4ATGA

Taf6 c-terminal domain from antonospora locustae
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
195
structure length
195
Chain Sequence
b'GSHMLPKELQLYFDKILSMIKSDMKDIAIECLEKESGLQQLVPYFIQHISELILKSFKEAEVLKTCIALYFSLIKNKHVFIDPYLHQILPSLLTCVIGKSIVDDDVRKMSADIVKYIYDTYSRSYKTLAPRVLKTLKGVWMDPNRSEDSQYGALYCLSILSKNVVNTVIREHAEEYKRTIGKKKVTNLLDNVLNV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TAF6
publication title TFIID Taf6-Taf9 Complex Formation Involves the Heat Repeat-Containing C-Terminal Domain of Taf6 and is Modulated by Taf5 Protein.
pubmed doi rcsb
source organism Antonospora locustae
molecule tags Transcription
total genus 77
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07571 TAF6_C TAF6 C-terminal HEAT repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.770 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4atgA00
4ATGA
chains in the Genus database with same CATH superfamily
4WAFA 1TN8A 1K3ZD 4DJAA 3MKQA 3AG1E 5G2NA 3SGHA 3UX4A 3Q73A 4HI8A 3RK6A 1HS6A 3S7DA 3PEUB 2IY0C 3Q47B 3CIAA 4ATGA 4Z68A 5FZSA 5ENQD 1OXJA 2V4HC 2R05A 3ZNGA 2EQXA 3L6AA 4F1SA 3UKRG 3VLFA 3G2SA 4GYOA 5AYWD 4DX6D 1H2UA 4N3CA 1OWMA 4UQZA 4ILHB 5JA4D 3FU6A 3DSWA 2R17C 4TXRA 4KZCA 4U0SA 2I2OA 3UUXA 3QNKA 5AN8A 1HX8A 3C3QA 1K1BA 4URKA 4K03A 2WQ6A 3RRUA 2GW1A 4QFVA 2R2LA 2VYIA 2J09A 3G2VA 4GTPA 4PS3A 3EHRA 5ENOD 2C0LA 2WMOA 3P1UA 1SVXA 4LEUA 2ETAA 4N5CA 2J4BA 4N3AA 5EYPF 5ANRA 5AJLA 3PEVB 1IQRA 4XI9A 4DI4A 2RG8A 4UQYA 3FY4A 1HFAA 4AM9A 1Q2ZA 3B13A 4RG6A 5AJDA 2IJGX 3PREA 1BPOA 3URZA 4I6EA 1N11A 3E30A 4AVXA 4UI9K 3EU5A 2QY7A 1IXVA 2YHEA 3CEQA 5HRYA 4OVUA 4G23A 1KT1A 1O1TA 3AG4E 3ONKA 2FULA 3UM1A 2FF4A 5KJKA 2P2CP 4EZKA 5CEDB 3AS4A 2AJAA 3TG5A 3ZHEA 1S70B 2LSUA 3J5PA 3Q7FA 3CK7A 3L08A 4O1OA 3R9AB 4B93B 2X6HA 4FU3A 4XZ4A 2IOSA 2E0IA 4JC8A 4BTAA 2XPIA 5KWDA 5HI7A 3LVQE 4DX2A 3NF1A 3RIBA 4H7YA 3HHMA 3LEWA 1HG5A 4GMLA 4HBDA 4A1GA 3LY9A 3KSQA 4O6FA 3DRAA 5G04C 1NA0A 3I5PA 3KSLA 3G2WA 3B7RL 3NOCD 2X6KA 3FULA 4K0RA 4LRZA 4GYYA 3B95A 3ZU7B 5BNWA 1E90A 2A5UA 4KVMA 4NQ0A 2PM6A 4GPMA 1JUQA 3OXLA 2ZU6B 4UWKA 2V4LA 4K5AB 3IHVA 5EKQD 3C3RA 4UWFA 2OEVA 4UWHA 5A7DB 2GRNB 3HRAA 3MA5A 4I17A 4TXQA 4GTTA 3Q9UC 4PDXA 2FBNA 1DCEA 4GB9A 2RD0A 1JPLA 3MV2B 4G24A 3SF4A 3L17A 3B7UX 2LUHA 5AARA 3ULEG 3U66A 4A1SA 4I1MA 2J8SD 5B3SE 4Q96A 1RW2A 4ZHBA 2QFCA 1HE8A 2WPVA 2P9IG 2JEKA 4TV3A 3ZVVA 1TYQG 2PQRA 4XEIG 4JW1A 2Y4UA 5ENSD 1E8XA 2ILRA 3EUVA 2AW6A 3CHSA 3HVEA 4BEPA 3HXCA 3OAWA 3CK8A 1SA4A 1TNYA 1D8DA 4C48B 4YDOA 1N4RA 2IEJA 4BX8A 4C9BB 3ZGQA 2JABA 3PNTB 3CVQA 1TNUA 3FHEA 3TJPA 4WNEA 4U63A 4GTMA 3D9OA 4YVOA 2RFAA 4A3VA 2WB2A 5T3RA 5ARGA 3NQPA 3DWLG 3GZ2A 2J08A 4GA1A 4I1AA 5EN5D 4MKTA 3V31A 4GTOA 3Q75A 1IYGA 2HR2A 4I9CA 3I3NA 3T9KA 3QWWA 2VGYA 4WUYA 3ML9A 3PNLB 5ENRD 2HYZA 4GZDA 5B1BE 4M3OA 5LP0A 2BKKB 3B7SA 2AWIA 4U07A 3C98A 1E8WA 4NACA 1B89A 3NOGD 1LF8A 3VLDA 5FIOA 5D0OD 3DEPA 1N0QA 3SFYA 4BERA 4A63B 3SZ7A 1YCSB 5LCWC 5CRVA 3MKRA 4ACLA 4MRUA 4B8AA 5J08A 4F6RD 2WXOA 3TXNA 4DLQA 1U3DA 1X5BA 1FVFA 3L54A 1UG3A 3CVLA 3X2QE 3JUIA 3L22A 4DX7D 2IU1A 3ZIMA 4U8HA 4F3VA 2QYUA 4U7EB 2VSOE 3TG4A 3ZPJA 1HU3A 4UUCA 3ZN3A 1WG0A 3LJNA 1N4PA 5KNGA 4B0ZA 4HQDA 3CLJA 3ML8A 2X38A 3ISMC 2XS1A 3TWQA 1OUVA 3JQ0A 4JVSA 3J5QB 2RFMA 2XZTG 2F8XK 3UPVA 2EINE 5JHBA 4EQFA 3VTXA 1FPPA 1V55E 3D9PA 2YHCA 1UN8A 2XPYA 3DXMG 1FT1A 3NBNB 4IN3B 5FZRA 4TXPA 2XEVA 3CVVA 3ZYMA 2IO2C 2A4ZA 5B1AE 3ASFA 4ILIA 1TN7A 2YNQA 2I1JA 4KZ0A 3ABME 2MYOA 3NB2A 4AIFA 4CEMA 5G05J 1LD7A 2XCCA 4WNDA 3C72A 2XCBA 2R59A 2L6BA 4PS8A 2IONA 2WMNA 2IO3C 4L23A 1MYOA 3DSUA 2J07A 3CVWA 1N94A 3QAQA 2E2EA 2VGEA 4FJZA 4JA7A 1JWGA 1HH8A 3ONLA 3PZ1A 4GTVA 4OAUC 2XPZA 2ZGDA 1MJ0A 1IQUA 1ELKA 3ZYLA 4HORA 4KBQA 2XS8A 3PZ4A 2GRLA 2Q7FA 4HXIA 4FHKA 2J9QA 1IHGA 1MZCA 3ESKA 1GW6A 2EIME 3CV0A 1N0RA 1HG2A 1H2TC 2WQHA 3PZDA 1SW6A 3S7BA 4WWNA 2R5SA 3IEGA 4UQXA 4I9EA 4KYOB 1ELWA 1AWCB 3TGOA 4KT6B 4ANUA 3FH7A 4MBGA 5LCWJ 4XKCA 3UIPC 3ASOE 1S0PA 4J8SA 1H6PA 1ELRA 3C5RA 5J90A 4F7AA 3PZ2A 4J8EA 4O60A 4FJYA 1QZ2A 3PS6A 3UKUG 2WXNA 1LTXA 4OYSA 4CGWA 3ZKJA 4I2ZA 3MEKA 2WXJA 3CR3A 2F8YA 3MZLB 1Z3XA 4N2SA 3FTZA 4GA0A 4K5CA 2UY1B 5LOZA 4JXTA 5BT1A 2R03A 4CZ2D 3HXDA 5BUZA 2NSZA 1DVPA 1MX6A 4CDRA 2ONDA 2DZNA 4EZLA 2KXPC 3ULYA 3HXBA 3TWWA 3AS5A 4E85A 4G25A 4IULA 1OCZE 5T8IA 3GZSA 2F0YA 3TWXA 5HQ8A 4L2YA 1OT8A 4YDWA 3G2TA 3EJNA 3LY8A 1WY6A 4HI9A 4RQIA 5FINA 4XKBA 4FC8A 2AXUA 4GCOA 4GZ5A 2KCLA 1IKND 4U8YD 3BG1B 3RO2A 3EDTB 1S64A 4NIKA 4WNFA 3NZUA 3QWVA 1QNFA 2XZDG 4OVVA 4FHJA 4BWRA 4XI0A 3FUIA 1N4SA 2OEWA 3I4GA 3DXKG 3SD5A 3VLEA 2C2LA 2XGOA 2OOEA 2LAHA 2CG2A 3PE4A 3SBSA 4MS6A 2H6GA 2KCVA 3IBEA 4LNUD 5LX8A 3D9KA 1OWLA 2OVFA 5CRUA 2LO6A 2X3MA 5CECB 2YINA 2YQ8A 4KVOA 4CGVA 2CHZA 3FP3A 1Y6IA 1Y8MA 3S7JA 2GRQB 3T8KA 3CVNA 3FU0A 2WXHA 1OWPA 3PE3A 4GTSA 3Q4AB 1D8EA 4YVQC 3TWRA 3UT8A 1O1SA 4BX9A 2XGMA 3TWSA 4BTBA 3ZXSA 4OAVB 3BG0B 3T8MA 2A5EA 2J49A 4AY6A 3OXFA 2VTBB 4L1BA 2WXFA 5BPPA 3FTSA 1NFIE 4U04A 5JHAA 3VTYA 4O1PA 3FUHA 3CQCB 3FEXA 2WQ7A 5H7PA 3UXGA 1PY1A 3MKQB 4LSZE 1L5JA 3SFXA 5IY5E 2WXLA 3SFZA 5JJ7A 5AQBA 1H6OA 1SA5A 4L7TA 3UQ3A 2P9SG 5EIBE 2L9BA 2JLBA 4TUMA 5HS0A 2XRYA 4Y6WA 5E76A 5G05C 3APCA 1UOHA 2P9PG 5FT9A 3AAAC 3RKVA 3GW4A 4HRLA 3Q49B 3FTVA 4L9PA 4GZ6A 4DX1A 3OXGA 4CCAA 4GTRA 3T5XA 3D3MA 4XIFA 1JCRA 3L82A 3JXIA 2AXZA 4GTQA 4D10C 3CKCA 2IOLA 1ZU2A 1N54A 4HVBA 3QK0A 3QKYA 4NURA 4JHKA 2KBXA 5BXOA 4HS2A 2IFUA 3L13A 2B6CA 5CMWA 5ITZF 4N39A 2F37A 4P29A 1O5MA 4AV7A 4HB5A 5BV1A 1KPSB 2EIKE 3FUJA 2CHWA 2PL2A 3EHMA 3FUFA 3DSXA 4JB8P 4TUUA 4LNGA 1N4QA 1V54E 2XHEA 2CHXA 4J0UA 3Q15A 4F1PA 1FVHA 2P9KG 4U0UA 2MHKA 3IHYA 3CSFA 5C2YA 3CK9A 4U8VD 3HDXA 2VGXB 5KJMA 3EIJA 2RKKA 1K1AA 3WG7E 1WM5A 2LXMA 3FH8A 3HG0D 4DI3A 3SNXA 1H19A 3HXEA 2C0MA 4IYPA 1A17A 2X6FA 1OWNA 1U2VG 1NP7A 3OTNA 3CHMA 1D9SA 2KZTB 4G8KA 4WNGA 4YDYA 4LG6A 2WXMA 3SHFA 4GU5A 2L0IA 4KMOA 2UY1A 3LXUX 1OY3D 1E7VA 5EX0A 3O48A 4AY5A 2WXKA 3UT7A 1H2VC 5KBAA 3KEZA 2ZISA 2NYJA 3FFLA 4DPRA 4B94A 3FU3A 3LVRE 2H6FA 2IQCA 4PUCA 2FEZA 3UMVA 2QYJA 4U96D 4LUNU 3EU9A 3ASNE 1KZOA 2BTDA 3UINC 5FQ7A 3E33A 5ENTD 3FTUA 4JPSA 3ZW3A 4BSZB 4A55A 3QDNA 4G8LA 2ZXWE 3EHNA 1SZAA 3EIQC 4HOSA 1NI1A 2XENA 3JXJA 3AU5A 2FO1E 2H6IA 5A23A 3CVYA 4G2VA 3JCKC 2V5FA 3JUEA 2L0TB 5DBKA 3DSSA 2ETBA 1BI7B 3CQGB 3GYZA 2DIWA 5BXUA 2AVPA 5EIDA 2KM4A 4JEUA 4I6GA 1X81A 2BEDA 3HYMB 2AXVA 3FUKA 3SY2A 4UWLA 4DX5D 5HKPA 3APDA 3R9MA 1TJCA 3AG3E 3CKBA 4G1TA 4BFRA 5JJTA 4C0MA 1NA3A 3RU0A 1QYMA 5T4YA 4J8DA 1BLXB 1JCSA 2XEEA 3KS2A 4FADA 3UTMA 3CGHA 2BKGA 4XE0A 2P9UG 3UM3A 1ZBPA 5CCMA 3QC1A 4DRXE 4W9RA 4EHMA 3O4ZA 3Q5MA 2DYSE 2XGSA 3RRNB 3AJIA 4EPZA 5KCMA 3V30A 1MQSA 4CDNA 1KT0A 1E8YA 1UJJA 1YMPA 4I1OB 1KLXA 2GROB 3ZUVB 1HO8A 2LNIA 2MOWA 3K9IA 3FTYA 4YNDA 1DC2A 3CSTA 4EBAA 2WXPA 2H6HA 3Q79A 5ENPD 4JZYA 1RZ4A 3ABLE 3R7RA 2DVWA 3TAXA 5A6CA 4GMRA 3FUNA 5CHEE 5FZQA 3T5VA 1W3BA 2ETCA 2XQ0A 4XX5A 2ZIRA 3LY7A 3DPYA 4L2LA 2FO7A 3D9IA 4WWOA 4ACKA 2M63A 3FDHA 3B7TA 4GYWA 3IKOB 3ULQA 3ZYQA 1AP7A 4GCNA 5D2MC 2WXRA 1DNPA 1P5QA 5AQ7A 4CT0A 3Q78A 4J7WA 3R7QA 1U3CA 5DIZA 4WWPA 3FEYA 3ABKE 4RSYA 5FQ4A 5BW8C 5ENNA 3JQ1A 1MX2A 1XNFA 4APOA 3ESLA 2GGFA 1TNOA 4YDEA 4CYMD 3LJ3A 2P58C 4FULA 3AG2E 2BF0X 3F6QA 3MJWA 1MX4A 3TWVA 4KXKB 4G11A 4U0ZA 3LYAA 4FLHA 5AQ9A 3IXEA 2OVBA 3GZ1A 3AU4A 1PC2A 3ENEA 3BQOA 4J8YA 4GMJA 1H0AA 4ANVA 4ABNA 1EF1C 1EPUA 1Z6TA 2NXPA 4AXHA 2VGXA 5FTPA 4GPKA 3D9MA 4UWGA 3UI2A 2BUGA 3I4RB 3D9LA 2KATA 4RG9A 3AS8A 4F53A 3RO3A 2NC9A 3D9HA 1TR4A 3HXFA 5EYLA 3BU8A 5CCLA 2V5QC 1TN6A 1SZ9A 5FQ8A 2V8SE 4GZ3A 2PM7A 2KZTA 3PRZA 5JMND 1EYHA 3ZXPA 3FH5A 3PDNA 3V79K 4JA9A 1EDUA 1E7UA 3PUJA 2I6HA 4A3TA 5E75A 2R02A 4DUIA 1H6KA 4ATZD 5D66A 4M7CA 5FQ6A 4UI9J 2QZAA 2EILE 5EDSA 4Y6CA 2VSNA 5AQAA 4JD2G 3W9FA 3C3OA 3KEAA 1BU9A 2P9LG 2HM8A 2VQ2A 3JYSA 3PH0C 3L16A 3SI5A 4AEZC 1JWFA 3DSTA 5KJNA 1MHQA 1O1RA 3SQVA 3TXMA 4N2QA 2HE0A 4AOFA 5LFAA 4CT4A 3FWVA 4B89A 2LXLA 1HF8A 1PAQA 3NAWA 3ZRHA 1K8KG 4BY6A 1N95A 1QQEA 1A5EA 2GRRB 5AIJA 4HOQA 2WVIA 2OCCE 1S63A 3CHPA 1N52A 1IHBA 4DLOA 4HFGA 4J6IA 2UWJG 3IV0A 4B8CB 4JHJA 2PQNA 2X6JA 2P9NG 4EBAG 4G26A 3U4TA 1YYHA 3V2OA 1WDYA 3S7FA 4K5BA 5G55A 5CBNA 4LCTA 3DPDA 5EX3A 2Y4TA 2WM9A 3NZSA 5CMYA 1WAO1 5CEAA 3G2UA 4N5QA 3CHRA 4R7LA 4BT8A 2Y0BG 1FCHA 4PH4B 2EIJE 2V0PA 1FT2A 3ASDA 4JL0A 3KD7A 3LDZA 4GZCA 2HO1A 3E37A 1G3NB 1VDYA 3FUMA 2IF4A 1TEZA 1LD8A 4V3IA 5FJYA 3KAEA 3N71A 1Z5SC 4NRHB 3DEOA 3WXXA 3RRMB 2MRIA 3E32A 3D9NA 4MLPA 2CG3A 2DZOA 3MX3A 3UM2A 4RVBA 4I43A 3UT4A 5CBOA 3QOUA 3PVLA 4BT9A 3APFA 4EZJA 2OV8A 5KNHD 4ILGA 4C0EA 4DK5A 1E96B 2WXIA 3V2XA 3ZHEB 3UIOC 3LS8A 4I6JA 3W9GA 5AENA 3PZ3A 4U95D 4HOTA 3E34A 2L6JA 4N3BA 3Q9NC 2DCPA 2WXQA 3QARA 4PS7A 5ANLA 3DBSA 5M72A 2DYRE 1XGWA 2PZIA 5G04J 4FP7A 4BESA 4IRUA 3QB2A 2KC7A 2Y1LE 3MCXA 2LAIA 3LPZA 4APFA 3EHQA 4AJWA 4CRWA 3ASGA 5EILA 1TNZA 3FTXA 3QWPA 4TRQA 2GRPB 2VSXE 1INZA 2GRMA 5KJLA 4Q69A 2LSVA 4I2WA 3FU5A 1BI8B 3ASHA 3DSVA 2I1KA 3E4BA 1TJFA 3RJVA 3SO8A 5CERB 2KCKA 1KZPA 5FWQA 3SBTB 2FI7A 3BEEA 3TWUA 4LERA 5ARFA 5C1DA 2XRZA 4LNBA 3ZEFA 1YA0A 3ZYKA 2I9CA 2B0OE 4HLLA 2VJ8A 4RLYA 4HLEA 4FA6A 1NZNA 3LKUA 1OCCE 3U64A 1Z3YA 3ZFWA 4JEHA 2DWZA 1OCRE 4J8FA 2XEHA 3U3WA 1ZB1A 4ZFHA 2DBAA 4GA2A 3TWTA 3QJZA 4BETA 3UM0A 1BD8A 3CVUA 3FTWA 1E8ZA 1QBQA 4GAAA 1UW4B 1SQMA 3S2AA 1HXIA 4ANWA 1JCQA 4HRMB 4E6HA 2VSYA 2Y69E 5AAOA 1OCOE 1NL4A 4EECA 3P2BA 3CHQA 3HVEB 3CVXA 1OWOA 4Q94A 4HNAD 2ZGGA 3Q7AA 5JJ6A 4CDMA 1N9AA 3RAUA 4AP2A 4BSXA 3MYVA 4QQIA 2QC9A 1TNBA 1DCQA 2Y3AA 4JHRA 4ANXA 3D9JA 1UN9A 3MV3B 1UJKA 3B7BA 3CVPA 3LCAA 4HRNA 3RSEG 3CHOA 3U9WA 1HZ4A 4UI9C 3BUAA 4X8QA 2CFUA 4HOUA 2J4DA 3PUKA 2PNNA 2VTBA 3MGBA 4FLBA 2CFZA 3FUDA 4H7XA 3FUEA 3L9TA 5D0QD 4ME2A 2X6IA 3HIZA 2WXGA 3TL5A 5BV0A
chains in the Genus database with same CATH topology
3OXGA 4WAFA 4CCAA 4UWGA 1OUVA 3JQ0A 3T5XA 2BUGA 3D3MA 4JVSA 4XIFA 3I4RB 2AXZA 4DJAA 3MKQA 3D9LA 5G2NA 3CKCA 4D10C 2IOLA 2KATA 3SGHA 1ZU2A 4RG9A 3UX4A 3AS8A 4F53A 3RO3A 3UPVA 3RK6A 5JHBA 2NC9A 1HS6A 4EQFA 3S7DA 3VTXA 3PEUB 1N54A 5CCLA 4HVBA 3D9PA 3Q47B 3CIAA 2YHCA 3QK0A 3QKYA 1UN8A 4NURA 4ATGA 5FZSA 2XPYA 4JHKA 1SZ9A 5FQ8A 2V8SE 4GZ3A 4HS2A 2IFUA 3L13A 2PM7A 2KZTA 5CMWA 3PRZA 2EQXA 3L6AA 4N39A 4P29A 4F1SA 4IN3B 4AV7A 5FZRA 2XEVA 3CVVA 3ZYMA 3VLFA 1EYHA 3G2SA 4GYOA 5AYWD 3FH5A 5BV1A 1H2UA 4N3CA 2A4ZA 3PDNA 1OWMA 4JA9A 3FUJA 1EDUA 2CHWA 2PL2A 4UQZA 1E7UA 3ASFA 3PUJA 4ILHB 2I6HA 3EHMA 4ILIA 4A3TA 2YNQA 3FUFA 5E75A 2I1JA 4KZ0A 4TUUA 3FU6A 4AIFA 1H6KA 4CEMA 2XHEA 2CHXA 4J0UA 5G05J 3Q15A 1FVHA 2R17C 4KZCA 2XCCA 4U0SA 4U0UA 2I2OA 5FQ6A 4WNDA 2MHKA 3UUXA 3IHYA 4UI9J 3CSFA 3QNKA 2XCBA 5EDSA 5C2YA 2R59A 4Y6CA 4PS8A 1HX8A 2IONA 2WMNA 3CK9A 4URKA 4L23A 4K03A 3HDXA 2VSNA 2VGXB 5KJMA 2WQ6A 3EIJA 3RRUA 2GW1A 2J07A 4QFVA 3CVWA 2VYIA 3QAQA 2J09A 3G2VA 2HM8A 2E2EA 2VQ2A 4PS3A 1WM5A 3JYSA 4FJZA 4JA7A 3FH8A 4DI3A 2C0LA 2WMOA 1JWGA 3PH0C 3SNXA 3L16A 3SI5A 1H19A 1HH8A 4AEZC 1JWFA 2C0MA 4IYPA 1A17A 3P1UA 2X6FA 3ONLA 4LEUA 5KJNA 1MHQA 1OWNA 1NP7A 3OTNA 2XPZA 3CHMA 3TXMA 4N5CA 4N2QA 4AOFA 2J4BA 5LFAA 4N3AA 1IQUA 3FWVA 4CT4A 1ELKA 2KZTB 3ZYLA 4WNGA 5ANRA 5AJLA 4B89A 4HORA 4KBQA 3PEVB 1HF8A 1IQRA 1PAQA 3ZRHA 2GRLA 2Q7FA 4HXIA 2WXMA 4FHKA 4GU5A 2J9QA 4XI9A 3SHFA 4BY6A 1IHGA 2L0IA 4DI4A 2RG8A 1QQEA 4UQYA 3FY4A 4KMOA 1HFAA 3ESKA 4AM9A 1GW6A 5AIJA 3B13A 4HOQA 2WVIA 3CV0A 2UY1A 3LXUX 3CHPA 3OAWA 1N52A 4RG6A 5AJDA 1E7VA 5EX0A 3O48A 4DLOA 4HFGA 2IJGX 4AY5A 3PREA 1HG2A 1H2TC 2WXKA 2WQHA 1BPOA 4J6IA 3PZDA 3URZA 3UT7A 2UWJG 3IV0A 4B8CB 4JHJA 1H2VC 4I6EA 3S7BA 2PQNA 2X6JA 3KEZA 2R5SA 4WWNA 3IEGA 4EBAG 4G26A 4UQXA 4AVXA 4I9EA 4UI9K 3U4TA 4KYOB 3FFLA 1ELWA 4DPRA 4B94A 3FU3A 2QY7A 3S7FA 2YHEA 3CEQA 4OVUA 4G23A 5G55A 3LVRE 4LCTA 3DPDA 1KT1A 3ONKA 3TGOA 2FULA 4KT6B 2IQCA 2FF4A 4PUCA 2Y4TA 2FEZA 2WM9A 5EX3A 3UMVA 5KJKA 4EZKA 3NZSA 4LUNU 5CMYA 3AS4A 1WAO1 3G2UA 4ANUA 3FH7A 3TG5A 3ZHEA 5LCWJ 2LSUA 2BTDA 3CHRA 4R7LA 4XKCA 3CK7A 3L08A 4BT8A 3R9AB 5FQ7A 2X6HA 1FCHA 4FU3A 4XZ4A 2IOSA 2E0IA 1S0PA 3FTUA 4PH4B 4J8SA 4JPSA 3ZW3A 1ELRA 4JC8A 4BTAA 2XPIA 2V0PA 3ASDA 4A55A 5HI7A 3LVQE 5J90A 3NF1A 3QDNA 4F7AA 4JL0A 3KD7A 3LDZA 4GZCA 3RIBA 2HO1A 4H7YA 4J8EA 3HHMA 3EHNA 3LEWA 1SZAA 1HG5A 3EIQC 4FJYA 4HOSA 4GMLA 1QZ2A 3PS6A 2WXNA 3AU5A 4A1GA 1VDYA 3FUMA 2IF4A 1TEZA 3LY9A 4OYSA 4O6FA 4V3IA 4CGWA 4I2ZA 5G04C 3MEKA 1NA0A 5FJYA 2WXJA 5A23A 3CVYA 3CR3A 3I5PA 3KAEA 4G2VA 3G2WA 3JCKC 3N71A 3MZLB 2V5FA 4NRHB 1Z3XA 3B7RL 2L0TB 5DBKA 4N2SA 3WXXA 3FTZA 3RRMB 2MRIA 4GA0A 2UY1B 2X6KA 5LOZA 4JXTA 3CQGB 5BT1A 3GYZA 3FULA 4K0RA 3D9NA 4LRZA 4MLPA 4GYYA 2CG3A 2DIWA 3MX3A 5BNWA 5BUZA 2AVPA 4RVBA 2NSZA 1E90A 1DVPA 2A5UA 4I43A 3UT4A 2KM4A 4JEUA 2ONDA 4CDRA 4KVMA 3QOUA 2PM6A 3PVLA 1JUQA 3APFA 3OXLA 4NQ0A 4BT9A 4EZJA 4EZLA 2OV8A 3AS5A 4E85A 4G25A 4I6GA 4IULA 2ZU6B 3HYMB 4ILGA 4C0EA 2AXVA 3FUKA 5T8IA 4DK5A 4UWKA 3GZSA 2V4LA 1E96B 3IHVA 5EKQD 2WXIA 4UWLA 4UWFA 5HQ8A 4L2YA 3APDA 4UWHA 3G2TA 1TJCA 3ZHEB 3EJNA 3CKBA 5A7DB 3LY8A 3LS8A 3MA5A 1WY6A 4G1TA 4I6JA 4BFRA 5JJTA 4C0MA 4I17A 1NA3A 5AENA 3RU0A 5T4YA 4HOTA 2L6JA 4N3BA 4J8DA 4PDXA 2FBNA 4XKBA 3KS2A 4FC8A 4GB9A 2RD0A 2AXUA 2DCPA 4GCOA 4GZ5A 4FADA 2WXQA 1JPLA 3MV2B 3CGHA 3QARA 4PS7A 4G24A 3DBSA 5ANLA 5M72A 2KCLA 3SF4A 4XE0A 3BG1B 3RO2A 1ZBPA 1XGWA 3EDTB 3L17A 5CCMA 4WNFA 3B7UX 3QC1A 2PZIA 3NZUA 3QWVA 4W9RA 1QNFA 4A1SA 3U66A 4FP7A 4I1MA 4OVVA 3O4ZA 4FHJA 3Q5MA 4IRUA 5G04J 3QB2A 2KC7A 4Q96A 4BWRA 3MCXA 4XI0A 2LAIA 2XGSA 3FUIA 3LPZA 2QFCA 3RRNB 1HE8A 3I4GA 4APFA 3SD5A 3VLEA 2WPVA 4AJWA 4CRWA 3ASGA 4EPZA 5KCMA 2C2LA 2XGOA 2OOEA 1MQSA 3FTXA 2JEKA 2LAHA 3QWPA 2CG2A 3PE4A 4TRQA 4TV3A 3ZVVA 4CDNA 1KT0A 3SBSA 4MS6A 1E8YA 1UJJA 2PQRA 2KCVA 3IBEA 4JW1A 2Y4UA 2VSXE 1INZA 1E8XA 2GRMA 2ILRA 4Q69A 5KJLA 5LX8A 4I1OB 3D9KA 2LSVA 2AW6A 1OWLA 3CHSA 1KLXA 3HVEA 4I2WA 1HO8A 2OVFA 2LNIA 2LO6A 3CK8A 2MOWA 2X3MA 3ASHA 3FU5A 2I1KA 3E4BA 3K9IA 3FTYA 1TJFA 2YINA 4YNDA 3RJVA 3CSTA 2YQ8A 4KVOA 4CGVA 2CHZA 2KCKA 1Y6IA 3FP3A 5FWQA 2WXPA 1Y8MA 2FI7A 3S7JA 3BEEA 3SBTB 4EBAA 4JZYA 3R7RA 4LERA 5ARFA 3CVNA 3TAXA 5C1DA 2XRZA 3FU0A 3ZEFA 4BX8A 4C9BB 1YA0A 3ZGQA 3ZYKA 2I9CA 5A6CA 2WXHA 1OWPA 3FUNA 3PE3A 3PNTB 3CVQA 5CHEE 3FHEA 5FZQA 3T5VA 3TJPA 4WNEA 2VJ8A 1W3BA 4HLEA 4U63A 4FA6A 1NZNA 2XQ0A 3D9OA 3LKUA 3Q4AB 4YVOA 4XX5A 3U64A 3LY7A 1Z3YA 4A3VA 2WB2A 3ZFWA 5T3RA 4JEHA 4L2LA 5ARGA 3NQPA 3GZ2A 4YVQC 2FO7A 4J8FA 2J08A 3U3WA 3D9IA 4GA1A 4WWOA 4ACKA 2M63A 3FDHA 3B7TA 4GYWA 4I1AA 3UT8A 3IKOB 3ULQA 4MKTA 3ZYQA 4BX9A 2DBAA 4GCNA 2XGMA 1IYGA 2HR2A 4I9CA 3I3NA 4BTBA 3QWWA 2VGYA 2WXRA 4GA2A 4WUYA 3ZXSA 3BG0B 3ML9A 3PNLB 3QJZA 3T8MA 2HYZA 1DNPA 2J49A 3CVUA 3OXFA 4GZDA 3FTWA 4AY6A 1P5QA 4CT0A 1E8ZA 4M3OA 4GAAA 5LP0A 1UW4B 3B7SA 2AWIA 1SQMA 3S2AA 4U07A 3C98A 3R7QA 1E8WA 1U3CA 4NACA 5DIZA 1B89A 4WWPA 3FEYA 2VTBB 1HXIA 4L1BA 4ANWA 1LF8A 2WXFA 3VLDA 5BPPA 3FTSA 4U04A 5JHAA 4E6HA 4RSYA 2VSYA 3VTYA 5FQ4A 5D0OD 5BW8C 3FUHA 5ENNA 3JQ1A 1XNFA 3CQCB 4EECA 4APOA 3P2BA 3SZ7A 3FEXA 2WQ7A 3ESLA 5LCWC 2GGFA 3CHQA 3HVEB 1PY1A 3MKRA 3CVXA 1OWOA 3MKQB 4Q94A 4ACLA 4MRUA 3LJ3A 4B8AA 5J08A 2P58C 1L5JA 2WXOA 4FULA 5JJ6A 4CDMA 3TXNA 4DLQA 1U3DA 2BF0X 1X5BA 1FVFA 3L54A 1UG3A 3MYVA 4AP2A 3MJWA 4BSXA 2WXLA 3SFZA 3CVLA 2Y3AA 4JHRA 4ANXA 5JJ7A 3D9JA 3UQ3A 4L7TA 1UN9A 4KXKB 4AXHA 3JUIA 4G11A 3MV3B 3L22A 2IU1A 4U0ZA 1UJKA 2L9BA 2JLBA 3CVPA 3LYAA 4FLHA 2XRYA 3ZIMA 2OVBA 3LCAA 4U8HA 4Y6WA 4F3VA 3GZ1A 5E76A 5G05C 3APCA 2VSOE 3TG4A 5FT9A 3CHOA 3ZPJA 3U9WA 1HU3A 1HZ4A 3RKVA 4UI9C 3AU4A 1PC2A 2CFUA 3ENEA 3ZN3A 4HOUA 2J4DA 3PUKA 3GW4A 2VTBA 4GMJA 1H0AA 3MGBA 4ANVA 3Q49B 4FLBA 4ABNA 2CFZA 4B0ZA 1EF1C 3FUDA 1EPUA 4H7XA 3FUEA 1Z6TA 2NXPA 3CLJA 2VGXA 3FTVA 4ME2A 2X6IA 3ML8A 3HIZA 5D0QD 2X38A 5FTPA 4GZ6A 2WXGA 4GPKA 3D9MA 3TL5A 5BV0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ATG A; 
#chains in the Genus database with same CATH topology
 4WAF A;  1TN8 A;  1K3Z D;  4DJA A;  3MKQ A;  3AG1 E;  5G2N A;  3SGH A;  3UX4 A;  3Q73 A;  4HI8 A;  3RK6 A;  1HS6 A;  3S7D A;  3PEU B;  2IY0 C;  3Q47 B;  3CIA A;  4ATG A;  4Z68 A;  5FZS A;  5ENQ D;  1OXJ A;  2V4H C;  2R05 A;  3ZNG A;  2EQX A;  3L6A A;  4F1S A;  3UKR G;  3VLF A;  3G2S A;  4GYO A;  5AYW D;  4DX6 D;  1H2U A;  4N3C A;  1OWM A;  4UQZ A;  4ILH B;  5JA4 D;  3FU6 A;  3DSW A;  2R17 C;  4TXR A;  4KZC A;  4U0S A;  2I2O A;  3UUX A;  3QNK A;  5AN8 A;  1HX8 A;  3C3Q A;  1K1B A;  4URK A;  4K03 A;  2WQ6 A;  3RRU A;  2GW1 A;  4QFV A;  2R2L A;  2VYI A;  2J09 A;  3G2V A;  4GTP A;  4PS3 A;  3EHR A;  5ENO D;  2C0L A;  2WMO A;  3P1U A;  1SVX A;  4LEU A;  2ETA A;  4N5C A;  2J4B A;  4N3A A;  5EYP F;  5ANR A;  5AJL A;  3PEV B;  1IQR A;  4XI9 A;  4DI4 A;  2RG8 A;  4UQY A;  3FY4 A;  1HFA A;  4AM9 A;  1Q2Z A;  3B13 A;  4RG6 A;  5AJD A;  2IJG X;  3PRE A;  1BPO A;  3URZ A;  4I6E A;  1N11 A;  3E30 A;  4AVX A;  4UI9 K;  3EU5 A;  2QY7 A;  1IXV A;  2YHE A;  3CEQ A;  5HRY A;  4OVU A;  4G23 A;  1KT1 A;  1O1T A;  3AG4 E;  3ONK A;  2FUL A;  3UM1 A;  2FF4 A;  5KJK A;  2P2C P;  4EZK A;  5CED B;  3AS4 A;  2AJA A;  3TG5 A;  3ZHE A;  1S70 B;  2LSU A;  3J5P A;  3Q7F A;  3CK7 A;  3L08 A;  4O1O A;  3R9A B;  4B93 B;  2X6H A;  4FU3 A;  4XZ4 A;  2IOS A;  2E0I A;  4JC8 A;  4BTA A;  2XPI A;  5KWD A;  5HI7 A;  3LVQ E;  4DX2 A;  3NF1 A;  3RIB A;  4H7Y A;  3HHM A;  3LEW A;  1HG5 A;  4GML A;  4HBD A;  4A1G A;  3LY9 A;  3KSQ A;  4O6F A;  3DRA A;  5G04 C;  1NA0 A;  3I5P A;  3KSL A;  3G2W A;  3B7R L;  3NOC D;  2X6K A;  3FUL A;  4K0R A;  4LRZ A;  4GYY A;  3B95 A;  3ZU7 B;  5BNW A;  1E90 A;  2A5U A;  4KVM A;  4NQ0 A;  2PM6 A;  4GPM A;  1JUQ A;  3OXL A;  2ZU6 B;  4UWK A;  2V4L A;  4K5A B;  3IHV A;  5EKQ D;  3C3R A;  4UWF A;  2OEV A;  4UWH A;  5A7D B;  2GRN B;  3HRA A;  3MA5 A;  4I17 A;  4TXQ A;  4GTT A;  3Q9U C;  4PDX A;  2FBN A;  1DCE A;  4GB9 A;  2RD0 A;  1JPL A;  3MV2 B;  4G24 A;  3SF4 A;  3L17 A;  3B7U X;  2LUH A;  5AAR A;  3ULE G;  3U66 A;  4A1S A;  4I1M A;  2J8S D;  5B3S E;  4Q96 A;  1RW2 A;  4ZHB A;  2QFC A;  1HE8 A;  2WPV A;  2P9I G;  2JEK A;  4TV3 A;  3ZVV A;  1TYQ G;  2PQR A;  4XEI G;  4JW1 A;  2Y4U A;  5ENS D;  1E8X A;  2ILR A;  3EUV A;  2AW6 A;  3CHS A;  3HVE A;  4BEP A;  3HXC A;  3OAW A;  3CK8 A;  1SA4 A;  1TNY A;  1D8D A;  4C48 B;  4YDO A;  1N4R A;  2IEJ A;  4BX8 A;  4C9B B;  3ZGQ A;  2JAB A;  3PNT B;  3CVQ A;  1TNU A;  3FHE A;  3TJP A;  4WNE A;  4U63 A;  4GTM A;  3D9O A;  4YVO A;  2RFA A;  4A3V A;  2WB2 A;  5T3R A;  5ARG A;  3NQP A;  3DWL G;  3GZ2 A;  2J08 A;  4GA1 A;  4I1A A;  5EN5 D;  4MKT A;  3V31 A;  4GTO A;  3Q75 A;  1IYG A;  2HR2 A;  4I9C A;  3I3N A;  3T9K A;  3QWW A;  2VGY A;  4WUY A;  3ML9 A;  3PNL B;  5ENR D;  2HYZ A;  4GZD A;  5B1B E;  4M3O A;  5LP0 A;  2BKK B;  3B7S A;  2AWI A;  4U07 A;  3C98 A;  1E8W A;  4NAC A;  1B89 A;  3NOG D;  1LF8 A;  3VLD A;  5FIO A;  5D0O D;  3DEP A;  1N0Q A;  3SFY A;  4BER A;  4A63 B;  3SZ7 A;  1YCS B;  5LCW C;  5CRV A;  3MKR A;  4ACL A;  4MRU A;  4B8A A;  5J08 A;  4F6R D;  2WXO A;  3TXN A;  4DLQ A;  1U3D A;  1X5B A;  1FVF A;  3L54 A;  1UG3 A;  3CVL A;  3X2Q E;  3JUI A;  3L22 A;  4DX7 D;  2IU1 A;  3ZIM A;  4U8H A;  4F3V A;  2QYU A;  4U7E B;  2VSO E;  3TG4 A;  3ZPJ A;  1HU3 A;  4UUC A;  3ZN3 A;  1WG0 A;  3LJN A;  1N4P A;  5KNG A;  4B0Z A;  4HQD A;  3CLJ A;  3ML8 A;  2X38 A;  3ISM C;  2XS1 A;  3TWQ A;  1OUV A;  3JQ0 A;  4JVS A;  3J5Q B;  2RFM A;  2XZT G;  2F8X K;  3UPV A;  2EIN E;  5JHB A;  4EQF A;  3VTX A;  1FPP A;  1V55 E;  3D9P A;  2YHC A;  1UN8 A;  2XPY A;  3DXM G;  1FT1 A;  3NBN B;  4IN3 B;  5FZR A;  4TXP A;  2XEV A;  3CVV A;  3ZYM A;  2IO2 C;  2A4Z A;  5B1A E;  3ASF A;  4ILI A;  1TN7 A;  2YNQ A;  2I1J A;  4KZ0 A;  3ABM E;  2MYO A;  3NB2 A;  4AIF A;  4CEM A;  5G05 J;  1LD7 A;  2XCC A;  4WND A;  3C72 A;  2XCB A;  2R59 A;  2L6B A;  4PS8 A;  2ION A;  2WMN A;  2IO3 C;  4L23 A;  1MYO A;  3DSU A;  2J07 A;  3CVW A;  1N94 A;  3QAQ A;  2E2E A;  2VGE A;  4FJZ A;  4JA7 A;  1JWG A;  1HH8 A;  3ONL A;  3PZ1 A;  4GTV A;  4OAU C;  2XPZ A;  2ZGD A;  1MJ0 A;  1IQU A;  1ELK A;  3ZYL A;  4HOR A;  4KBQ A;  2XS8 A;  3PZ4 A;  2GRL A;  2Q7F A;  4HXI A;  4FHK A;  2J9Q A;  1IHG A;  1MZC A;  3ESK A;  1GW6 A;  2EIM E;  3CV0 A;  1N0R A;  1HG2 A;  1H2T C;  2WQH A;  3PZD A;  1SW6 A;  3S7B A;  4WWN A;  2R5S A;  3IEG A;  4UQX A;  4I9E A;  4KYO B;  1ELW A;  1AWC B;  3TGO A;  4KT6 B;  4ANU A;  3FH7 A;  4MBG A;  5LCW J;  4XKC A;  3UIP C;  3ASO E;  1S0P A;  4J8S A;  1H6P A;  1ELR A;  3C5R A;  5J90 A;  4F7A A;  3PZ2 A;  4J8E A;  4O60 A;  4FJY A;  1QZ2 A;  3PS6 A;  3UKU G;  2WXN A;  1LTX A;  4OYS A;  4CGW A;  3ZKJ A;  4I2Z A;  3MEK A;  2WXJ A;  3CR3 A;  2F8Y A;  3MZL B;  1Z3X A;  4N2S A;  3FTZ A;  4GA0 A;  4K5C A;  2UY1 B;  5LOZ A;  4JXT A;  5BT1 A;  2R03 A;  4CZ2 D;  3HXD A;  5BUZ A;  2NSZ A;  1DVP A;  1MX6 A;  4CDR A;  2OND A;  2DZN A;  4EZL A;  2KXP C;  3ULY A;  3HXB A;  3TWW A;  3AS5 A;  4E85 A;  4G25 A;  4IUL A;  1OCZ E;  5T8I A;  3GZS A;  2F0Y A;  3TWX A;  5HQ8 A;  4L2Y A;  1OT8 A;  4YDW A;  3G2T A;  3EJN A;  3LY8 A;  1WY6 A;  4HI9 A;  4RQI A;  5FIN A;  4XKB A;  4FC8 A;  2AXU A;  4GCO A;  4GZ5 A;  2KCL A;  1IKN D;  4U8Y D;  3BG1 B;  3RO2 A;  3EDT B;  1S64 A;  4NIK A;  4WNF A;  3NZU A;  3QWV A;  1QNF A;  2XZD G;  4OVV A;  4FHJ A;  4BWR A;  4XI0 A;  3FUI A;  1N4S A;  2OEW A;  3I4G A;  3DXK G;  3SD5 A;  3VLE A;  2C2L A;  2XGO A;  2OOE A;  2LAH A;  2CG2 A;  3PE4 A;  3SBS A;  4MS6 A;  2H6G A;  2KCV A;  3IBE A;  4LNU D;  5LX8 A;  3D9K A;  1OWL A;  2OVF A;  5CRU A;  2LO6 A;  2X3M A;  5CEC B;  2YIN A;  2YQ8 A;  4KVO A;  4CGV A;  2CHZ A;  3FP3 A;  1Y6I A;  1Y8M A;  3S7J A;  2GRQ B;  3T8K A;  3CVN A;  3FU0 A;  2WXH A;  1OWP A;  3PE3 A;  4GTS A;  3Q4A B;  1D8E A;  4YVQ C;  3TWR A;  3UT8 A;  1O1S A;  4BX9 A;  2XGM A;  3TWS A;  4BTB A;  3ZXS A;  4OAV B;  3BG0 B;  3T8M A;  2A5E A;  2J49 A;  4AY6 A;  3OXF A;  2VTB B;  4L1B A;  2WXF A;  5BPP A;  3FTS A;  1NFI E;  4U04 A;  5JHA A;  3VTY A;  4O1P A;  3FUH A;  3CQC B;  3FEX A;  2WQ7 A;  5H7P A;  3UXG A;  1PY1 A;  3MKQ B;  4LSZ E;  1L5J A;  3SFX A;  5IY5 E;  2WXL A;  3SFZ A;  5JJ7 A;  5AQB A;  1H6O A;  1SA5 A;  4L7T A;  3UQ3 A;  2P9S G;  5EIB E;  2L9B A;  2JLB A;  4TUM A;  5HS0 A;  2XRY A;  4Y6W A;  5E76 A;  5G05 C;  3APC A;  1UOH A;  2P9P G;  5FT9 A;  3AAA C;  3RKV A;  3GW4 A;  4HRL A;  3Q49 B;  3FTV A;  4L9P A;  4GZ6 A;  4DX1 A;  3OXG A;  4CCA A;  4GTR A;  3T5X A;  3D3M A;  4XIF A;  1JCR A;  3L82 A;  3JXI A;  2AXZ A;  4GTQ A;  4D10 C;  3CKC A;  2IOL A;  1ZU2 A;  1N54 A;  4HVB A;  3QK0 A;  3QKY A;  4NUR A;  4JHK A;  2KBX A;  5BXO A;  4HS2 A;  2IFU A;  3L13 A;  2B6C A;  5CMW A;  5ITZ F;  4N39 A;  2F37 A;  4P29 A;  1O5M A;  4AV7 A;  4HB5 A;  5BV1 A;  1KPS B;  2EIK E;  3FUJ A;  2CHW A;  2PL2 A;  3EHM A;  3FUF A;  3DSX A;  4JB8 P;  4TUU A;  4LNG A;  1N4Q A;  1V54 E;  2XHE A;  2CHX A;  4J0U A;  3Q15 A;  4F1P A;  1FVH A;  2P9K G;  4U0U A;  2MHK A;  3IHY A;  3CSF A;  5C2Y A;  3CK9 A;  4U8V D;  3HDX A;  2VGX B;  5KJM A;  3EIJ A;  2RKK A;  1K1A A;  3WG7 E;  1WM5 A;  2LXM A;  3FH8 A;  3HG0 D;  4DI3 A;  3SNX A;  1H19 A;  3HXE A;  2C0M A;  4IYP A;  1A17 A;  2X6F A;  1OWN A;  1U2V G;  1NP7 A;  3OTN A;  3CHM A;  1D9S A;  2KZT B;  4G8K A;  4WNG A;  4YDY A;  4LG6 A;  2WXM A;  3SHF A;  4GU5 A;  2L0I A;  4KMO A;  2UY1 A;  3LXU X;  1OY3 D;  1E7V A;  5EX0 A;  3O48 A;  4AY5 A;  2WXK A;  3UT7 A;  1H2V C;  5KBA A;  3KEZ A;  2ZIS A;  2NYJ A;  3FFL A;  4DPR A;  4B94 A;  3FU3 A;  3LVR E;  2H6F A;  2IQC A;  4PUC A;  2FEZ A;  3UMV A;  2QYJ A;  4U96 D;  4LUN U;  3EU9 A;  3ASN E;  1KZO A;  2BTD A;  3UIN C;  5FQ7 A;  3E33 A;  5ENT D;  3FTU A;  4JPS A;  3ZW3 A;  4BSZ B;  4A55 A;  3QDN A;  4G8L A;  2ZXW E;  3EHN A;  1SZA A;  3EIQ C;  4HOS A;  1NI1 A;  2XEN A;  3JXJ A;  3AU5 A;  2FO1 E;  2H6I A;  5A23 A;  3CVY A;  4G2V A;  3JCK C;  2V5F A;  3JUE A;  2L0T B;  5DBK A;  3DSS A;  2ETB A;  1BI7 B;  3CQG B;  3GYZ A;  2DIW A;  5BXU A;  2AVP A;  5EID A;  2KM4 A;  4JEU A;  4I6G A;  1X81 A;  2BED A;  3HYM B;  2AXV A;  3FUK A;  3SY2 A;  4UWL A;  4DX5 D;  5HKP A;  3APD A;  3R9M A;  1TJC A;  3AG3 E;  3CKB A;  4G1T A;  4BFR A;  5JJT A;  4C0M A;  1NA3 A;  3RU0 A;  1QYM A;  5T4Y A;  4J8D A;  1BLX B;  1JCS A;  2XEE A;  3KS2 A;  4FAD A;  3UTM A;  3CGH A;  2BKG A;  4XE0 A;  2P9U G;  3UM3 A;  1ZBP A;  5CCM A;  3QC1 A;  4DRX E;  4W9R A;  4EHM A;  3O4Z A;  3Q5M A;  2DYS E;  2XGS A;  3RRN B;  3AJI A;  4EPZ A;  5KCM A;  3V30 A;  1MQS A;  4CDN A;  1KT0 A;  1E8Y A;  1UJJ A;  1YMP A;  4I1O B;  1KLX A;  2GRO B;  3ZUV B;  1HO8 A;  2LNI A;  2MOW A;  3K9I A;  3FTY A;  4YND A;  1DC2 A;  3CST A;  4EBA A;  2WXP A;  2H6H A;  3Q79 A;  5ENP D;  4JZY A;  1RZ4 A;  3ABL E;  3R7R A;  2DVW A;  3TAX A;  5A6C A;  4GMR A;  3FUN A;  5CHE E;  5FZQ A;  3T5V A;  1W3B A;  2ETC A;  2XQ0 A;  4XX5 A;  2ZIR A;  3LY7 A;  3DPY A;  4L2L A;  2FO7 A;  3D9I A;  4WWO A;  4ACK A;  2M63 A;  3FDH A;  3B7T A;  4GYW A;  3IKO B;  3ULQ A;  3ZYQ A;  1AP7 A;  4GCN A;  5D2M C;  2WXR A;  1DNP A;  1P5Q A;  5AQ7 A;  4CT0 A;  3Q78 A;  4J7W A;  3R7Q A;  1U3C A;  5DIZ A;  4WWP A;  3FEY A;  3ABK E;  4RSY A;  5FQ4 A;  5BW8 C;  5ENN A;  3JQ1 A;  1MX2 A;  1XNF A;  4APO A;  3ESL A;  2GGF A;  1TNO A;  4YDE A;  4CYM D;  3LJ3 A;  2P58 C;  4FUL A;  3AG2 E;  2BF0 X;  3F6Q A;  3MJW A;  1MX4 A;  3TWV A;  4KXK B;  4G11 A;  4U0Z A;  3LYA A;  4FLH A;  5AQ9 A;  3IXE A;  2OVB A;  3GZ1 A;  3AU4 A;  1PC2 A;  3ENE A;  3BQO A;  4J8Y A;  4GMJ A;  1H0A A;  4ANV A;  4ABN A;  1EF1 C;  1EPU A;  1Z6T A;  2NXP A;  4AXH A;  2VGX A;  5FTP A;  4GPK A;  3D9M A;  4UWG A;  3UI2 A;  2BUG A;  3I4R B;  3D9L A;  2KAT A;  4RG9 A;  3AS8 A;  4F53 A;  3RO3 A;  2NC9 A;  3D9H A;  1TR4 A;  3HXF A;  5EYL A;  3BU8 A;  5CCL A;  2V5Q C;  1TN6 A;  1SZ9 A;  5FQ8 A;  2V8S E;  4GZ3 A;  2PM7 A;  2KZT A;  3PRZ A;  5JMN D;  1EYH A;  3ZXP A;  3FH5 A;  3PDN A;  3V79 K;  4JA9 A;  1EDU A;  1E7U A;  3PUJ A;  2I6H A;  4A3T A;  5E75 A;  2R02 A;  4DUI A;  1H6K A;  4ATZ D;  5D66 A;  4M7C A;  5FQ6 A;  4UI9 J;  2QZA A;  2EIL E;  5EDS A;  4Y6C A;  2VSN A;  5AQA A;  4JD2 G;  3W9F A;  3C3O A;  3KEA A;  1BU9 A;  2P9L G;  2HM8 A;  2VQ2 A;  3JYS A;  3PH0 C;  3L16 A;  3SI5 A;  4AEZ C;  1JWF A;  3DST A;  5KJN A;  1MHQ A;  1O1R A;  3SQV A;  3TXM A;  4N2Q A;  2HE0 A;  4AOF A;  5LFA A;  4CT4 A;  3FWV A;  4B89 A;  2LXL A;  1HF8 A;  1PAQ A;  3NAW A;  3ZRH A;  1K8K G;  4BY6 A;  1N95 A;  1QQE A;  1A5E A;  2GRR B;  5AIJ A;  4HOQ A;  2WVI A;  2OCC E;  1S63 A;  3CHP A;  1N52 A;  1IHB A;  4DLO A;  4HFG A;  4J6I A;  2UWJ G;  3IV0 A;  4B8C B;  4JHJ A;  2PQN A;  2X6J A;  2P9N G;  4EBA G;  4G26 A;  3U4T A;  1YYH A;  3V2O A;  1WDY A;  3S7F A;  4K5B A;  5G55 A;  5CBN A;  4LCT A;  3DPD A;  5EX3 A;  2Y4T A;  2WM9 A;  3NZS A;  5CMY A;  1WAO 1;  5CEA A;  3G2U A;  4N5Q A;  3CHR A;  4R7L A;  4BT8 A;  2Y0B G;  1FCH A;  4PH4 B;  2EIJ E;  2V0P A;  1FT2 A;  3ASD A;  4JL0 A;  3KD7 A;  3LDZ A;  4GZC A;  2HO1 A;  3E37 A;  1G3N B;  1VDY A;  3FUM A;  2IF4 A;  1TEZ A;  1LD8 A;  4V3I A;  5FJY A;  3KAE A;  3N71 A;  1Z5S C;  4NRH B;  3DEO A;  3WXX A;  3RRM B;  2MRI A;  3E32 A;  3D9N A;  4MLP A;  2CG3 A;  2DZO A;  3MX3 A;  3UM2 A;  4RVB A;  4I43 A;  3UT4 A;  5CBO A;  3QOU A;  3PVL A;  4BT9 A;  3APF A;  4EZJ A;  2OV8 A;  5KNH D;  4ILG A;  4C0E A;  4DK5 A;  1E96 B;  2WXI A;  3V2X A;  3ZHE B;  3UIO C;  3LS8 A;  4I6J A;  3W9G A;  5AEN A;  3PZ3 A;  4U95 D;  4HOT A;  3E34 A;  2L6J A;  4N3B A;  3Q9N C;  2DCP A;  2WXQ A;  3QAR A;  4PS7 A;  5ANL A;  3DBS A;  5M72 A;  2DYR E;  1XGW A;  2PZI A;  5G04 J;  4FP7 A;  4BES A;  4IRU A;  3QB2 A;  2KC7 A;  2Y1L E;  3MCX A;  2LAI A;  3LPZ A;  4APF A;  3EHQ A;  4AJW A;  4CRW A;  3ASG A;  5EIL A;  1TNZ A;  3FTX A;  3QWP A;  4TRQ A;  2GRP B;  2VSX E;  1INZ A;  2GRM A;  5KJL A;  4Q69 A;  2LSV A;  4I2W A;  3FU5 A;  1BI8 B;  3ASH A;  3DSV A;  2I1K A;  3E4B A;  1TJF A;  3RJV A;  3SO8 A;  5CER B;  2KCK A;  1KZP A;  5FWQ A;  3SBT B;  2FI7 A;  3BEE A;  3TWU A;  4LER A;  5ARF A;  5C1D A;  2XRZ A;  4LNB A;  3ZEF A;  1YA0 A;  3ZYK A;  2I9C A;  2B0O E;  4HLL A;  2VJ8 A;  4RLY A;  4HLE A;  4FA6 A;  1NZN A;  3LKU A;  1OCC E;  3U64 A;  1Z3Y A;  3ZFW A;  4JEH A;  2DWZ A;  1OCR E;  4J8F A;  2XEH A;  3U3W A;  1ZB1 A;  4ZFH A;  2DBA A;  4GA2 A;  3TWT A;  3QJZ A;  4BET A;  3UM0 A;  1BD8 A;  3CVU A;  3FTW A;  1E8Z A;  1QBQ A;  4GAA A;  1UW4 B;  1SQM A;  3S2A A;  1HXI A;  4ANW A;  1JCQ A;  4HRM B;  4E6H A;  2VSY A;  2Y69 E;  5AAO A;  1OCO E;  1NL4 A;  4EEC A;  3P2B A;  3CHQ A;  3HVE B;  3CVX A;  1OWO A;  4Q94 A;  4HNA D;  2ZGG A;  3Q7A A;  5JJ6 A;  4CDM A;  1N9A A;  3RAU A;  4AP2 A;  4BSX A;  3MYV A;  4QQI A;  2QC9 A;  1TNB A;  1DCQ A;  2Y3A A;  4JHR A;  4ANX A;  3D9J A;  1UN9 A;  3MV3 B;  1UJK A;  3B7B A;  3CVP A;  3LCA A;  4HRN A;  3RSE G;  3CHO A;  3U9W A;  1HZ4 A;  4UI9 C;  3BUA A;  4X8Q A;  2CFU A;  4HOU A;  2J4D A;  3PUK A;  2PNN A;  2VTB A;  3MGB A;  4FLB A;  2CFZ A;  3FUD A;  4H7X A;  3FUE A;  3L9T A;  5D0Q D;  4ME2 A;  2X6I A;  3HIZ A;  2WXG A;  3TL5 A;  5BV0 A; 
#chains in the Genus database with same CATH homology
 3OXG A;  4WAF A;  4CCA A;  4UWG A;  1OUV A;  3JQ0 A;  3T5X A;  2BUG A;  3D3M A;  4JVS A;  4XIF A;  3I4R B;  2AXZ A;  4DJA A;  3MKQ A;  3D9L A;  5G2N A;  3CKC A;  4D10 C;  2IOL A;  2KAT A;  3SGH A;  1ZU2 A;  4RG9 A;  3UX4 A;  3AS8 A;  4F53 A;  3RO3 A;  3UPV A;  3RK6 A;  5JHB A;  2NC9 A;  1HS6 A;  4EQF A;  3S7D A;  3VTX A;  3PEU B;  1N54 A;  5CCL A;  4HVB A;  3D9P A;  3Q47 B;  3CIA A;  2YHC A;  3QK0 A;  3QKY A;  1UN8 A;  4NUR A;  4ATG A;  5FZS A;  2XPY A;  4JHK A;  1SZ9 A;  5FQ8 A;  2V8S E;  4GZ3 A;  4HS2 A;  2IFU A;  3L13 A;  2PM7 A;  2KZT A;  5CMW A;  3PRZ A;  2EQX A;  3L6A A;  4N39 A;  4P29 A;  4F1S A;  4IN3 B;  4AV7 A;  5FZR A;  2XEV A;  3CVV A;  3ZYM A;  3VLF A;  1EYH A;  3G2S A;  4GYO A;  5AYW D;  3FH5 A;  5BV1 A;  1H2U A;  4N3C A;  2A4Z A;  3PDN A;  1OWM A;  4JA9 A;  3FUJ A;  1EDU A;  2CHW A;  2PL2 A;  4UQZ A;  1E7U A;  3ASF A;  3PUJ A;  4ILH B;  2I6H A;  3EHM A;  4ILI A;  4A3T A;  2YNQ A;  3FUF A;  5E75 A;  2I1J A;  4KZ0 A;  4TUU A;  3FU6 A;  4AIF A;  1H6K A;  4CEM A;  2XHE A;  2CHX A;  4J0U A;  5G05 J;  3Q15 A;  1FVH A;  2R17 C;  4KZC A;  2XCC A;  4U0S A;  4U0U A;  2I2O A;  5FQ6 A;  4WND A;  2MHK A;  3UUX A;  3IHY A;  4UI9 J;  3CSF A;  3QNK A;  2XCB A;  5EDS A;  5C2Y A;  2R59 A;  4Y6C A;  4PS8 A;  1HX8 A;  2ION A;  2WMN A;  3CK9 A;  4URK A;  4L23 A;  4K03 A;  3HDX A;  2VSN A;  2VGX B;  5KJM A;  2WQ6 A;  3EIJ A;  3RRU A;  2GW1 A;  2J07 A;  4QFV A;  3CVW A;  2VYI A;  3QAQ A;  2J09 A;  3G2V A;  2HM8 A;  2E2E A;  2VQ2 A;  4PS3 A;  1WM5 A;  3JYS A;  4FJZ A;  4JA7 A;  3FH8 A;  4DI3 A;  2C0L A;  2WMO A;  1JWG A;  3PH0 C;  3SNX A;  3L16 A;  3SI5 A;  1H19 A;  1HH8 A;  4AEZ C;  1JWF A;  2C0M A;  4IYP A;  1A17 A;  3P1U A;  2X6F A;  3ONL A;  4LEU A;  5KJN A;  1MHQ A;  1OWN A;  1NP7 A;  3OTN A;  2XPZ A;  3CHM A;  3TXM A;  4N5C A;  4N2Q A;  4AOF A;  2J4B A;  5LFA A;  4N3A A;  1IQU A;  3FWV A;  4CT4 A;  1ELK A;  2KZT B;  3ZYL A;  4WNG A;  5ANR A;  5AJL A;  4B89 A;  4HOR A;  4KBQ A;  3PEV B;  1HF8 A;  1IQR A;  1PAQ A;  3ZRH A;  2GRL A;  2Q7F A;  4HXI A;  2WXM A;  4FHK A;  4GU5 A;  2J9Q A;  4XI9 A;  3SHF A;  4BY6 A;  1IHG A;  2L0I A;  4DI4 A;  2RG8 A;  1QQE A;  4UQY A;  3FY4 A;  4KMO A;  1HFA A;  3ESK A;  4AM9 A;  1GW6 A;  5AIJ A;  3B13 A;  4HOQ A;  2WVI A;  3CV0 A;  2UY1 A;  3LXU X;  3CHP A;  3OAW A;  1N52 A;  4RG6 A;  5AJD A;  1E7V A;  5EX0 A;  3O48 A;  4DLO A;  4HFG A;  2IJG X;  4AY5 A;  3PRE A;  1HG2 A;  1H2T C;  2WXK A;  2WQH A;  1BPO A;  4J6I A;  3PZD A;  3URZ A;  3UT7 A;  2UWJ G;  3IV0 A;  4B8C B;  4JHJ A;  1H2V C;  4I6E A;  3S7B A;  2PQN A;  2X6J A;  3KEZ A;  2R5S A;  4WWN A;  3IEG A;  4EBA G;  4G26 A;  4UQX A;  4AVX A;  4I9E A;  4UI9 K;  3U4T A;  4KYO B;  3FFL A;  1ELW A;  4DPR A;  4B94 A;  3FU3 A;  2QY7 A;  3S7F A;  2YHE A;  3CEQ A;  4OVU A;  4G23 A;  5G55 A;  3LVR E;  4LCT A;  3DPD A;  1KT1 A;  3ONK A;  3TGO A;  2FUL A;  4KT6 B;  2IQC A;  2FF4 A;  4PUC A;  2Y4T A;  2FEZ A;  2WM9 A;  5EX3 A;  3UMV A;  5KJK A;  4EZK A;  3NZS A;  4LUN U;  5CMY A;  3AS4 A;  1WAO 1;  3G2U A;  4ANU A;  3FH7 A;  3TG5 A;  3ZHE A;  5LCW J;  2LSU A;  2BTD A;  3CHR A;  4R7L A;  4XKC A;  3CK7 A;  3L08 A;  4BT8 A;  3R9A B;  5FQ7 A;  2X6H A;  1FCH A;  4FU3 A;  4XZ4 A;  2IOS A;  2E0I A;  1S0P A;  3FTU A;  4PH4 B;  4J8S A;  4JPS A;  3ZW3 A;  1ELR A;  4JC8 A;  4BTA A;  2XPI A;  2V0P A;  3ASD A;  4A55 A;  5HI7 A;  3LVQ E;  5J90 A;  3NF1 A;  3QDN A;  4F7A A;  4JL0 A;  3KD7 A;  3LDZ A;  4GZC A;  3RIB A;  2HO1 A;  4H7Y A;  4J8E A;  3HHM A;  3EHN A;  3LEW A;  1SZA A;  1HG5 A;  3EIQ C;  4FJY A;  4HOS A;  4GML A;  1QZ2 A;  3PS6 A;  2WXN A;  3AU5 A;  4A1G A;  1VDY A;  3FUM A;  2IF4 A;  1TEZ A;  3LY9 A;  4OYS A;  4O6F A;  4V3I A;  4CGW A;  4I2Z A;  5G04 C;  3MEK A;  1NA0 A;  5FJY A;  2WXJ A;  5A23 A;  3CVY A;  3CR3 A;  3I5P A;  3KAE A;  4G2V A;  3G2W A;  3JCK C;  3N71 A;  3MZL B;  2V5F A;  4NRH B;  1Z3X A;  3B7R L;  2L0T B;  5DBK A;  4N2S A;  3WXX A;  3FTZ A;  3RRM B;  2MRI A;  4GA0 A;  2UY1 B;  2X6K A;  5LOZ A;  4JXT A;  3CQG B;  5BT1 A;  3GYZ A;  3FUL A;  4K0R A;  3D9N A;  4LRZ A;  4MLP A;  4GYY A;  2CG3 A;  2DIW A;  3MX3 A;  5BNW A;  5BUZ A;  2AVP A;  4RVB A;  2NSZ A;  1E90 A;  1DVP A;  2A5U A;  4I43 A;  3UT4 A;  2KM4 A;  4JEU A;  2OND A;  4CDR A;  4KVM A;  3QOU A;  2PM6 A;  3PVL A;  1JUQ A;  3APF A;  3OXL A;  4NQ0 A;  4BT9 A;  4EZJ A;  4EZL A;  2OV8 A;  3AS5 A;  4E85 A;  4G25 A;  4I6G A;  4IUL A;  2ZU6 B;  3HYM B;  4ILG A;  4C0E A;  2AXV A;  3FUK A;  5T8I A;  4DK5 A;  4UWK A;  3GZS A;  2V4L A;  1E96 B;  3IHV A;  5EKQ D;  2WXI A;  4UWL A;  4UWF A;  5HQ8 A;  4L2Y A;  3APD A;  4UWH A;  3G2T A;  1TJC A;  3ZHE B;  3EJN A;  3CKB A;  5A7D B;  3LY8 A;  3LS8 A;  3MA5 A;  1WY6 A;  4G1T A;  4I6J A;  4BFR A;  5JJT A;  4C0M A;  4I17 A;  1NA3 A;  5AEN A;  3RU0 A;  5T4Y A;  4HOT A;  2L6J A;  4N3B A;  4J8D A;  4PDX A;  2FBN A;  4XKB A;  3KS2 A;  4FC8 A;  4GB9 A;  2RD0 A;  2AXU A;  2DCP A;  4GCO A;  4GZ5 A;  4FAD A;  2WXQ A;  1JPL A;  3MV2 B;  3CGH A;  3QAR A;  4PS7 A;  4G24 A;  3DBS A;  5ANL A;  5M72 A;  2KCL A;  3SF4 A;  4XE0 A;  3BG1 B;  3RO2 A;  1ZBP A;  1XGW A;  3EDT B;  3L17 A;  5CCM A;  4WNF A;  3B7U X;  3QC1 A;  2PZI A;  3NZU A;  3QWV A;  4W9R A;  1QNF A;  4A1S A;  3U66 A;  4FP7 A;  4I1M A;  4OVV A;  3O4Z A;  4FHJ A;  3Q5M A;  4IRU A;  5G04 J;  3QB2 A;  2KC7 A;  4Q96 A;  4BWR A;  3MCX A;  4XI0 A;  2LAI A;  2XGS A;  3FUI A;  3LPZ A;  2QFC A;  3RRN B;  1HE8 A;  3I4G A;  4APF A;  3SD5 A;  3VLE A;  2WPV A;  4AJW A;  4CRW A;  3ASG A;  4EPZ A;  5KCM A;  2C2L A;  2XGO A;  2OOE A;  1MQS A;  3FTX A;  2JEK A;  2LAH A;  3QWP A;  2CG2 A;  3PE4 A;  4TRQ A;  4TV3 A;  3ZVV A;  4CDN A;  1KT0 A;  3SBS A;  4MS6 A;  1E8Y A;  1UJJ A;  2PQR A;  2KCV A;  3IBE A;  4JW1 A;  2Y4U A;  2VSX E;  1INZ A;  1E8X A;  2GRM A;  2ILR A;  4Q69 A;  5KJL A;  5LX8 A;  4I1O B;  3D9K A;  2LSV A;  2AW6 A;  1OWL A;  3CHS A;  1KLX A;  3HVE A;  4I2W A;  1HO8 A;  2OVF A;  2LNI A;  2LO6 A;  3CK8 A;  2MOW A;  2X3M A;  3ASH A;  3FU5 A;  2I1K A;  3E4B A;  3K9I A;  3FTY A;  1TJF A;  2YIN A;  4YND A;  3RJV A;  3CST A;  2YQ8 A;  4KVO A;  4CGV A;  2CHZ A;  2KCK A;  1Y6I A;  3FP3 A;  5FWQ A;  2WXP A;  1Y8M A;  2FI7 A;  3S7J A;  3BEE A;  3SBT B;  4EBA A;  4JZY A;  3R7R A;  4LER A;  5ARF A;  3CVN A;  3TAX A;  5C1D A;  2XRZ A;  3FU0 A;  3ZEF A;  4BX8 A;  4C9B B;  1YA0 A;  3ZGQ A;  3ZYK A;  2I9C A;  5A6C A;  2WXH A;  1OWP A;  3FUN A;  3PE3 A;  3PNT B;  3CVQ A;  5CHE E;  3FHE A;  5FZQ A;  3T5V A;  3TJP A;  4WNE A;  2VJ8 A;  1W3B A;  4HLE A;  4U63 A;  4FA6 A;  1NZN A;  2XQ0 A;  3D9O A;  3LKU A;  3Q4A B;  4YVO A;  4XX5 A;  3U64 A;  3LY7 A;  1Z3Y A;  4A3V A;  2WB2 A;  3ZFW A;  5T3R A;  4JEH A;  4L2L A;  5ARG A;  3NQP A;  3GZ2 A;  4YVQ C;  2FO7 A;  4J8F A;  2J08 A;  3U3W A;  3D9I A;  4GA1 A;  4WWO A;  4ACK A;  2M63 A;  3FDH A;  3B7T A;  4GYW A;  4I1A A;  3UT8 A;  3IKO B;  3ULQ A;  4MKT A;  3ZYQ A;  4BX9 A;  2DBA A;  4GCN A;  2XGM A;  1IYG A;  2HR2 A;  4I9C A;  3I3N A;  4BTB A;  3QWW A;  2VGY A;  2WXR A;  4GA2 A;  4WUY A;  3ZXS A;  3BG0 B;  3ML9 A;  3PNL B;  3QJZ A;  3T8M A;  2HYZ A;  1DNP A;  2J49 A;  3CVU A;  3OXF A;  4GZD A;  3FTW A;  4AY6 A;  1P5Q A;  4CT0 A;  1E8Z A;  4M3O A;  4GAA A;  5LP0 A;  1UW4 B;  3B7S A;  2AWI A;  1SQM A;  3S2A A;  4U07 A;  3C98 A;  3R7Q A;  1E8W A;  1U3C A;  4NAC A;  5DIZ A;  1B89 A;  4WWP A;  3FEY A;  2VTB B;  1HXI A;  4L1B A;  4ANW A;  1LF8 A;  2WXF A;  3VLD A;  5BPP A;  3FTS A;  4U04 A;  5JHA A;  4E6H A;  4RSY A;  2VSY A;  3VTY A;  5FQ4 A;  5D0O D;  5BW8 C;  3FUH A;  5ENN A;  3JQ1 A;  1XNF A;  3CQC B;  4EEC A;  4APO A;  3P2B A;  3SZ7 A;  3FEX A;  2WQ7 A;  3ESL A;  5LCW C;  2GGF A;  3CHQ A;  3HVE B;  1PY1 A;  3MKR A;  3CVX A;  1OWO A;  3MKQ B;  4Q94 A;  4ACL A;  4MRU A;  3LJ3 A;  4B8A A;  5J08 A;  2P58 C;  1L5J A;  2WXO A;  4FUL A;  5JJ6 A;  4CDM A;  3TXN A;  4DLQ A;  1U3D A;  2BF0 X;  1X5B A;  1FVF A;  3L54 A;  1UG3 A;  3MYV A;  4AP2 A;  3MJW A;  4BSX A;  2WXL A;  3SFZ A;  3CVL A;  2Y3A A;  4JHR A;  4ANX A;  5JJ7 A;  3D9J A;  3UQ3 A;  4L7T A;  1UN9 A;  4KXK B;  4AXH A;  3JUI A;  4G11 A;  3MV3 B;  3L22 A;  2IU1 A;  4U0Z A;  1UJK A;  2L9B A;  2JLB A;  3CVP A;  3LYA A;  4FLH A;  2XRY A;  3ZIM A;  2OVB A;  3LCA A;  4U8H A;  4Y6W A;  4F3V A;  3GZ1 A;  5E76 A;  5G05 C;  3APC A;  2VSO E;  3TG4 A;  5FT9 A;  3CHO A;  3ZPJ A;  3U9W A;  1HU3 A;  1HZ4 A;  3RKV A;  4UI9 C;  3AU4 A;  1PC2 A;  2CFU A;  3ENE A;  3ZN3 A;  4HOU A;  2J4D A;  3PUK A;  3GW4 A;  2VTB A;  4GMJ A;  1H0A A;  3MGB A;  4ANV A;  3Q49 B;  4FLB A;  4ABN A;  2CFZ A;  4B0Z A;  1EF1 C;  3FUD A;  1EPU A;  4H7X A;  3FUE A;  1Z6T A;  2NXP A;  3CLJ A;  2VGX A;  3FTV A;  4ME2 A;  2X6I A;  3ML8 A;  3HIZ A;  5D0Q D;  2X38 A;  5FTP A;  4GZ6 A;  2WXG A;  4GPK A;  3D9M A;  3TL5 A;  5BV0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...