2DIWA

Solution structure of the rpr domain of putative rna-binding protein 16
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
152
structure length
152
Chain Sequence
GSSGSSGDNMEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKNNVFKSEIIQPLLDMAAGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords Putative RNA-binding protein 16
publication title Solution structure of the RPR domain of Putative RNA-binding protein 16
rcsb
source organism Homo sapiens
total genus 37
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2006-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04818 CTD_bind RNA polymerase II-binding domain.
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2diwA01
4HFGA 1JWFA 1EDUA 3ZYKA 2L0IA 2QY7A 1HX8A 1VDYA 2BF0X 1HG5A 3D9OA 5LOZA 1SZAA 4JXTA 1INZA 4AVXA 2LO6A 4NACA 5J08A 3G2TA 3D9IA 3ZYQA 3RRUA 1SZ9A 3G2UA 5CMYA 1LF8A 3D9MA 3G2SA 4Q94A 2KM4A 1EYHA 1MHQA 2DIWA 1X5BA 1HF8A 3D9NA 4GZDA 4Q96A 1JUQA 1JPLA 1UJKA 3ONLA 2V8SE 2DCPA 4FU3A 1JWGA 3G2WA 1UJJA 3D9PA 3CLJA 5LP0A 2MOWA 3ZYMA 3G2VA 3ZYLA 4GZCA 3D9LA 1PY1A 3D9KA 3D9JA 1H0AA 3LDZA 1HG2A 1ELKA 4FLBA 1XGWA 5CMWA 1HFAA 2L0TB 1DVPA 3ONKA
chains in the Genus database with same CATH superfamily
4U95D 2IOLA 3T8MA 1H2VC 1HO8A 2QYUA 4O1PA 1N95A 2Y4UA 4UWKA 5JJ6A 3P2BA 4XZ4A 3BG0B 1PC2A 1JWFA 4GTSA 4JPSA 2AWIA 4HB5A 1OWMA 4FU3A 3TXNA 4MLPA 2YQ8A 3I5PA 3TAXA 4L2YA 4A3TA 3UT4A 4J8SA 2FF4A 5CMYA 5JJTA 3Q47B 3E34A 3UM1A 4PDXA 2J09A 3S7BA 4C0MA 4MBGA 2C2LA 5AAOA 3DBSA 3AAAC 3EIJA 3IEGA 3NAWA 3GW4A 3QDNA 4CYMD 1RZ4A 1Z3YA 2HYZA 3FUIA 4CEMA 2QYJA 4EBAG 4CDNA 1JCRA 3R9MA 2X6IA 3HXFA 1S70B 1Z3XA 4JHRA 4Q94A 4UUCA 1SVXA 3SY2A 1S0PA 4PS3A 4L2LA 2Y1LE 4WNFA 3S7DA 3Q5MA 5BUZA 3V31A 2DZNA 4GYWA 3UX4A 4ANUA 4AJWA 4CGWA 4BESA 3NQPA 3TWRA 3APFA 3U64A 3L82A 5C1DA 3DRAA 4ATGA 5M72A 2XPYA 3FH8A 3QOUA 3CVXA 1DCEA 3QWWA 4GPKA 2EIKE 1U3DA 2VTBB 3HXDA 3EHNA 4UWHA 3FHEA 4HOQA 3PZ2A 2X3MA 1MYOA 4CCAA 1WG0A 2KM4A 2VGXB 4B93B 5LP0A 1OY3D 1YYHA 1LTXA 4F53A 2NXPA 3TWXA 3ML8A 3TXMA 2IJGX 3NOGD 4GYYA 2VSNA 3TWUA 1N0RA 4ANXA 4O6FA 4J8EA 3G2UA 3Q7FA 5AYWD 4QFVA 1EPUA 4FLHA 4I1OB 4CRWA 5ARGA 3ONLA 4NQ0A 4JA7A 3V30A 3LS8A 5AN8A 4Y6CA 3CQGB 2I1KA 2XZDG 2P9KG 3HVEA 4HVBA 2WMNA 4GPMA 4GTRA 4KYOB 3PEVB 4K5BA 3DEOA 4APOA 1MJ0A 3CHOA 5BNWA 4JHKA 4L1BA 2X6HA 4M3OA 3ZU7B 3SHFA 3PS6A 1BU9A 2ONDA 4GTQA 4DX7D 1BD8A 3CR3A 4B0ZA 3EU5A 3AS8A 5BXUA 1YA0A 4BX9A 3OAWA 1EDUA 4HBDA 3U4TA 1HX8A 1MQSA 3MGBA 4CZ2D 1K1AA 3UINC 1IQUA 2AJAA 5FWQA 3ZRHA 3D9NA 1UJKA 5KJNA 4TXPA 3PEUB 2B0OE 3TWWA 3LJNA 2XHEA 4DRXE 1H6PA 5A6CA 3PZ4A 3LCAA 2GRMA 3VLEA 2CFZA 3SO8A 3ZVVA 5CRUA 2WQHA 1N4QA 3W9GA 4F1PA 3L54A 4L23A 1TNOA 3CVNA 4GA1A 3KSQA 3JUIA 3ASGA 5CHEE 2WXPA 3ZHEB 4KXKB 1OWLA 5B1BE 5CCMA 5FQ4A 4QQIA 4BSXA 3DSVA 4FULA 2AXZA 2LXMA 3AG2E 1O5MA 2VSYA 4U0SA 5HRYA 1Y8MA 2V4HC 4MRUA 4WAFA 5B3SE 4BX8A 4UQZA 3ML9A 4X8QA 4CDMA 3OXLA 1UW4B 4KMOA 2VTBA 1V54E 1HH8A 5LX8A 2DVWA 4JD2G 4WNDA 1NP7A 1JCQA 2WXNA 4JVSA 3D9JA 2VGXA 1SA4A 4C0EA 1OCRE 2J49A 3BQOA 3JXJA 2LAIA 3ASOE 4F7AA 3BG1B 3KSLA 3PVLA 4YDWA 4ACLA 4ZFHA 3FUKA 2I9CA 4GB9A 2V5FA 3Q7AA 3AU5A 4BFRA 3HXEA 5JA4D 2RFAA 1DCQA 5FQ6A 3GZ1A 3PUKA 4ATZD 2V4LA 3R7RA 3K9IA 3KEAA 3NZUA 3CQCB 4Q69A 4I2WA 4K03A 1SZAA 3VTXA 5FZRA 3RRMB 2IOSA 4XE0A 2LNIA 1JPLA 2BUGA 4BTBA 3FTYA 4ILIA 2PQNA 4RLYA 4B8CB 3C3OA 3LJ3A 5KWDA 4DX1A 4EPZA 2KXPC 3Q9UC 2L6JA 3J5QB 5ENOD 4F1SA 3RSEG 3WXXA 3RRUA 3MA5A 3ASDA 1A5EA 1TNYA 4XI0A 4DX6D 1NFIE 2EIJE 2ILRA 4I1AA 1JUQA 3ENEA 3CGHA 2A4ZA 2VGYA 4U0UA 3FH7A 5HS0A 2L0TB 3HG0D 5LFAA 2ZU6B 3IV0A 4NACA 3EJNA 3IHYA 1FVFA 2DCPA 3FTXA 2EQXA 3UT8A 3SFZA 1HXIA 1D9SA 3B7TA 3DWLG 5LCWC 4K5AB 3HXCA 2RG8A 5ARFA 2R03A 2DYSE 3B13A 4GTTA 1SW6A 3ULQA 5KCMA 3IHVA 3D9KA 3MEKA 2P9NG 4HFGA 4HLLA 3ABLE 4YDEA 3OXGA 1SZ9A 5D0QD 3S7JA 2C0MA 3L13A 3AJIA 3FH5A 3D9PA 4JEUA 1E96B 3CVLA 5BT1A 2WXFA 3FP3A 3FEXA 2LSUA 3LDZA 3DSSA 3PDNA 2DBAA 2HR2A 3LEWA 3SD5A 4I9CA 1N94A 3X2QE 3D9IA 4KT6B 4PUCA 5BPPA 5LCWJ 5EDSA 5AJLA 3TWQA 3FUJA 1KPSB 3FUHA 4DLQA 1QQEA 1K1BA 4J8FA 5G05C 2BKGA 2ETAA 1B89A 3FUMA 4HRNA 1SQMA 4GZ3A 4NRHB 3C3RA 4E85A 4BT8A 2PNNA 3CVYA 1TJFA 2F8YA 4B8AA 3FUDA 4DX2A 4Z68A 2P9IG 4AV7A 1LD8A 1ELKA 2CFUA 3KD7A 3MCXA 2ETBA 2WB2A 3Q9NC 1OWOA 5JHAA 4ME2A 3FTSA 3AU4A 2L9BA 2GROB 4R7LA 1IKND 2R2LA 4WNEA 3AG1E 2H6HA 4GCNA 3LY8A 1HG5A 4D10C 3CHPA 3CIAA 3DPYA 4LERA 3FFLA 5ENSD 2IY0C 5FZSA 5G05J 3EIQC 5G04C 3UIOC 3HVEB 1N4SA 1E8YA 2LSVA 3ONKA 2ETCA 5DBKA 4L9PA 3ISMC 4I6JA 3PUJA 2J08A 3URZA 3APCA 2Q7FA 3JXIA 1LF8A 4HRMB 1E8WA 1UG3A 2WQ6A 2XZTG 5JMND 1XNFA 2R05A 3ZXPA 1P5QA 2WXRA 3IXEA 3QKYA 5HKPA 1MX4A 5EYPF 2J4DA 5D66A 3FU5A 4RG9A 3AS4A 4KVOA 1KZOA 3ZFWA 3NZSA 3S7FA 4P29A 2XS1A 3E37A 4GZ5A 3RO2A 3CV0A 4RVBA 3FDHA 3CKCA 1HS6A 1JCSA 5G04J 1OCOE 5J08A 2IONA 3AG3E 1H6KA 4MS6A 2UY1A 3UTMA 1S64A 1KLXA 3T8KA 3RU0A 1FCHA 5BV0A 4BETA 4E6HA 1O1TA 1HG2A 3E33A 3V2OA 4ILHB 4HORA 2ZXWE 2CG2A 4A3VA 4FADA 2MYOA 3ZEFA 4JL0A 4U8VD 3LYAA 2HM8A 4UQYA 4O1OA 2XRZA 2X6JA 3B7SA 3RRNB 2P2CP 3U66A 4BSZB 2XGSA 1KT1A 4XI9A 2KC7A 3KEZA 3OXFA 3T9KA 4GYOA 4N39A 5CEAA 2AW6A 2XEHA 3Q78A 5AJDA 1Z5SC 3GYZA 3PE4A 2KBXA 1N9AA 3UMVA 2WXLA 1QNFA 2I2OA 2Y4TA 2J8SD 5T8IA 2BTDA 2FULA 2ZISA 3DPDA 4L7TA 5H7PA 4JA9A 4I6EA 1IQRA 3PZDA 4U04A 3ABKE 1W3BA 2WM9A 3GZSA 1WY6A 3DXKG 3RIBA 2MRIA 4BY6A 2ZGDA 4FP7A 4G1TA 1ZB1A 2WVIA 4DJAA 2YHCA 3CVWA 3MX3A 3SZ7A 4FA6A 2QY7A 3EHQA 1TEZA 2Y3AA 3MKQB 5FJYA 3S2AA 4EBAA 4JC8A 2BKKB 4DX5D 2F0YA 3G2WA 3P1UA 3ZYLA 1OXJA 5KBAA 4AY5A 4YNDA 1N54A 3LXUX 3R7QA 1KZPA 4GTPA 2R02A 4GZ6A 2WXGA 3Q15A 3SFXA 2KATA 2DIWA 3QB2A 4LUNU 3LKUA 3CVQA 4J7WA 3UXGA 4URKA 5J90A 3SGHA 3TWSA 3V79K 1FT1A 4U8HA 2BF0X 3PNLB 3SI5A 1E7VA 4XEIG 5FIOA 5KNHD 5CRVA 1TNZA 4I1MA 4F3VA 1UN9A 2AVPA 1TYQG 3L08A 3CVVA 1N4PA 1OWNA 4LCTA 3CSTA 4N2SA 4DUIA 1DC2A 1INZA 4LNBA 4HI8A 4LEUA 1BI7B 2OEVA 4Y6WA 4Q96A 1E8ZA 3ZYMA 4GZCA 1BLXB 4IULA 3MZLB 2OEWA 3PZ1A 4EHMA 3FY4A 3BEEA 3DSWA 4LNUD 5T4YA 3VLFA 3LVQE 4C9BB 3ZKJA 3CHQA 4G26A 4TRQA 2PM6A 3ASNE 3UI2A 3NB2A 3DXMG 1HZ4A 2XPZA 1AP7A 4G11A 2E0IA 4LNGA 3DSXA 5CCLA 4UI9J 3E4BA 1H2TC 4CT4A 3FU6A 1IXVA 3G2VA 4HRLA 2F37A 4TXQA 4FLBA 5EX0A 1HFAA 2ZGGA 3ZPJA 2WXQA 5A7DB 4U63A 2WQ7A 4J0UA 3PREA 3FUFA 4XX5A 2YHEA 3FTUA 1U2VG 4W9RA 4UWLA 3QK0A 4FJZA 4KZ0A 4EZLA 3MKQA 5IY5E 3VLDA 1AWCB 4O60A 4A1GA 2GRPB 4ANVA 2FEZA 3EU9A 4B89A 4OAVB 3CVPA 1O1SA 2YINA 4N2QA 2HE0A 1HU3A 1K3ZD 1SA5A 5ENQD 3UM3A 2FO7A 4EZJA 3PRZA 4FC8A 4CT0A 3NBNB 2VYIA 3ESKA 2A5UA 3F6QA 3NOCD 3L6AA 1ELWA 3FULA 3L22A 3FTVA 1Q2ZA 3FWVA 2GGFA 1JWGA 5BW8C 3EHMA 4DI4A 1O1RA 4F6RD 4KBQA 5CEDB 2FBNA 4PS8A 1TN6A 1WM5A 3U3WA 2UWJG 2EINE 3TWVA 5AARA 2UY1B 4M7CA 2A5EA 3HYMB 2FO1E 4WWOA 3DSUA 3RJVA 3MJWA 4DI3A 3I4GA 4AOFA 2L0IA 4G25A 2OV8A 1OT8A 3EUVA 2EILE 2YNQA 3HXBA 4AVXA 2QFCA 2J9QA 3U9WA 3AS5A 4UQXA 5CERB 3MKRA 5ITZF 2HO1A 4GA0A 3ABME 5FTPA 4A63B 2WXMA 3CLJA 4TUMA 5EILA 1D8DA 4JHJA 1NA0A 2WXHA 3RO3A 5FZQA 1N11A 3KS2A 1UN8A 3CK7A 4ANWA 1FT2A 2PQRA 3HDXA 4YDOA 2Y0BG 1OWPA 4J8YA 2IQCA 2V0PA 5ENTD 4HOUA 4ILGA 5HQ8A 2EIME 4HLEA 4HI9A 2XCBA 4GMRA 4OVVA 2M63A 3JUEA 2AXUA 4I9EA 5AQ7A 2KZTB 4C48B 1YMPA 3L17A 4HS2A 3T5VA 2DZOA 4EECA 5A23A 1X81A 1MZCA 4HOSA 2H6GA 3C3QA 3ULEG 4OYSA 1E90A 4GMLA 1MX6A 2Y69E 2XENA 3LVRE 3J5PA 4A55A 2WXIA 2WPVA 2J4BA 2LO6A 2P9LG 2H6IA 4DPRA 3ASFA 2WXOA 2OVFA 3ZXSA 3QAQA 3WG7E 4U8YD 1UJJA 3TG4A 3ZNGA 4AP2A 5CBOA 3SNXA 2I6HA 3UM0A 1L5JA 3FUEA 5EKQD 3L16A 4LRZA 3CVUA 2V5QC 1X5BA 2X38A 2H6FA 5C2YA 4LG6A 4NIKA 2LXLA 4N5CA 3ZGQA 5T3RA 3FEYA 2J07A 4U7EB 2IEJA 1K8KG 1MX2A 3RK6A 1QYMA 1IHGA 4GZDA 2CHWA 4LSZE 4NURA 1LD7A 3APDA 4OVUA 4UWFA 3C72A 3O48A 3D9LA 4B94A 4BWRA 2NYJA 3UM2A 1UOHA 3MV3B 3TL5A 2GRRB 3ZIMA 4GAAA 3G2TA 4ACKA 3HHMA 5KNGA 1EYHA 4H7XA 1PAQA 1GW6A 1ELRA 4AY6A 2JABA 4N3BA 4FJYA 4ZHBA 2XEEA 4IYPA 3HRAA 3ESLA 3DSTA 1TNUA 2P9PG 3SBSA 3OTNA 4OAUC 2DYRE 2IO2C 2MHKA 4BEPA 1MHQA 3E32A 4JZYA 2JLBA 4KZCA 1WAO1 3RKVA 4TUUA 2FI7A 1H0AA 1S63A 3SBTB 3ZYQA 2OVBA 4N3CA 4YVQC 5AQAA 3TJPA 4WUYA 3DEPA 2WXKA 2P9SG 1KT0A 1QBQA 3G2SA 1A17A 2KZTA 1NZNA 3EDTB 3KAEA 1TR4A 2RKKA 4JEHA 3C5RA 3JYSA 3RAUA 5CMWA 2X6FA 2CHZA 4G8LA 2R17C 1TJCA 4WWPA 4KVMA 5EIBE 3L9TA 5AQ9A 3BU8A 5E75A 5KJKA 2RFMA 4ABNA 2I1JA 2GRNB 4K0RA 3B95A 5ENNA 2PM7A 1TNBA 2OCCE 1Y6IA 1H6OA 3PH0C 2LAHA 5E76A 4WWNA 2QZAA 4J8DA 2OOEA 4CDRA 3R9AB 3Q4AB 5D0OD 3V2XA 5JHBA 2QC9A 3FTZA 4YDYA 2XS8A 5EN5D 5G55A 3E30A 2VSOE 3PZ3A 2ZIRA 3D3MA 3UKRG 3C98A 4XKBA 3BUAA 5FINA 2XCCA 5ENPD 1HF8A 3Q79A 3SQVA 3ASHA 2V8SE 2BEDA 4IN3B 2XEVA 4U0ZA 2NSZA 3CHRA 1HE8A 4N5QA 4UI9C 4HQDA 1ZBPA 3QJZA 4TV3A 5HI7A 4GA2A 4FHKA 5ENRD 5CBNA 3ZUVB 4N3AA 1NA3A 3UT7A 3N71A 3TWTA 1XGWA 1ZU2A 3IBEA 4AEZC 2VGEA 3B7UX 4GTOA 4U07A 2R5SA 1D8EA 4A1SA 5FQ8A 3ULYA 1DVPA 1E7UA 4RSYA 2XPIA 2PZIA 3D9OA 4V3IA 4XKCA 3UPVA 4HOTA 4IRUA 2WMOA 5G2NA 2B6CA 3LY7A 3MYVA 3CSFA 1H2UA 5BV1A 2GRQB 4I6GA 1PY1A 5BXOA 3CKBA 4UWGA 4G2VA 3QNKA 2C0LA 1VDYA 5KJLA 3FTWA 4EQFA 4I2ZA 3UUXA 4K5CA 4MKTA 2XQ0A 3B7BA 4BT9A 5ANRA 1N4RA 1G3NB 2R59A 3HIZA 2KCLA 5FT9A 2VJ8A 2VSXE 4HNAD 2CHXA 4XIFA 3ZYKA 3EHRA 5EIDA 1IHBA 2F8XK 4HXIA 5AENA 2L6BA 5EYLA 2P58C 1Z6TA 2P9UG 4AXHA 3D9HA 3QARA 2MOWA 3NF1A 3FU0A 2CG3A 2GW1A 3Q73A 5KJMA 5CECB 2IFUA 3PNTB 1E8XA 4H7YA 2RD0A 1N0QA 4DK5A 5FQ7A 4GCOA 4BTAA 2E2EA 3O4ZA 1QZ2A 3LY9A 3VTYA 5JJ7A 3UIPC 3GZ2A 1WDYA 3ZW3A 1FVHA 4CGVA 3I3NA 2LUHA 1V55E 5D2MC 2JEKA 1H19A 2WXJA 2AXVA 4EZKA 3TG5A 4U96D 3PE3A 3MV2B 1BI8B 3JQ1A 3QC1A 2PL2A 3ZHEA 2IU1A 1EF1C 4I43A 5EX3A 4PH4B 1N52A 2XRYA 2KCVA 3T5XA 1RW2A 2X6KA 1TN8A 5LOZA 4JXTA 4APFA 4RQIA 3ZN3A 5DIZA 3QWPA 4I17A 1NL4A 3CHSA 3UKUG 3JQ0A 3SFYA 4RG6A 5AIJA 4UI9K 5B1AE 2NC9A 3Q75A 1IYGA 4GU5A 1U3CA 3AG4E 1FPPA 2KCKA 3SF4A 3IKOB 3FU3A 5ANLA 3D9MA 4YVOA 1OCZE 4GTVA 4WNGA 3JCKC 3CHMA 4AIFA 3I4RB 4AM9A 3CK8A 1BPOA 4G23A 3B7RL 4GTMA 3Q49B 2XGOA 4G8KA 4FHJA 4JB8P 4BERA 1DNPA 2VQ2A 3TGOA 4DLOA 3CK9A 3UQ3A 4GMJA 4G24A 1TN7A 4TXRA 1NI1A 2IO3C 4J6IA 3LPZA 3CEQA 2IF4A 4JW1A 4PS7A 2XGMA 1OUVA 3W9FA 1OCCE 3QWVA 5AQBA 2DWZA 2GRLA 3FUNA 1YCSB
chains in the Genus database with same CATH topology
2OVBA 4N3CA 5LCWC 4LCTA 3CSTA 4YVQC 4N2SA 2IOLA 3TJPA 1INZA 4WUYA 1H2VC 3T8MA 2WXKA 4LEUA 2RG8A 1HO8A 1KT0A 4Y6WA 3G2SA 1A17A 5ARFA 2KZTA 1NZNA 2Y4UA 3EDTB 3KAEA 4Q96A 3B13A 1E8ZA 4JEHA 4UWKA 3ULQA 3ZYMA 5KCMA 4GZCA 3IHVA 5JJ6A 4IULA 3D9KA 3JYSA 3P2BA 3MEKA 4XZ4A 5CMWA 2X6FA 2CHZA 3BG0B 1PC2A 3MZLB 4HFGA 1JWFA 3FY4A 2R17C 1TJCA 3BEEA 4WWPA 3OXGA 4JPSA 4KVMA 2AWIA 5T4YA 3VLFA 1SZ9A 3LVQE 5D0QD 3S7JA 4C9BB 2C0MA 3CHQA 4G26A 5E75A 1OWMA 3L13A 5KJKA 4FU3A 3TXNA 3FH5A 3D9PA 4JEUA 4MLPA 1E96B 3CVLA 5BT1A 2WXFA 2YQ8A 3FP3A 3FEXA 3I5PA 2LSUA 4TRQA 4ABNA 3LDZA 3PDNA 3TAXA 2I1JA 2PM6A 2DBAA 2HR2A 3LEWA 4L2YA 3SD5A 4K0RA 4I9CA 4A3TA 5ENNA 2PM7A 3UT4A 3D9IA 4J8SA 1HZ4A 4KT6B 1Y6IA 2XPZA 4PUCA 4G11A 5BPPA 2FF4A 5CMYA 5JJTA 2E0IA 3Q47B 5LCWJ 5CCLA 5EDSA 4UI9J 4PDXA 2J09A 3E4BA 1H2TC 3S7BA 5AJLA 4C0MA 4CT4A 2C2LA 3FU6A 3G2VA 3FUJA 3PH0C 3DBSA 2LAHA 3FUHA 4DLQA 5E76A 1QQEA 3EIJA 3IEGA 4FLBA 4WWNA 1HFAA 5EX0A 3GW4A 3ZPJA 3QDNA 4J8FA 5G05C 2WXQA 5A7DB 4J8DA 4U63A 1B89A 3FUMA 2WQ7A 1Z3YA 1SQMA 2HYZA 2OOEA 4GZ3A 3FUIA 4J0UA 4NRHB 3R9AB 4CEMA 4CDRA 4EBAG 4CDNA 3Q4AB 3PREA 5D0OD 4E85A 4BT8A 3FUFA 5JHBA 3FTZA 2X6IA 2YHEA 4JHRA 1Z3XA 3FTUA 4Q94A 4XX5A 4W9RA 4UWLA 3QK0A 4FJZA 3CVYA 4KZ0A 1TJFA 4EZLA 3MKQA 1S0PA 3VLDA 4PS3A 4L2LA 4B8AA 3FUDA 4WNFA 5G55A 4A1GA 3S7DA 4ANVA 3Q5MA 5BUZA 4AV7A 1ELKA 2VSOE 3D3MA 2FEZA 4B89A 4GYWA 3UX4A 3C98A 4XKBA 4ANUA 4AJWA 3CVPA 2CFUA 3KD7A 3MCXA 4CGWA 3NQPA 2YINA 2WB2A 3APFA 4N2QA 3U64A 2XCCA 1OWOA 5JHAA 5C1DA 1HF8A 4ME2A 3ASHA 2V8SE 3FTSA 4ATGA 1HU3A 5M72A 2XPYA 3FH8A 4IN3B 3QOUA 3CVXA 2XEVA 3AU4A 3QWWA 2L9BA 4R7LA 4GPKA 4U0ZA 2FO7A 2NSZA 4WNEA 4EZJA 3CHRA 3PRZA 4GCNA 1U3DA 2VTBB 3LY8A 4FC8A 4CT0A 3EHNA 1HG5A 1HE8A 4UI9C 4D10C 2VYIA 3ESKA 3CHPA 2A5UA 4UWHA 3FHEA 1ZBPA 3QJZA 4TV3A 3CIAA 5HI7A 3L6AA 4LERA 1ELWA 4HOQA 4GA2A 2X3MA 4CCAA 3FULA 2KM4A 3L22A 3FFLA 4FHKA 3FTVA 5FZSA 5G05J 3EIQC 3FWVA 2VGXB 2GGFA 5G04C 1JWGA 1NA3A 3HVEB 4N3AA 5LP0A 3UT7A 1E8YA 5BW8C 4F53A 2NXPA 3N71A 3ML8A 1XGWA 2LSVA 3EHMA 3TXMA 4DI4A 2IJGX 3ONKA 4GYYA 2VSNA 5DBKA 1ZU2A 4I6JA 3IBEA 4AEZC 4ANXA 3PUJA 2J08A 4O6FA 3URZA 3APCA 4J8EA 3G2UA 2Q7FA 3B7UX 4KBQA 1LF8A 5AYWD 4QFVA 1EPUA 4U07A 2FBNA 4FLHA 4I1OB 2R5SA 4CRWA 1E8WA 5ARGA 4A1SA 3ONLA 4NQ0A 4PS8A 4JA7A 1UG3A 3LS8A 2WQ6A 5FQ8A 4Y6CA 1WM5A 3U3WA 3CQGB 1XNFA 2I1KA 3HVEA 2UWJG 4HVBA 2WMNA 1P5QA 1DVPA 1E7UA 2WXRA 4RSYA 2XPIA 4KYOB 2PZIA 3PEVB 3D9OA 3QKYA 4V3IA 4XKCA 3UPVA 4HOTA 2UY1B 2J4DA 4APOA 4IRUA 3HYMB 2WMOA 5G2NA 3CHOA 3FU5A 5BNWA 4JHKA 4L1BA 4WWOA 3LY7A 3MYVA 4RG9A 2X6HA 3AS4A 4KVOA 4M3OA 3CSFA 3RJVA 3ZFWA 3SHFA 3MJWA 3NZSA 1H2UA 3PS6A 4P29A 3S7FA 2ONDA 4GZ5A 3RO2A 4I6GA 5BV1A 1PY1A 3CV0A 4DI3A 4RVBA 3CR3A 4B0ZA 3CKBA 4UWGA 3AS8A 3FDHA 4G2VA 3CKCA 3I4GA 1HS6A 1YA0A 3QNKA 3OAWA 1EDUA 2C0LA 2L0IA 5G04J 3U4TA 1HX8A 1VDYA 4G25A 4AOFA 1MQSA 3MGBA 2OV8A 2YNQA 5KJLA 4AVXA 2QFCA 5J08A 3FTWA 2J9QA 2IONA 4I2ZA 3U9WA 3UUXA 4EQFA 1IQUA 3AS5A 4UQXA 4MKTA 1H6KA 2XQ0A 4MS6A 5FWQA 2UY1A 3MKRA 3ZRHA 2HO1A 4GA0A 3D9NA 1UJKA 5FTPA 1KLXA 2WXMA 3RU0A 3CLJA 4BT9A 1FCHA 5KJNA 5ANRA 5BV0A 4JHJA 3HIZA 2R59A 4E6HA 2KCLA 3PEUB 5FT9A 2VJ8A 1HG2A 2VSXE 2CHXA 4ILHB 4XIFA 1NA0A 4HORA 2WXHA 2CG2A 3RO3A 5FZQA 3ZYKA 4A3VA 3KS2A 1UN8A 3CK7A 4ANWA 2XHEA 4FADA 2PQRA 3HDXA 1OWPA 4HXIA 5AENA 5A6CA 3ZEFA 3LCAA 4JL0A 2GRMA 3VLEA 2CFZA 3LYAA 2IQCA 2V0PA 2P58C 1Z6TA 2HM8A 4HOUA 4UQYA 3ZVVA 4ILGA 5HQ8A 4AXHA 3QARA 2MOWA 2WQHA 3NF1A 4HLEA 3FU0A 2XRZA 2CG3A 2GW1A 2X6JA 5KJMA 2XCBA 3L54A 4OVVA 3B7SA 4L23A 2IFUA 2M63A 3PNTB 3RRNB 1E8XA 2AXUA 3CVNA 4GA1A 4H7YA 2RD0A 4I9EA 3JUIA 3U66A 3ASGA 2KZTB 5CHEE 2WXPA 5FQ7A 3ZHEB 4DK5A 2XGSA 4KXKB 4GCOA 3L17A 4HS2A 4BTAA 1KT1A 1OWLA 2E2EA 3O4ZA 3T5VA 1QZ2A 4XI9A 2KC7A 3LY9A 3VTYA 5JJ7A 3GZ2A 3KEZA 3ZW3A 3OXFA 1FVHA 5CCMA 4GYOA 5FQ4A 4EECA 4N39A 5A23A 4CGVA 3I3NA 2AW6A 4HOSA 4BSXA 5AJDA 3GYZA 2JEKA 1E90A 4FULA 2AXZA 4GMLA 4OYSA 3PE4A 2VSYA 4U0SA 1Y8MA 4MRUA 4WAFA 3LVRE 1H19A 3UMVA 2WXLA 4A55A 1QNFA 2I2OA 2WXIA 2WXJA 2Y4TA 2AXVA 4UQZA 2WPVA 3TG5A 5T8IA 4BX8A 4EZKA 2BTDA 2J4BA 2LO6A 3ML9A 4CDMA 2FULA 3OXLA 4DPRA 1UW4B 4KMOA 3DPDA 3PE3A 3MV2B 4L7TA 2VTBA 3ASFA 2WXOA 3JQ1A 3QC1A 2PL2A 4JA9A 4I6EA 1HH8A 2IU1A 3ZHEA 2OVFA 3ZXSA 1EF1C 4I43A 5EX3A 5LX8A 3QAQA 3TG4A 1UJJA 4PH4B 4AP2A 1IQRA 3PZDA 3SNXA 2I6HA 1NP7A 1N52A 4JVSA 2WXNA 4U04A 2XRYA 3D9JA 4WNDA 2VGXA 1L5JA 1W3BA 4C0EA 2J49A 2LAIA 2KCVA 3FUEA 3T5XA 2WM9A 4F7AA 3GZSA 3BG1B 5EKQD 1WY6A 2X6KA 3L16A 4JXTA 5LOZA 3PVLA 4ACLA 4LRZA 3FUKA 4APFA 3CVUA 3ZN3A 2I9CA 3RIBA 4GB9A 5DIZA 4BX9A 2MRIA 2V5FA 4BY6A 3AU5A 3QWPA 1X5BA 4I17A 3CHSA 4BFRA 2X38A 3JQ0A 4FP7A 5C2YA 4G1TA 2WVIA 5FQ6A 4DJAA 2YHCA 4RG6A 5AIJA 4UI9K 3CVWA 2NC9A 3GZ1A 3PUKA 1IYGA 3MX3A 3SZ7A 2V4LA 4N5CA 4GU5A 1U3CA 3R7RA 3ZGQA 3K9IA 4FA6A 2QY7A 3CQCB 3NZUA 5T3RA 4Q69A 4I2WA 4K03A 2KCKA 3SF4A 1SZAA 3FEYA 2J07A 3IKOB 3VTXA 5FZRA 3RRMB 1TEZA 3FU3A 2Y3AA 3MKQB 5ANLA 5FJYA 3D9MA 4YVOA 3S2AA 4EBAA 3RK6A 4JC8A 2IOSA 4XE0A 1IHGA 4GZDA 2CHWA 2LNIA 1JPLA 2BUGA 4NURA 4WNGA 4BTBA 3G2WA 3APDA 4OVUA 3JCKC 4UWFA 3P1UA 3CHMA 3O48A 3ZYLA 3FTYA 3D9LA 2PQNA 4ILIA 4AIFA 3I4RB 4AM9A 3CK8A 4B94A 4YNDA 4B8CB 3LJ3A 4AY5A 1BPOA 4EPZA 4BWRA 4G23A 3B7RL 1N54A 2L6JA 3LXUX 3R7QA 3MV3B 3TL5A 4F1SA 3Q49B 2XGOA 4FHJA 3WXXA 3ZIMA 4GAAA 1DNPA 2VQ2A 3G2TA 4ACKA 3RRUA 3HHMA 3MA5A 3ASDA 4DLOA 4GZ6A 3TGOA 4XI0A 3CK9A 2WXGA 3Q15A 2KATA 1EYHA 2ILRA 2DIWA 4I1AA 4H7XA 1PAQA 1JUQA 3UQ3A 3ENEA 3QB2A 3CGHA 4LUNU 1GW6A 1ELRA 4AY6A 2A4ZA 4N3BA 4FJYA 3LKUA 4GMJA 4G24A 2VGYA 3CVQA 4U0UA 4URKA 5J90A 3FH7A 3SGHA 4IYPA 2L0TB 3ESLA 4U8HA 5LFAA 2BF0X 3PNLB 2ZU6B 3SI5A 3SBSA 4J6IA 3LPZA 3IV0A 1E7VA 3OTNA 4NACA 3CEQA 3EJNA 3IHYA 1FVFA 2IF4A 4I1MA 4F3VA 4JW1A 2MHKA 1UN9A 1MHQA 4PS7A 2XGMA 1OUVA 2AVPA 2DCPA 3FTXA 4JZYA 2JLBA 4KZCA 3L08A 3QWVA 3CVVA 1WAO1 2EQXA 3RKVA 4TUUA 3UT8A 3SFZA 1HXIA 2FI7A 1H0AA 2GRLA 3B7TA 3FUNA 3SBTB 3ZYQA 1OWNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HFG A;  1JWF A;  1EDU A;  3ZYK A;  2L0I A;  2QY7 A;  1HX8 A;  1VDY A;  2BF0 X;  1HG5 A;  3D9O A;  5LOZ A;  1SZA A;  4JXT A;  1INZ A;  4AVX A;  2LO6 A;  4NAC A;  5J08 A;  3G2T A;  3D9I A;  3ZYQ A;  3RRU A;  1SZ9 A;  3G2U A;  5CMY A;  1LF8 A;  3D9M A;  3G2S A;  4Q94 A;  2KM4 A;  1EYH A;  1MHQ A;  2DIW A;  1X5B A;  1HF8 A;  3D9N A;  4GZD A;  4Q96 A;  1JUQ A;  1JPL A;  1UJK A;  3ONL A;  2V8S E;  2DCP A;  4FU3 A;  1JWG A;  3G2W A;  1UJJ A;  3D9P A;  3CLJ A;  5LP0 A;  2MOW A;  3ZYM A;  3G2V A;  3ZYL A;  4GZC A;  3D9L A;  1PY1 A;  3D9K A;  3D9J A;  1H0A A;  3LDZ A;  1HG2 A;  1ELK A;  4FLB A;  1XGW A;  5CMW A;  1HFA A;  2L0T B;  1DVP A;  3ONK A; 
#chains in the Genus database with same CATH topology
 4U95 D;  2IOL A;  3T8M A;  1H2V C;  1HO8 A;  2QYU A;  4O1P A;  1N95 A;  2Y4U A;  4UWK A;  5JJ6 A;  3P2B A;  4XZ4 A;  3BG0 B;  1PC2 A;  1JWF A;  4GTS A;  4JPS A;  2AWI A;  4HB5 A;  1OWM A;  4FU3 A;  3TXN A;  4MLP A;  2YQ8 A;  3I5P A;  3TAX A;  4L2Y A;  4A3T A;  3UT4 A;  4J8S A;  2FF4 A;  5CMY A;  5JJT A;  3Q47 B;  3E34 A;  3UM1 A;  4PDX A;  2J09 A;  3S7B A;  4C0M A;  4MBG A;  2C2L A;  5AAO A;  3DBS A;  3AAA C;  3EIJ A;  3IEG A;  3NAW A;  3GW4 A;  3QDN A;  4CYM D;  1RZ4 A;  1Z3Y A;  2HYZ A;  3FUI A;  4CEM A;  2QYJ A;  4EBA G;  4CDN A;  1JCR A;  3R9M A;  2X6I A;  3HXF A;  1S70 B;  1Z3X A;  4JHR A;  4Q94 A;  4UUC A;  1SVX A;  3SY2 A;  1S0P A;  4PS3 A;  4L2L A;  2Y1L E;  4WNF A;  3S7D A;  3Q5M A;  5BUZ A;  3V31 A;  2DZN A;  4GYW A;  3UX4 A;  4ANU A;  4AJW A;  4CGW A;  4BES A;  3NQP A;  3TWR A;  3APF A;  3U64 A;  3L82 A;  5C1D A;  3DRA A;  4ATG A;  5M72 A;  2XPY A;  3FH8 A;  3QOU A;  3CVX A;  1DCE A;  3QWW A;  4GPK A;  2EIK E;  1U3D A;  2VTB B;  3HXD A;  3EHN A;  4UWH A;  3FHE A;  4HOQ A;  3PZ2 A;  2X3M A;  1MYO A;  4CCA A;  1WG0 A;  2KM4 A;  2VGX B;  4B93 B;  5LP0 A;  1OY3 D;  1YYH A;  1LTX A;  4F53 A;  2NXP A;  3TWX A;  3ML8 A;  3TXM A;  2IJG X;  3NOG D;  4GYY A;  2VSN A;  3TWU A;  1N0R A;  4ANX A;  4O6F A;  4J8E A;  3G2U A;  3Q7F A;  5AYW D;  4QFV A;  1EPU A;  4FLH A;  4I1O B;  4CRW A;  5ARG A;  3ONL A;  4NQ0 A;  4JA7 A;  3V30 A;  3LS8 A;  5AN8 A;  4Y6C A;  3CQG B;  2I1K A;  2XZD G;  2P9K G;  3HVE A;  4HVB A;  2WMN A;  4GPM A;  4GTR A;  4KYO B;  3PEV B;  4K5B A;  3DEO A;  4APO A;  1MJ0 A;  3CHO A;  5BNW A;  4JHK A;  4L1B A;  2X6H A;  4M3O A;  3ZU7 B;  3SHF A;  3PS6 A;  1BU9 A;  2OND A;  4GTQ A;  4DX7 D;  1BD8 A;  3CR3 A;  4B0Z A;  3EU5 A;  3AS8 A;  5BXU A;  1YA0 A;  4BX9 A;  3OAW A;  1EDU A;  4HBD A;  3U4T A;  1HX8 A;  1MQS A;  3MGB A;  4CZ2 D;  1K1A A;  3UIN C;  1IQU A;  2AJA A;  5FWQ A;  3ZRH A;  3D9N A;  1UJK A;  5KJN A;  4TXP A;  3PEU B;  2B0O E;  3TWW A;  3LJN A;  2XHE A;  4DRX E;  1H6P A;  5A6C A;  3PZ4 A;  3LCA A;  2GRM A;  3VLE A;  2CFZ A;  3SO8 A;  3ZVV A;  5CRU A;  2WQH A;  1N4Q A;  3W9G A;  4F1P A;  3L54 A;  4L23 A;  1TNO A;  3CVN A;  4GA1 A;  3KSQ A;  3JUI A;  3ASG A;  5CHE E;  2WXP A;  3ZHE B;  4KXK B;  1OWL A;  5B1B E;  5CCM A;  5FQ4 A;  4QQI A;  4BSX A;  3DSV A;  4FUL A;  2AXZ A;  2LXM A;  3AG2 E;  1O5M A;  2VSY A;  4U0S A;  5HRY A;  1Y8M A;  2V4H C;  4MRU A;  4WAF A;  5B3S E;  4BX8 A;  4UQZ A;  3ML9 A;  4X8Q A;  4CDM A;  3OXL A;  1UW4 B;  4KMO A;  2VTB A;  1V54 E;  1HH8 A;  5LX8 A;  2DVW A;  4JD2 G;  4WND A;  1NP7 A;  1JCQ A;  2WXN A;  4JVS A;  3D9J A;  2VGX A;  1SA4 A;  4C0E A;  1OCR E;  2J49 A;  3BQO A;  3JXJ A;  2LAI A;  3ASO E;  4F7A A;  3BG1 B;  3KSL A;  3PVL A;  4YDW A;  4ACL A;  4ZFH A;  3FUK A;  2I9C A;  4GB9 A;  2V5F A;  3Q7A A;  3AU5 A;  4BFR A;  3HXE A;  5JA4 D;  2RFA A;  1DCQ A;  5FQ6 A;  3GZ1 A;  3PUK A;  4ATZ D;  2V4L A;  3R7R A;  3K9I A;  3KEA A;  3NZU A;  3CQC B;  4Q69 A;  4I2W A;  4K03 A;  1SZA A;  3VTX A;  5FZR A;  3RRM B;  2IOS A;  4XE0 A;  2LNI A;  1JPL A;  2BUG A;  4BTB A;  3FTY A;  4ILI A;  2PQN A;  4RLY A;  4B8C B;  3C3O A;  3LJ3 A;  5KWD A;  4DX1 A;  4EPZ A;  2KXP C;  3Q9U C;  2L6J A;  3J5Q B;  5ENO D;  4F1S A;  3RSE G;  3WXX A;  3RRU A;  3MA5 A;  3ASD A;  1A5E A;  1TNY A;  4XI0 A;  4DX6 D;  1NFI E;  2EIJ E;  2ILR A;  4I1A A;  1JUQ A;  3ENE A;  3CGH A;  2A4Z A;  2VGY A;  4U0U A;  3FH7 A;  5HS0 A;  2L0T B;  3HG0 D;  5LFA A;  2ZU6 B;  3IV0 A;  4NAC A;  3EJN A;  3IHY A;  1FVF A;  2DCP A;  3FTX A;  2EQX A;  3UT8 A;  3SFZ A;  1HXI A;  1D9S A;  3B7T A;  3DWL G;  5LCW C;  4K5A B;  3HXC A;  2RG8 A;  5ARF A;  2R03 A;  2DYS E;  3B13 A;  4GTT A;  1SW6 A;  3ULQ A;  5KCM A;  3IHV A;  3D9K A;  3MEK A;  2P9N G;  4HFG A;  4HLL A;  3ABL E;  4YDE A;  3OXG A;  1SZ9 A;  5D0Q D;  3S7J A;  2C0M A;  3L13 A;  3AJI A;  3FH5 A;  3D9P A;  4JEU A;  1E96 B;  3CVL A;  5BT1 A;  2WXF A;  3FP3 A;  3FEX A;  2LSU A;  3LDZ A;  3DSS A;  3PDN A;  2DBA A;  2HR2 A;  3LEW A;  3SD5 A;  4I9C A;  1N94 A;  3X2Q E;  3D9I A;  4KT6 B;  4PUC A;  5BPP A;  5LCW J;  5EDS A;  5AJL A;  3TWQ A;  3FUJ A;  1KPS B;  3FUH A;  4DLQ A;  1QQE A;  1K1B A;  4J8F A;  5G05 C;  2BKG A;  2ETA A;  1B89 A;  3FUM A;  4HRN A;  1SQM A;  4GZ3 A;  4NRH B;  3C3R A;  4E85 A;  4BT8 A;  2PNN A;  3CVY A;  1TJF A;  2F8Y A;  4B8A A;  3FUD A;  4DX2 A;  4Z68 A;  2P9I G;  4AV7 A;  1LD8 A;  1ELK A;  2CFU A;  3KD7 A;  3MCX A;  2ETB A;  2WB2 A;  3Q9N C;  1OWO A;  5JHA A;  4ME2 A;  3FTS A;  3AU4 A;  2L9B A;  2GRO B;  4R7L A;  1IKN D;  2R2L A;  4WNE A;  3AG1 E;  2H6H A;  4GCN A;  3LY8 A;  1HG5 A;  4D10 C;  3CHP A;  3CIA A;  3DPY A;  4LER A;  3FFL A;  5ENS D;  2IY0 C;  5FZS A;  5G05 J;  3EIQ C;  5G04 C;  3UIO C;  3HVE B;  1N4S A;  1E8Y A;  2LSV A;  3ONK A;  2ETC A;  5DBK A;  4L9P A;  3ISM C;  4I6J A;  3PUJ A;  2J08 A;  3URZ A;  3APC A;  2Q7F A;  3JXI A;  1LF8 A;  4HRM B;  1E8W A;  1UG3 A;  2WQ6 A;  2XZT G;  5JMN D;  1XNF A;  2R05 A;  3ZXP A;  1P5Q A;  2WXR A;  3IXE A;  3QKY A;  5HKP A;  1MX4 A;  5EYP F;  2J4D A;  5D66 A;  3FU5 A;  4RG9 A;  3AS4 A;  4KVO A;  1KZO A;  3ZFW A;  3NZS A;  3S7F A;  4P29 A;  2XS1 A;  3E37 A;  4GZ5 A;  3RO2 A;  3CV0 A;  4RVB A;  3FDH A;  3CKC A;  1HS6 A;  1JCS A;  5G04 J;  1OCO E;  5J08 A;  2ION A;  3AG3 E;  1H6K A;  4MS6 A;  2UY1 A;  3UTM A;  1S64 A;  1KLX A;  3T8K A;  3RU0 A;  1FCH A;  5BV0 A;  4BET A;  4E6H A;  1O1T A;  1HG2 A;  3E33 A;  3V2O A;  4ILH B;  4HOR A;  2ZXW E;  2CG2 A;  4A3V A;  4FAD A;  2MYO A;  3ZEF A;  4JL0 A;  4U8V D;  3LYA A;  2HM8 A;  4UQY A;  4O1O A;  2XRZ A;  2X6J A;  3B7S A;  3RRN B;  2P2C P;  3U66 A;  4BSZ B;  2XGS A;  1KT1 A;  4XI9 A;  2KC7 A;  3KEZ A;  3OXF A;  3T9K A;  4GYO A;  4N39 A;  5CEA A;  2AW6 A;  2XEH A;  3Q78 A;  5AJD A;  1Z5S C;  3GYZ A;  3PE4 A;  2KBX A;  1N9A A;  3UMV A;  2WXL A;  1QNF A;  2I2O A;  2Y4T A;  2J8S D;  5T8I A;  2BTD A;  2FUL A;  2ZIS A;  3DPD A;  4L7T A;  5H7P A;  4JA9 A;  4I6E A;  1IQR A;  3PZD A;  4U04 A;  3ABK E;  1W3B A;  2WM9 A;  3GZS A;  1WY6 A;  3DXK G;  3RIB A;  2MRI A;  4BY6 A;  2ZGD A;  4FP7 A;  4G1T A;  1ZB1 A;  2WVI A;  4DJA A;  2YHC A;  3CVW A;  3MX3 A;  3SZ7 A;  4FA6 A;  2QY7 A;  3EHQ A;  1TEZ A;  2Y3A A;  3MKQ B;  5FJY A;  3S2A A;  4EBA A;  4JC8 A;  2BKK B;  4DX5 D;  2F0Y A;  3G2W A;  3P1U A;  3ZYL A;  1OXJ A;  5KBA A;  4AY5 A;  4YND A;  1N54 A;  3LXU X;  3R7Q A;  1KZP A;  4GTP A;  2R02 A;  4GZ6 A;  2WXG A;  3Q15 A;  3SFX A;  2KAT A;  2DIW A;  3QB2 A;  4LUN U;  3LKU A;  3CVQ A;  4J7W A;  3UXG A;  4URK A;  5J90 A;  3SGH A;  3TWS A;  3V79 K;  1FT1 A;  4U8H A;  2BF0 X;  3PNL B;  3SI5 A;  1E7V A;  4XEI G;  5FIO A;  5KNH D;  5CRV A;  1TNZ A;  4I1M A;  4F3V A;  1UN9 A;  2AVP A;  1TYQ G;  3L08 A;  3CVV A;  1N4P A;  1OWN A;  4LCT A;  3CST A;  4N2S A;  4DUI A;  1DC2 A;  1INZ A;  4LNB A;  4HI8 A;  4LEU A;  1BI7 B;  2OEV A;  4Y6W A;  4Q96 A;  1E8Z A;  3ZYM A;  4GZC A;  1BLX B;  4IUL A;  3MZL B;  2OEW A;  3PZ1 A;  4EHM A;  3FY4 A;  3BEE A;  3DSW A;  4LNU D;  5T4Y A;  3VLF A;  3LVQ E;  4C9B B;  3ZKJ A;  3CHQ A;  4G26 A;  4TRQ A;  2PM6 A;  3ASN E;  3UI2 A;  3NB2 A;  3DXM G;  1HZ4 A;  2XPZ A;  1AP7 A;  4G11 A;  2E0I A;  4LNG A;  3DSX A;  5CCL A;  4UI9 J;  3E4B A;  1H2T C;  4CT4 A;  3FU6 A;  1IXV A;  3G2V A;  4HRL A;  2F37 A;  4TXQ A;  4FLB A;  5EX0 A;  1HFA A;  2ZGG A;  3ZPJ A;  2WXQ A;  5A7D B;  4U63 A;  2WQ7 A;  4J0U A;  3PRE A;  3FUF A;  4XX5 A;  2YHE A;  3FTU A;  1U2V G;  4W9R A;  4UWL A;  3QK0 A;  4FJZ A;  4KZ0 A;  4EZL A;  3MKQ A;  5IY5 E;  3VLD A;  1AWC B;  4O60 A;  4A1G A;  2GRP B;  4ANV A;  2FEZ A;  3EU9 A;  4B89 A;  4OAV B;  3CVP A;  1O1S A;  2YIN A;  4N2Q A;  2HE0 A;  1HU3 A;  1K3Z D;  1SA5 A;  5ENQ D;  3UM3 A;  2FO7 A;  4EZJ A;  3PRZ A;  4FC8 A;  4CT0 A;  3NBN B;  2VYI A;  3ESK A;  2A5U A;  3F6Q A;  3NOC D;  3L6A A;  1ELW A;  3FUL A;  3L22 A;  3FTV A;  1Q2Z A;  3FWV A;  2GGF A;  1JWG A;  5BW8 C;  3EHM A;  4DI4 A;  1O1R A;  4F6R D;  4KBQ A;  5CED B;  2FBN A;  4PS8 A;  1TN6 A;  1WM5 A;  3U3W A;  2UWJ G;  2EIN E;  3TWV A;  5AAR A;  2UY1 B;  4M7C A;  2A5E A;  3HYM B;  2FO1 E;  4WWO A;  3DSU A;  3RJV A;  3MJW A;  4DI3 A;  3I4G A;  4AOF A;  2L0I A;  4G25 A;  2OV8 A;  1OT8 A;  3EUV A;  2EIL E;  2YNQ A;  3HXB A;  4AVX A;  2QFC A;  2J9Q A;  3U9W A;  3AS5 A;  4UQX A;  5CER B;  3MKR A;  5ITZ F;  2HO1 A;  4GA0 A;  3ABM E;  5FTP A;  4A63 B;  2WXM A;  3CLJ A;  4TUM A;  5EIL A;  1D8D A;  4JHJ A;  1NA0 A;  2WXH A;  3RO3 A;  5FZQ A;  1N11 A;  3KS2 A;  1UN8 A;  3CK7 A;  4ANW A;  1FT2 A;  2PQR A;  3HDX A;  4YDO A;  2Y0B G;  1OWP A;  4J8Y A;  2IQC A;  2V0P A;  5ENT D;  4HOU A;  4ILG A;  5HQ8 A;  2EIM E;  4HLE A;  4HI9 A;  2XCB A;  4GMR A;  4OVV A;  2M63 A;  3JUE A;  2AXU A;  4I9E A;  5AQ7 A;  2KZT B;  4C48 B;  1YMP A;  3L17 A;  4HS2 A;  3T5V A;  2DZO A;  4EEC A;  5A23 A;  1X81 A;  1MZC A;  4HOS A;  2H6G A;  3C3Q A;  3ULE G;  4OYS A;  1E90 A;  4GML A;  1MX6 A;  2Y69 E;  2XEN A;  3LVR E;  3J5P A;  4A55 A;  2WXI A;  2WPV A;  2J4B A;  2LO6 A;  2P9L G;  2H6I A;  4DPR A;  3ASF A;  2WXO A;  2OVF A;  3ZXS A;  3QAQ A;  3WG7 E;  4U8Y D;  1UJJ A;  3TG4 A;  3ZNG A;  4AP2 A;  5CBO A;  3SNX A;  2I6H A;  3UM0 A;  1L5J A;  3FUE A;  5EKQ D;  3L16 A;  4LRZ A;  3CVU A;  2V5Q C;  1X5B A;  2X38 A;  2H6F A;  5C2Y A;  4LG6 A;  4NIK A;  2LXL A;  4N5C A;  3ZGQ A;  5T3R A;  3FEY A;  2J07 A;  4U7E B;  2IEJ A;  1K8K G;  1MX2 A;  3RK6 A;  1QYM A;  1IHG A;  4GZD A;  2CHW A;  4LSZ E;  4NUR A;  1LD7 A;  3APD A;  4OVU A;  4UWF A;  3C72 A;  3O48 A;  3D9L A;  4B94 A;  4BWR A;  2NYJ A;  3UM2 A;  1UOH A;  3MV3 B;  3TL5 A;  2GRR B;  3ZIM A;  4GAA A;  3G2T A;  4ACK A;  3HHM A;  5KNG A;  1EYH A;  4H7X A;  1PAQ A;  1GW6 A;  1ELR A;  4AY6 A;  2JAB A;  4N3B A;  4FJY A;  4ZHB A;  2XEE A;  4IYP A;  3HRA A;  3ESL A;  3DST A;  1TNU A;  2P9P G;  3SBS A;  3OTN A;  4OAU C;  2DYR E;  2IO2 C;  2MHK A;  4BEP A;  1MHQ A;  3E32 A;  4JZY A;  2JLB A;  4KZC A;  1WAO 1;  3RKV A;  4TUU A;  2FI7 A;  1H0A A;  1S63 A;  3SBT B;  3ZYQ A;  2OVB A;  4N3C A;  4YVQ C;  5AQA A;  3TJP A;  4WUY A;  3DEP A;  2WXK A;  2P9S G;  1KT0 A;  1QBQ A;  3G2S A;  1A17 A;  2KZT A;  1NZN A;  3EDT B;  3KAE A;  1TR4 A;  2RKK A;  4JEH A;  3C5R A;  3JYS A;  3RAU A;  5CMW A;  2X6F A;  2CHZ A;  4G8L A;  2R17 C;  1TJC A;  4WWP A;  4KVM A;  5EIB E;  3L9T A;  5AQ9 A;  3BU8 A;  5E75 A;  5KJK A;  2RFM A;  4ABN A;  2I1J A;  2GRN B;  4K0R A;  3B95 A;  5ENN A;  2PM7 A;  1TNB A;  2OCC E;  1Y6I A;  1H6O A;  3PH0 C;  2LAH A;  5E76 A;  4WWN A;  2QZA A;  4J8D A;  2OOE A;  4CDR A;  3R9A B;  3Q4A B;  5D0O D;  3V2X A;  5JHB A;  2QC9 A;  3FTZ A;  4YDY A;  2XS8 A;  5EN5 D;  5G55 A;  3E30 A;  2VSO E;  3PZ3 A;  2ZIR A;  3D3M A;  3UKR G;  3C98 A;  4XKB A;  3BUA A;  5FIN A;  2XCC A;  5ENP D;  1HF8 A;  3Q79 A;  3SQV A;  3ASH A;  2V8S E;  2BED A;  4IN3 B;  2XEV A;  4U0Z A;  2NSZ A;  3CHR A;  1HE8 A;  4N5Q A;  4UI9 C;  4HQD A;  1ZBP A;  3QJZ A;  4TV3 A;  5HI7 A;  4GA2 A;  4FHK A;  5ENR D;  5CBN A;  3ZUV B;  4N3A A;  1NA3 A;  3UT7 A;  3N71 A;  3TWT A;  1XGW A;  1ZU2 A;  3IBE A;  4AEZ C;  2VGE A;  3B7U X;  4GTO A;  4U07 A;  2R5S A;  1D8E A;  4A1S A;  5FQ8 A;  3ULY A;  1DVP A;  1E7U A;  4RSY A;  2XPI A;  2PZI A;  3D9O A;  4V3I A;  4XKC A;  3UPV A;  4HOT A;  4IRU A;  2WMO A;  5G2N A;  2B6C A;  3LY7 A;  3MYV A;  3CSF A;  1H2U A;  5BV1 A;  2GRQ B;  4I6G A;  1PY1 A;  5BXO A;  3CKB A;  4UWG A;  4G2V A;  3QNK A;  2C0L A;  1VDY A;  5KJL A;  3FTW A;  4EQF A;  4I2Z A;  3UUX A;  4K5C A;  4MKT A;  2XQ0 A;  3B7B A;  4BT9 A;  5ANR A;  1N4R A;  1G3N B;  2R59 A;  3HIZ A;  2KCL A;  5FT9 A;  2VJ8 A;  2VSX E;  4HNA D;  2CHX A;  4XIF A;  3ZYK A;  3EHR A;  5EID A;  1IHB A;  2F8X K;  4HXI A;  5AEN A;  2L6B A;  5EYL A;  2P58 C;  1Z6T A;  2P9U G;  4AXH A;  3D9H A;  3QAR A;  2MOW A;  3NF1 A;  3FU0 A;  2CG3 A;  2GW1 A;  3Q73 A;  5KJM A;  5CEC B;  2IFU A;  3PNT B;  1E8X A;  4H7Y A;  2RD0 A;  1N0Q A;  4DK5 A;  5FQ7 A;  4GCO A;  4BTA A;  2E2E A;  3O4Z A;  1QZ2 A;  3LY9 A;  3VTY A;  5JJ7 A;  3UIP C;  3GZ2 A;  1WDY A;  3ZW3 A;  1FVH A;  4CGV A;  3I3N A;  2LUH A;  1V55 E;  5D2M C;  2JEK A;  1H19 A;  2WXJ A;  2AXV A;  4EZK A;  3TG5 A;  4U96 D;  3PE3 A;  3MV2 B;  1BI8 B;  3JQ1 A;  3QC1 A;  2PL2 A;  3ZHE A;  2IU1 A;  1EF1 C;  4I43 A;  5EX3 A;  4PH4 B;  1N52 A;  2XRY A;  2KCV A;  3T5X A;  1RW2 A;  2X6K A;  1TN8 A;  5LOZ A;  4JXT A;  4APF A;  4RQI A;  3ZN3 A;  5DIZ A;  3QWP A;  4I17 A;  1NL4 A;  3CHS A;  3UKU G;  3JQ0 A;  3SFY A;  4RG6 A;  5AIJ A;  4UI9 K;  5B1A E;  2NC9 A;  3Q75 A;  1IYG A;  4GU5 A;  1U3C A;  3AG4 E;  1FPP A;  2KCK A;  3SF4 A;  3IKO B;  3FU3 A;  5ANL A;  3D9M A;  4YVO A;  1OCZ E;  4GTV A;  4WNG A;  3JCK C;  3CHM A;  4AIF A;  3I4R B;  4AM9 A;  3CK8 A;  1BPO A;  4G23 A;  3B7R L;  4GTM A;  3Q49 B;  2XGO A;  4G8K A;  4FHJ A;  4JB8 P;  4BER A;  1DNP A;  2VQ2 A;  3TGO A;  4DLO A;  3CK9 A;  3UQ3 A;  4GMJ A;  4G24 A;  1TN7 A;  4TXR A;  1NI1 A;  2IO3 C;  4J6I A;  3LPZ A;  3CEQ A;  2IF4 A;  4JW1 A;  4PS7 A;  2XGM A;  1OUV A;  3W9F A;  1OCC E;  3QWV A;  5AQB A;  2DWZ A;  2GRL A;  3FUN A;  1YCS B; 
#chains in the Genus database with same CATH homology
 2OVB A;  4N3C A;  5LCW C;  4LCT A;  3CST A;  4YVQ C;  4N2S A;  2IOL A;  3TJP A;  1INZ A;  4WUY A;  1H2V C;  3T8M A;  2WXK A;  4LEU A;  2RG8 A;  1HO8 A;  1KT0 A;  4Y6W A;  3G2S A;  1A17 A;  5ARF A;  2KZT A;  1NZN A;  2Y4U A;  3EDT B;  3KAE A;  4Q96 A;  3B13 A;  1E8Z A;  4JEH A;  4UWK A;  3ULQ A;  3ZYM A;  5KCM A;  4GZC A;  3IHV A;  5JJ6 A;  4IUL A;  3D9K A;  3JYS A;  3P2B A;  3MEK A;  4XZ4 A;  5CMW A;  2X6F A;  2CHZ A;  3BG0 B;  1PC2 A;  3MZL B;  4HFG A;  1JWF A;  3FY4 A;  2R17 C;  1TJC A;  3BEE A;  4WWP A;  3OXG A;  4JPS A;  4KVM A;  2AWI A;  5T4Y A;  3VLF A;  1SZ9 A;  3LVQ E;  5D0Q D;  3S7J A;  4C9B B;  2C0M A;  3CHQ A;  4G26 A;  5E75 A;  1OWM A;  3L13 A;  5KJK A;  4FU3 A;  3TXN A;  3FH5 A;  3D9P A;  4JEU A;  4MLP A;  1E96 B;  3CVL A;  5BT1 A;  2WXF A;  2YQ8 A;  3FP3 A;  3FEX A;  3I5P A;  2LSU A;  4TRQ A;  4ABN A;  3LDZ A;  3PDN A;  3TAX A;  2I1J A;  2PM6 A;  2DBA A;  2HR2 A;  3LEW A;  4L2Y A;  3SD5 A;  4K0R A;  4I9C A;  4A3T A;  5ENN A;  2PM7 A;  3UT4 A;  3D9I A;  4J8S A;  1HZ4 A;  4KT6 B;  1Y6I A;  2XPZ A;  4PUC A;  4G11 A;  5BPP A;  2FF4 A;  5CMY A;  5JJT A;  2E0I A;  3Q47 B;  5LCW J;  5CCL A;  5EDS A;  4UI9 J;  4PDX A;  2J09 A;  3E4B A;  1H2T C;  3S7B A;  5AJL A;  4C0M A;  4CT4 A;  2C2L A;  3FU6 A;  3G2V A;  3FUJ A;  3PH0 C;  3DBS A;  2LAH A;  3FUH A;  4DLQ A;  5E76 A;  1QQE A;  3EIJ A;  3IEG A;  4FLB A;  4WWN A;  1HFA A;  5EX0 A;  3GW4 A;  3ZPJ A;  3QDN A;  4J8F A;  5G05 C;  2WXQ A;  5A7D B;  4J8D A;  4U63 A;  1B89 A;  3FUM A;  2WQ7 A;  1Z3Y A;  1SQM A;  2HYZ A;  2OOE A;  4GZ3 A;  3FUI A;  4J0U A;  4NRH B;  3R9A B;  4CEM A;  4CDR A;  4EBA G;  4CDN A;  3Q4A B;  3PRE A;  5D0O D;  4E85 A;  4BT8 A;  3FUF A;  5JHB A;  3FTZ A;  2X6I A;  2YHE A;  4JHR A;  1Z3X A;  3FTU A;  4Q94 A;  4XX5 A;  4W9R A;  4UWL A;  3QK0 A;  4FJZ A;  3CVY A;  4KZ0 A;  1TJF A;  4EZL A;  3MKQ A;  1S0P A;  3VLD A;  4PS3 A;  4L2L A;  4B8A A;  3FUD A;  4WNF A;  5G55 A;  4A1G A;  3S7D A;  4ANV A;  3Q5M A;  5BUZ A;  4AV7 A;  1ELK A;  2VSO E;  3D3M A;  2FEZ A;  4B89 A;  4GYW A;  3UX4 A;  3C98 A;  4XKB A;  4ANU A;  4AJW A;  3CVP A;  2CFU A;  3KD7 A;  3MCX A;  4CGW A;  3NQP A;  2YIN A;  2WB2 A;  3APF A;  4N2Q A;  3U64 A;  2XCC A;  1OWO A;  5JHA A;  5C1D A;  1HF8 A;  4ME2 A;  3ASH A;  2V8S E;  3FTS A;  4ATG A;  1HU3 A;  5M72 A;  2XPY A;  3FH8 A;  4IN3 B;  3QOU A;  3CVX A;  2XEV A;  3AU4 A;  3QWW A;  2L9B A;  4R7L A;  4GPK A;  4U0Z A;  2FO7 A;  2NSZ A;  4WNE A;  4EZJ A;  3CHR A;  3PRZ A;  4GCN A;  1U3D A;  2VTB B;  3LY8 A;  4FC8 A;  4CT0 A;  3EHN A;  1HG5 A;  1HE8 A;  4UI9 C;  4D10 C;  2VYI A;  3ESK A;  3CHP A;  2A5U A;  4UWH A;  3FHE A;  1ZBP A;  3QJZ A;  4TV3 A;  3CIA A;  5HI7 A;  3L6A A;  4LER A;  1ELW A;  4HOQ A;  4GA2 A;  2X3M A;  4CCA A;  3FUL A;  2KM4 A;  3L22 A;  3FFL A;  4FHK A;  3FTV A;  5FZS A;  5G05 J;  3EIQ C;  3FWV A;  2VGX B;  2GGF A;  5G04 C;  1JWG A;  1NA3 A;  3HVE B;  4N3A A;  5LP0 A;  3UT7 A;  1E8Y A;  5BW8 C;  4F53 A;  2NXP A;  3N71 A;  3ML8 A;  1XGW A;  2LSV A;  3EHM A;  3TXM A;  4DI4 A;  2IJG X;  3ONK A;  4GYY A;  2VSN A;  5DBK A;  1ZU2 A;  4I6J A;  3IBE A;  4AEZ C;  4ANX A;  3PUJ A;  2J08 A;  4O6F A;  3URZ A;  3APC A;  4J8E A;  3G2U A;  2Q7F A;  3B7U X;  4KBQ A;  1LF8 A;  5AYW D;  4QFV A;  1EPU A;  4U07 A;  2FBN A;  4FLH A;  4I1O B;  2R5S A;  4CRW A;  1E8W A;  5ARG A;  4A1S A;  3ONL A;  4NQ0 A;  4PS8 A;  4JA7 A;  1UG3 A;  3LS8 A;  2WQ6 A;  5FQ8 A;  4Y6C A;  1WM5 A;  3U3W A;  3CQG B;  1XNF A;  2I1K A;  3HVE A;  2UWJ G;  4HVB A;  2WMN A;  1P5Q A;  1DVP A;  1E7U A;  2WXR A;  4RSY A;  2XPI A;  4KYO B;  2PZI A;  3PEV B;  3D9O A;  3QKY A;  4V3I A;  4XKC A;  3UPV A;  4HOT A;  2UY1 B;  2J4D A;  4APO A;  4IRU A;  3HYM B;  2WMO A;  5G2N A;  3CHO A;  3FU5 A;  5BNW A;  4JHK A;  4L1B A;  4WWO A;  3LY7 A;  3MYV A;  4RG9 A;  2X6H A;  3AS4 A;  4KVO A;  4M3O A;  3CSF A;  3RJV A;  3ZFW A;  3SHF A;  3MJW A;  3NZS A;  1H2U A;  3PS6 A;  4P29 A;  3S7F A;  2OND A;  4GZ5 A;  3RO2 A;  4I6G A;  5BV1 A;  1PY1 A;  3CV0 A;  4DI3 A;  4RVB A;  3CR3 A;  4B0Z A;  3CKB A;  4UWG A;  3AS8 A;  3FDH A;  4G2V A;  3CKC A;  3I4G A;  1HS6 A;  1YA0 A;  3QNK A;  3OAW A;  1EDU A;  2C0L A;  2L0I A;  5G04 J;  3U4T A;  1HX8 A;  1VDY A;  4G25 A;  4AOF A;  1MQS A;  3MGB A;  2OV8 A;  2YNQ A;  5KJL A;  4AVX A;  2QFC A;  5J08 A;  3FTW A;  2J9Q A;  2ION A;  4I2Z A;  3U9W A;  3UUX A;  4EQF A;  1IQU A;  3AS5 A;  4UQX A;  4MKT A;  1H6K A;  2XQ0 A;  4MS6 A;  5FWQ A;  2UY1 A;  3MKR A;  3ZRH A;  2HO1 A;  4GA0 A;  3D9N A;  1UJK A;  5FTP A;  1KLX A;  2WXM A;  3RU0 A;  3CLJ A;  4BT9 A;  1FCH A;  5KJN A;  5ANR A;  5BV0 A;  4JHJ A;  3HIZ A;  2R59 A;  4E6H A;  2KCL A;  3PEU B;  5FT9 A;  2VJ8 A;  1HG2 A;  2VSX E;  2CHX A;  4ILH B;  4XIF A;  1NA0 A;  4HOR A;  2WXH A;  2CG2 A;  3RO3 A;  5FZQ A;  3ZYK A;  4A3V A;  3KS2 A;  1UN8 A;  3CK7 A;  4ANW A;  2XHE A;  4FAD A;  2PQR A;  3HDX A;  1OWP A;  4HXI A;  5AEN A;  5A6C A;  3ZEF A;  3LCA A;  4JL0 A;  2GRM A;  3VLE A;  2CFZ A;  3LYA A;  2IQC A;  2V0P A;  2P58 C;  1Z6T A;  2HM8 A;  4HOU A;  4UQY A;  3ZVV A;  4ILG A;  5HQ8 A;  4AXH A;  3QAR A;  2MOW A;  2WQH A;  3NF1 A;  4HLE A;  3FU0 A;  2XRZ A;  2CG3 A;  2GW1 A;  2X6J A;  5KJM A;  2XCB A;  3L54 A;  4OVV A;  3B7S A;  4L23 A;  2IFU A;  2M63 A;  3PNT B;  3RRN B;  1E8X A;  2AXU A;  3CVN A;  4GA1 A;  4H7Y A;  2RD0 A;  4I9E A;  3JUI A;  3U66 A;  3ASG A;  2KZT B;  5CHE E;  2WXP A;  5FQ7 A;  3ZHE B;  4DK5 A;  2XGS A;  4KXK B;  4GCO A;  3L17 A;  4HS2 A;  4BTA A;  1KT1 A;  1OWL A;  2E2E A;  3O4Z A;  3T5V A;  1QZ2 A;  4XI9 A;  2KC7 A;  3LY9 A;  3VTY A;  5JJ7 A;  3GZ2 A;  3KEZ A;  3ZW3 A;  3OXF A;  1FVH A;  5CCM A;  4GYO A;  5FQ4 A;  4EEC A;  4N39 A;  5A23 A;  4CGV A;  3I3N A;  2AW6 A;  4HOS A;  4BSX A;  5AJD A;  3GYZ A;  2JEK A;  1E90 A;  4FUL A;  2AXZ A;  4GML A;  4OYS A;  3PE4 A;  2VSY A;  4U0S A;  1Y8M A;  4MRU A;  4WAF A;  3LVR E;  1H19 A;  3UMV A;  2WXL A;  4A55 A;  1QNF A;  2I2O A;  2WXI A;  2WXJ A;  2Y4T A;  2AXV A;  4UQZ A;  2WPV A;  3TG5 A;  5T8I A;  4BX8 A;  4EZK A;  2BTD A;  2J4B A;  2LO6 A;  3ML9 A;  4CDM A;  2FUL A;  3OXL A;  4DPR A;  1UW4 B;  4KMO A;  3DPD A;  3PE3 A;  3MV2 B;  4L7T A;  2VTB A;  3ASF A;  2WXO A;  3JQ1 A;  3QC1 A;  2PL2 A;  4JA9 A;  4I6E A;  1HH8 A;  2IU1 A;  3ZHE A;  2OVF A;  3ZXS A;  1EF1 C;  4I43 A;  5EX3 A;  5LX8 A;  3QAQ A;  3TG4 A;  1UJJ A;  4PH4 B;  4AP2 A;  1IQR A;  3PZD A;  3SNX A;  2I6H A;  1NP7 A;  1N52 A;  4JVS A;  2WXN A;  4U04 A;  2XRY A;  3D9J A;  4WND A;  2VGX A;  1L5J A;  1W3B A;  4C0E A;  2J49 A;  2LAI A;  2KCV A;  3FUE A;  3T5X A;  2WM9 A;  4F7A A;  3GZS A;  3BG1 B;  5EKQ D;  1WY6 A;  2X6K A;  3L16 A;  4JXT A;  5LOZ A;  3PVL A;  4ACL A;  4LRZ A;  3FUK A;  4APF A;  3CVU A;  3ZN3 A;  2I9C A;  3RIB A;  4GB9 A;  5DIZ A;  4BX9 A;  2MRI A;  2V5F A;  4BY6 A;  3AU5 A;  3QWP A;  1X5B A;  4I17 A;  3CHS A;  4BFR A;  2X38 A;  3JQ0 A;  4FP7 A;  5C2Y A;  4G1T A;  2WVI A;  5FQ6 A;  4DJA A;  2YHC A;  4RG6 A;  5AIJ A;  4UI9 K;  3CVW A;  2NC9 A;  3GZ1 A;  3PUK A;  1IYG A;  3MX3 A;  3SZ7 A;  2V4L A;  4N5C A;  4GU5 A;  1U3C A;  3R7R A;  3ZGQ A;  3K9I A;  4FA6 A;  2QY7 A;  3CQC B;  3NZU A;  5T3R A;  4Q69 A;  4I2W A;  4K03 A;  2KCK A;  3SF4 A;  1SZA A;  3FEY A;  2J07 A;  3IKO B;  3VTX A;  5FZR A;  3RRM B;  1TEZ A;  3FU3 A;  2Y3A A;  3MKQ B;  5ANL A;  5FJY A;  3D9M A;  4YVO A;  3S2A A;  4EBA A;  3RK6 A;  4JC8 A;  2IOS A;  4XE0 A;  1IHG A;  4GZD A;  2CHW A;  2LNI A;  1JPL A;  2BUG A;  4NUR A;  4WNG A;  4BTB A;  3G2W A;  3APD A;  4OVU A;  3JCK C;  4UWF A;  3P1U A;  3CHM A;  3O48 A;  3ZYL A;  3FTY A;  3D9L A;  2PQN A;  4ILI A;  4AIF A;  3I4R B;  4AM9 A;  3CK8 A;  4B94 A;  4YND A;  4B8C B;  3LJ3 A;  4AY5 A;  1BPO A;  4EPZ A;  4BWR A;  4G23 A;  3B7R L;  1N54 A;  2L6J A;  3LXU X;  3R7Q A;  3MV3 B;  3TL5 A;  4F1S A;  3Q49 B;  2XGO A;  4FHJ A;  3WXX A;  3ZIM A;  4GAA A;  1DNP A;  2VQ2 A;  3G2T A;  4ACK A;  3RRU A;  3HHM A;  3MA5 A;  3ASD A;  4DLO A;  4GZ6 A;  3TGO A;  4XI0 A;  3CK9 A;  2WXG A;  3Q15 A;  2KAT A;  1EYH A;  2ILR A;  2DIW A;  4I1A A;  4H7X A;  1PAQ A;  1JUQ A;  3UQ3 A;  3ENE A;  3QB2 A;  3CGH A;  4LUN U;  1GW6 A;  1ELR A;  4AY6 A;  2A4Z A;  4N3B A;  4FJY A;  3LKU A;  4GMJ A;  4G24 A;  2VGY A;  3CVQ A;  4U0U A;  4URK A;  5J90 A;  3FH7 A;  3SGH A;  4IYP A;  2L0T B;  3ESL A;  4U8H A;  5LFA A;  2BF0 X;  3PNL B;  2ZU6 B;  3SI5 A;  3SBS A;  4J6I A;  3LPZ A;  3IV0 A;  1E7V A;  3OTN A;  4NAC A;  3CEQ A;  3EJN A;  3IHY A;  1FVF A;  2IF4 A;  4I1M A;  4F3V A;  4JW1 A;  2MHK A;  1UN9 A;  1MHQ A;  4PS7 A;  2XGM A;  1OUV A;  2AVP A;  2DCP A;  3FTX A;  4JZY A;  2JLB A;  4KZC A;  3L08 A;  3QWV A;  3CVV A;  1WAO 1;  2EQX A;  3RKV A;  4TUU A;  3UT8 A;  3SFZ A;  1HXI A;  2FI7 A;  1H0A A;  2GRL A;  3B7T A;  3FUN A;  3SBT B;  3ZYQ A;  1OWN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...