4ATGA

Taf6 c-terminal domain from antonospora locustae
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
195
structure length
195
Chain Sequence
GSHMLPKELQLYFDKILSMIKSDMKDIAIECLEKESGLQQLVPYFIQHISELILKSFKEAEVLKTCIALYFSLIKNKHVFIDPYLHQILPSLLTCVIGKSIVDDDVRKMSADIVKYIYDTYSRSYKTLAPRVLKTLKGVWMDPNRSEDSQYGALYCLSILSKNVVNTVIREHAEEYKRTIGKKKVTNLLDNVLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TFIID Taf6-Taf9 Complex Formation Involves the Heat Repeat-Containing C-Terminal Domain of Taf6 and is Modulated by Taf5 Protein.
pubmed doi rcsb
source organism Antonospora locustae
molecule tags Transcription
molecule keywords TAF6
total genus 77
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07571 TAF6_C TAF6 C-terminal HEAT repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.770 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4atgA00
4ATGA
chains in the Genus database with same CATH superfamily
5ITZF 1OCOE 1TJFA 4IN3B 4U8VD 3PZ2A 1E8ZA 1IYGA 1QZ2A 4J8YA 1BD8A 4XZ4A 3NZUA 2WM9A 3QWPA 4NIKA 5ENQD 4WNEA 4JHKA 3O48A 1YCSB 3CVPA 5FZSA 2AXVA 4EECA 1QQEA 3AS5A 3TWUA 4CRWA 5HKPA 2XCCA 2IJGX 4B93B 3SF4A 1BPOA 1TNYA 3MYVA 2MHKA 3Q7FA 4N3BA 3PEVB 3IXEA 4L7TA 4GA2A 3ESKA 4BX8A 3CVNA 3PUJA 3UM1A 3LJNA 5AJLA 3D9KA 4XIFA 3SY2A 2XZDG 3B7BA 3R7RA 5CEDB 2AVPA 1V55E 2P9IG 1H6OA 3DPDA 2XEVA 3MV2B 3ZEFA 3MEKA 2QYUA 1OUVA 4G11A 2IO3C 2J08A 3CHSA 1LD8A 4U96D 4DJAA 4FC8A 5KJLA 5B3SE 1RZ4A 3KSLA 2JABA 5G2NA 5DIZA 4R7LA 3TWWA 4NURA 2ZU6B 4BWRA 5A6CA 3TL5A 3OTNA 3DSWA 3FTXA 4BESA 3HXFA 5LCWC 4HLEA 2VSNA 4RLYA 4GAAA 3UM0A 4G2VA 3KEAA 2UY1A 3CKCA 5KWDA 1TN7A 1WDYA 4TUUA 4UQYA 3ZHEA 1A5EA 1NP7A 4AJWA 2DBAA 5IY5E 4HRLA 2WQHA 3N71A 1OT8A 3CVVA 4JHRA 4G24A 3L9TA 2GRPB 1MX6A 2GRLA 1PY1A 2XEEA 4QQIA 3UPVA 4MRUA 3ASOE 5ENPD 3FTVA 2P9KG 1EDUA 4B8AA 3CHQA 5G04J 2H6FA 5T3RA 2P9LG 3Q7AA 5E75A 2MYOA 4HBDA 2FO7A 4CDNA 5CBOA 4F1PA 5J90A 2WQ7A 4I1OB 4CGVA 3KD7A 4ACLA 1UOHA 4HRMB 1EF1C 4I17A 3PE4A 1KT0A 4YVQC 2AJAA 1ZU2A 5D0OD 2BTDA 4GCNA 1BI8B 4WNFA 3EUVA 4E6HA 4UI9K 2R17C 1HS6A 1MZCA 3GZ2A 3PREA 4UQXA 5G55A 3G2WA 3OXGA 2L0IA 3IHYA 4GZ6A 2R5SA 4GZCA 4N2SA 3TWQA 4AM9A 2P9PG 2GGFA 3PUKA 3CK9A 3QAQA 2QC9A 3ULEG 5BW8C 2EIKE 4UWKA 3T5XA 4ATZD 1AP7A 5JHBA 3TWTA 4EBAA 4LUNU 3VLEA 3V31A 4PUCA 2CHZA 4Y6WA 3FUDA 3BUAA 4CZ2D 3ULQA 3PZ4A 3L54A 3JYSA 3NAWA 3LY7A 1LD7A 3UQ3A 4IULA 4LG6A 4G23A 3S7JA 3W9FA 4WUYA 2WXJA 4OVUA 3UT4A 1X5BA 2WXLA 3C3OA 3K9IA 2P9SG 2P9UG 3FH8A 5FIOA 4DI4A 3SBTB 2BEDA 1TNUA 5AQBA 3ZFWA 3I4GA 3L16A 3IV0A 2ZXWE 3LDZA 4U95D 3UM3A 5JJ6A 2NSZA 3BEEA 4LNGA 3T8MA 1H6KA 4HOTA 2YQ8A 4GYWA 4AY6A 1O1SA 2Y1LE 4J7WA 3RO3A 5AENA 4B94A 2A5UA 3NOCD 4K5AB 4ATGA 1KPSB 2QY7A 2PNNA 3HXBA 1KZPA 4Q96A 2J09A 5EYPF 3CIAA 4YVOA 4BTAA 3U4TA 2PQNA 1NL4A 1FT1A 2GRMA 3PNTB 4U8YD 2HE0A 3Q9NC 1H2UA 5BV1A 4BX9A 5KNGA 3RRUA 3L17A 4CGWA 2XENA 3RO2A 4GA0A 3IBEA 3ZYMA 3J5QB 2LAHA 2FEZA 2XQ0A 2QFCA 1HO8A 4H7XA 4APOA 4DX5D 1V54E 1O5MA 2KCLA 3UKUG 2KCKA 4J8FA 1H0AA 3NQPA 2PZIA 4GMLA 3RIBA 3NBNB 3LVRE 4JB8P 3D9LA 4HVBA 3MX3A 4ACKA 4JXTA 3CHMA 1K1BA 3AG4E 3RU0A 1Z6TA 3SNXA 4ANXA 4W9RA 4GTQA 2VTBA 4Z68A 3AAAC 5EILA 3LY9A 4J0UA 4LNBA 1MYOA 1A17A 3ASNE 2E0IA 3QK0A 3FUKA 5ANRA 4XI0A 4C0EA 1UG3A 4A63B 4AIFA 3L6AA 2ZGDA 2GRQB 2BKKB 1SA5A 1G3NB 2AXUA 1HE8A 4XKCA 4I2WA 3AG1E 3ABKE 5H7PA 3ZYQA 1Z3YA 3VTXA 1OWNA 5D0QD 4F3VA 4WNDA 1E8XA 3WG7E 5FQ6A 4MLPA 3RRMB 1N4RA 4A1GA 3CHRA 3ONLA 3APFA 3E33A 4GYOA 4U63A 2F8XK 3DXMG 2WMOA 1YMPA 1YA0A 1HH8A 2DIWA 2IO2C 4HOSA 2VSOE 2V8SE 3IHVA 4KVMA 4MBGA 2QZAA 4EHMA 1H2VC 3E4BA 2WXQA 3MCXA 1ELWA 3ML8A 3S7FA 1GW6A 3LPZA 3PH0C 3DEOA 4MS6A 3L22A 3UIPC 5FTPA 2LUHA 3BU8A 2Y3AA 1Q2ZA 3DWLG 1BI7B 1E8YA 2L9BA 2OVFA 3AS4A 4N3AA 3VTYA 4BFRA 2XCBA 4GCOA 3DPYA 3ZN3A 4JD2G 4JEHA 4UWGA 4M7CA 5ARFA 3OXLA 2A4ZA 3QJZA 3HXCA 4GPKA 3EHMA 5B1AE 3FTYA 1IKND 1BU9A 1PAQA 3RKVA 5J08A 1NA3A 4O1OA 1P5QA 2LXMA 5FINA 5BPPA 3B7SA 4GMJA 4BSZB 4GZ3A 2PM6A 3NOGD 2ETBA 2R02A 3EHNA 4KYOB 2XRZA 5KJNA 2XZTG 1N52A 4DPRA 3U66A 4U04A 3Q5MA 2YHCA 4K0RA 1YYHA 3DEPA 3FTSA 4YDEA 3ZHEB 4YNDA 4UWLA 2WB2A 3FH7A 4A55A 5HQ8A 4HB5A 1O1TA 1TYQG 1FPPA 1N0RA 3LY8A 3SFXA 4FADA 4DLQA 5CECB 3UKRG 2R2LA 4UI9J 2IY0C 4CEMA 2GW1A 3EIJA 4A3TA 3EJNA 2OOEA 3EHRA 4L2LA 2F37A 3HVEB 4I1MA 3QKYA 2R05A 3CVQA 1OY3D 1E8WA 4CT4A 3SQVA 1TJCA 3CGHA 4GTMA 3UTMA 3C72A 4X8QA 4UI9C 5ENNA 4JHJA 1QNFA 2PQRA 1SZ9A 4DK5A 1BLXB 3CK8A 5DBKA 3EIQC 4JZYA 2WVIA 5LX8A 2E2EA 1QYMA 2DVWA 3I4RB 3IKOB 2P2CP 4F7AA 2VGEA 5D2MC 3FEXA 3JXIA 3EU5A 4HOUA 1HZ4A 1IHGA 2XPIA 4PS7A 5D66A 3FHEA 4GB9A 1IQUA 2KXPC 3LVQE 5E76A 1TNBA 2IU1A 1WAO1 2RD0A 3QB2A 5LP0A 3CVYA 4EPZA 3HXDA 4ANWA 2OEVA 3RRNB 2LAIA 1N11A 4BETA 3CVXA 4DRXE 4RVBA 3FUIA 5ANLA 4WWPA 1TR4A 4F53A 4FULA 3T9KA 4PS3A 1Z3XA 5FQ4A 4HOQA 5CRVA 3Q73A 2RFMA 3FTZA 4DUIA 4ME2A 3ESLA 4GTOA 4M3OA 4OVVA 4UQZA 4RQIA 4GZDA 1H2TC 5HI7A 3LJ3A 4U0SA 3BQOA 3V2XA 3CVUA 2ZIRA 4OYSA 3GW4A 2WXMA 3W9GA 3GZSA 1N9AA 2IFUA 3TWVA 4HORA 2L0TB 4TUMA 1KZOA 1UJKA 3G2SA 4GTVA 3TJPA 2H6GA 2VGYA 3ASGA 3TWXA 4U7EB 2LSUA 4URKA 3CSTA 4ANVA 2XEHA 5FZQA 3CK7A 1OWMA 1FCHA 3CV0A 3PZ1A 3D9IA 3FFLA 3U3WA 4P29A 5KJMA 1Z5SC 4K5BA 2X3MA 3R9AB 2V5FA 2Y4UA 3PZ3A 2L6BA 5EKQD 2WXRA 5JJTA 1SW6A 1UJJA 4BEPA 4C0MA 1SZAA 1KT1A 3SFYA 4PH4B 1HXIA 4DX2A 1N95A 1OCCE 5CMYA 5A7DB 1B89A 4BSXA 4AOFA 4G26A 3ENEA 2Y0BG 3PRZA 3TGOA 3CSFA 1TNOA 5C2YA 3LYAA 1MJ0A 2H6IA 5CHEE 3UI2A 5EX0A 4ZHBA 4J8EA 2C0LA 2C2LA 3D9PA 1OXJA 1SVXA 4RG9A 4B8CB 4GTRA 3AU4A 2ZISA 3U9WA 4G1TA 5EX3A 4FU3A 4B89A 5BV0A 2KC7A 1D9SA 2OEWA 3IEGA 4XX5A 2J8SD 2WXNA 5AJDA 2UY1B 2BF0X 3BG0B 3C3QA 4HFGA 2KZTB 3DSXA 5AARA 3WXXA 4LCTA 3Q49B 2IQCA 1H6PA 3UINC 4NQ0A 3G2VA 4YDOA 4TXPA 2IF4A 1E90A 3FDHA 4B0ZA 2R03A 5ENSD 4DLOA 3GYZA 2J49A 3SGHA 3B7UX 2PL2A 2VGXA 3FTWA 3D9JA 3FH5A 4J8DA 3AG3E 3TWRA 3FUFA 1TNZA 4AXHA 4KMOA 3VLDA 3Q9UC 3ZYLA 3ULYA 1NFIE 1U2VG 3OAWA 1N4QA 3S7DA 3S7BA 1VDYA 2GRNB 4WNGA 3CR3A 2QYJA 3ZPJA 5CCMA 4EZLA 2LSVA 2XS1A 5ENOD 2XHEA 5AAOA 3APDA 4WAFA 2YINA 3FU5A 3I5PA 5BXOA 4L2YA 4BY6A 3V79K 4TRQA 1INZA 5G05C 3LXUX 3FWVA 1ZBPA 4H7YA 1UN9A 4JEUA 3JQ1A 1O1RA 4UWFA 4GZ5A 4HXIA 4A1SA 5C1DA 5EIDA 5ARGA 4XEIG 3UT8A 4AV7A 2WXOA 3J5PA 3QWWA 2EIJE 3UUXA 3ZNGA 4EQFA 3ZKJA 2JLBA 5AQ9A 2YNQA 3MGBA 1X81A 4LSZE 3V2OA 3ASDA 3P2BA 1K8KG 3CHPA 4HI8A 4NRHB 4OAVB 2HR2A 3FUMA 4BERA 3Q15A 3TAXA 4YDYA 1N4SA 4HS2A 1S64A 3UXGA 2ETAA 4A3VA 4G8LA 5EYLA 2IEJA 1LTXA 2KATA 2WXFA 5KNHD 3FTUA 4K03A 2WMNA 4GTPA 1NA0A 1OWLA 3HRAA 4TV3A 3ZW3A 2FF4A 5BT1A 4V3IA 5AQAA 4IYPA 4UUCA 2RKKA 1MHQA 3FUNA 4DX1A 1W3BA 2OVBA 2XPZA 3CQCB 3LEWA 3ZUVB 3ZRHA 2F0YA 4UWHA 4L23A 3B13A 1JCQA 4LNUD 1MQSA 2BKGA 5BUZA 5CRUA 2NXPA 2CG2A 3EU9A 4LEUA 4CCAA 4IRUA 4FLBA 4F1SA 2XGMA 2HM8A 2WPVA 4HNAD 2P9NG 2JEKA 3MA5A 3AS8A 4KVOA 4U0ZA 3O4ZA 3KEZA 4ILGA 5KCMA 2VSYA 2FO1E 4GPMA 3ZU7B 2LO6A 3MV3B 2J9QA 1ELKA 3L13A 2KM4A 1N4PA 2HYZA 3NB2A 3D9HA 4D10C 4G25A 3AU5A 3QARA 1HG5A 5CEAA 2XGSA 4I43A 4JA7A 3MKRA 4FHJA 2X6KA 5JA4D 2YHEA 2AW6A 2C0MA 3PEUB 2WXKA 3KAEA 2X38A 4HI9A 4I9CA 1D8DA 1RW2A 3E30A 4KBQA 4FP7A 3C3RA 3TXNA 3QNKA 3EDTB 4XI9A 1QBQA 2WXHA 4ABNA 4GTSA 4GYYA 5A23A 1U3DA 5JMND 1HF8A 2VSXE 3UX4A 3SI5A 4GMRA 4LERA 3HVEA 2V4HC 4MKTA 3JUIA 4Y6CA 1NI1A 1S70B 4L1BA 2Y69E 4Q94A 5AIJA 3UMVA 5AQ7A 3ZVVA 4FA6A 4FHKA 1MX2A 5FJYA 3U64A 3HDXA 3JUEA 5T4YA 3FY4A 3TWSA 4U0UA 3E37A 4ZFHA 5EIBE 3QWVA 2ONDA 3FUHA 3VLFA 3S2AA 3RK6A 2EQXA 3FU3A 2CFUA 4JPSA 1TN8A 3MKQB 4F6RD 3PZDA 1SA4A 3TG4A 4I6GA 2IONA 4TXRA 1DVPA 2XPYA 2IOSA 1JPLA 3ZYKA 1DNPA 2B0OE 4XKBA 4C9BB 1E96B 3UM2A 2X6FA 3D9NA 4G8KA 3DSUA 3JQ0A 4WWOA 4ILHB 5BNWA 1N94A 3MKQA 2OV8A 5HRYA 3Q4AB 2WXIA 4ANUA 3SZ7A 2VTBB 3DSVA 2VYIA 3PNLB 5JHAA 1E7VA 3ML9A 1IHBA 3CLJA 4O6FA 3APCA 1OCZE 5CMWA 3V30A 3LS8A 3CHOA 1IXVA 3G2TA 1HU3A 4TXQA 3PVLA 3CEQA 2Q7FA 4N2QA 4ILIA 2DZNA 3BG1B 5AN8A 4AY5A 3ABLE 2LXLA 3SFZA 2FULA 2AWIA 4I1AA 1HG2A 1JCRA 2I1JA 5FZRA 4KZCA 3SHFA 3CVWA 1S0PA 4EBAG 3ZGQA 3AJIA 1HFAA 3Q79A 4DI3A 3LKUA 1IQRA 1ZB1A 1FT2A 3HG0D 3LCAA 2XRYA 4HLLA 2B6CA 3FULA 5FT9A 4O1PA 1DCQA 1UN8A 3JCKC 3FU0A 4YDWA 2V4LA 4JC8A 5EDSA 4U8HA 3Q47B 2PM7A 4RG6A 1DCEA 3FUJA 4KZ0A 1DC2A 3R9MA 5KJKA 1D8EA 4GU5A 4I9EA 4RSYA 1LF8A 3DBSA 3HXEA 5M72A 3L82A 2MRIA 5BXUA 1KLXA 1L5JA 1E7UA 4JW1A 4N5QA 1JWFA 5LCWJ 1NZNA 1JCSA 1U3CA 3P1UA 1K1AA 4OAUC 5CBNA 4FJYA 2DYRE 3I3NA 3CQGB 4HQDA 4WWNA 4BT9A 3FP3A 4AP2A 1XGWA 3ASFA 4KT6B 2I2OA 3E32A 4N3CA 3Q75A 4I6EA 2BUGA 2H6HA 4PDXA 4JVSA 3D3MA 3Q78A 2DWZA 2KZTA 3TG5A 1TN6A 3SD5A 3MZLB 2FBNA 4PS8A 2FI7A 4CT0A 2CHWA 1EYHA 4GA1A 3HHMA 4CDRA 1N0QA 4FLHA 2X6JA 1XNFA 3F6QA 2J07A 1ELRA 2EILE 2ILRA 2EIME 3RAUA 3PS6A 4L9PA 3R7QA 3HYMB 2V5QC 1JUQA 5CCLA 4JA9A 2WQ6A 2R59A 2VJ8A 5ENRD 4N39A 4QFVA 5LOZA 3D9MA 4J6IA 3EHQA 4N5CA 1K3ZD 4EZJA 3B7RL 3NF1A 4J8SA 1AWCB 3T5VA 1HX8A 4U07A 4Q69A 1WG0A 3ASHA 4I6JA 2RG8A 5CERB 3ZIMA 1OWOA 2WXPA 4NACA 2M63A 3RSEG 2HO1A 1MX4A 5FWQA 4BT8A 2XGOA 4AEZC 2DCPA 2GROB 4BTBA 2J4DA 2XS8A 4C48B 4O60A 3B95A 3ZXPA 1WM5A 3PDNA 1FVFA 3E34A 1EPUA 3FU6A 3ABME 4HRNA 5ENTD 2ETCA 3AG2E 2DZOA 2A5EA 2X6HA 2CHXA 4E85A 5T8IA 3RJVA 2F8YA 2I1KA 2OCCE 4KXKB 4K5CA 3GZ1A 2LNIA 2AXZA 4CDMA 5KBAA 3QOUA 4DX7D 2J4BA 2NC9A 3KSQA 3FEYA 3UIOC 5G05J 1FVHA 1SQMA 2CG3A 5LFAA 4I2ZA 3CKBA 1Y8MA 2IOLA 3QDNA 2WXGA 2ZGGA 3DSTA 3CVLA 3C5RA 2DYSE 2NYJA 5G04C 2UWJG 2L6JA 2GRRB 4CYMD 3HIZA 3ZXSA 1H19A 5HS0A 3FUEA 3MJWA 2EINE 3G2UA 2CFZA 2I6HA 4APFA 1UW4B 4AVXA 3KS2A 3ONKA 3C98A 3SBSA 2VQ2A 5FQ8A 4FJZA 3JXJA 4EZKA 2VGXB 4GTTA 3DXKG 1TEZA 4XE0A 1OCRE 1Y6IA 3NZSA 3QC1A 3D9OA 1OWPA 2RFAA 5EN5D 5JJ7A 2Y4TA 3B7TA 3T8KA 2P58C 1S63A 2I9CA 3DRAA 3TXMA 5AYWD 2X6IA 2V0PA 3OXFA 1JWGA 3ISMC 3L08A 4LRZA 3DSSA 4DX6D 3UT7A 5B1BE 2KBXA 5FQ7A 1PC2A 3X2QE 3SO8A 1WY6A 2KCVA 2MOWA 3URZA 4JL0A 1N54A 3PE3A
chains in the Genus database with same CATH topology
3CEQA 2Q7FA 5C2YA 1TJFA 4IN3B 3RU0A 3LYAA 1Z6TA 4N2QA 4ILIA 3BG1B 3SNXA 5CHEE 1E8ZA 4ANXA 1IYGA 1QZ2A 4W9RA 5EX0A 2VTBA 4J8EA 4XZ4A 2C0LA 3NZUA 4AY5A 2WM9A 3SFZA 2FULA 2C2LA 2AWIA 3QWPA 3D9PA 3LY9A 4J0UA 4RG9A 4I1AA 4B8CB 1HG2A 3AU4A 1A17A 2I1JA 5FZRA 4WNEA 4JHKA 2E0IA 3O48A 3QK0A 3FUKA 5ANRA 3U9WA 3CVPA 4G1TA 4XI0A 4KZCA 2AXVA 5FZSA 3SHFA 4EECA 3CVWA 1QQEA 1S0PA 4C0EA 5EX3A 3AS5A 1UG3A 4FU3A 4EBAG 4B89A 4CRWA 3ZGQA 5BV0A 4AIFA 2XCCA 2IJGX 1HFAA 3L6AA 4DI3A 3LKUA 2KC7A 3SF4A 1BPOA 3IEGA 3MYVA 1IQRA 2MHKA 4N3BA 3PEVB 4XX5A 2AXUA 1HE8A 2WXNA 4XKCA 4L7TA 5AJDA 4I2WA 3LCAA 2UY1B 2BF0X 2XRYA 4GA2A 3BG0B 3ESKA 3ZYQA 4HFGA 2KZTB 1Z3YA 4BX8A 3CVNA 3VTXA 1OWNA 5D0QD 3FULA 3WXXA 4LCTA 3PUJA 4WNDA 4F3VA 3Q49B 5FT9A 2IQCA 1E8XA 5FQ6A 4MLPA 4NQ0A 3G2VA 5AJLA 3D9KA 4XIFA 3RRMB 4A1GA 3CHRA 3ONLA 3APFA 1UN8A 3R7RA 2IF4A 3JCKC 1E90A 3FDHA 2AVPA 4GYOA 4B0ZA 4U63A 3FU0A 4DLOA 2WMOA 2J49A 3GYZA 3SGHA 3B7UX 2V4LA 2PL2A 1YA0A 4JC8A 1HH8A 2DIWA 5EDSA 2VGXA 3DPDA 4HOSA 2XEVA 2VSOE 2V8SE 3FTWA 3IHVA 3MV2B 4U8HA 3D9JA 4KVMA 3FH5A 4J8DA 3ZEFA 3FUFA 4AXHA 3Q47B 4KMOA 3VLDA 3MEKA 2PM7A 4RG6A 1H2VC 1OUVA 3FUJA 3ZYLA 3E4BA 4KZ0A 4G11A 2WXQA 3OAWA 5KJKA 2J08A 3CHSA 3MCXA 3S7DA 3S7BA 1ELWA 3ML8A 1VDYA 4GU5A 4I9EA 4RSYA 3S7FA 1GW6A 3LPZA 3PH0C 4DJAA 1LF8A 4MS6A 4FC8A 4WNGA 5KJLA 3CR3A 3L22A 3DBSA 5FTPA 3ZPJA 5CCMA 5M72A 4EZLA 2LSVA 2Y3AA 5G2NA 5DIZA 4R7LA 2MRIA 4NURA 2ZU6B 2XHEA 1E8YA 1KLXA 1L5JA 3APDA 4BWRA 4WAFA 1E7UA 2L9BA 2YINA 5A6CA 4JW1A 3FU5A 3TL5A 3OTNA 3FTXA 2OVFA 1JWFA 5LCWJ 3AS4A 1NZNA 3I5PA 1U3CA 3P1UA 4N3AA 4L2YA 4BY6A 3VTYA 4BFRA 2XCBA 4TRQA 1INZA 4GCOA 5LCWC 3ZN3A 4HLEA 5G05C 3LXUX 4JEHA 2VSNA 3FWVA 1ZBPA 4UWGA 4H7YA 1UN9A 4FJYA 4GAAA 4JEUA 3I3NA 3CQGB 3JQ1A 4WWNA 5ARFA 3OXLA 4G2VA 4UWFA 4GZ5A 4HXIA 4BT9A 4A1SA 3FP3A 2A4ZA 4AP2A 1XGWA 2UY1A 5C1DA 3QJZA 3ASFA 3CKCA 4KT6B 2I2OA 5ARGA 4N3CA 4TUUA 4I6EA 4UQYA 4GPKA 2BUGA 3EHMA 4PDXA 3FTYA 4JVSA 3D3MA 1PAQA 3RKVA 3ZHEA 5J08A 3UT8A 1NP7A 4AV7A 2WXOA 1NA3A 2KZTA 3QWWA 1P5QA 4AJWA 3TG5A 2DBAA 3SD5A 3MZLB 3UUXA 5BPPA 2FBNA 3B7SA 4EQFA 4GMJA 4PS8A 2WQHA 3N71A 2JLBA 4GZ3A 2YNQA 2FI7A 2PM6A 3MGBA 4CT0A 2CHWA 1EYHA 3ASDA 3HHMA 3P2BA 4GA1A 3CHPA 4NRHB 4CDRA 3CVVA 4JHRA 3EHNA 4G24A 4KYOB 4FLHA 2X6JA 2GRLA 2XRZA 1PY1A 2HR2A 3FUMA 1XNFA 5KJNA 2J07A 1N52A 1ELRA 4DPRA 2ILRA 3Q15A 3TAXA 3U66A 4U04A 3UPVA 3Q5MA 4MRUA 3PS6A 4HS2A 2YHCA 4A3VA 4K0RA 3R7QA 3ZHEB 3FTSA 3HYMB 4YNDA 3FTVA 4UWLA 2KATA 1EDUA 2WXFA 4B8AA 3CHQA 5G04J 2WB2A 1JUQA 3FH7A 5CCLA 4A55A 5HQ8A 3FTUA 4K03A 2WMNA 5T3RA 4JA9A 5E75A 3LY8A 4FADA 4DLQA 2WQ6A 1NA0A 2R59A 2VJ8A 1OWLA 2FO7A 4UI9J 4CDNA 4TV3A 3ZW3A 4CEMA 4N39A 4QFVA 5LOZA 5J90A 2WQ7A 2FF4A 2GW1A 5BT1A 4V3IA 3D9MA 4J6IA 3EIJA 4A3TA 3EJNA 4I1OB 2OOEA 4L2LA 4CGVA 4IYPA 3KD7A 4ACLA 4N5CA 1EF1C 4I17A 3HVEB 3PE4A 4EZJA 4I1MA 3QKYA 1KT0A 1MHQA 3B7RL 3FUNA 1ZU2A 3CVQA 3NF1A 4J8SA 5D0OD 4YVQC 1E8WA 1W3BA 2OVBA 2BTDA 2XPZA 3CQCB 3LEWA 4CT4A 3ZRHA 4GCNA 1TJCA 1HX8A 4WNFA 3CGHA 4U07A 4UWHA 4Q69A 4L23A 3T5VA 3B13A 3ASHA 1MQSA 5BUZA 4I6JA 2NXPA 4E6HA 4UI9C 5ENNA 2CG2A 4JHJA 1QNFA 2PQRA 2RG8A 2R17C 1HS6A 4LEUA 4UI9K 3ZIMA 3GZ2A 1SZ9A 3PREA 4CCAA 1OWOA 4IRUA 4FLBA 4UQXA 4DK5A 4F1SA 2XGMA 5G55A 3CK8A 5DBKA 2WXPA 4NACA 2HM8A 2WPVA 3G2WA 3OXGA 3EIQC 4JZYA 2L0IA 2M63A 2WVIA 3IHYA 2HO1A 4GZ6A 5LX8A 2R5SA 2JEKA 4GZCA 3MA5A 4N2SA 5FWQA 4AM9A 2E2EA 3AS8A 4KVOA 4U0ZA 2XGOA 4BT8A 2GGFA 3PUKA 3CK9A 4AEZC 2DCPA 3O4ZA 3KEZA 3I4RB 3QAQA 4ILGA 4BTBA 2J4DA 5KCMA 2VSYA 3IKOB 4F7AA 1WM5A 2LO6A 5BW8C 4UWKA 3T5XA 3PDNA 3MV3B 1FVFA 2J9QA 1ELKA 3FEXA 1EPUA 3L13A 2KM4A 5JHBA 4HOUA 2HYZA 1HZ4A 1IHGA 2XPIA 4G25A 4D10C 3AU5A 3FU6A 3QARA 4EBAA 4PS7A 4LUNU 3VLEA 3FHEA 1HG5A 4GB9A 4PUCA 2CHZA 4Y6WA 3FUDA 1IQUA 2XGSA 4I43A 4JA7A 3MKRA 4FHJA 3ULQA 3L54A 3JYSA 2X6KA 2YHEA 3LVQE 2AW6A 3LY7A 5E76A 2C0MA 3PEUB 2WXKA 2X6HA 3KAEA 3UQ3A 2X38A 2IU1A 4IULA 1WAO1 2RD0A 4I9CA 2CHXA 4E85A 5T8IA 4G23A 3QB2A 3S7JA 5LP0A 3CVYA 4WUYA 2WXJA 4OVUA 3UT4A 4EPZA 4KBQA 4FP7A 3RJVA 4ANWA 1X5BA 2WXLA 3RRNB 3K9IA 3TXNA 3QNKA 3EDTB 2LAIA 3FH8A 4XI9A 2I1KA 3CVXA 4DI4A 3SBTB 1HU3A 4KXKB 3GZ1A 2WXHA 2LNIA 4RVBA 4ABNA 3ZFWA 3FUIA 5ANLA 3I4GA 4WWPA 2AXZA 4GYYA 3L16A 4CDMA 3IV0A 3QOUA 5A23A 1U3DA 4F53A 3LDZA 4FULA 2J4BA 4PS3A 5JJ6A 1Z3XA 2NC9A 5FQ4A 1HF8A 2VSXE 3FEYA 2NSZA 3UX4A 5G05J 4HOQA 1FVHA 3BEEA 1SQMA 3SI5A 4LERA 1H6KA 3T8MA 3HVEA 2CG3A 5LFAA 3FTZA 4I2ZA 4MKTA 4ME2A 3ESLA 3CKBA 3JUIA 1Y8MA 4HOTA 4Y6CA 2YQ8A 4M3OA 4GYWA 4OVVA 4UQZA 4AY6A 4L1BA 2IOLA 3QDNA 2WXGA 4Q94A 3CVLA 5AIJA 4GZDA 5G04C 3RO3A 5AENA 2UWJG 3UMVA 4B94A 1H2TC 3ZVVA 5HI7A 2A5UA 3LJ3A 4U0SA 2L6JA 4FA6A 4ATGA 4FHKA 3CVUA 5FJYA 3U64A 4OYSA 3GW4A 2QY7A 2WXMA 3HDXA 3HIZA 3ZXSA 1H19A 5T4YA 3GZSA 2IFUA 3FUEA 3MJWA 4Q96A 2J09A 4HORA 3FY4A 4U0UA 3CIAA 2L0TB 3QWVA 4YVOA 2ONDA 4BTAA 3FUHA 3VLFA 3U4TA 1UJKA 3G2UA 3G2SA 2PQNA 2CFZA 3S2AA 3TJPA 2I6HA 3RK6A 2GRMA 2EQXA 2VGYA 4APFA 1UW4B 3ASGA 3PNTB 3FU3A 4AVXA 1H2UA 5BV1A 2CFUA 4JPSA 4BX9A 3KS2A 3MKQB 3ONKA 2LSUA 3C98A 3SBSA 2VQ2A 3RRUA 4URKA 5FQ8A 3PZDA 4FJZA 3CSTA 4ANVA 3L17A 4CGWA 5FZQA 3CK7A 3RO2A 1OWMA 3TG4A 4EZKA 2VGXB 2IONA 4I6GA 1FCHA 3CV0A 1DVPA 2XPYA 4GA0A 3IBEA 3ZYMA 2LAHA 2FEZA 2IOSA 2XQ0A 2QFCA 3D9IA 1JPLA 1HO8A 3FFLA 1TEZA 4XE0A 3U3WA 3NZSA 1Y6IA 4P29A 3ZYKA 1DNPA 3QC1A 4XKBA 5KJMA 4C9BB 1E96B 4H7XA 3D9OA 1OWPA 5JJ7A 4APOA 2Y4TA 2X6FA 3D9NA 3B7TA 2X3MA 3R9AB 2KCLA 2V5FA 2Y4UA 3JQ0A 2KCKA 2P58C 4J8FA 2I9CA 4ILHB 4WWOA 3MKQA 5BNWA 2OV8A 1H0AA 5EKQD 5AYWD 3Q4AB 3TXMA 2X6IA 2V0PA 2WXRA 1JWGA 3OXFA 2WXIA 3NQPA 5JJTA 4ANUA 3SZ7A 3L08A 1UJJA 2PZIA 4LRZA 4C0MA 2VTBB 4GMLA 1SZAA 3RIBA 1KT1A 2VYIA 3LVRE 3UT7A 4PH4B 1HXIA 3PNLB 1E7VA 5JHAA 3ML9A 3D9LA 5CMYA 5FQ7A 5A7DB 1B89A 3MX3A 4HVBA 1PC2A 4BSXA 3CLJA 4O6FA 4AOFA 4G26A 3APCA 3ENEA 1WY6A 2KCVA 2MOWA 3URZA 5CMWA 3PRZA 4JL0A 4ACKA 3TGOA 3CSFA 3LS8A 1N54A 4JXTA 3CHOA 3G2TA 3CHMA 3PVLA 3PE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ATG A; 
#chains in the Genus database with same CATH topology
 5ITZ F;  1OCO E;  1TJF A;  4IN3 B;  4U8V D;  3PZ2 A;  1E8Z A;  1IYG A;  1QZ2 A;  4J8Y A;  1BD8 A;  4XZ4 A;  3NZU A;  2WM9 A;  3QWP A;  4NIK A;  5ENQ D;  4WNE A;  4JHK A;  3O48 A;  1YCS B;  3CVP A;  5FZS A;  2AXV A;  4EEC A;  1QQE A;  3AS5 A;  3TWU A;  4CRW A;  5HKP A;  2XCC A;  2IJG X;  4B93 B;  3SF4 A;  1BPO A;  1TNY A;  3MYV A;  2MHK A;  3Q7F A;  4N3B A;  3PEV B;  3IXE A;  4L7T A;  4GA2 A;  3ESK A;  4BX8 A;  3CVN A;  3PUJ A;  3UM1 A;  3LJN A;  5AJL A;  3D9K A;  4XIF A;  3SY2 A;  2XZD G;  3B7B A;  3R7R A;  5CED B;  2AVP A;  1V55 E;  2P9I G;  1H6O A;  3DPD A;  2XEV A;  3MV2 B;  3ZEF A;  3MEK A;  2QYU A;  1OUV A;  4G11 A;  2IO3 C;  2J08 A;  3CHS A;  1LD8 A;  4U96 D;  4DJA A;  4FC8 A;  5KJL A;  5B3S E;  1RZ4 A;  3KSL A;  2JAB A;  5G2N A;  5DIZ A;  4R7L A;  3TWW A;  4NUR A;  2ZU6 B;  4BWR A;  5A6C A;  3TL5 A;  3OTN A;  3DSW A;  3FTX A;  4BES A;  3HXF A;  5LCW C;  4HLE A;  2VSN A;  4RLY A;  4GAA A;  3UM0 A;  4G2V A;  3KEA A;  2UY1 A;  3CKC A;  5KWD A;  1TN7 A;  1WDY A;  4TUU A;  4UQY A;  3ZHE A;  1A5E A;  1NP7 A;  4AJW A;  2DBA A;  5IY5 E;  4HRL A;  2WQH A;  3N71 A;  1OT8 A;  3CVV A;  4JHR A;  4G24 A;  3L9T A;  2GRP B;  1MX6 A;  2GRL A;  1PY1 A;  2XEE A;  4QQI A;  3UPV A;  4MRU A;  3ASO E;  5ENP D;  3FTV A;  2P9K G;  1EDU A;  4B8A A;  3CHQ A;  5G04 J;  2H6F A;  5T3R A;  2P9L G;  3Q7A A;  5E75 A;  2MYO A;  4HBD A;  2FO7 A;  4CDN A;  5CBO A;  4F1P A;  5J90 A;  2WQ7 A;  4I1O B;  4CGV A;  3KD7 A;  4ACL A;  1UOH A;  4HRM B;  1EF1 C;  4I17 A;  3PE4 A;  1KT0 A;  4YVQ C;  2AJA A;  1ZU2 A;  5D0O D;  2BTD A;  4GCN A;  1BI8 B;  4WNF A;  3EUV A;  4E6H A;  4UI9 K;  2R17 C;  1HS6 A;  1MZC A;  3GZ2 A;  3PRE A;  4UQX A;  5G55 A;  3G2W A;  3OXG A;  2L0I A;  3IHY A;  4GZ6 A;  2R5S A;  4GZC A;  4N2S A;  3TWQ A;  4AM9 A;  2P9P G;  2GGF A;  3PUK A;  3CK9 A;  3QAQ A;  2QC9 A;  3ULE G;  5BW8 C;  2EIK E;  4UWK A;  3T5X A;  4ATZ D;  1AP7 A;  5JHB A;  3TWT A;  4EBA A;  4LUN U;  3VLE A;  3V31 A;  4PUC A;  2CHZ A;  4Y6W A;  3FUD A;  3BUA A;  4CZ2 D;  3ULQ A;  3PZ4 A;  3L54 A;  3JYS A;  3NAW A;  3LY7 A;  1LD7 A;  3UQ3 A;  4IUL A;  4LG6 A;  4G23 A;  3S7J A;  3W9F A;  4WUY A;  2WXJ A;  4OVU A;  3UT4 A;  1X5B A;  2WXL A;  3C3O A;  3K9I A;  2P9S G;  2P9U G;  3FH8 A;  5FIO A;  4DI4 A;  3SBT B;  2BED A;  1TNU A;  5AQB A;  3ZFW A;  3I4G A;  3L16 A;  3IV0 A;  2ZXW E;  3LDZ A;  4U95 D;  3UM3 A;  5JJ6 A;  2NSZ A;  3BEE A;  4LNG A;  3T8M A;  1H6K A;  4HOT A;  2YQ8 A;  4GYW A;  4AY6 A;  1O1S A;  2Y1L E;  4J7W A;  3RO3 A;  5AEN A;  4B94 A;  2A5U A;  3NOC D;  4K5A B;  4ATG A;  1KPS B;  2QY7 A;  2PNN A;  3HXB A;  1KZP A;  4Q96 A;  2J09 A;  5EYP F;  3CIA A;  4YVO A;  4BTA A;  3U4T A;  2PQN A;  1NL4 A;  1FT1 A;  2GRM A;  3PNT B;  4U8Y D;  2HE0 A;  3Q9N C;  1H2U A;  5BV1 A;  4BX9 A;  5KNG A;  3RRU A;  3L17 A;  4CGW A;  2XEN A;  3RO2 A;  4GA0 A;  3IBE A;  3ZYM A;  3J5Q B;  2LAH A;  2FEZ A;  2XQ0 A;  2QFC A;  1HO8 A;  4H7X A;  4APO A;  4DX5 D;  1V54 E;  1O5M A;  2KCL A;  3UKU G;  2KCK A;  4J8F A;  1H0A A;  3NQP A;  2PZI A;  4GML A;  3RIB A;  3NBN B;  3LVR E;  4JB8 P;  3D9L A;  4HVB A;  3MX3 A;  4ACK A;  4JXT A;  3CHM A;  1K1B A;  3AG4 E;  3RU0 A;  1Z6T A;  3SNX A;  4ANX A;  4W9R A;  4GTQ A;  2VTB A;  4Z68 A;  3AAA C;  5EIL A;  3LY9 A;  4J0U A;  4LNB A;  1MYO A;  1A17 A;  3ASN E;  2E0I A;  3QK0 A;  3FUK A;  5ANR A;  4XI0 A;  4C0E A;  1UG3 A;  4A63 B;  4AIF A;  3L6A A;  2ZGD A;  2GRQ B;  2BKK B;  1SA5 A;  1G3N B;  2AXU A;  1HE8 A;  4XKC A;  4I2W A;  3AG1 E;  3ABK E;  5H7P A;  3ZYQ A;  1Z3Y A;  3VTX A;  1OWN A;  5D0Q D;  4F3V A;  4WND A;  1E8X A;  3WG7 E;  5FQ6 A;  4MLP A;  3RRM B;  1N4R A;  4A1G A;  3CHR A;  3ONL A;  3APF A;  3E33 A;  4GYO A;  4U63 A;  2F8X K;  3DXM G;  2WMO A;  1YMP A;  1YA0 A;  1HH8 A;  2DIW A;  2IO2 C;  4HOS A;  2VSO E;  2V8S E;  3IHV A;  4KVM A;  4MBG A;  2QZA A;  4EHM A;  1H2V C;  3E4B A;  2WXQ A;  3MCX A;  1ELW A;  3ML8 A;  3S7F A;  1GW6 A;  3LPZ A;  3PH0 C;  3DEO A;  4MS6 A;  3L22 A;  3UIP C;  5FTP A;  2LUH A;  3BU8 A;  2Y3A A;  1Q2Z A;  3DWL G;  1BI7 B;  1E8Y A;  2L9B A;  2OVF A;  3AS4 A;  4N3A A;  3VTY A;  4BFR A;  2XCB A;  4GCO A;  3DPY A;  3ZN3 A;  4JD2 G;  4JEH A;  4UWG A;  4M7C A;  5ARF A;  3OXL A;  2A4Z A;  3QJZ A;  3HXC A;  4GPK A;  3EHM A;  5B1A E;  3FTY A;  1IKN D;  1BU9 A;  1PAQ A;  3RKV A;  5J08 A;  1NA3 A;  4O1O A;  1P5Q A;  2LXM A;  5FIN A;  5BPP A;  3B7S A;  4GMJ A;  4BSZ B;  4GZ3 A;  2PM6 A;  3NOG D;  2ETB A;  2R02 A;  3EHN A;  4KYO B;  2XRZ A;  5KJN A;  2XZT G;  1N52 A;  4DPR A;  3U66 A;  4U04 A;  3Q5M A;  2YHC A;  4K0R A;  1YYH A;  3DEP A;  3FTS A;  4YDE A;  3ZHE B;  4YND A;  4UWL A;  2WB2 A;  3FH7 A;  4A55 A;  5HQ8 A;  4HB5 A;  1O1T A;  1TYQ G;  1FPP A;  1N0R A;  3LY8 A;  3SFX A;  4FAD A;  4DLQ A;  5CEC B;  3UKR G;  2R2L A;  4UI9 J;  2IY0 C;  4CEM A;  2GW1 A;  3EIJ A;  4A3T A;  3EJN A;  2OOE A;  3EHR A;  4L2L A;  2F37 A;  3HVE B;  4I1M A;  3QKY A;  2R05 A;  3CVQ A;  1OY3 D;  1E8W A;  4CT4 A;  3SQV A;  1TJC A;  3CGH A;  4GTM A;  3UTM A;  3C72 A;  4X8Q A;  4UI9 C;  5ENN A;  4JHJ A;  1QNF A;  2PQR A;  1SZ9 A;  4DK5 A;  1BLX B;  3CK8 A;  5DBK A;  3EIQ C;  4JZY A;  2WVI A;  5LX8 A;  2E2E A;  1QYM A;  2DVW A;  3I4R B;  3IKO B;  2P2C P;  4F7A A;  2VGE A;  5D2M C;  3FEX A;  3JXI A;  3EU5 A;  4HOU A;  1HZ4 A;  1IHG A;  2XPI A;  4PS7 A;  5D66 A;  3FHE A;  4GB9 A;  1IQU A;  2KXP C;  3LVQ E;  5E76 A;  1TNB A;  2IU1 A;  1WAO 1;  2RD0 A;  3QB2 A;  5LP0 A;  3CVY A;  4EPZ A;  3HXD A;  4ANW A;  2OEV A;  3RRN B;  2LAI A;  1N11 A;  4BET A;  3CVX A;  4DRX E;  4RVB A;  3FUI A;  5ANL A;  4WWP A;  1TR4 A;  4F53 A;  4FUL A;  3T9K A;  4PS3 A;  1Z3X A;  5FQ4 A;  4HOQ A;  5CRV A;  3Q73 A;  2RFM A;  3FTZ A;  4DUI A;  4ME2 A;  3ESL A;  4GTO A;  4M3O A;  4OVV A;  4UQZ A;  4RQI A;  4GZD A;  1H2T C;  5HI7 A;  3LJ3 A;  4U0S A;  3BQO A;  3V2X A;  3CVU A;  2ZIR A;  4OYS A;  3GW4 A;  2WXM A;  3W9G A;  3GZS A;  1N9A A;  2IFU A;  3TWV A;  4HOR A;  2L0T B;  4TUM A;  1KZO A;  1UJK A;  3G2S A;  4GTV A;  3TJP A;  2H6G A;  2VGY A;  3ASG A;  3TWX A;  4U7E B;  2LSU A;  4URK A;  3CST A;  4ANV A;  2XEH A;  5FZQ A;  3CK7 A;  1OWM A;  1FCH A;  3CV0 A;  3PZ1 A;  3D9I A;  3FFL A;  3U3W A;  4P29 A;  5KJM A;  1Z5S C;  4K5B A;  2X3M A;  3R9A B;  2V5F A;  2Y4U A;  3PZ3 A;  2L6B A;  5EKQ D;  2WXR A;  5JJT A;  1SW6 A;  1UJJ A;  4BEP A;  4C0M A;  1SZA A;  1KT1 A;  3SFY A;  4PH4 B;  1HXI A;  4DX2 A;  1N95 A;  1OCC E;  5CMY A;  5A7D B;  1B89 A;  4BSX A;  4AOF A;  4G26 A;  3ENE A;  2Y0B G;  3PRZ A;  3TGO A;  3CSF A;  1TNO A;  5C2Y A;  3LYA A;  1MJ0 A;  2H6I A;  5CHE E;  3UI2 A;  5EX0 A;  4ZHB A;  4J8E A;  2C0L A;  2C2L A;  3D9P A;  1OXJ A;  1SVX A;  4RG9 A;  4B8C B;  4GTR A;  3AU4 A;  2ZIS A;  3U9W A;  4G1T A;  5EX3 A;  4FU3 A;  4B89 A;  5BV0 A;  2KC7 A;  1D9S A;  2OEW A;  3IEG A;  4XX5 A;  2J8S D;  2WXN A;  5AJD A;  2UY1 B;  2BF0 X;  3BG0 B;  3C3Q A;  4HFG A;  2KZT B;  3DSX A;  5AAR A;  3WXX A;  4LCT A;  3Q49 B;  2IQC A;  1H6P A;  3UIN C;  4NQ0 A;  3G2V A;  4YDO A;  4TXP A;  2IF4 A;  1E90 A;  3FDH A;  4B0Z A;  2R03 A;  5ENS D;  4DLO A;  3GYZ A;  2J49 A;  3SGH A;  3B7U X;  2PL2 A;  2VGX A;  3FTW A;  3D9J A;  3FH5 A;  4J8D A;  3AG3 E;  3TWR A;  3FUF A;  1TNZ A;  4AXH A;  4KMO A;  3VLD A;  3Q9U C;  3ZYL A;  3ULY A;  1NFI E;  1U2V G;  3OAW A;  1N4Q A;  3S7D A;  3S7B A;  1VDY A;  2GRN B;  4WNG A;  3CR3 A;  2QYJ A;  3ZPJ A;  5CCM A;  4EZL A;  2LSV A;  2XS1 A;  5ENO D;  2XHE A;  5AAO A;  3APD A;  4WAF A;  2YIN A;  3FU5 A;  3I5P A;  5BXO A;  4L2Y A;  4BY6 A;  3V79 K;  4TRQ A;  1INZ A;  5G05 C;  3LXU X;  3FWV A;  1ZBP A;  4H7Y A;  1UN9 A;  4JEU A;  3JQ1 A;  1O1R A;  4UWF A;  4GZ5 A;  4HXI A;  4A1S A;  5C1D A;  5EID A;  5ARG A;  4XEI G;  3UT8 A;  4AV7 A;  2WXO A;  3J5P A;  3QWW A;  2EIJ E;  3UUX A;  3ZNG A;  4EQF A;  3ZKJ A;  2JLB A;  5AQ9 A;  2YNQ A;  3MGB A;  1X81 A;  4LSZ E;  3V2O A;  3ASD A;  3P2B A;  1K8K G;  3CHP A;  4HI8 A;  4NRH B;  4OAV B;  2HR2 A;  3FUM A;  4BER A;  3Q15 A;  3TAX A;  4YDY A;  1N4S A;  4HS2 A;  1S64 A;  3UXG A;  2ETA A;  4A3V A;  4G8L A;  5EYL A;  2IEJ A;  1LTX A;  2KAT A;  2WXF A;  5KNH D;  3FTU A;  4K03 A;  2WMN A;  4GTP A;  1NA0 A;  1OWL A;  3HRA A;  4TV3 A;  3ZW3 A;  2FF4 A;  5BT1 A;  4V3I A;  5AQA A;  4IYP A;  4UUC A;  2RKK A;  1MHQ A;  3FUN A;  4DX1 A;  1W3B A;  2OVB A;  2XPZ A;  3CQC B;  3LEW A;  3ZUV B;  3ZRH A;  2F0Y A;  4UWH A;  4L23 A;  3B13 A;  1JCQ A;  4LNU D;  1MQS A;  2BKG A;  5BUZ A;  5CRU A;  2NXP A;  2CG2 A;  3EU9 A;  4LEU A;  4CCA A;  4IRU A;  4FLB A;  4F1S A;  2XGM A;  2HM8 A;  2WPV A;  4HNA D;  2P9N G;  2JEK A;  3MA5 A;  3AS8 A;  4KVO A;  4U0Z A;  3O4Z A;  3KEZ A;  4ILG A;  5KCM A;  2VSY A;  2FO1 E;  4GPM A;  3ZU7 B;  2LO6 A;  3MV3 B;  2J9Q A;  1ELK A;  3L13 A;  2KM4 A;  1N4P A;  2HYZ A;  3NB2 A;  3D9H A;  4D10 C;  4G25 A;  3AU5 A;  3QAR A;  1HG5 A;  5CEA A;  2XGS A;  4I43 A;  4JA7 A;  3MKR A;  4FHJ A;  2X6K A;  5JA4 D;  2YHE A;  2AW6 A;  2C0M A;  3PEU B;  2WXK A;  3KAE A;  2X38 A;  4HI9 A;  4I9C A;  1D8D A;  1RW2 A;  3E30 A;  4KBQ A;  4FP7 A;  3C3R A;  3TXN A;  3QNK A;  3EDT B;  4XI9 A;  1QBQ A;  2WXH A;  4ABN A;  4GTS A;  4GYY A;  5A23 A;  1U3D A;  5JMN D;  1HF8 A;  2VSX E;  3UX4 A;  3SI5 A;  4GMR A;  4LER A;  3HVE A;  2V4H C;  4MKT A;  3JUI A;  4Y6C A;  1NI1 A;  1S70 B;  4L1B A;  2Y69 E;  4Q94 A;  5AIJ A;  3UMV A;  5AQ7 A;  3ZVV A;  4FA6 A;  4FHK A;  1MX2 A;  5FJY A;  3U64 A;  3HDX A;  3JUE A;  5T4Y A;  3FY4 A;  3TWS A;  4U0U A;  3E37 A;  4ZFH A;  5EIB E;  3QWV A;  2OND A;  3FUH A;  3VLF A;  3S2A A;  3RK6 A;  2EQX A;  3FU3 A;  2CFU A;  4JPS A;  1TN8 A;  3MKQ B;  4F6R D;  3PZD A;  1SA4 A;  3TG4 A;  4I6G A;  2ION A;  4TXR A;  1DVP A;  2XPY A;  2IOS A;  1JPL A;  3ZYK A;  1DNP A;  2B0O E;  4XKB A;  4C9B B;  1E96 B;  3UM2 A;  2X6F A;  3D9N A;  4G8K A;  3DSU A;  3JQ0 A;  4WWO A;  4ILH B;  5BNW A;  1N94 A;  3MKQ A;  2OV8 A;  5HRY A;  3Q4A B;  2WXI A;  4ANU A;  3SZ7 A;  2VTB B;  3DSV A;  2VYI A;  3PNL B;  5JHA A;  1E7V A;  3ML9 A;  1IHB A;  3CLJ A;  4O6F A;  3APC A;  1OCZ E;  5CMW A;  3V30 A;  3LS8 A;  3CHO A;  1IXV A;  3G2T A;  1HU3 A;  4TXQ A;  3PVL A;  3CEQ A;  2Q7F A;  4N2Q A;  4ILI A;  2DZN A;  3BG1 B;  5AN8 A;  4AY5 A;  3ABL E;  2LXL A;  3SFZ A;  2FUL A;  2AWI A;  4I1A A;  1HG2 A;  1JCR A;  2I1J A;  5FZR A;  4KZC A;  3SHF A;  3CVW A;  1S0P A;  4EBA G;  3ZGQ A;  3AJI A;  1HFA A;  3Q79 A;  4DI3 A;  3LKU A;  1IQR A;  1ZB1 A;  1FT2 A;  3HG0 D;  3LCA A;  2XRY A;  4HLL A;  2B6C A;  3FUL A;  5FT9 A;  4O1P A;  1DCQ A;  1UN8 A;  3JCK C;  3FU0 A;  4YDW A;  2V4L A;  4JC8 A;  5EDS A;  4U8H A;  3Q47 B;  2PM7 A;  4RG6 A;  1DCE A;  3FUJ A;  4KZ0 A;  1DC2 A;  3R9M A;  5KJK A;  1D8E A;  4GU5 A;  4I9E A;  4RSY A;  1LF8 A;  3DBS A;  3HXE A;  5M72 A;  3L82 A;  2MRI A;  5BXU A;  1KLX A;  1L5J A;  1E7U A;  4JW1 A;  4N5Q A;  1JWF A;  5LCW J;  1NZN A;  1JCS A;  1U3C A;  3P1U A;  1K1A A;  4OAU C;  5CBN A;  4FJY A;  2DYR E;  3I3N A;  3CQG B;  4HQD A;  4WWN A;  4BT9 A;  3FP3 A;  4AP2 A;  1XGW A;  3ASF A;  4KT6 B;  2I2O A;  3E32 A;  4N3C A;  3Q75 A;  4I6E A;  2BUG A;  2H6H A;  4PDX A;  4JVS A;  3D3M A;  3Q78 A;  2DWZ A;  2KZT A;  3TG5 A;  1TN6 A;  3SD5 A;  3MZL B;  2FBN A;  4PS8 A;  2FI7 A;  4CT0 A;  2CHW A;  1EYH A;  4GA1 A;  3HHM A;  4CDR A;  1N0Q A;  4FLH A;  2X6J A;  1XNF A;  3F6Q A;  2J07 A;  1ELR A;  2EIL E;  2ILR A;  2EIM E;  3RAU A;  3PS6 A;  4L9P A;  3R7Q A;  3HYM B;  2V5Q C;  1JUQ A;  5CCL A;  4JA9 A;  2WQ6 A;  2R59 A;  2VJ8 A;  5ENR D;  4N39 A;  4QFV A;  5LOZ A;  3D9M A;  4J6I A;  3EHQ A;  4N5C A;  1K3Z D;  4EZJ A;  3B7R L;  3NF1 A;  4J8S A;  1AWC B;  3T5V A;  1HX8 A;  4U07 A;  4Q69 A;  1WG0 A;  3ASH A;  4I6J A;  2RG8 A;  5CER B;  3ZIM A;  1OWO A;  2WXP A;  4NAC A;  2M63 A;  3RSE G;  2HO1 A;  1MX4 A;  5FWQ A;  4BT8 A;  2XGO A;  4AEZ C;  2DCP A;  2GRO B;  4BTB A;  2J4D A;  2XS8 A;  4C48 B;  4O60 A;  3B95 A;  3ZXP A;  1WM5 A;  3PDN A;  1FVF A;  3E34 A;  1EPU A;  3FU6 A;  3ABM E;  4HRN A;  5ENT D;  2ETC A;  3AG2 E;  2DZO A;  2A5E A;  2X6H A;  2CHX A;  4E85 A;  5T8I A;  3RJV A;  2F8Y A;  2I1K A;  2OCC E;  4KXK B;  4K5C A;  3GZ1 A;  2LNI A;  2AXZ A;  4CDM A;  5KBA A;  3QOU A;  4DX7 D;  2J4B A;  2NC9 A;  3KSQ A;  3FEY A;  3UIO C;  5G05 J;  1FVH A;  1SQM A;  2CG3 A;  5LFA A;  4I2Z A;  3CKB A;  1Y8M A;  2IOL A;  3QDN A;  2WXG A;  2ZGG A;  3DST A;  3CVL A;  3C5R A;  2DYS E;  2NYJ A;  5G04 C;  2UWJ G;  2L6J A;  2GRR B;  4CYM D;  3HIZ A;  3ZXS A;  1H19 A;  5HS0 A;  3FUE A;  3MJW A;  2EIN E;  3G2U A;  2CFZ A;  2I6H A;  4APF A;  1UW4 B;  4AVX A;  3KS2 A;  3ONK A;  3C98 A;  3SBS A;  2VQ2 A;  5FQ8 A;  4FJZ A;  3JXJ A;  4EZK A;  2VGX B;  4GTT A;  3DXK G;  1TEZ A;  4XE0 A;  1OCR E;  1Y6I A;  3NZS A;  3QC1 A;  3D9O A;  1OWP A;  2RFA A;  5EN5 D;  5JJ7 A;  2Y4T A;  3B7T A;  3T8K A;  2P58 C;  1S63 A;  2I9C A;  3DRA A;  3TXM A;  5AYW D;  2X6I A;  2V0P A;  3OXF A;  1JWG A;  3ISM C;  3L08 A;  4LRZ A;  3DSS A;  4DX6 D;  3UT7 A;  5B1B E;  2KBX A;  5FQ7 A;  1PC2 A;  3X2Q E;  3SO8 A;  1WY6 A;  2KCV A;  2MOW A;  3URZ A;  4JL0 A;  1N54 A;  3PE3 A; 
#chains in the Genus database with same CATH homology
 3CEQ A;  2Q7F A;  5C2Y A;  1TJF A;  4IN3 B;  3RU0 A;  3LYA A;  1Z6T A;  4N2Q A;  4ILI A;  3BG1 B;  3SNX A;  5CHE E;  1E8Z A;  4ANX A;  1IYG A;  1QZ2 A;  4W9R A;  5EX0 A;  2VTB A;  4J8E A;  4XZ4 A;  2C0L A;  3NZU A;  4AY5 A;  2WM9 A;  3SFZ A;  2FUL A;  2C2L A;  2AWI A;  3QWP A;  3D9P A;  3LY9 A;  4J0U A;  4RG9 A;  4I1A A;  4B8C B;  1HG2 A;  3AU4 A;  1A17 A;  2I1J A;  5FZR A;  4WNE A;  4JHK A;  2E0I A;  3O48 A;  3QK0 A;  3FUK A;  5ANR A;  3U9W A;  3CVP A;  4G1T A;  4XI0 A;  4KZC A;  2AXV A;  5FZS A;  3SHF A;  4EEC A;  3CVW A;  1QQE A;  1S0P A;  4C0E A;  5EX3 A;  3AS5 A;  1UG3 A;  4FU3 A;  4EBA G;  4B89 A;  4CRW A;  3ZGQ A;  5BV0 A;  4AIF A;  2XCC A;  2IJG X;  1HFA A;  3L6A A;  4DI3 A;  3LKU A;  2KC7 A;  3SF4 A;  1BPO A;  3IEG A;  3MYV A;  1IQR A;  2MHK A;  4N3B A;  3PEV B;  4XX5 A;  2AXU A;  1HE8 A;  2WXN A;  4XKC A;  4L7T A;  5AJD A;  4I2W A;  3LCA A;  2UY1 B;  2BF0 X;  2XRY A;  4GA2 A;  3BG0 B;  3ESK A;  3ZYQ A;  4HFG A;  2KZT B;  1Z3Y A;  4BX8 A;  3CVN A;  3VTX A;  1OWN A;  5D0Q D;  3FUL A;  3WXX A;  4LCT A;  3PUJ A;  4WND A;  4F3V A;  3Q49 B;  5FT9 A;  2IQC A;  1E8X A;  5FQ6 A;  4MLP A;  4NQ0 A;  3G2V A;  5AJL A;  3D9K A;  4XIF A;  3RRM B;  4A1G A;  3CHR A;  3ONL A;  3APF A;  1UN8 A;  3R7R A;  2IF4 A;  3JCK C;  1E90 A;  3FDH A;  2AVP A;  4GYO A;  4B0Z A;  4U63 A;  3FU0 A;  4DLO A;  2WMO A;  2J49 A;  3GYZ A;  3SGH A;  3B7U X;  2V4L A;  2PL2 A;  1YA0 A;  4JC8 A;  1HH8 A;  2DIW A;  5EDS A;  2VGX A;  3DPD A;  4HOS A;  2XEV A;  2VSO E;  2V8S E;  3FTW A;  3IHV A;  3MV2 B;  4U8H A;  3D9J A;  4KVM A;  3FH5 A;  4J8D A;  3ZEF A;  3FUF A;  4AXH A;  3Q47 B;  4KMO A;  3VLD A;  3MEK A;  2PM7 A;  4RG6 A;  1H2V C;  1OUV A;  3FUJ A;  3ZYL A;  3E4B A;  4KZ0 A;  4G11 A;  2WXQ A;  3OAW A;  5KJK A;  2J08 A;  3CHS A;  3MCX A;  3S7D A;  3S7B A;  1ELW A;  3ML8 A;  1VDY A;  4GU5 A;  4I9E A;  4RSY A;  3S7F A;  1GW6 A;  3LPZ A;  3PH0 C;  4DJA A;  1LF8 A;  4MS6 A;  4FC8 A;  4WNG A;  5KJL A;  3CR3 A;  3L22 A;  3DBS A;  5FTP A;  3ZPJ A;  5CCM A;  5M72 A;  4EZL A;  2LSV A;  2Y3A A;  5G2N A;  5DIZ A;  4R7L A;  2MRI A;  4NUR A;  2ZU6 B;  2XHE A;  1E8Y A;  1KLX A;  1L5J A;  3APD A;  4BWR A;  4WAF A;  1E7U A;  2L9B A;  2YIN A;  5A6C A;  4JW1 A;  3FU5 A;  3TL5 A;  3OTN A;  3FTX A;  2OVF A;  1JWF A;  5LCW J;  3AS4 A;  1NZN A;  3I5P A;  1U3C A;  3P1U A;  4N3A A;  4L2Y A;  4BY6 A;  3VTY A;  4BFR A;  2XCB A;  4TRQ A;  1INZ A;  4GCO A;  5LCW C;  3ZN3 A;  4HLE A;  5G05 C;  3LXU X;  4JEH A;  2VSN A;  3FWV A;  1ZBP A;  4UWG A;  4H7Y A;  1UN9 A;  4FJY A;  4GAA A;  4JEU A;  3I3N A;  3CQG B;  3JQ1 A;  4WWN A;  5ARF A;  3OXL A;  4G2V A;  4UWF A;  4GZ5 A;  4HXI A;  4BT9 A;  4A1S A;  3FP3 A;  2A4Z A;  4AP2 A;  1XGW A;  2UY1 A;  5C1D A;  3QJZ A;  3ASF A;  3CKC A;  4KT6 B;  2I2O A;  5ARG A;  4N3C A;  4TUU A;  4I6E A;  4UQY A;  4GPK A;  2BUG A;  3EHM A;  4PDX A;  3FTY A;  4JVS A;  3D3M A;  1PAQ A;  3RKV A;  3ZHE A;  5J08 A;  3UT8 A;  1NP7 A;  4AV7 A;  2WXO A;  1NA3 A;  2KZT A;  3QWW A;  1P5Q A;  4AJW A;  3TG5 A;  2DBA A;  3SD5 A;  3MZL B;  3UUX A;  5BPP A;  2FBN A;  3B7S A;  4EQF A;  4GMJ A;  4PS8 A;  2WQH A;  3N71 A;  2JLB A;  4GZ3 A;  2YNQ A;  2FI7 A;  2PM6 A;  3MGB A;  4CT0 A;  2CHW A;  1EYH A;  3ASD A;  3HHM A;  3P2B A;  4GA1 A;  3CHP A;  4NRH B;  4CDR A;  3CVV A;  4JHR A;  3EHN A;  4G24 A;  4KYO B;  4FLH A;  2X6J A;  2GRL A;  2XRZ A;  1PY1 A;  2HR2 A;  3FUM A;  1XNF A;  5KJN A;  2J07 A;  1N52 A;  1ELR A;  4DPR A;  2ILR A;  3Q15 A;  3TAX A;  3U66 A;  4U04 A;  3UPV A;  3Q5M A;  4MRU A;  3PS6 A;  4HS2 A;  2YHC A;  4A3V A;  4K0R A;  3R7Q A;  3ZHE B;  3FTS A;  3HYM B;  4YND A;  3FTV A;  4UWL A;  2KAT A;  1EDU A;  2WXF A;  4B8A A;  3CHQ A;  5G04 J;  2WB2 A;  1JUQ A;  3FH7 A;  5CCL A;  4A55 A;  5HQ8 A;  3FTU A;  4K03 A;  2WMN A;  5T3R A;  4JA9 A;  5E75 A;  3LY8 A;  4FAD A;  4DLQ A;  2WQ6 A;  1NA0 A;  2R59 A;  2VJ8 A;  1OWL A;  2FO7 A;  4UI9 J;  4CDN A;  4TV3 A;  3ZW3 A;  4CEM A;  4N39 A;  4QFV A;  5LOZ A;  5J90 A;  2WQ7 A;  2FF4 A;  2GW1 A;  5BT1 A;  4V3I A;  3D9M A;  4J6I A;  3EIJ A;  4A3T A;  3EJN A;  4I1O B;  2OOE A;  4L2L A;  4CGV A;  4IYP A;  3KD7 A;  4ACL A;  4N5C A;  1EF1 C;  4I17 A;  3HVE B;  3PE4 A;  4EZJ A;  4I1M A;  3QKY A;  1KT0 A;  1MHQ A;  3B7R L;  3FUN A;  1ZU2 A;  3CVQ A;  3NF1 A;  4J8S A;  5D0O D;  4YVQ C;  1E8W A;  1W3B A;  2OVB A;  2BTD A;  2XPZ A;  3CQC B;  3LEW A;  4CT4 A;  3ZRH A;  4GCN A;  1TJC A;  1HX8 A;  4WNF A;  3CGH A;  4U07 A;  4UWH A;  4Q69 A;  4L23 A;  3T5V A;  3B13 A;  3ASH A;  1MQS A;  5BUZ A;  4I6J A;  2NXP A;  4E6H A;  4UI9 C;  5ENN A;  2CG2 A;  4JHJ A;  1QNF A;  2PQR A;  2RG8 A;  2R17 C;  1HS6 A;  4LEU A;  4UI9 K;  3ZIM A;  3GZ2 A;  1SZ9 A;  3PRE A;  4CCA A;  1OWO A;  4IRU A;  4FLB A;  4UQX A;  4DK5 A;  4F1S A;  2XGM A;  5G55 A;  3CK8 A;  5DBK A;  2WXP A;  4NAC A;  2HM8 A;  2WPV A;  3G2W A;  3OXG A;  3EIQ C;  4JZY A;  2L0I A;  2M63 A;  2WVI A;  3IHY A;  2HO1 A;  4GZ6 A;  5LX8 A;  2R5S A;  2JEK A;  4GZC A;  3MA5 A;  4N2S A;  5FWQ A;  4AM9 A;  2E2E A;  3AS8 A;  4KVO A;  4U0Z A;  2XGO A;  4BT8 A;  2GGF A;  3PUK A;  3CK9 A;  4AEZ C;  2DCP A;  3O4Z A;  3KEZ A;  3I4R B;  3QAQ A;  4ILG A;  4BTB A;  2J4D A;  5KCM A;  2VSY A;  3IKO B;  4F7A A;  1WM5 A;  2LO6 A;  5BW8 C;  4UWK A;  3T5X A;  3PDN A;  3MV3 B;  1FVF A;  2J9Q A;  1ELK A;  3FEX A;  1EPU A;  3L13 A;  2KM4 A;  5JHB A;  4HOU A;  2HYZ A;  1HZ4 A;  1IHG A;  2XPI A;  4G25 A;  4D10 C;  3AU5 A;  3FU6 A;  3QAR A;  4EBA A;  4PS7 A;  4LUN U;  3VLE A;  3FHE A;  1HG5 A;  4GB9 A;  4PUC A;  2CHZ A;  4Y6W A;  3FUD A;  1IQU A;  2XGS A;  4I43 A;  4JA7 A;  3MKR A;  4FHJ A;  3ULQ A;  3L54 A;  3JYS A;  2X6K A;  2YHE A;  3LVQ E;  2AW6 A;  3LY7 A;  5E76 A;  2C0M A;  3PEU B;  2WXK A;  2X6H A;  3KAE A;  3UQ3 A;  2X38 A;  2IU1 A;  4IUL A;  1WAO 1;  2RD0 A;  4I9C A;  2CHX A;  4E85 A;  5T8I A;  4G23 A;  3QB2 A;  3S7J A;  5LP0 A;  3CVY A;  4WUY A;  2WXJ A;  4OVU A;  3UT4 A;  4EPZ A;  4KBQ A;  4FP7 A;  3RJV A;  4ANW A;  1X5B A;  2WXL A;  3RRN B;  3K9I A;  3TXN A;  3QNK A;  3EDT B;  2LAI A;  3FH8 A;  4XI9 A;  2I1K A;  3CVX A;  4DI4 A;  3SBT B;  1HU3 A;  4KXK B;  3GZ1 A;  2WXH A;  2LNI A;  4RVB A;  4ABN A;  3ZFW A;  3FUI A;  5ANL A;  3I4G A;  4WWP A;  2AXZ A;  4GYY A;  3L16 A;  4CDM A;  3IV0 A;  3QOU A;  5A23 A;  1U3D A;  4F53 A;  3LDZ A;  4FUL A;  2J4B A;  4PS3 A;  5JJ6 A;  1Z3X A;  2NC9 A;  5FQ4 A;  1HF8 A;  2VSX E;  3FEY A;  2NSZ A;  3UX4 A;  5G05 J;  4HOQ A;  1FVH A;  3BEE A;  1SQM A;  3SI5 A;  4LER A;  1H6K A;  3T8M A;  3HVE A;  2CG3 A;  5LFA A;  3FTZ A;  4I2Z A;  4MKT A;  4ME2 A;  3ESL A;  3CKB A;  3JUI A;  1Y8M A;  4HOT A;  4Y6C A;  2YQ8 A;  4M3O A;  4GYW A;  4OVV A;  4UQZ A;  4AY6 A;  4L1B A;  2IOL A;  3QDN A;  2WXG A;  4Q94 A;  3CVL A;  5AIJ A;  4GZD A;  5G04 C;  3RO3 A;  5AEN A;  2UWJ G;  3UMV A;  4B94 A;  1H2T C;  3ZVV A;  5HI7 A;  2A5U A;  3LJ3 A;  4U0S A;  2L6J A;  4FA6 A;  4ATG A;  4FHK A;  3CVU A;  5FJY A;  3U64 A;  4OYS A;  3GW4 A;  2QY7 A;  2WXM A;  3HDX A;  3HIZ A;  3ZXS A;  1H19 A;  5T4Y A;  3GZS A;  2IFU A;  3FUE A;  3MJW A;  4Q96 A;  2J09 A;  4HOR A;  3FY4 A;  4U0U A;  3CIA A;  2L0T B;  3QWV A;  4YVO A;  2OND A;  4BTA A;  3FUH A;  3VLF A;  3U4T A;  1UJK A;  3G2U A;  3G2S A;  2PQN A;  2CFZ A;  3S2A A;  3TJP A;  2I6H A;  3RK6 A;  2GRM A;  2EQX A;  2VGY A;  4APF A;  1UW4 B;  3ASG A;  3PNT B;  3FU3 A;  4AVX A;  1H2U A;  5BV1 A;  2CFU A;  4JPS A;  4BX9 A;  3KS2 A;  3MKQ B;  3ONK A;  2LSU A;  3C98 A;  3SBS A;  2VQ2 A;  3RRU A;  4URK A;  5FQ8 A;  3PZD A;  4FJZ A;  3CST A;  4ANV A;  3L17 A;  4CGW A;  5FZQ A;  3CK7 A;  3RO2 A;  1OWM A;  3TG4 A;  4EZK A;  2VGX B;  2ION A;  4I6G A;  1FCH A;  3CV0 A;  1DVP A;  2XPY A;  4GA0 A;  3IBE A;  3ZYM A;  2LAH A;  2FEZ A;  2IOS A;  2XQ0 A;  2QFC A;  3D9I A;  1JPL A;  1HO8 A;  3FFL A;  1TEZ A;  4XE0 A;  3U3W A;  3NZS A;  1Y6I A;  4P29 A;  3ZYK A;  1DNP A;  3QC1 A;  4XKB A;  5KJM A;  4C9B B;  1E96 B;  4H7X A;  3D9O A;  1OWP A;  5JJ7 A;  4APO A;  2Y4T A;  2X6F A;  3D9N A;  3B7T A;  2X3M A;  3R9A B;  2KCL A;  2V5F A;  2Y4U A;  3JQ0 A;  2KCK A;  2P58 C;  4J8F A;  2I9C A;  4ILH B;  4WWO A;  3MKQ A;  5BNW A;  2OV8 A;  1H0A A;  5EKQ D;  5AYW D;  3Q4A B;  3TXM A;  2X6I A;  2V0P A;  2WXR A;  1JWG A;  3OXF A;  2WXI A;  3NQP A;  5JJT A;  4ANU A;  3SZ7 A;  3L08 A;  1UJJ A;  2PZI A;  4LRZ A;  4C0M A;  2VTB B;  4GML A;  1SZA A;  3RIB A;  1KT1 A;  2VYI A;  3LVR E;  3UT7 A;  4PH4 B;  1HXI A;  3PNL B;  1E7V A;  5JHA A;  3ML9 A;  3D9L A;  5CMY A;  5FQ7 A;  5A7D B;  1B89 A;  3MX3 A;  4HVB A;  1PC2 A;  4BSX A;  3CLJ A;  4O6F A;  4AOF A;  4G26 A;  3APC A;  3ENE A;  1WY6 A;  2KCV A;  2MOW A;  3URZ A;  5CMW A;  3PRZ A;  4JL0 A;  4ACK A;  3TGO A;  3CSF A;  3LS8 A;  1N54 A;  4JXT A;  3CHO A;  3G2T A;  3CHM A;  3PVL A;  3PE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...