5D0QD

Bamacde complex, outer membrane beta-barrel assembly machinery (bam) complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
EVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Outer membrane protein assembly factor BamA
publication title Structural basis of outer membrane protein insertion by the BAM complex.
pubmed doi rcsb
source organism Escherichia coli k-12
total genus 65
structure length 218
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5d0qD00
3U3WA 1HXIA 3ULQA 3S7BA 2PQRA 4APOA 5CCLA 4GCOA 2ONDA 4ABNA 2VGYA 4GA1A 4GYYA 3CK9A 3IEGA 3UPVA 3FP3A 5KJLA 4JA7A 4GYOA 3MV2B 3U4TA 1Y8MA 4N2QA 2YHCA 3ASDA 3CVQA 5EX0A 4YVOA 1NA3A 5FZRA 2FF4A 5JJ6A 4J8FA 1QQEA 2UWJG 1KT0A 3OXFA 3SF4A 3CVNA 4WUYA 1B89A 3PE3A 4J0UA 2XGOA 4H7YA 4I2ZA 2AVPA 1TJCA 4ME2A 4N5CA 5JJ7A 4JL0A 3AS8A 4WNEA 2FBNA 4U07A 1PC2A 2VSYA 2UY1B 3GYZA 3MEKA 3KD7A 3LY8A 2KCKA 3RJVA 2WPVA 3AS5A 4EQFA 2PL2A 3PDNA 3CK7A 5DBKA 3RU0A 5C1DA 4BTBA 4BT8A 3ESKA 2Y4UA 3LY9A 1KLXA 5AYWD 1A17A 5FTPA 4JHRA 3ASGA 4I17A 4KBQA 5EX3A 3LPZA 1W3BA 2KATA 1E96B 1WM5A 4IN3B 5JJTA 3OXLA 5FJYA 2Y4TA 4AY5A 4WNGA 2HO1A 1OUVA 1FCHA 2C0MA 3TG4A 3GZ2A 2I6HA 3QDNA 3MV3B 4N3BA 2XEVA 2LSUA 3ASFA 2KCVA 3SZ7A 2YQ8A 4A1SA 5BNWA 4UQZA 3MKRA 3NF1A 5CCMA 3RO2A 4NQ0A 2R5SA 3LKUA 5A6CA 3ZFWA 1ELRA 4GA2A 3ZHEA 2VSNA 2C0LA 3OXGA 1QZ2A 2QFCA 4UQYA 2WQHA 4N2SA 2FI7A 3RO3A 3GW4A 4HORA 3EDTB 5EKQD 5G04J 5KJNA 3Q47B 3ASHA 3LYAA 2VQ2A 4Y6CA 4UI9J 3CVPA 3VTYA 3Q4AB 4UI9K 2BUGA 4J8EA 2IFUA 2IF4A 3QWWA 5HI7A 5BW8C 5G05C 4YVQC 3K9IA 2FO7A 4I1AA 4CDRA 3CKCA 4W9RA 4RG6A 1HH8A 3BEEA 5CHEE 3Q5MA 1ELWA 4RG9A 1YA0A 5A7DB 2NC9A 5ARFA 4G26A 3KS2A 5G05J 3Q15A 3CKBA 3CK8A 2XPIA 5LCWC 4NRHB 2V5FA 4U0UA 5FZQA 3QOUA 4U0ZA 5D0OD 3RKVA 3QWPA 4G24A 5DIZA 4N39A 3CEQA 5FT9A 5LCWJ 3RIBA 2J9QA 1KT1A 4WNDA 3AS4A 2VGXB 3FFLA 1ZBPA 4O6FA 5BT1A 5ARGA 4G25A 4I9EA 2LNIA 4JA9A 4BT9A 2VYIA 1IYGA 3R9AB 3O48A 2KCLA 3S7FA 2DBAA 2XGMA 3KAEA 4CGVA 4N3CA 1WAO1 4GPKA 4WNFA 5D0QD 4KYOB 4BWRA 4HOUA 4I2WA 2HYZA 2Q7FA 5G04C 3ZGQA 2PZIA 4UI9C 3TAXA 1P5QA 3URZA 5HQ8A 5M72A 3LY7A 2P58C 3ZHEB 4KXKB 4AIFA 3PE4A 3QKYA 2XCCA 2C2LA 2HR2A 3UUXA 1NZNA 2E2EA 3S7DA 4CGWA 5FZSA 5KJKA 4AM9A 4G1TA 4U04A 3FWVA 2OOEA 4GA0A 4J8DA 4LEUA 3N71A 4I9CA 4GCNA 4U0SA 3GZ1A 4XIFA 3ZN3A 4B94A 3JYSA 4GZ5A 1NA0A 3TGOA 2UY1A 2KC7A 1XNFA 4GZ6A 2XGSA 3Q49B 3VTXA 3HYMB 4YNDA 3ZPJA 3S7JA 4UQXA 4HOSA 4HOTA 4G23A 4XI0A 5KJMA 4G2VA 2LSVA 4GYWA 4BTAA 2GW1A 3TG5A 2JLBA 3E4BA 2PQNA 4GZ3A 3CV0A 3LCAA 3UQ3A 1IHGA 2VGXA 4N3AA 3WXXA 2FEZA 3QWVA 2MHKA 3MA5A 4H7XA 4XI9A 2XCBA 4AY6A 2L6JA 3CVLA 4HOQA 1ZU2A 4Y6WA 4F3VA 1HZ4A
chains in the Genus database with same CATH superfamily
4AOFA 2DYRE 3ISMC 4GCOA 1S64A 1TYQG 3B7UX 3FUEA 2VGYA 4GA1A 3CK9A 4RSYA 3ZYKA 5LFAA 5JHAA 2R05A 2ZU6B 5EIBE 3B13A 4LSZE 4AV7A 4N2QA 4FLHA 3FUMA 3CVXA 3HIZA 2WXQA 3EJNA 3CVQA 5EDSA 3FEYA 4J7WA 2FF4A 1QQEA 4KVOA 2WXKA 3PZ1A 1KT0A 3LEWA 5CECB 3OXFA 2J8SD 5CBOA 3CVNA 3ULYA 1YCSB 2LXMA 5B1AE 3B95A 3PNTB 4H7YA 1EF1C 1TJCA 1TNUA 3TXMA 2DZNA 3UINC 4WNEA 5C2YA 3FUFA 4PH4B 2FBNA 2PM6A 4RVBA 1QBQA 1N4PA 3PEUB 1IQRA 2WXNA 3L54A 5ENQD 2V5QC 2FULA 3KD7A 3I3NA 3P1UA 4EZJA 2YHEA 3SGHA 4XE0A 3R9MA 2KXPC 3FTUA 3D9OA 3NB2A 1UN9A 4F1SA 3UKUG 4TRQA 3PZDA 3QJZA 3AS5A 3D9LA 4KZ0A 5C1DA 2PM7A 3L16A 1E8WA 4GTVA 3CHRA 1A17A 5FTPA 1OCRE 3HVEA 4KBQA 5T3RA 2P9SG 2R02A 2WMNA 1V55E 5JJTA 2A5EA 4UWKA 5FQ4A 2P2CP 2Y4TA 4AY5A 2WXIA 1FCHA 2WXRA 3EHNA 2GRMA 3EU5A 3FUJA 3QC1A 5CMYA 4N3BA 4HQDA 2KCVA 3D9HA 5BNWA 2XRYA 2XPYA 4UQZA 3PS6A 3SNXA 3ML8A 5AARA 4NQ0A 4GTTA 3FUIA 1ELRA 2P9UG 3UT8A 2J4BA 4UWFA 4U7EB 4HRNA 2IJGX 1TN6A 2A4ZA 3RSEG 3FU6A 4UQYA 1JCQA 2QZAA 2DZOA 2VTBB 3ZRHA 5ITZF 3EDTB 3OTNA 3PUJA 1PAQA 1MX6A 2IOSA 3RAUA 4C0MA 4DX1A 3VTYA 3Q4AB 4K0RA 2IF4A 3B7TA 3W9FA 5BW8C 4ANXA 3F6QA 1E8ZA 1MJ0A 1TN8A 3JQ0A 4RG6A 5HS0A 1JCSA 3Q5MA 3ZNGA 4RG9A 1YA0A 1H0AA 4ZFHA 3FH5A 5A7DB 5ANRA 4JB8P 4GMLA 2NC9A 2IU1A 2FO1E 4U95D 3E33A 3ABME 5AENA 4TUUA 3KSLA 4ILGA 5KWDA 3DSVA 5EILA 1E7VA 3G2TA 4U0ZA 4YDEA 3TWWA 3PZ2A 2ETBA 2J08A 3QWPA 4G24A 3MX3A 5FT9A 5LCWJ 2ETCA 1KT1A 3AS4A 2H6IA 2YINA 3NZUA 1MX2A 3C3OA 3PVLA 3MKQB 4O6FA 3G2WA 5BT1A 3CVWA 4P29A 4G25A 4HNAD 3LJ3A 3RRMB 4BT9A 5CERB 1N0QA 4A3TA 4C0EA 2VSOE 3J5QB 3D9MA 3S7FA 3Q7FA 2XGMA 3UIOC 4EBAG 2WXLA 2LUHA 4GAAA 4B89A 4GPKA 3DEPA 5D0QD 3WG7E 2WQ6A 3J5PA 5CRUA 4HOUA 3L9TA 4EECA 4I2WA 3ZXPA 4DLOA 5G04C 2MOWA 5BV0A 3C98A 1H6OA 3VLDA 4XZ4A 2I1JA 3HXBA 3TAXA 4DI3A 1SA5A 4A3VA 4A1GA 3ZEFA 4UWLA 3LY7A 4FHJA 4NACA 4AIFA 3DSXA 3QKYA 4YDOA 4B8CB 2C2LA 3QB2A 3CLJA 4U96D 3S7DA 2OVFA 2WXGA 1HS6A 3L08A 1X5BA 4G1TA 4AM9A 2WB2A 5HKPA 4DK5A 4J8DA 5LP0A 4HBDA 2AWIA 3NZSA 4GCNA 1OCZE 4GZ5A 1NA0A 3TGOA 2Y3AA 2I1KA 1XNFA 2HM8A 4BEPA 3D9IA 3VTXA 1LD7A 4YNDA 3V79K 4E85A 4XI0A 3TWTA 1RW2A 3UKRG 3Q73A 4JPSA 4G11A 4GMJA 2XRZA 2CFUA 1HG5A 2GW1A 3FU3A 1OWPA 4JEHA 3E4BA 3MCXA 1H19A 3CV0A 3LCAA 3UQ3A 2IEJA 4PS7A 3Q79A 4N3AA 2E0IA 2FEZA 4U63A 4XI9A 2XCBA 3AG3E 5CEDB 2B0OE 3CQGB 3IKOB 2V0PA 1ZU2A 4LUNU 2LXLA 4F3VA 3BG1B 3VLEA 3ULQA 4LRZA 1OY3D 4F53A 3S7BA 5BXUA 3IHVA 4APOA 5CCLA 3FU5A 5KNGA 1EDUA 1SVXA 2XENA 4WWNA 3JCKC 5BXOA 3IEGA 4I6GA 4CDNA 2MYOA 4JA7A 4GYOA 4QFVA 4EBAA 4BSXA 3U4TA 2NYJA 3ABKE 1SQMA 4HFGA 2YHCA 4J8YA 3CHQA 1DCEA 3JXIA 3L13A 4DX7D 2CHZA 5FZRA 1BD8A 1AWCB 4Q94A 2Y0BG 3SFXA 2DIWA 2PNNA 4GTOA 5CMWA 1JCRA 2BTDA 4CEMA 3G2VA 4ME2A 1K1AA 4HRLA 3AS8A 4WAFA 4DRXE 4U07A 2VSYA 3GYZA 3TWRA 1NL4A 2LAIA 3TJPA 3Q9UC 1MHQA 5ENPD 3ZYMA 4V3IA 3CK7A 5DBKA 2XPZA 3NQPA 2IQCA 3T8KA 2ETAA 1E8YA 4BT8A 3EHMA 3LY9A 2AXVA 5AYWD 4KMOA 1A5EA 2BKKB 3DRAA 4I17A 5EX3A 1NP7A 4CDMA 1WM5A 3PZ3A 3U64A 4IN3B 4JHKA 2EIJE 3CIAA 3OXLA 5FJYA 1D9SA 5E75A 2V8SE 3TG4A 3ZUVB 3L82A 3FU0A 3AU5A 2P9NG 3FUDA 3MV3B 5FINA 3ASOE 4K5AB 2XEVA 4A1SA 2X3MA 3IBEA 2EIME 3TWUA 3SBSA 3JXJA 3CVUA 1WG0A 1TR4A 4L7TA 3LKUA 4L23A 3V2XA 5A6CA 3AG4E 3QARA 2C0LA 4PS3A 1QZ2A 4U8VD 1JWGA 3HDXA 2QFCA 3G2UA 5EYLA 2FI7A 3GW4A 3FULA 2GRNB 2JABA 4FHKA 1HG2A 5KCMA 5KJNA 3C5RA 2Y1LE 3ASHA 2VQ2A 2CG2A 1VDYA 3SBTB 5A23A 4UI9K 3ESLA 3UM2A 4J8EA 4TV3A 2IFUA 1N94A 2OV8A 4URKA 3CVYA 4OVVA 3UTMA 4YVQC 2FO7A 2GRQB 3CKCA 4W9RA 3UM3A 4DX6D 2H6FA 2P9IG 3BEEA 3IV0A 4JW1A 3E30A 3APCA 3DSSA 1N0RA 4JD2G 5G55A 4DX5D 5ARFA 1FT2A 3Q15A 1UG3A 3KSQA 4I6EA 5LCWC 5BPPA 3ML9A 1O1SA 4NRHB 5AQAA 1JWFA 4U0UA 3UT4A 2GGFA 4FA6A 4LNGA 3QOUA 3IXEA 3DPYA 5D0OD 4KZCA 5DIZA 4WNDA 5KNHD 2I2OA 4WWPA 3S2AA 3T5XA 5CRVA 2OEWA 3LVRE 3VLFA 1N95A 2LNIA 4JA9A 5JHBA 4JZYA 3O48A 2WXJA 2DBAA 1OWOA 4XEIG 2GRPB 3HXFA 4WWOA 1U3CA 3QK0A 5FQ8A 4N3CA 3B7RL 4GZDA 3MYVA 4I43A 1BLXB 1O5MA 1DCQA 2HYZA 3HXDA 2XEHA 3EHRA 4LERA 2Q7FA 2LO6A 3ZGQA 2J4DA 1IXVA 4FC8A 4UI9C 2QY7A 4J8SA 1P5QA 3RRNB 1HO8A 3NAWA 3ZHEB 3MZLB 5CBNA 3PH0C 3L6AA 3PE4A 3FTVA 4PDXA 4RLYA 4OYSA 4Q69A 4JXTA 2E2EA 3DXKG 4CGWA 5FZSA 5KJKA 4U04A 2ZGGA 3FWVA 5FIOA 4R7LA 5B3SE 3QAQA 4ATZD 3HXCA 3HHMA 3GZ1A 2KZTB 4XIFA 4B94A 4MKTA 5JA4D 4GPMA 3PZ4A 2AW6A 4GU5A 3ENEA 3TWQA 4AP2A 4IULA 3HYMB 3ZPJA 3SY2A 4UQXA 4HOSA 4G23A 1DVPA 2WXPA 3JUEA 5KJMA 2CHWA 3LS8A 3SFYA 3CGHA 3C72A 1HE8A 2VSXE 4MS6A 3TG5A 2F0YA 4HXIA 4GZ3A 5ENRD 3W9GA 3MA5A 4H7XA 2RFMA 4AY6A 2NSZA 3ZVVA 5ENSD 3LXUX 4O1PA 4UWGA 1WDYA 2RG8A 4Y6WA 3PNLB 3UT7A 4ACKA 1HZ4A 3PUKA 4YDWA 4HVBA 2PQRA 1HFAA 4LNBA 5D66A 5LOZA 3ZYQA 2ONDA 4ABNA 3LVQE 1OWMA 5BUZA 1H2TC 4L2YA 2P9KG 4TXPA 4BERA 3FP3A 4BFRA 3MV2B 3HG0D 3DSUA 4U8YD 3UMVA 2VTBA 2J49A 3ASDA 4YVOA 2X6IA 3BUAA 4GTPA 1JUQA 1NA3A 5JJ6A 3FTSA 4J8FA 2X6FA 4K5CA 4L9PA 2WXHA 4EZLA 3D9JA 4UUCA 4WUYA 2L0IA 4K03A 1B89A 2ZXWE 3BQOA 3PE3A 4J0UA 5AQ9A 2XGOA 4I2ZA 4OAVB 2AVPA 2P9LG 2WXFA 5JJ7A 4JL0A 1PC2A 2UY1B 3AJIA 4FULA 2IONA 2RD0A 1AP7A 4MRUA 3X2QE 4FLBA 3ZU7B 1BI8B 2KCKA 4N5QA 2WPVA 3R7QA 1K8KG 4CT0A 4EQFA 4KT6B 3E32A 2OEVA 2PL2A 1OCOE 3RU0A 2QYJA 1PY1A 2EQXA 1KLXA 2QYUA 3MKQA 4B8AA 1EYHA 3ZW3A 2B6CA 1E96B 2KATA 1H6KA 4OAUC 3FUHA 4LCTA 3HRAA 2HO1A 2XZTG 3B7BA 2C0MA 4GTRA 3GZ2A 3DEOA 2DYSE 4PS8A 3LDZA 2LSUA 4GB9A 3ASFA 3SZ7A 2YQ8A 1QYMA 4J6IA 3RRUA 3I4RB 1N4RA 3ZYLA 3ZFWA 4FADA 3ZKJA 3B7SA 2VSNA 3OXGA 2KM4A 5ENNA 4ANWA 3RO3A 2ILRA 3ASNE 5J90A 3UX4A 1BPOA 5EKQD 5G04J 1S70B 4BSZB 1Y6IA 1WY6A 2WVIA 2F37A 3QWWA 3K9IA 5FQ7A 3ULEG 1SZAA 4G8KA 3KEAA 5CHEE 5J08A 4EZKA 1ELWA 3IHYA 4APFA 4XX5A 3GZSA 4G8LA 4G26A 3KS2A 5G05J 3CKBA 3CK8A 3DPDA 2XPIA 3ZXSA 1XGWA 2V5FA 1U3DA 5FZQA 1Z3YA 5B1BE 5T8IA 4MLPA 4YDYA 3RKVA 4CZ2D 4I1OB 4N39A 4CRWA 3PEVB 3RIBA 2VGXB 3FFLA 3CVVA 3D9KA 3FY4A 3E37A 2GROB 1QNFA 2XEEA 1MZCA 1U2VG 3QNKA 1O1TA 3Q7AA 3T9KA 4I9EA 3HXEA 3T8MA 3APFA 4D10C 2RFAA 3R9AB 1GW6A 2P9PG 2EILE 4ANVA 4F1PA 1Z6TA 3E34A 1IHBA 5AQ7A 1N9AA 4U8HA 4LNUD 2CFZA 5KBAA 2OVBA 4KYOB 1MYOA 4F6RD 2IO2C 4HI9A 2H6GA 3Q9NC 5ENOD 2M63A 3URZA 1TJFA 4XKCA 1DNPA 3C3QA 4KXKB 4GTQA 2HR2A 4FJYA 1SW6A 4BX8A 1NZNA 3SO8A 4CYMD 3TL5A 2R59A 4L1BA 4HS2A 2J07A 5AJLA 4MBGA 1E7UA 2AXZA 4I9CA 4DJAA 2GRLA 4U0SA 4O1OA 1E90A 3V2OA 3U9WA 3TWXA 4AXHA 1YMPA 3AU4A 2XGSA 3JQ1A 3Q49B 3FTZA 3S7JA 3BG0B 3AG2E 3FTYA 2BF0X 4JHJA 4GYWA 4ANUA 2DCPA 3UI2A 4ILHB 2ZISA 1EPUA 5ENTD 5H7PA 3CR3A 2XS8A 4DPRA 2JLBA 3AAAC 4UWHA 2OCCE 1ZB1A 5LX8A 4CT4A 3D3MA 3RK6A 1IHGA 2VGXA 1LD8A 3UXGA 1V54E 1FVFA 1IQUA 4BESA 3D9NA 2L6JA 4HB5A 3Q78A 5ANLA 3CVLA 4RQIA 4B93B 1HX8A 1TNYA 1BI7B 3U3WA 2F8YA 1HXIA 4TXRA 2GRRB 5EN5D 3SQVA 4E6HA 5AIJA 4GYYA 3KEZA 2V4LA 3UPVA 2NXPA 3AG1E 2ZIRA 4BY6A 5KJLA 1SZ9A 4NURA 4L2LA 1Y8MA 3SI5A 2VJ8A 2WMOA 1S0PA 2R2LA 2HE0A 3NOCD 2EINE 2R03A 2XZDG 1NI1A 4JEUA 5EX0A 1H6PA 3DWLG 5EYPF 2WXOA 5HRYA 5AJDA 3T5VA 3UM1A 2UWJG 1NFIE 1L5JA 3SF4A 3C3RA 4GZCA 3UIPC 4Z68A 4AJWA 3EIQC 5G2NA 2Y69E 4N5CA 3EU9A 3CHMA 4HRMB 4HI8A 2AJAA 3TWSA 4M7CA 3L22A 4TUMA 3D9PA 3OAWA 2YNQA 1YYHA 3MEKA 2BKGA 3ONLA 3JUIA 3LY8A 2MRIA 3PREA 1TNOA 3RJVA 4Q96A 5E76A 3PDNA 2V4HC 5IY5E 4BTBA 3ESKA 2VGEA 1N52A 2Y4UA 1N54A 3L17A 3FDHA 4O60A 4JHRA 3ASGA 3LPZA 1W3BA 3R7RA 1OWNA 3SFZA 4A63B 3CQCB 4K5BA 4GMRA 3SHFA 4WNGA 1OUVA 3Q75A 4C48B 5CEAA 1Q2ZA 2I6HA 3QDNA 4QQIA 5AAOA 3CSFA 4DUIA 3MKRA 4DLQA 3NF1A 5CCMA 3RO2A 3FUKA 2R5SA 2A5UA 3FHEA 5AQBA 2QC9A 4GA2A 4ILIA 4TXQA 3BU8A 3ZHEA 3FH7A 4B0ZA 4IYPA 4LG6A 1ELKA 1OCCE 3DSWA 2WQHA 4N2SA 4HORA 1UN8A 1INZA 4X8QA 3Q47B 3LYAA 4Y6CA 1DC2A 4UI9J 3CVPA 4CCAA 2BUGA 1MX4A 2KZTA 2XQ0A 2WQ7A 3V31A 5HI7A 4FP7A 5G05C 1O1RA 4I1AA 4CDRA 2H6HA 4JVSA 1HH8A 3FTWA 2KBXA 1FPPA 1S63A 1TNZA 3CSTA 4ATGA 2L6BA 4AVXA 5D2MC 3MGBA 1KZOA 3APDA 2XHEA 2F8XK 4C9BB 1TEZA 4IRUA 3EUVA 1TN7A 2RKKA 1N11A 3ONKA 1FT1A 2WM9A 5T4YA 4BETA 4HLLA 4I1MA 1UOHA 3NBNB 1TNBA 3I5PA 2BEDA 3CHPA 4XKBA 3CEQA 3V30A 5AN8A 3FUNA 2J9QA 1OWLA 1ZBPA 1JPLA 1IKND 1HU3A 4M3OA 4I6JA 3FEXA 4BX9A 3DXMG 1OT8A 5ARGA 3TXNA 5FQ6A 2VYIA 5JMND 1D8EA 1IYGA 3TWVA 1BU9A 3NOGD 2KCLA 3EIJA 3DSTA 3FTXA 2JEKA 3DBSA 5EIDA 1Z5SC 3UM0A 3PRZA 4AEZC 1H2UA 3ZIMA 3KAEA 2J09A 4CGVA 3ABLE 1WAO1 5BV1A 2CG3A 1D8DA 4WNFA 4KVMA 4BWRA 3U66A 1LTXA 1Z3XA 2PZIA 3CHOA 5HQ8A 5M72A 4OVUA 4A55A 2EIKE 2P58C 2I9CA 3P2BA 1H2VC 2IY0C 3FH8A 1MQSA 2XCCA 5FWQA 4EHMA 1K1BA 3MJWA 2IOLA 3UUXA 4GTSA 2X6JA 2DWZA 2DVWA 1K3ZD 4FU3A 1LF8A 2CHXA 2OOEA 4GA0A 4LEUA 3N71A 3SD5A 1SA4A 2X6KA 1N4SA 3I4GA 3LJNA 3EHQA 3ZN3A 2X38A 2ZGDA 3JYSA 4HLEA 4PUCA 2UY1A 2KC7A 4JC8A 4NIKA 4GZ6A 1OXJA 2LAHA 1G3NB 4DI4A 4ACLA 2IO3C 4FJZA 2L0TB 2XS1A 2X6HA 4HOTA 1UW4B 4G2VA 2LSVA 4DX2A 2WXMA 4BTAA 1FVHA 1UJKA 1X81A 2AXUA 1HF8A 2PQNA 3G2SA 3WXXA 1UJJA 3QWVA 2MHKA 3HVEB 1KPSB 4GTMA 1RZ4A 1N4QA 1KZPA 3O4ZA 4HOQA 2L9BA 4EPZA 4F7AA 3CHSA 2R17C 4ZHBA 1E8XA
chains in the Genus database with same CATH topology
4AOFA 3U3WA 3BG1B 3VLEA 1HXIA 4LRZA 3ULQA 3PUKA 4F53A 4HVBA 3S7BA 2PQRA 3IHVA 4APOA 5CCLA 1HFAA 3FU5A 4GCOA 1EDUA 5LOZA 3ZYQA 2ONDA 4ABNA 4E6HA 5AIJA 3LVQE 3B7UX 3FUEA 2VGYA 1OWMA 5BUZA 1H2TC 4GA1A 4L2YA 4GYYA 4WWNA 3JCKC 3KEZA 3CK9A 2V4LA 3IEGA 4RSYA 4I6GA 3ZYKA 5LFAA 2NXPA 3UPVA 5JHAA 4CDNA 3FP3A 4BY6A 5KJLA 4JA7A 2ZU6B 3B13A 4GYOA 4QFVA 1SZ9A 4BFRA 4NURA 4EBAA 4AV7A 3MV2B 4BSXA 4L2LA 3U4TA 1Y8MA 3SI5A 2VJ8A 4N2QA 4FLHA 1SQMA 2WMOA 3FUMA 4HFGA 1S0PA 3UMVA 3HIZA 3CVXA 2WXQA 2VTBA 3EJNA 2YHCA 2J49A 3ASDA 3CVQA 4JEUA 5EDSA 3FEYA 3CHQA 3L13A 5EX0A 4YVOA 2X6IA 2CHZA 1JUQA 1NA3A 2FF4A 5FZRA 3FTSA 5JJ6A 4J8FA 4Q94A 2X6FA 1QQEA 2WXOA 4KVOA 5AJDA 2WXKA 2DIWA 3T5VA 2UWJG 1KT0A 3LEWA 3OXFA 2WXHA 4EZLA 1L5JA 3SF4A 5CMWA 3CVNA 3D9JA 4WUYA 2L0IA 4K03A 1B89A 2BTDA 4CEMA 4GZCA 3G2VA 3PE3A 4J0UA 3PNTB 2XGOA 4AJWA 4H7YA 3EIQC 1EF1C 2AVPA 1TJCA 4I2ZA 5G2NA 4ME2A 3TXMA 2WXFA 4N5CA 5JJ7A 4JL0A 3AS8A 4WNEA 5C2YA 3FUFA 3CHMA 4WAFA 4PH4B 2FBNA 4U07A 2PM6A 1PC2A 3L22A 4RVBA 2VSYA 2UY1B 3D9PA 3GYZA 3PEUB 1IQRA 2WXNA 3OAWA 4FULA 3L54A 2IONA 2RD0A 2YNQA 2FULA 3MEKA 3KD7A 4MRUA 3I3NA 3P1UA 3ONLA 3JUIA 3LY8A 4FLBA 2LAIA 2MRIA 2YHEA 3PREA 4EZJA 3SGHA 4XE0A 3FTUA 3D9OA 1UN9A 4F1SA 3TJPA 1MHQA 4TRQA 2KCKA 3RJVA 3R7QA 2WPVA 3PZDA 3QJZA 4Q96A 3AS5A 3D9LA 5E76A 3ZYMA 4CT0A 4EQFA 4KT6B 2PL2A 3PDNA 4V3IA 3CK7A 5DBKA 2XPZA 3NQPA 2IQCA 4KZ0A 3RU0A 5C1DA 2PM7A 1E8YA 3L16A 4BT8A 1PY1A 3EHMA 3ESKA 4BTBA 2Y4UA 1N52A 2EQXA 3LY9A 1E8WA 1KLXA 2AXVA 5AYWD 4KMOA 3CHRA 1N54A 3MKQA 3L17A 3FDHA 1A17A 5FTPA 4JHRA 4B8AA 3HVEA 1EYHA 3ASGA 4I17A 4KBQA 5EX3A 3ZW3A 3LPZA 1W3BA 1NP7A 4CDMA 1E96B 2KATA 1WM5A 3R7RA 3U64A 1H6KA 1OWNA 4IN3B 3SFZA 5T3RA 4JHKA 3FUHA 2WMNA 4LCTA 3CQCB 5JJTA 3CIAA 3OXLA 5FJYA 4UWKA 5FQ4A 2Y4TA 4AY5A 2WXIA 3SHFA 5E75A 4WNGA 2HO1A 1OUVA 2V8SE 1FCHA 2WXRA 2C0MA 3EHNA 3TG4A 2GRMA 3GZ2A 2I6HA 3FU0A 3QDNA 4PS8A 3FUJA 3QC1A 3AU5A 3FUDA 3MV3B 5CMYA 4N3BA 3LDZA 2XEVA 2LSUA 4GB9A 3ASFA 2KCVA 3SZ7A 2YQ8A 3CSFA 4A1SA 2XRYA 2X3MA 3IBEA 5BNWA 4J6IA 3SBSA 2XPYA 4UQZA 3MKRA 4DLQA 3PS6A 3NF1A 3SNXA 3CVUA 3ML8A 3RRUA 5CCMA 3RO2A 3FUKA 4NQ0A 3FUIA 2R5SA 3I4RB 2A5UA 4L7TA 3LKUA 4L23A 3ZYLA 5A6CA 3ZFWA 3FHEA 1ELRA 4FADA 4GA2A 4ILIA 3UT8A 3ZHEA 3QARA 3FH7A 2J4BA 4B0ZA 3B7SA 2VSNA 2C0LA 3OXGA 4IYPA 4PS3A 4UWFA 1QZ2A 1ELKA 2IJGX 2A4ZA 1JWGA 2KM4A 3HDXA 3FU6A 2QFCA 3G2UA 4UQYA 2WQHA 4N2SA 5ENNA 4ANWA 2FI7A 3RO3A 2ILRA 2VTBB 3ZRHA 3GW4A 3FULA 4HORA 3EDTB 5J90A 1UN8A 1INZA 3OTNA 1BPOA 4FHKA 3UX4A 1HG2A 1PAQA 3PUJA 5EKQD 5G04J 5KCMA 5KJNA 3Q47B 2IOSA 3ASHA 3LYAA 2VQ2A 4Y6CA 4UI9J 2CG2A 3CVPA 1VDYA 4C0MA 3SBTB 1Y6IA 3Q4AB 3VTYA 5A23A 4UI9K 2BUGA 3ESLA 1WY6A 4CCAA 4J8EA 4TV3A 2IFUA 4K0RA 2KZTA 2IF4A 2OV8A 2WVIA 2XQ0A 4URKA 3B7TA 2WQ7A 3CVYA 4OVVA 3QWWA 5HI7A 4FP7A 5BW8C 5G05C 4YVQC 2FO7A 3K9IA 5FQ7A 4I1AA 4ANXA 1E8ZA 1SZAA 4CDRA 3CKCA 3JQ0A 4W9RA 4JVSA 4RG6A 1HH8A 3FTWA 3BEEA 5CHEE 5J08A 3IV0A 4EZKA 3Q5MA 4JW1A 1ELWA 4RG9A 3APCA 3CSTA 4ATGA 1YA0A 3IHYA 4APFA 4AVXA 5G55A 1H0AA 4XX5A 3FH5A 5A7DB 3GZSA 5ANRA 4GMLA 2NC9A 5ARFA 4G26A 3KS2A 5G05J 3Q15A 1UG3A 2IU1A 3CKBA 3CK8A 3DPDA 3MGBA 3APDA 2XHEA 2XPIA 4I6EA 1XGWA 3ZXSA 5LCWC 5BPPA 4C9BB 3ML9A 1TEZA 4IRUA 4NRHB 5AENA 1JWFA 2V5FA 4TUUA 4U0UA 4ILGA 3ONKA 1U3DA 5FZQA 3UT4A 2GGFA 2WM9A 5T4YA 4FA6A 1E7VA 1Z3YA 3G2TA 4I1MA 3QOUA 4U0ZA 5D0OD 4KZCA 3I5PA 5T8IA 2J08A 3QWPA 4MLPA 3RKVA 3CHPA 4G24A 4I1OB 5DIZA 4XKBA 4N39A 4CRWA 3CEQA 3MX3A 3PEVB 5FT9A 3RIBA 3FUNA 2J9QA 5LCWJ 1KT1A 1OWLA 3AS4A 2VGXB 4WNDA 3FFLA 3CVVA 3D9KA 3FY4A 2YINA 1ZBPA 3NZUA 1QNFA 2I2OA 4WWPA 3S2AA 1JPLA 3PVLA 3MKQB 3QNKA 3T5XA 4O6FA 1HU3A 4M3OA 3G2WA 4I6JA 3FEXA 4BX9A 5BT1A 5ARGA 3LVRE 3VLFA 3CVWA 4P29A 4G25A 4I9EA 3TXNA 2LNIA 4JA9A 5FQ6A 3LJ3A 3RRMB 3T8MA 4BT9A 2VYIA 5JHBA 3APFA 4JZYA 4D10C 1IYGA 3R9AB 1GW6A 4A3TA 3O48A 2KCLA 4ANVA 3EIJA 4C0EA 2VSOE 2WXJA 2JEKA 3D9MA 3FTXA 3S7FA 1Z6TA 3DBSA 2DBAA 1OWOA 2XGMA 4EBAG 2WXLA 3PRZA 4AEZC 1H2UA 4WWOA 3ZIMA 3KAEA 4U8HA 1U3CA 2J09A 3QK0A 4GAAA 4CGVA 5FQ8A 2CFZA 4B89A 4N3CA 1WAO1 5BV1A 2CG3A 3B7RL 4GZDA 4WNFA 4KVMA 2OVBA 4KYOB 5D0QD 4GPKA 2WQ6A 4BWRA 3MYVA 4I43A 4HOUA 3U66A 4EECA 4I2WA 4LERA 2HYZA 2Q7FA 2LO6A 5G04C 4DLOA 2MOWA 3ZGQA 5BV0A 3C98A 2J4DA 3VLDA 4XZ4A 1Z3XA 2I1JA 2PZIA 3CHOA 2QY7A 4FC8A 4UI9C 2M63A 4J8SA 1P5QA 3TAXA 4A3VA 4DI3A 3URZA 3RRNB 3ZEFA 4A1GA 5HQ8A 5M72A 1HO8A 1TJFA 4OVUA 4UWLA 3LY7A 4A55A 2P58C 3ZHEB 3MZLB 2I9CA 3P2BA 4FHJA 1DNPA 4XKCA 1H2VC 3PH0C 4NACA 4KXKB 4AIFA 3L6AA 3PE4A 3QKYA 3FH8A 1MQSA 3FTVA 4PDXA 2XCCA 5FWQA 4B8CB 2C2LA 2HR2A 3MJWA 2IOLA 4FJYA 3UUXA 4BX8A 3QB2A 4OYSA 4Q69A 1NZNA 4JXTA 2E2EA 3CLJA 2X6JA 2R59A 3TL5A 4L1BA 3S7DA 4HS2A 4CGWA 2OVFA 2J07A 1HS6A 2WXGA 3L08A 5FZSA 1X5BA 4G1TA 4AM9A 5KJKA 4FU3A 4U04A 1LF8A 2CHXA 3FWVA 2OOEA 4DK5A 2WB2A 4GA0A 4J8DA 4R7LA 4LEUA 3N71A 5AJLA 3SD5A 5LP0A 1E7UA 2AXZA 2X6KA 3QAQA 2AWIA 3NZSA 4GCNA 4I9CA 4DJAA 3HHMA 2GRLA 3I4GA 4U0SA 3GZ1A 2KZTB 1E90A 4XIFA 3ZN3A 2X38A 4B94A 4MKTA 3U9WA 3JYSA 4GZ5A 1NA0A 4HLEA 2Y3AA 3TGOA 4PUCA 2UY1A 2KC7A 2AW6A 2I1KA 3ENEA 4GU5A 4JC8A 1XNFA 4AXHA 4AP2A 4IULA 2HM8A 4GZ6A 2LAHA 2XGSA 3AU4A 3D9IA 3JQ1A 3Q49B 4DI4A 3VTXA 3FTZA 3HYMB 4YNDA 4ACLA 3ZPJA 4E85A 4FJZA 2L0TB 3S7JA 4UQXA 4HOSA 2X6HA 4HOTA 3BG0B 4G23A 4XI0A 1DVPA 1UW4B 2WXPA 3FTYA 2BF0X 5KJMA 2CHWA 4G2VA 3LS8A 2LSVA 4JPSA 4JHJA 4GYWA 4ANUA 3CGHA 2DCPA 4G11A 4GMJA 2XRZA 1HE8A 2WXMA 2CFUA 4ILHB 1EPUA 1HG5A 4BTAA 1FVHA 1UJKA 2GW1A 2VSXE 3CR3A 3FU3A 2AXUA 4DPRA 4MS6A 1OWPA 4JEHA 2JLBA 3E4BA 3TG5A 4UWHA 3MCXA 1HF8A 1H19A 4HXIA 2PQNA 4GZ3A 3CV0A 3LCAA 3UQ3A 5LX8A 3G2SA 4CT4A 3D3MA 1IHGA 2VGXA 4PS7A 3RK6A 4N3AA 1FVFA 2E0IA 3WXXA 1UJJA 1IQUA 2FEZA 3QWVA 4U63A 2MHKA 3MA5A 3HVEB 4H7XA 4XI9A 2XCBA 4AY6A 2NSZA 3D9NA 2L6JA 3ZVVA 3LXUX 3CQGB 3CVLA 4UWGA 5ANLA 3IKOB 2V0PA 3O4ZA 4HOQA 2L9BA 4EPZA 1HX8A 4F7AA 2RG8A 1ZU2A 3CHSA 4LUNU 2R17C 4Y6WA 3PNLB 4F3VA 1E8XA 3UT7A 4ACKA 1HZ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U3W A;  1HXI A;  3ULQ A;  3S7B A;  2PQR A;  4APO A;  5CCL A;  4GCO A;  2OND A;  4ABN A;  2VGY A;  4GA1 A;  4GYY A;  3CK9 A;  3IEG A;  3UPV A;  3FP3 A;  5KJL A;  4JA7 A;  4GYO A;  3MV2 B;  3U4T A;  1Y8M A;  4N2Q A;  2YHC A;  3ASD A;  3CVQ A;  5EX0 A;  4YVO A;  1NA3 A;  5FZR A;  2FF4 A;  5JJ6 A;  4J8F A;  1QQE A;  2UWJ G;  1KT0 A;  3OXF A;  3SF4 A;  3CVN A;  4WUY A;  1B89 A;  3PE3 A;  4J0U A;  2XGO A;  4H7Y A;  4I2Z A;  2AVP A;  1TJC A;  4ME2 A;  4N5C A;  5JJ7 A;  4JL0 A;  3AS8 A;  4WNE A;  2FBN A;  4U07 A;  1PC2 A;  2VSY A;  2UY1 B;  3GYZ A;  3MEK A;  3KD7 A;  3LY8 A;  2KCK A;  3RJV A;  2WPV A;  3AS5 A;  4EQF A;  2PL2 A;  3PDN A;  3CK7 A;  5DBK A;  3RU0 A;  5C1D A;  4BTB A;  4BT8 A;  3ESK A;  2Y4U A;  3LY9 A;  1KLX A;  5AYW D;  1A17 A;  5FTP A;  4JHR A;  3ASG A;  4I17 A;  4KBQ A;  5EX3 A;  3LPZ A;  1W3B A;  2KAT A;  1E96 B;  1WM5 A;  4IN3 B;  5JJT A;  3OXL A;  5FJY A;  2Y4T A;  4AY5 A;  4WNG A;  2HO1 A;  1OUV A;  1FCH A;  2C0M A;  3TG4 A;  3GZ2 A;  2I6H A;  3QDN A;  3MV3 B;  4N3B A;  2XEV A;  2LSU A;  3ASF A;  2KCV A;  3SZ7 A;  2YQ8 A;  4A1S A;  5BNW A;  4UQZ A;  3MKR A;  3NF1 A;  5CCM A;  3RO2 A;  4NQ0 A;  2R5S A;  3LKU A;  5A6C A;  3ZFW A;  1ELR A;  4GA2 A;  3ZHE A;  2VSN A;  2C0L A;  3OXG A;  1QZ2 A;  2QFC A;  4UQY A;  2WQH A;  4N2S A;  2FI7 A;  3RO3 A;  3GW4 A;  4HOR A;  3EDT B;  5EKQ D;  5G04 J;  5KJN A;  3Q47 B;  3ASH A;  3LYA A;  2VQ2 A;  4Y6C A;  4UI9 J;  3CVP A;  3VTY A;  3Q4A B;  4UI9 K;  2BUG A;  4J8E A;  2IFU A;  2IF4 A;  3QWW A;  5HI7 A;  5BW8 C;  5G05 C;  4YVQ C;  3K9I A;  2FO7 A;  4I1A A;  4CDR A;  3CKC A;  4W9R A;  4RG6 A;  1HH8 A;  3BEE A;  5CHE E;  3Q5M A;  1ELW A;  4RG9 A;  1YA0 A;  5A7D B;  2NC9 A;  5ARF A;  4G26 A;  3KS2 A;  5G05 J;  3Q15 A;  3CKB A;  3CK8 A;  2XPI A;  5LCW C;  4NRH B;  2V5F A;  4U0U A;  5FZQ A;  3QOU A;  4U0Z A;  5D0O D;  3RKV A;  3QWP A;  4G24 A;  5DIZ A;  4N39 A;  3CEQ A;  5FT9 A;  5LCW J;  3RIB A;  2J9Q A;  1KT1 A;  4WND A;  3AS4 A;  2VGX B;  3FFL A;  1ZBP A;  4O6F A;  5BT1 A;  5ARG A;  4G25 A;  4I9E A;  2LNI A;  4JA9 A;  4BT9 A;  2VYI A;  1IYG A;  3R9A B;  3O48 A;  2KCL A;  3S7F A;  2DBA A;  2XGM A;  3KAE A;  4CGV A;  4N3C A;  1WAO 1;  4GPK A;  4WNF A;  5D0Q D;  4KYO B;  4BWR A;  4HOU A;  4I2W A;  2HYZ A;  2Q7F A;  5G04 C;  3ZGQ A;  2PZI A;  4UI9 C;  3TAX A;  1P5Q A;  3URZ A;  5HQ8 A;  5M72 A;  3LY7 A;  2P58 C;  3ZHE B;  4KXK B;  4AIF A;  3PE4 A;  3QKY A;  2XCC A;  2C2L A;  2HR2 A;  3UUX A;  1NZN A;  2E2E A;  3S7D A;  4CGW A;  5FZS A;  5KJK A;  4AM9 A;  4G1T A;  4U04 A;  3FWV A;  2OOE A;  4GA0 A;  4J8D A;  4LEU A;  3N71 A;  4I9C A;  4GCN A;  4U0S A;  3GZ1 A;  4XIF A;  3ZN3 A;  4B94 A;  3JYS A;  4GZ5 A;  1NA0 A;  3TGO A;  2UY1 A;  2KC7 A;  1XNF A;  4GZ6 A;  2XGS A;  3Q49 B;  3VTX A;  3HYM B;  4YND A;  3ZPJ A;  3S7J A;  4UQX A;  4HOS A;  4HOT A;  4G23 A;  4XI0 A;  5KJM A;  4G2V A;  2LSV A;  4GYW A;  4BTA A;  2GW1 A;  3TG5 A;  2JLB A;  3E4B A;  2PQN A;  4GZ3 A;  3CV0 A;  3LCA A;  3UQ3 A;  1IHG A;  2VGX A;  4N3A A;  3WXX A;  2FEZ A;  3QWV A;  2MHK A;  3MA5 A;  4H7X A;  4XI9 A;  2XCB A;  4AY6 A;  2L6J A;  3CVL A;  4HOQ A;  1ZU2 A;  4Y6W A;  4F3V A;  1HZ4 A; 
#chains in the Genus database with same CATH topology
 4AOF A;  2DYR E;  3ISM C;  4GCO A;  1S64 A;  1TYQ G;  3B7U X;  3FUE A;  2VGY A;  4GA1 A;  3CK9 A;  4RSY A;  3ZYK A;  5LFA A;  5JHA A;  2R05 A;  2ZU6 B;  5EIB E;  3B13 A;  4LSZ E;  4AV7 A;  4N2Q A;  4FLH A;  3FUM A;  3CVX A;  3HIZ A;  2WXQ A;  3EJN A;  3CVQ A;  5EDS A;  3FEY A;  4J7W A;  2FF4 A;  1QQE A;  4KVO A;  2WXK A;  3PZ1 A;  1KT0 A;  3LEW A;  5CEC B;  3OXF A;  2J8S D;  5CBO A;  3CVN A;  3ULY A;  1YCS B;  2LXM A;  5B1A E;  3B95 A;  3PNT B;  4H7Y A;  1EF1 C;  1TJC A;  1TNU A;  3TXM A;  2DZN A;  3UIN C;  4WNE A;  5C2Y A;  3FUF A;  4PH4 B;  2FBN A;  2PM6 A;  4RVB A;  1QBQ A;  1N4P A;  3PEU B;  1IQR A;  2WXN A;  3L54 A;  5ENQ D;  2V5Q C;  2FUL A;  3KD7 A;  3I3N A;  3P1U A;  4EZJ A;  2YHE A;  3SGH A;  4XE0 A;  3R9M A;  2KXP C;  3FTU A;  3D9O A;  3NB2 A;  1UN9 A;  4F1S A;  3UKU G;  4TRQ A;  3PZD A;  3QJZ A;  3AS5 A;  3D9L A;  4KZ0 A;  5C1D A;  2PM7 A;  3L16 A;  1E8W A;  4GTV A;  3CHR A;  1A17 A;  5FTP A;  1OCR E;  3HVE A;  4KBQ A;  5T3R A;  2P9S G;  2R02 A;  2WMN A;  1V55 E;  5JJT A;  2A5E A;  4UWK A;  5FQ4 A;  2P2C P;  2Y4T A;  4AY5 A;  2WXI A;  1FCH A;  2WXR A;  3EHN A;  2GRM A;  3EU5 A;  3FUJ A;  3QC1 A;  5CMY A;  4N3B A;  4HQD A;  2KCV A;  3D9H A;  5BNW A;  2XRY A;  2XPY A;  4UQZ A;  3PS6 A;  3SNX A;  3ML8 A;  5AAR A;  4NQ0 A;  4GTT A;  3FUI A;  1ELR A;  2P9U G;  3UT8 A;  2J4B A;  4UWF A;  4U7E B;  4HRN A;  2IJG X;  1TN6 A;  2A4Z A;  3RSE G;  3FU6 A;  4UQY A;  1JCQ A;  2QZA A;  2DZO A;  2VTB B;  3ZRH A;  5ITZ F;  3EDT B;  3OTN A;  3PUJ A;  1PAQ A;  1MX6 A;  2IOS A;  3RAU A;  4C0M A;  4DX1 A;  3VTY A;  3Q4A B;  4K0R A;  2IF4 A;  3B7T A;  3W9F A;  5BW8 C;  4ANX A;  3F6Q A;  1E8Z A;  1MJ0 A;  1TN8 A;  3JQ0 A;  4RG6 A;  5HS0 A;  1JCS A;  3Q5M A;  3ZNG A;  4RG9 A;  1YA0 A;  1H0A A;  4ZFH A;  3FH5 A;  5A7D B;  5ANR A;  4JB8 P;  4GML A;  2NC9 A;  2IU1 A;  2FO1 E;  4U95 D;  3E33 A;  3ABM E;  5AEN A;  4TUU A;  3KSL A;  4ILG A;  5KWD A;  3DSV A;  5EIL A;  1E7V A;  3G2T A;  4U0Z A;  4YDE A;  3TWW A;  3PZ2 A;  2ETB A;  2J08 A;  3QWP A;  4G24 A;  3MX3 A;  5FT9 A;  5LCW J;  2ETC A;  1KT1 A;  3AS4 A;  2H6I A;  2YIN A;  3NZU A;  1MX2 A;  3C3O A;  3PVL A;  3MKQ B;  4O6F A;  3G2W A;  5BT1 A;  3CVW A;  4P29 A;  4G25 A;  4HNA D;  3LJ3 A;  3RRM B;  4BT9 A;  5CER B;  1N0Q A;  4A3T A;  4C0E A;  2VSO E;  3J5Q B;  3D9M A;  3S7F A;  3Q7F A;  2XGM A;  3UIO C;  4EBA G;  2WXL A;  2LUH A;  4GAA A;  4B89 A;  4GPK A;  3DEP A;  5D0Q D;  3WG7 E;  2WQ6 A;  3J5P A;  5CRU A;  4HOU A;  3L9T A;  4EEC A;  4I2W A;  3ZXP A;  4DLO A;  5G04 C;  2MOW A;  5BV0 A;  3C98 A;  1H6O A;  3VLD A;  4XZ4 A;  2I1J A;  3HXB A;  3TAX A;  4DI3 A;  1SA5 A;  4A3V A;  4A1G A;  3ZEF A;  4UWL A;  3LY7 A;  4FHJ A;  4NAC A;  4AIF A;  3DSX A;  3QKY A;  4YDO A;  4B8C B;  2C2L A;  3QB2 A;  3CLJ A;  4U96 D;  3S7D A;  2OVF A;  2WXG A;  1HS6 A;  3L08 A;  1X5B A;  4G1T A;  4AM9 A;  2WB2 A;  5HKP A;  4DK5 A;  4J8D A;  5LP0 A;  4HBD A;  2AWI A;  3NZS A;  4GCN A;  1OCZ E;  4GZ5 A;  1NA0 A;  3TGO A;  2Y3A A;  2I1K A;  1XNF A;  2HM8 A;  4BEP A;  3D9I A;  3VTX A;  1LD7 A;  4YND A;  3V79 K;  4E85 A;  4XI0 A;  3TWT A;  1RW2 A;  3UKR G;  3Q73 A;  4JPS A;  4G11 A;  4GMJ A;  2XRZ A;  2CFU A;  1HG5 A;  2GW1 A;  3FU3 A;  1OWP A;  4JEH A;  3E4B A;  3MCX A;  1H19 A;  3CV0 A;  3LCA A;  3UQ3 A;  2IEJ A;  4PS7 A;  3Q79 A;  4N3A A;  2E0I A;  2FEZ A;  4U63 A;  4XI9 A;  2XCB A;  3AG3 E;  5CED B;  2B0O E;  3CQG B;  3IKO B;  2V0P A;  1ZU2 A;  4LUN U;  2LXL A;  4F3V A;  3BG1 B;  3VLE A;  3ULQ A;  4LRZ A;  1OY3 D;  4F53 A;  3S7B A;  5BXU A;  3IHV A;  4APO A;  5CCL A;  3FU5 A;  5KNG A;  1EDU A;  1SVX A;  2XEN A;  4WWN A;  3JCK C;  5BXO A;  3IEG A;  4I6G A;  4CDN A;  2MYO A;  4JA7 A;  4GYO A;  4QFV A;  4EBA A;  4BSX A;  3U4T A;  2NYJ A;  3ABK E;  1SQM A;  4HFG A;  2YHC A;  4J8Y A;  3CHQ A;  1DCE A;  3JXI A;  3L13 A;  4DX7 D;  2CHZ A;  5FZR A;  1BD8 A;  1AWC B;  4Q94 A;  2Y0B G;  3SFX A;  2DIW A;  2PNN A;  4GTO A;  5CMW A;  1JCR A;  2BTD A;  4CEM A;  3G2V A;  4ME2 A;  1K1A A;  4HRL A;  3AS8 A;  4WAF A;  4DRX E;  4U07 A;  2VSY A;  3GYZ A;  3TWR A;  1NL4 A;  2LAI A;  3TJP A;  3Q9U C;  1MHQ A;  5ENP D;  3ZYM A;  4V3I A;  3CK7 A;  5DBK A;  2XPZ A;  3NQP A;  2IQC A;  3T8K A;  2ETA A;  1E8Y A;  4BT8 A;  3EHM A;  3LY9 A;  2AXV A;  5AYW D;  4KMO A;  1A5E A;  2BKK B;  3DRA A;  4I17 A;  5EX3 A;  1NP7 A;  4CDM A;  1WM5 A;  3PZ3 A;  3U64 A;  4IN3 B;  4JHK A;  2EIJ E;  3CIA A;  3OXL A;  5FJY A;  1D9S A;  5E75 A;  2V8S E;  3TG4 A;  3ZUV B;  3L82 A;  3FU0 A;  3AU5 A;  2P9N G;  3FUD A;  3MV3 B;  5FIN A;  3ASO E;  4K5A B;  2XEV A;  4A1S A;  2X3M A;  3IBE A;  2EIM E;  3TWU A;  3SBS A;  3JXJ A;  3CVU A;  1WG0 A;  1TR4 A;  4L7T A;  3LKU A;  4L23 A;  3V2X A;  5A6C A;  3AG4 E;  3QAR A;  2C0L A;  4PS3 A;  1QZ2 A;  4U8V D;  1JWG A;  3HDX A;  2QFC A;  3G2U A;  5EYL A;  2FI7 A;  3GW4 A;  3FUL A;  2GRN B;  2JAB A;  4FHK A;  1HG2 A;  5KCM A;  5KJN A;  3C5R A;  2Y1L E;  3ASH A;  2VQ2 A;  2CG2 A;  1VDY A;  3SBT B;  5A23 A;  4UI9 K;  3ESL A;  3UM2 A;  4J8E A;  4TV3 A;  2IFU A;  1N94 A;  2OV8 A;  4URK A;  3CVY A;  4OVV A;  3UTM A;  4YVQ C;  2FO7 A;  2GRQ B;  3CKC A;  4W9R A;  3UM3 A;  4DX6 D;  2H6F A;  2P9I G;  3BEE A;  3IV0 A;  4JW1 A;  3E30 A;  3APC A;  3DSS A;  1N0R A;  4JD2 G;  5G55 A;  4DX5 D;  5ARF A;  1FT2 A;  3Q15 A;  1UG3 A;  3KSQ A;  4I6E A;  5LCW C;  5BPP A;  3ML9 A;  1O1S A;  4NRH B;  5AQA A;  1JWF A;  4U0U A;  3UT4 A;  2GGF A;  4FA6 A;  4LNG A;  3QOU A;  3IXE A;  3DPY A;  5D0O D;  4KZC A;  5DIZ A;  4WND A;  5KNH D;  2I2O A;  4WWP A;  3S2A A;  3T5X A;  5CRV A;  2OEW A;  3LVR E;  3VLF A;  1N95 A;  2LNI A;  4JA9 A;  5JHB A;  4JZY A;  3O48 A;  2WXJ A;  2DBA A;  1OWO A;  4XEI G;  2GRP B;  3HXF A;  4WWO A;  1U3C A;  3QK0 A;  5FQ8 A;  4N3C A;  3B7R L;  4GZD A;  3MYV A;  4I43 A;  1BLX B;  1O5M A;  1DCQ A;  2HYZ A;  3HXD A;  2XEH A;  3EHR A;  4LER A;  2Q7F A;  2LO6 A;  3ZGQ A;  2J4D A;  1IXV A;  4FC8 A;  4UI9 C;  2QY7 A;  4J8S A;  1P5Q A;  3RRN B;  1HO8 A;  3NAW A;  3ZHE B;  3MZL B;  5CBN A;  3PH0 C;  3L6A A;  3PE4 A;  3FTV A;  4PDX A;  4RLY A;  4OYS A;  4Q69 A;  4JXT A;  2E2E A;  3DXK G;  4CGW A;  5FZS A;  5KJK A;  4U04 A;  2ZGG A;  3FWV A;  5FIO A;  4R7L A;  5B3S E;  3QAQ A;  4ATZ D;  3HXC A;  3HHM A;  3GZ1 A;  2KZT B;  4XIF A;  4B94 A;  4MKT A;  5JA4 D;  4GPM A;  3PZ4 A;  2AW6 A;  4GU5 A;  3ENE A;  3TWQ A;  4AP2 A;  4IUL A;  3HYM B;  3ZPJ A;  3SY2 A;  4UQX A;  4HOS A;  4G23 A;  1DVP A;  2WXP A;  3JUE A;  5KJM A;  2CHW A;  3LS8 A;  3SFY A;  3CGH A;  3C72 A;  1HE8 A;  2VSX E;  4MS6 A;  3TG5 A;  2F0Y A;  4HXI A;  4GZ3 A;  5ENR D;  3W9G A;  3MA5 A;  4H7X A;  2RFM A;  4AY6 A;  2NSZ A;  3ZVV A;  5ENS D;  3LXU X;  4O1P A;  4UWG A;  1WDY A;  2RG8 A;  4Y6W A;  3PNL B;  3UT7 A;  4ACK A;  1HZ4 A;  3PUK A;  4YDW A;  4HVB A;  2PQR A;  1HFA A;  4LNB A;  5D66 A;  5LOZ A;  3ZYQ A;  2OND A;  4ABN A;  3LVQ E;  1OWM A;  5BUZ A;  1H2T C;  4L2Y A;  2P9K G;  4TXP A;  4BER A;  3FP3 A;  4BFR A;  3MV2 B;  3HG0 D;  3DSU A;  4U8Y D;  3UMV A;  2VTB A;  2J49 A;  3ASD A;  4YVO A;  2X6I A;  3BUA A;  4GTP A;  1JUQ A;  1NA3 A;  5JJ6 A;  3FTS A;  4J8F A;  2X6F A;  4K5C A;  4L9P A;  2WXH A;  4EZL A;  3D9J A;  4UUC A;  4WUY A;  2L0I A;  4K03 A;  1B89 A;  2ZXW E;  3BQO A;  3PE3 A;  4J0U A;  5AQ9 A;  2XGO A;  4I2Z A;  4OAV B;  2AVP A;  2P9L G;  2WXF A;  5JJ7 A;  4JL0 A;  1PC2 A;  2UY1 B;  3AJI A;  4FUL A;  2ION A;  2RD0 A;  1AP7 A;  4MRU A;  3X2Q E;  4FLB A;  3ZU7 B;  1BI8 B;  2KCK A;  4N5Q A;  2WPV A;  3R7Q A;  1K8K G;  4CT0 A;  4EQF A;  4KT6 B;  3E32 A;  2OEV A;  2PL2 A;  1OCO E;  3RU0 A;  2QYJ A;  1PY1 A;  2EQX A;  1KLX A;  2QYU A;  3MKQ A;  4B8A A;  1EYH A;  3ZW3 A;  2B6C A;  1E96 B;  2KAT A;  1H6K A;  4OAU C;  3FUH A;  4LCT A;  3HRA A;  2HO1 A;  2XZT G;  3B7B A;  2C0M A;  4GTR A;  3GZ2 A;  3DEO A;  2DYS E;  4PS8 A;  3LDZ A;  2LSU A;  4GB9 A;  3ASF A;  3SZ7 A;  2YQ8 A;  1QYM A;  4J6I A;  3RRU A;  3I4R B;  1N4R A;  3ZYL A;  3ZFW A;  4FAD A;  3ZKJ A;  3B7S A;  2VSN A;  3OXG A;  2KM4 A;  5ENN A;  4ANW A;  3RO3 A;  2ILR A;  3ASN E;  5J90 A;  3UX4 A;  1BPO A;  5EKQ D;  5G04 J;  1S70 B;  4BSZ B;  1Y6I A;  1WY6 A;  2WVI A;  2F37 A;  3QWW A;  3K9I A;  5FQ7 A;  3ULE G;  1SZA A;  4G8K A;  3KEA A;  5CHE E;  5J08 A;  4EZK A;  1ELW A;  3IHY A;  4APF A;  4XX5 A;  3GZS A;  4G8L A;  4G26 A;  3KS2 A;  5G05 J;  3CKB A;  3CK8 A;  3DPD A;  2XPI A;  3ZXS A;  1XGW A;  2V5F A;  1U3D A;  5FZQ A;  1Z3Y A;  5B1B E;  5T8I A;  4MLP A;  4YDY A;  3RKV A;  4CZ2 D;  4I1O B;  4N39 A;  4CRW A;  3PEV B;  3RIB A;  2VGX B;  3FFL A;  3CVV A;  3D9K A;  3FY4 A;  3E37 A;  2GRO B;  1QNF A;  2XEE A;  1MZC A;  1U2V G;  3QNK A;  1O1T A;  3Q7A A;  3T9K A;  4I9E A;  3HXE A;  3T8M A;  3APF A;  4D10 C;  2RFA A;  3R9A B;  1GW6 A;  2P9P G;  2EIL E;  4ANV A;  4F1P A;  1Z6T A;  3E34 A;  1IHB A;  5AQ7 A;  1N9A A;  4U8H A;  4LNU D;  2CFZ A;  5KBA A;  2OVB A;  4KYO B;  1MYO A;  4F6R D;  2IO2 C;  4HI9 A;  2H6G A;  3Q9N C;  5ENO D;  2M63 A;  3URZ A;  1TJF A;  4XKC A;  1DNP A;  3C3Q A;  4KXK B;  4GTQ A;  2HR2 A;  4FJY A;  1SW6 A;  4BX8 A;  1NZN A;  3SO8 A;  4CYM D;  3TL5 A;  2R59 A;  4L1B A;  4HS2 A;  2J07 A;  5AJL A;  4MBG A;  1E7U A;  2AXZ A;  4I9C A;  4DJA A;  2GRL A;  4U0S A;  4O1O A;  1E90 A;  3V2O A;  3U9W A;  3TWX A;  4AXH A;  1YMP A;  3AU4 A;  2XGS A;  3JQ1 A;  3Q49 B;  3FTZ A;  3S7J A;  3BG0 B;  3AG2 E;  3FTY A;  2BF0 X;  4JHJ A;  4GYW A;  4ANU A;  2DCP A;  3UI2 A;  4ILH B;  2ZIS A;  1EPU A;  5ENT D;  5H7P A;  3CR3 A;  2XS8 A;  4DPR A;  2JLB A;  3AAA C;  4UWH A;  2OCC E;  1ZB1 A;  5LX8 A;  4CT4 A;  3D3M A;  3RK6 A;  1IHG A;  2VGX A;  1LD8 A;  3UXG A;  1V54 E;  1FVF A;  1IQU A;  4BES A;  3D9N A;  2L6J A;  4HB5 A;  3Q78 A;  5ANL A;  3CVL A;  4RQI A;  4B93 B;  1HX8 A;  1TNY A;  1BI7 B;  3U3W A;  2F8Y A;  1HXI A;  4TXR A;  2GRR B;  5EN5 D;  3SQV A;  4E6H A;  5AIJ A;  4GYY A;  3KEZ A;  2V4L A;  3UPV A;  2NXP A;  3AG1 E;  2ZIR A;  4BY6 A;  5KJL A;  1SZ9 A;  4NUR A;  4L2L A;  1Y8M A;  3SI5 A;  2VJ8 A;  2WMO A;  1S0P A;  2R2L A;  2HE0 A;  3NOC D;  2EIN E;  2R03 A;  2XZD G;  1NI1 A;  4JEU A;  5EX0 A;  1H6P A;  3DWL G;  5EYP F;  2WXO A;  5HRY A;  5AJD A;  3T5V A;  3UM1 A;  2UWJ G;  1NFI E;  1L5J A;  3SF4 A;  3C3R A;  4GZC A;  3UIP C;  4Z68 A;  4AJW A;  3EIQ C;  5G2N A;  2Y69 E;  4N5C A;  3EU9 A;  3CHM A;  4HRM B;  4HI8 A;  2AJA A;  3TWS A;  4M7C A;  3L22 A;  4TUM A;  3D9P A;  3OAW A;  2YNQ A;  1YYH A;  3MEK A;  2BKG A;  3ONL A;  3JUI A;  3LY8 A;  2MRI A;  3PRE A;  1TNO A;  3RJV A;  4Q96 A;  5E76 A;  3PDN A;  2V4H C;  5IY5 E;  4BTB A;  3ESK A;  2VGE A;  1N52 A;  2Y4U A;  1N54 A;  3L17 A;  3FDH A;  4O60 A;  4JHR A;  3ASG A;  3LPZ A;  1W3B A;  3R7R A;  1OWN A;  3SFZ A;  4A63 B;  3CQC B;  4K5B A;  4GMR A;  3SHF A;  4WNG A;  1OUV A;  3Q75 A;  4C48 B;  5CEA A;  1Q2Z A;  2I6H A;  3QDN A;  4QQI A;  5AAO A;  3CSF A;  4DUI A;  3MKR A;  4DLQ A;  3NF1 A;  5CCM A;  3RO2 A;  3FUK A;  2R5S A;  2A5U A;  3FHE A;  5AQB A;  2QC9 A;  4GA2 A;  4ILI A;  4TXQ A;  3BU8 A;  3ZHE A;  3FH7 A;  4B0Z A;  4IYP A;  4LG6 A;  1ELK A;  1OCC E;  3DSW A;  2WQH A;  4N2S A;  4HOR A;  1UN8 A;  1INZ A;  4X8Q A;  3Q47 B;  3LYA A;  4Y6C A;  1DC2 A;  4UI9 J;  3CVP A;  4CCA A;  2BUG A;  1MX4 A;  2KZT A;  2XQ0 A;  2WQ7 A;  3V31 A;  5HI7 A;  4FP7 A;  5G05 C;  1O1R A;  4I1A A;  4CDR A;  2H6H A;  4JVS A;  1HH8 A;  3FTW A;  2KBX A;  1FPP A;  1S63 A;  1TNZ A;  3CST A;  4ATG A;  2L6B A;  4AVX A;  5D2M C;  3MGB A;  1KZO A;  3APD A;  2XHE A;  2F8X K;  4C9B B;  1TEZ A;  4IRU A;  3EUV A;  1TN7 A;  2RKK A;  1N11 A;  3ONK A;  1FT1 A;  2WM9 A;  5T4Y A;  4BET A;  4HLL A;  4I1M A;  1UOH A;  3NBN B;  1TNB A;  3I5P A;  2BED A;  3CHP A;  4XKB A;  3CEQ A;  3V30 A;  5AN8 A;  3FUN A;  2J9Q A;  1OWL A;  1ZBP A;  1JPL A;  1IKN D;  1HU3 A;  4M3O A;  4I6J A;  3FEX A;  4BX9 A;  3DXM G;  1OT8 A;  5ARG A;  3TXN A;  5FQ6 A;  2VYI A;  5JMN D;  1D8E A;  1IYG A;  3TWV A;  1BU9 A;  3NOG D;  2KCL A;  3EIJ A;  3DST A;  3FTX A;  2JEK A;  3DBS A;  5EID A;  1Z5S C;  3UM0 A;  3PRZ A;  4AEZ C;  1H2U A;  3ZIM A;  3KAE A;  2J09 A;  4CGV A;  3ABL E;  1WAO 1;  5BV1 A;  2CG3 A;  1D8D A;  4WNF A;  4KVM A;  4BWR A;  3U66 A;  1LTX A;  1Z3X A;  2PZI A;  3CHO A;  5HQ8 A;  5M72 A;  4OVU A;  4A55 A;  2EIK E;  2P58 C;  2I9C A;  3P2B A;  1H2V C;  2IY0 C;  3FH8 A;  1MQS A;  2XCC A;  5FWQ A;  4EHM A;  1K1B A;  3MJW A;  2IOL A;  3UUX A;  4GTS A;  2X6J A;  2DWZ A;  2DVW A;  1K3Z D;  4FU3 A;  1LF8 A;  2CHX A;  2OOE A;  4GA0 A;  4LEU A;  3N71 A;  3SD5 A;  1SA4 A;  2X6K A;  1N4S A;  3I4G A;  3LJN A;  3EHQ A;  3ZN3 A;  2X38 A;  2ZGD A;  3JYS A;  4HLE A;  4PUC A;  2UY1 A;  2KC7 A;  4JC8 A;  4NIK A;  4GZ6 A;  1OXJ A;  2LAH A;  1G3N B;  4DI4 A;  4ACL A;  2IO3 C;  4FJZ A;  2L0T B;  2XS1 A;  2X6H A;  4HOT A;  1UW4 B;  4G2V A;  2LSV A;  4DX2 A;  2WXM A;  4BTA A;  1FVH A;  1UJK A;  1X81 A;  2AXU A;  1HF8 A;  2PQN A;  3G2S A;  3WXX A;  1UJJ A;  3QWV A;  2MHK A;  3HVE B;  1KPS B;  4GTM A;  1RZ4 A;  1N4Q A;  1KZP A;  3O4Z A;  4HOQ A;  2L9B A;  4EPZ A;  4F7A A;  3CHS A;  2R17 C;  4ZHB A;  1E8X A; 
#chains in the Genus database with same CATH homology
 4AOF A;  3U3W A;  3BG1 B;  3VLE A;  1HXI A;  4LRZ A;  3ULQ A;  3PUK A;  4F53 A;  4HVB A;  3S7B A;  2PQR A;  3IHV A;  4APO A;  5CCL A;  1HFA A;  3FU5 A;  4GCO A;  1EDU A;  5LOZ A;  3ZYQ A;  2OND A;  4ABN A;  4E6H A;  5AIJ A;  3LVQ E;  3B7U X;  3FUE A;  2VGY A;  1OWM A;  5BUZ A;  1H2T C;  4GA1 A;  4L2Y A;  4GYY A;  4WWN A;  3JCK C;  3KEZ A;  3CK9 A;  2V4L A;  3IEG A;  4RSY A;  4I6G A;  3ZYK A;  5LFA A;  2NXP A;  3UPV A;  5JHA A;  4CDN A;  3FP3 A;  4BY6 A;  5KJL A;  4JA7 A;  2ZU6 B;  3B13 A;  4GYO A;  4QFV A;  1SZ9 A;  4BFR A;  4NUR A;  4EBA A;  4AV7 A;  3MV2 B;  4BSX A;  4L2L A;  3U4T A;  1Y8M A;  3SI5 A;  2VJ8 A;  4N2Q A;  4FLH A;  1SQM A;  2WMO A;  3FUM A;  4HFG A;  1S0P A;  3UMV A;  3HIZ A;  3CVX A;  2WXQ A;  2VTB A;  3EJN A;  2YHC A;  2J49 A;  3ASD A;  3CVQ A;  4JEU A;  5EDS A;  3FEY A;  3CHQ A;  3L13 A;  5EX0 A;  4YVO A;  2X6I A;  2CHZ A;  1JUQ A;  1NA3 A;  2FF4 A;  5FZR A;  3FTS A;  5JJ6 A;  4J8F A;  4Q94 A;  2X6F A;  1QQE A;  2WXO A;  4KVO A;  5AJD A;  2WXK A;  2DIW A;  3T5V A;  2UWJ G;  1KT0 A;  3LEW A;  3OXF A;  2WXH A;  4EZL A;  1L5J A;  3SF4 A;  5CMW A;  3CVN A;  3D9J A;  4WUY A;  2L0I A;  4K03 A;  1B89 A;  2BTD A;  4CEM A;  4GZC A;  3G2V A;  3PE3 A;  4J0U A;  3PNT B;  2XGO A;  4AJW A;  4H7Y A;  3EIQ C;  1EF1 C;  2AVP A;  1TJC A;  4I2Z A;  5G2N A;  4ME2 A;  3TXM A;  2WXF A;  4N5C A;  5JJ7 A;  4JL0 A;  3AS8 A;  4WNE A;  5C2Y A;  3FUF A;  3CHM A;  4WAF A;  4PH4 B;  2FBN A;  4U07 A;  2PM6 A;  1PC2 A;  3L22 A;  4RVB A;  2VSY A;  2UY1 B;  3D9P A;  3GYZ A;  3PEU B;  1IQR A;  2WXN A;  3OAW A;  4FUL A;  3L54 A;  2ION A;  2RD0 A;  2YNQ A;  2FUL A;  3MEK A;  3KD7 A;  4MRU A;  3I3N A;  3P1U A;  3ONL A;  3JUI A;  3LY8 A;  4FLB A;  2LAI A;  2MRI A;  2YHE A;  3PRE A;  4EZJ A;  3SGH A;  4XE0 A;  3FTU A;  3D9O A;  1UN9 A;  4F1S A;  3TJP A;  1MHQ A;  4TRQ A;  2KCK A;  3RJV A;  3R7Q A;  2WPV A;  3PZD A;  3QJZ A;  4Q96 A;  3AS5 A;  3D9L A;  5E76 A;  3ZYM A;  4CT0 A;  4EQF A;  4KT6 B;  2PL2 A;  3PDN A;  4V3I A;  3CK7 A;  5DBK A;  2XPZ A;  3NQP A;  2IQC A;  4KZ0 A;  3RU0 A;  5C1D A;  2PM7 A;  1E8Y A;  3L16 A;  4BT8 A;  1PY1 A;  3EHM A;  3ESK A;  4BTB A;  2Y4U A;  1N52 A;  2EQX A;  3LY9 A;  1E8W A;  1KLX A;  2AXV A;  5AYW D;  4KMO A;  3CHR A;  1N54 A;  3MKQ A;  3L17 A;  3FDH A;  1A17 A;  5FTP A;  4JHR A;  4B8A A;  3HVE A;  1EYH A;  3ASG A;  4I17 A;  4KBQ A;  5EX3 A;  3ZW3 A;  3LPZ A;  1W3B A;  1NP7 A;  4CDM A;  1E96 B;  2KAT A;  1WM5 A;  3R7R A;  3U64 A;  1H6K A;  1OWN A;  4IN3 B;  3SFZ A;  5T3R A;  4JHK A;  3FUH A;  2WMN A;  4LCT A;  3CQC B;  5JJT A;  3CIA A;  3OXL A;  5FJY A;  4UWK A;  5FQ4 A;  2Y4T A;  4AY5 A;  2WXI A;  3SHF A;  5E75 A;  4WNG A;  2HO1 A;  1OUV A;  2V8S E;  1FCH A;  2WXR A;  2C0M A;  3EHN A;  3TG4 A;  2GRM A;  3GZ2 A;  2I6H A;  3FU0 A;  3QDN A;  4PS8 A;  3FUJ A;  3QC1 A;  3AU5 A;  3FUD A;  3MV3 B;  5CMY A;  4N3B A;  3LDZ A;  2XEV A;  2LSU A;  4GB9 A;  3ASF A;  2KCV A;  3SZ7 A;  2YQ8 A;  3CSF A;  4A1S A;  2XRY A;  2X3M A;  3IBE A;  5BNW A;  4J6I A;  3SBS A;  2XPY A;  4UQZ A;  3MKR A;  4DLQ A;  3PS6 A;  3NF1 A;  3SNX A;  3CVU A;  3ML8 A;  3RRU A;  5CCM A;  3RO2 A;  3FUK A;  4NQ0 A;  3FUI A;  2R5S A;  3I4R B;  2A5U A;  4L7T A;  3LKU A;  4L23 A;  3ZYL A;  5A6C A;  3ZFW A;  3FHE A;  1ELR A;  4FAD A;  4GA2 A;  4ILI A;  3UT8 A;  3ZHE A;  3QAR A;  3FH7 A;  2J4B A;  4B0Z A;  3B7S A;  2VSN A;  2C0L A;  3OXG A;  4IYP A;  4PS3 A;  4UWF A;  1QZ2 A;  1ELK A;  2IJG X;  2A4Z A;  1JWG A;  2KM4 A;  3HDX A;  3FU6 A;  2QFC A;  3G2U A;  4UQY A;  2WQH A;  4N2S A;  5ENN A;  4ANW A;  2FI7 A;  3RO3 A;  2ILR A;  2VTB B;  3ZRH A;  3GW4 A;  3FUL A;  4HOR A;  3EDT B;  5J90 A;  1UN8 A;  1INZ A;  3OTN A;  1BPO A;  4FHK A;  3UX4 A;  1HG2 A;  1PAQ A;  3PUJ A;  5EKQ D;  5G04 J;  5KCM A;  5KJN A;  3Q47 B;  2IOS A;  3ASH A;  3LYA A;  2VQ2 A;  4Y6C A;  4UI9 J;  2CG2 A;  3CVP A;  1VDY A;  4C0M A;  3SBT B;  1Y6I A;  3Q4A B;  3VTY A;  5A23 A;  4UI9 K;  2BUG A;  3ESL A;  1WY6 A;  4CCA A;  4J8E A;  4TV3 A;  2IFU A;  4K0R A;  2KZT A;  2IF4 A;  2OV8 A;  2WVI A;  2XQ0 A;  4URK A;  3B7T A;  2WQ7 A;  3CVY A;  4OVV A;  3QWW A;  5HI7 A;  4FP7 A;  5BW8 C;  5G05 C;  4YVQ C;  2FO7 A;  3K9I A;  5FQ7 A;  4I1A A;  4ANX A;  1E8Z A;  1SZA A;  4CDR A;  3CKC A;  3JQ0 A;  4W9R A;  4JVS A;  4RG6 A;  1HH8 A;  3FTW A;  3BEE A;  5CHE E;  5J08 A;  3IV0 A;  4EZK A;  3Q5M A;  4JW1 A;  1ELW A;  4RG9 A;  3APC A;  3CST A;  4ATG A;  1YA0 A;  3IHY A;  4APF A;  4AVX A;  5G55 A;  1H0A A;  4XX5 A;  3FH5 A;  5A7D B;  3GZS A;  5ANR A;  4GML A;  2NC9 A;  5ARF A;  4G26 A;  3KS2 A;  5G05 J;  3Q15 A;  1UG3 A;  2IU1 A;  3CKB A;  3CK8 A;  3DPD A;  3MGB A;  3APD A;  2XHE A;  2XPI A;  4I6E A;  1XGW A;  3ZXS A;  5LCW C;  5BPP A;  4C9B B;  3ML9 A;  1TEZ A;  4IRU A;  4NRH B;  5AEN A;  1JWF A;  2V5F A;  4TUU A;  4U0U A;  4ILG A;  3ONK A;  1U3D A;  5FZQ A;  3UT4 A;  2GGF A;  2WM9 A;  5T4Y A;  4FA6 A;  1E7V A;  1Z3Y A;  3G2T A;  4I1M A;  3QOU A;  4U0Z A;  5D0O D;  4KZC A;  3I5P A;  5T8I A;  2J08 A;  3QWP A;  4MLP A;  3RKV A;  3CHP A;  4G24 A;  4I1O B;  5DIZ A;  4XKB A;  4N39 A;  4CRW A;  3CEQ A;  3MX3 A;  3PEV B;  5FT9 A;  3RIB A;  3FUN A;  2J9Q A;  5LCW J;  1KT1 A;  1OWL A;  3AS4 A;  2VGX B;  4WND A;  3FFL A;  3CVV A;  3D9K A;  3FY4 A;  2YIN A;  1ZBP A;  3NZU A;  1QNF A;  2I2O A;  4WWP A;  3S2A A;  1JPL A;  3PVL A;  3MKQ B;  3QNK A;  3T5X A;  4O6F A;  1HU3 A;  4M3O A;  3G2W A;  4I6J A;  3FEX A;  4BX9 A;  5BT1 A;  5ARG A;  3LVR E;  3VLF A;  3CVW A;  4P29 A;  4G25 A;  4I9E A;  3TXN A;  2LNI A;  4JA9 A;  5FQ6 A;  3LJ3 A;  3RRM B;  3T8M A;  4BT9 A;  2VYI A;  5JHB A;  3APF A;  4JZY A;  4D10 C;  1IYG A;  3R9A B;  1GW6 A;  4A3T A;  3O48 A;  2KCL A;  4ANV A;  3EIJ A;  4C0E A;  2VSO E;  2WXJ A;  2JEK A;  3D9M A;  3FTX A;  3S7F A;  1Z6T A;  3DBS A;  2DBA A;  1OWO A;  2XGM A;  4EBA G;  2WXL A;  3PRZ A;  4AEZ C;  1H2U A;  4WWO A;  3ZIM A;  3KAE A;  4U8H A;  1U3C A;  2J09 A;  3QK0 A;  4GAA A;  4CGV A;  5FQ8 A;  2CFZ A;  4B89 A;  4N3C A;  1WAO 1;  5BV1 A;  2CG3 A;  3B7R L;  4GZD A;  4WNF A;  4KVM A;  2OVB A;  4KYO B;  5D0Q D;  4GPK A;  2WQ6 A;  4BWR A;  3MYV A;  4I43 A;  4HOU A;  3U66 A;  4EEC A;  4I2W A;  4LER A;  2HYZ A;  2Q7F A;  2LO6 A;  5G04 C;  4DLO A;  2MOW A;  3ZGQ A;  5BV0 A;  3C98 A;  2J4D A;  3VLD A;  4XZ4 A;  1Z3X A;  2I1J A;  2PZI A;  3CHO A;  2QY7 A;  4FC8 A;  4UI9 C;  2M63 A;  4J8S A;  1P5Q A;  3TAX A;  4A3V A;  4DI3 A;  3URZ A;  3RRN B;  3ZEF A;  4A1G A;  5HQ8 A;  5M72 A;  1HO8 A;  1TJF A;  4OVU A;  4UWL A;  3LY7 A;  4A55 A;  2P58 C;  3ZHE B;  3MZL B;  2I9C A;  3P2B A;  4FHJ A;  1DNP A;  4XKC A;  1H2V C;  3PH0 C;  4NAC A;  4KXK B;  4AIF A;  3L6A A;  3PE4 A;  3QKY A;  3FH8 A;  1MQS A;  3FTV A;  4PDX A;  2XCC A;  5FWQ A;  4B8C B;  2C2L A;  2HR2 A;  3MJW A;  2IOL A;  4FJY A;  3UUX A;  4BX8 A;  3QB2 A;  4OYS A;  4Q69 A;  1NZN A;  4JXT A;  2E2E A;  3CLJ A;  2X6J A;  2R59 A;  3TL5 A;  4L1B A;  3S7D A;  4HS2 A;  4CGW A;  2OVF A;  2J07 A;  1HS6 A;  2WXG A;  3L08 A;  5FZS A;  1X5B A;  4G1T A;  4AM9 A;  5KJK A;  4FU3 A;  4U04 A;  1LF8 A;  2CHX A;  3FWV A;  2OOE A;  4DK5 A;  2WB2 A;  4GA0 A;  4J8D A;  4R7L A;  4LEU A;  3N71 A;  5AJL A;  3SD5 A;  5LP0 A;  1E7U A;  2AXZ A;  2X6K A;  3QAQ A;  2AWI A;  3NZS A;  4GCN A;  4I9C A;  4DJA A;  3HHM A;  2GRL A;  3I4G A;  4U0S A;  3GZ1 A;  2KZT B;  1E90 A;  4XIF A;  3ZN3 A;  2X38 A;  4B94 A;  4MKT A;  3U9W A;  3JYS A;  4GZ5 A;  1NA0 A;  4HLE A;  2Y3A A;  3TGO A;  4PUC A;  2UY1 A;  2KC7 A;  2AW6 A;  2I1K A;  3ENE A;  4GU5 A;  4JC8 A;  1XNF A;  4AXH A;  4AP2 A;  4IUL A;  2HM8 A;  4GZ6 A;  2LAH A;  2XGS A;  3AU4 A;  3D9I A;  3JQ1 A;  3Q49 B;  4DI4 A;  3VTX A;  3FTZ A;  3HYM B;  4YND A;  4ACL A;  3ZPJ A;  4E85 A;  4FJZ A;  2L0T B;  3S7J A;  4UQX A;  4HOS A;  2X6H A;  4HOT A;  3BG0 B;  4G23 A;  4XI0 A;  1DVP A;  1UW4 B;  2WXP A;  3FTY A;  2BF0 X;  5KJM A;  2CHW A;  4G2V A;  3LS8 A;  2LSV A;  4JPS A;  4JHJ A;  4GYW A;  4ANU A;  3CGH A;  2DCP A;  4G11 A;  4GMJ A;  2XRZ A;  1HE8 A;  2WXM A;  2CFU A;  4ILH B;  1EPU A;  1HG5 A;  4BTA A;  1FVH A;  1UJK A;  2GW1 A;  2VSX E;  3CR3 A;  3FU3 A;  2AXU A;  4DPR A;  4MS6 A;  1OWP A;  4JEH A;  2JLB A;  3E4B A;  3TG5 A;  4UWH A;  3MCX A;  1HF8 A;  1H19 A;  4HXI A;  2PQN A;  4GZ3 A;  3CV0 A;  3LCA A;  3UQ3 A;  5LX8 A;  3G2S A;  4CT4 A;  3D3M A;  1IHG A;  2VGX A;  4PS7 A;  3RK6 A;  4N3A A;  1FVF A;  2E0I A;  3WXX A;  1UJJ A;  1IQU A;  2FEZ A;  3QWV A;  4U63 A;  2MHK A;  3MA5 A;  3HVE B;  4H7X A;  4XI9 A;  2XCB A;  4AY6 A;  2NSZ A;  3D9N A;  2L6J A;  3ZVV A;  3LXU X;  3CQG B;  3CVL A;  4UWG A;  5ANL A;  3IKO B;  2V0P A;  3O4Z A;  4HOQ A;  2L9B A;  4EPZ A;  1HX8 A;  4F7A A;  2RG8 A;  1ZU2 A;  3CHS A;  4LUN U;  2R17 C;  4Y6W A;  3PNL B;  4F3V A;  1E8X A;  3UT7 A;  4ACK A;  1HZ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...