2DIWA

Solution structure of the rpr domain of putative rna-binding protein 16
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
152
Chain Sequence
b'GSSGSSGDNMEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative RNA-binding protein 16
publication title Solution structure of the RPR domain of Putative RNA-binding protein 16
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 37
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2diwA01
1VDYA 1H0AA 3G2WA 1EYHA 1HX8A 3CLJA 1LF8A 1JUQA 2BF0X 3D9NA 2DCPA 2LO6A 4NACA 3D9PA 3G2VA 3LDZA 5CMYA 3D9LA 1DVPA 5LOZA 1JWGA 5CMWA 3D9KA 3G2SA 1UJJA 4GZDA 1SZAA 3ONLA 4Q94A 2L0TB 4FU3A 3ZYMA 1XGWA 1SZ9A 3ZYKA 5J08A 1HG2A 3D9IA 3D9MA 1X5BA 4FLBA 2DIWA 3D9JA 3G2UA 4JXTA 1ELKA 1MHQA 2MOWA 3ZYLA 1PY1A 3RRUA 5LP0A 3G2TA 1INZA 2V8SE 4GZCA 4Q96A 4HFGA 3ONKA 3ZYQA 4AVXA 2QY7A 1JPLA 3D9OA 1HF8A 1JWFA 1HG5A 2KM4A 1UJKA 2L0IA 1HFAA 1EDUA
chains in the Genus database with same CATH superfamily
1ZU2A 2L9BA 3FU3A 2J4DA 4J8FA 3EU5A 1UJJA 3EU9A 1H19A 1Z3XA 2UWJG 3ULEG 4XI0A 3ZVVA 2X6KA 3KEZA 2LO6A 2VTBB 2GW1A 3QJZA 4U04A 3C72A 4ZFHA 4UWFA 3D9IA 1NI1A 1N54A 5CRVA 1OCZE 2E2EA 4N3BA 2H6FA 4JHRA 1A5EA 3C3OA 1UN8A 3TWQA 2V5QC 3O4ZA 4PUCA 4Q69A 3E32A 4GZDA 4GZ6A 4J8YA 1SZ9A 1H6OA 4HXIA 3CV0A 3CK8A 5AYWD 3ML8A 2LXMA 2HR2A 3Q7FA 4K5AB 3TWSA 2FI7A 4V3IA 4J6IA 4GA1A 3RSEG 5KJNA 3R9MA 5BPPA 3ZHEA 4FJYA 2KZTB 3EDTB 4F6RD 1NA3A 3ONLA 3QWWA 1ZBPA 4U8HA 3SGHA 2EILE 3QNKA 4APOA 1V54E 2Y1LE 4AM9A 1H0AA 2HE0A 2PM6A 4UWKA 5ARFA 1QNFA 5JJ6A 3LKUA 3N71A 5G55A 5CECB 4GMJA 1ELKA 3HXCA 2CHWA 2DZNA 4OAVB 3BUAA 3UM2A 1IXVA 2WXQA 4GTQA 3I5PA 4HRNA 4QFVA 3TWRA 4L1BA 1HO8A 4XKCA 2P2CP 4LUNU 4DRXE 4O1OA 4I43A 3Q4AB 2FULA 3KEAA 1S70B 3ZFWA 3CVQA 4M7CA 4A1GA 3KS2A 1G3NB 3HXEA 3PVLA 4RG6A 5FWQA 3EHMA 4DK5A 1Z6TA 5ARGA 4G2VA 4BTBA 3MKQB 5JJTA 2P9UG 1O5MA 4L2YA 4UWHA 3U9WA 2VYIA 4YDOA 4W9RA 3RK6A 5ENRD 2XRYA 5KBAA 5AN8A 1TR4A 4BY6A 2C2LA 3ZRHA 4DI3A 1S64A 2DIWA 3HVEA 4EHMA 2IO2C 2WXJA 2B6CA 4FJZA 2WMNA 2OV8A 4XEIG 2H6HA 4YDEA 3FUJA 3CHSA 1D8DA 1P5QA 4MRUA 2XEEA 1H6PA 4LSZE 3NZSA 5E76A 5A23A 1SA5A 2OOEA 4XKBA 3MCXA 3QAQA 1H2TC 3B7RL 3ZXSA 4AJWA 4GMLA 1E96B 1WAO1 1A17A 2J07A 5CMYA 3FY4A 4KZCA 4B0ZA 4BETA 3UT7A 2HYZA 2J08A 3CR3A 5FQ7A 4ZHBA 3AAAC 2GRPB 4XI9A 1O1TA 5B1AE 1N4PA 2J4BA 2XPYA 4HBDA 5EX0A 1UW4B 2WXPA 1OWNA 1EPUA 3PEVB 4GA0A 4G8LA 4A1SA 4A55A 2H6IA 4CEMA 3Q9UC 3B95A 2X6IA 3HG0D 4DJAA 4GZCA 3ONKA 3ZHEB 1H6KA 3UM0A 1BU9A 1WDYA 3P2BA 4YDYA 1EF1C 3FTYA 4FLHA 4O1PA 5CEDB 5CEAA 3QWVA 4KT6B 5BV1A 4K5CA 1PAQA 3RKVA 3W9FA 2YHEA 1LD8A 4C9BB 3LY9A 5M72A 2EINE 2XCBA 2AXUA 3RJVA 3ASHA 3SI5A 3B7BA 1BPOA 3FEXA 3Q15A 4O60A 2I1KA 4GB9A 3X2QE 3FU6A 1OXJA 3PZ3A 3AG2E 3HRAA 1FVFA 3DPDA 3ASOE 3RRNB 3TWXA 3PUKA 2R17C 3FUNA 4DUIA 3E30A 2V4HC 4WNFA 1N52A 2CHXA 4BWRA 4JVSA 2VGXB 2B0OE 3AU4A 4IULA 5BW8C 4GTTA 3PREA 3UUXA 4N39A 1N4QA 1LD7A 4I2ZA 3G2VA 4TUMA 5D0QD 5H7PA 3TWWA 4UWLA 3CKCA 4EPZA 3AG4E 1MX2A 3ENEA 1OWMA 3IBEA 4YVQC 5AQAA 1N95A 2AXVA 3IHVA 4J8SA 1E8ZA 3GZ2A 3UT8A 2RD0A 4U8YD 3QB2A 3TAXA 3URZA 3QARA 3P1UA 1JCQA 1YYHA 4ABNA 2RFAA 4OYSA 3ZEFA 2WQ6A 2RFMA 4I6EA 2DZOA 4XIFA 2XS8A 4CDNA 3ZYQA 4JC8A 3NBNB 5EDSA 4BTAA 1IQUA 4HLEA 3CVYA 5AQBA 3LJ3A 4I6GA 3ZXPA 3PEUB 1OCOE 3L6AA 3PE4A 4U8VD 2E0IA 3MV3B 3QK0A 5CHEE 1EDUA 2VSYA 1JUQA 2XHEA 3FP3A 1NP7A 3F6QA 2WXGA 2FF4A 5C2YA 5FQ6A 2DYRE 3Q7AA 3Q75A 4N5CA 4F53A 1SA4A 3S7FA 4ACLA 2AXZA 2XS1A 5ENPD 2Y0BG 1JWGA 5CMWA 4NRHB 3VTXA 3IEGA 3SHFA 4UI9C 1H2VC 2XRZA 1XGWA 5JMND 4WAFA 2VSXE 4FLBA 1BI8B 5JA4D 3Q79A 1UJKA 3S7BA 2I1JA 3UM3A 3K9IA 5KJMA 3HXFA 1TN7A 1TN8A 2KC7A 4ATGA 2AW6A 2OVBA 4KZ0A 4B89A 1ELRA 3UPVA 3ABME 1HE8A 3S7JA 2IONA 5G05C 4YNDA 1KT1A 3SFZA 1DCQA 2WQHA 5C1DA 3RU0A 3NZUA 2GRMA 2EIJE 1SW6A 1AP7A 4I9EA 2NXPA 3CVVA 4YDWA 5FJYA 3SFXA 3ASNE 2A5EA 3SQVA 4BX8A 4AY6A 4MKTA 3MZLB 1QQEA 1BI7B 4HOTA 3LY7A 2ZGGA 2EIME 1H2UA 3ML9A 2ETCA 1HH8A 5CBOA 5KNGA 2J9QA 2IY0C 3UQ3A 3Q9NC 3L9TA 1TJCA 1HZ4A 3MEKA 3SBSA 3VLEA 2R02A 3GYZA 5ANLA 2WXHA 4HS2A 4FC8A 2PNNA 3FU5A 3IXEA 3DPYA 4GYYA 4L7TA 3L82A 4O6FA 3AS8A 3ZKJA 3UI2A 2DWZA 2LSUA 2QZAA 2OVFA 1HU3A 2KXPC 2VQ2A 2QFCA 1OY3D 2L0TB 3UT4A 3L08A 5KNHD 5CRUA 2BKGA 5AJDA 4DLOA 2PQRA 2QY7A 1IYGA 1WM5A 3AS5A 2BKKB 4EECA 3MKRA 4JHJA 2GRLA 5ENQD 4HB5A 2YHCA 4WWPA 3KSQA 3JXJA 1ZB1A 2F37A 5ENNA 3SZ7A 3U64A 2V8SE 3Q47B 3CQGB 4K0RA 3I4GA 4FHKA 1DCEA 4GTPA 4F3VA 3R7QA 4GPMA 3FUHA 4PH4B 4UQXA 3ZNGA 1IKND 3CHPA 4HOQA 5AQ7A 3MA5A 3FHEA 4I1OB 2Q7FA 2C0LA 2ZISA 3EIJA 1XNFA 2VJ8A 2YQ8A 3PE3A 2I6HA 2P58C 3NB2A 3DBSA 4U95D 1AWCB 2LNIA 1Z3YA 1K1BA 3LXUX 4K5BA 1FVHA 3UXGA 4HOSA 3HXDA 5EKQD 3D9JA 5FTPA 1O1SA 3AG1E 3NAWA 4HFGA 3ZN3A 1W3BA 4WWNA 3Q5MA 5KJKA 3DXKG 2XGSA 4GAAA 5AQ9A 3D3MA 3TL5A 4HNAD 4DX6D 4GPKA 3PZ2A 3JUIA 3SD5A 3V31A 1PY1A 4I1AA 3DSUA 3ZUVB 1HFAA 4MBGA 4UQZA 1TNZA 2KCVA 5DBKA 2M63A 2KCKA 3KAEA 2VGEA 1U3DA 3GW4A 4R7LA 2F0YA 2P9LG 2WXKA 3RO2A 4CDRA 2QYUA 3G2TA 4UUCA 4J7WA 1OWOA 4FULA 1YMPA 3D9HA 3SY2A 4KVOA 2MYOA 3LDZA 4ANXA 3D9LA 3ULQA 5T4YA 3T5VA 3ESKA 3PNLB 3TXMA 2P9PG 2XEVA 3FH7A 3APFA 3UINC 4PS3A 1U2VG 4G25A 5E75A 4LERA 3ZGQA 1D8EA 2Y4TA 4X8QA 3L16A 1VDYA 4DX1A 2Y69E 3CLJA 3W9GA 2EIKE 5BXOA 3RO3A 4TXRA 4BX9A 4N2SA 3BU8A 4WNGA 4G1TA 5JHBA 3G2UA 4H7XA 4ILHB 2MOWA 2ONDA 1TN6A 4BERA 3FTUA 2MHKA 3NQPA 2AWIA 2I9CA 2JABA 4JD2G 4RQIA 3LVRE 5EIBE 3PZDA 4I2WA 4GTMA 2FO1E 3FFLA 1RZ4A 5G04J 4L23A 4HI8A 2ZU6B 1OWPA 3I3NA 4WNDA 3C98A 1JCSA 5IY5E 3UIOC 2VSOE 3FUEA 3CVLA 4DI4A 3FUKA 1MYOA 5CCLA 4EZJA 4URKA 3O48A 2P9NG 3VLFA 2XGMA 3HHMA 4QQIA 2CFZA 2WXOA 4APFA 3B13A 2XPZA 2PM7A 5EX3A 3U3WA 2R03A 5DIZA 1RW2A 3D9PA 3UIPC 3AG3E 3ABKE 3CSFA 3T8KA 4F1PA 3SO8A 3T8MA 1MX6A 4Y6WA 3R7RA 4LNBA 3ASFA 1KT0A 1TNOA 4A3VA 2WMOA 1GW6A 2PZIA 3FTSA 3GZ1A 2XENA 3QOUA 3FU0A 1N11A 4GTOA 3RIBA 2Y4UA 2VSNA 2FO7A 2WXNA 4Y6CA 1BD8A 3GZSA 3SF4A 1NZNA 2WXLA 1X5BA 3RRMB 3S7DA 3IHYA 5B3SE 4U0ZA 3OXFA 2FBNA 3CHQA 2XCCA 4GCOA 4LNGA 4CDMA 5FINA 3CHRA 3TGOA 5EYPF 3ISMC 4U96D 4JEUA 4XX5A 1YCSB 5FZSA 2VTBA 3HVEB 3RRUA 2R59A 3LPZA 3Q49B 3MYVA 1OCCE 4N3CA 4RLYA 2NYJA 4JA9A 4ME2A 4I9CA 5CERB 4K03A 3WG7E 1SZAA 4G8KA 2Y3AA 2J8SD 2YNQA 4WUYA 2GRNB 1TNBA 5AAOA 3MX3A 4JA7A 4G26A 1IHBA 3QC1A 3FUMA 4NIKA 4E6HA 4N2QA 4GU5A 1S63A 2GGFA 1K8KG 3DEPA 1FT2A 4EZKA 4TXQA 2KZTA 5LFAA 3ASGA 3C3QA 5LCWC 4DX5D 4TRQA 2X38A 4U0UA 3ASDA 4OVVA 1YA0A 4BEPA 4JEHA 5HI7A 3DSSA 4EBAA 5HKPA 1TJFA 3T5XA 3FUDA 3Q73A 2PQNA 1O1RA 2XQ0A 3G2WA 4YVOA 1FCHA 1KZPA 1X81A 4I17A 4LEUA 3ZIMA 3DXMG 2DVWA 1IQRA 2X6FA 5BUZA 3AJIA 2R5SA 3CGHA 4FP7A 4M3OA 4GZ5A 5J08A 2I2OA 2LAHA 4MS6A 4AP2A 1E7VA 4U7EB 2KM4A 4AIFA 4UI9J 4BFRA 4L2LA 1HX8A 2L6JA 4JHKA 4KYOB 3EIQC 3CIAA 4CYMD 3HIZA 5FZRA 4J8EA 2GRQB 3U66A 1MQSA 3ZYMA 4AEZC 1N4SA 1HG2A 4BSXA 1U3CA 4TV3A 4FADA 3BQOA 3L17A 4RVBA 5ANRA 5AIJA 2WXIA 2KATA 3L22A 3AU5A 2DBAA 3FTVA 1LTXA 2KCLA 3J5QB 5G05J 4CT4A 3BEEA 4HLLA 4WNEA 2IFUA 3B7SA 4BESA 1UOHA 3FUIA 4HOUA 3UX4A 5BNWA 1KZOA 4N3AA 5AENA 2ZGDA 3MJWA 3LY8A 3DSWA 2IOSA 5ITZF 1MJ0A 1TNYA 4ANVA 4G11A 4UI9K 3PRZA 4G23A 2XZTG 4RSYA 3B7UX 1TYQG 3HYMB 1KPSB 2X6HA 3QKYA 3FH8A 2L6BA 1QYMA 3VLDA 3PZ4A 3SBTB 2L0IA 4GTRA 2ETAA 1K1AA 2BF0X 3L13A 2NSZA 3JCKC 1WY6A 2GRRB 5D66A 3KD7A 4HQDA 2OEWA 3FTXA 4NQ0A 3HDXA 5ENSD 3E33A 3PDNA 4D10C 2WB2A 2WM9A 2WXFA 4XE0A 3DSVA 3RAUA 4BSZB 5KCMA 4JXTA 5KJLA 2ZXWE 3FUFA 1E90A 4EZLA 1JWFA 3FEYA 2XPIA 4BT9A 3IKOB 1N0RA 4LCTA 3EHNA 2J09A 1N9AA 2PL2A 2BEDA 1L5JA 4C0EA 1SQMA 3PNTB 3HXBA 5EILA 1IHGA 2A4ZA 4JW1A 4CCAA 1TNUA 2UY1A 4LNUD 2IO3C 1N4RA 4DX7D 3PH0C 3I4RB 2AVPA 3LEWA 2R2LA 3B7TA 4CZ2D 2JLBA 3ZW3A 4DX2A 4P29A 1NFIE 3ULYA 5AARA 3C5RA 4HI9A 3APDA 2RG8A 3R9AB 3NOGD 2XGOA 2VGXA 4CGVA 4U07A 1N0QA 3TWTA 3APCA 3TJPA 4ATZD 4HORA 1B89A 4GMRA 3FULA 2WVIA 3PS6A 5ENOD 2CG3A 2F8XK 4U63A 2X3MA 5FQ8A 2J49A 4B8AA 2F8YA 1PC2A 3CEQA 4KXKB 3DSTA 4IRUA 3VTYA 2LAIA 2VGYA 3PUJA 3C3RA 4JZYA 2EQXA 1DC2A 4UQYA 4B94A 3PZ1A 1MX4A 2CG2A 4XZ4A 1D9SA 4FU3A 2V4LA 3DRAA 5FIOA 5HS0A 5EYLA 4PDXA 1ELWA 1OWLA 2ZIRA 1HF8A 3DEOA 3KSLA 3CHOA 4LG6A 4J0UA 3WXXA 3J5PA 2CFUA 3JXIA 5EIDA 5LOZA 4FHJA 4L9PA 4EBAG 3G2SA 5KWDA 2WXRA 3AS4A 5FQ4A 5BV0A 2A5UA 1N94A 4ACKA 1QBQA 5A7DB 3Q78A 3JQ0A 4AY5A 4GTVA 4BT8A 3MGBA 3UTMA 3DWLG 2OEVA 4B93B 1EYHA 3D9NA 4I6JA 1E7UA 1WG0A 2V0PA 2IEJA 3V2OA 2XEHA 3UM1A 3NF1A 4AOFA 1HS6A 3ZYLA 3V79K 4JPSA 3LYAA 2P9SG 2C0MA 3FDHA 4ANUA 4CT0A 3OTNA 3CVXA 4U0SA 4NURA 4Q94A 1Z5SC 4G24A 4GA2A 4GYOA 5G04C 4ILGA 4GTSA 3U4TA 4JB8P 1OCRE 1UN9A 4KVMA 3LJNA 3SFYA 4H7YA 5FZQA 5BXUA 2LXLA 3V2XA 3T9KA 4ILIA 3CKBA 3UKUG 4IYPA 3CHMA 2BUGA 1E8XA 3TWUA 5FT9A 4CRWA 2AJAA 1JCRA 3E37A 1Y6IA 4UWGA 4WWOA 3CVPA 2X6JA 3CK7A 2JEKA 3CK9A 4HRMB 3S2AA 4Q96A 2UY1B 2YINA 3FH5A 4C0MA 4OAUC 2H6GA 2DCPA 3SNXA 2RKKA 3UMVA 4HRLA 3ZYKA 4I1MA 3ESLA 3ZU7B 3MV2B 4B8CB 3TG5A 3FTZA 3EHRA 3UKRG 2R05A 3CSTA 1SVXA 5B1BE 3TG4A 1OT8A 4A3TA 5HQ8A 2QC9A 5ENTD 1MZCA 3JYSA 3CVWA 3EUVA 2NC9A 1E8YA 3E34A 3TWVA 1NA0A 1S0PA 3ZPJA 3L54A 3CVUA 3V30A 4TXPA 2OCCE 2P9KG 3QWPA 2WXMA 1BLXB 2IJGX 1DVPA 3JUEA 4GYWA 3TXNA 3FTWA 1FT1A 3EHQA 2IQCA 4LRZA 5BT1A 2ILRA 4N5QA 1K3ZD 5EN5D 1V55E 2HM8A 3ABLE 2BTDA 3OAWA 4TUUA 3CQCB 3BG0B 4F7AA 5HRYA 3D9KA 4GCNA 5T8IA 4AV7A 5LX8A 2CHZA 5D0OD 3D9MA 2FEZA 3LS8A 4GZ3A 4AXHA 3QDNA 5CBNA 1KLXA 1LF8A 1UG3A 4CGWA 3EJNA 3JQ1A 5LCWJ 2WQ7A 2IF4A 3E4BA 1DNPA 4DPRA 4JL0A 2HO1A 2XZDG 5D2MC 3OXLA 3LCAA 2DYSE 4PS8A 1NL4A 1E8WA 2P9IG 2LUHA 3DSXA 1TEZA 3FWVA 5G2NA 4J8DA 2WPVA 1MHQA 4IN3B 2IOLA 5T3RA 1Y8MA 5CCMA 4F1SA 3CVNA 2ETBA 4KMOA 3NOCD 5A6CA 4E85A 2LSVA 2GROB 1HXIA 1FPPA 2IU1A 4KBQA 4ANWA 4PS7A 4EQFA 4RG9A 5LP0A 1INZA 4AVXA 1OUVA 2QYJA 1HG5A 4MLPA 3IV0A 3MKQA 2KBXA 4NACA 3LVQE 5JHAA 1QZ2A 2V5FA 5AJLA 4A63B 5JJ7A 5J90A 4OVUA 4DLQA 3OXGA 4HVBA 1Q2ZA 3BG1B 1JPLA 3D9OA 4Z68A 4FA6A 4C48B 2MRIA
chains in the Genus database with same CATH topology
4JW1A 2MHKA 3NQPA 1ZU2A 4CCAA 2AWIA 2I9CA 4ABNA 2L9BA 3FU3A 2UY1A 4OYSA 2J4DA 3LVRE 3PZDA 4J8FA 3PH0C 4I2WA 3ZEFA 2WQ6A 3I4RB 2AVPA 1UJJA 3LEWA 3FFLA 3B7TA 5G04J 1H19A 4I6EA 4L23A 2ZU6B 2JLBA 1OWPA 1Z3XA 2UWJG 3I3NA 3ZW3A 4WNDA 3C98A 4P29A 4XI0A 3ZVVA 4XIFA 4CDNA 3ZYQA 2VSOE 3FUEA 3CVLA 4JC8A 4DI4A 3FUKA 5CCLA 4EZJA 3APDA 2X6KA 5EDSA 2RG8A 4BTAA 3R9AB 4URKA 1IQUA 2VGXA 2XGOA 3O48A 3KEZA 4HLEA 4CGVA 2LO6A 2VTBB 3VLFA 2XGMA 3CVYA 3LJ3A 4I6GA 4U07A 2GW1A 3PEUB 3QJZA 4U04A 3HHMA 3APCA 2CFZA 3L6AA 3TJPA 4HORA 1B89A 4UWFA 3FULA 2WVIA 2WXOA 3D9IA 4APFA 3B13A 3PE4A 3PS6A 2CG3A 2E0IA 2XPZA 1N54A 2PM7A 3MV3B 4U63A 5EX3A 2E2EA 3QK0A 4N3BA 5CHEE 2X3MA 5FQ8A 3U3WA 2J49A 1EDUA 4B8AA 1PC2A 3CEQA 4JHRA 5DIZA 4KXKB 4IRUA 2VSYA 3VTYA 1JUQA 2LAIA 2VGYA 3PUJA 1UN8A 2XHEA 1NP7A 3D9PA 2WXGA 3FP3A 2EQXA 3O4ZA 4UQYA 2FF4A 3CSFA 4PUCA 4B94A 5C2YA 5FQ6A 4Q69A 4GZDA 3T8MA 4GZ6A 2CG2A 4XZ4A 4FU3A 1SZ9A 2V4LA 4Y6WA 4HXIA 3CV0A 3CK8A 3R7RA 5AYWD 3ML8A 4PDXA 2HR2A 3ASFA 1KT0A 1ELWA 4N5CA 1OWLA 4A3VA 1HF8A 2WMOA 1GW6A 2FI7A 4V3IA 2PZIA 3FTSA 4J6IA 4GA1A 4F53A 3GZ1A 5KJNA 3CHOA 4J0UA 3WXXA 5BPPA 2CFUA 3S7FA 3ZHEA 5LOZA 3QOUA 4FHJA 4FJYA 4ACLA 2AXZA 3FU0A 3RIBA 1JWGA 4EBAG 5CMWA 2Y4UA 2KZTB 4NRHB 3EDTB 2VSNA 3G2SA 3VTXA 2FO7A 3IEGA 1NA3A 2WXNA 3ONLA 4UI9C 3SHFA 4Y6CA 3QWWA 1H2VC 2XRZA 1XGWA 2WXRA 3AS4A 3GZSA 5FQ4A 3SF4A 1ZBPA 1NZNA 2WXLA 4U8HA 4WAFA 2VSXE 2A5UA 3SGHA 5BV0A 1X5BA 3RRMB 4FLBA 3S7DA 4ACKA 3IHYA 4U0ZA 3QNKA 4APOA 3OXFA 5A7DB 3JQ0A 2FBNA 4AY5A 4BT8A 3CHQA 2XCCA 3MGBA 1UJKA 4AM9A 4GCOA 1H0AA 4CDMA 3CHRA 3S7BA 1EYHA 2I1JA 3TGOA 2PM6A 3D9NA 4UWKA 4I6JA 3K9IA 1E7UA 5ARFA 4JEUA 2V0PA 1QNFA 5KJMA 5JJ6A 3LKUA 3N71A 4XX5A 5G55A 5FZSA 2VTBA 4GMJA 2KC7A 3HVEB 3NF1A 4ATGA 2AW6A 2OVBA 4AOFA 1ELKA 1HS6A 3ZYLA 4KZ0A 3RRUA 2CHWA 2R59A 3LPZA 3Q49B 4B89A 3MYVA 3FTUA 1ELRA 4JPSA 2WXQA 3UPVA 3LYAA 4N3CA 3I5PA 1HE8A 3S7JA 4JA9A 2C0MA 2IONA 3FDHA 4QFVA 5G05C 4ANUA 4YNDA 1KT1A 4CT0A 3SFZA 3OTNA 4ME2A 2WQHA 4L1BA 4I9CA 5C1DA 3RU0A 3NZUA 3CVXA 2GRMA 4U0SA 1HO8A 4XKCA 4NURA 4K03A 1SZAA 4Q94A 4LUNU 2Y3AA 4I9EA 2NXPA 4G24A 4GA2A 2YNQA 4GYOA 4WUYA 3MX3A 4I43A 3Q4AB 3CVVA 2FULA 5G04C 4ILGA 4JA7A 4G26A 5FJYA 3QC1A 3U4TA 3ZFWA 4KVMA 1UN9A 3CVQA 3FUMA 4E6HA 4BX8A 4AY6A 4H7YA 5FZQA 4A1GA 4MKTA 3MZLB 1QQEA 3KS2A 4HOTA 4N2QA 4ILIA 3CKBA 3LY7A 4IYPA 4GU5A 3CHMA 1H2UA 3PVLA 4RG6A 5FWQA 2GGFA 2BUGA 3ML9A 1E8XA 3EHMA 5FT9A 4EZKA 1HH8A 4DK5A 1Z6TA 5ARGA 4G2VA 4BTBA 2KZTA 3MKQB 2J9QA 4CRWA 5JJTA 3UQ3A 5LFAA 4L2YA 4UWHA 3U9WA 3ASGA 5LCWC 1Y6IA 4UWGA 1TJCA 4TRQA 1HZ4A 2VYIA 3MEKA 3SBSA 4WWOA 2X38A 3VLEA 3GYZA 4U0UA 4W9RA 3ASDA 3RK6A 4OVVA 5ANLA 2WXHA 1YA0A 2XRYA 4HS2A 4FC8A 4JEHA 3CVPA 5HI7A 4EBAA 2X6JA 1TJFA 2C2LA 3FU5A 3ZRHA 4BY6A 4DI3A 3CK7A 3T5XA 2DIWA 2JEKA 3CK9A 4GYYA 4L7TA 3FUDA 3S2AA 2PQNA 4Q96A 2UY1B 3HVEA 2YINA 2XQ0A 3FH5A 3G2WA 4O6FA 4YVOA 2WXJA 4C0MA 4FJZA 1FCHA 2WMNA 3AS8A 4I17A 2OV8A 4LEUA 3ZIMA 3FUJA 2DCPA 3SNXA 1IQRA 2X6FA 2LSUA 2OVFA 1HU3A 1P5QA 3CHSA 4MRUA 5BUZA 2R5SA 2VQ2A 3CGHA 4FP7A 2QFCA 3UMVA 4M3OA 4GZ5A 2L0TB 3UT4A 3L08A 3ZYKA 5J08A 4I1MA 3ESLA 3NZSA 2I2OA 3MV2B 5E76A 4B8CB 5A23A 2LAHA 4MS6A 3TG5A 4AP2A 3FTZA 2OOEA 1E7VA 4XKBA 5AJDA 4DLOA 2PQRA 2QY7A 3CSTA 3MCXA 3TG4A 3QAQA 2KM4A 4AIFA 4UI9J 1IYGA 1H2TC 1WM5A 4BFRA 3B7RL 3AS5A 4L2LA 4A3TA 3ZXSA 5HQ8A 4AJWA 4GMLA 1HX8A 1E96B 2L6JA 4EECA 1WAO1 1A17A 4JHKA 4KYOB 2J07A 3EIQC 3CIAA 5CMYA 3FY4A 3MKRA 4KZCA 3HIZA 2GRLA 4JHJA 5FZRA 4B0ZA 3JYSA 4J8EA 3UT7A 2YHCA 4WWPA 3CVWA 2HYZA 3U66A 1MQSA 3ZYMA 4AEZC 2J08A 2NC9A 1HG2A 3CR3A 5FQ7A 1E8YA 4BSXA 5ENNA 3SZ7A 1U3CA 4TV3A 3U64A 4FADA 4XI9A 2V8SE 1NA0A 1S0PA 3ZPJA 3L54A 3Q47B 3CQGB 3L17A 4K0RA 4RVBA 3CVUA 2J4BA 5ANRA 5AIJA 2XPYA 5EX0A 1UW4B 2WXPA 1OWNA 1EPUA 2WXIA 3QWPA 2KATA 2WXMA 3L22A 3I4GA 4FHKA 2IJGX 3PEVB 1DVPA 4GA0A 3AU5A 4F3VA 2DBAA 3R7QA 3FUHA 4GYWA 3FTVA 4PH4B 4UQXA 3TXNA 3CHPA 4HOQA 3FTWA 4A1SA 3MA5A 4A55A 2KCLA 3FHEA 4I1OB 4CEMA 5G05J 4CT4A 2IQCA 2X6IA 3BEEA 4DJAA 4LRZA 2Q7FA 4WNEA 5BT1A 2C0LA 2ILRA 4GZCA 3EIJA 3ONKA 1XNFA 3ZHEB 2IFUA 3B7SA 1H6KA 2VJ8A 2YQ8A 3PE3A 2HM8A 3P2BA 2I6HA 2P58C 1EF1C 3FUIA 4HOUA 3DBSA 3FTYA 4FLHA 3UX4A 5BNWA 2BTDA 3OAWA 4TUUA 4N3AA 3CQCB 5AENA 3BG0B 4F7AA 3QWVA 4KT6B 3MJWA 3D9KA 4GCNA 2LNIA 3LY8A 1Z3YA 5T8IA 3LXUX 1FVHA 4AV7A 5BV1A 5LX8A 2IOSA 2CHZA 5D0OD 4HOSA 3D9MA 2FEZA 3LS8A 4GZ3A 5EKQD 4AXHA 3D9JA 1PAQA 5FTPA 3QDNA 4HFGA 3ZN3A 3RKVA 1W3BA 4ANVA 4G11A 2YHEA 4WWNA 3Q5MA 4C9BB 1KLXA 5KJKA 3LY9A 5M72A 1LF8A 1UG3A 4UI9K 4CGWA 2XGSA 2XCBA 3PRZA 2AXUA 3EJNA 3ASHA 3JQ1A 3P1UA 4G23A 4GAAA 3RJVA 3SI5A 3D3MA 5LCWJ 2WQ7A 2IF4A 1BPOA 4RSYA 3FEXA 3TL5A 3B7UX 3HYMB 3QKYA 4GPKA 2X6HA 3E4BA 1DNPA 3JUIA 3Q15A 3FH8A 4JL0A 3SD5A 4DPRA 2I1KA 4GB9A 1PY1A 4I1AA 2HO1A 3FU6A 3VLDA 3SBTB 3OXLA 3LCAA 2L0IA 1HFAA 4PS8A 4UQZA 1FVFA 3DPDA 2KCVA 1E8WA 2BF0X 2M63A 5DBKA 3RRNB 3L13A 2KCKA 3KAEA 3PUKA 1TEZA 3FWVA 1U3DA 5G2NA 2NSZA 2R17C 3FUNA 3GW4A 3JCKC 1WY6A 4J8DA 2WPVA 4R7LA 3KD7A 4WNFA 1N52A 2WXKA 3RO2A 2CHXA 3FTXA 4CDRA 1MHQA 4BWRA 4JVSA 3G2TA 2IOLA 4IN3B 1Y8MA 2VGXB 4NQ0A 5T3RA 4F1SA 5CCMA 3AU4A 3CVNA 4IULA 3HDXA 5BW8C 3PREA 3UUXA 4N39A 4KMOA 1OWOA 4I2ZA 4FULA 5A6CA 4E85A 3PDNA 2LSVA 4KVOA 4D10C 3G2VA 3LDZA 1HXIA 4ANXA 3D9LA 3ULQA 2WB2A 5T4YA 3T5VA 2WM9A 3ESKA 5D0QD 3PNLB 3TXMA 2IU1A 4JZYA 2WXFA 4UWLA 3CKCA 4XE0A 2XEVA 3FH7A 4KBQA 4ANWA 3APFA 4EPZA 4PS3A 4PS7A 5KCMA 4EQFA 4JXTA 4G25A 4RG9A 5E75A 5KJLA 3ENEA 1OWMA 5LP0A 1INZA 4AVXA 3FUFA 4LERA 1E90A 3IBEA 4YVQC 3ZGQA 4EZLA 1OUVA 1JWFA 1HG5A 4MLPA 3IV0A 3MKQA 2Y4TA 3FEYA 3L16A 1VDYA 2XPIA 4BT9A 3IKOB 3CLJA 4LCTA 4NACA 3LVQE 2AXVA 3IHVA 5JHAA 3RO3A 3EHNA 4J8SA 4BX9A 1E8ZA 1QZ2A 3GZ2A 4N2SA 2V5FA 2J09A 3UT8A 4WNGA 2PL2A 5AJLA 2RD0A 4G1TA 5JJ7A 5JHBA 5J90A 4OVUA 4DLQA 1L5JA 3G2UA 3OXGA 1SQMA 3QB2A 4H7XA 4ILHB 2MOWA 4C0EA 3PNTB 4HVBA 3TAXA 3URZA 2ONDA 3BG1B 1JPLA 3D9OA 1IHGA 3QARA 4FA6A 2MRIA 2A4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDY A;  1H0A A;  3G2W A;  1EYH A;  1HX8 A;  3CLJ A;  1LF8 A;  1JUQ A;  2BF0 X;  3D9N A;  2DCP A;  2LO6 A;  4NAC A;  3D9P A;  3G2V A;  3LDZ A;  5CMY A;  3D9L A;  1DVP A;  5LOZ A;  1JWG A;  5CMW A;  3D9K A;  3G2S A;  1UJJ A;  4GZD A;  1SZA A;  3ONL A;  4Q94 A;  2L0T B;  4FU3 A;  3ZYM A;  1XGW A;  1SZ9 A;  3ZYK A;  5J08 A;  1HG2 A;  3D9I A;  3D9M A;  1X5B A;  4FLB A;  2DIW A;  3D9J A;  3G2U A;  4JXT A;  1ELK A;  1MHQ A;  2MOW A;  3ZYL A;  1PY1 A;  3RRU A;  5LP0 A;  3G2T A;  1INZ A;  2V8S E;  4GZC A;  4Q96 A;  4HFG A;  3ONK A;  3ZYQ A;  4AVX A;  2QY7 A;  1JPL A;  3D9O A;  1HF8 A;  1JWF A;  1HG5 A;  2KM4 A;  1UJK A;  2L0I A;  1HFA A;  1EDU A; 
#chains in the Genus database with same CATH topology
 1ZU2 A;  2L9B A;  3FU3 A;  2J4D A;  4J8F A;  3EU5 A;  1UJJ A;  3EU9 A;  1H19 A;  1Z3X A;  2UWJ G;  3ULE G;  4XI0 A;  3ZVV A;  2X6K A;  3KEZ A;  2LO6 A;  2VTB B;  2GW1 A;  3QJZ A;  4U04 A;  3C72 A;  4ZFH A;  4UWF A;  3D9I A;  1NI1 A;  1N54 A;  5CRV A;  1OCZ E;  2E2E A;  4N3B A;  2H6F A;  4JHR A;  1A5E A;  3C3O A;  1UN8 A;  3TWQ A;  2V5Q C;  3O4Z A;  4PUC A;  4Q69 A;  3E32 A;  4GZD A;  4GZ6 A;  4J8Y A;  1SZ9 A;  1H6O A;  4HXI A;  3CV0 A;  3CK8 A;  5AYW D;  3ML8 A;  2LXM A;  2HR2 A;  3Q7F A;  4K5A B;  3TWS A;  2FI7 A;  4V3I A;  4J6I A;  4GA1 A;  3RSE G;  5KJN A;  3R9M A;  5BPP A;  3ZHE A;  4FJY A;  2KZT B;  3EDT B;  4F6R D;  1NA3 A;  3ONL A;  3QWW A;  1ZBP A;  4U8H A;  3SGH A;  2EIL E;  3QNK A;  4APO A;  1V54 E;  2Y1L E;  4AM9 A;  1H0A A;  2HE0 A;  2PM6 A;  4UWK A;  5ARF A;  1QNF A;  5JJ6 A;  3LKU A;  3N71 A;  5G55 A;  5CEC B;  4GMJ A;  1ELK A;  3HXC A;  2CHW A;  2DZN A;  4OAV B;  3BUA A;  3UM2 A;  1IXV A;  2WXQ A;  4GTQ A;  3I5P A;  4HRN A;  4QFV A;  3TWR A;  4L1B A;  1HO8 A;  4XKC A;  2P2C P;  4LUN U;  4DRX E;  4O1O A;  4I43 A;  3Q4A B;  2FUL A;  3KEA A;  1S70 B;  3ZFW A;  3CVQ A;  4M7C A;  4A1G A;  3KS2 A;  1G3N B;  3HXE A;  3PVL A;  4RG6 A;  5FWQ A;  3EHM A;  4DK5 A;  1Z6T A;  5ARG A;  4G2V A;  4BTB A;  3MKQ B;  5JJT A;  2P9U G;  1O5M A;  4L2Y A;  4UWH A;  3U9W A;  2VYI A;  4YDO A;  4W9R A;  3RK6 A;  5ENR D;  2XRY A;  5KBA A;  5AN8 A;  1TR4 A;  4BY6 A;  2C2L A;  3ZRH A;  4DI3 A;  1S64 A;  2DIW A;  3HVE A;  4EHM A;  2IO2 C;  2WXJ A;  2B6C A;  4FJZ A;  2WMN A;  2OV8 A;  4XEI G;  2H6H A;  4YDE A;  3FUJ A;  3CHS A;  1D8D A;  1P5Q A;  4MRU A;  2XEE A;  1H6P A;  4LSZ E;  3NZS A;  5E76 A;  5A23 A;  1SA5 A;  2OOE A;  4XKB A;  3MCX A;  3QAQ A;  1H2T C;  3B7R L;  3ZXS A;  4AJW A;  4GML A;  1E96 B;  1WAO 1;  1A17 A;  2J07 A;  5CMY A;  3FY4 A;  4KZC A;  4B0Z A;  4BET A;  3UT7 A;  2HYZ A;  2J08 A;  3CR3 A;  5FQ7 A;  4ZHB A;  3AAA C;  2GRP B;  4XI9 A;  1O1T A;  5B1A E;  1N4P A;  2J4B A;  2XPY A;  4HBD A;  5EX0 A;  1UW4 B;  2WXP A;  1OWN A;  1EPU A;  3PEV B;  4GA0 A;  4G8L A;  4A1S A;  4A55 A;  2H6I A;  4CEM A;  3Q9U C;  3B95 A;  2X6I A;  3HG0 D;  4DJA A;  4GZC A;  3ONK A;  3ZHE B;  1H6K A;  3UM0 A;  1BU9 A;  1WDY A;  3P2B A;  4YDY A;  1EF1 C;  3FTY A;  4FLH A;  4O1P A;  5CED B;  5CEA A;  3QWV A;  4KT6 B;  5BV1 A;  4K5C A;  1PAQ A;  3RKV A;  3W9F A;  2YHE A;  1LD8 A;  4C9B B;  3LY9 A;  5M72 A;  2EIN E;  2XCB A;  2AXU A;  3RJV A;  3ASH A;  3SI5 A;  3B7B A;  1BPO A;  3FEX A;  3Q15 A;  4O60 A;  2I1K A;  4GB9 A;  3X2Q E;  3FU6 A;  1OXJ A;  3PZ3 A;  3AG2 E;  3HRA A;  1FVF A;  3DPD A;  3ASO E;  3RRN B;  3TWX A;  3PUK A;  2R17 C;  3FUN A;  4DUI A;  3E30 A;  2V4H C;  4WNF A;  1N52 A;  2CHX A;  4BWR A;  4JVS A;  2VGX B;  2B0O E;  3AU4 A;  4IUL A;  5BW8 C;  4GTT A;  3PRE A;  3UUX A;  4N39 A;  1N4Q A;  1LD7 A;  4I2Z A;  3G2V A;  4TUM A;  5D0Q D;  5H7P A;  3TWW A;  4UWL A;  3CKC A;  4EPZ A;  3AG4 E;  1MX2 A;  3ENE A;  1OWM A;  3IBE A;  4YVQ C;  5AQA A;  1N95 A;  2AXV A;  3IHV A;  4J8S A;  1E8Z A;  3GZ2 A;  3UT8 A;  2RD0 A;  4U8Y D;  3QB2 A;  3TAX A;  3URZ A;  3QAR A;  3P1U A;  1JCQ A;  1YYH A;  4ABN A;  2RFA A;  4OYS A;  3ZEF A;  2WQ6 A;  2RFM A;  4I6E A;  2DZO A;  4XIF A;  2XS8 A;  4CDN A;  3ZYQ A;  4JC8 A;  3NBN B;  5EDS A;  4BTA A;  1IQU A;  4HLE A;  3CVY A;  5AQB A;  3LJ3 A;  4I6G A;  3ZXP A;  3PEU B;  1OCO E;  3L6A A;  3PE4 A;  4U8V D;  2E0I A;  3MV3 B;  3QK0 A;  5CHE E;  1EDU A;  2VSY A;  1JUQ A;  2XHE A;  3FP3 A;  1NP7 A;  3F6Q A;  2WXG A;  2FF4 A;  5C2Y A;  5FQ6 A;  2DYR E;  3Q7A A;  3Q75 A;  4N5C A;  4F53 A;  1SA4 A;  3S7F A;  4ACL A;  2AXZ A;  2XS1 A;  5ENP D;  2Y0B G;  1JWG A;  5CMW A;  4NRH B;  3VTX A;  3IEG A;  3SHF A;  4UI9 C;  1H2V C;  2XRZ A;  1XGW A;  5JMN D;  4WAF A;  2VSX E;  4FLB A;  1BI8 B;  5JA4 D;  3Q79 A;  1UJK A;  3S7B A;  2I1J A;  3UM3 A;  3K9I A;  5KJM A;  3HXF A;  1TN7 A;  1TN8 A;  2KC7 A;  4ATG A;  2AW6 A;  2OVB A;  4KZ0 A;  4B89 A;  1ELR A;  3UPV A;  3ABM E;  1HE8 A;  3S7J A;  2ION A;  5G05 C;  4YND A;  1KT1 A;  3SFZ A;  1DCQ A;  2WQH A;  5C1D A;  3RU0 A;  3NZU A;  2GRM A;  2EIJ E;  1SW6 A;  1AP7 A;  4I9E A;  2NXP A;  3CVV A;  4YDW A;  5FJY A;  3SFX A;  3ASN E;  2A5E A;  3SQV A;  4BX8 A;  4AY6 A;  4MKT A;  3MZL B;  1QQE A;  1BI7 B;  4HOT A;  3LY7 A;  2ZGG A;  2EIM E;  1H2U A;  3ML9 A;  2ETC A;  1HH8 A;  5CBO A;  5KNG A;  2J9Q A;  2IY0 C;  3UQ3 A;  3Q9N C;  3L9T A;  1TJC A;  1HZ4 A;  3MEK A;  3SBS A;  3VLE A;  2R02 A;  3GYZ A;  5ANL A;  2WXH A;  4HS2 A;  4FC8 A;  2PNN A;  3FU5 A;  3IXE A;  3DPY A;  4GYY A;  4L7T A;  3L82 A;  4O6F A;  3AS8 A;  3ZKJ A;  3UI2 A;  2DWZ A;  2LSU A;  2QZA A;  2OVF A;  1HU3 A;  2KXP C;  2VQ2 A;  2QFC A;  1OY3 D;  2L0T B;  3UT4 A;  3L08 A;  5KNH D;  5CRU A;  2BKG A;  5AJD A;  4DLO A;  2PQR A;  2QY7 A;  1IYG A;  1WM5 A;  3AS5 A;  2BKK B;  4EEC A;  3MKR A;  4JHJ A;  2GRL A;  5ENQ D;  4HB5 A;  2YHC A;  4WWP A;  3KSQ A;  3JXJ A;  1ZB1 A;  2F37 A;  5ENN A;  3SZ7 A;  3U64 A;  2V8S E;  3Q47 B;  3CQG B;  4K0R A;  3I4G A;  4FHK A;  1DCE A;  4GTP A;  4F3V A;  3R7Q A;  4GPM A;  3FUH A;  4PH4 B;  4UQX A;  3ZNG A;  1IKN D;  3CHP A;  4HOQ A;  5AQ7 A;  3MA5 A;  3FHE A;  4I1O B;  2Q7F A;  2C0L A;  2ZIS A;  3EIJ A;  1XNF A;  2VJ8 A;  2YQ8 A;  3PE3 A;  2I6H A;  2P58 C;  3NB2 A;  3DBS A;  4U95 D;  1AWC B;  2LNI A;  1Z3Y A;  1K1B A;  3LXU X;  4K5B A;  1FVH A;  3UXG A;  4HOS A;  3HXD A;  5EKQ D;  3D9J A;  5FTP A;  1O1S A;  3AG1 E;  3NAW A;  4HFG A;  3ZN3 A;  1W3B A;  4WWN A;  3Q5M A;  5KJK A;  3DXK G;  2XGS A;  4GAA A;  5AQ9 A;  3D3M A;  3TL5 A;  4HNA D;  4DX6 D;  4GPK A;  3PZ2 A;  3JUI A;  3SD5 A;  3V31 A;  1PY1 A;  4I1A A;  3DSU A;  3ZUV B;  1HFA A;  4MBG A;  4UQZ A;  1TNZ A;  2KCV A;  5DBK A;  2M63 A;  2KCK A;  3KAE A;  2VGE A;  1U3D A;  3GW4 A;  4R7L A;  2F0Y A;  2P9L G;  2WXK A;  3RO2 A;  4CDR A;  2QYU A;  3G2T A;  4UUC A;  4J7W A;  1OWO A;  4FUL A;  1YMP A;  3D9H A;  3SY2 A;  4KVO A;  2MYO A;  3LDZ A;  4ANX A;  3D9L A;  3ULQ A;  5T4Y A;  3T5V A;  3ESK A;  3PNL B;  3TXM A;  2P9P G;  2XEV A;  3FH7 A;  3APF A;  3UIN C;  4PS3 A;  1U2V G;  4G25 A;  5E75 A;  4LER A;  3ZGQ A;  1D8E A;  2Y4T A;  4X8Q A;  3L16 A;  1VDY A;  4DX1 A;  2Y69 E;  3CLJ A;  3W9G A;  2EIK E;  5BXO A;  3RO3 A;  4TXR A;  4BX9 A;  4N2S A;  3BU8 A;  4WNG A;  4G1T A;  5JHB A;  3G2U A;  4H7X A;  4ILH B;  2MOW A;  2OND A;  1TN6 A;  4BER A;  3FTU A;  2MHK A;  3NQP A;  2AWI A;  2I9C A;  2JAB A;  4JD2 G;  4RQI A;  3LVR E;  5EIB E;  3PZD A;  4I2W A;  4GTM A;  2FO1 E;  3FFL A;  1RZ4 A;  5G04 J;  4L23 A;  4HI8 A;  2ZU6 B;  1OWP A;  3I3N A;  4WND A;  3C98 A;  1JCS A;  5IY5 E;  3UIO C;  2VSO E;  3FUE A;  3CVL A;  4DI4 A;  3FUK A;  1MYO A;  5CCL A;  4EZJ A;  4URK A;  3O48 A;  2P9N G;  3VLF A;  2XGM A;  3HHM A;  4QQI A;  2CFZ A;  2WXO A;  4APF A;  3B13 A;  2XPZ A;  2PM7 A;  5EX3 A;  3U3W A;  2R03 A;  5DIZ A;  1RW2 A;  3D9P A;  3UIP C;  3AG3 E;  3ABK E;  3CSF A;  3T8K A;  4F1P A;  3SO8 A;  3T8M A;  1MX6 A;  4Y6W A;  3R7R A;  4LNB A;  3ASF A;  1KT0 A;  1TNO A;  4A3V A;  2WMO A;  1GW6 A;  2PZI A;  3FTS A;  3GZ1 A;  2XEN A;  3QOU A;  3FU0 A;  1N11 A;  4GTO A;  3RIB A;  2Y4U A;  2VSN A;  2FO7 A;  2WXN A;  4Y6C A;  1BD8 A;  3GZS A;  3SF4 A;  1NZN A;  2WXL A;  1X5B A;  3RRM B;  3S7D A;  3IHY A;  5B3S E;  4U0Z A;  3OXF A;  2FBN A;  3CHQ A;  2XCC A;  4GCO A;  4LNG A;  4CDM A;  5FIN A;  3CHR A;  3TGO A;  5EYP F;  3ISM C;  4U96 D;  4JEU A;  4XX5 A;  1YCS B;  5FZS A;  2VTB A;  3HVE B;  3RRU A;  2R59 A;  3LPZ A;  3Q49 B;  3MYV A;  1OCC E;  4N3C A;  4RLY A;  2NYJ A;  4JA9 A;  4ME2 A;  4I9C A;  5CER B;  4K03 A;  3WG7 E;  1SZA A;  4G8K A;  2Y3A A;  2J8S D;  2YNQ A;  4WUY A;  2GRN B;  1TNB A;  5AAO A;  3MX3 A;  4JA7 A;  4G26 A;  1IHB A;  3QC1 A;  3FUM A;  4NIK A;  4E6H A;  4N2Q A;  4GU5 A;  1S63 A;  2GGF A;  1K8K G;  3DEP A;  1FT2 A;  4EZK A;  4TXQ A;  2KZT A;  5LFA A;  3ASG A;  3C3Q A;  5LCW C;  4DX5 D;  4TRQ A;  2X38 A;  4U0U A;  3ASD A;  4OVV A;  1YA0 A;  4BEP A;  4JEH A;  5HI7 A;  3DSS A;  4EBA A;  5HKP A;  1TJF A;  3T5X A;  3FUD A;  3Q73 A;  2PQN A;  1O1R A;  2XQ0 A;  3G2W A;  4YVO A;  1FCH A;  1KZP A;  1X81 A;  4I17 A;  4LEU A;  3ZIM A;  3DXM G;  2DVW A;  1IQR A;  2X6F A;  5BUZ A;  3AJI A;  2R5S A;  3CGH A;  4FP7 A;  4M3O A;  4GZ5 A;  5J08 A;  2I2O A;  2LAH A;  4MS6 A;  4AP2 A;  1E7V A;  4U7E B;  2KM4 A;  4AIF A;  4UI9 J;  4BFR A;  4L2L A;  1HX8 A;  2L6J A;  4JHK A;  4KYO B;  3EIQ C;  3CIA A;  4CYM D;  3HIZ A;  5FZR A;  4J8E A;  2GRQ B;  3U66 A;  1MQS A;  3ZYM A;  4AEZ C;  1N4S A;  1HG2 A;  4BSX A;  1U3C A;  4TV3 A;  4FAD A;  3BQO A;  3L17 A;  4RVB A;  5ANR A;  5AIJ A;  2WXI A;  2KAT A;  3L22 A;  3AU5 A;  2DBA A;  3FTV A;  1LTX A;  2KCL A;  3J5Q B;  5G05 J;  4CT4 A;  3BEE A;  4HLL A;  4WNE A;  2IFU A;  3B7S A;  4BES A;  1UOH A;  3FUI A;  4HOU A;  3UX4 A;  5BNW A;  1KZO A;  4N3A A;  5AEN A;  2ZGD A;  3MJW A;  3LY8 A;  3DSW A;  2IOS A;  5ITZ F;  1MJ0 A;  1TNY A;  4ANV A;  4G11 A;  4UI9 K;  3PRZ A;  4G23 A;  2XZT G;  4RSY A;  3B7U X;  1TYQ G;  3HYM B;  1KPS B;  2X6H A;  3QKY A;  3FH8 A;  2L6B A;  1QYM A;  3VLD A;  3PZ4 A;  3SBT B;  2L0I A;  4GTR A;  2ETA A;  1K1A A;  2BF0 X;  3L13 A;  2NSZ A;  3JCK C;  1WY6 A;  2GRR B;  5D66 A;  3KD7 A;  4HQD A;  2OEW A;  3FTX A;  4NQ0 A;  3HDX A;  5ENS D;  3E33 A;  3PDN A;  4D10 C;  2WB2 A;  2WM9 A;  2WXF A;  4XE0 A;  3DSV A;  3RAU A;  4BSZ B;  5KCM A;  4JXT A;  5KJL A;  2ZXW E;  3FUF A;  1E90 A;  4EZL A;  1JWF A;  3FEY A;  2XPI A;  4BT9 A;  3IKO B;  1N0R A;  4LCT A;  3EHN A;  2J09 A;  1N9A A;  2PL2 A;  2BED A;  1L5J A;  4C0E A;  1SQM A;  3PNT B;  3HXB A;  5EIL A;  1IHG A;  2A4Z A;  4JW1 A;  4CCA A;  1TNU A;  2UY1 A;  4LNU D;  2IO3 C;  1N4R A;  4DX7 D;  3PH0 C;  3I4R B;  2AVP A;  3LEW A;  2R2L A;  3B7T A;  4CZ2 D;  2JLB A;  3ZW3 A;  4DX2 A;  4P29 A;  1NFI E;  3ULY A;  5AAR A;  3C5R A;  4HI9 A;  3APD A;  2RG8 A;  3R9A B;  3NOG D;  2XGO A;  2VGX A;  4CGV A;  4U07 A;  1N0Q A;  3TWT A;  3APC A;  3TJP A;  4ATZ D;  4HOR A;  1B89 A;  4GMR A;  3FUL A;  2WVI A;  3PS6 A;  5ENO D;  2CG3 A;  2F8X K;  4U63 A;  2X3M A;  5FQ8 A;  2J49 A;  4B8A A;  2F8Y A;  1PC2 A;  3CEQ A;  4KXK B;  3DST A;  4IRU A;  3VTY A;  2LAI A;  2VGY A;  3PUJ A;  3C3R A;  4JZY A;  2EQX A;  1DC2 A;  4UQY A;  4B94 A;  3PZ1 A;  1MX4 A;  2CG2 A;  4XZ4 A;  1D9S A;  4FU3 A;  2V4L A;  3DRA A;  5FIO A;  5HS0 A;  5EYL A;  4PDX A;  1ELW A;  1OWL A;  2ZIR A;  1HF8 A;  3DEO A;  3KSL A;  3CHO A;  4LG6 A;  4J0U A;  3WXX A;  3J5P A;  2CFU A;  3JXI A;  5EID A;  5LOZ A;  4FHJ A;  4L9P A;  4EBA G;  3G2S A;  5KWD A;  2WXR A;  3AS4 A;  5FQ4 A;  5BV0 A;  2A5U A;  1N94 A;  4ACK A;  1QBQ A;  5A7D B;  3Q78 A;  3JQ0 A;  4AY5 A;  4GTV A;  4BT8 A;  3MGB A;  3UTM A;  3DWL G;  2OEV A;  4B93 B;  1EYH A;  3D9N A;  4I6J A;  1E7U A;  1WG0 A;  2V0P A;  2IEJ A;  3V2O A;  2XEH A;  3UM1 A;  3NF1 A;  4AOF A;  1HS6 A;  3ZYL A;  3V79 K;  4JPS A;  3LYA A;  2P9S G;  2C0M A;  3FDH A;  4ANU A;  4CT0 A;  3OTN A;  3CVX A;  4U0S A;  4NUR A;  4Q94 A;  1Z5S C;  4G24 A;  4GA2 A;  4GYO A;  5G04 C;  4ILG A;  4GTS A;  3U4T A;  4JB8 P;  1OCR E;  1UN9 A;  4KVM A;  3LJN A;  3SFY A;  4H7Y A;  5FZQ A;  5BXU A;  2LXL A;  3V2X A;  3T9K A;  4ILI A;  3CKB A;  3UKU G;  4IYP A;  3CHM A;  2BUG A;  1E8X A;  3TWU A;  5FT9 A;  4CRW A;  2AJA A;  1JCR A;  3E37 A;  1Y6I A;  4UWG A;  4WWO A;  3CVP A;  2X6J A;  3CK7 A;  2JEK A;  3CK9 A;  4HRM B;  3S2A A;  4Q96 A;  2UY1 B;  2YIN A;  3FH5 A;  4C0M A;  4OAU C;  2H6G A;  2DCP A;  3SNX A;  2RKK A;  3UMV A;  4HRL A;  3ZYK A;  4I1M A;  3ESL A;  3ZU7 B;  3MV2 B;  4B8C B;  3TG5 A;  3FTZ A;  3EHR A;  3UKR G;  2R05 A;  3CST A;  1SVX A;  5B1B E;  3TG4 A;  1OT8 A;  4A3T A;  5HQ8 A;  2QC9 A;  5ENT D;  1MZC A;  3JYS A;  3CVW A;  3EUV A;  2NC9 A;  1E8Y A;  3E34 A;  3TWV A;  1NA0 A;  1S0P A;  3ZPJ A;  3L54 A;  3CVU A;  3V30 A;  4TXP A;  2OCC E;  2P9K G;  3QWP A;  2WXM A;  1BLX B;  2IJG X;  1DVP A;  3JUE A;  4GYW A;  3TXN A;  3FTW A;  1FT1 A;  3EHQ A;  2IQC A;  4LRZ A;  5BT1 A;  2ILR A;  4N5Q A;  1K3Z D;  5EN5 D;  1V55 E;  2HM8 A;  3ABL E;  2BTD A;  3OAW A;  4TUU A;  3CQC B;  3BG0 B;  4F7A A;  5HRY A;  3D9K A;  4GCN A;  5T8I A;  4AV7 A;  5LX8 A;  2CHZ A;  5D0O D;  3D9M A;  2FEZ A;  3LS8 A;  4GZ3 A;  4AXH A;  3QDN A;  5CBN A;  1KLX A;  1LF8 A;  1UG3 A;  4CGW A;  3EJN A;  3JQ1 A;  5LCW J;  2WQ7 A;  2IF4 A;  3E4B A;  1DNP A;  4DPR A;  4JL0 A;  2HO1 A;  2XZD G;  5D2M C;  3OXL A;  3LCA A;  2DYS E;  4PS8 A;  1NL4 A;  1E8W A;  2P9I G;  2LUH A;  3DSX A;  1TEZ A;  3FWV A;  5G2N A;  4J8D A;  2WPV A;  1MHQ A;  4IN3 B;  2IOL A;  5T3R A;  1Y8M A;  5CCM A;  4F1S A;  3CVN A;  2ETB A;  4KMO A;  3NOC D;  5A6C A;  4E85 A;  2LSV A;  2GRO B;  1HXI A;  1FPP A;  2IU1 A;  4KBQ A;  4ANW A;  4PS7 A;  4EQF A;  4RG9 A;  5LP0 A;  1INZ A;  4AVX A;  1OUV A;  2QYJ A;  1HG5 A;  4MLP A;  3IV0 A;  3MKQ A;  2KBX A;  4NAC A;  3LVQ E;  5JHA A;  1QZ2 A;  2V5F A;  5AJL A;  4A63 B;  5JJ7 A;  5J90 A;  4OVU A;  4DLQ A;  3OXG A;  4HVB A;  1Q2Z A;  3BG1 B;  1JPL A;  3D9O A;  4Z68 A;  4FA6 A;  4C48 B;  2MRI A; 
#chains in the Genus database with same CATH homology
 4JW1 A;  2MHK A;  3NQP A;  1ZU2 A;  4CCA A;  2AWI A;  2I9C A;  4ABN A;  2L9B A;  3FU3 A;  2UY1 A;  4OYS A;  2J4D A;  3LVR E;  3PZD A;  4J8F A;  3PH0 C;  4I2W A;  3ZEF A;  2WQ6 A;  3I4R B;  2AVP A;  1UJJ A;  3LEW A;  3FFL A;  3B7T A;  5G04 J;  1H19 A;  4I6E A;  4L23 A;  2ZU6 B;  2JLB A;  1OWP A;  1Z3X A;  2UWJ G;  3I3N A;  3ZW3 A;  4WND A;  3C98 A;  4P29 A;  4XI0 A;  3ZVV A;  4XIF A;  4CDN A;  3ZYQ A;  2VSO E;  3FUE A;  3CVL A;  4JC8 A;  4DI4 A;  3FUK A;  5CCL A;  4EZJ A;  3APD A;  2X6K A;  5EDS A;  2RG8 A;  4BTA A;  3R9A B;  4URK A;  1IQU A;  2VGX A;  2XGO A;  3O48 A;  3KEZ A;  4HLE A;  4CGV A;  2LO6 A;  2VTB B;  3VLF A;  2XGM A;  3CVY A;  3LJ3 A;  4I6G A;  4U07 A;  2GW1 A;  3PEU B;  3QJZ A;  4U04 A;  3HHM A;  3APC A;  2CFZ A;  3L6A A;  3TJP A;  4HOR A;  1B89 A;  4UWF A;  3FUL A;  2WVI A;  2WXO A;  3D9I A;  4APF A;  3B13 A;  3PE4 A;  3PS6 A;  2CG3 A;  2E0I A;  2XPZ A;  1N54 A;  2PM7 A;  3MV3 B;  4U63 A;  5EX3 A;  2E2E A;  3QK0 A;  4N3B A;  5CHE E;  2X3M A;  5FQ8 A;  3U3W A;  2J49 A;  1EDU A;  4B8A A;  1PC2 A;  3CEQ A;  4JHR A;  5DIZ A;  4KXK B;  4IRU A;  2VSY A;  3VTY A;  1JUQ A;  2LAI A;  2VGY A;  3PUJ A;  1UN8 A;  2XHE A;  1NP7 A;  3D9P A;  2WXG A;  3FP3 A;  2EQX A;  3O4Z A;  4UQY A;  2FF4 A;  3CSF A;  4PUC A;  4B94 A;  5C2Y A;  5FQ6 A;  4Q69 A;  4GZD A;  3T8M A;  4GZ6 A;  2CG2 A;  4XZ4 A;  4FU3 A;  1SZ9 A;  2V4L A;  4Y6W A;  4HXI A;  3CV0 A;  3CK8 A;  3R7R A;  5AYW D;  3ML8 A;  4PDX A;  2HR2 A;  3ASF A;  1KT0 A;  1ELW A;  4N5C A;  1OWL A;  4A3V A;  1HF8 A;  2WMO A;  1GW6 A;  2FI7 A;  4V3I A;  2PZI A;  3FTS A;  4J6I A;  4GA1 A;  4F53 A;  3GZ1 A;  5KJN A;  3CHO A;  4J0U A;  3WXX A;  5BPP A;  2CFU A;  3S7F A;  3ZHE A;  5LOZ A;  3QOU A;  4FHJ A;  4FJY A;  4ACL A;  2AXZ A;  3FU0 A;  3RIB A;  1JWG A;  4EBA G;  5CMW A;  2Y4U A;  2KZT B;  4NRH B;  3EDT B;  2VSN A;  3G2S A;  3VTX A;  2FO7 A;  3IEG A;  1NA3 A;  2WXN A;  3ONL A;  4UI9 C;  3SHF A;  4Y6C A;  3QWW A;  1H2V C;  2XRZ A;  1XGW A;  2WXR A;  3AS4 A;  3GZS A;  5FQ4 A;  3SF4 A;  1ZBP A;  1NZN A;  2WXL A;  4U8H A;  4WAF A;  2VSX E;  2A5U A;  3SGH A;  5BV0 A;  1X5B A;  3RRM B;  4FLB A;  3S7D A;  4ACK A;  3IHY A;  4U0Z A;  3QNK A;  4APO A;  3OXF A;  5A7D B;  3JQ0 A;  2FBN A;  4AY5 A;  4BT8 A;  3CHQ A;  2XCC A;  3MGB A;  1UJK A;  4AM9 A;  4GCO A;  1H0A A;  4CDM A;  3CHR A;  3S7B A;  1EYH A;  2I1J A;  3TGO A;  2PM6 A;  3D9N A;  4UWK A;  4I6J A;  3K9I A;  1E7U A;  5ARF A;  4JEU A;  2V0P A;  1QNF A;  5KJM A;  5JJ6 A;  3LKU A;  3N71 A;  4XX5 A;  5G55 A;  5FZS A;  2VTB A;  4GMJ A;  2KC7 A;  3HVE B;  3NF1 A;  4ATG A;  2AW6 A;  2OVB A;  4AOF A;  1ELK A;  1HS6 A;  3ZYL A;  4KZ0 A;  3RRU A;  2CHW A;  2R59 A;  3LPZ A;  3Q49 B;  4B89 A;  3MYV A;  3FTU A;  1ELR A;  4JPS A;  2WXQ A;  3UPV A;  3LYA A;  4N3C A;  3I5P A;  1HE8 A;  3S7J A;  4JA9 A;  2C0M A;  2ION A;  3FDH A;  4QFV A;  5G05 C;  4ANU A;  4YND A;  1KT1 A;  4CT0 A;  3SFZ A;  3OTN A;  4ME2 A;  2WQH A;  4L1B A;  4I9C A;  5C1D A;  3RU0 A;  3NZU A;  3CVX A;  2GRM A;  4U0S A;  1HO8 A;  4XKC A;  4NUR A;  4K03 A;  1SZA A;  4Q94 A;  4LUN U;  2Y3A A;  4I9E A;  2NXP A;  4G24 A;  4GA2 A;  2YNQ A;  4GYO A;  4WUY A;  3MX3 A;  4I43 A;  3Q4A B;  3CVV A;  2FUL A;  5G04 C;  4ILG A;  4JA7 A;  4G26 A;  5FJY A;  3QC1 A;  3U4T A;  3ZFW A;  4KVM A;  1UN9 A;  3CVQ A;  3FUM A;  4E6H A;  4BX8 A;  4AY6 A;  4H7Y A;  5FZQ A;  4A1G A;  4MKT A;  3MZL B;  1QQE A;  3KS2 A;  4HOT A;  4N2Q A;  4ILI A;  3CKB A;  3LY7 A;  4IYP A;  4GU5 A;  3CHM A;  1H2U A;  3PVL A;  4RG6 A;  5FWQ A;  2GGF A;  2BUG A;  3ML9 A;  1E8X A;  3EHM A;  5FT9 A;  4EZK A;  1HH8 A;  4DK5 A;  1Z6T A;  5ARG A;  4G2V A;  4BTB A;  2KZT A;  3MKQ B;  2J9Q A;  4CRW A;  5JJT A;  3UQ3 A;  5LFA A;  4L2Y A;  4UWH A;  3U9W A;  3ASG A;  5LCW C;  1Y6I A;  4UWG A;  1TJC A;  4TRQ A;  1HZ4 A;  2VYI A;  3MEK A;  3SBS A;  4WWO A;  2X38 A;  3VLE A;  3GYZ A;  4U0U A;  4W9R A;  3ASD A;  3RK6 A;  4OVV A;  5ANL A;  2WXH A;  1YA0 A;  2XRY A;  4HS2 A;  4FC8 A;  4JEH A;  3CVP A;  5HI7 A;  4EBA A;  2X6J A;  1TJF A;  2C2L A;  3FU5 A;  3ZRH A;  4BY6 A;  4DI3 A;  3CK7 A;  3T5X A;  2DIW A;  2JEK A;  3CK9 A;  4GYY A;  4L7T A;  3FUD A;  3S2A A;  2PQN A;  4Q96 A;  2UY1 B;  3HVE A;  2YIN A;  2XQ0 A;  3FH5 A;  3G2W A;  4O6F A;  4YVO A;  2WXJ A;  4C0M A;  4FJZ A;  1FCH A;  2WMN A;  3AS8 A;  4I17 A;  2OV8 A;  4LEU A;  3ZIM A;  3FUJ A;  2DCP A;  3SNX A;  1IQR A;  2X6F A;  2LSU A;  2OVF A;  1HU3 A;  1P5Q A;  3CHS A;  4MRU A;  5BUZ A;  2R5S A;  2VQ2 A;  3CGH A;  4FP7 A;  2QFC A;  3UMV A;  4M3O A;  4GZ5 A;  2L0T B;  3UT4 A;  3L08 A;  3ZYK A;  5J08 A;  4I1M A;  3ESL A;  3NZS A;  2I2O A;  3MV2 B;  5E76 A;  4B8C B;  5A23 A;  2LAH A;  4MS6 A;  3TG5 A;  4AP2 A;  3FTZ A;  2OOE A;  1E7V A;  4XKB A;  5AJD A;  4DLO A;  2PQR A;  2QY7 A;  3CST A;  3MCX A;  3TG4 A;  3QAQ A;  2KM4 A;  4AIF A;  4UI9 J;  1IYG A;  1H2T C;  1WM5 A;  4BFR A;  3B7R L;  3AS5 A;  4L2L A;  4A3T A;  3ZXS A;  5HQ8 A;  4AJW A;  4GML A;  1HX8 A;  1E96 B;  2L6J A;  4EEC A;  1WAO 1;  1A17 A;  4JHK A;  4KYO B;  2J07 A;  3EIQ C;  3CIA A;  5CMY A;  3FY4 A;  3MKR A;  4KZC A;  3HIZ A;  2GRL A;  4JHJ A;  5FZR A;  4B0Z A;  3JYS A;  4J8E A;  3UT7 A;  2YHC A;  4WWP A;  3CVW A;  2HYZ A;  3U66 A;  1MQS A;  3ZYM A;  4AEZ C;  2J08 A;  2NC9 A;  1HG2 A;  3CR3 A;  5FQ7 A;  1E8Y A;  4BSX A;  5ENN A;  3SZ7 A;  1U3C A;  4TV3 A;  3U64 A;  4FAD A;  4XI9 A;  2V8S E;  1NA0 A;  1S0P A;  3ZPJ A;  3L54 A;  3Q47 B;  3CQG B;  3L17 A;  4K0R A;  4RVB A;  3CVU A;  2J4B A;  5ANR A;  5AIJ A;  2XPY A;  5EX0 A;  1UW4 B;  2WXP A;  1OWN A;  1EPU A;  2WXI A;  3QWP A;  2KAT A;  2WXM A;  3L22 A;  3I4G A;  4FHK A;  2IJG X;  3PEV B;  1DVP A;  4GA0 A;  3AU5 A;  4F3V A;  2DBA A;  3R7Q A;  3FUH A;  4GYW A;  3FTV A;  4PH4 B;  4UQX A;  3TXN A;  3CHP A;  4HOQ A;  3FTW A;  4A1S A;  3MA5 A;  4A55 A;  2KCL A;  3FHE A;  4I1O B;  4CEM A;  5G05 J;  4CT4 A;  2IQC A;  2X6I A;  3BEE A;  4DJA A;  4LRZ A;  2Q7F A;  4WNE A;  5BT1 A;  2C0L A;  2ILR A;  4GZC A;  3EIJ A;  3ONK A;  1XNF A;  3ZHE B;  2IFU A;  3B7S A;  1H6K A;  2VJ8 A;  2YQ8 A;  3PE3 A;  2HM8 A;  3P2B A;  2I6H A;  2P58 C;  1EF1 C;  3FUI A;  4HOU A;  3DBS A;  3FTY A;  4FLH A;  3UX4 A;  5BNW A;  2BTD A;  3OAW A;  4TUU A;  4N3A A;  3CQC B;  5AEN A;  3BG0 B;  4F7A A;  3QWV A;  4KT6 B;  3MJW A;  3D9K A;  4GCN A;  2LNI A;  3LY8 A;  1Z3Y A;  5T8I A;  3LXU X;  1FVH A;  4AV7 A;  5BV1 A;  5LX8 A;  2IOS A;  2CHZ A;  5D0O D;  4HOS A;  3D9M A;  2FEZ A;  3LS8 A;  4GZ3 A;  5EKQ D;  4AXH A;  3D9J A;  1PAQ A;  5FTP A;  3QDN A;  4HFG A;  3ZN3 A;  3RKV A;  1W3B A;  4ANV A;  4G11 A;  2YHE A;  4WWN A;  3Q5M A;  4C9B B;  1KLX A;  5KJK A;  3LY9 A;  5M72 A;  1LF8 A;  1UG3 A;  4UI9 K;  4CGW A;  2XGS A;  2XCB A;  3PRZ A;  2AXU A;  3EJN A;  3ASH A;  3JQ1 A;  3P1U A;  4G23 A;  4GAA A;  3RJV A;  3SI5 A;  3D3M A;  5LCW J;  2WQ7 A;  2IF4 A;  1BPO A;  4RSY A;  3FEX A;  3TL5 A;  3B7U X;  3HYM B;  3QKY A;  4GPK A;  2X6H A;  3E4B A;  1DNP A;  3JUI A;  3Q15 A;  3FH8 A;  4JL0 A;  3SD5 A;  4DPR A;  2I1K A;  4GB9 A;  1PY1 A;  4I1A A;  2HO1 A;  3FU6 A;  3VLD A;  3SBT B;  3OXL A;  3LCA A;  2L0I A;  1HFA A;  4PS8 A;  4UQZ A;  1FVF A;  3DPD A;  2KCV A;  1E8W A;  2BF0 X;  2M63 A;  5DBK A;  3RRN B;  3L13 A;  2KCK A;  3KAE A;  3PUK A;  1TEZ A;  3FWV A;  1U3D A;  5G2N A;  2NSZ A;  2R17 C;  3FUN A;  3GW4 A;  3JCK C;  1WY6 A;  4J8D A;  2WPV A;  4R7L A;  3KD7 A;  4WNF A;  1N52 A;  2WXK A;  3RO2 A;  2CHX A;  3FTX A;  4CDR A;  1MHQ A;  4BWR A;  4JVS A;  3G2T A;  2IOL A;  4IN3 B;  1Y8M A;  2VGX B;  4NQ0 A;  5T3R A;  4F1S A;  5CCM A;  3AU4 A;  3CVN A;  4IUL A;  3HDX A;  5BW8 C;  3PRE A;  3UUX A;  4N39 A;  4KMO A;  1OWO A;  4I2Z A;  4FUL A;  5A6C A;  4E85 A;  3PDN A;  2LSV A;  4KVO A;  4D10 C;  3G2V A;  3LDZ A;  1HXI A;  4ANX A;  3D9L A;  3ULQ A;  2WB2 A;  5T4Y A;  3T5V A;  2WM9 A;  3ESK A;  5D0Q D;  3PNL B;  3TXM A;  2IU1 A;  4JZY A;  2WXF A;  4UWL A;  3CKC A;  4XE0 A;  2XEV A;  3FH7 A;  4KBQ A;  4ANW A;  3APF A;  4EPZ A;  4PS3 A;  4PS7 A;  5KCM A;  4EQF A;  4JXT A;  4G25 A;  4RG9 A;  5E75 A;  5KJL A;  3ENE A;  1OWM A;  5LP0 A;  1INZ A;  4AVX A;  3FUF A;  4LER A;  1E90 A;  3IBE A;  4YVQ C;  3ZGQ A;  4EZL A;  1OUV A;  1JWF A;  1HG5 A;  4MLP A;  3IV0 A;  3MKQ A;  2Y4T A;  3FEY A;  3L16 A;  1VDY A;  2XPI A;  4BT9 A;  3IKO B;  3CLJ A;  4LCT A;  4NAC A;  3LVQ E;  2AXV A;  3IHV A;  5JHA A;  3RO3 A;  3EHN A;  4J8S A;  4BX9 A;  1E8Z A;  1QZ2 A;  3GZ2 A;  4N2S A;  2V5F A;  2J09 A;  3UT8 A;  4WNG A;  2PL2 A;  5AJL A;  2RD0 A;  4G1T A;  5JJ7 A;  5JHB A;  5J90 A;  4OVU A;  4DLQ A;  1L5J A;  3G2U A;  3OXG A;  1SQM A;  3QB2 A;  4H7X A;  4ILH B;  2MOW A;  4C0E A;  3PNT B;  4HVB A;  3TAX A;  3URZ A;  2OND A;  3BG1 B;  1JPL A;  3D9O A;  1IHG A;  3QAR A;  4FA6 A;  2MRI A;  2A4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...