2DIWA

Solution structure of the rpr domain of putative rna-binding protein 16
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
152
Chain Sequence
GSSGSSGDNMEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RPR domain of Putative RNA-binding protein 16
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords Putative RNA-binding protein 16
total genus 37
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2diwA01
3ONLA 2MOWA 3LDZA 3D9MA 1SZ9A 3RRUA 1H0AA 4Q96A 4NACA 2LO6A 1INZA 5LOZA 1PY1A 2BF0X 5LP0A 4JXTA 1EDUA 3D9PA 3ZYMA 2DCPA 1JWGA 2KM4A 4AVXA 1HX8A 3G2SA 1SZAA 1UJJA 3G2VA 3G2TA 1JUQA 1HG2A 4FLBA 1EYHA 3G2UA 3G2WA 2V8SE 3ONKA 1HG5A 1VDYA 3D9NA 1DVPA 1JWFA 4GZCA 4FU3A 4HFGA 3D9KA 3D9LA 1HF8A 1X5BA 3ZYKA 3ZYLA 2QY7A 5CMWA 2L0TB 3D9IA 3D9OA 1HFAA 1MHQA 2L0IA 4Q94A 2DIWA 5CMYA 3ZYQA 3D9JA 5J08A 1JPLA 1LF8A 1ELKA 4GZDA 1XGWA 1UJKA 3CLJA
chains in the Genus database with same CATH superfamily
3ASGA 1PC2A 3FU6A 4JD2G 1KT0A 3KEZA 5ENSD 2V5FA 3HHMA 3KSLA 2IONA 4FLHA 3AG1E 3T8KA 3NQPA 4YVQC 3MCXA 5BV1A 4RQIA 4I2ZA 3ASDA 3EIJA 1E7UA 5ANRA 3OAWA 4HVBA 4XIFA 3S2AA 2MHKA 5G2NA 4UI9J 2IEJA 4HOTA 2J49A 3CVLA 3ASOE 4DRXE 2FF4A 1OT8A 2MOWA 4EBAA 3O4ZA 5KNGA 1E8YA 3FUIA 2HM8A 2DVWA 3VLEA 3SHFA 3JXJA 3ZXPA 4UWGA 3FUJA 3D9IA 3CQGB 4DPRA 2R17C 2QC9A 1FVFA 2CHZA 1TN6A 3MKQA 3FUFA 3AG3E 1OY3D 3ESKA 2DZOA 1N52A 3KS2A 5FQ8A 1SW6A 4WUYA 5EYLA 3B13A 3NZUA 1RZ4A 3ZVVA 1N95A 3ZUVB 3DEOA 2VGXB 1Z3YA 3RSEG 5EIBE 1SZAA 4I2WA 5KJNA 2IY0C 2VSXE 3TGOA 3U66A 2XQ0A 4KBQA 4GTSA 1XGWA 3D9MA 4DX1A 5AQ7A 4HRLA 4DX7D 3CK8A 3PRZA 3FEXA 1UG3A 5DIZA 2XPZA 4A55A 4O1PA 4HS2A 2M63A 1H2UA 3TG4A 4FA6A 3D9KA 4C9BB 4JHRA 5M72A 1MJ0A 1WAO1 3L82A 3PNTB 4DLOA 1K1BA 4RG6A 2ZGDA 3UT7A 5T3RA 1X5BA 3ZN3A 4CCAA 3CLJA 5LCWJ 3LJ3A 4GYWA 3B95A 2BKKB 5ENRD 2HE0A 3UIPC 4G11A 1UJJA 1AP7A 1UN9A 3D9NA 4FHJA 2WQ6A 3AAAC 2QFCA 2A5EA 4J8FA 1E96B 3C72A 4LCTA 1TNYA 4U96D 4AOFA 3DSWA 1IQUA 4G26A 3KD7A 3Q79A 3AG2E 4IULA 2WXLA 3JQ0A 3L54A 4NQ0A 3TL5A 1OWNA 2GGFA 4LEUA 2YQ8A 2V0PA 5E76A 2B0OE 3UM0A 4JA9A 3ABME 4MKTA 4I6GA 4BEPA 3ESLA 2X6JA 3ULQA 1N94A 1BLXB 2DWZA 1MQSA 5EILA 3JYSA 2L6BA 3PEVB 1MX2A 4ATGA 2X38A 4GA2A 4ANVA 1HZ4A 2VGYA 2VGEA 1Z6TA 4HQDA 4B8AA 3D9OA 4EPZA 5D66A 4LNGA 3ML9A 3EHMA 2PQNA 1K3ZD 3QNKA 3RO3A 1HS6A 1QZ2A 4U0UA 2AXZA 3PZDA 3R7QA 2FO7A 3BUAA 3P2BA 3J5QB 4Q96A 3MKRA 3ASFA 4EZJA 4I1AA 1OWMA 5D0QD 3KEAA 3CHMA 3T9KA 2EIJE 3MEKA 2V4LA 3JXIA 5FQ4A 2C2LA 2ZISA 4I6EA 4BERA 4KT6B 2RD0A 1KLXA 2XGSA 3G2UA 3DSVA 2F0YA 5JJTA 3LCAA 1HU3A 3FUEA 2XEVA 2LAIA 4UI9C 2NSZA 2MYOA 5FIOA 3EDTB 3IBEA 3TAXA 3U64A 1K1AA 1H2TC 3C3OA 1NP7A 1E8XA 4MBGA 3LY7A 3ULYA 2VTBB 4URKA 3CVXA 1O1SA 3R7RA 4JPSA 4CEMA 1JCSA 5AENA 5EN5D 2BUGA 4TUUA 5ARGA 4TXQA 4GMLA 2H6IA 1HH8A 3N71A 1IXVA 3QK0A 2WQHA 4HB5A 4UWHA 1MX6A 2Y1LE 4U7EB 3JQ1A 3BEEA 1HXIA 3IEGA 4GA1A 4IN3B 4KZCA 3LJNA 3B7BA 1H6PA 5E75A 1DCEA 4N3AA 3C3QA 4D10C 2CHXA 4L2LA 4GTPA 2WMNA 4CDRA 3MV3B 3FH5A 4IYPA 2ZIRA 2WXRA 4AVXA 2UWJG 1JUQA 4NRHB 4MRUA 4CRWA 4RG9A 3BQOA 4BWRA 1KPSB 1Z5SC 2FI7A 2GROB 2L6JA 2Y3AA 4FJZA 2LUHA 4QFVA 5HKPA 2P9LG 3OTNA 2HYZA 4XI0A 3JUEA 5A7DB 2QY7A 2OV8A 3DXKG 4MS6A 5ANLA 1MHQA 3Q9UC 1LF8A 3GZ1A 4L23A 3MYVA 1SQMA 4XI9A 2WXOA 3S7BA 2WVIA 4LSZE 3ULEG 3FTXA 3P1UA 3CVPA 2WM9A 2IQCA 3CV0A 1VDYA 3BU8A 2DIWA 1WDYA 1E90A 5KJLA 1TNUA 3ONLA 4TXPA 4RVBA 5ENQD 2CG2A 3I4GA 2J09A 1TNOA 3UM1A 3LPZA 3MX3A 2XGOA 2WB2A 4GZCA 4FU3A 4GCNA 1H6KA 1HF8A 3NBNB 2WXGA 4DUIA 1OWOA 4H7XA 3TWUA 4G25A 3T5VA 2PQRA 4JL0A 2DYSE 3VTXA 4HXIA 2PM7A 3LYAA 2ONDA 2Y4TA 4KMOA 3IHYA 1N4PA 5CEDB 3FH7A 3PUJA 1XNFA 4YDOA 5CBOA 2V5QC 2KCVA 2WXMA 2P58C 3FU3A 3DSXA 2Q7FA 2IU1A 5B1AE 2VGXA 3G2SA 4UWFA 1S64A 3G2VA 3U3WA 2GRPB 5FTPA 3TG5A 4BTBA 4G23A 4WWPA 4L1BA 5JJ7A 2R5SA 5BT1A 1QYMA 4E6HA 2EIME 4XX5A 3FTSA 3Q7FA 3RO2A 3ZYLA 1N0RA 4GZDA 3UMVA 3HXDA 1SA4A 3JUIA 3C3RA 1H0AA 5FZQA 1NA3A 3SFXA 3UQ3A 2KATA 1OCZE 3TXNA 1ELRA 2JABA 4L7TA 4TUMA 4X8QA 1N4QA 1EF1C 2IOLA 3CHOA 1E7VA 2YHEA 4WNGA 4YDEA 1OWPA 3TWRA 3QOUA 5CCMA 4XEIG 2XGMA 5KJMA 5EDSA 4HOSA 3ABKE 4F6RD 1L5JA 4AV7A 2J9QA 4ANWA 2AWIA 3UXGA 4AIFA 1X81A 2DZNA 4UQXA 1ZBPA 2VYIA 2H6FA 5JHAA 3CGHA 4BSXA 5FINA 4ILIA 5AJLA 4J0UA 3GW4A 1SVXA 3FY4A 2KBXA 2R59A 1QNFA 1TN8A 4YDYA 3D9HA 2EIKE 3MGBA 4EZLA 3EHRA 4E85A 1RW2A 3URZA 4HLLA 5CECB 3D3MA 3LDZA 1ZU2A 1TEZA 4PS3A 3S7FA 2LXMA 3HVEB 4BX8A 3B7TA 4R7LA 3V2OA 4KYOB 2NXPA 1N11A 1D8DA 2OVBA 4UQZA 5ENTD 1MZCA 4GTRA 4Z68A 2XZTG 4GAAA 1H2VC 4L2YA 2RG8A 2KM4A 2F8YA 4ILHB 2WXPA 4UUCA 3D9LA 3PNLB 2OOEA 1PAQA 2LSUA 5HI7A 5H7PA 3SO8A 3TWSA 2FBNA 1TNZA 3RRMB 4TV3A 3V79K 2AXVA 3GZSA 4JA7A 4B0ZA 1OCRE 4ME2A 3FTYA 4UQYA 1JCRA 2R03A 4AM9A 3L17A 3QWPA 2VSYA 3UM2A 3UT4A 1NI1A 3HXBA 4HOQA 1D9SA 5ENPD 1IHGA 4DI4A 3QDNA 2OCCE 5KWDA 3DXMG 4AEZC 4JVSA 3G2TA 3DWLG 4A3TA 3ZKJA 5KCMA 2IJGX 5FZRA 4JZYA 1OXJA 4I17A 2CHWA 4DX5D 2XZDG 3FP3A 4CDNA 3EUVA 5D0OD 2BF0X 5AN8A 2IF4A 4LNUD 1Y8MA 4YVOA 3APCA 3LKUA 3S7DA 2NYJA 4I9CA 4P29A 1ZB1A 2IO2C 1BI7B 1S0PA 4A3VA 2J4BA 3AU5A 3ENEA 4GA0A 5A23A 3I5PA 1LD7A 4HLEA 3Q78A 4H7YA 2E0IA 2DBAA 3DRAA 3L9TA 3WG7E 4GB9A 3FFLA 1D8EA 4GPMA 5D2MC 2GRLA 2X6HA 3WXXA 5FWQA 4B93B 4EBAG 3DSUA 2XRZA 4Y6WA 1KZOA 4JW1A 2EINE 4G8LA 3SFZA 4TXRA 2ETCA 5AARA 2Y4UA 4GU5A 1O1RA 5LP0A 3D9PA 4CGWA 2QYUA 4UWLA 4GTTA 4UWKA 4EECA 3E34A 2AW6A 4ATZD 3PS6A 4IRUA 3LY9A 3Q73A 2X3MA 4ACLA 4APOA 2IOSA 5AJDA 2R05A 3ASNE 5AQBA 2GRQB 2P2CP 4GYOA 2WXQA 2I2OA 4K5CA 3CIAA 1SA5A 3ZYQA 5J08A 5CMYA 4U0SA 3MZLB 2WMOA 3DPDA 2EQXA 5LX8A 3CVQA 5JJ6A 2C0LA 2BKGA 4QQIA 2DYRE 2VSOE 5LFAA 4FADA 1IYGA 3HIZA 3C5RA 3PZ2A 3LY8A 3QJZA 2QZAA 3MV2B 4WNEA 5ITZF 3L6AA 4U8VD 5CMWA 3SZ7A 4AP2A 5J90A 4J8YA 4G8KA 1BI8B 3FEYA 4J8SA 4KVOA 2VTBA 5B1BE 4F1SA 2I9CA 2GW1A 3TJPA 3CHSA 3B7UX 4KXKB 3DPYA 1UJKA 5G04J 5AYWD 5C1DA 5LOZA 2P9PG 4F7AA 3QKYA 5CRVA 1A5EA 4N5CA 2XCCA 1Y6IA 3RIBA 3AS8A 4JB8P 3NF1A 3RKVA 4U04A 4KZ0A 1KT1A 2F8XK 2ETAA 5AAOA 5BPPA 2AXUA 3R9MA 4OYSA 1IQRA 3SY2A 4AXHA 2BEDA 2FEZA 3EU9A 5EX0A 3J5PA 3LVQE 3L13A 4OVVA 3NZSA 4NACA 4GPKA 4DI3A 4GTQA 1DCQA 2XENA 1DC2A 3CVWA 3FU0A 3PREA 1S63A 4WAFA 4UI9K 3Q49B 3D9JA 4N39A 3VTYA 4YNDA 2HR2A 1INZA 1BU9A 2LO6A 4M7CA 3VLDA 1PY1A 5BXUA 3ZYMA 3FWVA 2RKKA 2GRMA 4A63B 4C0MA 2FO1E 2LNIA 3ZNGA 3B7RL 3ASHA 5AQ9A 3PZ1A 3TWXA 2L0IA 3W9GA 3IKOB 3CVVA 2I1JA 2KXPC 3Q47B 4I1OB 4WNDA 3RRNB 3CEQA 2OEVA 4N3CA 3VLFA 3CVNA 4PS7A 3K9IA 1FT2A 3FTWA 4V3IA 2WPVA 2RFMA 3T8MA 4U8HA 2E2EA 4CDMA 3HXFA 4I9EA 4B89A 2P9SG 5KJKA 5EX3A 3UTMA 4ACKA 3Q7AA 5FZSA 1N54A 3OXFA 1B89A 1TN7A 3G2WA 3FUNA 1QBQA 1DVPA 4JEUA 1V55E 2VSNA 5KNHD 4GYYA 3NAWA 4U95D 3I4RB 5ENNA 3EHNA 1SZ9A 4TRQA 4JXTA 4FP7A 4G24A 4GTMA 3ZU7B 1OCOE 2YNQA 3W9FA 2PNNA 2LAHA 3BG0B 1TJFA 1U3DA 4B8CB 4GTOA 2ILRA 4HBDA 3O48A 4GZ3A 5CRUA 4HI8A 3BG1B 3E32A 3AU4A 3ISMC 2DCPA 3OXGA 3ZFWA 5B3SE 1WG0A 3FUMA 2H6HA 4YDWA 4AY5A 3UI2A 1BD8A 2P9NG 2XS1A 3CSFA 3FUDA 5G55A 3UIOC 1FPPA 5CBNA 3CQCB 4ZFHA 4LRZA 3SQVA 3TXMA 1YCSB 5FJYA 3ZW3A 3PDNA 4XE0A 4N2QA 4BY6A 4F3VA 3CHPA 3NOGD 3JCKC 1ELWA 1HE8A 4Q69A 3E37A 3MA5A 3ZYKA 4KVMA 3CK9A 3DBSA 3SNXA 1JWGA 4I43A 4C0EA 4WWNA 1BPOA 1Q2ZA 2AVPA 3L16A 5G05C 4JC8A 3RK6A 3RAUA 3U4TA 3SI5A 1EDUA 1FVHA 2KC7A 2VJ8A 4RLYA 3QWWA 4K5AB 4C48B 4N5QA 3MKQB 2EILE 4Q94A 3ZHEA 3AS4A 2LXLA 1YYHA 2XCBA 3RJVA 2R2LA 3UM3A 1OCCE 4J7WA 3RU0A 2A5UA 3EHQA 4DJAA 2GRRB 1U3CA 4PUCA 4CGVA 5HS0A 2J07A 5BW8C 3PE4A 4GMJA 3ZPJA 3APDA 3GZ2A 3ABLE 4LERA 3X2QE 3PVLA 3CHRA 3C98A 4HRNA 5FQ7A 1FT1A 4FLBA 3UKUG 4PH4B 4U63A 3CK7A 1UOHA 1GW6A 5EYPF 4RSYA 4CZ2D 3PUKA 3I3NA 1E8WA 1YA0A 4K03A 4XKCA 5CCLA 5JMND 4XZ4A 2X6FA 3ZHEB 4BETA 2MRIA 4PS8A 3QC1A 4CT4A 3KAEA 2X6IA 3CHQA 3Q9NC 3OXLA 4EZKA 1E8ZA 4G2VA 4O6FA 5EKQD 3EU5A 1N4SA 4DLQA 4U8YD 2JLBA 3SBSA 1LTXA 4BSZB 3FUKA 2ZGGA 4APFA 4O1OA 1OUVA 2VQ2A 4PDXA 1TYQG 3SF4A 4EQFA 3DEPA 1V54E 4BFRA 3LVRE 1NZNA 4LNBA 2RFAA 5BV0A 3FTZA 3HVEA 3V30A 2XEHA 4JHKA 1QQEA 4I1MA 1UW4B 4BESA 2J4DA 1IHBA 1U2VG 3U9WA 2BTDA 3TWTA 5ARFA 5LCWC 4FHKA 3HDXA 3CSTA 3PE3A 3NOCD 3AS5A 2WXHA 4FULA 4Y6CA 1KZPA 2IO3C 2XEEA 1UN8A 2OVFA 3IV0A 1HX8A 4GTVA 3TWVA 4BX9A 1HG5A 2A4ZA 3UPVA 2PZIA 5A6CA 3HYMB 3LS8A 3ZIMA 4K0RA 4J8DA 4A1GA 2YHCA 2R02A 3T5XA 4FJYA 1G3NB 3Q15A 1OWLA 3V2XA 3Q75A 2PL2A 4I6JA 2I1KA 2X6KA 4N2SA 2KCLA 4ILGA 3SGHA 4JEHA 1NA0A 4OAUC 1K8KG 2I6HA 1Z3XA 2XPIA 4BT8A 3IXEA 2WXKA 2XRYA 5JA4D 5T8IA 1N9AA 4G1TA 4CYMD 1O5MA 5T4YA 3FTVA 4OVUA 5CERB 3CKCA 3MJWA 3FU5A 3PZ3A 5IY5E 1H19A 1LD8A 3Q5MA 2LSVA 3LXUX 1MYOA 5CEAA 3RRUA 4U07A 3CVUA 1TNBA 4GCOA 4F1PA 3FHEA 3S7JA 3TWQA 1N0QA 3SD5A 4MLPA 3PH0C 2KCKA 4FC8A 4HOUA 4XKBA 4A1SA 2GRNB 3EIQC 3FTUA 3FULA 2NC9A 3FUHA 3ZGQA 1ELKA 3AJIA 3PEUB 3B7SA 2ETBA 1A17A 3QARA 1TR4A 2UY1A 2WXIA 2J8SD 3DSTA 1NL4A 2AJAA 2HO1A 2P9UG 5FT9A 2C0MA 2CFZA 1YMPA 2XS8A 3UKRG 3CR3A 4F53A 5G04C 3E30A 1AWCB 4U0ZA 2F37A 5KBAA 1EYHA 3GYZA 4ABNA 5DBKA 2WQ7A 4WNFA 2Y0BG 3QB2A 2L0TB 2QYJA 4J6IA 3SFYA 2WXJA 3QWVA 3Q4AB 1TJCA 2WXFA 2J08A 5FQ6A 2Y69E 1WY6A 2JEKA 4NIKA 3FH8A 1HO8A 3HG0D 4BTAA 3FDHA 3AG4E 4ANXA 3L08A 3SBTB 1JPLA 2CG3A 4LG6A 5BXOA 4GMRA 3ZEFA 3IHVA 2UY1B 4AJWA 2PM6A 4AY6A 3UINC 4J8EA 1S70B 1HG2A 2ZXWE 3UT8A 4LUNU 3E4BA 3E33A 5AIJA 1MX4A 3KSQA 4GZ5A 3HRAA 4NURA 1W3BA 4HFGA 1IKND 3PZ4A 4HRMB 4ANUA 2IFUA 3QAQA 1P5QA 1H6OA 1N4RA 4GZ6A 1FCHA 2XHEA 5BUZA 3HXEA 4WWOA 4ZHBA 3CVYA 5BNWA 4OAVB 1JCQA 3CKBA 5EIDA 2B6CA 2P9IG 4W9RA 4M3OA 4L9PA 4N3BA 2KZTA 3ML8A 4HI9A 5CHEE 3NB2A 4HORA 4B94A 4K5BA 1O1TA 1NFIE 2H6GA 4DX2A 4HNAD 2XPYA 2L9BA 2V8SE 3ONKA 3EJNA 3L22A 5C2YA 3ZRHA 2CFUA 1JWFA 1HFAA 4JHJA 3UUXA 4DK5A 2KZTB 1EPUA 1WM5A 5HQ8A 4DX6D 3UX4A 2ZU6B 4O60A 5ENOD 4CT0A 2V4HC 3R9AB 3DSSA 1DNPA 3LEWA 4BT9A 4EHMA 3ZXSA 5G05J 3TWWA 3V31A 2YINA 5JHBA 2FULA 3APFA 5AQAA 2P9KG 2WXNA 3F6QA 5HRYA 3HXCA 2OEWA
chains in the Genus database with same CATH topology
2Y4UA 3ASGA 1PC2A 3FU6A 4BWRA 3RJVA 4GU5A 2FI7A 5LP0A 2L6JA 3D9PA 3RU0A 2A5UA 2Y3AA 4CGWA 4DJAA 1KT0A 3KEZA 4UWLA 4FJZA 2V5FA 1U3CA 3HHMA 4PUCA 2IONA 4QFVA 4FLHA 4UWKA 4EECA 4CGVA 2AW6A 3OTNA 2HYZA 3NQPA 3PS6A 2J07A 4XI0A 4IRUA 3LY9A 4YVQC 3MCXA 5A7DB 2QY7A 2OV8A 3PE4A 4MS6A 4I2ZA 5ANLA 5BW8C 5BV1A 1MHQA 3ASDA 3EIJA 4GMJA 3ZPJA 2X3MA 1LF8A 3GZ1A 4L23A 3MYVA 4ACLA 1E7UA 4APOA 2IOSA 3APDA 1SQMA 5ANRA 3GZ2A 5AJDA 3OAWA 4LERA 4XI9A 4HVBA 3PVLA 4XIFA 3CHRA 2WXOA 3S7BA 3S2AA 3C98A 2WVIA 5FQ7A 3FTXA 2MHKA 3P1UA 5G2NA 3CVPA 4FLBA 2WM9A 2IQCA 3CV0A 4PH4B 4UI9J 1VDYA 4U63A 4HOTA 4GYOA 2WXQA 2I2OA 2J49A 3CK7A 3CIAA 1GW6A 3ZYQA 5J08A 5CMYA 2DIWA 4RSYA 4U0SA 3CVLA 1E90A 3MZLB 2WMOA 3DPDA 2EQXA 3PUKA 5KJLA 5LX8A 2FF4A 3CVQA 3I3NA 5JJ6A 3ONLA 2C0LA 2MOWA 1E8WA 1YA0A 2VSOE 5LFAA 4EBAA 4K03A 4RVBA 4FADA 4XKCA 1IYGA 5CCLA 3HIZA 3O4ZA 1E8YA 3FUIA 2HM8A 4XZ4A 2CG2A 3I4GA 2X6FA 3LY8A 2J09A 3QJZA 3VLEA 3ZHEB 3LPZA 3MX3A 3SHFA 2XGOA 2MRIA 2WB2A 4GZCA 4FU3A 4GCNA 1H6KA 4PS8A 1HF8A 3MV2B 4WNEA 3L6AA 3QC1A 4UWGA 3FUJA 5CMWA 3D9IA 3SZ7A 4AP2A 4CT4A 5J90A 3KAEA 2X6IA 3CHQA 2WXGA 3CQGB 3OXLA 4DPRA 2R17C 4EZKA 1OWOA 4H7XA 3FEYA 4G25A 1E8ZA 4G2VA 1FVFA 4J8SA 2PQRA 2CHZA 4O6FA 4JL0A 3T5VA 3MKQA 3VTXA 4KVOA 5EKQD 3FUFA 4HXIA 2PM7A 2VTBA 3LYAA 2ONDA 3ESKA 4DLQA 2Y4TA 2JLBA 3SBSA 1N52A 3KS2A 3FUKA 5FQ8A 4KMOA 4APFA 3IHYA 4WUYA 4F1SA 1OUVA 2I9CA 2VQ2A 2GW1A 3B13A 3TJPA 3NZUA 3CHSA 4PDXA 3FH7A 3PUJA 1XNFA 3SF4A 4EQFA 3B7UX 4KXKB 3ZVVA 1UJKA 4BFRA 5G04J 3LVRE 5AYWD 5C1DA 2KCVA 2WXMA 2P58C 3FU3A 2VGXB 5LOZA 1NZNA 4F7AA 3QKYA 2Q7FA 1Z3YA 5BV0A 2IU1A 3FTZA 3HVEA 2VGXA 3G2SA 4UWFA 1SZAA 4I2WA 5KJNA 3G2VA 3U3WA 4N5CA 4JHKA 1QQEA 4I1MA 1UW4B 2XCCA 5FTPA 1Y6IA 2J4DA 3TG5A 2VSXE 3TGOA 4BTBA 3U9WA 2BTDA 3U66A 4G23A 3RIBA 2XQ0A 4KBQA 4L1BA 4WWPA 5ARFA 5LCWC 4FHKA 3AS8A 3NF1A 1XGWA 3D9MA 3HDXA 3CSTA 3PE3A 3RKVA 4U04A 3AS5A 2WXHA 4FULA 3CK8A 4Y6CA 5JJ7A 3PRZA 4KZ0A 1KT1A 3FEXA 1UG3A 1UN8A 2R5SA 2OVFA 5DIZA 5LCWJ 3IV0A 5BPPA 5BT1A 2XPZA 1HX8A 2AXUA 4E6HA 4BX9A 4A55A 4XX5A 4HS2A 1H2UA 1HG5A 2A4ZA 2M63A 3FTSA 4OYSA 3TG4A 1IQRA 3UPVA 4FA6A 3RO2A 3D9KA 3ZYLA 4AXHA 2FEZA 4C9BB 2PZIA 4JHRA 5A6CA 3HYMB 5EX0A 5M72A 3LS8A 1WAO1 4GZDA 3UMVA 3JUIA 3LVQE 3ZIMA 3PNTB 3L13A 4OVVA 1H0AA 3NZSA 4K0RA 4NACA 5FZQA 1NA3A 4J8DA 4A1GA 2YHCA 4GPKA 3T5XA 3UQ3A 2KATA 4FJYA 3Q15A 3TXNA 1OWLA 1ELRA 4L7TA 4DI3A 4DLOA 1EF1C 2PL2A 4RG6A 3CVWA 2IOLA 4I6JA 3UT7A 3FU0A 3PREA 2I1KA 3CHOA 5T3RA 1E7VA 1X5BA 2X6KA 2YHEA 4WNGA 4N2SA 4WAFA 2KCLA 3ZN3A 1OWPA 4UI9K 3Q49B 3D9JA 3QOUA 4ILGA 3SGHA 4JEHA 4N39A 4CCAA 5CCMA 1NA0A 3CLJA 2XGMA 2I6HA 1Z3XA 3VTYA 2XPIA 3LJ3A 4BT8A 4GYWA 5EDSA 4YNDA 5KJMA 2HR2A 1INZA 2WXKA 4HOSA 2LO6A 3VLDA 2XRYA 1PY1A 5T8IA 3ZYMA 3FWVA 1L5JA 4AV7A 2GRMA 4G1TA 4C0MA 2J9QA 4G11A 1UJJA 2AWIA 4ANWA 4AIFA 5T4YA 1UN9A 2LNIA 3FTVA 3D9NA 4OVUA 4UQXA 4FHJA 3CKCA 3B7RL 3MJWA 2WQ6A 1ZBPA 2VYIA 3ASHA 3FU5A 5JHAA 2QFCA 2L0IA 3CGHA 4J8FA 1E96B 3IKOB 4BSXA 1H19A 4LCTA 2I1JA 3CVVA 3Q47B 4ILIA 4AOFA 3Q5MA 2LSVA 3LXUX 5AJLA 4I1OB 1IQUA 4G26A 4WNDA 3KD7A 4J0UA 4U07A 3RRNB 3RRUA 3CVUA 3GW4A 4GCOA 3CEQA 4IULA 2WXLA 3FHEA 3FY4A 3JQ0A 3S7JA 3L54A 4NQ0A 4N3CA 3TL5A 1OWNA 3VLFA 2GGFA 4LEUA 2R59A 2YQ8A 3SD5A 1QNFA 2V0PA 3CVNA 4MLPA 4PS7A 5E76A 3PH0C 3MGBA 2KCKA 4FC8A 4EZLA 4JA9A 4E85A 4HOUA 3URZA 4XKBA 3K9IA 4A1SA 3EIQC 3FTUA 3FULA 4MKTA 2NC9A 4I6GA 3FUHA 3FTWA 4V3IA 2WPVA 3ZGQA 1ELKA 3ESLA 2X6JA 3T8MA 3ULQA 4U8HA 2E2EA 3D3MA 3LDZA 3PEUB 4CDMA 1MQSA 1ZU2A 3B7SA 4I9EA 1A17A 4B89A 5KJKA 5EX3A 3JYSA 4ACKA 1TEZA 3PEVB 4PS3A 3S7FA 5FZSA 1N54A 4ATGA 2X38A 1B89A 3OXFA 3QARA 2UY1A 3HVEB 4BX8A 3B7TA 3G2WA 4GA2A 4ANVA 3FUNA 4R7LA 1DVPA 4KYOB 1HZ4A 2WXIA 2VGYA 4JEUA 1Z6TA 2VSNA 4B8AA 3D9OA 2NXPA 4GYYA 4EPZA 2OVBA 2HO1A 4UQZA 5FT9A 3I4RB 5ENNA 2C0MA 3EHNA 1SZ9A 2CFZA 3ML9A 3EHMA 4GAAA 4TRQA 1H2VC 4JXTA 4L2YA 4F53A 2RG8A 3CR3A 2PQNA 4FP7A 4G24A 2KM4A 5G04C 4U0ZA 2YNQA 3QNKA 2LAHA 3BG0B 4ILHB 1EYHA 3RO3A 3GYZA 1TJFA 4ABNA 2WXPA 5DBKA 1HS6A 1QZ2A 1U3DA 2WQ7A 3D9LA 2AXZA 3PNLB 3PZDA 4U0UA 3QB2A 4WNFA 2OOEA 2L0TB 3R7QA 4B8CB 1PAQA 2FO7A 2LSUA 5HI7A 4J6IA 2ILRA 4GZ3A 3O48A 2WXJA 3P2BA 3Q4AB 3QWVA 1TJCA 2WXFA 2J08A 5FQ6A 2FBNA 3BG1B 4Q96A 3RRMB 4TV3A 3MKRA 3ASFA 4EZJA 2AXVA 3AU4A 3GZSA 4I1AA 1WY6A 4JA7A 2JEKA 2DCPA 4B0ZA 3FH8A 3OXGA 1HO8A 4ME2A 1OWMA 5D0QD 3ZFWA 3FTYA 4UQYA 3CHMA 4BTAA 3FDHA 4AM9A 3FUMA 4ANXA 3L17A 3L08A 3QWPA 3SBTB 2VSYA 3MEKA 1JPLA 2CG3A 4AY5A 2V4LA 5FQ4A 3UT4A 2C2LA 3ZEFA 4I6EA 3IHVA 4HOQA 2UY1B 3CSFA 1IHGA 4AJWA 4DI4A 3QDNA 2PM6A 3FUDA 4KT6B 5G55A 2RD0A 4AY6A 1KLXA 4AEZC 4JVSA 4J8EA 2XGSA 3G2TA 1HG2A 3G2UA 3CQCB 3UT8A 4A3TA 4LUNU 5JJTA 3LCAA 3E4BA 1HU3A 4LRZA 3FUEA 5AIJA 2XEVA 5KCMA 3TXMA 2IJGX 2LAIA 4GZ5A 4UI9C 5FJYA 5FZRA 4JZYA 4NURA 4I17A 3ZW3A 1W3BA 4HFGA 2CHWA 4ANUA 2NSZA 3PDNA 2IFUA 3QAQA 1P5QA 4XE0A 3EDTB 3FP3A 3IBEA 4CDNA 4N2QA 4BY6A 5D0OD 3TAXA 2BF0X 3U64A 4F3VA 1H2TC 3CHPA 1NP7A 3JCKC 4GZ6A 1E8XA 1FCHA 1ELWA 2XHEA 5BUZA 4WWOA 3LY7A 2IF4A 2VTBB 3CVYA 5BNWA 4URKA 3CVXA 1Y8MA 3R7RA 3CKBA 1HE8A 4JPSA 4Q69A 4YVOA 4CEMA 3APCA 3MA5A 3ZYKA 3LKUA 4W9RA 3S7DA 5AENA 4M3OA 4N3BA 4KVMA 2BUGA 2KZTA 4I9CA 4TUUA 5ARGA 3CK9A 3ML8A 5CHEE 4GMLA 4P29A 4HORA 1HH8A 3DBSA 3N71A 4B94A 3SNXA 1S0PA 4A3VA 2J4BA 3QK0A 1JWGA 2WQHA 4UWHA 3AU5A 2XPYA 3JQ1A 2L9BA 3BEEA 1HXIA 2V8SE 3ONKA 3EJNA 3L22A 5C2YA 3ZRHA 3IEGA 4GA1A 3ENEA 4GA0A 4I43A 2CFUA 1JWFA 4IN3B 4KZCA 4C0EA 5A23A 4WWNA 3I5PA 1HFAA 4JHJA 3UUXA 4DK5A 1BPOA 4HLEA 5E75A 4H7YA 2KZTB 1EPUA 1WM5A 5HQ8A 4N3AA 3UX4A 4D10C 2ZU6B 2AVPA 2DBAA 2CHXA 2E0IA 3L16A 4JC8A 4L2LA 5G05C 3RK6A 2WMNA 4CDRA 3MV3B 3FH5A 4GB9A 3U4TA 4IYPA 4CT0A 3FFLA 3SI5A 3R9AB 1EDUA 1DNPA 3LEWA 2WXRA 4BT9A 3ZXSA 5G05J 4AVXA 1FVHA 2UWJG 2KC7A 1JUQA 4NRHB 2YINA 2GRLA 2X6HA 4MRUA 3WXXA 5JHBA 4CRWA 2FULA 2VJ8A 5FWQA 3APFA 3QWWA 4EBAG 4RG9A 2XRZA 2WXNA 4Y6WA 3MKQB 4JW1A 4Q94A 3ZHEA 3AS4A 3SFZA 2XCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ONL A;  2MOW A;  3LDZ A;  3D9M A;  1SZ9 A;  3RRU A;  1H0A A;  4Q96 A;  4NAC A;  2LO6 A;  1INZ A;  5LOZ A;  1PY1 A;  2BF0 X;  5LP0 A;  4JXT A;  1EDU A;  3D9P A;  3ZYM A;  2DCP A;  1JWG A;  2KM4 A;  4AVX A;  1HX8 A;  3G2S A;  1SZA A;  1UJJ A;  3G2V A;  3G2T A;  1JUQ A;  1HG2 A;  4FLB A;  1EYH A;  3G2U A;  3G2W A;  2V8S E;  3ONK A;  1HG5 A;  1VDY A;  3D9N A;  1DVP A;  1JWF A;  4GZC A;  4FU3 A;  4HFG A;  3D9K A;  3D9L A;  1HF8 A;  1X5B A;  3ZYK A;  3ZYL A;  2QY7 A;  5CMW A;  2L0T B;  3D9I A;  3D9O A;  1HFA A;  1MHQ A;  2L0I A;  4Q94 A;  2DIW A;  5CMY A;  3ZYQ A;  3D9J A;  5J08 A;  1JPL A;  1LF8 A;  1ELK A;  4GZD A;  1XGW A;  1UJK A;  3CLJ A; 
#chains in the Genus database with same CATH topology
 3ASG A;  1PC2 A;  3FU6 A;  4JD2 G;  1KT0 A;  3KEZ A;  5ENS D;  2V5F A;  3HHM A;  3KSL A;  2ION A;  4FLH A;  3AG1 E;  3T8K A;  3NQP A;  4YVQ C;  3MCX A;  5BV1 A;  4RQI A;  4I2Z A;  3ASD A;  3EIJ A;  1E7U A;  5ANR A;  3OAW A;  4HVB A;  4XIF A;  3S2A A;  2MHK A;  5G2N A;  4UI9 J;  2IEJ A;  4HOT A;  2J49 A;  3CVL A;  3ASO E;  4DRX E;  2FF4 A;  1OT8 A;  2MOW A;  4EBA A;  3O4Z A;  5KNG A;  1E8Y A;  3FUI A;  2HM8 A;  2DVW A;  3VLE A;  3SHF A;  3JXJ A;  3ZXP A;  4UWG A;  3FUJ A;  3D9I A;  3CQG B;  4DPR A;  2R17 C;  2QC9 A;  1FVF A;  2CHZ A;  1TN6 A;  3MKQ A;  3FUF A;  3AG3 E;  1OY3 D;  3ESK A;  2DZO A;  1N52 A;  3KS2 A;  5FQ8 A;  1SW6 A;  4WUY A;  5EYL A;  3B13 A;  3NZU A;  1RZ4 A;  3ZVV A;  1N95 A;  3ZUV B;  3DEO A;  2VGX B;  1Z3Y A;  3RSE G;  5EIB E;  1SZA A;  4I2W A;  5KJN A;  2IY0 C;  2VSX E;  3TGO A;  3U66 A;  2XQ0 A;  4KBQ A;  4GTS A;  1XGW A;  3D9M A;  4DX1 A;  5AQ7 A;  4HRL A;  4DX7 D;  3CK8 A;  3PRZ A;  3FEX A;  1UG3 A;  5DIZ A;  2XPZ A;  4A55 A;  4O1P A;  4HS2 A;  2M63 A;  1H2U A;  3TG4 A;  4FA6 A;  3D9K A;  4C9B B;  4JHR A;  5M72 A;  1MJ0 A;  1WAO 1;  3L82 A;  3PNT B;  4DLO A;  1K1B A;  4RG6 A;  2ZGD A;  3UT7 A;  5T3R A;  1X5B A;  3ZN3 A;  4CCA A;  3CLJ A;  5LCW J;  3LJ3 A;  4GYW A;  3B95 A;  2BKK B;  5ENR D;  2HE0 A;  3UIP C;  4G11 A;  1UJJ A;  1AP7 A;  1UN9 A;  3D9N A;  4FHJ A;  2WQ6 A;  3AAA C;  2QFC A;  2A5E A;  4J8F A;  1E96 B;  3C72 A;  4LCT A;  1TNY A;  4U96 D;  4AOF A;  3DSW A;  1IQU A;  4G26 A;  3KD7 A;  3Q79 A;  3AG2 E;  4IUL A;  2WXL A;  3JQ0 A;  3L54 A;  4NQ0 A;  3TL5 A;  1OWN A;  2GGF A;  4LEU A;  2YQ8 A;  2V0P A;  5E76 A;  2B0O E;  3UM0 A;  4JA9 A;  3ABM E;  4MKT A;  4I6G A;  4BEP A;  3ESL A;  2X6J A;  3ULQ A;  1N94 A;  1BLX B;  2DWZ A;  1MQS A;  5EIL A;  3JYS A;  2L6B A;  3PEV B;  1MX2 A;  4ATG A;  2X38 A;  4GA2 A;  4ANV A;  1HZ4 A;  2VGY A;  2VGE A;  1Z6T A;  4HQD A;  4B8A A;  3D9O A;  4EPZ A;  5D66 A;  4LNG A;  3ML9 A;  3EHM A;  2PQN A;  1K3Z D;  3QNK A;  3RO3 A;  1HS6 A;  1QZ2 A;  4U0U A;  2AXZ A;  3PZD A;  3R7Q A;  2FO7 A;  3BUA A;  3P2B A;  3J5Q B;  4Q96 A;  3MKR A;  3ASF A;  4EZJ A;  4I1A A;  1OWM A;  5D0Q D;  3KEA A;  3CHM A;  3T9K A;  2EIJ E;  3MEK A;  2V4L A;  3JXI A;  5FQ4 A;  2C2L A;  2ZIS A;  4I6E A;  4BER A;  4KT6 B;  2RD0 A;  1KLX A;  2XGS A;  3G2U A;  3DSV A;  2F0Y A;  5JJT A;  3LCA A;  1HU3 A;  3FUE A;  2XEV A;  2LAI A;  4UI9 C;  2NSZ A;  2MYO A;  5FIO A;  3EDT B;  3IBE A;  3TAX A;  3U64 A;  1K1A A;  1H2T C;  3C3O A;  1NP7 A;  1E8X A;  4MBG A;  3LY7 A;  3ULY A;  2VTB B;  4URK A;  3CVX A;  1O1S A;  3R7R A;  4JPS A;  4CEM A;  1JCS A;  5AEN A;  5EN5 D;  2BUG A;  4TUU A;  5ARG A;  4TXQ A;  4GML A;  2H6I A;  1HH8 A;  3N71 A;  1IXV A;  3QK0 A;  2WQH A;  4HB5 A;  4UWH A;  1MX6 A;  2Y1L E;  4U7E B;  3JQ1 A;  3BEE A;  1HXI A;  3IEG A;  4GA1 A;  4IN3 B;  4KZC A;  3LJN A;  3B7B A;  1H6P A;  5E75 A;  1DCE A;  4N3A A;  3C3Q A;  4D10 C;  2CHX A;  4L2L A;  4GTP A;  2WMN A;  4CDR A;  3MV3 B;  3FH5 A;  4IYP A;  2ZIR A;  2WXR A;  4AVX A;  2UWJ G;  1JUQ A;  4NRH B;  4MRU A;  4CRW A;  4RG9 A;  3BQO A;  4BWR A;  1KPS B;  1Z5S C;  2FI7 A;  2GRO B;  2L6J A;  2Y3A A;  4FJZ A;  2LUH A;  4QFV A;  5HKP A;  2P9L G;  3OTN A;  2HYZ A;  4XI0 A;  3JUE A;  5A7D B;  2QY7 A;  2OV8 A;  3DXK G;  4MS6 A;  5ANL A;  1MHQ A;  3Q9U C;  1LF8 A;  3GZ1 A;  4L23 A;  3MYV A;  1SQM A;  4XI9 A;  2WXO A;  3S7B A;  2WVI A;  4LSZ E;  3ULE G;  3FTX A;  3P1U A;  3CVP A;  2WM9 A;  2IQC A;  3CV0 A;  1VDY A;  3BU8 A;  2DIW A;  1WDY A;  1E90 A;  5KJL A;  1TNU A;  3ONL A;  4TXP A;  4RVB A;  5ENQ D;  2CG2 A;  3I4G A;  2J09 A;  1TNO A;  3UM1 A;  3LPZ A;  3MX3 A;  2XGO A;  2WB2 A;  4GZC A;  4FU3 A;  4GCN A;  1H6K A;  1HF8 A;  3NBN B;  2WXG A;  4DUI A;  1OWO A;  4H7X A;  3TWU A;  4G25 A;  3T5V A;  2PQR A;  4JL0 A;  2DYS E;  3VTX A;  4HXI A;  2PM7 A;  3LYA A;  2OND A;  2Y4T A;  4KMO A;  3IHY A;  1N4P A;  5CED B;  3FH7 A;  3PUJ A;  1XNF A;  4YDO A;  5CBO A;  2V5Q C;  2KCV A;  2WXM A;  2P58 C;  3FU3 A;  3DSX A;  2Q7F A;  2IU1 A;  5B1A E;  2VGX A;  3G2S A;  4UWF A;  1S64 A;  3G2V A;  3U3W A;  2GRP B;  5FTP A;  3TG5 A;  4BTB A;  4G23 A;  4WWP A;  4L1B A;  5JJ7 A;  2R5S A;  5BT1 A;  1QYM A;  4E6H A;  2EIM E;  4XX5 A;  3FTS A;  3Q7F A;  3RO2 A;  3ZYL A;  1N0R A;  4GZD A;  3UMV A;  3HXD A;  1SA4 A;  3JUI A;  3C3R A;  1H0A A;  5FZQ A;  1NA3 A;  3SFX A;  3UQ3 A;  2KAT A;  1OCZ E;  3TXN A;  1ELR A;  2JAB A;  4L7T A;  4TUM A;  4X8Q A;  1N4Q A;  1EF1 C;  2IOL A;  3CHO A;  1E7V A;  2YHE A;  4WNG A;  4YDE A;  1OWP A;  3TWR A;  3QOU A;  5CCM A;  4XEI G;  2XGM A;  5KJM A;  5EDS A;  4HOS A;  3ABK E;  4F6R D;  1L5J A;  4AV7 A;  2J9Q A;  4ANW A;  2AWI A;  3UXG A;  4AIF A;  1X81 A;  2DZN A;  4UQX A;  1ZBP A;  2VYI A;  2H6F A;  5JHA A;  3CGH A;  4BSX A;  5FIN A;  4ILI A;  5AJL A;  4J0U A;  3GW4 A;  1SVX A;  3FY4 A;  2KBX A;  2R59 A;  1QNF A;  1TN8 A;  4YDY A;  3D9H A;  2EIK E;  3MGB A;  4EZL A;  3EHR A;  4E85 A;  1RW2 A;  3URZ A;  4HLL A;  5CEC B;  3D3M A;  3LDZ A;  1ZU2 A;  1TEZ A;  4PS3 A;  3S7F A;  2LXM A;  3HVE B;  4BX8 A;  3B7T A;  4R7L A;  3V2O A;  4KYO B;  2NXP A;  1N11 A;  1D8D A;  2OVB A;  4UQZ A;  5ENT D;  1MZC A;  4GTR A;  4Z68 A;  2XZT G;  4GAA A;  1H2V C;  4L2Y A;  2RG8 A;  2KM4 A;  2F8Y A;  4ILH B;  2WXP A;  4UUC A;  3D9L A;  3PNL B;  2OOE A;  1PAQ A;  2LSU A;  5HI7 A;  5H7P A;  3SO8 A;  3TWS A;  2FBN A;  1TNZ A;  3RRM B;  4TV3 A;  3V79 K;  2AXV A;  3GZS A;  4JA7 A;  4B0Z A;  1OCR E;  4ME2 A;  3FTY A;  4UQY A;  1JCR A;  2R03 A;  4AM9 A;  3L17 A;  3QWP A;  2VSY A;  3UM2 A;  3UT4 A;  1NI1 A;  3HXB A;  4HOQ A;  1D9S A;  5ENP D;  1IHG A;  4DI4 A;  3QDN A;  2OCC E;  5KWD A;  3DXM G;  4AEZ C;  4JVS A;  3G2T A;  3DWL G;  4A3T A;  3ZKJ A;  5KCM A;  2IJG X;  5FZR A;  4JZY A;  1OXJ A;  4I17 A;  2CHW A;  4DX5 D;  2XZD G;  3FP3 A;  4CDN A;  3EUV A;  5D0O D;  2BF0 X;  5AN8 A;  2IF4 A;  4LNU D;  1Y8M A;  4YVO A;  3APC A;  3LKU A;  3S7D A;  2NYJ A;  4I9C A;  4P29 A;  1ZB1 A;  2IO2 C;  1BI7 B;  1S0P A;  4A3V A;  2J4B A;  3AU5 A;  3ENE A;  4GA0 A;  5A23 A;  3I5P A;  1LD7 A;  4HLE A;  3Q78 A;  4H7Y A;  2E0I A;  2DBA A;  3DRA A;  3L9T A;  3WG7 E;  4GB9 A;  3FFL A;  1D8E A;  4GPM A;  5D2M C;  2GRL A;  2X6H A;  3WXX A;  5FWQ A;  4B93 B;  4EBA G;  3DSU A;  2XRZ A;  4Y6W A;  1KZO A;  4JW1 A;  2EIN E;  4G8L A;  3SFZ A;  4TXR A;  2ETC A;  5AAR A;  2Y4U A;  4GU5 A;  1O1R A;  5LP0 A;  3D9P A;  4CGW A;  2QYU A;  4UWL A;  4GTT A;  4UWK A;  4EEC A;  3E34 A;  2AW6 A;  4ATZ D;  3PS6 A;  4IRU A;  3LY9 A;  3Q73 A;  2X3M A;  4ACL A;  4APO A;  2IOS A;  5AJD A;  2R05 A;  3ASN E;  5AQB A;  2GRQ B;  2P2C P;  4GYO A;  2WXQ A;  2I2O A;  4K5C A;  3CIA A;  1SA5 A;  3ZYQ A;  5J08 A;  5CMY A;  4U0S A;  3MZL B;  2WMO A;  3DPD A;  2EQX A;  5LX8 A;  3CVQ A;  5JJ6 A;  2C0L A;  2BKG A;  4QQI A;  2DYR E;  2VSO E;  5LFA A;  4FAD A;  1IYG A;  3HIZ A;  3C5R A;  3PZ2 A;  3LY8 A;  3QJZ A;  2QZA A;  3MV2 B;  4WNE A;  5ITZ F;  3L6A A;  4U8V D;  5CMW A;  3SZ7 A;  4AP2 A;  5J90 A;  4J8Y A;  4G8K A;  1BI8 B;  3FEY A;  4J8S A;  4KVO A;  2VTB A;  5B1B E;  4F1S A;  2I9C A;  2GW1 A;  3TJP A;  3CHS A;  3B7U X;  4KXK B;  3DPY A;  1UJK A;  5G04 J;  5AYW D;  5C1D A;  5LOZ A;  2P9P G;  4F7A A;  3QKY A;  5CRV A;  1A5E A;  4N5C A;  2XCC A;  1Y6I A;  3RIB A;  3AS8 A;  4JB8 P;  3NF1 A;  3RKV A;  4U04 A;  4KZ0 A;  1KT1 A;  2F8X K;  2ETA A;  5AAO A;  5BPP A;  2AXU A;  3R9M A;  4OYS A;  1IQR A;  3SY2 A;  4AXH A;  2BED A;  2FEZ A;  3EU9 A;  5EX0 A;  3J5P A;  3LVQ E;  3L13 A;  4OVV A;  3NZS A;  4NAC A;  4GPK A;  4DI3 A;  4GTQ A;  1DCQ A;  2XEN A;  1DC2 A;  3CVW A;  3FU0 A;  3PRE A;  1S63 A;  4WAF A;  4UI9 K;  3Q49 B;  3D9J A;  4N39 A;  3VTY A;  4YND A;  2HR2 A;  1INZ A;  1BU9 A;  2LO6 A;  4M7C A;  3VLD A;  1PY1 A;  5BXU A;  3ZYM A;  3FWV A;  2RKK A;  2GRM A;  4A63 B;  4C0M A;  2FO1 E;  2LNI A;  3ZNG A;  3B7R L;  3ASH A;  5AQ9 A;  3PZ1 A;  3TWX A;  2L0I A;  3W9G A;  3IKO B;  3CVV A;  2I1J A;  2KXP C;  3Q47 B;  4I1O B;  4WND A;  3RRN B;  3CEQ A;  2OEV A;  4N3C A;  3VLF A;  3CVN A;  4PS7 A;  3K9I A;  1FT2 A;  3FTW A;  4V3I A;  2WPV A;  2RFM A;  3T8M A;  4U8H A;  2E2E A;  4CDM A;  3HXF A;  4I9E A;  4B89 A;  2P9S G;  5KJK A;  5EX3 A;  3UTM A;  4ACK A;  3Q7A A;  5FZS A;  1N54 A;  3OXF A;  1B89 A;  1TN7 A;  3G2W A;  3FUN A;  1QBQ A;  1DVP A;  4JEU A;  1V55 E;  2VSN A;  5KNH D;  4GYY A;  3NAW A;  4U95 D;  3I4R B;  5ENN A;  3EHN A;  1SZ9 A;  4TRQ A;  4JXT A;  4FP7 A;  4G24 A;  4GTM A;  3ZU7 B;  1OCO E;  2YNQ A;  3W9F A;  2PNN A;  2LAH A;  3BG0 B;  1TJF A;  1U3D A;  4B8C B;  4GTO A;  2ILR A;  4HBD A;  3O48 A;  4GZ3 A;  5CRU A;  4HI8 A;  3BG1 B;  3E32 A;  3AU4 A;  3ISM C;  2DCP A;  3OXG A;  3ZFW A;  5B3S E;  1WG0 A;  3FUM A;  2H6H A;  4YDW A;  4AY5 A;  3UI2 A;  1BD8 A;  2P9N G;  2XS1 A;  3CSF A;  3FUD A;  5G55 A;  3UIO C;  1FPP A;  5CBN A;  3CQC B;  4ZFH A;  4LRZ A;  3SQV A;  3TXM A;  1YCS B;  5FJY A;  3ZW3 A;  3PDN A;  4XE0 A;  4N2Q A;  4BY6 A;  4F3V A;  3CHP A;  3NOG D;  3JCK C;  1ELW A;  1HE8 A;  4Q69 A;  3E37 A;  3MA5 A;  3ZYK A;  4KVM A;  3CK9 A;  3DBS A;  3SNX A;  1JWG A;  4I43 A;  4C0E A;  4WWN A;  1BPO A;  1Q2Z A;  2AVP A;  3L16 A;  5G05 C;  4JC8 A;  3RK6 A;  3RAU A;  3U4T A;  3SI5 A;  1EDU A;  1FVH A;  2KC7 A;  2VJ8 A;  4RLY A;  3QWW A;  4K5A B;  4C48 B;  4N5Q A;  3MKQ B;  2EIL E;  4Q94 A;  3ZHE A;  3AS4 A;  2LXL A;  1YYH A;  2XCB A;  3RJV A;  2R2L A;  3UM3 A;  1OCC E;  4J7W A;  3RU0 A;  2A5U A;  3EHQ A;  4DJA A;  2GRR B;  1U3C A;  4PUC A;  4CGV A;  5HS0 A;  2J07 A;  5BW8 C;  3PE4 A;  4GMJ A;  3ZPJ A;  3APD A;  3GZ2 A;  3ABL E;  4LER A;  3X2Q E;  3PVL A;  3CHR A;  3C98 A;  4HRN A;  5FQ7 A;  1FT1 A;  4FLB A;  3UKU G;  4PH4 B;  4U63 A;  3CK7 A;  1UOH A;  1GW6 A;  5EYP F;  4RSY A;  4CZ2 D;  3PUK A;  3I3N A;  1E8W A;  1YA0 A;  4K03 A;  4XKC A;  5CCL A;  5JMN D;  4XZ4 A;  2X6F A;  3ZHE B;  4BET A;  2MRI A;  4PS8 A;  3QC1 A;  4CT4 A;  3KAE A;  2X6I A;  3CHQ A;  3Q9N C;  3OXL A;  4EZK A;  1E8Z A;  4G2V A;  4O6F A;  5EKQ D;  3EU5 A;  1N4S A;  4DLQ A;  4U8Y D;  2JLB A;  3SBS A;  1LTX A;  4BSZ B;  3FUK A;  2ZGG A;  4APF A;  4O1O A;  1OUV A;  2VQ2 A;  4PDX A;  1TYQ G;  3SF4 A;  4EQF A;  3DEP A;  1V54 E;  4BFR A;  3LVR E;  1NZN A;  4LNB A;  2RFA A;  5BV0 A;  3FTZ A;  3HVE A;  3V30 A;  2XEH A;  4JHK A;  1QQE A;  4I1M A;  1UW4 B;  4BES A;  2J4D A;  1IHB A;  1U2V G;  3U9W A;  2BTD A;  3TWT A;  5ARF A;  5LCW C;  4FHK A;  3HDX A;  3CST A;  3PE3 A;  3NOC D;  3AS5 A;  2WXH A;  4FUL A;  4Y6C A;  1KZP A;  2IO3 C;  2XEE A;  1UN8 A;  2OVF A;  3IV0 A;  1HX8 A;  4GTV A;  3TWV A;  4BX9 A;  1HG5 A;  2A4Z A;  3UPV A;  2PZI A;  5A6C A;  3HYM B;  3LS8 A;  3ZIM A;  4K0R A;  4J8D A;  4A1G A;  2YHC A;  2R02 A;  3T5X A;  4FJY A;  1G3N B;  3Q15 A;  1OWL A;  3V2X A;  3Q75 A;  2PL2 A;  4I6J A;  2I1K A;  2X6K A;  4N2S A;  2KCL A;  4ILG A;  3SGH A;  4JEH A;  1NA0 A;  4OAU C;  1K8K G;  2I6H A;  1Z3X A;  2XPI A;  4BT8 A;  3IXE A;  2WXK A;  2XRY A;  5JA4 D;  5T8I A;  1N9A A;  4G1T A;  4CYM D;  1O5M A;  5T4Y A;  3FTV A;  4OVU A;  5CER B;  3CKC A;  3MJW A;  3FU5 A;  3PZ3 A;  5IY5 E;  1H19 A;  1LD8 A;  3Q5M A;  2LSV A;  3LXU X;  1MYO A;  5CEA A;  3RRU A;  4U07 A;  3CVU A;  1TNB A;  4GCO A;  4F1P A;  3FHE A;  3S7J A;  3TWQ A;  1N0Q A;  3SD5 A;  4MLP A;  3PH0 C;  2KCK A;  4FC8 A;  4HOU A;  4XKB A;  4A1S A;  2GRN B;  3EIQ C;  3FTU A;  3FUL A;  2NC9 A;  3FUH A;  3ZGQ A;  1ELK A;  3AJI A;  3PEU B;  3B7S A;  2ETB A;  1A17 A;  3QAR A;  1TR4 A;  2UY1 A;  2WXI A;  2J8S D;  3DST A;  1NL4 A;  2AJA A;  2HO1 A;  2P9U G;  5FT9 A;  2C0M A;  2CFZ A;  1YMP A;  2XS8 A;  3UKR G;  3CR3 A;  4F53 A;  5G04 C;  3E30 A;  1AWC B;  4U0Z A;  2F37 A;  5KBA A;  1EYH A;  3GYZ A;  4ABN A;  5DBK A;  2WQ7 A;  4WNF A;  2Y0B G;  3QB2 A;  2L0T B;  2QYJ A;  4J6I A;  3SFY A;  2WXJ A;  3QWV A;  3Q4A B;  1TJC A;  2WXF A;  2J08 A;  5FQ6 A;  2Y69 E;  1WY6 A;  2JEK A;  4NIK A;  3FH8 A;  1HO8 A;  3HG0 D;  4BTA A;  3FDH A;  3AG4 E;  4ANX A;  3L08 A;  3SBT B;  1JPL A;  2CG3 A;  4LG6 A;  5BXO A;  4GMR A;  3ZEF A;  3IHV A;  2UY1 B;  4AJW A;  2PM6 A;  4AY6 A;  3UIN C;  4J8E A;  1S70 B;  1HG2 A;  2ZXW E;  3UT8 A;  4LUN U;  3E4B A;  3E33 A;  5AIJ A;  1MX4 A;  3KSQ A;  4GZ5 A;  3HRA A;  4NUR A;  1W3B A;  4HFG A;  1IKN D;  3PZ4 A;  4HRM B;  4ANU A;  2IFU A;  3QAQ A;  1P5Q A;  1H6O A;  1N4R A;  4GZ6 A;  1FCH A;  2XHE A;  5BUZ A;  3HXE A;  4WWO A;  4ZHB A;  3CVY A;  5BNW A;  4OAV B;  1JCQ A;  3CKB A;  5EID A;  2B6C A;  2P9I G;  4W9R A;  4M3O A;  4L9P A;  4N3B A;  2KZT A;  3ML8 A;  4HI9 A;  5CHE E;  3NB2 A;  4HOR A;  4B94 A;  4K5B A;  1O1T A;  1NFI E;  2H6G A;  4DX2 A;  4HNA D;  2XPY A;  2L9B A;  2V8S E;  3ONK A;  3EJN A;  3L22 A;  5C2Y A;  3ZRH A;  2CFU A;  1JWF A;  1HFA A;  4JHJ A;  3UUX A;  4DK5 A;  2KZT B;  1EPU A;  1WM5 A;  5HQ8 A;  4DX6 D;  3UX4 A;  2ZU6 B;  4O60 A;  5ENO D;  4CT0 A;  2V4H C;  3R9A B;  3DSS A;  1DNP A;  3LEW A;  4BT9 A;  4EHM A;  3ZXS A;  5G05 J;  3TWW A;  3V31 A;  2YIN A;  5JHB A;  2FUL A;  3APF A;  5AQA A;  2P9K G;  2WXN A;  3F6Q A;  5HRY A;  3HXC A;  2OEW A; 
#chains in the Genus database with same CATH homology
 2Y4U A;  3ASG A;  1PC2 A;  3FU6 A;  4BWR A;  3RJV A;  4GU5 A;  2FI7 A;  5LP0 A;  2L6J A;  3D9P A;  3RU0 A;  2A5U A;  2Y3A A;  4CGW A;  4DJA A;  1KT0 A;  3KEZ A;  4UWL A;  4FJZ A;  2V5F A;  1U3C A;  3HHM A;  4PUC A;  2ION A;  4QFV A;  4FLH A;  4UWK A;  4EEC A;  4CGV A;  2AW6 A;  3OTN A;  2HYZ A;  3NQP A;  3PS6 A;  2J07 A;  4XI0 A;  4IRU A;  3LY9 A;  4YVQ C;  3MCX A;  5A7D B;  2QY7 A;  2OV8 A;  3PE4 A;  4MS6 A;  4I2Z A;  5ANL A;  5BW8 C;  5BV1 A;  1MHQ A;  3ASD A;  3EIJ A;  4GMJ A;  3ZPJ A;  2X3M A;  1LF8 A;  3GZ1 A;  4L23 A;  3MYV A;  4ACL A;  1E7U A;  4APO A;  2IOS A;  3APD A;  1SQM A;  5ANR A;  3GZ2 A;  5AJD A;  3OAW A;  4LER A;  4XI9 A;  4HVB A;  3PVL A;  4XIF A;  3CHR A;  2WXO A;  3S7B A;  3S2A A;  3C98 A;  2WVI A;  5FQ7 A;  3FTX A;  2MHK A;  3P1U A;  5G2N A;  3CVP A;  4FLB A;  2WM9 A;  2IQC A;  3CV0 A;  4PH4 B;  4UI9 J;  1VDY A;  4U63 A;  4HOT A;  4GYO A;  2WXQ A;  2I2O A;  2J49 A;  3CK7 A;  3CIA A;  1GW6 A;  3ZYQ A;  5J08 A;  5CMY A;  2DIW A;  4RSY A;  4U0S A;  3CVL A;  1E90 A;  3MZL B;  2WMO A;  3DPD A;  2EQX A;  3PUK A;  5KJL A;  5LX8 A;  2FF4 A;  3CVQ A;  3I3N A;  5JJ6 A;  3ONL A;  2C0L A;  2MOW A;  1E8W A;  1YA0 A;  2VSO E;  5LFA A;  4EBA A;  4K03 A;  4RVB A;  4FAD A;  4XKC A;  1IYG A;  5CCL A;  3HIZ A;  3O4Z A;  1E8Y A;  3FUI A;  2HM8 A;  4XZ4 A;  2CG2 A;  3I4G A;  2X6F A;  3LY8 A;  2J09 A;  3QJZ A;  3VLE A;  3ZHE B;  3LPZ A;  3MX3 A;  3SHF A;  2XGO A;  2MRI A;  2WB2 A;  4GZC A;  4FU3 A;  4GCN A;  1H6K A;  4PS8 A;  1HF8 A;  3MV2 B;  4WNE A;  3L6A A;  3QC1 A;  4UWG A;  3FUJ A;  5CMW A;  3D9I A;  3SZ7 A;  4AP2 A;  4CT4 A;  5J90 A;  3KAE A;  2X6I A;  3CHQ A;  2WXG A;  3CQG B;  3OXL A;  4DPR A;  2R17 C;  4EZK A;  1OWO A;  4H7X A;  3FEY A;  4G25 A;  1E8Z A;  4G2V A;  1FVF A;  4J8S A;  2PQR A;  2CHZ A;  4O6F A;  4JL0 A;  3T5V A;  3MKQ A;  3VTX A;  4KVO A;  5EKQ D;  3FUF A;  4HXI A;  2PM7 A;  2VTB A;  3LYA A;  2OND A;  3ESK A;  4DLQ A;  2Y4T A;  2JLB A;  3SBS A;  1N52 A;  3KS2 A;  3FUK A;  5FQ8 A;  4KMO A;  4APF A;  3IHY A;  4WUY A;  4F1S A;  1OUV A;  2I9C A;  2VQ2 A;  2GW1 A;  3B13 A;  3TJP A;  3NZU A;  3CHS A;  4PDX A;  3FH7 A;  3PUJ A;  1XNF A;  3SF4 A;  4EQF A;  3B7U X;  4KXK B;  3ZVV A;  1UJK A;  4BFR A;  5G04 J;  3LVR E;  5AYW D;  5C1D A;  2KCV A;  2WXM A;  2P58 C;  3FU3 A;  2VGX B;  5LOZ A;  1NZN A;  4F7A A;  3QKY A;  2Q7F A;  1Z3Y A;  5BV0 A;  2IU1 A;  3FTZ A;  3HVE A;  2VGX A;  3G2S A;  4UWF A;  1SZA A;  4I2W A;  5KJN A;  3G2V A;  3U3W A;  4N5C A;  4JHK A;  1QQE A;  4I1M A;  1UW4 B;  2XCC A;  5FTP A;  1Y6I A;  2J4D A;  3TG5 A;  2VSX E;  3TGO A;  4BTB A;  3U9W A;  2BTD A;  3U66 A;  4G23 A;  3RIB A;  2XQ0 A;  4KBQ A;  4L1B A;  4WWP A;  5ARF A;  5LCW C;  4FHK A;  3AS8 A;  3NF1 A;  1XGW A;  3D9M A;  3HDX A;  3CST A;  3PE3 A;  3RKV A;  4U04 A;  3AS5 A;  2WXH A;  4FUL A;  3CK8 A;  4Y6C A;  5JJ7 A;  3PRZ A;  4KZ0 A;  1KT1 A;  3FEX A;  1UG3 A;  1UN8 A;  2R5S A;  2OVF A;  5DIZ A;  5LCW J;  3IV0 A;  5BPP A;  5BT1 A;  2XPZ A;  1HX8 A;  2AXU A;  4E6H A;  4BX9 A;  4A55 A;  4XX5 A;  4HS2 A;  1H2U A;  1HG5 A;  2A4Z A;  2M63 A;  3FTS A;  4OYS A;  3TG4 A;  1IQR A;  3UPV A;  4FA6 A;  3RO2 A;  3D9K A;  3ZYL A;  4AXH A;  2FEZ A;  4C9B B;  2PZI A;  4JHR A;  5A6C A;  3HYM B;  5EX0 A;  5M72 A;  3LS8 A;  1WAO 1;  4GZD A;  3UMV A;  3JUI A;  3LVQ E;  3ZIM A;  3PNT B;  3L13 A;  4OVV A;  1H0A A;  3NZS A;  4K0R A;  4NAC A;  5FZQ A;  1NA3 A;  4J8D A;  4A1G A;  2YHC A;  4GPK A;  3T5X A;  3UQ3 A;  2KAT A;  4FJY A;  3Q15 A;  3TXN A;  1OWL A;  1ELR A;  4L7T A;  4DI3 A;  4DLO A;  1EF1 C;  2PL2 A;  4RG6 A;  3CVW A;  2IOL A;  4I6J A;  3UT7 A;  3FU0 A;  3PRE A;  2I1K A;  3CHO A;  5T3R A;  1E7V A;  1X5B A;  2X6K A;  2YHE A;  4WNG A;  4N2S A;  4WAF A;  2KCL A;  3ZN3 A;  1OWP A;  4UI9 K;  3Q49 B;  3D9J A;  3QOU A;  4ILG A;  3SGH A;  4JEH A;  4N39 A;  4CCA A;  5CCM A;  1NA0 A;  3CLJ A;  2XGM A;  2I6H A;  1Z3X A;  3VTY A;  2XPI A;  3LJ3 A;  4BT8 A;  4GYW A;  5EDS A;  4YND A;  5KJM A;  2HR2 A;  1INZ A;  2WXK A;  4HOS A;  2LO6 A;  3VLD A;  2XRY A;  1PY1 A;  5T8I A;  3ZYM A;  3FWV A;  1L5J A;  4AV7 A;  2GRM A;  4G1T A;  4C0M A;  2J9Q A;  4G11 A;  1UJJ A;  2AWI A;  4ANW A;  4AIF A;  5T4Y A;  1UN9 A;  2LNI A;  3FTV A;  3D9N A;  4OVU A;  4UQX A;  4FHJ A;  3CKC A;  3B7R L;  3MJW A;  2WQ6 A;  1ZBP A;  2VYI A;  3ASH A;  3FU5 A;  5JHA A;  2QFC A;  2L0I A;  3CGH A;  4J8F A;  1E96 B;  3IKO B;  4BSX A;  1H19 A;  4LCT A;  2I1J A;  3CVV A;  3Q47 B;  4ILI A;  4AOF A;  3Q5M A;  2LSV A;  3LXU X;  5AJL A;  4I1O B;  1IQU A;  4G26 A;  4WND A;  3KD7 A;  4J0U A;  4U07 A;  3RRN B;  3RRU A;  3CVU A;  3GW4 A;  4GCO A;  3CEQ A;  4IUL A;  2WXL A;  3FHE A;  3FY4 A;  3JQ0 A;  3S7J A;  3L54 A;  4NQ0 A;  4N3C A;  3TL5 A;  1OWN A;  3VLF A;  2GGF A;  4LEU A;  2R59 A;  2YQ8 A;  3SD5 A;  1QNF A;  2V0P A;  3CVN A;  4MLP A;  4PS7 A;  5E76 A;  3PH0 C;  3MGB A;  2KCK A;  4FC8 A;  4EZL A;  4JA9 A;  4E85 A;  4HOU A;  3URZ A;  4XKB A;  3K9I A;  4A1S A;  3EIQ C;  3FTU A;  3FUL A;  4MKT A;  2NC9 A;  4I6G A;  3FUH A;  3FTW A;  4V3I A;  2WPV A;  3ZGQ A;  1ELK A;  3ESL A;  2X6J A;  3T8M A;  3ULQ A;  4U8H A;  2E2E A;  3D3M A;  3LDZ A;  3PEU B;  4CDM A;  1MQS A;  1ZU2 A;  3B7S A;  4I9E A;  1A17 A;  4B89 A;  5KJK A;  5EX3 A;  3JYS A;  4ACK A;  1TEZ A;  3PEV B;  4PS3 A;  3S7F A;  5FZS A;  1N54 A;  4ATG A;  2X38 A;  1B89 A;  3OXF A;  3QAR A;  2UY1 A;  3HVE B;  4BX8 A;  3B7T A;  3G2W A;  4GA2 A;  4ANV A;  3FUN A;  4R7L A;  1DVP A;  4KYO B;  1HZ4 A;  2WXI A;  2VGY A;  4JEU A;  1Z6T A;  2VSN A;  4B8A A;  3D9O A;  2NXP A;  4GYY A;  4EPZ A;  2OVB A;  2HO1 A;  4UQZ A;  5FT9 A;  3I4R B;  5ENN A;  2C0M A;  3EHN A;  1SZ9 A;  2CFZ A;  3ML9 A;  3EHM A;  4GAA A;  4TRQ A;  1H2V C;  4JXT A;  4L2Y A;  4F53 A;  2RG8 A;  3CR3 A;  2PQN A;  4FP7 A;  4G24 A;  2KM4 A;  5G04 C;  4U0Z A;  2YNQ A;  3QNK A;  2LAH A;  3BG0 B;  4ILH B;  1EYH A;  3RO3 A;  3GYZ A;  1TJF A;  4ABN A;  2WXP A;  5DBK A;  1HS6 A;  1QZ2 A;  1U3D A;  2WQ7 A;  3D9L A;  2AXZ A;  3PNL B;  3PZD A;  4U0U A;  3QB2 A;  4WNF A;  2OOE A;  2L0T B;  3R7Q A;  4B8C B;  1PAQ A;  2FO7 A;  2LSU A;  5HI7 A;  4J6I A;  2ILR A;  4GZ3 A;  3O48 A;  2WXJ A;  3P2B A;  3Q4A B;  3QWV A;  1TJC A;  2WXF A;  2J08 A;  5FQ6 A;  2FBN A;  3BG1 B;  4Q96 A;  3RRM B;  4TV3 A;  3MKR A;  3ASF A;  4EZJ A;  2AXV A;  3AU4 A;  3GZS A;  4I1A A;  1WY6 A;  4JA7 A;  2JEK A;  2DCP A;  4B0Z A;  3FH8 A;  3OXG A;  1HO8 A;  4ME2 A;  1OWM A;  5D0Q D;  3ZFW A;  3FTY A;  4UQY A;  3CHM A;  4BTA A;  3FDH A;  4AM9 A;  3FUM A;  4ANX A;  3L17 A;  3L08 A;  3QWP A;  3SBT B;  2VSY A;  3MEK A;  1JPL A;  2CG3 A;  4AY5 A;  2V4L A;  5FQ4 A;  3UT4 A;  2C2L A;  3ZEF A;  4I6E A;  3IHV A;  4HOQ A;  2UY1 B;  3CSF A;  1IHG A;  4AJW A;  4DI4 A;  3QDN A;  2PM6 A;  3FUD A;  4KT6 B;  5G55 A;  2RD0 A;  4AY6 A;  1KLX A;  4AEZ C;  4JVS A;  4J8E A;  2XGS A;  3G2T A;  1HG2 A;  3G2U A;  3CQC B;  3UT8 A;  4A3T A;  4LUN U;  5JJT A;  3LCA A;  3E4B A;  1HU3 A;  4LRZ A;  3FUE A;  5AIJ A;  2XEV A;  5KCM A;  3TXM A;  2IJG X;  2LAI A;  4GZ5 A;  4UI9 C;  5FJY A;  5FZR A;  4JZY A;  4NUR A;  4I17 A;  3ZW3 A;  1W3B A;  4HFG A;  2CHW A;  4ANU A;  2NSZ A;  3PDN A;  2IFU A;  3QAQ A;  1P5Q A;  4XE0 A;  3EDT B;  3FP3 A;  3IBE A;  4CDN A;  4N2Q A;  4BY6 A;  5D0O D;  3TAX A;  2BF0 X;  3U64 A;  4F3V A;  1H2T C;  3CHP A;  1NP7 A;  3JCK C;  4GZ6 A;  1E8X A;  1FCH A;  1ELW A;  2XHE A;  5BUZ A;  4WWO A;  3LY7 A;  2IF4 A;  2VTB B;  3CVY A;  5BNW A;  4URK A;  3CVX A;  1Y8M A;  3R7R A;  3CKB A;  1HE8 A;  4JPS A;  4Q69 A;  4YVO A;  4CEM A;  3APC A;  3MA5 A;  3ZYK A;  3LKU A;  4W9R A;  3S7D A;  5AEN A;  4M3O A;  4N3B A;  4KVM A;  2BUG A;  2KZT A;  4I9C A;  4TUU A;  5ARG A;  3CK9 A;  3ML8 A;  5CHE E;  4GML A;  4P29 A;  4HOR A;  1HH8 A;  3DBS A;  3N71 A;  4B94 A;  3SNX A;  1S0P A;  4A3V A;  2J4B A;  3QK0 A;  1JWG A;  2WQH A;  4UWH A;  3AU5 A;  2XPY A;  3JQ1 A;  2L9B A;  3BEE A;  1HXI A;  2V8S E;  3ONK A;  3EJN A;  3L22 A;  5C2Y A;  3ZRH A;  3IEG A;  4GA1 A;  3ENE A;  4GA0 A;  4I43 A;  2CFU A;  1JWF A;  4IN3 B;  4KZC A;  4C0E A;  5A23 A;  4WWN A;  3I5P A;  1HFA A;  4JHJ A;  3UUX A;  4DK5 A;  1BPO A;  4HLE A;  5E75 A;  4H7Y A;  2KZT B;  1EPU A;  1WM5 A;  5HQ8 A;  4N3A A;  3UX4 A;  4D10 C;  2ZU6 B;  2AVP A;  2DBA A;  2CHX A;  2E0I A;  3L16 A;  4JC8 A;  4L2L A;  5G05 C;  3RK6 A;  2WMN A;  4CDR A;  3MV3 B;  3FH5 A;  4GB9 A;  3U4T A;  4IYP A;  4CT0 A;  3FFL A;  3SI5 A;  3R9A B;  1EDU A;  1DNP A;  3LEW A;  2WXR A;  4BT9 A;  3ZXS A;  5G05 J;  4AVX A;  1FVH A;  2UWJ G;  2KC7 A;  1JUQ A;  4NRH B;  2YIN A;  2GRL A;  2X6H A;  4MRU A;  3WXX A;  5JHB A;  4CRW A;  2FUL A;  2VJ8 A;  5FWQ A;  3APF A;  3QWW A;  4EBA G;  4RG9 A;  2XRZ A;  2WXN A;  4Y6W A;  3MKQ B;  4JW1 A;  4Q94 A;  3ZHE A;  3AS4 A;  3SFZ A;  2XCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...