLP A;  2FI7 A;  4UUC A;  3FU0 A;  1WY6 A;  3FTU A;  3Q9N C;  2PNN A;  1U3D A;  2IF4 A;  3FH7 A;  2R02 A;  2XEH A;  3FEY A;  3NAW A;  3ZXP A;  2GRO B;  3AU4 A;  3MGB A;  4GA0 A;  4GZC A;  5KNG A;  2VJ8 A;  2GRM A;  4U0Z A;  4UI9 J;  1EYH A;  3AG2 E;  1E7U A;  1BI8 B;  3BG1 B;  4AOF A;  1FPP A;  3C98 A;  3ESK A;  3E34 A;  3PUJ A;  4FUL A;  2VSY A;  4JZY A;  3Q47 B;  2A4Z A;  4LNG A;  4N3B A;  3MA5 A;  2XEN A;  3HVE A;  1XGW A;  3UMV A;  4J8S A;  1U2V G;  1AWC B;  4APF A;  3T8M A;  5ENN A;  3PZ1 A;  2LNI A;  2BED A;  4HOU A;  4NUR A;  3Q15 A;  4HOT A;  1H6P A;  4WND A;  5ENS D;  4C48 B;  1HH8 A;  4GB9 A;  4FJY A;  4FHK A;  1KT0 A;  5AQB A;  3FU3 A;  3B7S A;  2DYR E;  4I17 A;  5EN5 D;  4GTV A;  1WM5 A;  4JA7 A;  4EZK A;  4L2L A;  2IO2 C;  3CHR A;  2J08 A;  3DBS A;  4V3I A;  2GGF A;  4GTQ A;  3LKU A;  1MZC A;  1Z5S C;  4J0U A;  4LER A;  4BEP A;  1Z3Y A;  3ZVV A;  2WXO A;  1S0P A;  5EX3 A;  3FUM A;  2Q7F A;  4Q69 A;  3PDN A;  3ZYM A;  3LPZ A;  3AS8 A;  3ZYQ A;  3KSL A;  3QAR A;  3I4R B;  4WNG A;  4IUL A;  2GRN B;  5JMN D;  3CV0 A;  3TWW A;  2WXI A;  3S7D A;  3SF4 A;  4UWG A;  2IJG X;  3HXD A;  5HRY A;  1H6O A;  2YIN A;  4RQI A;  2HR2 A;  2DIW A;  4MKT A;  3MEK A;  3D9P A;  4O6F A;  4U0S A;  3TWQ A;  1RW2 A;  3SBT B;  2XS1 A;  2L9B A;  2AWI A;  3TWX A;  3DPY A;  3IHY A;  5BT1 A;  5ARF A;  2OVB A;  3C3O A;  4LG6 A;  3ZGQ A;  4ABN A;  1MHQ A;  2KBX A;  1PAQ A;  4JA9 A;  4DX2 A;  3ZYL A;  4U7E B;  4U0U A;  4L9P A;  2WXG A;  3RU0 A;  2BTD A;  3JUI A;  1HF8 A;  4XZ4 A;  4K5C A;  1LD8 A;  4YDY A;  3FWV A;  3FTW A;  3R9M A;  3CHQ A;  4GTM A;  3IV0 A;  4JC8 A;  4PDX A;  3UXG A;  4EBA A;  2I6H A;  3NZU A;  4QFV A;  1NA0 A;  4LSZ E;  4G26 A;  2C2L A;  2OEV A;  5JJ7 A;  2L0I A;  2LAH A;  3I5P A;  1P5Q A;  3HIZ A;  3VTX A;  1N4S A;  2CHW A;  3MX3 A;  2J4B A;  3L82 A;  3FUF A;  3U3W A;  3FUN A;  3AS4 A;  5FQ7 A;  2YQ8 A;  4HOR A;  4F1S A;  1ZB1 A;  4HRN A;  5G2N A;  3CVU A;  2WXP A;  4K5B A;  3MV3 B;  2L6J A;  1TNU A;  2ZU6 B;  4BSX A;  3CLJ A;  4G1T A;  5KWD A;  1UJJ A;  2KCV A;  4IN3 B;  3MYV A;  1VDY A;  4EZL A;  3ZYK A;  1WDY A;  3Q78 A;  1RZ4 A;  3N71 A;  2E2E A;  5G05 J;  1TNO A;  2WXF A;  4O60 A;  4XI0 A;  1KZP A;  1IHB A;  2FUL A;  1Q2Z A;  4K5A B;  4A3T A;  1NP7 A;  3SQV A;  2WQ7 A;  2J4D A;  4RG9 A;  3CVX A;  4I1M A;  3ZIM A;  4GMR A;  1QBQ A;  4APO A;  4CDR A;  4NIK A;  1S64 A;  4G2V A;  5D0O D;  4Y6C A;  3SGH A;  4DLO A;  3PRE A;  3VLD A;  3CKC A;  4ZHB A;  4MBG A;  3UKU G;  3DSS A;  1HZ4 A;  3CVP A;  5BNW A;  3O48 A;  1TN7 A;  3EU5 A;  1E8W A;  3APF A;  3G2U A;  3L9T A;  3ENE A;  3EJN A;  2PL2 A;  4XI9 A;  1OCC E;  3UM1 A;  4JL0 A;  2NXP A;  4OYS A;  3CVN A;  2J49 A;  1GW6 A;  2VSN A;  4YVQ C;  1ELW A;  2JAB A;  4GA1 A;  2IO3 C;  3URZ A;  4I2W A;  1DVP A;  4FC8 A;  4BER A;  2MOW A;  2CHZ A;  4LEU A;  1OCO E;  1LD7 A;  4W9R A;  1NZN A;  3DSX A;  3CST A;  5BW8 C;  3PZD A;  3WXX A;  4J8D A;  3CVW A;  3LJN A;  3ZKJ A;  5BPP A;  1NA3 A;  3RRM B;  3ZXS A;  1KT1 A;  1MX2 A;  5LX8 A;  2UWJ G;  4GTP A;  3C5R A;  2F0Y A;  1HX8 A;  5JA4 D;  3Q5M A;  3Q4A B;  2Y0B G;  4L2Y A;  3ASN E;  2H6G A;  3T5X A;  1BLX B;  2WQH A;  3FUH A;  2P9I G;  3TXN A;  4I9C A;  3BG0 B;  4A63 B;  3TJP A;  4XIF A;  4U07 A;  4FLH A;  3X2Q E;  3FH8 A;  4O1P A;  4G24 A;  5HI7 A;  1E8Y A;  3ASG A;  4L23 A;  1IHG A;  5LFA A;  3E32 A;  3U9W A;  5EYL A;  4BY6 A;  1OY3 D;  3D9L A;  3ABL E;  3HG0 D;  5CHE E;  5BXO A;  1DC2 A;  4OAU C;  5FIN A;  5ANL A;  3PRZ A;  3MZL B;  3CIA A;  2R5S A;  4FJZ A;  3ISM C;  2XPZ A;  2P9S G;  2F8X K;  2WB2 A;  2XEE A;  2ETC A;  4GCN A;  3HDX A;  2QY7 A;  2LXM A;  2IY0 C;  4H7Y A;  1B89 A;  3PVL A;  1OCR E;  4XE0 A;  2FF4 A;  1FT1 A;  4DX5 D;  2EIL E;  3MKR A;  2X38 A;  3TGO A;  5ENP D;  1WAO 1;  3PS6 A;  2WQ6 A;  2LO6 A;  5FTP A;  2IU1 A;  3D9K A;  4ILG A;  1QNF A;  3UIN C;  3ESL A;  3PNT B;  3L08 A;  3QWP A;  1E8Z A;  4JEU A;  3OAW A;  3ZFW A;  1N11 A;  4N3C A;  5KJL A;  3MCX A;  2KM4 A;  3DPD A;  4KZC A;  3SBS A;  2Y3A A;  4J7W A;  3S7J A;  1LF8 A;  1MX4 A;  5LP0 A;  1Y6I A;  4L7T A;  5FZR A;  3CVV A;  3EHM A;  4ACK A;  1ELK A;  3W9G A;  2Y1L E;  5CEC B;  2UY1 B;  1N4P A;  1HG5 A;  4U95 D;  3MKQ A;  4TXP A;  4RSY A;  2ZXW E;  3K9I A;  4ANX A;  3TXM A;  2NSZ A;  4DLQ A;  3CHP A;  2MHK A;  3DSW A;  3QK0 A;  4NQ0 A;  3LEW A;  3Q7A A;  4J8F A;  2RG8 A;  2QZA A;  4BFR A;  1OWO A;  4YDW A;  1KZO A;  3UUX A;  3OTN A;  1MX6 A;  2XCC A;  2IOS A;  1H6K A;  4HNA D;  1TJC A;  3RO3 A;  3ONK A;  3APD A;  5EIL A;  5ENR D;  4PS7 A;  4NRH B;  3CQG B;  2KZT B;  2V0P A;  4XKB A;  1A17 A;  1IQR A;  3C72 A;  4I1O B;  1WG0 A;  1O1R A;  3UT7 A;  4U04 A;  2XGS A;  3LY7 A;  5EYP F;  3GW4 A;  4G8L A;  3W9F A;  3CR3 A;  4EBA G;  2J09 A;  5AAR A;  2OV8 A;  2PZI A;  2X6F A;  4UWL A;  3DXM G;  1U3C A;  2AXU A;  2WXH A;  4JD2 G;  1YYH A;  1TJF A;  1UG3 A;  3SNX A;  4N2Q A;  2RD0 A;  3ZRH A;  4ACL A;  1MQS A;  2LSV A;  2LAI A;  2ZGG A;  3ZPJ A;  4F1P A;  2MYO A;  2X6I A;  3E33 A;  5BXU A;  1TNZ A;  1IKN D;  5G55 A;  1BI7 B;  4EEC A;  3LXU X;  1D9S A;  5CBN A;  2E0I A;  1EPU A;  2P9K G;  3BU8 A;  2WXR A;  2ILR A;  3RIB A;  1BPO A;  3P2B A;  1X81 A;  3RKV A;  4GMJ A;  2R59 A;  4ZFH A;  2P9U G;  1OWM A;  3CSF A;  2I1K A;  2WPV A;  4WWP A;  1A5E A;  2V5Q C;  1W3B A;  4K0R A;  2QYU A;  5AN8 A;  3TWS A;  5CCM A;  4CT4 A;  2J9Q A;  1HFA A;  1D8E A;  3FTV A;  2I9C A;  4U96 D;  5EID A;  2OVF A;  5KJN A;  4U63 A;  2BF0 X;  3R7Q A;  3CQC B;  2V4L A;  2A5U A;  4X8Q A;  3U4T A;  3BEE A;  2RKK A;  3LJ3 A;  3ZU7 B;  3D9I A;  4DI4 A;  2UY1 A;  3JUE A;  4ILH B;  3LVQ E;  3UT8 A;  2LXL A;  4D10 C;  4GML A;  5BV0 A;  5CBO A;  1UW4 B;  4C0E A;  5HS0 A;  5FZS A;  4NAC A;  2IQC A;  5D0Q D;  3ZHE B;  1UN8 A;  2EIM E;  4BSZ B;  4FLB A;  3FUL A;  3QWW A;  4JHR A;  2X6H A;  4HI9 A;  3SO8 A;  4B89 A;  2H6F A;  5JJT A;  1N94 A;  1N54 A;  1HE8 A;  1G3N B;  5T8I A;  3T8K A;  2XEV A;  3HHM A;  2OOE A;  2XQ0 A;  1QYM A;  1H2T C;  3S2A A;  4BTB A;  5KCM A;  5EX0 A;  2CHX A;  5CCL A;  2V5F A;  2YHC A;  5D66 A;  2ETB A;  5E75 A;  3ONL A;  2XHE A;  4WWO A;  1N9A A;  3GYZ A;  4GCO A;  3L16 A;  1Z3X A;  4LUN U;  1E8X A;  5JHA A;  4HOQ A;  3FUD A; 
#chains in the Genus database with same CATH homology
 4IRU A;  3L54 A;  2VTB B;  3CHO A;  1L5J A;  2JEK A;  2KZT A;  1HX8 A;  3B13 A;  4CGW A;  4H7X A;  2IOL A;  2M63 A;  3Q4A B;  3Q5M A;  4I2Z A;  3L6A A;  3UT4 A;  4JXT A;  4L2Y A;  4J6I A;  5A23 A;  3IEG A;  3PUK A;  3T5X A;  2FEZ A;  2WM9 A;  2WQH A;  4UQX A;  3FUH A;  3LDZ A;  4JVS A;  1EF1 C;  2CG3 A;  3RK6 A;  4FHJ A;  1YA0 A;  5JJ6 A;  2HO1 A;  3TXN A;  4TUU A;  1E96 B;  3OXG A;  5HQ8 A;  5AJD A;  3CHS A;  3PNL B;  3FUI A;  4GPK A;  4JW1 A;  4ANW A;  4I9C A;  3BG0 B;  4JHK A;  4MLP A;  3I3N A;  3L17 A;  4CDN A;  4KVO A;  2C0M A;  2FI7 A;  5E76 A;  2I2O A;  3TG5 A;  3TJP A;  4DJA A;  3FU0 A;  4GA2 A;  4LCT A;  1WY6 A;  3CK9 A;  2XPI A;  3FTU A;  4BX8 A;  4XIF A;  1U3D A;  1EDU A;  3ML8 A;  4U07 A;  4FLH A;  2IF4 A;  2OND A;  1UN9 A;  3FH7 A;  3FH8 A;  4G24 A;  5HI7 A;  3FEY A;  3FP3 A;  3QNK A;  3AU4 A;  1E8Y A;  2GW1 A;  2WXM A;  3MGB A;  4I9E A;  4BTA A;  3ASG A;  4N39 A;  5LCW J;  3ASH A;  4GA0 A;  2QFC A;  4GZC A;  4L23 A;  4XKC A;  1IHG A;  2VJ8 A;  2GRM A;  4U0Z A;  4UI9 J;  1EYH A;  1E7U A;  5LFA A;  3BG1 B;  3AU5 A;  1OUV A;  4HVB A;  4AOF A;  3C98 A;  3ESK A;  4PS3 A;  4YVO A;  3U9W A;  4BY6 A;  4IYP A;  1TEZ A;  2WXL A;  3LVR E;  4A55 A;  2XRY A;  3PUJ A;  3D9L A;  2HYZ A;  4FUL A;  5CHE E;  2VSY A;  4JZY A;  4AY6 A;  3Q47 B;  2A4Z A;  4WAF A;  4KYO B;  5ANL A;  3PRZ A;  3MZL B;  4N3B A;  4ANV A;  3MA5 A;  3CIA A;  4Q96 A;  5FQ8 A;  4ANU A;  2R5S A;  4DK5 A;  3APC A;  2VSO E;  3HVE A;  3RRN B;  4I6G A;  1XGW A;  3UMV A;  4I43 A;  4G11 A;  4J8S A;  4WUY A;  4FJZ A;  1H2V C;  4APF A;  4AJW A;  3T8M A;  3D9M A;  5ENN A;  2WMN A;  2XPZ A;  2LNI A;  4HOU A;  3LY8 A;  2WB2 A;  1E7V A;  4NUR A;  3Q15 A;  4G25 A;  4GU5 A;  5T4Y A;  3D9J A;  5C2Y A;  5LCW C;  4HOT A;  4WND A;  4F3V A;  3GZ1 A;  1HH8 A;  2VGX B;  3IBE A;  4UI9 C;  3G2V A;  3UX4 A;  4GCN A;  2WXQ A;  1SZA A;  3HDX A;  2QY7 A;  3FU6 A;  4HS2 A;  3QKY A;  3TL5 A;  4H7Y A;  1B89 A;  4GB9 A;  3PVL A;  3SFZ A;  4UI9 K;  4A3V A;  3CHM A;  4FJY A;  2Y4T A;  4FHK A;  1KT0 A;  3FU3 A;  4XE0 A;  3B7S A;  3D9O A;  4I17 A;  3S7F A;  2KC7 A;  4HOS A;  2FF4 A;  1OWP A;  1IYG A;  1WM5 A;  4JA7 A;  4HLE A;  2JLB A;  3MKR A;  1OWN A;  4L2L A;  4EZK A;  3CHR A;  2J08 A;  4GYY A;  2WVI A;  2X38 A;  3TGO A;  3DBS A;  5M72 A;  1WAO 1;  3FUJ A;  3PS6 A;  3PE4 A;  2GGF A;  4V3I A;  2WQ6 A;  3LKU A;  4Q94 A;  2LO6 A;  1XNF A;  5FTP A;  4J0U A;  2IU1 A;  3D9K A;  4ILG A;  4LER A;  1QNF A;  5C1D A;  1Z3Y A;  4CT0 A;  4WNF A;  3PEU B;  4EZJ A;  3ZVV A;  3ESL A;  3PNT B;  5BV1 A;  2WXO A;  3L08 A;  1S0P A;  4AM9 A;  5AJL A;  3JQ0 A;  3QWP A;  5EX3 A;  1E8Z A;  3FUM A;  4JEU A;  3SZ7 A;  5J08 A;  5A6C A;  4CDM A;  3OAW A;  3ZFW A;  4C0M A;  2Q7F A;  3E4B A;  4N3C A;  5KJL A;  3MCX A;  2L0T B;  2KM4 A;  2FO7 A;  3DPD A;  4KZC A;  4OVV A;  4Q69 A;  4RVB A;  3L22 A;  3PDN A;  3SBS A;  2Y3A A;  3S7J A;  3ZYM A;  1LF8 A;  3LPZ A;  3AS8 A;  3D3M A;  3R9A B;  3ZYQ A;  3I4G A;  5JHB A;  5LP0 A;  1Y6I A;  4L7T A;  5FZR A;  3CVV A;  3QAR A;  4UWK A;  3EHM A;  3I4R B;  4WNG A;  4ACK A;  1ELK A;  4IUL A;  3CGH A;  2KAT A;  2UY1 B;  3FUK A;  3CV0 A;  3U66 A;  2WXI A;  1HG5 A;  4N2S A;  5ARG A;  3D9N A;  3S7D A;  3SF4 A;  3MV2 B;  4C9B B;  4UWG A;  2IJG X;  3MKQ A;  4RSY A;  2YIN A;  4UWH A;  4AV7 A;  1HU3 A;  2HR2 A;  3K9I A;  4AY5 A;  2DIW A;  4MKT A;  3MEK A;  4CCA A;  5AIJ A;  3D9P A;  4EPZ A;  4ANX A;  2CFU A;  4O6F A;  4U0S A;  3TXM A;  4YND A;  2NSZ A;  3HVE B;  3SBT B;  3LS8 A;  4DLQ A;  3CHP A;  4AEZ C;  2L9B A;  2AWI A;  2MHK A;  5KJK A;  2AXV A;  4KBQ A;  2KCK A;  4TV3 A;  3NF1 A;  3QK0 A;  4NQ0 A;  2V8S E;  4CGV A;  3CVY A;  4EQF A;  3QB2 A;  4AIF A;  3LEW A;  3VTY A;  3CK7 A;  3RO2 A;  3IHY A;  5FQ4 A;  5BT1 A;  4I6J A;  3SI5 A;  3FDH A;  4HFG A;  2WMO A;  3EDT B;  3EHN A;  3JCK C;  5KJM A;  3JYS A;  4J8F A;  5ARF A;  2RG8 A;  1SZ9 A;  2OVB A;  3B7T A;  4XX5 A;  3LY9 A;  3ZGQ A;  3ZEF A;  1MHQ A;  3FHE A;  4ABN A;  4BX9 A;  4BFR A;  1OWO A;  5CMY A;  2VTB A;  4GZ5 A;  1PAQ A;  4JPS A;  3TG4 A;  1H19 A;  3CEQ A;  1UJK A;  4JA9 A;  1KLX A;  3ZN3 A;  4PS8 A;  3ZYL A;  5AEN A;  3UUX A;  3OTN A;  4U0U A;  3FTZ A;  2C0L A;  2XCC A;  2IOS A;  1H6K A;  1TJC A;  3FU5 A;  2EQX A;  1OWL A;  2WXG A;  2VGY A;  3IKO B;  3RU0 A;  2BTD A;  3RO3 A;  3ONK A;  2GRL A;  3QAQ A;  3JUI A;  3APD A;  5J90 A;  3QOU A;  4PS7 A;  4BT8 A;  2XCB A;  4NRH B;  3CQG B;  3OXF A;  4Y6W A;  2Y4U A;  1HF8 A;  4XZ4 A;  4F53 A;  3FWV A;  3FTW A;  4U8H A;  4KVM A;  2PQR A;  3CHQ A;  1DNP A;  2XRZ A;  5EKQ D;  1FVF A;  3IV0 A;  4K03 A;  2WXJ A;  4UQY A;  4F7A A;  4JC8 A;  2KZT B;  2V0P A;  2XPY A;  4PDX A;  2P58 C;  4EBA A;  4XKB A;  1SQM A;  2I6H A;  1A17 A;  2AVP A;  1IQR A;  3UPV A;  3NZU A;  4I1O B;  4QFV A;  1NA0 A;  3KAE A;  3EIQ C;  4FP7 A;  4G26 A;  3UT7 A;  5LX8 A;  2C2L A;  4U04 A;  5BUZ A;  5A7D B;  5JJ7 A;  2XGS A;  3VLE A;  2L0I A;  2LAH A;  3LY7 A;  4G23 A;  3I5P A;  3GW4 A;  4R7L A;  2R17 C;  1P5Q A;  3HIZ A;  3VTX A;  3S7B A;  2MRI A;  4MRU A;  1HG2 A;  3KS2 A;  5G04 J;  2CHW A;  3CR3 A;  3SD5 A;  3U64 A;  3MX3 A;  3MKQ B;  4EBA G;  2J09 A;  2J4B A;  3FUE A;  3QC1 A;  1INZ A;  2OV8 A;  2PZI A;  2DBA A;  2X6F A;  2PM6 A;  1U3C A;  4UWL A;  2AXU A;  3FUF A;  2PM7 A;  2WXH A;  3PE3 A;  5FZQ A;  3U3W A;  3FUN A;  3ZHE A;  2ION A;  1TJF A;  4A1G A;  1E90 A;  1UG3 A;  4KZ0 A;  3SNX A;  4N2Q A;  3FH5 A;  3AS4 A;  3KEZ A;  2RD0 A;  5FQ7 A;  2YQ8 A;  4I1A A;  3ZRH A;  1MQS A;  2LSV A;  4ACL A;  4F1S A;  4HOR A;  2LAI A;  3ZPJ A;  4UQZ A;  4B94 A;  1Y8M A;  2AXZ A;  5G2N A;  2X6I A;  3ML9 A;  4GYW A;  3CVU A;  2WXP A;  3MV3 B;  4TRQ A;  2L6J A;  2WXN A;  2X3M A;  2ZU6 B;  4GYO A;  1FCH A;  5G55 A;  2NC9 A;  4BSX A;  5EDS A;  1JUQ A;  4CEM A;  2VGX A;  4EEC A;  2CFZ A;  3AS5 A;  1HS6 A;  3LXU X;  3ULQ A;  2E0I A;  1EPU A;  3CLJ A;  4G1T A;  2WXR A;  1UJJ A;  2ILR A;  2KCV A;  3RIB A;  4IN3 B;  1BPO A;  5LOZ A;  3MYV A;  3OXL A;  3P2B A;  3RJV A;  5AYW D;  5ANR A;  1VDY A;  3RKV A;  4E85 A;  4EZL A;  4ILI A;  2AW6 A;  3ZYK A;  3CK8 A;  3MJW A;  5G04 C;  4GMJ A;  2R59 A;  3UQ3 A;  2DCP A;  3ASD A;  1OWM A;  3CSF A;  3B7U X;  2I1K A;  3LYA A;  2WPV A;  4WWP A;  1W3B A;  3N71 A;  2E2E A;  3CKB A;  4K0R A;  1N52 A;  4LRZ A;  5CCM A;  3QWV A;  4B8C B;  4CT4 A;  5G05 J;  2J9Q A;  2WXF A;  3KD7 A;  4N5C A;  1HFA A;  1QZ2 A;  4M3O A;  4XI0 A;  4FU3 A;  4WNE A;  5T3R A;  4GZD A;  3B7R L;  2VQ2 A;  3FTV A;  2I9C A;  2OVF A;  4BWR A;  4KMO A;  2FUL A;  4A3T A;  1NP7 A;  5KJN A;  4N3A A;  2WQ7 A;  2J4D A;  4U63 A;  4GZ6 A;  4UWF A;  4AXH A;  2BF0 X;  5FT9 A;  4MS6 A;  4RG9 A;  4CRW A;  3R7Q A;  1PY1 A;  3CQC B;  4I1M A;  4KXK B;  5FJY A;  2X6K A;  3CVX A;  2V4L A;  3ASF A;  3ZIM A;  4DPR A;  2A5U A;  2IFU A;  3FTX A;  2VSX E;  3FTS A;  4J8E A;  2WXK A;  1ZBP A;  4JEH A;  4APO A;  4CDR A;  3QJZ A;  3U4T A;  3PH0 C;  4AP2 A;  4G2V A;  5D0O D;  4Y6C A;  3BEE A;  3R7R A;  3LJ3 A;  3ZW3 A;  3D9I A;  1PC2 A;  3SHF A;  4DI4 A;  4PUC A;  3JQ1 A;  3SGH A;  2VYI A;  1HXI A;  5DIZ A;  2XGO A;  4DLO A;  1X5B A;  3PRE A;  1JWG A;  3VLD A;  3HYM B;  2HM8 A;  4URK A;  3CKC A;  2UY1 A;  3NQP A;  4ILH B;  3LVQ E;  4DI3 A;  3UT8 A;  5G05 C;  1HZ4 A;  2CG2 A;  3CVP A;  3FEX A;  4GML A;  4D10 C;  5BV0 A;  1UW4 B;  4C0E A;  2PQN A;  5BNW A;  3O48 A;  2YHE A;  3LCA A;  5FZS A;  4A1S A;  4GZ3 A;  4NAC A;  4JHJ A;  1E8W A;  3G2W A;  2IQC A;  3APF A;  3IHV A;  1IQU A;  5D0Q D;  3G2U A;  3ZHE B;  2J07 A;  1UN8 A;  2LSU A;  4FLB A;  3RRU A;  3ENE A;  3EJN A;  3FUL A;  3QWW A;  1ELR A;  2PL2 A;  4JHR A;  4XI9 A;  5DBK A;  2X6H A;  4I6E A;  4JL0 A;  2NXP A;  4B89 A;  3CVQ A;  4OYS A;  5JJT A;  3G2T A;  3P1U A;  1N54 A;  3CVN A;  4E6H A;  1H2U A;  4KT6 B;  1HE8 A;  3GZ2 A;  5T8I A;  2J49 A;  4B8A A;  3CVL A;  4GAA A;  2XEV A;  3FFL A;  3HHM A;  4RG6 A;  2OOE A;  1GW6 A;  2XQ0 A;  2VSN A;  3FY4 A;  4B0Z A;  1Z6T A;  4PH4 B;  4YVQ C;  1JPL A;  1ELW A;  3URZ A;  4GA1 A;  4I2W A;  1DVP A;  5FWQ A;  3G2S A;  4FC8 A;  1H2T C;  3S2A A;  1FVH A;  4BTB A;  4OVU A;  3L13 A;  5KCM A;  5EX0 A;  2CHX A;  2BUG A;  5CMW A;  2MOW A;  5CCL A;  2CHZ A;  2YNQ A;  3TAX A;  4LEU A;  2V5F A;  2YHC A;  3QDN A;  4WWN A;  1HO8 A;  4W9R A;  5E75 A;  3ONL A;  4ME2 A;  2I1J A;  2XHE A;  3VLF A;  4P29 A;  1NZN A;  2XGM A;  4HXI A;  3NZS A;  3CST A;  5BW8 C;  3PZD A;  4WWO A;  3O4Z A;  4J8D A;  3WXX A;  3T5V A;  3CVW A;  3GYZ A;  4GCO A;  3L16 A;  3EIJ A;  1Z3X A;  3PEV B;  4LUN U;  1JWF A;  4L1B A;  4AVX A;  4ATG A;  5FQ6 A;  2FBN A;  1E8X A;  1H0A A;  2X6J A;  5BPP A;  1NA3 A;  5JHA A;  3RRM B;  4FA6 A;  3ZXS A;  3FTY A;  4HOQ A;  1KT1 A;  2KCL A;  3FUD A;  3GZS A;  3Q49 B;  4BT9 A;  4FAD A;  1ZU2 A;  1QQE A;  2UWJ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...