4ATGA

Taf6 c-terminal domain from antonospora locustae
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
195
structure length
195
Chain Sequence
GSHMLPKELQLYFDKILSMIKSDMKDIAIECLEKESGLQQLVPYFIQHISELILKSFKEAEVLKTCIALYFSLIKNKHVFIDPYLHQILPSLLTCVIGKSIVDDDVRKMSADIVKYIYDTYSRSYKTLAPRVLKTLKGVWMDPNRSEDSQYGALYCLSILSKNVVNTVIREHAEEYKRTIGKKKVTNLLDNVLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title TFIID Taf6-Taf9 Complex Formation Involves the Heat Repeat-Containing C-Terminal Domain of Taf6 and is Modulated by Taf5 Protein.
pubmed doi rcsb
source organism Antonospora locustae
molecule tags Transcription
molecule keywords TAF6
total genus 77
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07571 TAF6_C TAF6 C-terminal HEAT repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.770 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4atgA00
4ATGA
chains in the Genus database with same CATH superfamily
3IHYA 1Y8MA 2IY0C 1QZ2A 3PDNA 5T4YA 5BNWA 4GTTA 3ZYMA 5FTPA 2CFZA 1MX6A 3L9TA 4CGVA 1K3ZD 3S7FA 1INZA 3APCA 4AY6A 3QC1A 1BI7B 1TNYA 3UX4A 5T3RA 3IHVA 5LP0A 3LY9A 3FU3A 4J8FA 2GRLA 3MA5A 1Z6TA 2Y1LE 4JD2G 3X2QE 4F3VA 1MX4A 3ASGA 2EIME 3N71A 4YNDA 3EHQA 2WQ6A 4JEUA 4KVMA 2CHZA 2R05A 4DX5D 2ZGGA 1OT8A 5FQ8A 3K9IA 2KXPC 4NURA 2CG3A 3ASHA 2PQRA 4BX8A 2MHKA 2J4BA 2M63A 3BUAA 2V0PA 3PEVB 2F0YA 4F6RD 3VLDA 2XENA 3FEYA 4KYOB 4JL0A 2RG8A 1IXVA 3D9KA 3NAWA 2P9PG 4F7AA 3AG2E 4WNGA 3Q5MA 4EZLA 2EQXA 1E8YA 3ESKA 3F6QA 4A55A 5BXUA 3TXNA 2HO1A 1LD7A 5AQ7A 3FU6A 3VTYA 4N3CA 1UN8A 4I2ZA 5JA4D 3I5PA 4K5AB 1BD8A 1IKND 4NQ0A 3DSVA 3CV0A 3SBSA 3CSTA 5FJYA 1RZ4A 3ONLA 4A63B 2VSOE 3D9HA 2I1JA 2RKKA 3DEPA 3FUDA 2ZIRA 3UKUG 1HS6A 4J0UA 1EF1C 5HKPA 4A1GA 2QC9A 4C0EA 4DX1A 4P29A 4BTBA 1NA0A 2WQHA 1HH8A 4DLOA 3P2BA 4GB9A 3RKVA 3TWSA 4DRXE 3TWWA 3MGBA 5EDSA 4NIKA 3PRZA 3RJVA 4AVXA 4Q69A 3LEWA 2KATA 4J8DA 3CVWA 1OWPA 4QQIA 3QB2A 4G11A 4HRNA 3LCAA 4YVOA 3MZLB 5KJMA 3CVLA 3EIJA 4U0SA 2LXMA 3IEGA 5DIZA 3TWVA 1N52A 3HXFA 2WXFA 1NP7A 4EZKA 2IQCA 4UWGA 2DWZA 4LNBA 1O5MA 4GA1A 3AU4A 3B7UX 4Q96A 2CHWA 4L23A 1N9AA 4MRUA 4XI9A 3JQ0A 3L6AA 3Q47B 3B7BA 1YYHA 4G26A 2Y4TA 3S7BA 4CYMD 3KEAA 4WNFA 2JABA 3RRNB 1TEZA 3W9GA 3FHEA 4C48B 3ZHEA 1H2TC 4UWFA 1OWOA 2P9IG 4J6IA 2IEJA 3FH8A 3I4RB 3PEUB 1ZB1A 4G25A 5G04J 3UPVA 4ABNA 4FULA 2ETCA 4BERA 4N5CA 4OVUA 2B0OE 3ZPJA 3G2VA 4DX7D 3JCKC 4I6GA 4CDMA 2ONDA 4ACLA 3NZUA 4K5CA 1V54E 2A5EA 4K03A 3ZUVB 2L0IA 3O48A 4PUCA 1TJCA 4KVOA 3E30A 4J8SA 5EX3A 4FJZA 2BTDA 3HXEA 3C3RA 4BY6A 2RFMA 1MYOA 2GRQB 5KWDA 1NA3A 4F53A 3EHMA 2H6HA 2WXLA 4AP2A 4MS6A 2VGEA 3L16A 4HI9A 3D9JA 5HI7A 2PZIA 2LAIA 3ONKA 1SZ9A 4JZYA 5KJNA 4JVSA 4ZFHA 2PL2A 5KCMA 4GA0A 3PUKA 1LF8A 3MKQB 4BSZB 2C0MA 3DWLG 5A7DB 2CHXA 1U3DA 1EDUA 2B6CA 3LVRE 4YVQC 2WXGA 1KLXA 4JHKA 5EIDA 3LYAA 4FADA 2XGSA 3CHQA 4YDOA 2DBAA 2PNNA 1IHGA 2GRNB 4MLPA 4WNEA 3UIOC 1N0QA 1EYHA 2RD0A 3JQ1A 1NZNA 3ZKJA 2FF4A 2OVFA 3T5VA 2GRRB 3EU5A 3UI2A 1LTXA 1MJ0A 3ASDA 5G2NA 4Y6WA 3CKCA 4E85A 3MV2B 4L2YA 4GZDA 5ENNA 2P9UG 4LERA 1BI8B 5AYWD 4ANUA 3HIZA 1H6PA 3NB2A 5ENPD 3R9AB 2BUGA 4YDYA 1PC2A 2A5UA 2QYJA 4ATZD 3MJWA 3T8KA 3NOCD 3R9MA 1N94A 3L82A 4RVBA 2X6JA 3TWUA 1K1AA 1ELWA 5BUZA 3RO3A 4UWHA 3CK8A 2WXPA 3QARA 4I1AA 4BX9A 4XIFA 4LUNU 5KJKA 2P9SG 3O4ZA 3TG5A 4BSXA 2PM6A 2DZNA 4U0UA 1OCRE 2NSZA 2QZAA 2XHEA 5D0OD 1N4RA 4WWNA 3OTNA 3GZ1A 3TL5A 3D9MA 2GROB 2LAHA 3OXLA 4KMOA 4HNAD 2PQNA 5EN5D 4BT8A 2CG2A 4GYOA 3L54A 3B95A 1YA0A 2DYRE 3IXEA 1SQMA 4FLHA 4J8EA 2I2OA 1AP7A 4UI9C 4WUYA 1N54A 4GCNA 4JW1A 2DVWA 5B1AE 3FUKA 2C2LA 5CBOA 2FI7A 3J5QB 1KZOA 5ANLA 2J4DA 1MX2A 3U3WA 3EU9A 3UM0A 3FTVA 4TRQA 4C0MA 2YQ8A 3TWQA 1HX8A 3ASFA 3D9OA 5EKQD 2QY7A 5B1BE 3CSFA 3ASNE 1JPLA 1WM5A 4I43A 1E8WA 1HU3A 3KS2A 2BKGA 5E75A 3FUJA 3FY4A 1WDYA 4HOTA 4U07A 4AIFA 4G24A 2MYOA 3C72A 2J09A 1TN6A 3T5XA 4H7YA 2J8SD 4J7WA 5H7PA 1K1BA 5D0QD 2BEDA 1Q2ZA 5CCMA 2HR2A 4CRWA 5ENSD 2XCBA 3SI5A 2HYZA 3KSLA 3MYVA 3TJPA 4O60A 4UUCA 3G2TA 4EECA 3CK7A 4I6JA 3S7JA 5JHAA 4OAUC 4WAFA 5D2MC 2ZGDA 3NBNB 3VLFA 3CHOA 4AV7A 1U3CA 1Z5SC 3I3NA 3NOGD 2YHEA 3BU8A 3UMVA 5CCLA 4YDWA 2IOLA 4XI0A 4DI3A 1BLXB 3AU5A 4V3IA 1IHBA 3JUEA 4G8LA 1BPOA 1N4PA 3G2SA 3TWTA 4HOQA 4HB5A 3NQPA 3PS6A 2UWJG 1OWLA 3SD5A 1NL4A 2UY1B 3GYZA 2VGYA 2DYSE 3FUNA 4DX6D 2C0LA 3S2AA 2WXMA 3AG1E 3PUJA 4H7XA 3UQ3A 2J49A 3FFLA 5HRYA 1IQUA 3GZSA 5HQ8A 3SFXA 4W9RA 4HOUA 5LX8A 3FUFA 1H6KA 1WG0A 3DXKG 4ANXA 2L0TB 1FT2A 4ME2A 2BF0X 4ILIA 2XPIA 4IULA 2KBXA 3NF1A 1HZ4A 4Y6CA 1QQEA 3FUIA 3MX3A 3R7QA 4ATGA 4UI9K 2WMNA 4G1TA 2I1KA 2AJAA 2AVPA 4EBAG 3FH5A 3RU0A 3LPZA 2F37A 4XKCA 3UT7A 2XPZA 3VTXA 4GMLA 4RQIA 1MQSA 4K5BA 3Q4AB 2WPVA 1FVFA 3ZYLA 3E4BA 5FZRA 4WNDA 3RRUA 2DZOA 4Z68A 2XZDG 2X6KA 3DSWA 4L2LA 2FO1E 4JHRA 3ZU7B 1N95A 5FQ6A 4GYWA 1TJFA 2E2EA 2OEWA 5EYLA 4FLBA 1N4SA 2GRPB 4BESA 3QNKA 4FP7A 1QBQA 3IV0A 2WXNA 3G2UA 2EINE 3Q9NC 2R02A 2HE0A 3RO2A 2R2LA 5KBAA 2PM7A 5JJTA 3LDZA 3I4GA 3PZ3A 1TR4A 3AG3E 5IY5E 3L13A 3BQOA 4M3OA 4CDRA 3U9WA 4IRUA 4GTMA 1UOHA 4GZ6A 1YCSB 4U8YD 2IFUA 1OUVA 1V55E 2IO2C 2VSYA 4TXPA 3Q15A 1KT0A 3CK9A 3PNLB 5LFAA 2RFAA 1TNUA 1KZPA 4I6EA 4FC8A 4KXKB 4PS8A 3SY2A 3PE4A 4F1PA 1E8XA 1HE8A 3CVUA 3ML8A 5AENA 3AAAC 2P9LG 5BV1A 3DRAA 3HXCA 3VLEA 1HF8A 3CLJA 3ZFWA 3BG0B 3C98A 5FZQA 4B93B 1MHQA 4FHJA 5ENTD 3FWVA 4GYYA 5ENOD 3UIPC 2MRIA 3FU5A 3RAUA 3MKRA 3NZSA 2WXQA 3GW4A 3CHMA 1OY3D 4LCTA 4TUMA 4U96D 4FHKA 3C3QA 3EJNA 3UM3A 4NRHB 3LKUA 3TAXA 3SO8A 3LJ3A 3Q75A 3PZ2A 2XRYA 3B7RL 2VTBB 3LJNA 5BPPA 3LXUX 2EILE 1OCZE 3FTUA 4N2SA 5DBKA 4XKBA 2P58C 3FTXA 3ZXPA 4WWPA 2LSVA 4GCOA 3CQCB 5EILA 4GMRA 3KAEA 5C1DA 3DPYA 1OWNA 1O1RA 1UW4B 2EIKE 5G04C 2ILRA 3ZRHA 1H0AA 3EHNA 3LS8A 2I6HA 3HVEB 2XZTG 3TWRA 4U0ZA 3FEXA 4ZHBA 5CECB 3ABKE 3DSSA 1H6OA 4GZ5A 3HRAA 3PH0C 3SFYA 3ZNGA 4HVBA 2WXRA 1H2VC 4AM9A 1S64A 1EPUA 3SNXA 5ARGA 1KT1A 1XGWA 2AXUA 3ZVVA 3ESLA 1WY6A 5CEDB 2KCKA 5G55A 4M7CA 4JA9A 4D10C 5CMYA 4XE0A 5AAOA 1DC2A 1UJKA 1TN8A 3TG4A 2XCCA 1SA4A 2Y4UA 2MOWA 4DJAA 4O1OA 2IF4A 1LD8A 1MZCA 2L9BA 3FTSA 4FA6A 2IO3C 3MV3B 2YNQA 3Q73A 1D8DA 4LG6A 2CFUA 1N0RA 2H6FA 4LEUA 3CHRA 4GTVA 3HXDA 3CVNA 2WXHA 2DCPA 4OAVB 1X5BA 3LY8A 2KC7A 4I1MA 4N5QA 3CVQA 3FUHA 5CMWA 2E0IA 3UTMA 4I1OB 4BETA 2IJGX 1S63A 4DI4A 2GGFA 4I17A 3IBEA 1FVHA 5BV0A 4C9BB 3B13A 4HI8A 4JPSA 2LSUA 3CHSA 2L6BA 3D9LA 4B8AA 3ENEA 3W9FA 2GW1A 1VDYA 4CZ2D 3ASOE 1E96B 3CGHA 1JWFA 2P9KG 3V79K 1A5EA 1FPPA 5D66A 2WQ7A 1S0PA 2NXPA 1JCSA 2WXKA 2OV8A 1Y6IA 1IQRA 4BFRA 2AXVA 3AG4E 1OCCE 1QYMA 3C5RA 3JXIA 3JXJA 4U63A 1NFIE 3WXXA 3S7DA 1Z3YA 4RG9A 5CEAA 2QFCA 3Q78A 1A17A 2J9QA 4JEHA 2FEZA 4PS7A 3U4TA 5AQ9A 4DX2A 1TNBA 2OVBA 4HLLA 2NC9A 3FUMA 2F8XK 1TNOA 4BTAA 4JB8P 5EYPF 4U95D 4BT9A 2R03A 3FTZA 1HFAA 3D3MA 4ILHB 2VSNA 5G05C 3CVPA 4GPKA 2VGXB 4N3BA 3V2XA 1RW2A 2AXZA 2AWIA 1YMPA 1JCQA 4GZCA 4BWRA 4B0ZA 4F1SA 2OCCE 3PREA 5JJ7A 2JEKA 3FTYA 1BU9A 5BXOA 4GMJA 3ULEG 3SQVA 4TXRA 3OXGA 1DNPA 4E6HA 3APDA 1L5JA 2KCLA 1N4QA 4KT6B 4MKTA 3AS4A 2NYJA 2KZTA 3MCXA 3FU0A 3Q49B 2H6GA 2BKKB 4U04A 1IYGA 4TUUA 3E32A 4CT4A 1NI1A 1S70B 3SF4A 1DCEA 1JCRA 5G05J 4AEZC 4O6FA 2V4HC 4J8YA 3TGOA 3D9IA 4U8VD 1U2VG 5FZSA 3URZA 5T8IA 4KBQA 3CEQA 2FULA 4A3VA 2ZXWE 3ISMC 3J5PA 3LY7A 3T8MA 1Z3XA 1D9SA 3AS5A 3KEZA 2XEVA 2X3MA 4B89A 2ETBA 4HORA 4UQYA 3PNTB 2KM4A 4UWKA 3UT4A 3SFZA 5J90A 1D8EA 4UWLA 1ELRA 5A23A 1SZAA 4KZ0A 4I2WA 4JXTA 3RSEG 4A1SA 4CEMA 5LOZA 1W3BA 4RLYA 4WWOA 3IKOB 2DIWA 1KPSB 3EIQC 1N11A 4L7TA 3D9NA 1ZU2A 3PVLA 1HG2A 2J07A 3CQGB 3MEKA 2Y3AA 2GRMA 4KZCA 4APOA 2XRZA 2R5SA 2LXLA 5LCWJ 3ML9A 1FCHA 1OXJA 2X6FA 3GZ2A 4I9EA 3LVQE 4XX5A 2FO7A 4HRLA 1PAQA 1X81A 2A4ZA 3QDNA 2WB2A 5ANRA 3UM2A 2R17C 5ENRD 2ETAA 4UQXA 3CR3A 1G3NB 2VTBA 3FP3A 3V30A 4JHJA 4G8KA 5ITZF 3DXMG 5KJLA 4AXHA 3B7TA 1JWGA 1H2UA 4EZJA 4Q94A 2VGXA 3B7SA 3RRMB 4EPZA 3UXGA 3SZ7A 4L1BA 4ACKA 3RIBA 4GU5A 3ABME 1H19A 5HS0A 3WG7E 4TXQA 5EX0A 2WMOA 5C2YA 3CVYA 4PS3A 3HHMA 2WXIA 5AJLA 4CDNA 4HQDA 4HOSA 4IN3B 2IONA 3QJZA 3HVEA 2AW6A 4CCAA 1SA5A 4GAAA 5FWQA 5AQBA 1WAO1 1HXIA 2VSXE 1OCOE 1SVXA 2ZU6B 4AJWA 2HM8A 2YINA 3R7RA 4I9CA 2L6JA 1TYQG 2KZTB 5JMND 4JA7A 2UY1A 4GTPA 5KNGA 5J08A 3JUIA 5E76A 3QKYA 2V8SE 3QK0A 2EIJE 3ZHEB 3QWWA 4K0RA 3PE3A 4MBGA 1E90A 5AQAA 2P2CP 2LO6A 2XS8A 4GTOA 3FTWA 2VYIA 1OWMA 3ZXSA 4GPMA 4UI9J 2WXOA 3DPDA 3PZ1A 1UG3A 2XEEA 4CGWA 3UM1A 3PZDA 4EQFA 1E7UA 2OEVA 4HS2A 5AIJA 4JC8A 3ULQA 1UJJA 2X38A 4L9PA 4URKA 3G2WA 4LSZE 4G23A 4B8CB 4HLEA 4FJYA 3CIAA 4APFA 4OVVA 3ZYKA 4XZ4A 3D9PA 3FDHA 1E7VA 1TNZA 3ABLE 3ZN3A 2X6IA 4HXIA 4U7EB 2X6HA 3L08A 4LRZA 3E37A 5M72A 2P9NG 4U8HA 2Y69E 3TXMA 3CVVA 5CERB 4FU3A 2V5QC 5AJDA 3DEOA 3HDXA 2FBNA 2H6IA 4PH4B 3UKRG 4RSYA 3T9KA 2WVIA 3CKBA 1FT1A 4UQZA 3HYMB 3AJIA 4DPRA 1P5QA 3E34A 2V4LA 4EBAA 3DSXA 2IOSA 4IYPA 4R7LA 4GTQA 4GTRA 3U64A 2Q7FA 1AWCB 4RG6A 1O1SA 3QOUA 1TN7A 2WXJA 3APFA 2LNIA 3RK6A 4N39A 3ULYA 3C3OA 4PDXA 5FQ7A 3UT8A 4N2QA 3AS8A 3OAWA 4GTSA 1HG5A 2ZISA 4A3TA 2R59A 3ZIMA 5CHEE 3SGHA 3CHPA 2YHCA 1QNFA 1SW6A 1O1TA 4HRMB 3QWPA 4ANVA 5AN8A 1B89A 4AOFA 2I9CA 2V5FA 3JYSA 3HG0D 4EHMA 3BEEA 4OYSA 3ZW3A 2XS1A 3UUXA 4HFGA 5BW8C 3Q7FA 5ARFA 1PY1A 4GZ3A 2KCVA 5AARA 5JHBA 3DSTA 4GA2A 2Y0BG 3L22A 4N3AA 1ELKA 2XPYA 3BG1B 2VQ2A 2XQ0A 3Q9UC 1E8ZA 4QFVA 3EHRA 3DSUA 4B94A 3OXFA 4DLQA 5CBNA 3PZ4A 5FT9A 5FINA 5LCWC 4HBDA 1ZBPA 4O1PA 5EIBE 1HO8A 4BEPA 3V31A 3CVXA 2OOEA 2J08A 5FIOA 2XGMA 5CRUA 4X8QA 2XGOA 4ILGA 4CT0A 2VJ8A 4YDEA 3ZYQA 3UINC 1JUQA 2LUHA 3EUVA 1GW6A 3ZGQA 5A6CA 5FQ4A 2QYUA 4LNGA 3DBSA 4NACA 4G2VA 1DVPA 5BT1A 3E33A 3KD7A 2IU1A 3SBTB 3FUEA 2XEHA 4DUIA 3HXBA 3MKQA 3V2OA 3EDTB 4LNUD 3FULA 5CRVA 3L17A 3KSQA 1XNFA 3TWXA 2JLBA 3P1UA 2F8YA 3ZEFA 5JJ6A 4TV3A 4DK5A 3U66A 2WM9A 1K8KG 4XEIG 3QWVA 4ANWA 1UN9A 5B3SE 3SHFA 3FH7A 5ENQD 1DCQA 3Q7AA 5KNHD 4AY5A 3Q79A 3QAQA
chains in the Genus database with same CATH topology
1ELWA 3EJNA 3IHYA 5ANRA 1Y8MA 2R17C 5BUZA 3RO3A 4UWHA 1QZ2A 4NRHB 3PDNA 5T4YA 3CK8A 2WXPA 3LKUA 3TAXA 5BNWA 3ZYMA 4UQXA 3CR3A 5FTPA 2VTBA 3QARA 4I1AA 4BX9A 2CFZA 3FP3A 3LJ3A 4JHJA 4LUNU 4XIFA 4CGVA 5KJKA 5KJLA 4AXHA 3B7TA 3S7FA 1JWGA 1INZA 3B7RL 1H2UA 2XRYA 3APCA 4AY6A 3QC1A 2VTBB 4EZJA 5BPPA 4Q94A 3O4ZA 3TG5A 3LXUX 2VGXA 3B7SA 4BSXA 3RRMB 3UX4A 3FTUA 2PM6A 4EPZA 5T3RA 4N2SA 4U0UA 3IHVA 2NSZA 4XKBA 5DBKA 5LP0A 3LY9A 2P58C 3FU3A 2XHEA 4J8FA 4L1BA 5D0OD 2GRLA 3SZ7A 3RIBA 3FTXA 4ACKA 4WWNA 3MA5A 4GU5A 4WWPA 2LSVA 3OTNA 1Z6TA 3GZ1A 4GCOA 1H19A 3CQCB 3TL5A 3D9MA 2LAHA 4F3VA 3OXLA 3ASGA 3KAEA 4KMOA 5C1DA 1OWNA 3N71A 5EX0A 2PQNA 1UW4B 4BT8A 2CG2A 2WMOA 4YNDA 5C2YA 3CVYA 2WQ6A 4PS3A 4GYOA 3HHMA 3L54A 4JEUA 1YA0A 5G04C 2WXIA 4KVMA 4FLHA 1SQMA 2ILRA 2CHZA 4J8EA 5AJLA 3ZRHA 4CDNA 1H0AA 2I2OA 3EHNA 3LS8A 4UI9C 4WUYA 2I6HA 5FQ8A 3HVEB 1N54A 3K9IA 4GCNA 4JW1A 4NURA 2CG3A 3ASHA 2PQRA 3FUKA 4U0ZA 3FEXA 4BX8A 2MHKA 2C2LA 4HOSA 4IN3B 2IONA 3QJZA 3HVEA 2AW6A 2FI7A 4CCAA 5ANLA 4GAAA 2J4BA 2J4DA 2M63A 4GZ5A 3PH0C 4HVBA 2WXRA 3U3WA 2V0PA 1H2VC 5FWQA 1WAO1 4AM9A 3FTVA 1EPUA 1HXIA 4TRQA 3PEVB 4C0MA 2YQ8A 3VLDA 2VSXE 3SNXA 5ARGA 1HX8A 3ASFA 3FEYA 4KYOB 2ZU6B 1KT1A 4JL0A 1XGWA 3D9OA 2AXUA 4AJWA 2HM8A 2YINA 3ZVVA 3ESLA 2RG8A 5EKQD 3D9KA 3R7RA 1WY6A 4I9CA 2L6JA 2KCKA 5G55A 2KZTB 2QY7A 4F7AA 4JA7A 4JA9A 4WNGA 3CSFA 3Q5MA 4D10C 2UY1A 5CMYA 1JPLA 1WM5A 4I43A 4EZLA 2EQXA 1E8WA 1E8YA 4XE0A 1HU3A 1UJKA 3ESKA 3KS2A 3TG4A 5J08A 5E75A 2XCCA 4A55A 3FUJA 3FY4A 3JUIA 2Y4UA 5E76A 2MOWA 3QKYA 4DJAA 3TXNA 4HOTA 2V8SE 2HO1A 4U07A 4AIFA 3QK0A 2IF4A 4G24A 3FU6A 3VTYA 2L9BA 3FTSA 2J09A 3T5XA 4N3CA 4FA6A 4H7YA 1UN8A 3QWWA 3ZHEB 4K0RA 4I2ZA 3MV3B 3PE3A 2YNQA 5D0QD 1E90A 3I5PA 2LO6A 2CFUA 3FTWA 2VYIA 1OWMA 3ZXSA 4UI9J 4NQ0A 4LEUA 3CV0A 3CHRA 2WXOA 3SBSA 3CVNA 2WXHA 3CSTA 2DCPA 5CCMA 5FJYA 3DPDA 1X5BA 3LY8A 2KC7A 4I1MA 1UG3A 2HR2A 4CRWA 2XCBA 4CGWA 3ONLA 2VSOE 3CVQA 3PZDA 3SI5A 2HYZA 3FUHA 2I1JA 3MYVA 3FUDA 3TJPA 1HS6A 4J0UA 4EQFA 3G2TA 5CMWA 4EECA 1E7UA 3CK7A 4I6JA 2E0IA 3S7JA 1EF1C 5JHAA 4I1OB 4HS2A 5AIJA 4JC8A 3ULQA 1UJJA 2IJGX 4A1GA 4C0EA 4DI4A 4P29A 2GGFA 4BTBA 2X38A 4I17A 4URKA 3IBEA 1NA0A 2WQHA 1FVHA 5BV0A 1HH8A 3G2WA 4C9BB 3B13A 4G23A 4WAFA 4B8CB 4DLOA 4JPSA 4HLEA 2LSUA 4FJYA 3CHSA 3D9LA 3P2BA 4B8AA 3CIAA 4APFA 4OVVA 3ENEA 3ZYKA 4GB9A 4XZ4A 3VLFA 3RKVA 3CHOA 3D9PA 2GW1A 1U3CA 1E7VA 1VDYA 3FDHA 3I3NA 4AV7A 3MGBA 5EDSA 1E96B 3CGHA 1JWFA 3PRZA 2YHEA 3RJVA 4AVXA 3LEWA 4Q69A 2KATA 3UMVA 3ZN3A 2X6IA 4HXIA 5CCLA 2WQ7A 2X6HA 1S0PA 2NXPA 4J8DA 2IOLA 2WXKA 3L08A 4XI0A 3CVWA 4LRZA 1OWPA 4DI3A 2OV8A 1Y6IA 1IQRA 3AU5A 4BFRA 4V3IA 2AXVA 3QB2A 4G11A 5M72A 3LCAA 4YVOA 3MZLB 1BPOA 5KJMA 3G2SA 3CVLA 3EIJA 4U0SA 3IEGA 4U8HA 4HOQA 5DIZA 1N52A 3TXMA 3NQPA 3PS6A 2UWJG 1OWLA 4U63A 3SD5A 3WXXA 3CVVA 3S7DA 1Z3YA 4RG9A 2UY1B 4FU3A 2WXFA 1NP7A 3GYZA 4EZKA 2IQCA 2QFCA 5AJDA 2VGYA 1A17A 4UWGA 3FUNA 2J9QA 4JEHA 2C0LA 3S2AA 3HDXA 2FBNA 2FEZA 2WXMA 4PH4B 4PS7A 4GA1A 3U4TA 3PUJA 3AU4A 3B7UX 4H7XA 4Q96A 2CHWA 4L23A 4RSYA 2OVBA 2WVIA 3UQ3A 2NC9A 3FUMA 4BTAA 4MRUA 2J49A 3FFLA 3CKBA 4XI9A 1IQUA 3JQ0A 3L6AA 3HYMB 3Q47B 4UQZA 4BT9A 3FTZA 3GZSA 1HFAA 4DPRA 1P5QA 5HQ8A 4G26A 2Y4TA 3D3MA 4ILHB 3S7BA 2VSNA 5G05C 3CVPA 4GPKA 2VGXB 4N3BA 4W9RA 4WNFA 2AXZA 2V4LA 2AWIA 3RRNB 4EBAA 1TEZA 4HOUA 3FHEA 5LX8A 3ZHEA 1H2TC 3FUFA 4GZCA 1H6KA 4BWRA 4UWFA 4B0ZA 2IOSA 4IYPA 4F1SA 4R7LA 5JJ7A 3PREA 1OWOA 4ANXA 3U64A 2JEKA 2L0TB 2Q7FA 4J6IA 3FH8A 4ME2A 2BF0X 3I4RB 4ILIA 2XPIA 3PEUB 3FTYA 4IULA 4RG6A 4G25A 3QOUA 3NF1A 5G04J 3UPVA 2WXJA 4ABNA 1HZ4A 4Y6CA 1QQEA 3APFA 4FULA 4GMJA 2LNIA 3RK6A 3FUIA 4N39A 3OXGA 1DNPA 4E6HA 3APDA 1L5JA 2KCLA 3MX3A 4N5CA 4OVUA 3R7QA 4KT6B 4PDXA 4MKTA 5FQ7A 3AS4A 3UT8A 4N2QA 3ZPJA 3G2VA 3AS8A 3JCKC 3OAWA 4I6GA 2KZTA 4UI9K 4ATGA 3MCXA 2WMNA 1HG5A 4CDMA 3FU0A 4G1TA 2ONDA 4A3TA 3Q49B 2R59A 4ACLA 3NZUA 2I1KA 3ZIMA 4U04A 5CHEE 2AVPA 4EBAG 4K03A 3FH5A 3SGHA 3RU0A 1IYGA 3CHPA 3LPZA 4XKCA 2YHCA 3UT7A 4TUUA 2XPZA 4CT4A 1QNFA 3VTXA 2L0IA 4GMLA 3O48A 1MQSA 3ZYLA 3Q4AB 2WPVA 1FVFA 3SF4A 3QWPA 4ANVA 4PUCA 3E4BA 1TJCA 4WNDA 5FZRA 4KVOA 3RRUA 4J8SA 5EX3A 1B89A 5G05J 4FJZA 2BTDA 4O6FA 4AEZC 4AOFA 2I9CA 2V5FA 3TGOA 3JYSA 3D9IA 4BY6A 3BEEA 2X6KA 4OYSA 5FZSA 3ZW3A 3URZA 4L2LA 5T8IA 4KBQA 4JHRA 3UUXA 3CEQA 1NA3A 2FULA 5FQ6A 4A3VA 4F53A 4GYWA 1TJFA 3EHMA 4HFGA 5BW8C 2E2EA 2WXLA 4AP2A 5ARFA 1PY1A 4MS6A 4GZ3A 3L16A 4FLBA 2KCVA 3D9JA 5HI7A 2PZIA 2LAIA 3LY7A 3QNKA 3T8MA 4GA2A 5JHBA 3ONKA 4FP7A 1SZ9A 3IV0A 4JZYA 2WXNA 1Z3XA 3G2UA 3L22A 4N3AA 5KJNA 1ELKA 4JVSA 3AS5A 2XPYA 3KEZA 3BG1B 2XEVA 2VQ2A 2XQ0A 2PL2A 5KCMA 3RO2A 2PM7A 5JJTA 2X3MA 1E8ZA 3LDZA 3I4GA 4QFVA 4B94A 4GA0A 3OXFA 4DLQA 4B89A 5FT9A 5LCWC 4HORA 1ZBPA 3PUKA 1LF8A 4UQYA 3L13A 3MKQB 2C0MA 3PNTB 4M3OA 2KM4A 4CDRA 1HO8A 2CHXA 5A7DB 1U3DA 4IRUA 4UWKA 3U9WA 3CVXA 3UT4A 2OOEA 3SFZA 2J08A 4GZ6A 2IFUA 5J90A 1OUVA 1EDUA 3LVRE 2XGMA 2VSYA 4YVQC 2WXGA 2XGOA 4ILGA 4UWLA 1ELRA 1KLXA 4JHKA 3Q15A 5A23A 1KT0A 1SZAA 3CK9A 3PNLB 3LYAA 4CT0A 5LFAA 4KZ0A 4FADA 2VJ8A 2XGSA 3CHQA 4I2WA 4JXTA 3ZYQA 1JUQA 2DBAA 1IHGA 4A1SA 4CEMA 1GW6A 3ZGQA 5A6CA 5FQ4A 4MLPA 4WNEA 5LOZA 1EYHA 1W3BA 2RD0A 3DBSA 4I6EA 4NACA 4FC8A 4WWOA 3IKOB 3JQ1A 1NZNA 1DVPA 4G2VA 2FF4A 2DIWA 4KXKB 4PS8A 5BT1A 3EIQC 2OVFA 3PE4A 3T5VA 4L7TA 3D9NA 1E8XA 1HE8A 3KD7A 2IU1A 3SBTB 1ZU2A 3ML8A 5AENA 3FUEA 3CVUA 3PVLA 3ASDA 1HG2A 3MKQA 2J07A 3CQGB 5G2NA 3MEKA 5BV1A 4Y6WA 3EDTB 3CKCA 2Y3AA 3FULA 4E85A 2GRMA 3MV2B 3L17A 4L2YA 3VLEA 1HF8A 4GZDA 3CLJA 5ENNA 4LERA 4KZCA 4APOA 3ZFWA 1XNFA 3BG0B 3C98A 5FZQA 2XRZA 2JLBA 3P1UA 2R5SA 5LCWJ 5AYWD 3ML9A 4ANUA 1FCHA 3HIZA 3ZEFA 5JJ6A 1MHQA 4TV3A 4DK5A 4FHJA 2X6FA 3R9AB 2BUGA 3U66A 3FWVA 3GZ2A 2WM9A 1PC2A 2A5UA 4GYYA 4I9EA 3LVQE 4XX5A 3MJWA 2FO7A 3QWVA 4RVBA 4ANWA 2MRIA 3FU5A 2X6JA 1PAQA 1UN9A 3MKRA 2A4ZA 3NZSA 3SHFA 2WXQA 3GW4A 3CHMA 3FH7A 3QDNA 4LCTA 4AY5A 4FHKA 3QAQA 2WB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ATG A; 
#chains in the Genus database with same CATH topology
 3IHY A;  1Y8M A;  2IY0 C;  1QZ2 A;  3PDN A;  5T4Y A;  5BNW A;  4GTT A;  3ZYM A;  5FTP A;  2CFZ A;  1MX6 A;  3L9T A;  4CGV A;  1K3Z D;  3S7F A;  1INZ A;  3APC A;  4AY6 A;  3QC1 A;  1BI7 B;  1TNY A;  3UX4 A;  5T3R A;  3IHV A;  5LP0 A;  3LY9 A;  3FU3 A;  4J8F A;  2GRL A;  3MA5 A;  1Z6T A;  2Y1L E;  4JD2 G;  3X2Q E;  4F3V A;  1MX4 A;  3ASG A;  2EIM E;  3N71 A;  4YND A;  3EHQ A;  2WQ6 A;  4JEU A;  4KVM A;  2CHZ A;  2R05 A;  4DX5 D;  2ZGG A;  1OT8 A;  5FQ8 A;  3K9I A;  2KXP C;  4NUR A;  2CG3 A;  3ASH A;  2PQR A;  4BX8 A;  2MHK A;  2J4B A;  2M63 A;  3BUA A;  2V0P A;  3PEV B;  2F0Y A;  4F6R D;  3VLD A;  2XEN A;  3FEY A;  4KYO B;  4JL0 A;  2RG8 A;  1IXV A;  3D9K A;  3NAW A;  2P9P G;  4F7A A;  3AG2 E;  4WNG A;  3Q5M A;  4EZL A;  2EQX A;  1E8Y A;  3ESK A;  3F6Q A;  4A55 A;  5BXU A;  3TXN A;  2HO1 A;  1LD7 A;  5AQ7 A;  3FU6 A;  3VTY A;  4N3C A;  1UN8 A;  4I2Z A;  5JA4 D;  3I5P A;  4K5A B;  1BD8 A;  1IKN D;  4NQ0 A;  3DSV A;  3CV0 A;  3SBS A;  3CST A;  5FJY A;  1RZ4 A;  3ONL A;  4A63 B;  2VSO E;  3D9H A;  2I1J A;  2RKK A;  3DEP A;  3FUD A;  2ZIR A;  3UKU G;  1HS6 A;  4J0U A;  1EF1 C;  5HKP A;  4A1G A;  2QC9 A;  4C0E A;  4DX1 A;  4P29 A;  4BTB A;  1NA0 A;  2WQH A;  1HH8 A;  4DLO A;  3P2B A;  4GB9 A;  3RKV A;  3TWS A;  4DRX E;  3TWW A;  3MGB A;  5EDS A;  4NIK A;  3PRZ A;  3RJV A;  4AVX A;  4Q69 A;  3LEW A;  2KAT A;  4J8D A;  3CVW A;  1OWP A;  4QQI A;  3QB2 A;  4G11 A;  4HRN A;  3LCA A;  4YVO A;  3MZL B;  5KJM A;  3CVL A;  3EIJ A;  4U0S A;  2LXM A;  3IEG A;  5DIZ A;  3TWV A;  1N52 A;  3HXF A;  2WXF A;  1NP7 A;  4EZK A;  2IQC A;  4UWG A;  2DWZ A;  4LNB A;  1O5M A;  4GA1 A;  3AU4 A;  3B7U X;  4Q96 A;  2CHW A;  4L23 A;  1N9A A;  4MRU A;  4XI9 A;  3JQ0 A;  3L6A A;  3Q47 B;  3B7B A;  1YYH A;  4G26 A;  2Y4T A;  3S7B A;  4CYM D;  3KEA A;  4WNF A;  2JAB A;  3RRN B;  1TEZ A;  3W9G A;  3FHE A;  4C48 B;  3ZHE A;  1H2T C;  4UWF A;  1OWO A;  2P9I G;  4J6I A;  2IEJ A;  3FH8 A;  3I4R B;  3PEU B;  1ZB1 A;  4G25 A;  5G04 J;  3UPV A;  4ABN A;  4FUL A;  2ETC A;  4BER A;  4N5C A;  4OVU A;  2B0O E;  3ZPJ A;  3G2V A;  4DX7 D;  3JCK C;  4I6G A;  4CDM A;  2OND A;  4ACL A;  3NZU A;  4K5C A;  1V54 E;  2A5E A;  4K03 A;  3ZUV B;  2L0I A;  3O48 A;  4PUC A;  1TJC A;  4KVO A;  3E30 A;  4J8S A;  5EX3 A;  4FJZ A;  2BTD A;  3HXE A;  3C3R A;  4BY6 A;  2RFM A;  1MYO A;  2GRQ B;  5KWD A;  1NA3 A;  4F53 A;  3EHM A;  2H6H A;  2WXL A;  4AP2 A;  4MS6 A;  2VGE A;  3L16 A;  4HI9 A;  3D9J A;  5HI7 A;  2PZI A;  2LAI A;  3ONK A;  1SZ9 A;  4JZY A;  5KJN A;  4JVS A;  4ZFH A;  2PL2 A;  5KCM A;  4GA0 A;  3PUK A;  1LF8 A;  3MKQ B;  4BSZ B;  2C0M A;  3DWL G;  5A7D B;  2CHX A;  1U3D A;  1EDU A;  2B6C A;  3LVR E;  4YVQ C;  2WXG A;  1KLX A;  4JHK A;  5EID A;  3LYA A;  4FAD A;  2XGS A;  3CHQ A;  4YDO A;  2DBA A;  2PNN A;  1IHG A;  2GRN B;  4MLP A;  4WNE A;  3UIO C;  1N0Q A;  1EYH A;  2RD0 A;  3JQ1 A;  1NZN A;  3ZKJ A;  2FF4 A;  2OVF A;  3T5V A;  2GRR B;  3EU5 A;  3UI2 A;  1LTX A;  1MJ0 A;  3ASD A;  5G2N A;  4Y6W A;  3CKC A;  4E85 A;  3MV2 B;  4L2Y A;  4GZD A;  5ENN A;  2P9U G;  4LER A;  1BI8 B;  5AYW D;  4ANU A;  3HIZ A;  1H6P A;  3NB2 A;  5ENP D;  3R9A B;  2BUG A;  4YDY A;  1PC2 A;  2A5U A;  2QYJ A;  4ATZ D;  3MJW A;  3T8K A;  3NOC D;  3R9M A;  1N94 A;  3L82 A;  4RVB A;  2X6J A;  3TWU A;  1K1A A;  1ELW A;  5BUZ A;  3RO3 A;  4UWH A;  3CK8 A;  2WXP A;  3QAR A;  4I1A A;  4BX9 A;  4XIF A;  4LUN U;  5KJK A;  2P9S G;  3O4Z A;  3TG5 A;  4BSX A;  2PM6 A;  2DZN A;  4U0U A;  1OCR E;  2NSZ A;  2QZA A;  2XHE A;  5D0O D;  1N4R A;  4WWN A;  3OTN A;  3GZ1 A;  3TL5 A;  3D9M A;  2GRO B;  2LAH A;  3OXL A;  4KMO A;  4HNA D;  2PQN A;  5EN5 D;  4BT8 A;  2CG2 A;  4GYO A;  3L54 A;  3B95 A;  1YA0 A;  2DYR E;  3IXE A;  1SQM A;  4FLH A;  4J8E A;  2I2O A;  1AP7 A;  4UI9 C;  4WUY A;  1N54 A;  4GCN A;  4JW1 A;  2DVW A;  5B1A E;  3FUK A;  2C2L A;  5CBO A;  2FI7 A;  3J5Q B;  1KZO A;  5ANL A;  2J4D A;  1MX2 A;  3U3W A;  3EU9 A;  3UM0 A;  3FTV A;  4TRQ A;  4C0M A;  2YQ8 A;  3TWQ A;  1HX8 A;  3ASF A;  3D9O A;  5EKQ D;  2QY7 A;  5B1B E;  3CSF A;  3ASN E;  1JPL A;  1WM5 A;  4I43 A;  1E8W A;  1HU3 A;  3KS2 A;  2BKG A;  5E75 A;  3FUJ A;  3FY4 A;  1WDY A;  4HOT A;  4U07 A;  4AIF A;  4G24 A;  2MYO A;  3C72 A;  2J09 A;  1TN6 A;  3T5X A;  4H7Y A;  2J8S D;  4J7W A;  5H7P A;  1K1B A;  5D0Q D;  2BED A;  1Q2Z A;  5CCM A;  2HR2 A;  4CRW A;  5ENS D;  2XCB A;  3SI5 A;  2HYZ A;  3KSL A;  3MYV A;  3TJP A;  4O60 A;  4UUC A;  3G2T A;  4EEC A;  3CK7 A;  4I6J A;  3S7J A;  5JHA A;  4OAU C;  4WAF A;  5D2M C;  2ZGD A;  3NBN B;  3VLF A;  3CHO A;  4AV7 A;  1U3C A;  1Z5S C;  3I3N A;  3NOG D;  2YHE A;  3BU8 A;  3UMV A;  5CCL A;  4YDW A;  2IOL A;  4XI0 A;  4DI3 A;  1BLX B;  3AU5 A;  4V3I A;  1IHB A;  3JUE A;  4G8L A;  1BPO A;  1N4P A;  3G2S A;  3TWT A;  4HOQ A;  4HB5 A;  3NQP A;  3PS6 A;  2UWJ G;  1OWL A;  3SD5 A;  1NL4 A;  2UY1 B;  3GYZ A;  2VGY A;  2DYS E;  3FUN A;  4DX6 D;  2C0L A;  3S2A A;  2WXM A;  3AG1 E;  3PUJ A;  4H7X A;  3UQ3 A;  2J49 A;  3FFL A;  5HRY A;  1IQU A;  3GZS A;  5HQ8 A;  3SFX A;  4W9R A;  4HOU A;  5LX8 A;  3FUF A;  1H6K A;  1WG0 A;  3DXK G;  4ANX A;  2L0T B;  1FT2 A;  4ME2 A;  2BF0 X;  4ILI A;  2XPI A;  4IUL A;  2KBX A;  3NF1 A;  1HZ4 A;  4Y6C A;  1QQE A;  3FUI A;  3MX3 A;  3R7Q A;  4ATG A;  4UI9 K;  2WMN A;  4G1T A;  2I1K A;  2AJA A;  2AVP A;  4EBA G;  3FH5 A;  3RU0 A;  3LPZ A;  2F37 A;  4XKC A;  3UT7 A;  2XPZ A;  3VTX A;  4GML A;  4RQI A;  1MQS A;  4K5B A;  3Q4A B;  2WPV A;  1FVF A;  3ZYL A;  3E4B A;  5FZR A;  4WND A;  3RRU A;  2DZO A;  4Z68 A;  2XZD G;  2X6K A;  3DSW A;  4L2L A;  2FO1 E;  4JHR A;  3ZU7 B;  1N95 A;  5FQ6 A;  4GYW A;  1TJF A;  2E2E A;  2OEW A;  5EYL A;  4FLB A;  1N4S A;  2GRP B;  4BES A;  3QNK A;  4FP7 A;  1QBQ A;  3IV0 A;  2WXN A;  3G2U A;  2EIN E;  3Q9N C;  2R02 A;  2HE0 A;  3RO2 A;  2R2L A;  5KBA A;  2PM7 A;  5JJT A;  3LDZ A;  3I4G A;  3PZ3 A;  1TR4 A;  3AG3 E;  5IY5 E;  3L13 A;  3BQO A;  4M3O A;  4CDR A;  3U9W A;  4IRU A;  4GTM A;  1UOH A;  4GZ6 A;  1YCS B;  4U8Y D;  2IFU A;  1OUV A;  1V55 E;  2IO2 C;  2VSY A;  4TXP A;  3Q15 A;  1KT0 A;  3CK9 A;  3PNL B;  5LFA A;  2RFA A;  1TNU A;  1KZP A;  4I6E A;  4FC8 A;  4KXK B;  4PS8 A;  3SY2 A;  3PE4 A;  4F1P A;  1E8X A;  1HE8 A;  3CVU A;  3ML8 A;  5AEN A;  3AAA C;  2P9L G;  5BV1 A;  3DRA A;  3HXC A;  3VLE A;  1HF8 A;  3CLJ A;  3ZFW A;  3BG0 B;  3C98 A;  5FZQ A;  4B93 B;  1MHQ A;  4FHJ A;  5ENT D;  3FWV A;  4GYY A;  5ENO D;  3UIP C;  2MRI A;  3FU5 A;  3RAU A;  3MKR A;  3NZS A;  2WXQ A;  3GW4 A;  3CHM A;  1OY3 D;  4LCT A;  4TUM A;  4U96 D;  4FHK A;  3C3Q A;  3EJN A;  3UM3 A;  4NRH B;  3LKU A;  3TAX A;  3SO8 A;  3LJ3 A;  3Q75 A;  3PZ2 A;  2XRY A;  3B7R L;  2VTB B;  3LJN A;  5BPP A;  3LXU X;  2EIL E;  1OCZ E;  3FTU A;  4N2S A;  5DBK A;  4XKB A;  2P58 C;  3FTX A;  3ZXP A;  4WWP A;  2LSV A;  4GCO A;  3CQC B;  5EIL A;  4GMR A;  3KAE A;  5C1D A;  3DPY A;  1OWN A;  1O1R A;  1UW4 B;  2EIK E;  5G04 C;  2ILR A;  3ZRH A;  1H0A A;  3EHN A;  3LS8 A;  2I6H A;  3HVE B;  2XZT G;  3TWR A;  4U0Z A;  3FEX A;  4ZHB A;  5CEC B;  3ABK E;  3DSS A;  1H6O A;  4GZ5 A;  3HRA A;  3PH0 C;  3SFY A;  3ZNG A;  4HVB A;  2WXR A;  1H2V C;  4AM9 A;  1S64 A;  1EPU A;  3SNX A;  5ARG A;  1KT1 A;  1XGW A;  2AXU A;  3ZVV A;  3ESL A;  1WY6 A;  5CED B;  2KCK A;  5G55 A;  4M7C A;  4JA9 A;  4D10 C;  5CMY A;  4XE0 A;  5AAO A;  1DC2 A;  1UJK A;  1TN8 A;  3TG4 A;  2XCC A;  1SA4 A;  2Y4U A;  2MOW A;  4DJA A;  4O1O A;  2IF4 A;  1LD8 A;  1MZC A;  2L9B A;  3FTS A;  4FA6 A;  2IO3 C;  3MV3 B;  2YNQ A;  3Q73 A;  1D8D A;  4LG6 A;  2CFU A;  1N0R A;  2H6F A;  4LEU A;  3CHR A;  4GTV A;  3HXD A;  3CVN A;  2WXH A;  2DCP A;  4OAV B;  1X5B A;  3LY8 A;  2KC7 A;  4I1M A;  4N5Q A;  3CVQ A;  3FUH A;  5CMW A;  2E0I A;  3UTM A;  4I1O B;  4BET A;  2IJG X;  1S63 A;  4DI4 A;  2GGF A;  4I17 A;  3IBE A;  1FVH A;  5BV0 A;  4C9B B;  3B13 A;  4HI8 A;  4JPS A;  2LSU A;  3CHS A;  2L6B A;  3D9L A;  4B8A A;  3ENE A;  3W9F A;  2GW1 A;  1VDY A;  4CZ2 D;  3ASO E;  1E96 B;  3CGH A;  1JWF A;  2P9K G;  3V79 K;  1A5E A;  1FPP A;  5D66 A;  2WQ7 A;  1S0P A;  2NXP A;  1JCS A;  2WXK A;  2OV8 A;  1Y6I A;  1IQR A;  4BFR A;  2AXV A;  3AG4 E;  1OCC E;  1QYM A;  3C5R A;  3JXI A;  3JXJ A;  4U63 A;  1NFI E;  3WXX A;  3S7D A;  1Z3Y A;  4RG9 A;  5CEA A;  2QFC A;  3Q78 A;  1A17 A;  2J9Q A;  4JEH A;  2FEZ A;  4PS7 A;  3U4T A;  5AQ9 A;  4DX2 A;  1TNB A;  2OVB A;  4HLL A;  2NC9 A;  3FUM A;  2F8X K;  1TNO A;  4BTA A;  4JB8 P;  5EYP F;  4U95 D;  4BT9 A;  2R03 A;  3FTZ A;  1HFA A;  3D3M A;  4ILH B;  2VSN A;  5G05 C;  3CVP A;  4GPK A;  2VGX B;  4N3B A;  3V2X A;  1RW2 A;  2AXZ A;  2AWI A;  1YMP A;  1JCQ A;  4GZC A;  4BWR A;  4B0Z A;  4F1S A;  2OCC E;  3PRE A;  5JJ7 A;  2JEK A;  3FTY A;  1BU9 A;  5BXO A;  4GMJ A;  3ULE G;  3SQV A;  4TXR A;  3OXG A;  1DNP A;  4E6H A;  3APD A;  1L5J A;  2KCL A;  1N4Q A;  4KT6 B;  4MKT A;  3AS4 A;  2NYJ A;  2KZT A;  3MCX A;  3FU0 A;  3Q49 B;  2H6G A;  2BKK B;  4U04 A;  1IYG A;  4TUU A;  3E32 A;  4CT4 A;  1NI1 A;  1S70 B;  3SF4 A;  1DCE A;  1JCR A;  5G05 J;  4AEZ C;  4O6F A;  2V4H C;  4J8Y A;  3TGO A;  3D9I A;  4U8V D;  1U2V G;  5FZS A;  3URZ A;  5T8I A;  4KBQ A;  3CEQ A;  2FUL A;  4A3V A;  2ZXW E;  3ISM C;  3J5P A;  3LY7 A;  3T8M A;  1Z3X A;  1D9S A;  3AS5 A;  3KEZ A;  2XEV A;  2X3M A;  4B89 A;  2ETB A;  4HOR A;  4UQY A;  3PNT B;  2KM4 A;  4UWK A;  3UT4 A;  3SFZ A;  5J90 A;  1D8E A;  4UWL A;  1ELR A;  5A23 A;  1SZA A;  4KZ0 A;  4I2W A;  4JXT A;  3RSE G;  4A1S A;  4CEM A;  5LOZ A;  1W3B A;  4RLY A;  4WWO A;  3IKO B;  2DIW A;  1KPS B;  3EIQ C;  1N11 A;  4L7T A;  3D9N A;  1ZU2 A;  3PVL A;  1HG2 A;  2J07 A;  3CQG B;  3MEK A;  2Y3A A;  2GRM A;  4KZC A;  4APO A;  2XRZ A;  2R5S A;  2LXL A;  5LCW J;  3ML9 A;  1FCH A;  1OXJ A;  2X6F A;  3GZ2 A;  4I9E A;  3LVQ E;  4XX5 A;  2FO7 A;  4HRL A;  1PAQ A;  1X81 A;  2A4Z A;  3QDN A;  2WB2 A;  5ANR A;  3UM2 A;  2R17 C;  5ENR D;  2ETA A;  4UQX A;  3CR3 A;  1G3N B;  2VTB A;  3FP3 A;  3V30 A;  4JHJ A;  4G8K A;  5ITZ F;  3DXM G;  5KJL A;  4AXH A;  3B7T A;  1JWG A;  1H2U A;  4EZJ A;  4Q94 A;  2VGX A;  3B7S A;  3RRM B;  4EPZ A;  3UXG A;  3SZ7 A;  4L1B A;  4ACK A;  3RIB A;  4GU5 A;  3ABM E;  1H19 A;  5HS0 A;  3WG7 E;  4TXQ A;  5EX0 A;  2WMO A;  5C2Y A;  3CVY A;  4PS3 A;  3HHM A;  2WXI A;  5AJL A;  4CDN A;  4HQD A;  4HOS A;  4IN3 B;  2ION A;  3QJZ A;  3HVE A;  2AW6 A;  4CCA A;  1SA5 A;  4GAA A;  5FWQ A;  5AQB A;  1WAO 1;  1HXI A;  2VSX E;  1OCO E;  1SVX A;  2ZU6 B;  4AJW A;  2HM8 A;  2YIN A;  3R7R A;  4I9C A;  2L6J A;  1TYQ G;  2KZT B;  5JMN D;  4JA7 A;  2UY1 A;  4GTP A;  5KNG A;  5J08 A;  3JUI A;  5E76 A;  3QKY A;  2V8S E;  3QK0 A;  2EIJ E;  3ZHE B;  3QWW A;  4K0R A;  3PE3 A;  4MBG A;  1E90 A;  5AQA A;  2P2C P;  2LO6 A;  2XS8 A;  4GTO A;  3FTW A;  2VYI A;  1OWM A;  3ZXS A;  4GPM A;  4UI9 J;  2WXO A;  3DPD A;  3PZ1 A;  1UG3 A;  2XEE A;  4CGW A;  3UM1 A;  3PZD A;  4EQF A;  1E7U A;  2OEV A;  4HS2 A;  5AIJ A;  4JC8 A;  3ULQ A;  1UJJ A;  2X38 A;  4L9P A;  4URK A;  3G2W A;  4LSZ E;  4G23 A;  4B8C B;  4HLE A;  4FJY A;  3CIA A;  4APF A;  4OVV A;  3ZYK A;  4XZ4 A;  3D9P A;  3FDH A;  1E7V A;  1TNZ A;  3ABL E;  3ZN3 A;  2X6I A;  4HXI A;  4U7E B;  2X6H A;  3L08 A;  4LRZ A;  3E37 A;  5M72 A;  2P9N G;  4U8H A;  2Y69 E;  3TXM A;  3CVV A;  5CER B;  4FU3 A;  2V5Q C;  5AJD A;  3DEO A;  3HDX A;  2FBN A;  2H6I A;  4PH4 B;  3UKR G;  4RSY A;  3T9K A;  2WVI A;  3CKB A;  1FT1 A;  4UQZ A;  3HYM B;  3AJI A;  4DPR A;  1P5Q A;  3E34 A;  2V4L A;  4EBA A;  3DSX A;  2IOS A;  4IYP A;  4R7L A;  4GTQ A;  4GTR A;  3U64 A;  2Q7F A;  1AWC B;  4RG6 A;  1O1S A;  3QOU A;  1TN7 A;  2WXJ A;  3APF A;  2LNI A;  3RK6 A;  4N39 A;  3ULY A;  3C3O A;  4PDX A;  5FQ7 A;  3UT8 A;  4N2Q A;  3AS8 A;  3OAW A;  4GTS A;  1HG5 A;  2ZIS A;  4A3T A;  2R59 A;  3ZIM A;  5CHE E;  3SGH A;  3CHP A;  2YHC A;  1QNF A;  1SW6 A;  1O1T A;  4HRM B;  3QWP A;  4ANV A;  5AN8 A;  1B89 A;  4AOF A;  2I9C A;  2V5F A;  3JYS A;  3HG0 D;  4EHM A;  3BEE A;  4OYS A;  3ZW3 A;  2XS1 A;  3UUX A;  4HFG A;  5BW8 C;  3Q7F A;  5ARF A;  1PY1 A;  4GZ3 A;  2KCV A;  5AAR A;  5JHB A;  3DST A;  4GA2 A;  2Y0B G;  3L22 A;  4N3A A;  1ELK A;  2XPY A;  3BG1 B;  2VQ2 A;  2XQ0 A;  3Q9U C;  1E8Z A;  4QFV A;  3EHR A;  3DSU A;  4B94 A;  3OXF A;  4DLQ A;  5CBN A;  3PZ4 A;  5FT9 A;  5FIN A;  5LCW C;  4HBD A;  1ZBP A;  4O1P A;  5EIB E;  1HO8 A;  4BEP A;  3V31 A;  3CVX A;  2OOE A;  2J08 A;  5FIO A;  2XGM A;  5CRU A;  4X8Q A;  2XGO A;  4ILG A;  4CT0 A;  2VJ8 A;  4YDE A;  3ZYQ A;  3UIN C;  1JUQ A;  2LUH A;  3EUV A;  1GW6 A;  3ZGQ A;  5A6C A;  5FQ4 A;  2QYU A;  4LNG A;  3DBS A;  4NAC A;  4G2V A;  1DVP A;  5BT1 A;  3E33 A;  3KD7 A;  2IU1 A;  3SBT B;  3FUE A;  2XEH A;  4DUI A;  3HXB A;  3MKQ A;  3V2O A;  3EDT B;  4LNU D;  3FUL A;  5CRV A;  3L17 A;  3KSQ A;  1XNF A;  3TWX A;  2JLB A;  3P1U A;  2F8Y A;  3ZEF A;  5JJ6 A;  4TV3 A;  4DK5 A;  3U66 A;  2WM9 A;  1K8K G;  4XEI G;  3QWV A;  4ANW A;  1UN9 A;  5B3S E;  3SHF A;  3FH7 A;  5ENQ D;  1DCQ A;  3Q7A A;  5KNH D;  4AY5 A;  3Q79 A;  3QAQ A; 
#chains in the Genus database with same CATH homology
 1ELW A;  3EJN A;  3IHY A;  5ANR A;  1Y8M A;  2R17 C;  5BUZ A;  3RO3 A;  4UWH A;  1QZ2 A;  4NRH B;  3PDN A;  5T4Y A;  3CK8 A;  2WXP A;  3LKU A;  3TAX A;  5BNW A;  3ZYM A;  4UQX A;  3CR3 A;  5FTP A;  2VTB A;  3QAR A;  4I1A A;  4BX9 A;  2CFZ A;  3FP3 A;  3LJ3 A;  4JHJ A;  4LUN U;  4XIF A;  4CGV A;  5KJK A;  5KJL A;  4AXH A;  3B7T A;  3S7F A;  1JWG A;  1INZ A;  3B7R L;  1H2U A;  2XRY A;  3APC A;  4AY6 A;  3QC1 A;  2VTB B;  4EZJ A;  5BPP A;  4Q94 A;  3O4Z A;  3TG5 A;  3LXU X;  2VGX A;  3B7S A;  4BSX A;  3RRM B;  3UX4 A;  3FTU A;  2PM6 A;  4EPZ A;  5T3R A;  4N2S A;  4U0U A;  3IHV A;  2NSZ A;  4XKB A;  5DBK A;  5LP0 A;  3LY9 A;  2P58 C;  3FU3 A;  2XHE A;  4J8F A;  4L1B A;  5D0O D;  2GRL A;  3SZ7 A;  3RIB A;  3FTX A;  4ACK A;  4WWN A;  3MA5 A;  4GU5 A;  4WWP A;  2LSV A;  3OTN A;  1Z6T A;  3GZ1 A;  4GCO A;  1H19 A;  3CQC B;  3TL5 A;  3D9M A;  2LAH A;  4F3V A;  3OXL A;  3ASG A;  3KAE A;  4KMO A;  5C1D A;  1OWN A;  3N71 A;  5EX0 A;  2PQN A;  1UW4 B;  4BT8 A;  2CG2 A;  2WMO A;  4YND A;  5C2Y A;  3CVY A;  2WQ6 A;  4PS3 A;  4GYO A;  3HHM A;  3L54 A;  4JEU A;  1YA0 A;  5G04 C;  2WXI A;  4KVM A;  4FLH A;  1SQM A;  2ILR A;  2CHZ A;  4J8E A;  5AJL A;  3ZRH A;  4CDN A;  1H0A A;  2I2O A;  3EHN A;  3LS8 A;  4UI9 C;  4WUY A;  2I6H A;  5FQ8 A;  3HVE B;  1N54 A;  3K9I A;  4GCN A;  4JW1 A;  4NUR A;  2CG3 A;  3ASH A;  2PQR A;  3FUK A;  4U0Z A;  3FEX A;  4BX8 A;  2MHK A;  2C2L A;  4HOS A;  4IN3 B;  2ION A;  3QJZ A;  3HVE A;  2AW6 A;  2FI7 A;  4CCA A;  5ANL A;  4GAA A;  2J4B A;  2J4D A;  2M63 A;  4GZ5 A;  3PH0 C;  4HVB A;  2WXR A;  3U3W A;  2V0P A;  1H2V C;  5FWQ A;  1WAO 1;  4AM9 A;  3FTV A;  1EPU A;  1HXI A;  4TRQ A;  3PEV B;  4C0M A;  2YQ8 A;  3VLD A;  2VSX E;  3SNX A;  5ARG A;  1HX8 A;  3ASF A;  3FEY A;  4KYO B;  2ZU6 B;  1KT1 A;  4JL0 A;  1XGW A;  3D9O A;  2AXU A;  4AJW A;  2HM8 A;  2YIN A;  3ZVV A;  3ESL A;  2RG8 A;  5EKQ D;  3D9K A;  3R7R A;  1WY6 A;  4I9C A;  2L6J A;  2KCK A;  5G55 A;  2KZT B;  2QY7 A;  4F7A A;  4JA7 A;  4JA9 A;  4WNG A;  3CSF A;  3Q5M A;  4D10 C;  2UY1 A;  5CMY A;  1JPL A;  1WM5 A;  4I43 A;  4EZL A;  2EQX A;  1E8W A;  1E8Y A;  4XE0 A;  1HU3 A;  1UJK A;  3ESK A;  3KS2 A;  3TG4 A;  5J08 A;  5E75 A;  2XCC A;  4A55 A;  3FUJ A;  3FY4 A;  3JUI A;  2Y4U A;  5E76 A;  2MOW A;  3QKY A;  4DJA A;  3TXN A;  4HOT A;  2V8S E;  2HO1 A;  4U07 A;  4AIF A;  3QK0 A;  2IF4 A;  4G24 A;  3FU6 A;  3VTY A;  2L9B A;  3FTS A;  2J09 A;  3T5X A;  4N3C A;  4FA6 A;  4H7Y A;  1UN8 A;  3QWW A;  3ZHE B;  4K0R A;  4I2Z A;  3MV3 B;  3PE3 A;  2YNQ A;  5D0Q D;  1E90 A;  3I5P A;  2LO6 A;  2CFU A;  3FTW A;  2VYI A;  1OWM A;  3ZXS A;  4UI9 J;  4NQ0 A;  4LEU A;  3CV0 A;  3CHR A;  2WXO A;  3SBS A;  3CVN A;  2WXH A;  3CST A;  2DCP A;  5CCM A;  5FJY A;  3DPD A;  1X5B A;  3LY8 A;  2KC7 A;  4I1M A;  1UG3 A;  2HR2 A;  4CRW A;  2XCB A;  4CGW A;  3ONL A;  2VSO E;  3CVQ A;  3PZD A;  3SI5 A;  2HYZ A;  3FUH A;  2I1J A;  3MYV A;  3FUD A;  3TJP A;  1HS6 A;  4J0U A;  4EQF A;  3G2T A;  5CMW A;  4EEC A;  1E7U A;  3CK7 A;  4I6J A;  2E0I A;  3S7J A;  1EF1 C;  5JHA A;  4I1O B;  4HS2 A;  5AIJ A;  4JC8 A;  3ULQ A;  1UJJ A;  2IJG X;  4A1G A;  4C0E A;  4DI4 A;  4P29 A;  2GGF A;  4BTB A;  2X38 A;  4I17 A;  4URK A;  3IBE A;  1NA0 A;  2WQH A;  1FVH A;  5BV0 A;  1HH8 A;  3G2W A;  4C9B B;  3B13 A;  4G23 A;  4WAF A;  4B8C B;  4DLO A;  4JPS A;  4HLE A;  2LSU A;  4FJY A;  3CHS A;  3D9L A;  3P2B A;  4B8A A;  3CIA A;  4APF A;  4OVV A;  3ENE A;  3ZYK A;  4GB9 A;  4XZ4 A;  3VLF A;  3RKV A;  3CHO A;  3D9P A;  2GW1 A;  1U3C A;  1E7V A;  1VDY A;  3FDH A;  3I3N A;  4AV7 A;  3MGB A;  5EDS A;  1E96 B;  3CGH A;  1JWF A;  3PRZ A;  2YHE A;  3RJV A;  4AVX A;  3LEW A;  4Q69 A;  2KAT A;  3UMV A;  3ZN3 A;  2X6I A;  4HXI A;  5CCL A;  2WQ7 A;  2X6H A;  1S0P A;  2NXP A;  4J8D A;  2IOL A;  2WXK A;  3L08 A;  4XI0 A;  3CVW A;  4LRZ A;  1OWP A;  4DI3 A;  2OV8 A;  1Y6I A;  1IQR A;  3AU5 A;  4BFR A;  4V3I A;  2AXV A;  3QB2 A;  4G11 A;  5M72 A;  3LCA A;  4YVO A;  3MZL B;  1BPO A;  5KJM A;  3G2S A;  3CVL A;  3EIJ A;  4U0S A;  3IEG A;  4U8H A;  4HOQ A;  5DIZ A;  1N52 A;  3TXM A;  3NQP A;  3PS6 A;  2UWJ G;  1OWL A;  4U63 A;  3SD5 A;  3WXX A;  3CVV A;  3S7D A;  1Z3Y A;  4RG9 A;  2UY1 B;  4FU3 A;  2WXF A;  1NP7 A;  3GYZ A;  4EZK A;  2IQC A;  2QFC A;  5AJD A;  2VGY A;  1A17 A;  4UWG A;  3FUN A;  2J9Q A;  4JEH A;  2C0L A;  3S2A A;  3HDX A;  2FBN A;  2FEZ A;  2WXM A;  4PH4 B;  4PS7 A;  4GA1 A;  3U4T A;  3PUJ A;  3AU4 A;  3B7U X;  4H7X A;  4Q96 A;  2CHW A;  4L23 A;  4RSY A;  2OVB A;  2WVI A;  3UQ3 A;  2NC9 A;  3FUM A;  4BTA A;  4MRU A;  2J49 A;  3FFL A;  3CKB A;  4XI9 A;  1IQU A;  3JQ0 A;  3L6A A;  3HYM B;  3Q47 B;  4UQZ A;  4BT9 A;  3FTZ A;  3GZS A;  1HFA A;  4DPR A;  1P5Q A;  5HQ8 A;  4G26 A;  2Y4T A;  3D3M A;  4ILH B;  3S7B A;  2VSN A;  5G05 C;  3CVP A;  4GPK A;  2VGX B;  4N3B A;  4W9R A;  4WNF A;  2AXZ A;  2V4L A;  2AWI A;  3RRN B;  4EBA A;  1TEZ A;  4HOU A;  3FHE A;  5LX8 A;  3ZHE A;  1H2T C;  3FUF A;  4GZC A;  1H6K A;  4BWR A;  4UWF A;  4B0Z A;  2IOS A;  4IYP A;  4F1S A;  4R7L A;  5JJ7 A;  3PRE A;  1OWO A;  4ANX A;  3U64 A;  2JEK A;  2L0T B;  2Q7F A;  4J6I A;  3FH8 A;  4ME2 A;  2BF0 X;  3I4R B;  4ILI A;  2XPI A;  3PEU B;  3FTY A;  4IUL A;  4RG6 A;  4G25 A;  3QOU A;  3NF1 A;  5G04 J;  3UPV A;  2WXJ A;  4ABN A;  1HZ4 A;  4Y6C A;  1QQE A;  3APF A;  4FUL A;  4GMJ A;  2LNI A;  3RK6 A;  3FUI A;  4N39 A;  3OXG A;  1DNP A;  4E6H A;  3APD A;  1L5J A;  2KCL A;  3MX3 A;  4N5C A;  4OVU A;  3R7Q A;  4KT6 B;  4PDX A;  4MKT A;  5FQ7 A;  3AS4 A;  3UT8 A;  4N2Q A;  3ZPJ A;  3G2V A;  3AS8 A;  3JCK C;  3OAW A;  4I6G A;  2KZT A;  4UI9 K;  4ATG A;  3MCX A;  2WMN A;  1HG5 A;  4CDM A;  3FU0 A;  4G1T A;  2OND A;  4A3T A;  3Q49 B;  2R59 A;  4ACL A;  3NZU A;  2I1K A;  3ZIM A;  4U04 A;  5CHE E;  2AVP A;  4EBA G;  4K03 A;  3FH5 A;  3SGH A;  3RU0 A;  1IYG A;  3CHP A;  3LPZ A;  4XKC A;  2YHC A;  3UT7 A;  4TUU A;  2XPZ A;  4CT4 A;  1QNF A;  3VTX A;  2L0I A;  4GML A;  3O48 A;  1MQS A;  3ZYL A;  3Q4A B;  2WPV A;  1FVF A;  3SF4 A;  3QWP A;  4ANV A;  4PUC A;  3E4B A;  1TJC A;  4WND A;  5FZR A;  4KVO A;  3RRU A;  4J8S A;  5EX3 A;  1B89 A;  5G05 J;  4FJZ A;  2BTD A;  4O6F A;  4AEZ C;  4AOF A;  2I9C A;  2V5F A;  3TGO A;  3JYS A;  3D9I A;  4BY6 A;  3BEE A;  2X6K A;  4OYS A;  5FZS A;  3ZW3 A;  3URZ A;  4L2L A;  5T8I A;  4KBQ A;  4JHR A;  3UUX A;  3CEQ A;  1NA3 A;  2FUL A;  5FQ6 A;  4A3V A;  4F53 A;  4GYW A;  1TJF A;  3EHM A;  4HFG A;  5BW8 C;  2E2E A;  2WXL A;  4AP2 A;  5ARF A;  1PY1 A;  4MS6 A;  4GZ3 A;  3L16 A;  4FLB A;  2KCV A;  3D9J A;  5HI7 A;  2PZI A;  2LAI A;  3LY7 A;  3QNK A;  3T8M A;  4GA2 A;  5JHB A;  3ONK A;  4FP7 A;  1SZ9 A;  3IV0 A;  4JZY A;  2WXN A;  1Z3X A;  3G2U A;  3L22 A;  4N3A A;  5KJN A;  1ELK A;  4JVS A;  3AS5 A;  2XPY A;  3KEZ A;  3BG1 B;  2XEV A;  2VQ2 A;  2XQ0 A;  2PL2 A;  5KCM A;  3RO2 A;  2PM7 A;  5JJT A;  2X3M A;  1E8Z A;  3LDZ A;  3I4G A;  4QFV A;  4B94 A;  4GA0 A;  3OXF A;  4DLQ A;  4B89 A;  5FT9 A;  5LCW C;  4HOR A;  1ZBP A;  3PUK A;  1LF8 A;  4UQY A;  3L13 A;  3MKQ B;  2C0M A;  3PNT B;  4M3O A;  2KM4 A;  4CDR A;  1HO8 A;  2CHX A;  5A7D B;  1U3D A;  4IRU A;  4UWK A;  3U9W A;  3CVX A;  3UT4 A;  2OOE A;  3SFZ A;  2J08 A;  4GZ6 A;  2IFU A;  5J90 A;  1OUV A;  1EDU A;  3LVR E;  2XGM A;  2VSY A;  4YVQ C;  2WXG A;  2XGO A;  4ILG A;  4UWL A;  1ELR A;  1KLX A;  4JHK A;  3Q15 A;  5A23 A;  1KT0 A;  1SZA A;  3CK9 A;  3PNL B;  3LYA A;  4CT0 A;  5LFA A;  4KZ0 A;  4FAD A;  2VJ8 A;  2XGS A;  3CHQ A;  4I2W A;  4JXT A;  3ZYQ A;  1JUQ A;  2DBA A;  1IHG A;  4A1S A;  4CEM A;  1GW6 A;  3ZGQ A;  5A6C A;  5FQ4 A;  4MLP A;  4WNE A;  5LOZ A;  1EYH A;  1W3B A;  2RD0 A;  3DBS A;  4I6E A;  4NAC A;  4FC8 A;  4WWO A;  3IKO B;  3JQ1 A;  1NZN A;  1DVP A;  4G2V A;  2FF4 A;  2DIW A;  4KXK B;  4PS8 A;  5BT1 A;  3EIQ C;  2OVF A;  3PE4 A;  3T5V A;  4L7T A;  3D9N A;  1E8X A;  1HE8 A;  3KD7 A;  2IU1 A;  3SBT B;  1ZU2 A;  3ML8 A;  5AEN A;  3FUE A;  3CVU A;  3PVL A;  3ASD A;  1HG2 A;  3MKQ A;  2J07 A;  3CQG B;  5G2N A;  3MEK A;  5BV1 A;  4Y6W A;  3EDT B;  3CKC A;  2Y3A A;  3FUL A;  4E85 A;  2GRM A;  3MV2 B;  3L17 A;  4L2Y A;  3VLE A;  1HF8 A;  4GZD A;  3CLJ A;  5ENN A;  4LER A;  4KZC A;  4APO A;  3ZFW A;  1XNF A;  3BG0 B;  3C98 A;  5FZQ A;  2XRZ A;  2JLB A;  3P1U A;  2R5S A;  5LCW J;  5AYW D;  3ML9 A;  4ANU A;  1FCH A;  3HIZ A;  3ZEF A;  5JJ6 A;  1MHQ A;  4TV3 A;  4DK5 A;  4FHJ A;  2X6F A;  3R9A B;  2BUG A;  3U66 A;  3FWV A;  3GZ2 A;  2WM9 A;  1PC2 A;  2A5U A;  4GYY A;  4I9E A;  3LVQ E;  4XX5 A;  3MJW A;  2FO7 A;  3QWV A;  4RVB A;  4ANW A;  2MRI A;  3FU5 A;  2X6J A;  1PAQ A;  1UN9 A;  3MKR A;  2A4Z A;  3NZS A;  3SHF A;  2WXQ A;  3GW4 A;  3CHM A;  3FH7 A;  3QDN A;  4LCT A;  4AY5 A;  4FHK A;  3QAQ A;  2WB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...