4ATGA

Taf6 c-terminal domain from antonospora locustae
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
195
structure length
195
Chain Sequence
GSHMLPKELQLYFDKILSMIKSDMKDIAIECLEKESGLQQLVPYFIQHISELILKSFKEAEVLKTCIALYFSLIKNKHVFIDPYLHQILPSLLTCVIGKSIVDDDVRKMSADIVKYIYDTYSRSYKTLAPRVLKTLKGVWMDPNRSEDSQYGALYCLSILSKNVVNTVIREHAEEYKRTIGKKKVTNLLDNVLNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TAF6
publication title TFIID Taf6-Taf9 Complex Formation Involves the Heat Repeat-Containing C-Terminal Domain of Taf6 and is Modulated by Taf5 Protein.
pubmed doi rcsb
source organism Antonospora locustae
total genus 77
structure length 195
sequence length 195
ec nomenclature
pdb deposition date 2012-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07571 TAF6_C TAF6 C-terminal HEAT repeat domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.770 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4atgA00
4ATGA
chains in the Genus database with same CATH superfamily
3C3RA 4CEMA 5E76A 3OAWA 2IOLA 3ZEFA 3TWRA 3FUNA 3D9IA 3ZXPA 3KD7A 2CFUA 2NYJA 3U66A 5CEAA 2WXIA 3UIPC 3VLFA 4F1PA 3WG7E 2WMOA 2WVIA 4A1GA 5ITZF 5ENTD 4URKA 4JZYA 3TWWA 4TRQA 1D8DA 4FHJA 3Q75A 4HOTA 1ELKA 1HO8A 3URZA 1IKND 4O1PA 3T5VA 4GTPA 4GTTA 3ASFA 3JUIA 2J4DA 2IOSA 5CHEE 3UKUG 2OOEA 2HR2A 4FP7A 3FUHA 3PZ1A 3U4TA 4ILGA 2AXUA 4EZKA 5D2MC 2DYRE 4KXKB 1INZA 3R9MA 1H2TC 4CDNA 2VTBB 3APDA 2XGMA 4BESA 1BPOA 4M3OA 2QC9A 4O6FA 5AQ9A 5ENRD 5AENA 3L6AA 2P2CP 3E34A 4H7XA 2KM4A 4GTRA 3UMVA 4TV3A 3E30A 3FFLA 4B0ZA 1FCHA 2AW6A 3AG4E 2XGOA 2X6IA 4ZHBA 3ZN3A 4GTSA 1OCCE 3MV2B 5EYLA 3HDXA 4GA1A 3ZPJA 3DEPA 4IRUA 5J90A 4L23A 2CFZA 5KNHD 2OEVA 1DNPA 2HO1A 1E96B 5C1DA 1MJ0A 2E0IA 2BUGA 3ABME 3NB2A 4HRMB 2AVPA 4GCOA 3U3WA 4Q94A 3RRUA 4I9EA 4F53A 3FUIA 5DBKA 3MZLB 2BEDA 1UW4B 3AS4A 4MLPA 3D9MA 4YVOA 4I2WA 4HLLA 3CVNA 4DX6D 5D66A 5ENPD 3LJ3A 2Q7FA 4GMJA 3D9KA 3I3NA 4AEZC 1N4QA 3LDZA 1UG3A 3DXMG 4EQFA 1YYHA 4KVOA 3D9OA 3CVYA 5FWQA 3HXDA 3MV3B 3FEXA 3V79K 4FHKA 2P9LG 3DSSA 4MKTA 4LNBA 4UWLA 4ILIA 5AQ7A 2VYIA 3LCAA 1H0AA 3G2SA 3JYSA 4DI3A 1Z3XA 3DXKG 4GYYA 3V2OA 3MX3A 5AN8A 5LFAA 2YNQA 2I2OA 4N5QA 1NP7A 2V4LA 4NACA 3HG0D 1V54E 5CRVA 1Z3YA 3CQCB 3SI5A 2F37A 5EX3A 1OCRE 2BF0X 4AVXA 3OTNA 1XNFA 4I1MA 3PREA 5DIZA 1WM5A 3D9JA 2HM8A 2OCCE 1OY3D 4B94A 4N2QA 3Q7FA 3V31A 1JCRA 5AAOA 3ISMC 2XRYA 4RVBA 3D9PA 1Y8MA 2H6GA 1IQUA 4CT4A 5A6CA 1E90A 3QWPA 1FT1A 2ZISA 1DCEA 5ENSD 3UPVA 2LAHA 2WXMA 4PUCA 4G25A 4WAFA 4UQYA 3QWVA 4J6IA 4L2LA 3LY9A 3HYMB 3OXLA 5CBNA 2ILRA 3L08A 5E75A 2OV8A 2IQCA 5JMND 5EYPF 4NQ0A 4U0ZA 3HIZA 4AP2A 4GAAA 3UI2A 4RG9A 4JD2G 5FQ6A 3ZGQA 1ZB1A 2RKKA 5BV1A 1EPUA 1HG5A 3MA5A 2QZAA 2IY0C 4JXTA 4CRWA 5A23A 2P9SG 3DPDA 3QWWA 1BD8A 1OCZE 5M72A 5ANRA 5AYWD 2PM7A 4UWGA 5T3RA 3EHQA 3HXBA 2H6FA 3ULYA 3PEVB 2J49A 4G8LA 2KCKA 2DCPA 3FH5A 4U95D 4LERA 5AQBA 1MX4A 4JA9A 4AOFA 1AWCB 3ENEA 3ZU7B 2VJ8A 1HZ4A 3Q47B 5ENOD 4KYOB 3LKUA 2NC9A 3G2TA 4DX1A 1GW6A 3UX4A 4BSZB 4BFRA 2YHEA 2B6CA 4O1OA 3FUKA 3ML9A 5KNGA 2DBAA 3Q9UC 4CGVA 3LVQE 4LRZA 5AIJA 1Y6IA 4CGWA 4R7LA 4UWKA 2R03A 4HXIA 1N0RA 4BTBA 1IQRA 5ANLA 4JB8P 1X5BA 4N2SA 5AQAA 2V4HC 3CHRA 4KBQA 4M7CA 4TUUA 2L9BA 4UUCA 4FC8A 4L9PA 3UM1A 3ASOE 3ASHA 3JQ1A 3S7BA 1N52A 3RIBA 1OWNA 5EX0A 2XCCA 3JXIA 2ETAA 1ZBPA 3K9IA 4A3VA 3CHOA 1TNOA 3N71A 1UJKA 2ZGDA 3G2UA 3VTXA 3T5XA 3AU4A 5C2YA 4WWOA 5T4YA 2KZTB 2IO2C 3S2AA 4AJWA 4D10C 3CEQA 4HOSA 2X6KA 1VDYA 2RD0A 1TEZA 4IULA 2VSYA 5JJTA 4KT6B 2EILE 4BY6A 2JEKA 3MJWA 2C2LA 3FTUA 3OXGA 1SQMA 1IHGA 1N54A 3O48A 2XPIA 4GTOA 3BU8A 4FADA 4BEPA 1N4PA 4LUNU 2XHEA 3DRAA 1TNBA 5H7PA 3AG2E 4OVVA 5G2NA 1N95A 1KZOA 3SY2A 3UTMA 4L2YA 3LJNA 3F6QA 3Q73A 2WXPA 4WNGA 1TYQG 4ZFHA 4FJZA 3KEZA 3RO3A 2XEVA 5CMYA 4PS8A 3ABLE 4I6GA 3CK8A 4FULA 4L7TA 1N11A 3CV0A 2GRRB 4Z68A 3E37A 2WXGA 4GA0A 1OUVA 4F6RD 5JA4D 5CBOA 4LG6A 2GRPB 3G2WA 4QFVA 2EQXA 2A4ZA 3UKRG 3B13A 3SBTB 4BX8A 4DK5A 4I43A 2QYJA 4A3TA 1MYOA 2Y4TA 4C0EA 3GW4A 1OWLA 2KBXA 3KAEA 1MQSA 2PL2A 3U64A 3UT8A 4CZ2D 2VTBA 3PUKA 1EF1C 3L82A 4LEUA 2R17C 4OAUC 2IFUA 2MYOA 3E33A 1H19A 4UI9J 3R9AB 3IV0A 3ZVVA 1E8YA 4EZLA 3CVUA 1U3DA 2CHWA 2FEZA 1IYGA 4JW1A 3IXEA 5FQ7A 3Q15A 5HKPA 4QQIA 4EBAG 4BERA 3IBEA 4DLOA 4ACLA 1B89A 4FA6A 4I6JA 4DX7D 2DZNA 3EU9A 1IHBA 3C98A 3AU5A 3CVVA 5B1BE 3T8KA 4EBAA 1OT8A 4I6EA 3ASGA 3EDTB 4ABNA 4YVQC 4B8AA 3TWXA 1Q2ZA 3FWVA 1QYMA 5G04C 4A55A 5G55A 1O1RA 2I1KA 2EIKE 4ATZD 1H2UA 3VLDA 2Y4UA 4MBGA 3CSFA 3TG5A 2XPZA 3E32A 3PZ4A 4GZ5A 5ARGA 3PNLB 2C0MA 4G2VA 2V8SE 3SNXA 1OWOA 3D9NA 4GA2A 3DSTA 3S7DA 3T9KA 2HE0A 4HNAD 3PS6A 4J8EA 3QOUA 4B8CB 5AJLA 4AM9A 1N9AA 3SGHA 4H7YA 3LY7A 3B95A 1LD8A 4P29A 3SBSA 3HXFA 3B7RL 3FU0A 2IF4A 3R7RA 5JHAA 3ZFWA 2NSZA 4W9RA 4CDMA 1S0PA 3TWTA 4HFGA 2R59A 4F1SA 3MKRA 3HXCA 2X3MA 2MHKA 1EYHA 1H6OA 4X8QA 2LNIA 3SO8A 3J5QB 4CCAA 4F3VA 4F7AA 4EHMA 1TJCA 3CK7A 1HF8A 3L13A 3GZ1A 1AP7A 2Y3AA 2P9PG 3PZ2A 3TWSA 3V30A 2LXLA 3ZYLA 3PH0C 3VTYA 2XENA 3FU3A 3BG1B 4U63A 5LCWJ 1EDUA 2FO1E 5CMWA 3FEYA 5KJKA 3NZUA 1SW6A 2IU1A 2XZDG 1G3NB 3AAAC 4V3IA 1W3BA 3LS8A 3TXNA 3AG3E 4WWNA 2OVFA 4PS3A 3SQVA 4EECA 4AXHA 1FT2A 1HG2A 1YMPA 5FZRA 2DIWA 4J8FA 3I5PA 2XS1A 4GYWA 4GZDA 2QY7A 4XX5A 2V5FA 1WG0A 3QC1A 3APFA 3TJPA 3ZIMA 2MRIA 2WXQA 3D9HA 3UM3A 2YQ8A 2X6JA 4BSXA 3ZUVB 3RO2A 5ARFA 4L1BA 1QNFA 5BT1A 4BX9A 1HE8A 1O1SA 4RLYA 4FLHA 2F0YA 1E7VA 2LSVA 2VGEA 2XPYA 1ELRA 3NOCD 4RSYA 1TN7A 4LNGA 1PC2A 1RZ4A 3ZKJA 4GCNA 2DZOA 1NA3A 4MRUA 4U04A 3HVEB 4BT9A 4G1TA 3CHSA 1X81A 5KJLA 1TNZA 4J0UA 1V55E 3DBSA 4I1AA 5CCMA 4HS2A 4G11A 1JWFA 3QKYA 3CKCA 4HQDA 2P9UG 3CHPA 2VSOE 2CG3A 5BPPA 4C9BB 2FBNA 3C3OA 4XKCA 4DRXE 2RG8A 3O4ZA 2LXMA 2KATA 3UM2A 3AG1E 4XEIG 2EIME 1NL4A 2P58C 3EHRA 3ONLA 3RAUA 3UINC 3FUFA 2KZTA 2GRNB 4TXPA 2RFAA 4HRNA 4HI8A 1K3ZD 4CDRA 3QJZA 4GZ3A 3CIAA 3HXEA 4DX2A 5D0QD 5FZSA 2PZIA 2VSXE 2LSUA 2QYUA 3FH7A 3DSVA 3ML8A 2XEEA 1UOHA 2GRQB 4FU3A 3TWQA 5FT9A 3EIJA 1SA4A 4GZ6A 5BV0A 1BU9A 1KT1A 3E4BA 1L5JA 1HX8A 2FULA 4K5BA 1OXJA 1IXVA 4ACKA 3DSXA 3PZ3A 2NXPA 5CEDB 3L9TA 4JPSA 3FDHA 1RW2A 4A63B 3WXXA 1KT0A 3Q79A 4JA7A 3UUXA 1LD7A 4WNDA 1DCQA 3PZDA 2UY1A 3SZ7A 3CQGB 3ASNE 3LXUX 3MGBA 3QB2A 3MKQA 1YCSB 2XS8A 2GRLA 4GU5A 1H6PA 2WXKA 3FUMA 4XE0A 4RG6A 4K5AB 1DC2A 2HYZA 5KJNA 4GTVA 1HS6A 3RU0A 4HOUA 4N3AA 4UQZA 5KCMA 4YDWA 3EHNA 5JHBA 4JEUA 3MYVA 3NBNB 2I6HA 4O60A 3TXMA 1YA0A 3W9GA 3ZW3A 5ENQD 2BTDA 2V0PA 5FINA 3LYAA 4TXQA 1JCQA 2IO3C 3TWVA 4G24A 2UY1B 3AJIA 1HXIA 2ZXWE 3TG4A 1S70B 3FP3A 1LF8A 3HRAA 4OAVB 3MKQB 5KBAA 4CT0A 4ANXA 2DYSE 2WXOA 1FVFA 1D9SA 4LNUD 5B1AE 3CKBA 4Y6WA 2QFCA 3U9WA 4AY6A 5EDSA 1A17A 2FO7A 3AS8A 4U96D 3ZNGA 3CSTA 3SFYA 1NZNA 5JJ6A 3W9FA 1QBQA 4U7EB 2ZGGA 3Q5MA 4XKBA 1DVPA 3FUJA 2Y1LE 3QARA 4GZCA 3LY8A 4KMOA 3ESLA 4XI0A 3CVXA 2P9IG 2L6BA 3EU5A 3ZHEA 3FTWA 4K0RA 3FUEA 3JCKC 4APOA 4J8SA 3L54A 2WQHA 4FLBA 3IKOB 2IEJA 3B7UX 3BG0B 3BUAA 4HI9A 1HU3A 2GRMA 5FZQA 2VGXA 2X38A 2WXRA 2CG2A 1PY1A 3GYZA 1U2VG 4U8VD 2VQ2A 4U0UA 3CGHA 4G26A 2J08A 3LVRE 1UN9A 4E6HA 4J8DA 4TUMA 1N0QA 4DLQA 2J9QA 2PM6A 1E8ZA 4ILHB 3EHMA 4J7WA 3G2VA 2XGSA 4GB9A 3OXFA 4AIFA 4NIKA 4YNDA 2R5SA 3I4RB 4DPRA 2VSNA 3ESKA 2YINA 4WNFA 3EUVA 2I9CA 4ANUA 3ZHEB 2JLBA 4APFA 3ULQA 2WXHA 4ANVA 3FH8A 2OEWA 3Q4AB 3PNTB 1SVXA 2PQRA 3DWLG 1K8KG 2VGXB 3SD5A 3B7TA 3JUEA 5B3SE 3IHYA 3ZXSA 1XGWA 3UIOC 2XCBA 3DEOA 4HORA 3PUJA 2FI7A 4UI9C 4HVBA 2P9NG 3FU5A 1ZU2A 2Y69E 3CVWA 5CERB 1SZAA 3RSEG 4BETA 2GW1A 1WDYA 2DVWA 1K1AA 4GTQA 3RRNB 1BI7B 2ZIRA 2WQ6A 3GZSA 2KC7A 3CK9A 3AS5A 5BW8C 4UWHA 5IY5E 2R05A 3NAWA 5HRYA 3D3MA 3Q78A 2WM9A 2H6HA 4BT8A 1SZ9A 2AWIA 1LTXA 1HH8A 3RJVA 2WXLA 2F8XK 2E2EA 1S63A 2L0IA 2XZTG 1UJJA 2AXZA 1KZPA 4DX5D 3CHMA 3ONKA 4U8HA 4Y6CA 3BEEA 3TL5A 4N39A 1N4SA 4PDXA 3BQOA 4DI4A 4ANWA 3QDNA 1D8EA 3QK0A 5CCLA 4EPZA 3EJNA 3FTSA 3RRMB 4MS6A 5BXUA 3SFXA 3FTXA 4DJAA 1QZ2A 4C0MA 4XIFA 2CHZA 3DPYA 3TGOA 2VGYA 3QAQA 5T8IA 3RKVA 5EN5D 2IJGX 1FVHA 2UWJG 3HVEA 3Q9NC 4OYSA 3PE3A 4HOQA 1MHQA 4ATGA 4GTMA 1MX2A 3FTYA 1P5QA 1TN8A 3KS2A 4JHRA 2AJAA 4GMRA 4EZJA 3MEKA 3Q49B 2WXFA 1SA5A 1H6KA 3D9LA 1E8WA 5G05J 1OCOE 3CR3A 3B7SA 2EINE 5FQ4A 1QQEA 3SHFA 2WPVA 3P2BA 3UT7A 1KLXA 2ETCA 2ZU6B 2FF4A 2OVBA 5FJYA 2EIJE 4N3BA 2WXNA 1WY6A 3TWUA 4FJYA 1NI1A 4KZ0A 1S64A 2RFMA 4GPMA 5BUZA 4K5CA 4NRHB 1OWPA 3LPZA 3S7FA 3QNKA 1BI8B 3ZYMA 5EIDA 1Z5SC 2XRZA 3KEAA 5LCWC 5FQ8A 3NF1A 5HI7A 2KCLA 2LUHA 4YDOA 1OWMA 3FTVA 5FTPA 1PAQA 4YDEA 3ULEG 4ME2A 4I9CA 3IHVA 1BLXB 4HB5A 3FULA 2XQ0A 4A1SA 3ZRHA 3C72A 4XZ4A 4GYOA 4RQIA 2GROB 1K1BA 3Q7AA 1JUQA 4Q69A 2XEHA 2Y0BG 3PVLA 2IONA 2WQ7A 3UXGA 5AARA 4WUYA 2AXVA 4HBDA 3LEWA 5G05C 4JHJA 2F8YA 3CLJA 4UI9K 3FU6A 3L17A 3C5RA 2PQNA 3JQ0A 4NURA 1TNYA 4UQXA 2GGFA 2J8SD 4JHKA 3CVLA 5HQ8A 3ZYQA 3R7QA 5LP0A 3IEGA 1JCSA 5EKQD 2B0OE 1MZCA 4KVMA 2J4BA 3T8MA 5LX8A 4HRLA 2I1JA 5AJDA 3ASDA 3RK6A 5JJ7A 4E85A 3KSQA 2PNNA 1E7UA 4I17A 4I1OB 2C0LA 3PRZA 2YHCA 3L16A 3TAXA 3NOGD 4KZCA 4PS7A 3SFZA 4Q96A 4J8YA 2JABA 4GPKA 4JC8A 4U8YD 5LOZA 2ETBA 1E8XA 4UWFA 2KCVA 1U3CA 2M63A 3NQPA 4B93B 4DUIA 3FTZA 5HS0A 5BXOA 2MOWA 1H2VC 2WB2A 3I4GA 2R02A 3EIQC 4N3CA 3X2QE 3NZSA 2KXPC 3P1UA 1O1TA 4GMLA 3DSWA 5EIBE 1TNUA 4TXRA 5KJMA 3VLEA 3L22A 5CRUA 4HLEA 1TJFA 4G8KA 1TR4A 2A5EA 1JWGA 1MX6A 2BKKB 4IN3B 4N5CA 3APCA 2L0TB 3J5PA 4IYPA 3SF4A 4LSZE 4BWRA 5A7DB 1HFAA 5ENNA 4OVUA 5FIOA 1N4RA 2L6JA 3CHQA 3HHMA 4U0SA 1A5EA 1NFIE 1FPPA 4BTAA 3FY4A 3UM0A 3KSLA 3CVQA 1UN8A 2H6IA 5CECB 3UQ3A 3PE4A 3DSUA 3C3QA 3S7JA 2WMNA 2R2LA 4WNEA 2X6HA 1KPSB 2A5UA 4CYMD 2LO6A 3ABKE 3FHEA 2P9KG 5D0OD 5EILA 4XI9A 4PH4B 5J08A 2WXJA 1TN6A 1O5MA 3GZ2A 2BKGA 1Z6TA 4JL0A 2ONDA 3CVPA 5BNWA 4JVSA 1N94A 2CHXA 3FUDA 2LAIA 5KWDA 3ZYKA 1WAO1 2J07A 4G23A 4U07A 4YDYA 4AY5A 3JXJA 4K03A 4C48B 1JPLA 3B7BA 4LCTA 3MCXA 5G04J 1NA0A 4WWPA 3UT4A 1ELWA 3PDNA 4JEHA 3V2XA 4I2ZA 4AV7A 3PEUB 4B89A 2X6FA 2J09A 2V5QC 2DWZA
chains in the Genus database with same CATH topology
2RD0A 1HH8A 3RJVA 2WXLA 4CEMA 1TEZA 4G1TA 5E76A 2E2EA 4IULA 2VSYA 3OAWA 3CHSA 2L0IA 5JJTA 1UJJA 2AXZA 2IOLA 4KT6B 3ZEFA 4BY6A 3FUNA 2JEKA 3MJWA 2C2LA 4J0UA 3FTUA 3CHMA 3DBSA 3OXGA 4I1AA 3ONKA 3D9IA 5CCMA 3KD7A 1SQMA 2CFUA 4HS2A 3U66A 4U8HA 1N54A 1IHGA 3BEEA 4Y6CA 3O48A 2WXIA 2XPIA 4G11A 1JWFA 3VLFA 3CVXA 2WMOA 3QKYA 4U04A 2WVIA 3CKCA 4N39A 3TL5A 4FADA 4A1GA 4PDXA 4DI4A 3CHPA 4ANWA 3QDNA 4JZYA 4URKA 4TRQA 3QK0A 5CCLA 4FHJA 4LUNU 2XHEA 4EPZA 2VSOE 2CG3A 5BPPA 4HOTA 3EJNA 4C9BB 3FTSA 3RRMB 1ELKA 1HO8A 4MS6A 3URZA 2FBNA 3T5VA 4XKCA 3ASFA 3FTXA 3JUIA 2RG8A 2J4DA 4DJAA 3O4ZA 1QZ2A 2IOSA 2KATA 4OVVA 5CHEE 4C0MA 5G2NA 4XIFA 2CHZA 2OOEA 3TGOA 2P58C 3ONLA 2VGYA 3FUFA 4L2YA 3QAQA 2HR2A 2KZTA 4FP7A 3FUHA 2WXPA 5T8IA 4WNGA 3RKVA 3U4TA 2IJGX 1FVHA 2UWJG 4ILGA 2AXUA 4EZKA 4FJZA 3KEZA 4KXKB 3RO3A 1INZA 3HVEA 2XEVA 4OYSA 3PE3A 1H2TC 5CMYA 4PS8A 4CDRA 4I6GA 3QJZA 4GZ3A 4CDNA 2VTBB 3CK8A 3APDA 1MHQA 3CIAA 4HOQA 4ATGA 2XGMA 1BPOA 4M3OA 3FTYA 1P5QA 4O6FA 4FULA 5D0QD 5FZSA 3KS2A 4L7TA 2PZIA 2VSXE 4JHRA 2LSUA 3CV0A 4EZJA 3FH7A 3ML8A 2WXGA 3L6AA 3MEKA 5AENA 4GA0A 3Q49B 2WXFA 4H7XA 2KM4A 1H6KA 3UMVA 1OUVA 4TV3A 3D9LA 1E8WA 3FFLA 4FU3A 4B0ZA 5FT9A 3EIJA 5G05J 1FCHA 2AW6A 4GZ6A 5BV0A 2XGOA 3CR3A 3B7SA 2X6IA 2AWIA 3G2WA 5FQ4A 4QFVA 1KT1A 2EQXA 3E4BA 1QQEA 3ZN3A 3SHFA 2A4ZA 2WPVA 3P2BA 3UT7A 1KLXA 1L5JA 2ZU6B 1HX8A 3MV2B 2FULA 2FF4A 2OVBA 5FJYA 3B13A 3SBTB 4BX8A 3HDXA 4N3BA 4ACKA 2WXNA 4DK5A 4I43A 1WY6A 4GA1A 4FJYA 3ZPJA 4A3TA 2NXPA 4KZ0A 4JPSA 3FDHA 4IRUA 5J90A 5BUZA 4L23A 2Y4TA 4NRHB 4C0EA 3WXXA 1KT0A 2CFZA 3GW4A 4JA7A 1OWLA 3UUXA 1OWPA 4WNDA 3LPZA 3S7FA 1DNPA 2HO1A 3KAEA 1E96B 1MQSA 3PZDA 3QNKA 2PL2A 2UY1A 3U64A 3UT8A 3ZYMA 2VTBA 5C1DA 2XRZA 3SZ7A 3PUKA 1EF1C 2E0IA 2BUGA 5LCWC 5FQ8A 3NF1A 3CQGB 5HI7A 3LXUX 2KCLA 3MGBA 2AVPA 4GCOA 3QB2A 3U3WA 3MKQA 4Q94A 3RRUA 4LEUA 4I9EA 1OWMA 4F53A 2R17C 2IFUA 3FTVA 3FUIA 1H19A 5DBKA 3MZLB 4UI9J 5FTPA 3R9AB 3IV0A 1PAQA 3ZVVA 1E8YA 1UW4B 4ME2A 3AS4A 4I9CA 3IHVA 2GRLA 3FULA 4EZLA 4GU5A 2XQ0A 4MLPA 3CVUA 1U3DA 2CHWA 2WXKA 3D9MA 4YVOA 3FUMA 4A1SA 4I2WA 4XE0A 2FEZA 3ZRHA 3CVNA 3LJ3A 4XZ4A 1IYGA 4GYOA 4JW1A 2Q7FA 4RG6A 4GMJA 4Q69A 1JUQA 2HYZA 5KJNA 3D9KA 3PVLA 3I3NA 1HS6A 3RU0A 4HOUA 4N3AA 4UQZA 2IONA 3LDZA 5FQ7A 1UG3A 5KCMA 4AEZC 2WQ7A 3Q15A 3EHNA 4EBAG 4EQFA 5JHBA 4WUYA 3IBEA 2AXVA 4KVOA 4DLOA 4JEUA 3MYVA 3D9OA 4ACLA 1B89A 4FA6A 4I6JA 3CVYA 5FWQA 3LEWA 2I6HA 5G05C 3TXMA 3MV3B 4JHJA 3C98A 3AU5A 3FEXA 3CVVA 3CLJA 4FHKA 4UI9K 1YA0A 3FU6A 3ZW3A 4MKTA 3L17A 4UWLA 4EBAA 2PQNA 2BTDA 3JQ0A 4ILIA 2V0PA 2VYIA 3LCAA 4NURA 3LYAA 1H0AA 3G2SA 3JYSA 4UQXA 2GGFA 4DI3A 4I6EA 3ASGA 3EDTB 1Z3XA 4JHKA 4ABNA 4G24A 4GYYA 4YVQC 2UY1B 3CVLA 4B8AA 3MX3A 3FWVA 1HXIA 3TG4A 5G04C 5LFAA 5HQ8A 2YNQA 3FP3A 2I2OA 4A55A 3ZYQA 5G55A 1LF8A 1NP7A 2V4LA 3R7QA 3MKQB 4NACA 5LP0A 3IEGA 5EKQD 4CT0A 2I1KA 4ANXA 4KVMA 2J4BA 3T8MA 5LX8A 1H2UA 2I1JA 2WXOA 1FVFA 5AJDA 3ASDA 3CKBA 3RK6A 4Y6WA 5JJ7A 2QFCA 3U9WA 4E85A 3VLDA 2Y4UA 5KJLA 1Z3YA 4AY6A 5EDSA 1A17A 2FO7A 3AS8A 1E7UA 4I17A 3CSFA 4I1OB 3TG5A 3CQCB 2XPZA 3SI5A 3CSTA 4GZ5A 2C0LA 5EX3A 5ARGA 2BF0X 3PNLB 2C0MA 1NZNA 3PRZA 2YHCA 5JJ6A 3L16A 4G2VA 3TAXA 4AVXA 3OTNA 4KZCA 2V8SE 3Q5MA 1XNFA 4I1MA 3PREA 4XKBA 4PS7A 5DIZA 3SNXA 3SFZA 1OWOA 1DVPA 3D9NA 3FUJA 3QARA 4GZCA 3LY8A 4GA2A 4Q96A 3S7DA 1WM5A 3D9JA 2HM8A 4KMOA 3ESLA 4XI0A 4N2QA 4B94A 4GPKA 3PS6A 2XRYA 4J8EA 4JC8A 4RVBA 3QOUA 3D9PA 1Y8MA 5LOZA 1IQUA 4B8CB 3ZHEA 3FTWA 5AJLA 4K0RA 3FUEA 3JCKC 4AM9A 4CT4A 3SGHA 5A6CA 4H7YA 4APOA 3LY7A 4J8SA 1E90A 1E8XA 3L54A 3QWPA 4P29A 3SBSA 3B7RL 4UWFA 2KCVA 3FU0A 2IF4A 1U3CA 2M63A 2WQHA 4FLBA 3R7RA 3NQPA 3IKOB 5JHAA 3ZFWA 3UPVA 3FTZA 2NSZA 4W9RA 4CDMA 1S0PA 3B7UX 2LAHA 3BG0B 2WXMA 4PUCA 4G25A 2MOWA 4HFGA 2R59A 1H2VC 2WB2A 3I4GA 4WAFA 1HU3A 3EIQC 4F1SA 3MKRA 4N3CA 2GRMA 4UQYA 3QWVA 2X3MA 2MHKA 3NZSA 5FZQA 1EYHA 2VGXA 2X38A 3P1UA 4J6IA 4L2LA 2WXRA 2CG2A 3LY9A 4GMLA 4CCAA 1PY1A 2LNIA 3HYMB 4F3VA 3GYZA 3OXLA 4F7AA 1TJCA 3CK7A 5KJMA 2VQ2A 2ILRA 1HF8A 3CGHA 3L22A 4G26A 2J08A 3L08A 3LVRE 4U0UA 3VLEA 4HLEA 1TJFA 1UN9A 4E6HA 5E75A 2OV8A 1JWGA 3L13A 4J8DA 3GZ1A 4IN3B 4DLQA 4N5CA 2J9QA 3APCA 2PM6A 2IQCA 2L0TB 2Y3AA 4IYPA 4NQ0A 3SF4A 4BWRA 4U0ZA 1E8ZA 3HIZA 4AP2A 5A7DB 4ILHB 3EHMA 3G2VA 4GAAA 2XGSA 4GB9A 3OXFA 1HFAA 5ENNA 4OVUA 4RG9A 5FQ6A 4AIFA 3ZGQA 4YNDA 2L6JA 2R5SA 3CHQA 3I4RB 3HHMA 4DPRA 3ZYLA 4U0SA 3PH0C 5BV1A 1EPUA 3VTYA 2VSNA 1HG5A 4BTAA 3ESKA 3FY4A 3MA5A 3FU3A 3BG1B 3CVQA 4JXTA 4U63A 4CRWA 5LCWJ 1UN8A 1EDUA 3DPDA 2YINA 4WNFA 5A23A 3QWWA 3UQ3A 5M72A 3PE4A 5ANRA 2I9CA 2PM7A 4UWGA 5AYWD 4ANUA 5CMWA 5T3RA 3ZHEB 3FEYA 5KJKA 2JLBA 3NZUA 3S7JA 4APFA 3ULQA 2WMNA 2WXHA 2IU1A 4WNEA 2X6HA 3PEVB 2J49A 3FH8A 4ANVA 2KCKA 2DCPA 3FH5A 4V3IA 2A5UA 3Q4AB 2LO6A 3FHEA 3PNTB 1W3BA 5D0OD 3LS8A 4LERA 3TXNA 4WWNA 2OVFA 4JA9A 4AOFA 4XI9A 2PQRA 4PH4B 3ENEA 5J08A 2WXJA 2VGXB 1HZ4A 2VJ8A 3Q47B 4PS3A 3SD5A 4KYOB 4EECA 3LKUA 2NC9A 3G2TA 3B7TA 4AXHA 3GZ2A 1GW6A 3UX4A 4BFRA 2YHEA 1HG2A 3FUKA 3ML9A 2DBAA 3IHYA 5FZRA 2DIWA 3ZXSA 1Z6TA 1XGWA 4JL0A 4CGVA 3LVQE 2XCBA 4LRZA 5AIJA 4J8FA 2ONDA 4HORA 1Y6IA 4CGWA 3CVPA 3I5PA 3PUJA 4R7LA 5BNWA 4UWKA 2FI7A 4HXIA 4JVSA 4GYWA 4UI9C 4BTBA 4HVBA 1IQRA 2CHXA 3FU5A 1ZU2A 2QY7A 3FUDA 2LAIA 4GZDA 5ANLA 1X5BA 3CVWA 4N2SA 1SZAA 4XX5A 3ZYKA 2V5FA 1WAO1 2J07A 3QC1A 4G23A 3CHRA 4KBQA 4U07A 2GW1A 3APFA 3TJPA 4AY5A 3ZIMA 4TUUA 2L9BA 4FC8A 4K03A 3RRNB 2MRIA 3ASHA 2WXQA 3JQ1A 1JPLA 4LCTA 2YQ8A 2X6JA 4BSXA 3MCXA 3S7BA 3RO2A 5ARFA 5G04J 2WQ6A 4L1BA 1QNFA 3GZSA 5BT1A 1NA0A 1N52A 4BX9A 3RIBA 1HE8A 1OWNA 2KC7A 3CK9A 5EX0A 2XCCA 4FLHA 3AS5A 4WWPA 3UT4A 5BW8C 1E7VA 2LSVA 1ELWA 4UWHA 2XPYA 1ELRA 3PDNA 1ZBPA 3K9IA 4JEHA 4A3VA 3CHOA 3N71A 4RSYA 1UJKA 4I2ZA 3G2UA 4AV7A 3PEUB 3VTXA 3T5XA 4B89A 3AU4A 5C2YA 4WWOA 5T4YA 2KZTB 2X6FA 1PC2A 3D3MA 3S2AA 2WM9A 2J09A 4AJWA 4GCNA 4BT8A 4D10C 3CEQA 1NA3A 4HOSA 1SZ9A 4MRUA 3HVEB 2X6KA 1VDYA 4BT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ATG A; 
#chains in the Genus database with same CATH topology
 3C3R A;  4CEM A;  5E76 A;  3OAW A;  2IOL A;  3ZEF A;  3TWR A;  3FUN A;  3D9I A;  3ZXP A;  3KD7 A;  2CFU A;  2NYJ A;  3U66 A;  5CEA A;  2WXI A;  3UIP C;  3VLF A;  4F1P A;  3WG7 E;  2WMO A;  2WVI A;  4A1G A;  5ITZ F;  5ENT D;  4URK A;  4JZY A;  3TWW A;  4TRQ A;  1D8D A;  4FHJ A;  3Q75 A;  4HOT A;  1ELK A;  1HO8 A;  3URZ A;  1IKN D;  4O1P A;  3T5V A;  4GTP A;  4GTT A;  3ASF A;  3JUI A;  2J4D A;  2IOS A;  5CHE E;  3UKU G;  2OOE A;  2HR2 A;  4FP7 A;  3FUH A;  3PZ1 A;  3U4T A;  4ILG A;  2AXU A;  4EZK A;  5D2M C;  2DYR E;  4KXK B;  1INZ A;  3R9M A;  1H2T C;  4CDN A;  2VTB B;  3APD A;  2XGM A;  4BES A;  1BPO A;  4M3O A;  2QC9 A;  4O6F A;  5AQ9 A;  5ENR D;  5AEN A;  3L6A A;  2P2C P;  3E34 A;  4H7X A;  2KM4 A;  4GTR A;  3UMV A;  4TV3 A;  3E30 A;  3FFL A;  4B0Z A;  1FCH A;  2AW6 A;  3AG4 E;  2XGO A;  2X6I A;  4ZHB A;  3ZN3 A;  4GTS A;  1OCC E;  3MV2 B;  5EYL A;  3HDX A;  4GA1 A;  3ZPJ A;  3DEP A;  4IRU A;  5J90 A;  4L23 A;  2CFZ A;  5KNH D;  2OEV A;  1DNP A;  2HO1 A;  1E96 B;  5C1D A;  1MJ0 A;  2E0I A;  2BUG A;  3ABM E;  3NB2 A;  4HRM B;  2AVP A;  4GCO A;  3U3W A;  4Q94 A;  3RRU A;  4I9E A;  4F53 A;  3FUI A;  5DBK A;  3MZL B;  2BED A;  1UW4 B;  3AS4 A;  4MLP A;  3D9M A;  4YVO A;  4I2W A;  4HLL A;  3CVN A;  4DX6 D;  5D66 A;  5ENP D;  3LJ3 A;  2Q7F A;  4GMJ A;  3D9K A;  3I3N A;  4AEZ C;  1N4Q A;  3LDZ A;  1UG3 A;  3DXM G;  4EQF A;  1YYH A;  4KVO A;  3D9O A;  3CVY A;  5FWQ A;  3HXD A;  3MV3 B;  3FEX A;  3V79 K;  4FHK A;  2P9L G;  3DSS A;  4MKT A;  4LNB A;  4UWL A;  4ILI A;  5AQ7 A;  2VYI A;  3LCA A;  1H0A A;  3G2S A;  3JYS A;  4DI3 A;  1Z3X A;  3DXK G;  4GYY A;  3V2O A;  3MX3 A;  5AN8 A;  5LFA A;  2YNQ A;  2I2O A;  4N5Q A;  1NP7 A;  2V4L A;  4NAC A;  3HG0 D;  1V54 E;  5CRV A;  1Z3Y A;  3CQC B;  3SI5 A;  2F37 A;  5EX3 A;  1OCR E;  2BF0 X;  4AVX A;  3OTN A;  1XNF A;  4I1M A;  3PRE A;  5DIZ A;  1WM5 A;  3D9J A;  2HM8 A;  2OCC E;  1OY3 D;  4B94 A;  4N2Q A;  3Q7F A;  3V31 A;  1JCR A;  5AAO A;  3ISM C;  2XRY A;  4RVB A;  3D9P A;  1Y8M A;  2H6G A;  1IQU A;  4CT4 A;  5A6C A;  1E90 A;  3QWP A;  1FT1 A;  2ZIS A;  1DCE A;  5ENS D;  3UPV A;  2LAH A;  2WXM A;  4PUC A;  4G25 A;  4WAF A;  4UQY A;  3QWV A;  4J6I A;  4L2L A;  3LY9 A;  3HYM B;  3OXL A;  5CBN A;  2ILR A;  3L08 A;  5E75 A;  2OV8 A;  2IQC A;  5JMN D;  5EYP F;  4NQ0 A;  4U0Z A;  3HIZ A;  4AP2 A;  4GAA A;  3UI2 A;  4RG9 A;  4JD2 G;  5FQ6 A;  3ZGQ A;  1ZB1 A;  2RKK A;  5BV1 A;  1EPU A;  1HG5 A;  3MA5 A;  2QZA A;  2IY0 C;  4JXT A;  4CRW A;  5A23 A;  2P9S G;  3DPD A;  3QWW A;  1BD8 A;  1OCZ E;  5M72 A;  5ANR A;  5AYW D;  2PM7 A;  4UWG A;  5T3R A;  3EHQ A;  3HXB A;  2H6F A;  3ULY A;  3PEV B;  2J49 A;  4G8L A;  2KCK A;  2DCP A;  3FH5 A;  4U95 D;  4LER A;  5AQB A;  1MX4 A;  4JA9 A;  4AOF A;  1AWC B;  3ENE A;  3ZU7 B;  2VJ8 A;  1HZ4 A;  3Q47 B;  5ENO D;  4KYO B;  3LKU A;  2NC9 A;  3G2T A;  4DX1 A;  1GW6 A;  3UX4 A;  4BSZ B;  4BFR A;  2YHE A;  2B6C A;  4O1O A;  3FUK A;  3ML9 A;  5KNG A;  2DBA A;  3Q9U C;  4CGV A;  3LVQ E;  4LRZ A;  5AIJ A;  1Y6I A;  4CGW A;  4R7L A;  4UWK A;  2R03 A;  4HXI A;  1N0R A;  4BTB A;  1IQR A;  5ANL A;  4JB8 P;  1X5B A;  4N2S A;  5AQA A;  2V4H C;  3CHR A;  4KBQ A;  4M7C A;  4TUU A;  2L9B A;  4UUC A;  4FC8 A;  4L9P A;  3UM1 A;  3ASO E;  3ASH A;  3JQ1 A;  3S7B A;  1N52 A;  3RIB A;  1OWN A;  5EX0 A;  2XCC A;  3JXI A;  2ETA A;  1ZBP A;  3K9I A;  4A3V A;  3CHO A;  1TNO A;  3N71 A;  1UJK A;  2ZGD A;  3G2U A;  3VTX A;  3T5X A;  3AU4 A;  5C2Y A;  4WWO A;  5T4Y A;  2KZT B;  2IO2 C;  3S2A A;  4AJW A;  4D10 C;  3CEQ A;  4HOS A;  2X6K A;  1VDY A;  2RD0 A;  1TEZ A;  4IUL A;  2VSY A;  5JJT A;  4KT6 B;  2EIL E;  4BY6 A;  2JEK A;  3MJW A;  2C2L A;  3FTU A;  3OXG A;  1SQM A;  1IHG A;  1N54 A;  3O48 A;  2XPI A;  4GTO A;  3BU8 A;  4FAD A;  4BEP A;  1N4P A;  4LUN U;  2XHE A;  3DRA A;  1TNB A;  5H7P A;  3AG2 E;  4OVV A;  5G2N A;  1N95 A;  1KZO A;  3SY2 A;  3UTM A;  4L2Y A;  3LJN A;  3F6Q A;  3Q73 A;  2WXP A;  4WNG A;  1TYQ G;  4ZFH A;  4FJZ A;  3KEZ A;  3RO3 A;  2XEV A;  5CMY A;  4PS8 A;  3ABL E;  4I6G A;  3CK8 A;  4FUL A;  4L7T A;  1N11 A;  3CV0 A;  2GRR B;  4Z68 A;  3E37 A;  2WXG A;  4GA0 A;  1OUV A;  4F6R D;  5JA4 D;  5CBO A;  4LG6 A;  2GRP B;  3G2W A;  4QFV A;  2EQX A;  2A4Z A;  3UKR G;  3B13 A;  3SBT B;  4BX8 A;  4DK5 A;  4I43 A;  2QYJ A;  4A3T A;  1MYO A;  2Y4T A;  4C0E A;  3GW4 A;  1OWL A;  2KBX A;  3KAE A;  1MQS A;  2PL2 A;  3U64 A;  3UT8 A;  4CZ2 D;  2VTB A;  3PUK A;  1EF1 C;  3L82 A;  4LEU A;  2R17 C;  4OAU C;  2IFU A;  2MYO A;  3E33 A;  1H19 A;  4UI9 J;  3R9A B;  3IV0 A;  3ZVV A;  1E8Y A;  4EZL A;  3CVU A;  1U3D A;  2CHW A;  2FEZ A;  1IYG A;  4JW1 A;  3IXE A;  5FQ7 A;  3Q15 A;  5HKP A;  4QQI A;  4EBA G;  4BER A;  3IBE A;  4DLO A;  4ACL A;  1B89 A;  4FA6 A;  4I6J A;  4DX7 D;  2DZN A;  3EU9 A;  1IHB A;  3C98 A;  3AU5 A;  3CVV A;  5B1B E;  3T8K A;  4EBA A;  1OT8 A;  4I6E A;  3ASG A;  3EDT B;  4ABN A;  4YVQ C;  4B8A A;  3TWX A;  1Q2Z A;  3FWV A;  1QYM A;  5G04 C;  4A55 A;  5G55 A;  1O1R A;  2I1K A;  2EIK E;  4ATZ D;  1H2U A;  3VLD A;  2Y4U A;  4MBG A;  3CSF A;  3TG5 A;  2XPZ A;  3E32 A;  3PZ4 A;  4GZ5 A;  5ARG A;  3PNL B;  2C0M A;  4G2V A;  2V8S E;  3SNX A;  1OWO A;  3D9N A;  4GA2 A;  3DST A;  3S7D A;  3T9K A;  2HE0 A;  4HNA D;  3PS6 A;  4J8E A;  3QOU A;  4B8C B;  5AJL A;  4AM9 A;  1N9A A;  3SGH A;  4H7Y A;  3LY7 A;  3B95 A;  1LD8 A;  4P29 A;  3SBS A;  3HXF A;  3B7R L;  3FU0 A;  2IF4 A;  3R7R A;  5JHA A;  3ZFW A;  2NSZ A;  4W9R A;  4CDM A;  1S0P A;  3TWT A;  4HFG A;  2R59 A;  4F1S A;  3MKR A;  3HXC A;  2X3M A;  2MHK A;  1EYH A;  1H6O A;  4X8Q A;  2LNI A;  3SO8 A;  3J5Q B;  4CCA A;  4F3V A;  4F7A A;  4EHM A;  1TJC A;  3CK7 A;  1HF8 A;  3L13 A;  3GZ1 A;  1AP7 A;  2Y3A A;  2P9P G;  3PZ2 A;  3TWS A;  3V30 A;  2LXL A;  3ZYL A;  3PH0 C;  3VTY A;  2XEN A;  3FU3 A;  3BG1 B;  4U63 A;  5LCW J;  1EDU A;  2FO1 E;  5CMW A;  3FEY A;  5KJK A;  3NZU A;  1SW6 A;  2IU1 A;  2XZD G;  1G3N B;  3AAA C;  4V3I A;  1W3B A;  3LS8 A;  3TXN A;  3AG3 E;  4WWN A;  2OVF A;  4PS3 A;  3SQV A;  4EEC A;  4AXH A;  1FT2 A;  1HG2 A;  1YMP A;  5FZR A;  2DIW A;  4J8F A;  3I5P A;  2XS1 A;  4GYW A;  4GZD A;  2QY7 A;  4XX5 A;  2V5F A;  1WG0 A;  3QC1 A;  3APF A;  3TJP A;  3ZIM A;  2MRI A;  2WXQ A;  3D9H A;  3UM3 A;  2YQ8 A;  2X6J A;  4BSX A;  3ZUV B;  3RO2 A;  5ARF A;  4L1B A;  1QNF A;  5BT1 A;  4BX9 A;  1HE8 A;  1O1S A;  4RLY A;  4FLH A;  2F0Y A;  1E7V A;  2LSV A;  2VGE A;  2XPY A;  1ELR A;  3NOC D;  4RSY A;  1TN7 A;  4LNG A;  1PC2 A;  1RZ4 A;  3ZKJ A;  4GCN A;  2DZO A;  1NA3 A;  4MRU A;  4U04 A;  3HVE B;  4BT9 A;  4G1T A;  3CHS A;  1X81 A;  5KJL A;  1TNZ A;  4J0U A;  1V55 E;  3DBS A;  4I1A A;  5CCM A;  4HS2 A;  4G11 A;  1JWF A;  3QKY A;  3CKC A;  4HQD A;  2P9U G;  3CHP A;  2VSO E;  2CG3 A;  5BPP A;  4C9B B;  2FBN A;  3C3O A;  4XKC A;  4DRX E;  2RG8 A;  3O4Z A;  2LXM A;  2KAT A;  3UM2 A;  3AG1 E;  4XEI G;  2EIM E;  1NL4 A;  2P58 C;  3EHR A;  3ONL A;  3RAU A;  3UIN C;  3FUF A;  2KZT A;  2GRN B;  4TXP A;  2RFA A;  4HRN A;  4HI8 A;  1K3Z D;  4CDR A;  3QJZ A;  4GZ3 A;  3CIA A;  3HXE A;  4DX2 A;  5D0Q D;  5FZS A;  2PZI A;  2VSX E;  2LSU A;  2QYU A;  3FH7 A;  3DSV A;  3ML8 A;  2XEE A;  1UOH A;  2GRQ B;  4FU3 A;  3TWQ A;  5FT9 A;  3EIJ A;  1SA4 A;  4GZ6 A;  5BV0 A;  1BU9 A;  1KT1 A;  3E4B A;  1L5J A;  1HX8 A;  2FUL A;  4K5B A;  1OXJ A;  1IXV A;  4ACK A;  3DSX A;  3PZ3 A;  2NXP A;  5CED B;  3L9T A;  4JPS A;  3FDH A;  1RW2 A;  4A63 B;  3WXX A;  1KT0 A;  3Q79 A;  4JA7 A;  3UUX A;  1LD7 A;  4WND A;  1DCQ A;  3PZD A;  2UY1 A;  3SZ7 A;  3CQG B;  3ASN E;  3LXU X;  3MGB A;  3QB2 A;  3MKQ A;  1YCS B;  2XS8 A;  2GRL A;  4GU5 A;  1H6P A;  2WXK A;  3FUM A;  4XE0 A;  4RG6 A;  4K5A B;  1DC2 A;  2HYZ A;  5KJN A;  4GTV A;  1HS6 A;  3RU0 A;  4HOU A;  4N3A A;  4UQZ A;  5KCM A;  4YDW A;  3EHN A;  5JHB A;  4JEU A;  3MYV A;  3NBN B;  2I6H A;  4O60 A;  3TXM A;  1YA0 A;  3W9G A;  3ZW3 A;  5ENQ D;  2BTD A;  2V0P A;  5FIN A;  3LYA A;  4TXQ A;  1JCQ A;  2IO3 C;  3TWV A;  4G24 A;  2UY1 B;  3AJI A;  1HXI A;  2ZXW E;  3TG4 A;  1S70 B;  3FP3 A;  1LF8 A;  3HRA A;  4OAV B;  3MKQ B;  5KBA A;  4CT0 A;  4ANX A;  2DYS E;  2WXO A;  1FVF A;  1D9S A;  4LNU D;  5B1A E;  3CKB A;  4Y6W A;  2QFC A;  3U9W A;  4AY6 A;  5EDS A;  1A17 A;  2FO7 A;  3AS8 A;  4U96 D;  3ZNG A;  3CST A;  3SFY A;  1NZN A;  5JJ6 A;  3W9F A;  1QBQ A;  4U7E B;  2ZGG A;  3Q5M A;  4XKB A;  1DVP A;  3FUJ A;  2Y1L E;  3QAR A;  4GZC A;  3LY8 A;  4KMO A;  3ESL A;  4XI0 A;  3CVX A;  2P9I G;  2L6B A;  3EU5 A;  3ZHE A;  3FTW A;  4K0R A;  3FUE A;  3JCK C;  4APO A;  4J8S A;  3L54 A;  2WQH A;  4FLB A;  3IKO B;  2IEJ A;  3B7U X;  3BG0 B;  3BUA A;  4HI9 A;  1HU3 A;  2GRM A;  5FZQ A;  2VGX A;  2X38 A;  2WXR A;  2CG2 A;  1PY1 A;  3GYZ A;  1U2V G;  4U8V D;  2VQ2 A;  4U0U A;  3CGH A;  4G26 A;  2J08 A;  3LVR E;  1UN9 A;  4E6H A;  4J8D A;  4TUM A;  1N0Q A;  4DLQ A;  2J9Q A;  2PM6 A;  1E8Z A;  4ILH B;  3EHM A;  4J7W A;  3G2V A;  2XGS A;  4GB9 A;  3OXF A;  4AIF A;  4NIK A;  4YND A;  2R5S A;  3I4R B;  4DPR A;  2VSN A;  3ESK A;  2YIN A;  4WNF A;  3EUV A;  2I9C A;  4ANU A;  3ZHE B;  2JLB A;  4APF A;  3ULQ A;  2WXH A;  4ANV A;  3FH8 A;  2OEW A;  3Q4A B;  3PNT B;  1SVX A;  2PQR A;  3DWL G;  1K8K G;  2VGX B;  3SD5 A;  3B7T A;  3JUE A;  5B3S E;  3IHY A;  3ZXS A;  1XGW A;  3UIO C;  2XCB A;  3DEO A;  4HOR A;  3PUJ A;  2FI7 A;  4UI9 C;  4HVB A;  2P9N G;  3FU5 A;  1ZU2 A;  2Y69 E;  3CVW A;  5CER B;  1SZA A;  3RSE G;  4BET A;  2GW1 A;  1WDY A;  2DVW A;  1K1A A;  4GTQ A;  3RRN B;  1BI7 B;  2ZIR A;  2WQ6 A;  3GZS A;  2KC7 A;  3CK9 A;  3AS5 A;  5BW8 C;  4UWH A;  5IY5 E;  2R05 A;  3NAW A;  5HRY A;  3D3M A;  3Q78 A;  2WM9 A;  2H6H A;  4BT8 A;  1SZ9 A;  2AWI A;  1LTX A;  1HH8 A;  3RJV A;  2WXL A;  2F8X K;  2E2E A;  1S63 A;  2L0I A;  2XZT G;  1UJJ A;  2AXZ A;  1KZP A;  4DX5 D;  3CHM A;  3ONK A;  4U8H A;  4Y6C A;  3BEE A;  3TL5 A;  4N39 A;  1N4S A;  4PDX A;  3BQO A;  4DI4 A;  4ANW A;  3QDN A;  1D8E A;  3QK0 A;  5CCL A;  4EPZ A;  3EJN A;  3FTS A;  3RRM B;  4MS6 A;  5BXU A;  3SFX A;  3FTX A;  4DJA A;  1QZ2 A;  4C0M A;  4XIF A;  2CHZ A;  3DPY A;  3TGO A;  2VGY A;  3QAQ A;  5T8I A;  3RKV A;  5EN5 D;  2IJG X;  1FVH A;  2UWJ G;  3HVE A;  3Q9N C;  4OYS A;  3PE3 A;  4HOQ A;  1MHQ A;  4ATG A;  4GTM A;  1MX2 A;  3FTY A;  1P5Q A;  1TN8 A;  3KS2 A;  4JHR A;  2AJA A;  4GMR A;  4EZJ A;  3MEK A;  3Q49 B;  2WXF A;  1SA5 A;  1H6K A;  3D9L A;  1E8W A;  5G05 J;  1OCO E;  3CR3 A;  3B7S A;  2EIN E;  5FQ4 A;  1QQE A;  3SHF A;  2WPV A;  3P2B A;  3UT7 A;  1KLX A;  2ETC A;  2ZU6 B;  2FF4 A;  2OVB A;  5FJY A;  2EIJ E;  4N3B A;  2WXN A;  1WY6 A;  3TWU A;  4FJY A;  1NI1 A;  4KZ0 A;  1S64 A;  2RFM A;  4GPM A;  5BUZ A;  4K5C A;  4NRH B;  1OWP A;  3LPZ A;  3S7F A;  3QNK A;  1BI8 B;  3ZYM A;  5EID A;  1Z5S C;  2XRZ A;  3KEA A;  5LCW C;  5FQ8 A;  3NF1 A;  5HI7 A;  2KCL A;  2LUH A;  4YDO A;  1OWM A;  3FTV A;  5FTP A;  1PAQ A;  4YDE A;  3ULE G;  4ME2 A;  4I9C A;  3IHV A;  1BLX B;  4HB5 A;  3FUL A;  2XQ0 A;  4A1S A;  3ZRH A;  3C72 A;  4XZ4 A;  4GYO A;  4RQI A;  2GRO B;  1K1B A;  3Q7A A;  1JUQ A;  4Q69 A;  2XEH A;  2Y0B G;  3PVL A;  2ION A;  2WQ7 A;  3UXG A;  5AAR A;  4WUY A;  2AXV A;  4HBD A;  3LEW A;  5G05 C;  4JHJ A;  2F8Y A;  3CLJ A;  4UI9 K;  3FU6 A;  3L17 A;  3C5R A;  2PQN A;  3JQ0 A;  4NUR A;  1TNY A;  4UQX A;  2GGF A;  2J8S D;  4JHK A;  3CVL A;  5HQ8 A;  3ZYQ A;  3R7Q A;  5LP0 A;  3IEG A;  1JCS A;  5EKQ D;  2B0O E;  1MZC A;  4KVM A;  2J4B A;  3T8M A;  5LX8 A;  4HRL A;  2I1J A;  5AJD A;  3ASD A;  3RK6 A;  5JJ7 A;  4E85 A;  3KSQ A;  2PNN A;  1E7U A;  4I17 A;  4I1O B;  2C0L A;  3PRZ A;  2YHC A;  3L16 A;  3TAX A;  3NOG D;  4KZC A;  4PS7 A;  3SFZ A;  4Q96 A;  4J8Y A;  2JAB A;  4GPK A;  4JC8 A;  4U8Y D;  5LOZ A;  2ETB A;  1E8X A;  4UWF A;  2KCV A;  1U3C A;  2M63 A;  3NQP A;  4B93 B;  4DUI A;  3FTZ A;  5HS0 A;  5BXO A;  2MOW A;  1H2V C;  2WB2 A;  3I4G A;  2R02 A;  3EIQ C;  4N3C A;  3X2Q E;  3NZS A;  2KXP C;  3P1U A;  1O1T A;  4GML A;  3DSW A;  5EIB E;  1TNU A;  4TXR A;  5KJM A;  3VLE A;  3L22 A;  5CRU A;  4HLE A;  1TJF A;  4G8K A;  1TR4 A;  2A5E A;  1JWG A;  1MX6 A;  2BKK B;  4IN3 B;  4N5C A;  3APC A;  2L0T B;  3J5P A;  4IYP A;  3SF4 A;  4LSZ E;  4BWR A;  5A7D B;  1HFA A;  5ENN A;  4OVU A;  5FIO A;  1N4R A;  2L6J A;  3CHQ A;  3HHM A;  4U0S A;  1A5E A;  1NFI E;  1FPP A;  4BTA A;  3FY4 A;  3UM0 A;  3KSL A;  3CVQ A;  1UN8 A;  2H6I A;  5CEC B;  3UQ3 A;  3PE4 A;  3DSU A;  3C3Q A;  3S7J A;  2WMN A;  2R2L A;  4WNE A;  2X6H A;  1KPS B;  2A5U A;  4CYM D;  2LO6 A;  3ABK E;  3FHE A;  2P9K G;  5D0O D;  5EIL A;  4XI9 A;  4PH4 B;  5J08 A;  2WXJ A;  1TN6 A;  1O5M A;  3GZ2 A;  2BKG A;  1Z6T A;  4JL0 A;  2OND A;  3CVP A;  5BNW A;  4JVS A;  1N94 A;  2CHX A;  3FUD A;  2LAI A;  5KWD A;  3ZYK A;  1WAO 1;  2J07 A;  4G23 A;  4U07 A;  4YDY A;  4AY5 A;  3JXJ A;  4K03 A;  4C48 B;  1JPL A;  3B7B A;  4LCT A;  3MCX A;  5G04 J;  1NA0 A;  4WWP A;  3UT4 A;  1ELW A;  3PDN A;  4JEH A;  3V2X A;  4I2Z A;  4AV7 A;  3PEU B;  4B89 A;  2X6F A;  2J09 A;  2V5Q C;  2DWZ A; 
#chains in the Genus database with same CATH homology
 2RD0 A;  1HH8 A;  3RJV A;  2WXL A;  4CEM A;  1TEZ A;  4G1T A;  5E76 A;  2E2E A;  4IUL A;  2VSY A;  3OAW A;  3CHS A;  2L0I A;  5JJT A;  1UJJ A;  2AXZ A;  2IOL A;  4KT6 B;  3ZEF A;  4BY6 A;  3FUN A;  2JEK A;  3MJW A;  2C2L A;  4J0U A;  3FTU A;  3CHM A;  3DBS A;  3OXG A;  4I1A A;  3ONK A;  3D9I A;  5CCM A;  3KD7 A;  1SQM A;  2CFU A;  4HS2 A;  3U66 A;  4U8H A;  1N54 A;  1IHG A;  3BEE A;  4Y6C A;  3O48 A;  2WXI A;  2XPI A;  4G11 A;  1JWF A;  3VLF A;  3CVX A;  2WMO A;  3QKY A;  4U04 A;  2WVI A;  3CKC A;  4N39 A;  3TL5 A;  4FAD A;  4A1G A;  4PDX A;  4DI4 A;  3CHP A;  4ANW A;  3QDN A;  4JZY A;  4URK A;  4TRQ A;  3QK0 A;  5CCL A;  4FHJ A;  4LUN U;  2XHE A;  4EPZ A;  2VSO E;  2CG3 A;  5BPP A;  4HOT A;  3EJN A;  4C9B B;  3FTS A;  3RRM B;  1ELK A;  1HO8 A;  4MS6 A;  3URZ A;  2FBN A;  3T5V A;  4XKC A;  3ASF A;  3FTX A;  3JUI A;  2RG8 A;  2J4D A;  4DJA A;  3O4Z A;  1QZ2 A;  2IOS A;  2KAT A;  4OVV A;  5CHE E;  4C0M A;  5G2N A;  4XIF A;  2CHZ A;  2OOE A;  3TGO A;  2P58 C;  3ONL A;  2VGY A;  3FUF A;  4L2Y A;  3QAQ A;  2HR2 A;  2KZT A;  4FP7 A;  3FUH A;  2WXP A;  5T8I A;  4WNG A;  3RKV A;  3U4T A;  2IJG X;  1FVH A;  2UWJ G;  4ILG A;  2AXU A;  4EZK A;  4FJZ A;  3KEZ A;  4KXK B;  3RO3 A;  1INZ A;  3HVE A;  2XEV A;  4OYS A;  3PE3 A;  1H2T C;  5CMY A;  4PS8 A;  4CDR A;  4I6G A;  3QJZ A;  4GZ3 A;  4CDN A;  2VTB B;  3CK8 A;  3APD A;  1MHQ A;  3CIA A;  4HOQ A;  4ATG A;  2XGM A;  1BPO A;  4M3O A;  3FTY A;  1P5Q A;  4O6F A;  4FUL A;  5D0Q D;  5FZS A;  3KS2 A;  4L7T A;  2PZI A;  2VSX E;  4JHR A;  2LSU A;  3CV0 A;  4EZJ A;  3FH7 A;  3ML8 A;  2WXG A;  3L6A A;  3MEK A;  5AEN A;  4GA0 A;  3Q49 B;  2WXF A;  4H7X A;  2KM4 A;  1H6K A;  3UMV A;  1OUV A;  4TV3 A;  3D9L A;  1E8W A;  3FFL A;  4FU3 A;  4B0Z A;  5FT9 A;  3EIJ A;  5G05 J;  1FCH A;  2AW6 A;  4GZ6 A;  5BV0 A;  2XGO A;  3CR3 A;  3B7S A;  2X6I A;  2AWI A;  3G2W A;  5FQ4 A;  4QFV A;  1KT1 A;  2EQX A;  3E4B A;  1QQE A;  3ZN3 A;  3SHF A;  2A4Z A;  2WPV A;  3P2B A;  3UT7 A;  1KLX A;  1L5J A;  2ZU6 B;  1HX8 A;  3MV2 B;  2FUL A;  2FF4 A;  2OVB A;  5FJY A;  3B13 A;  3SBT B;  4BX8 A;  3HDX A;  4N3B A;  4ACK A;  2WXN A;  4DK5 A;  4I43 A;  1WY6 A;  4GA1 A;  4FJY A;  3ZPJ A;  4A3T A;  2NXP A;  4KZ0 A;  4JPS A;  3FDH A;  4IRU A;  5J90 A;  5BUZ A;  4L23 A;  2Y4T A;  4NRH B;  4C0E A;  3WXX A;  1KT0 A;  2CFZ A;  3GW4 A;  4JA7 A;  1OWL A;  3UUX A;  1OWP A;  4WND A;  3LPZ A;  3S7F A;  1DNP A;  2HO1 A;  3KAE A;  1E96 B;  1MQS A;  3PZD A;  3QNK A;  2PL2 A;  2UY1 A;  3U64 A;  3UT8 A;  3ZYM A;  2VTB A;  5C1D A;  2XRZ A;  3SZ7 A;  3PUK A;  1EF1 C;  2E0I A;  2BUG A;  5LCW C;  5FQ8 A;  3NF1 A;  3CQG B;  5HI7 A;  3LXU X;  2KCL A;  3MGB A;  2AVP A;  4GCO A;  3QB2 A;  3U3W A;  3MKQ A;  4Q94 A;  3RRU A;  4LEU A;  4I9E A;  1OWM A;  4F53 A;  2R17 C;  2IFU A;  3FTV A;  3FUI A;  1H19 A;  5DBK A;  3MZL B;  4UI9 J;  5FTP A;  3R9A B;  3IV0 A;  1PAQ A;  3ZVV A;  1E8Y A;  1UW4 B;  4ME2 A;  3AS4 A;  4I9C A;  3IHV A;  2GRL A;  3FUL A;  4EZL A;  4GU5 A;  2XQ0 A;  4MLP A;  3CVU A;  1U3D A;  2CHW A;  2WXK A;  3D9M A;  4YVO A;  3FUM A;  4A1S A;  4I2W A;  4XE0 A;  2FEZ A;  3ZRH A;  3CVN A;  3LJ3 A;  4XZ4 A;  1IYG A;  4GYO A;  4JW1 A;  2Q7F A;  4RG6 A;  4GMJ A;  4Q69 A;  1JUQ A;  2HYZ A;  5KJN A;  3D9K A;  3PVL A;  3I3N A;  1HS6 A;  3RU0 A;  4HOU A;  4N3A A;  4UQZ A;  2ION A;  3LDZ A;  5FQ7 A;  1UG3 A;  5KCM A;  4AEZ C;  2WQ7 A;  3Q15 A;  3EHN A;  4EBA G;  4EQF A;  5JHB A;  4WUY A;  3IBE A;  2AXV A;  4KVO A;  4DLO A;  4JEU A;  3MYV A;  3D9O A;  4ACL A;  1B89 A;  4FA6 A;  4I6J A;  3CVY A;  5FWQ A;  3LEW A;  2I6H A;  5G05 C;  3TXM A;  3MV3 B;  4JHJ A;  3C98 A;  3AU5 A;  3FEX A;  3CVV A;  3CLJ A;  4FHK A;  4UI9 K;  1YA0 A;  3FU6 A;  3ZW3 A;  4MKT A;  3L17 A;  4UWL A;  4EBA A;  2PQN A;  2BTD A;  3JQ0 A;  4ILI A;  2V0P A;  2VYI A;  3LCA A;  4NUR A;  3LYA A;  1H0A A;  3G2S A;  3JYS A;  4UQX A;  2GGF A;  4DI3 A;  4I6E A;  3ASG A;  3EDT B;  1Z3X A;  4JHK A;  4ABN A;  4G24 A;  4GYY A;  4YVQ C;  2UY1 B;  3CVL A;  4B8A A;  3MX3 A;  3FWV A;  1HXI A;  3TG4 A;  5G04 C;  5LFA A;  5HQ8 A;  2YNQ A;  3FP3 A;  2I2O A;  4A55 A;  3ZYQ A;  5G55 A;  1LF8 A;  1NP7 A;  2V4L A;  3R7Q A;  3MKQ B;  4NAC A;  5LP0 A;  3IEG A;  5EKQ D;  4CT0 A;  2I1K A;  4ANX A;  4KVM A;  2J4B A;  3T8M A;  5LX8 A;  1H2U A;  2I1J A;  2WXO A;  1FVF A;  5AJD A;  3ASD A;  3CKB A;  3RK6 A;  4Y6W A;  5JJ7 A;  2QFC A;  3U9W A;  4E85 A;  3VLD A;  2Y4U A;  5KJL A;  1Z3Y A;  4AY6 A;  5EDS A;  1A17 A;  2FO7 A;  3AS8 A;  1E7U A;  4I17 A;  3CSF A;  4I1O B;  3TG5 A;  3CQC B;  2XPZ A;  3SI5 A;  3CST A;  4GZ5 A;  2C0L A;  5EX3 A;  5ARG A;  2BF0 X;  3PNL B;  2C0M A;  1NZN A;  3PRZ A;  2YHC A;  5JJ6 A;  3L16 A;  4G2V A;  3TAX A;  4AVX A;  3OTN A;  4KZC A;  2V8S E;  3Q5M A;  1XNF A;  4I1M A;  3PRE A;  4XKB A;  4PS7 A;  5DIZ A;  3SNX A;  3SFZ A;  1OWO A;  1DVP A;  3D9N A;  3FUJ A;  3QAR A;  4GZC A;  3LY8 A;  4GA2 A;  4Q96 A;  3S7D A;  1WM5 A;  3D9J A;  2HM8 A;  4KMO A;  3ESL A;  4XI0 A;  4N2Q A;  4B94 A;  4GPK A;  3PS6 A;  2XRY A;  4J8E A;  4JC8 A;  4RVB A;  3QOU A;  3D9P A;  1Y8M A;  5LOZ A;  1IQU A;  4B8C B;  3ZHE A;  3FTW A;  5AJL A;  4K0R A;  3FUE A;  3JCK C;  4AM9 A;  4CT4 A;  3SGH A;  5A6C A;  4H7Y A;  4APO A;  3LY7 A;  4J8S A;  1E90 A;  1E8X A;  3L54 A;  3QWP A;  4P29 A;  3SBS A;  3B7R L;  4UWF A;  2KCV A;  3FU0 A;  2IF4 A;  1U3C A;  2M63 A;  2WQH A;  4FLB A;  3R7R A;  3NQP A;  3IKO B;  5JHA A;  3ZFW A;  3UPV A;  3FTZ A;  2NSZ A;  4W9R A;  4CDM A;  1S0P A;  3B7U X;  2LAH A;  3BG0 B;  2WXM A;  4PUC A;  4G25 A;  2MOW A;  4HFG A;  2R59 A;  1H2V C;  2WB2 A;  3I4G A;  4WAF A;  1HU3 A;  3EIQ C;  4F1S A;  3MKR A;  4N3C A;  2GRM A;  4UQY A;  3QWV A;  2X3M A;  2MHK A;  3NZS A;  5FZQ A;  1EYH A;  2VGX A;  2X38 A;  3P1U A;  4J6I A;  4L2L A;  2WXR A;  2CG2 A;  3LY9 A;  4GML A;  4CCA A;  1PY1 A;  2LNI A;  3HYM B;  4F3V A;  3GYZ A;  3OXL A;  4F7A A;  1TJC A;  3CK7 A;  5KJM A;  2VQ2 A;  2ILR A;  1HF8 A;  3CGH A;  3L22 A;  4G26 A;  2J08 A;  3L08 A;  3LVR E;  4U0U A;  3VLE A;  4HLE A;  1TJF A;  1UN9 A;  4E6H A;  5E75 A;  2OV8 A;  1JWG A;  3L13 A;  4J8D A;  3GZ1 A;  4IN3 B;  4DLQ A;  4N5C A;  2J9Q A;  3APC A;  2PM6 A;  2IQC A;  2L0T B;  2Y3A A;  4IYP A;  4NQ0 A;  3SF4 A;  4BWR A;  4U0Z A;  1E8Z A;  3HIZ A;  4AP2 A;  5A7D B;  4ILH B;  3EHM A;  3G2V A;  4GAA A;  2XGS A;  4GB9 A;  3OXF A;  1HFA A;  5ENN A;  4OVU A;  4RG9 A;  5FQ6 A;  4AIF A;  3ZGQ A;  4YND A;  2L6J A;  2R5S A;  3CHQ A;  3I4R B;  3HHM A;  4DPR A;  3ZYL A;  4U0S A;  3PH0 C;  5BV1 A;  1EPU A;  3VTY A;  2VSN A;  1HG5 A;  4BTA A;  3ESK A;  3FY4 A;  3MA5 A;  3FU3 A;  3BG1 B;  3CVQ A;  4JXT A;  4U63 A;  4CRW A;  5LCW J;  1UN8 A;  1EDU A;  3DPD A;  2YIN A;  4WNF A;  5A23 A;  3QWW A;  3UQ3 A;  5M72 A;  3PE4 A;  5ANR A;  2I9C A;  2PM7 A;  4UWG A;  5AYW D;  4ANU A;  5CMW A;  5T3R A;  3ZHE B;  3FEY A;  5KJK A;  2JLB A;  3NZU A;  3S7J A;  4APF A;  3ULQ A;  2WMN A;  2WXH A;  2IU1 A;  4WNE A;  2X6H A;  3PEV B;  2J49 A;  3FH8 A;  4ANV A;  2KCK A;  2DCP A;  3FH5 A;  4V3I A;  2A5U A;  3Q4A B;  2LO6 A;  3FHE A;  3PNT B;  1W3B A;  5D0O D;  3LS8 A;  4LER A;  3TXN A;  4WWN A;  2OVF A;  4JA9 A;  4AOF A;  4XI9 A;  2PQR A;  4PH4 B;  3ENE A;  5J08 A;  2WXJ A;  2VGX B;  1HZ4 A;  2VJ8 A;  3Q47 B;  4PS3 A;  3SD5 A;  4KYO B;  4EEC A;  3LKU A;  2NC9 A;  3G2T A;  3B7T A;  4AXH A;  3GZ2 A;  1GW6 A;  3UX4 A;  4BFR A;  2YHE A;  1HG2 A;  3FUK A;  3ML9 A;  2DBA A;  3IHY A;  5FZR A;  2DIW A;  3ZXS A;  1Z6T A;  1XGW A;  4JL0 A;  4CGV A;  3LVQ E;  2XCB A;  4LRZ A;  5AIJ A;  4J8F A;  2OND A;  4HOR A;  1Y6I A;  4CGW A;  3CVP A;  3I5P A;  3PUJ A;  4R7L A;  5BNW A;  4UWK A;  2FI7 A;  4HXI A;  4JVS A;  4GYW A;  4UI9 C;  4BTB A;  4HVB A;  1IQR A;  2CHX A;  3FU5 A;  1ZU2 A;  2QY7 A;  3FUD A;  2LAI A;  4GZD A;  5ANL A;  1X5B A;  3CVW A;  4N2S A;  1SZA A;  4XX5 A;  3ZYK A;  2V5F A;  1WAO 1;  2J07 A;  3QC1 A;  4G23 A;  3CHR A;  4KBQ A;  4U07 A;  2GW1 A;  3APF A;  3TJP A;  4AY5 A;  3ZIM A;  4TUU A;  2L9B A;  4FC8 A;  4K03 A;  3RRN B;  2MRI A;  3ASH A;  2WXQ A;  3JQ1 A;  1JPL A;  4LCT A;  2YQ8 A;  2X6J A;  4BSX A;  3MCX A;  3S7B A;  3RO2 A;  5ARF A;  5G04 J;  2WQ6 A;  4L1B A;  1QNF A;  3GZS A;  5BT1 A;  1NA0 A;  1N52 A;  4BX9 A;  3RIB A;  1HE8 A;  1OWN A;  2KC7 A;  3CK9 A;  5EX0 A;  2XCC A;  4FLH A;  3AS5 A;  4WWP A;  3UT4 A;  5BW8 C;  1E7V A;  2LSV A;  1ELW A;  4UWH A;  2XPY A;  1ELR A;  3PDN A;  1ZBP A;  3K9I A;  4JEH A;  4A3V A;  3CHO A;  3N71 A;  4RSY A;  1UJK A;  4I2Z A;  3G2U A;  4AV7 A;  3PEU B;  3VTX A;  3T5X A;  4B89 A;  3AU4 A;  5C2Y A;  4WWO A;  5T4Y A;  2KZT B;  2X6F A;  1PC2 A;  3D3M A;  3S2A A;  2WM9 A;  2J09 A;  4AJW A;  4GCN A;  4BT8 A;  4D10 C;  3CEQ A;  1NA3 A;  4HOS A;  1SZ9 A;  4MRU A;  3HVE B;  2X6K A;  1VDY A;  4BT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...