5D0QD

Bamacde complex, outer membrane beta-barrel assembly machinery (bam) complex
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
218
structure length
218
Chain Sequence
EVPDNPPNEIYATAQQKLQDGNWRQAITQLEALDNRYPFGPYSQQVQLDLIYAYYKNADLPLAQAAIDRFIRLNPTHPNIDYVMYMRGLTNMALDDSALQGFFGVDRSDRDPQHARAAFSDFSKLVRGYPNSQYTTDATKRLVFLKDRLAKYEYSVAEYYTERGAWVAVVNRVEGMLRDYPDTQATRDALPLMENAYRQMQMNAQAEKVAKIIAANSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer membrane protein assembly factor BamA
publication title Structural basis of outer membrane protein insertion by the BAM complex.
pubmed doi rcsb
source organism Escherichia coli k-12
molecule tags Protein transport
total genus 65
structure length 218
sequence length 218
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF13525 YfiO Outer membrane lipoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5d0qD00
5ARGA 1P5QA 4GYYA 5A6CA 4HOTA 5FZQA 2V5FA 3FFLA 2NC9A 1QQEA 5G04J 4J0UA 2AVPA 3CVPA 3GZ2A 3LKUA 3QKYA 4IN3B 2KCKA 4KXKB 3KAEA 3RO3A 4U0ZA 3ZPJA 5EX0A 4I2WA 4G2VA 3LPZA 3KD7A 4N2QA 4GZ5A 2YHCA 1HXIA 2DBAA 3PE3A 4NRHB 3KS2A 3NF1A 3MV2B 3Q49B 4G1TA 4CDRA 5CCMA 4XIFA 1YA0A 4GYWA 3CK7A 3MA5A 3ZFWA 2WPVA 4WNGA 2UY1A 1ELRA 2XCBA 3Q47B 4ABNA 3CK9A 3PE4A 1B89A 5KJMA 4I9CA 4GYOA 4BTAA 4JHRA 4GA1A 5KJLA 3GYZA 4KBQA 3CV0A 4G23A 2YQ8A 2XGOA 2XGSA 4JA9A 4H7XA 3ULQA 3GZ1A 4G24A 4BT9A 1XNFA 4EQFA 4JL0A 3S7JA 2QFCA 2XGMA 2KCLA 5ARFA 2ONDA 2VSYA 4GZ3A 4YVQC 4N3BA 1E96B 3O48A 4UQXA 3OXLA 3QOUA 3URZA 3TG5A 2PQNA 3QWWA 2VGYA 4I17A 3JYSA 2VSNA 1NA0A 3ASHA 4RG9A 2VYIA 3CVNA 4Y6CA 3Q4AB 3QDNA 3RJVA 4APOA 3LY9A 3LYAA 1W3BA 2IF4A 5BW8C 4N2SA 2LSVA 3S7BA 1PC2A 4YVOA 3ZGQA 4U0SA 4N3CA 4G25A 3Q15A 4CGWA 2FF4A 3LY7A 4U04A 4I9EA 4AY5A 5JJ6A 5HQ8A 4GPKA 3VTXA 4U07A 5DIZA 2UWJG 3UQ3A 4AIFA 2JLBA 2PL2A 5G04C 2KC7A 4NQ0A 1IHGA 2E2EA 2PZIA 2HO1A 3E4BA 3GW4A 3QWVA 2FO7A 4BWRA 3ASDA 5BNWA 4I2ZA 5KJNA 3AS8A 4N3AA 3N71A 3MKRA 3CK8A 2IFUA 2HYZA 5D0QD 4Y6WA 5G05J 1IYGA 3SF4A 1ZU2A 4HOSA 2Y4UA 3TGOA 1KLXA 4J8EA 3ZHEB 5EX3A 5CHEE 3CEQA 3FP3A 4I1AA 4G26A 5FTPA 4KYOB 3EDTB 5KJKA 3OXGA 4WNDA 4F3VA 3LCAA 2FEZA 5G05C 3K9IA 3U4TA 1KT1A 3ASGA 1HH8A 5DBKA 2KATA 4J8DA 1ELWA 3SZ7A 4W9RA 1NZNA 2BUGA 1TJCA 3ASFA 4AM9A 2L6JA 3RO2A 5FT9A 4GA0A 5BT1A 4B94A 4O6FA 3OXFA 5M72A 3LY8A 1OUVA 5EKQD 1WAO1 3BEEA 1WM5A 4XI9A 3ESKA 1A17A 3RU0A 4JA7A 3U3WA 3ZN3A 4J8FA 1HZ4A 4CGVA 1KT0A 2WQHA 3QWPA 4BT8A 4GCNA 3AS5A 2XCCA 2Q7FA 2C0LA 4YNDA 5A7DB 4UI9J 3PDNA 2VQ2A 4A1SA 3CVLA 2I6HA 2VGXB 2UY1B 3TG4A 4N39A 5JJTA 3RKVA 2PQRA 4WNEA 2LNIA 3AS4A 2C0MA 2Y4TA 5FJYA 2P58C 4N5CA 4UI9K 1ZBPA 4UI9C 2FI7A 3S7FA 3MV3B 4BTBA 2VGXA 3HYMB 4LEUA 1QZ2A 3S7DA 4UQZA 3FWVA 3VTYA 2C2LA 2FBNA 2XPIA 5LCWJ 5C1DA 3WXXA 2KCVA 3CKBA 2R5SA 5AYWD 2J9QA 4HOQA 4U0UA 3UPVA 3Q5MA 5FZSA 4ME2A 4HOUA 2GW1A 4WNFA 3CKCA 1FCHA 5HI7A 4WUYA 4GCOA 5CCLA 4UQYA 3RIBA 4XI0A 3MEKA 3CVQA 1NA3A 3ZHEA 3UUXA 4RG6A 4HORA 5LCWC 4H7YA 5D0OD 2HR2A 4GZ6A 2LSUA 3R9AB 3IEGA 5JJ7A 3TAXA 2XEVA 2MHKA 2OOEA 5FZRA 4AY6A 4GA2A 1Y8MA
chains in the Genus database with same CATH superfamily
5G2NA 4DX6D 1O1TA 1ZB1A 5FINA 1K3ZD 5AENA 4GYYA 4KZCA 3VLDA 3DSSA 4TXPA 3PNTB 2V5FA 3NOGD 3ZUVB 3FFLA 3PUKA 4BSXA 2A4ZA 3EJNA 4F1PA 1SVXA 5ENQD 3CVPA 3I3NA 4JD2G 4NACA 2WQ7A 2DVWA 3QKYA 4IN3B 3ZW3A 2KCKA 1OWMA 3KAEA 3X2QE 4XE0A 3AG2E 3LPZA 5ENPD 3KD7A 4KVOA 3C72A 1UJJA 3R7QA 4I6JA 4YDYA 3UTMA 2VGEA 4G1TA 4EBAG 4GTMA 1U3CA 4GYWA 2IO3C 3CK7A 3ZFWA 4JW1A 5BV0A 1TEZA 3FTYA 2WXHA 1ELRA 2XCBA 3PVLA 4ABNA 3SNXA 1UN9A 3TWSA 1B89A 4UWLA 3D9LA 4GYOA 4BTAA 3S2AA 4HLLA 3TWVA 4G23A 2YQ8A 3NOCD 4P29A 3G2TA 2XQ0A 4H7XA 2LXMA 4K0RA 1HU3A 1XNFA 3ZIMA 3S7JA 4ACKA 5ARFA 1K8KG 1HX8A 4GZ3A 2NYJA 1E96B 4DX5D 1E8XA 4DI3A 2ETAA 3E30A 2XEHA 3G2VA 1H19A 3FU6A 3EHNA 4I17A 3JYSA 2VSNA 3ASHA 2OVFA 3L6AA 3B95A 3TWWA 5J90A 2L9BA 2MYOA 2LSVA 3S7BA 2J49A 4YVOA 4C0MA 4U0SA 4GTQA 4N3CA 3TWQA 2FF4A 3LY7A 4APFA 4CT4A 2A5UA 3JUIA 4ANVA 5A23A 4JEHA 2VTBA 2J4BA 4PS3A 5JJ6A 2R05A 2VSXE 1YMPA 4U8YD 4U07A 5DIZA 4AIFA 3CHRA 4MBGA 3HHMA 2P9UG 2IO2C 4GU5A 3FEYA 2PL2A 5FQ4A 3J5PA 3OTNA 2KC7A 4NQ0A 2ZIRA 3ML8A 4AEZC 2JABA 3LDZA 2HO1A 1SA5A 2HM8A 3E4BA 3JUEA 4AJWA 3QWVA 1VDYA 2FO7A 4HS2A 2WXMA 1V54E 1YCSB 1UOHA 1TR4A 3UKRG 4I2ZA 5FQ6A 5BV1A 3AS8A 5JHBA 3F6QA 2LXLA 3V2OA 3UT4A 2IFUA 5D0QD 1N11A 4Y6WA 3JXJA 3B7RL 1PAQA 3UT7A 3CLJA 1ZU2A 4HOSA 2Y4UA 4J8EA 2QZAA 4J7WA 3RRNB 2I9CA 3LEWA 1N52A 3FP3A 4I1AA 4V3IA 5FTPA 4DLQA 4KYOB 5KJKA 2J07A 4WNDA 4L2LA 2IOLA 1IXVA 3LVQE 5G05C 3K9IA 5EIBE 1GW6A 4YDWA 3AG3E 3PRZA 4HRNA 3ASNE 4GA0A 2VJ8A 4DX2A 3IXEA 5M72A 4A1GA 1N9AA 4J6IA 2IY0C 3HXDA 1LD7A 1WM5A 3ESKA 3LVRE 5G55A 2GRQB 4GMLA 5FQ8A 1E7UA 1QBQA 4K03A 4BT8A 3EUVA 3TJPA 4AOFA 1EDUA 2V4HC 2XENA 2X6IA 3JQ0A 3EIQC 1D8DA 4HRLA 5A7DB 4UI9J 1S63A 3LJNA 3PDNA 4LNBA 3CVLA 2H6FA 3AG1E 1H6KA 4PH4B 4XEIG 2LNIA 4K5AB 2Y4TA 5FJYA 2P9PG 4Z68A 1JCRA 1SZ9A 2WXQA 4U96D 5CECB 1NP7A 4B8CB 1ZBPA 3FUDA 4L1BA 5EN5D 3S7FA 3MV3B 3MJWA 4XKCA 4HBDA 3MGBA 2VGXA 3RSEG 3FWVA 3VTYA 2QY7A 3APFA 1MX6A 5C1DA 4Q69A 2F0YA 1RZ4A 3DXMG 3QJZA 1H2VC 1H2TC 1MZCA 1Y6IA 4WNFA 4C0EA 3CKCA 1N0QA 4FADA 1TN8A 1JCSA 3CVQA 2ZXWE 3FU0A 5LCWC 4JB8P 2J08A 3FU5A 5D0OD 2HR2A 3CR3A 4TV3A 4EZJA 5JJ7A 3TAXA 2XEVA 2IJGX 3PREA 1UW4B 1OT8A 2P2CP 2IOSA 2VTBB 4AY6A 2BKGA 3I4RB 3C5RA 2GRNB 2DCPA 5FQ7A 3ULEG 5A6CA 2Y3AA 4A3VA 5CEAA 5AAOA 3MCXA 4J0UA 4RVBA 3FUEA 1O1SA 5IY5E 5HRYA 1O1RA 3UIOC 1WY6A 4KXKB 1OY3D 4CEMA 4CZ2D 4U8VD 3EU9A 2AXUA 4N2QA 1HXIA 2DBAA 4NRHB 2NXPA 2WVIA 2X6JA 2WB2A 3NF1A 1BLXB 2EIJE 4B89A 1TN7A 4JPSA 1JPLA 3CHMA 4ZFHA 5KNHD 5CRUA 2L0IA 2WXJA 4AVXA 3DPYA 3PS6A 5D2MC 3V79K 5KCMA 3OAWA 4BFRA 3QC1A 1OWLA 2XZTG 5LOZA 4KT6B 4LUNU 3CK9A 4NIKA 3RRUA 3KEZA 4I9CA 3L17A 4LERA 4KBQA 4FHJA 3CV0A 3BUAA 3QARA 4JA9A 2OEVA 3MYVA 4G24A 5JMND 4TXRA 4EQFA 3EHMA 3UKUG 3DSWA 1TJFA 2KCLA 2BEDA 4YVQC 3RAUA 5JHAA 2WXRA 4PUCA 2EILE 3DEOA 4OVUA 3L22A 3TG5A 1IQUA 4MKTA 2PQNA 2RG8A 3IV0A 3ZXSA 3MKQB 1DCEA 3VLFA 3Q4AB 1SQMA 3CGHA 2WXNA 4FHKA 3ZRHA 2QYJA 3LYAA 4FU3A 4F53A 2Y69E 5ENNA 5FIOA 1PC2A 4FJYA 3IHYA 4DJAA 3DBSA 1V55E 4QFVA 3T9KA 4HFGA 4I9EA 4D10C 1OWOA 3BU8A 5HQ8A 1DC2A 3UQ3A 1TYQG 2JLBA 3FUMA 4J8YA 5D66A 3U66A 3ZVVA 2YNQA 4RSYA 3KSQA 5LX8A 2XS1A 1E8WA 5FWQA 2PZIA 2I1JA 3GW4A 3ZYKA 4BWRA 4HB5A 3EHQA 5JA4D 4JEUA 4EBAA 4B0ZA 3CK8A 5BXOA 1KZPA 3FH8A 5G05J 4UWFA 1MQSA 4PS7A 4Q96A 4F1SA 4K5CA 3TGOA 2H6IA 2R2LA 3TXNA 5CHEE 2PNNA 1E7VA 1E8YA 3Q79A 2DZOA 5CEDB 5BXUA 1DCQA 3KSLA 2V4LA 1IQRA 3LCAA 3G2UA 4DK5A 1KT1A 3D9JA 4HNAD 3L82A 1OWNA 1ELWA 1E8ZA 1NZNA 3TWRA 3C3RA 2XHEA 1TJCA 4AM9A 4JVSA 4KMOA 1FPPA 3CHSA 1RW2A 2EQXA 2L6JA 3RO2A 3P1UA 3UT8A 5BT1A 4B94A 3DXKG 3OXFA 5H7PA 2CHWA 3C3QA 2WXFA 3LY8A 3PEVB 1OUVA 4GTOA 4ANUA 2WXIA 2DYSE 2ZU6B 3FUHA 4GPMA 4JA7A 5LFAA 2CFUA 5HKPA 4J8FA 2LAIA 3J5QB 4Q94A 3V30A 3D9PA 3SBTB 4BX9A 3AS5A 3APCA 4BEPA 2C0LA 2VSOE 3RRMB 3FUIA 4HLEA 3UIPC 3IKOB 1OCZE 3SFYA 2R59A 4N39A 4U95D 3UX4A 3RKVA 2J09A 2WXLA 1JUQA 3O4ZA 3FTXA 2H6GA 4ILGA 1Z5SC 2GROB 2FULA 4GAAA 2J8SD 5AQ7A 3SQVA 4UI9K 3ZYQA 3DSTA 5LP0A 1MHQA 3UM2A 5ENRD 2OEWA 2IQCA 4LEUA 1QZ2A 2QC9A 4GB9A 4I6GA 2P9LG 4B8AA 5AARA 2XPIA 5LCWJ 3DWLG 3CKBA 2R02A 4GMJA 4C48B 4U0UA 1BU9A 3D9HA 4ME2A 4HOUA 3HVEA 2GW1A 1SA4A 3FEXA 1WG0A 4GCOA 2CG3A 2CHZA 1S0PA 2EIKE 4OVVA 4UQYA 2ZGDA 4XI0A 1DNPA 2GRMA 3ZHEA 4QQIA 3HXCA 5ENTD 1X5BA 2WXOA 4B93B 2XRZA 1QNFA 3IEGA 1U3DA 3QAQA 2MHKA 3E37A 5FZRA 4GA2A 1AP7A 2QYUA 1Y8MA 3BG1B 4C9BB 4EECA 2WXGA 5KWDA 2L0TB 4AXHA 5ARGA 3CVWA 4HOTA 2KZTA 3C98A 3CHQA 1AWCB 2V5QC 3GZSA 3Q75A 4IULA 4ANWA 3PH0C 4HVBA 3GZ2A 3SD5A 5B1BE 3UI2A 3EIJA 1N54A 1K1AA 4U0ZA 3ZPJA 5EX0A 3AAAC 3BQOA 4G2VA 1BI8B 3ZNGA 4XKBA 3SHFA 3PE3A 3ZU7B 4OAVB 3SY2A 3MV2B 3Q49B 3DRAA 4URKA 3FTZA 2MOWA 3PEUB 1D8EA 4XIFA 5CCMA 3ESLA 5AQBA 3MA5A 2WPVA 4WNGA 3FH5A 4HQDA 4LNUD 3DPDA 1LTXA 2LUHA 3PE4A 4F7AA 4N5QA 1QYMA 4JHRA 1KPSB 4CYMD 3GYZA 3FTWA 1OCCE 3PZ2A 2XGOA 1H6OA 2HE0A 4BT9A 4JL0A 2QFCA 2XGMA 2FO1E 4PS8A 1LD8A 3G2WA 2ONDA 3LXUX 2XEEA 3E33A 4BY6A 3OXLA 3LJ3A 3QOUA 4TUUA 3L54A 3FTUA 3P2BA 1HS6A 2VYIA 4Y6CA 2GRLA 3QDNA 2XS8A 3RJVA 2X3MA 4MS6A 3E32A 3W9FA 4PDXA 2AXVA 5BW8C 3IBEA 4N2SA 4DRXE 2DIWA 3W9GA 2PM7A 4K5BA 4CGWA 4MRUA 4U04A 4JZYA 4FC8A 4AY5A 4LSZE 3VTXA 3CHOA 5BPPA 1HE8A 2WMOA 3CSFA 1D9SA 3Q73A 1N95A 1SZAA 1X81A 1N4RA 1IHGA 2E2EA 2EIME 2EINE 4GTSA 2RFMA 1U2VG 4U63A 5KJNA 3EHRA 1MJ0A 4N3AA 5ENSD 3N71A 2I2OA 1HG2A 3HVEB 2RKKA 1NFIE 4HI9A 4OAUC 3NZUA 3VLEA 4DI4A 3G2SA 1N4SA 5EYLA 3U64A 2CHXA 3B7TA 3QK0A 1KLXA 3ZHEB 4U8HA 5EX3A 3D9IA 4A55A 3T8KA 2P9NG 3UXGA 3ZXPA 3APDA 4G26A 3EDTB 5T4YA 4JXTA 3V31A 1MYOA 1BI7B 4F3VA 3QB2A 1HH8A 4AP2A 4EHMA 4YDEA 4FA6A 1IHBA 1JWGA 3FUFA 4W9RA 3AU5A 2BUGA 3ULYA 3ASFA 3FTSA 4A63B 4U7EB 5FT9A 4ILHB 3Q7AA 3ASOE 4O6FA 3CQGB 4JHKA 1TNZA 5EKQD 1WAO1 3ONKA 4XI9A 5BUZA 1E90A 1A17A 3HDXA 3RU0A 3U3WA 4CRWA 4CDNA 2MRIA 3SFXA 4O60A 4CGVA 1KT0A 1N94A 3L08A 3L16A 3L13A 3QWPA 1MX2A 4GCNA 5AN8A 4UWGA 4I43A 2XCCA 2Q7FA 3C3OA 1K1BA 2J4DA 2I1KA 1YYHA 1N4PA 4JHJA 4A1SA 2V0PA 2VGXB 1EYHA 3TG4A 1H2UA 3Q9NC 3T8MA 5JJTA 5AQAA 2CFZA 2AXZA 1HFAA 3DEPA 3DSVA 2C0MA 5ANRA 1EPUA 3QNKA 4ANXA 3FUKA 4KZ0A 3Q9UC 1OCOE 2YHEA 4WWNA 2GGFA 2RFAA 2ZGGA 2XPYA 3ABKE 2X6KA 2E0IA 4BTBA 4HI8A 4M7CA 3JXIA 3S7DA 1N4QA 2C2LA 2FBNA 3ZKJA 3DSUA 2KCVA 4HOQA 3UPVA 3ONLA 4GTRA 1INZA 3CIAA 4A3TA 3CVXA 3D9OA 3UMVA 5CCLA 4I1MA 1A5EA 4DX7D 5ENOD 3RIBA 2L6BA 3ZYMA 3WG7E 4OYSA 3CQCB 4HORA 2P9IG 3PZ3A 4ILIA 4GTPA 3SI5A 4R7LA 4UWKA 2LSUA 1Q2ZA 4G11A 2RD0A 2OOEA 1OXJA 5ITZF 2DZNA 2XPZA 2IU1A 4ZHBA 5CERB 3ZYLA 5T8IA 1P5QA 4BESA 3HXFA 2ILRA 5FZQA 3Q7FA 2KM4A 3KEAA 2NC9A 1QQEA 5G04J 3PZ1A 4HXIA 2AWIA 4J8SA 2AVPA 3B7UX 1HO8A 4YDOA 3AU4A 1TNOA 2P9KG 3LKUA 4L9PA 3D3MA 3RO3A 2IONA 1FVHA 1LF8A 4I2WA 3UM0A 1FVFA 4GZ5A 2YHCA 3B13A 4XX5A 5EYPF 4CT0A 3IHVA 3KS2A 4GTTA 4WWPA 4RQIA 4EZLA 2WQ6A 2ETBA 4CDRA 4RLYA 4DLOA 3UM3A 1YA0A 1PY1A 1WDYA 2KXPC 3TWXA 4UWHA 3Q78A 4EZKA 4LRZA 1TNBA 5EIDA 5J08A 2UY1A 2X6FA 5B1AE 3Q47B 3D9MA 2YINA 2NSZA 4IYPA 3MX3A 5KJMA 3UM1A 4ATZD 3L9TA 2AW6A 2A5EA 4GA1A 5KJLA 3CVUA 5KNGA 1H0AA 4O1OA 2F8YA 1IKND 2XGSA 3ULQA 3GZ1A 2OCCE 5EDSA 2F8XK 1UJKA 1BD8A 2CG2A 2VSYA 3AG4E 4N3BA 1HF8A 3O48A 5CBNA 4ATGA 4UQXA 4X8QA 4AV7A 3FY4A 4EPZA 3JCKC 4O1PA 3URZA 3NQPA 1N0RA 3QWWA 1FT2A 2VGYA 3B7SA 3DSXA 1NA0A 4RG9A 3NBNB 4BX8A 3CVNA 5T3RA 2JEKA 2R17C 3HXEA 2GRPB 4APOA 4ACLA 3LY9A 2WM9A 3FDHA 1W3BA 2IF4A 2IEJA 5AJDA 3ML9A 3FHEA 3ZGQA 4G25A 3Q15A 2PM6A 3PNLB 4E6HA 2F37A 3SGHA 3MKQA 2ZISA 4FULA 2X6HA 2M63A 4GPKA 4I6EA 2UWJG 4KVMA 1MX4A 3B7BA 4TRQA 3AJIA 3NZSA 1FT1A 1S70B 4DX1A 5G04C 3MZLB 2LO6A 5CRVA 3SFZA 3FU3A 3CVYA 1UN8A 1KZOA 2WXPA 3ASDA 2WMNA 5BNWA 3HG0D 3I4GA 1NL4A 4WAFA 3ZEFA 4MLPA 3MKRA 2P9SG 2V8SE 3ABLE 2AJAA 2HYZA 1Z3XA 3TXMA 1IYGA 1OCRE 2DYRE 3SF4A 1Z3YA 4GMRA 4FLHA 3FH7A 2OV8A 3T5VA 5CMWA 4NURA 3EU5A 3TWTA 3R9MA 4UUCA 3CEQA 4LNGA 4GTVA 3FUNA 2H6HA 3OXGA 4HRMB 3I5PA 2ETCA 4L7TA 1JWFA 4CDMA 2FEZA 2WXKA 3U4TA 3SO8A 3ASGA 5DBKA 1TNYA 4GZDA 4DUIA 2KATA 4J8DA 1OWPA 4TUMA 3SZ7A 3TL5A 2BF0X 2Y0BG 3FULA 2Y1LE 4F6RD 5E76A 3CHPA 3HXBA 3BEEA 4E85A 4TXQA 3HRAA 2B0OE 4BERA 3V2XA 3ZN3A 1HZ4A 2WQHA 3FUJA 4M3OA 3RK6A 1O5MA 5C2YA 4L2YA 5KBAA 4YNDA 3BG0B 4XZ4A 3CSTA 3E34A 2VQ2A 4L23A 4CCAA 2XRYA 2I6HA 1UG3A 1HG5A 3R7RA 1Z6TA 2B6CA 1BPOA 2R03A 2UY1B 2XZDG 3LS8A 5EILA 2PQRA 4WNEA 1G3NB 2KBXA 5AJLA 4JC8A 4DPRA 3AS4A 5ANLA 3CVVA 4WWOA 2P58C 3SBSA 5E75A 5B3SE 4I1OB 1NI1A 2LAHA 4N5CA 4LG6A 4G8LA 3TWUA 3U9WA 4FP7A 3D9KA 1S64A 4UI9C 2FI7A 3NB2A 3HYMB 1TNUA 5CMYA 4UQZA 5AIJA 2BKKB 5AQ9A 3UINC 2X38A 1ELKA 3WXXA 1JCQA 1EF1C 2R5SA 5AYWD 3FTVA 4GZCA 2J9QA 3ABME 4IRUA 3Q5MA 5FZSA 2BTDA 1H6PA 4BETA 3JQ1A 1FCHA 5HI7A 3PZDA 4WUYA 2GRRB 5CBOA 3D9NA 4BSZB 1SW6A 1DVPA 3MEKA 2DWZA 1NA3A 4FLBA 3HIZA 4FJZA 3UUXA 4RG6A 1L5JA 4G8KA 4H7YA 2KZTB 1XGWA 4GZ6A 3R9AB 1TN6A 4LCTA 3ENEA 3ISMC 3PZ4A 3T5XA 3PUJA 3NAWA 5HS0A 2OVBA
chains in the Genus database with same CATH topology
2XPZA 2IU1A 5G2NA 3I4RB 3BG1B 4C9BB 4EECA 2WXGA 2L0TB 4AXHA 5ARGA 3ZYLA 2DCPA 5T8IA 5FQ7A 1P5QA 5AENA 3CVWA 4GYYA 4KZCA 3VLDA 5A6CA 2ILRA 4HOTA 2Y3AA 5FZQA 3PNTB 2V5FA 2KZTA 4A3VA 2KM4A 3FFLA 3C98A 2NC9A 1QQEA 3PUKA 4BSXA 2A4ZA 5G04J 3CHQA 3MCXA 3EJNA 4J0UA 4HXIA 2AWIA 3GZSA 4J8SA 4RVBA 3FUEA 2AVPA 3B7UX 1HO8A 4IULA 3AU4A 4ANWA 3CVPA 3PH0C 4HVBA 3I3NA 3GZ2A 4NACA 2WQ7A 3LKUA 3SD5A 3QKYA 3D3MA 4IN3B 3EIJA 3ZW3A 1WY6A 2KCKA 1N54A 4KXKB 1OWMA 3KAEA 3RO3A 2IONA 4U0ZA 3ZPJA 5EX0A 1FVHA 4CEMA 1LF8A 4I2WA 4G2VA 4XE0A 3LPZA 4XKBA 2AXUA 3KD7A 4N2QA 3SHFA 1FVFA 4GZ5A 2YHCA 1HXIA 2DBAA 3PE3A 4KVOA 1UJJA 4NRHB 3B13A 3R7QA 2NXPA 2WVIA 4XX5A 4CT0A 2X6JA 4I6JA 3IHVA 3KS2A 2WB2A 3NF1A 4WWPA 4B89A 3MV2B 3Q49B 4EZLA 4URKA 2WQ6A 3FTZA 4G1TA 4CDRA 4EBAG 4JPSA 2MOWA 3PEUB 4XIFA 5CCMA 1JPLA 3CHMA 3ESLA 4DLOA 1YA0A 1PY1A 1U3CA 2L0IA 2WXJA 4GYWA 4UWHA 4AVXA 3CK7A 3MA5A 3PS6A 3ZFWA 4EZKA 4JW1A 4LRZA 5J08A 5KCMA 5BV0A 1TEZA 2WPVA 4WNGA 3OAWA 3FTYA 2WXHA 2UY1A 1ELRA 3FH5A 2X6FA 2XCBA 3PVLA 3Q47B 4BFRA 3D9MA 2YINA 3DPDA 3QC1A 1OWLA 2NSZA 4ABNA 5LOZA 4KT6B 3SNXA 4IYPA 1UN9A 4LUNU 3MX3A 3CK9A 3PE4A 4F7AA 1B89A 5KJMA 4UWLA 3RRUA 3KEZA 3D9LA 4I9CA 2AW6A 4GYOA 4BTAA 4JHRA 3L17A 4GA1A 3S2AA 5KJLA 3CVUA 4LERA 3GYZA 4KBQA 1H0AA 4FHJA 3FTWA 3CV0A 3QARA 4G23A 2YQ8A 4P29A 2XGOA 2XGSA 4JA9A 3G2TA 2XQ0A 4H7XA 3ULQA 3GZ1A 3MYVA 4G24A 4K0RA 5EDSA 1HU3A 4BT9A 1XNFA 3ZIMA 4EQFA 3EHMA 4JL0A 3S7JA 1UJKA 2QFCA 2XGMA 1TJFA 4ACKA 4PS8A 2KCLA 2CG2A 5ARFA 3G2WA 2ONDA 2VSYA 1HX8A 3LXUX 4GZ3A 4YVQC 5JHAA 4N3BA 1E96B 2WXRA 1HF8A 3O48A 4PUCA 4ATGA 4OVUA 1E8XA 4UQXA 4BY6A 3OXLA 4AV7A 3FY4A 4EPZA 4DI3A 3JCKC 3L22A 3LJ3A 3QOUA 3URZA 3TG5A 1IQUA 4MKTA 4TUUA 2PQNA 3NQPA 2RG8A 3QWWA 3G2VA 1H19A 2VGYA 3FU6A 3B7SA 3EHNA 3JYSA 2VSNA 3L54A 4I17A 1NA0A 3ASHA 3IV0A 4RG9A 3FTUA 3ZXSA 3MKQB 3P2BA 2OVFA 1HS6A 3VLFA 2VYIA 3CVNA 2GRLA 3L6AA 4Y6CA 4BX8A 3Q4AB 3QDNA 1SQMA 3CGHA 5T3RA 2JEKA 2R17C 3RJVA 2X3MA 4MS6A 2WXNA 5J90A 4APOA 4FHKA 3ZRHA 4PDXA 4ACLA 2AXVA 2L9BA 2WM9A 3LYAA 3LY9A 3FDHA 4FU3A 1W3BA 4F53A 2IF4A 5BW8C 5AJDA 3IBEA 5ENNA 4N2SA 2LSVA 3ML9A 3S7BA 1PC2A 2DIWA 2J49A 3FHEA 4FJYA 3IHYA 4YVOA 4C0MA 4DJAA 3ZGQA 2PM7A 4U0SA 4N3CA 3DBSA 4G25A 4QFVA 3Q15A 4CGWA 2FF4A 3LY7A 2PM6A 3PNLB 4HFGA 4MRUA 4I9EA 4U04A 4APFA 4JZYA 4CT4A 4D10C 1OWOA 2A5UA 3JUIA 4FC8A 4ANVA 5A23A 4JEHA 2VTBA 3SGHA 4AY5A 2J4BA 4PS3A 5JJ6A 3MKQA 4FULA 5HQ8A 2VSXE 2X6HA 2M63A 4GPKA 3VTXA 3CHOA 4I6EA 5BPPA 4U07A 5DIZA 1HE8A 2UWJG 4KVMA 3UQ3A 4AIFA 3CHRA 2WMOA 2JLBA 3HHMA 3NZSA 4TRQA 3FUMA 3CSFA 3U66A 4GU5A 3ZVVA 3FEYA 2PL2A 5FQ4A 5G04C 3MZLB 1SZAA 3OTNA 2YNQA 4RSYA 2KC7A 4NQ0A 2LO6A 5LX8A 3ML8A 3SFZA 1IHGA 1E8WA 2E2EA 3FU3A 4AEZC 5FWQA 3LDZA 2PZIA 2HO1A 2I1JA 2HM8A 3CVYA 3E4BA 3GW4A 1UN8A 4AJWA 3QWVA 1VDYA 3ZYKA 2FO7A 4HS2A 4BWRA 2WXMA 2WXPA 3ASDA 2WMNA 5BNWA 4U63A 4I2ZA 5FQ6A 5BV1A 5KJNA 3I4GA 4JEUA 3AS8A 4EBAA 4N3AA 4WAFA 5JHBA 3N71A 2I2OA 3ZEFA 4MLPA 3MKRA 1HG2A 3HVEB 4B0ZA 2V8SE 3UT4A 3CK8A 2IFUA 2HYZA 1Z3XA 3FH8A 5D0QD 4Y6WA 5G05J 3TXMA 4UWFA 3NZUA 3VLEA 4DI4A 1IYGA 3B7RL 1MQSA 3G2SA 1PAQA 4PS7A 3SF4A 4Q96A 3U64A 3UT7A 1Z3YA 2CHXA 3B7TA 3CLJA 4F1SA 1ZU2A 4FLHA 4HOSA 2Y4UA 3TGOA 3QK0A 3FH7A 1KLXA 4J8EA 2OV8A 3ZHEB 4U8HA 3T5VA 3TXNA 5CMWA 5EX3A 3D9IA 4NURA 2I9CA 3LEWA 5CHEE 3RRNB 1N52A 4A55A 3CEQA 1E7VA 1E8YA 3FP3A 4I1AA 4V3IA 3FUNA 3APDA 4G26A 5FTPA 4DLQA 4KYOB 3EDTB 5KJKA 3OXGA 5T4YA 4JXTA 2J07A 4WNDA 2V4LA 3I5PA 4L2LA 2IOLA 4F3VA 4L7TA 1JWFA 3QB2A 1IQRA 4CDMA 3LCAA 3LVQE 2FEZA 3G2UA 2WXKA 3K9IA 5G05C 3U4TA 1KT1A 3ASGA 4DK5A 1HH8A 5DBKA 4AP2A 3D9JA 4GZDA 4FA6A 4E6HA 2KATA 4J8DA 1GW6A 1OWPA 1JWGA 1OWNA 1ELWA 3FUFA 3SZ7A 1E8ZA 4W9RA 3AU5A 1NZNA 2BUGA 3TL5A 2XHEA 1TJCA 3ASFA 4AM9A 4JVSA 4KMOA 2BF0X 3PRZA 3CHSA 3FTSA 2EQXA 2L6JA 3FULA 5FT9A 4GA0A 3RO2A 3P1UA 3UT8A 4ILHB 5BT1A 4B94A 2VJ8A 4O6FA 3OXFA 3CQGB 5E76A 5M72A 4JHKA 4A1GA 2CHWA 3LY8A 2WXFA 3PEVB 1OUVA 3CHPA 4J6IA 4ANUA 2WXIA 5EKQD 1WAO1 3BEEA 1WM5A 3ONKA 4E85A 4XI9A 5BUZA 3ESKA 1E90A 1A17A 3LVRE 2ZU6B 3FUHA 3HDXA 5G55A 3RU0A 4JA7A 3U3WA 4CRWA 5LFAA 2CFUA 4CDNA 2MRIA 3ZN3A 4GMLA 5FQ8A 4J8FA 1E7UA 1HZ4A 2LAIA 4CGVA 1KT0A 2WQHA 3L08A 4Q94A 3FUJA 3L16A 4K03A 3L13A 3QWPA 4BT8A 4M3OA 3TJPA 3D9PA 4GCNA 3RK6A 3SBTB 4UWGA 4AOFA 1EDUA 4I43A 4BX9A 3AS5A 2X6IA 2XCCA 3APCA 5C2YA 2Q7FA 3JQ0A 2J4DA 3EIQC 2VSOE 2C0LA 2I1KA 4L2YA 4YNDA 3BG0B 3RRMB 4XZ4A 5A7DB 3CSTA 4JHJA 4UI9J 3PDNA 2VQ2A 3FUIA 4L23A 4A1SA 3CVLA 2V0PA 2XRYA 4CCAA 4HLEA 2I6HA 1UG3A 3IKOB 1HG5A 1Z6TA 3R7RA 1BPOA 2VGXB 1EYHA 2UY1B 1H2UA 1H6KA 3LS8A 4PH4B 2R59A 4N39A 3TG4A 3T8MA 5JJTA 2CFZA 3UX4A 3RKVA 2J09A 2PQRA 1JUQA 2WXLA 4WNEA 2LNIA 3O4ZA 5AJLA 2AXZA 4JC8A 4DPRA 3FTXA 1HFAA 3AS4A 4ILGA 5ANLA 2C0MA 5ANRA 2Y4TA 5FJYA 3CVVA 4WWOA 2P58C 1SZ9A 2FULA 4GAAA 3SBSA 1EPUA 5E75A 3QNKA 4ANXA 3FUKA 4I1OB 2WXQA 4KZ0A 2LAHA 2YHEA 4N5CA 4UI9K 3ZYQA 1NP7A 4WWNA 2GGFA 3U9WA 4FP7A 3D9KA 5LP0A 4B8CB 1ZBPA 1MHQA 3FUDA 4UI9C 2XPYA 2FI7A 4L1BA 3S7FA 2X6KA 2E0IA 3MV3B 3MJWA 4XKCA 4BTBA 3MGBA 2VGXA 2IQCA 3HYMB 4LEUA 1QZ2A 4GB9A 4I6GA 5CMYA 3S7DA 4UQZA 5AIJA 3FWVA 3VTYA 2QY7A 4B8AA 2C2LA 3APFA 2FBNA 2XPIA 5LCWJ 5C1DA 4Q69A 2X38A 1ELKA 3WXXA 1EF1C 2KCVA 3CKBA 2R5SA 5AYWD 3FTVA 4GMJA 4GZCA 2J9QA 4HOQA 4U0UA 3UPVA 3ONLA 4IRUA 3Q5MA 5FZSA 3QJZA 1H2VC 2BTDA 1H2TC 4ME2A 4HOUA 1INZA 3CIAA 3HVEA 4A3TA 1Y6IA 2GW1A 4WNFA 3CVXA 4C0EA 3JQ1A 3CKCA 3FEXA 1FCHA 3D9OA 5HI7A 4FADA 3PZDA 4WUYA 4GCOA 3UMVA 5CCLA 2CG3A 2CHZA 4I1MA 1S0PA 4OVVA 4UQYA 3D9NA 3RIBA 4XI0A 1DNPA 2GRMA 1DVPA 3MEKA 3CVQA 1NA3A 3ZYMA 4FLBA 3ZHEA 3HIZA 4FJZA 3FU0A 4OYSA 3UUXA 4RG6A 1L5JA 1X5BA 3CQCB 5LCWC 2J08A 3FU5A 4ILIA 2WXOA 4H7YA 4HORA 5D0OD 2HR2A 1XGWA 2KZTB 4GZ6A 3CR3A 3SI5A 4R7LA 4TV3A 4UWKA 2LSUA 2XRZA 3R9AB 1QNFA 4G11A 2RD0A 3IEGA 1U3DA 4EZJA 5JJ7A 3QAQA 3TAXA 4LCTA 3ENEA 2XEVA 2MHKA 3T5XA 2IJGX 2OOEA 3PREA 1UW4B 5FZRA 3PUJA 2IOSA 2VTBB 4AY6A 4GA2A 1Y8MA 2OVBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ARG A;  1P5Q A;  4GYY A;  5A6C A;  4HOT A;  5FZQ A;  2V5F A;  3FFL A;  2NC9 A;  1QQE A;  5G04 J;  4J0U A;  2AVP A;  3CVP A;  3GZ2 A;  3LKU A;  3QKY A;  4IN3 B;  2KCK A;  4KXK B;  3KAE A;  3RO3 A;  4U0Z A;  3ZPJ A;  5EX0 A;  4I2W A;  4G2V A;  3LPZ A;  3KD7 A;  4N2Q A;  4GZ5 A;  2YHC A;  1HXI A;  2DBA A;  3PE3 A;  4NRH B;  3KS2 A;  3NF1 A;  3MV2 B;  3Q49 B;  4G1T A;  4CDR A;  5CCM A;  4XIF A;  1YA0 A;  4GYW A;  3CK7 A;  3MA5 A;  3ZFW A;  2WPV A;  4WNG A;  2UY1 A;  1ELR A;  2XCB A;  3Q47 B;  4ABN A;  3CK9 A;  3PE4 A;  1B89 A;  5KJM A;  4I9C A;  4GYO A;  4BTA A;  4JHR A;  4GA1 A;  5KJL A;  3GYZ A;  4KBQ A;  3CV0 A;  4G23 A;  2YQ8 A;  2XGO A;  2XGS A;  4JA9 A;  4H7X A;  3ULQ A;  3GZ1 A;  4G24 A;  4BT9 A;  1XNF A;  4EQF A;  4JL0 A;  3S7J A;  2QFC A;  2XGM A;  2KCL A;  5ARF A;  2OND A;  2VSY A;  4GZ3 A;  4YVQ C;  4N3B A;  1E96 B;  3O48 A;  4UQX A;  3OXL A;  3QOU A;  3URZ A;  3TG5 A;  2PQN A;  3QWW A;  2VGY A;  4I17 A;  3JYS A;  2VSN A;  1NA0 A;  3ASH A;  4RG9 A;  2VYI A;  3CVN A;  4Y6C A;  3Q4A B;  3QDN A;  3RJV A;  4APO A;  3LY9 A;  3LYA A;  1W3B A;  2IF4 A;  5BW8 C;  4N2S A;  2LSV A;  3S7B A;  1PC2 A;  4YVO A;  3ZGQ A;  4U0S A;  4N3C A;  4G25 A;  3Q15 A;  4CGW A;  2FF4 A;  3LY7 A;  4U04 A;  4I9E A;  4AY5 A;  5JJ6 A;  5HQ8 A;  4GPK A;  3VTX A;  4U07 A;  5DIZ A;  2UWJ G;  3UQ3 A;  4AIF A;  2JLB A;  2PL2 A;  5G04 C;  2KC7 A;  4NQ0 A;  1IHG A;  2E2E A;  2PZI A;  2HO1 A;  3E4B A;  3GW4 A;  3QWV A;  2FO7 A;  4BWR A;  3ASD A;  5BNW A;  4I2Z A;  5KJN A;  3AS8 A;  4N3A A;  3N71 A;  3MKR A;  3CK8 A;  2IFU A;  2HYZ A;  5D0Q D;  4Y6W A;  5G05 J;  1IYG A;  3SF4 A;  1ZU2 A;  4HOS A;  2Y4U A;  3TGO A;  1KLX A;  4J8E A;  3ZHE B;  5EX3 A;  5CHE E;  3CEQ A;  3FP3 A;  4I1A A;  4G26 A;  5FTP A;  4KYO B;  3EDT B;  5KJK A;  3OXG A;  4WND A;  4F3V A;  3LCA A;  2FEZ A;  5G05 C;  3K9I A;  3U4T A;  1KT1 A;  3ASG A;  1HH8 A;  5DBK A;  2KAT A;  4J8D A;  1ELW A;  3SZ7 A;  4W9R A;  1NZN A;  2BUG A;  1TJC A;  3ASF A;  4AM9 A;  2L6J A;  3RO2 A;  5FT9 A;  4GA0 A;  5BT1 A;  4B94 A;  4O6F A;  3OXF A;  5M72 A;  3LY8 A;  1OUV A;  5EKQ D;  1WAO 1;  3BEE A;  1WM5 A;  4XI9 A;  3ESK A;  1A17 A;  3RU0 A;  4JA7 A;  3U3W A;  3ZN3 A;  4J8F A;  1HZ4 A;  4CGV A;  1KT0 A;  2WQH A;  3QWP A;  4BT8 A;  4GCN A;  3AS5 A;  2XCC A;  2Q7F A;  2C0L A;  4YND A;  5A7D B;  4UI9 J;  3PDN A;  2VQ2 A;  4A1S A;  3CVL A;  2I6H A;  2VGX B;  2UY1 B;  3TG4 A;  4N39 A;  5JJT A;  3RKV A;  2PQR A;  4WNE A;  2LNI A;  3AS4 A;  2C0M A;  2Y4T A;  5FJY A;  2P58 C;  4N5C A;  4UI9 K;  1ZBP A;  4UI9 C;  2FI7 A;  3S7F A;  3MV3 B;  4BTB A;  2VGX A;  3HYM B;  4LEU A;  1QZ2 A;  3S7D A;  4UQZ A;  3FWV A;  3VTY A;  2C2L A;  2FBN A;  2XPI A;  5LCW J;  5C1D A;  3WXX A;  2KCV A;  3CKB A;  2R5S A;  5AYW D;  2J9Q A;  4HOQ A;  4U0U A;  3UPV A;  3Q5M A;  5FZS A;  4ME2 A;  4HOU A;  2GW1 A;  4WNF A;  3CKC A;  1FCH A;  5HI7 A;  4WUY A;  4GCO A;  5CCL A;  4UQY A;  3RIB A;  4XI0 A;  3MEK A;  3CVQ A;  1NA3 A;  3ZHE A;  3UUX A;  4RG6 A;  4HOR A;  5LCW C;  4H7Y A;  5D0O D;  2HR2 A;  4GZ6 A;  2LSU A;  3R9A B;  3IEG A;  5JJ7 A;  3TAX A;  2XEV A;  2MHK A;  2OOE A;  5FZR A;  4AY6 A;  4GA2 A;  1Y8M A; 
#chains in the Genus database with same CATH topology
 5G2N A;  4DX6 D;  1O1T A;  1ZB1 A;  5FIN A;  1K3Z D;  5AEN A;  4GYY A;  4KZC A;  3VLD A;  3DSS A;  4TXP A;  3PNT B;  2V5F A;  3NOG D;  3ZUV B;  3FFL A;  3PUK A;  4BSX A;  2A4Z A;  3EJN A;  4F1P A;  1SVX A;  5ENQ D;  3CVP A;  3I3N A;  4JD2 G;  4NAC A;  2WQ7 A;  2DVW A;  3QKY A;  4IN3 B;  3ZW3 A;  2KCK A;  1OWM A;  3KAE A;  3X2Q E;  4XE0 A;  3AG2 E;  3LPZ A;  5ENP D;  3KD7 A;  4KVO A;  3C72 A;  1UJJ A;  3R7Q A;  4I6J A;  4YDY A;  3UTM A;  2VGE A;  4G1T A;  4EBA G;  4GTM A;  1U3C A;  4GYW A;  2IO3 C;  3CK7 A;  3ZFW A;  4JW1 A;  5BV0 A;  1TEZ A;  3FTY A;  2WXH A;  1ELR A;  2XCB A;  3PVL A;  4ABN A;  3SNX A;  1UN9 A;  3TWS A;  1B89 A;  4UWL A;  3D9L A;  4GYO A;  4BTA A;  3S2A A;  4HLL A;  3TWV A;  4G23 A;  2YQ8 A;  3NOC D;  4P29 A;  3G2T A;  2XQ0 A;  4H7X A;  2LXM A;  4K0R A;  1HU3 A;  1XNF A;  3ZIM A;  3S7J A;  4ACK A;  5ARF A;  1K8K G;  1HX8 A;  4GZ3 A;  2NYJ A;  1E96 B;  4DX5 D;  1E8X A;  4DI3 A;  2ETA A;  3E30 A;  2XEH A;  3G2V A;  1H19 A;  3FU6 A;  3EHN A;  4I17 A;  3JYS A;  2VSN A;  3ASH A;  2OVF A;  3L6A A;  3B95 A;  3TWW A;  5J90 A;  2L9B A;  2MYO A;  2LSV A;  3S7B A;  2J49 A;  4YVO A;  4C0M A;  4U0S A;  4GTQ A;  4N3C A;  3TWQ A;  2FF4 A;  3LY7 A;  4APF A;  4CT4 A;  2A5U A;  3JUI A;  4ANV A;  5A23 A;  4JEH A;  2VTB A;  2J4B A;  4PS3 A;  5JJ6 A;  2R05 A;  2VSX E;  1YMP A;  4U8Y D;  4U07 A;  5DIZ A;  4AIF A;  3CHR A;  4MBG A;  3HHM A;  2P9U G;  2IO2 C;  4GU5 A;  3FEY A;  2PL2 A;  5FQ4 A;  3J5P A;  3OTN A;  2KC7 A;  4NQ0 A;  2ZIR A;  3ML8 A;  4AEZ C;  2JAB A;  3LDZ A;  2HO1 A;  1SA5 A;  2HM8 A;  3E4B A;  3JUE A;  4AJW A;  3QWV A;  1VDY A;  2FO7 A;  4HS2 A;  2WXM A;  1V54 E;  1YCS B;  1UOH A;  1TR4 A;  3UKR G;  4I2Z A;  5FQ6 A;  5BV1 A;  3AS8 A;  5JHB A;  3F6Q A;  2LXL A;  3V2O A;  3UT4 A;  2IFU A;  5D0Q D;  1N11 A;  4Y6W A;  3JXJ A;  3B7R L;  1PAQ A;  3UT7 A;  3CLJ A;  1ZU2 A;  4HOS A;  2Y4U A;  4J8E A;  2QZA A;  4J7W A;  3RRN B;  2I9C A;  3LEW A;  1N52 A;  3FP3 A;  4I1A A;  4V3I A;  5FTP A;  4DLQ A;  4KYO B;  5KJK A;  2J07 A;  4WND A;  4L2L A;  2IOL A;  1IXV A;  3LVQ E;  5G05 C;  3K9I A;  5EIB E;  1GW6 A;  4YDW A;  3AG3 E;  3PRZ A;  4HRN A;  3ASN E;  4GA0 A;  2VJ8 A;  4DX2 A;  3IXE A;  5M72 A;  4A1G A;  1N9A A;  4J6I A;  2IY0 C;  3HXD A;  1LD7 A;  1WM5 A;  3ESK A;  3LVR E;  5G55 A;  2GRQ B;  4GML A;  5FQ8 A;  1E7U A;  1QBQ A;  4K03 A;  4BT8 A;  3EUV A;  3TJP A;  4AOF A;  1EDU A;  2V4H C;  2XEN A;  2X6I A;  3JQ0 A;  3EIQ C;  1D8D A;  4HRL A;  5A7D B;  4UI9 J;  1S63 A;  3LJN A;  3PDN A;  4LNB A;  3CVL A;  2H6F A;  3AG1 E;  1H6K A;  4PH4 B;  4XEI G;  2LNI A;  4K5A B;  2Y4T A;  5FJY A;  2P9P G;  4Z68 A;  1JCR A;  1SZ9 A;  2WXQ A;  4U96 D;  5CEC B;  1NP7 A;  4B8C B;  1ZBP A;  3FUD A;  4L1B A;  5EN5 D;  3S7F A;  3MV3 B;  3MJW A;  4XKC A;  4HBD A;  3MGB A;  2VGX A;  3RSE G;  3FWV A;  3VTY A;  2QY7 A;  3APF A;  1MX6 A;  5C1D A;  4Q69 A;  2F0Y A;  1RZ4 A;  3DXM G;  3QJZ A;  1H2V C;  1H2T C;  1MZC A;  1Y6I A;  4WNF A;  4C0E A;  3CKC A;  1N0Q A;  4FAD A;  1TN8 A;  1JCS A;  3CVQ A;  2ZXW E;  3FU0 A;  5LCW C;  4JB8 P;  2J08 A;  3FU5 A;  5D0O D;  2HR2 A;  3CR3 A;  4TV3 A;  4EZJ A;  5JJ7 A;  3TAX A;  2XEV A;  2IJG X;  3PRE A;  1UW4 B;  1OT8 A;  2P2C P;  2IOS A;  2VTB B;  4AY6 A;  2BKG A;  3I4R B;  3C5R A;  2GRN B;  2DCP A;  5FQ7 A;  3ULE G;  5A6C A;  2Y3A A;  4A3V A;  5CEA A;  5AAO A;  3MCX A;  4J0U A;  4RVB A;  3FUE A;  1O1S A;  5IY5 E;  5HRY A;  1O1R A;  3UIO C;  1WY6 A;  4KXK B;  1OY3 D;  4CEM A;  4CZ2 D;  4U8V D;  3EU9 A;  2AXU A;  4N2Q A;  1HXI A;  2DBA A;  4NRH B;  2NXP A;  2WVI A;  2X6J A;  2WB2 A;  3NF1 A;  1BLX B;  2EIJ E;  4B89 A;  1TN7 A;  4JPS A;  1JPL A;  3CHM A;  4ZFH A;  5KNH D;  5CRU A;  2L0I A;  2WXJ A;  4AVX A;  3DPY A;  3PS6 A;  5D2M C;  3V79 K;  5KCM A;  3OAW A;  4BFR A;  3QC1 A;  1OWL A;  2XZT G;  5LOZ A;  4KT6 B;  4LUN U;  3CK9 A;  4NIK A;  3RRU A;  3KEZ A;  4I9C A;  3L17 A;  4LER A;  4KBQ A;  4FHJ A;  3CV0 A;  3BUA A;  3QAR A;  4JA9 A;  2OEV A;  3MYV A;  4G24 A;  5JMN D;  4TXR A;  4EQF A;  3EHM A;  3UKU G;  3DSW A;  1TJF A;  2KCL A;  2BED A;  4YVQ C;  3RAU A;  5JHA A;  2WXR A;  4PUC A;  2EIL E;  3DEO A;  4OVU A;  3L22 A;  3TG5 A;  1IQU A;  4MKT A;  2PQN A;  2RG8 A;  3IV0 A;  3ZXS A;  3MKQ B;  1DCE A;  3VLF A;  3Q4A B;  1SQM A;  3CGH A;  2WXN A;  4FHK A;  3ZRH A;  2QYJ A;  3LYA A;  4FU3 A;  4F53 A;  2Y69 E;  5ENN A;  5FIO A;  1PC2 A;  4FJY A;  3IHY A;  4DJA A;  3DBS A;  1V55 E;  4QFV A;  3T9K A;  4HFG A;  4I9E A;  4D10 C;  1OWO A;  3BU8 A;  5HQ8 A;  1DC2 A;  3UQ3 A;  1TYQ G;  2JLB A;  3FUM A;  4J8Y A;  5D66 A;  3U66 A;  3ZVV A;  2YNQ A;  4RSY A;  3KSQ A;  5LX8 A;  2XS1 A;  1E8W A;  5FWQ A;  2PZI A;  2I1J A;  3GW4 A;  3ZYK A;  4BWR A;  4HB5 A;  3EHQ A;  5JA4 D;  4JEU A;  4EBA A;  4B0Z A;  3CK8 A;  5BXO A;  1KZP A;  3FH8 A;  5G05 J;  4UWF A;  1MQS A;  4PS7 A;  4Q96 A;  4F1S A;  4K5C A;  3TGO A;  2H6I A;  2R2L A;  3TXN A;  5CHE E;  2PNN A;  1E7V A;  1E8Y A;  3Q79 A;  2DZO A;  5CED B;  5BXU A;  1DCQ A;  3KSL A;  2V4L A;  1IQR A;  3LCA A;  3G2U A;  4DK5 A;  1KT1 A;  3D9J A;  4HNA D;  3L82 A;  1OWN A;  1ELW A;  1E8Z A;  1NZN A;  3TWR A;  3C3R A;  2XHE A;  1TJC A;  4AM9 A;  4JVS A;  4KMO A;  1FPP A;  3CHS A;  1RW2 A;  2EQX A;  2L6J A;  3RO2 A;  3P1U A;  3UT8 A;  5BT1 A;  4B94 A;  3DXK G;  3OXF A;  5H7P A;  2CHW A;  3C3Q A;  2WXF A;  3LY8 A;  3PEV B;  1OUV A;  4GTO A;  4ANU A;  2WXI A;  2DYS E;  2ZU6 B;  3FUH A;  4GPM A;  4JA7 A;  5LFA A;  2CFU A;  5HKP A;  4J8F A;  2LAI A;  3J5Q B;  4Q94 A;  3V30 A;  3D9P A;  3SBT B;  4BX9 A;  3AS5 A;  3APC A;  4BEP A;  2C0L A;  2VSO E;  3RRM B;  3FUI A;  4HLE A;  3UIP C;  3IKO B;  1OCZ E;  3SFY A;  2R59 A;  4N39 A;  4U95 D;  3UX4 A;  3RKV A;  2J09 A;  2WXL A;  1JUQ A;  3O4Z A;  3FTX A;  2H6G A;  4ILG A;  1Z5S C;  2GRO B;  2FUL A;  4GAA A;  2J8S D;  5AQ7 A;  3SQV A;  4UI9 K;  3ZYQ A;  3DST A;  5LP0 A;  1MHQ A;  3UM2 A;  5ENR D;  2OEW A;  2IQC A;  4LEU A;  1QZ2 A;  2QC9 A;  4GB9 A;  4I6G A;  2P9L G;  4B8A A;  5AAR A;  2XPI A;  5LCW J;  3DWL G;  3CKB A;  2R02 A;  4GMJ A;  4C48 B;  4U0U A;  1BU9 A;  3D9H A;  4ME2 A;  4HOU A;  3HVE A;  2GW1 A;  1SA4 A;  3FEX A;  1WG0 A;  4GCO A;  2CG3 A;  2CHZ A;  1S0P A;  2EIK E;  4OVV A;  4UQY A;  2ZGD A;  4XI0 A;  1DNP A;  2GRM A;  3ZHE A;  4QQI A;  3HXC A;  5ENT D;  1X5B A;  2WXO A;  4B93 B;  2XRZ A;  1QNF A;  3IEG A;  1U3D A;  3QAQ A;  2MHK A;  3E37 A;  5FZR A;  4GA2 A;  1AP7 A;  2QYU A;  1Y8M A;  3BG1 B;  4C9B B;  4EEC A;  2WXG A;  5KWD A;  2L0T B;  4AXH A;  5ARG A;  3CVW A;  4HOT A;  2KZT A;  3C98 A;  3CHQ A;  1AWC B;  2V5Q C;  3GZS A;  3Q75 A;  4IUL A;  4ANW A;  3PH0 C;  4HVB A;  3GZ2 A;  3SD5 A;  5B1B E;  3UI2 A;  3EIJ A;  1N54 A;  1K1A A;  4U0Z A;  3ZPJ A;  5EX0 A;  3AAA C;  3BQO A;  4G2V A;  1BI8 B;  3ZNG A;  4XKB A;  3SHF A;  3PE3 A;  3ZU7 B;  4OAV B;  3SY2 A;  3MV2 B;  3Q49 B;  3DRA A;  4URK A;  3FTZ A;  2MOW A;  3PEU B;  1D8E A;  4XIF A;  5CCM A;  3ESL A;  5AQB A;  3MA5 A;  2WPV A;  4WNG A;  3FH5 A;  4HQD A;  4LNU D;  3DPD A;  1LTX A;  2LUH A;  3PE4 A;  4F7A A;  4N5Q A;  1QYM A;  4JHR A;  1KPS B;  4CYM D;  3GYZ A;  3FTW A;  1OCC E;  3PZ2 A;  2XGO A;  1H6O A;  2HE0 A;  4BT9 A;  4JL0 A;  2QFC A;  2XGM A;  2FO1 E;  4PS8 A;  1LD8 A;  3G2W A;  2OND A;  3LXU X;  2XEE A;  3E33 A;  4BY6 A;  3OXL A;  3LJ3 A;  3QOU A;  4TUU A;  3L54 A;  3FTU A;  3P2B A;  1HS6 A;  2VYI A;  4Y6C A;  2GRL A;  3QDN A;  2XS8 A;  3RJV A;  2X3M A;  4MS6 A;  3E32 A;  3W9F A;  4PDX A;  2AXV A;  5BW8 C;  3IBE A;  4N2S A;  4DRX E;  2DIW A;  3W9G A;  2PM7 A;  4K5B A;  4CGW A;  4MRU A;  4U04 A;  4JZY A;  4FC8 A;  4AY5 A;  4LSZ E;  3VTX A;  3CHO A;  5BPP A;  1HE8 A;  2WMO A;  3CSF A;  1D9S A;  3Q73 A;  1N95 A;  1SZA A;  1X81 A;  1N4R A;  1IHG A;  2E2E A;  2EIM E;  2EIN E;  4GTS A;  2RFM A;  1U2V G;  4U63 A;  5KJN A;  3EHR A;  1MJ0 A;  4N3A A;  5ENS D;  3N71 A;  2I2O A;  1HG2 A;  3HVE B;  2RKK A;  1NFI E;  4HI9 A;  4OAU C;  3NZU A;  3VLE A;  4DI4 A;  3G2S A;  1N4S A;  5EYL A;  3U64 A;  2CHX A;  3B7T A;  3QK0 A;  1KLX A;  3ZHE B;  4U8H A;  5EX3 A;  3D9I A;  4A55 A;  3T8K A;  2P9N G;  3UXG A;  3ZXP A;  3APD A;  4G26 A;  3EDT B;  5T4Y A;  4JXT A;  3V31 A;  1MYO A;  1BI7 B;  4F3V A;  3QB2 A;  1HH8 A;  4AP2 A;  4EHM A;  4YDE A;  4FA6 A;  1IHB A;  1JWG A;  3FUF A;  4W9R A;  3AU5 A;  2BUG A;  3ULY A;  3ASF A;  3FTS A;  4A63 B;  4U7E B;  5FT9 A;  4ILH B;  3Q7A A;  3ASO E;  4O6F A;  3CQG B;  4JHK A;  1TNZ A;  5EKQ D;  1WAO 1;  3ONK A;  4XI9 A;  5BUZ A;  1E90 A;  1A17 A;  3HDX A;  3RU0 A;  3U3W A;  4CRW A;  4CDN A;  2MRI A;  3SFX A;  4O60 A;  4CGV A;  1KT0 A;  1N94 A;  3L08 A;  3L16 A;  3L13 A;  3QWP A;  1MX2 A;  4GCN A;  5AN8 A;  4UWG A;  4I43 A;  2XCC A;  2Q7F A;  3C3O A;  1K1B A;  2J4D A;  2I1K A;  1YYH A;  1N4P A;  4JHJ A;  4A1S A;  2V0P A;  2VGX B;  1EYH A;  3TG4 A;  1H2U A;  3Q9N C;  3T8M A;  5JJT A;  5AQA A;  2CFZ A;  2AXZ A;  1HFA A;  3DEP A;  3DSV A;  2C0M A;  5ANR A;  1EPU A;  3QNK A;  4ANX A;  3FUK A;  4KZ0 A;  3Q9U C;  1OCO E;  2YHE A;  4WWN A;  2GGF A;  2RFA A;  2ZGG A;  2XPY A;  3ABK E;  2X6K A;  2E0I A;  4BTB A;  4HI8 A;  4M7C A;  3JXI A;  3S7D A;  1N4Q A;  2C2L A;  2FBN A;  3ZKJ A;  3DSU A;  2KCV A;  4HOQ A;  3UPV A;  3ONL A;  4GTR A;  1INZ A;  3CIA A;  4A3T A;  3CVX A;  3D9O A;  3UMV A;  5CCL A;  4I1M A;  1A5E A;  4DX7 D;  5ENO D;  3RIB A;  2L6B A;  3ZYM A;  3WG7 E;  4OYS A;  3CQC B;  4HOR A;  2P9I G;  3PZ3 A;  4ILI A;  4GTP A;  3SI5 A;  4R7L A;  4UWK A;  2LSU A;  1Q2Z A;  4G11 A;  2RD0 A;  2OOE A;  1OXJ A;  5ITZ F;  2DZN A;  2XPZ A;  2IU1 A;  4ZHB A;  5CER B;  3ZYL A;  5T8I A;  1P5Q A;  4BES A;  3HXF A;  2ILR A;  5FZQ A;  3Q7F A;  2KM4 A;  3KEA A;  2NC9 A;  1QQE A;  5G04 J;  3PZ1 A;  4HXI A;  2AWI A;  4J8S A;  2AVP A;  3B7U X;  1HO8 A;  4YDO A;  3AU4 A;  1TNO A;  2P9K G;  3LKU A;  4L9P A;  3D3M A;  3RO3 A;  2ION A;  1FVH A;  1LF8 A;  4I2W A;  3UM0 A;  1FVF A;  4GZ5 A;  2YHC A;  3B13 A;  4XX5 A;  5EYP F;  4CT0 A;  3IHV A;  3KS2 A;  4GTT A;  4WWP A;  4RQI A;  4EZL A;  2WQ6 A;  2ETB A;  4CDR A;  4RLY A;  4DLO A;  3UM3 A;  1YA0 A;  1PY1 A;  1WDY A;  2KXP C;  3TWX A;  4UWH A;  3Q78 A;  4EZK A;  4LRZ A;  1TNB A;  5EID A;  5J08 A;  2UY1 A;  2X6F A;  5B1A E;  3Q47 B;  3D9M A;  2YIN A;  2NSZ A;  4IYP A;  3MX3 A;  5KJM A;  3UM1 A;  4ATZ D;  3L9T A;  2AW6 A;  2A5E A;  4GA1 A;  5KJL A;  3CVU A;  5KNG A;  1H0A A;  4O1O A;  2F8Y A;  1IKN D;  2XGS A;  3ULQ A;  3GZ1 A;  2OCC E;  5EDS A;  2F8X K;  1UJK A;  1BD8 A;  2CG2 A;  2VSY A;  3AG4 E;  4N3B A;  1HF8 A;  3O48 A;  5CBN A;  4ATG A;  4UQX A;  4X8Q A;  4AV7 A;  3FY4 A;  4EPZ A;  3JCK C;  4O1P A;  3URZ A;  3NQP A;  1N0R A;  3QWW A;  1FT2 A;  2VGY A;  3B7S A;  3DSX A;  1NA0 A;  4RG9 A;  3NBN B;  4BX8 A;  3CVN A;  5T3R A;  2JEK A;  2R17 C;  3HXE A;  2GRP B;  4APO A;  4ACL A;  3LY9 A;  2WM9 A;  3FDH A;  1W3B A;  2IF4 A;  2IEJ A;  5AJD A;  3ML9 A;  3FHE A;  3ZGQ A;  4G25 A;  3Q15 A;  2PM6 A;  3PNL B;  4E6H A;  2F37 A;  3SGH A;  3MKQ A;  2ZIS A;  4FUL A;  2X6H A;  2M63 A;  4GPK A;  4I6E A;  2UWJ G;  4KVM A;  1MX4 A;  3B7B A;  4TRQ A;  3AJI A;  3NZS A;  1FT1 A;  1S70 B;  4DX1 A;  5G04 C;  3MZL B;  2LO6 A;  5CRV A;  3SFZ A;  3FU3 A;  3CVY A;  1UN8 A;  1KZO A;  2WXP A;  3ASD A;  2WMN A;  5BNW A;  3HG0 D;  3I4G A;  1NL4 A;  4WAF A;  3ZEF A;  4MLP A;  3MKR A;  2P9S G;  2V8S E;  3ABL E;  2AJA A;  2HYZ A;  1Z3X A;  3TXM A;  1IYG A;  1OCR E;  2DYR E;  3SF4 A;  1Z3Y A;  4GMR A;  4FLH A;  3FH7 A;  2OV8 A;  3T5V A;  5CMW A;  4NUR A;  3EU5 A;  3TWT A;  3R9M A;  4UUC A;  3CEQ A;  4LNG A;  4GTV A;  3FUN A;  2H6H A;  3OXG A;  4HRM B;  3I5P A;  2ETC A;  4L7T A;  1JWF A;  4CDM A;  2FEZ A;  2WXK A;  3U4T A;  3SO8 A;  3ASG A;  5DBK A;  1TNY A;  4GZD A;  4DUI A;  2KAT A;  4J8D A;  1OWP A;  4TUM A;  3SZ7 A;  3TL5 A;  2BF0 X;  2Y0B G;  3FUL A;  2Y1L E;  4F6R D;  5E76 A;  3CHP A;  3HXB A;  3BEE A;  4E85 A;  4TXQ A;  3HRA A;  2B0O E;  4BER A;  3V2X A;  3ZN3 A;  1HZ4 A;  2WQH A;  3FUJ A;  4M3O A;  3RK6 A;  1O5M A;  5C2Y A;  4L2Y A;  5KBA A;  4YND A;  3BG0 B;  4XZ4 A;  3CST A;  3E34 A;  2VQ2 A;  4L23 A;  4CCA A;  2XRY A;  2I6H A;  1UG3 A;  1HG5 A;  3R7R A;  1Z6T A;  2B6C A;  1BPO A;  2R03 A;  2UY1 B;  2XZD G;  3LS8 A;  5EIL A;  2PQR A;  4WNE A;  1G3N B;  2KBX A;  5AJL A;  4JC8 A;  4DPR A;  3AS4 A;  5ANL A;  3CVV A;  4WWO A;  2P58 C;  3SBS A;  5E75 A;  5B3S E;  4I1O B;  1NI1 A;  2LAH A;  4N5C A;  4LG6 A;  4G8L A;  3TWU A;  3U9W A;  4FP7 A;  3D9K A;  1S64 A;  4UI9 C;  2FI7 A;  3NB2 A;  3HYM B;  1TNU A;  5CMY A;  4UQZ A;  5AIJ A;  2BKK B;  5AQ9 A;  3UIN C;  2X38 A;  1ELK A;  3WXX A;  1JCQ A;  1EF1 C;  2R5S A;  5AYW D;  3FTV A;  4GZC A;  2J9Q A;  3ABM E;  4IRU A;  3Q5M A;  5FZS A;  2BTD A;  1H6P A;  4BET A;  3JQ1 A;  1FCH A;  5HI7 A;  3PZD A;  4WUY A;  2GRR B;  5CBO A;  3D9N A;  4BSZ B;  1SW6 A;  1DVP A;  3MEK A;  2DWZ A;  1NA3 A;  4FLB A;  3HIZ A;  4FJZ A;  3UUX A;  4RG6 A;  1L5J A;  4G8K A;  4H7Y A;  2KZT B;  1XGW A;  4GZ6 A;  3R9A B;  1TN6 A;  4LCT A;  3ENE A;  3ISM C;  3PZ4 A;  3T5X A;  3PUJ A;  3NAW A;  5HS0 A;  2OVB A; 
#chains in the Genus database with same CATH homology
 2XPZ A;  2IU1 A;  5G2N A;  3I4R B;  3BG1 B;  4C9B B;  4EEC A;  2WXG A;  2L0T B;  4AXH A;  5ARG A;  3ZYL A;  2DCP A;  5T8I A;  5FQ7 A;  1P5Q A;  5AEN A;  3CVW A;  4GYY A;  4KZC A;  3VLD A;  5A6C A;  2ILR A;  4HOT A;  2Y3A A;  5FZQ A;  3PNT B;  2V5F A;  2KZT A;  4A3V A;  2KM4 A;  3FFL A;  3C98 A;  2NC9 A;  1QQE A;  3PUK A;  4BSX A;  2A4Z A;  5G04 J;  3CHQ A;  3MCX A;  3EJN A;  4J0U A;  4HXI A;  2AWI A;  3GZS A;  4J8S A;  4RVB A;  3FUE A;  2AVP A;  3B7U X;  1HO8 A;  4IUL A;  3AU4 A;  4ANW A;  3CVP A;  3PH0 C;  4HVB A;  3I3N A;  3GZ2 A;  4NAC A;  2WQ7 A;  3LKU A;  3SD5 A;  3QKY A;  3D3M A;  4IN3 B;  3EIJ A;  3ZW3 A;  1WY6 A;  2KCK A;  1N54 A;  4KXK B;  1OWM A;  3KAE A;  3RO3 A;  2ION A;  4U0Z A;  3ZPJ A;  5EX0 A;  1FVH A;  4CEM A;  1LF8 A;  4I2W A;  4G2V A;  4XE0 A;  3LPZ A;  4XKB A;  2AXU A;  3KD7 A;  4N2Q A;  3SHF A;  1FVF A;  4GZ5 A;  2YHC A;  1HXI A;  2DBA A;  3PE3 A;  4KVO A;  1UJJ A;  4NRH B;  3B13 A;  3R7Q A;  2NXP A;  2WVI A;  4XX5 A;  4CT0 A;  2X6J A;  4I6J A;  3IHV A;  3KS2 A;  2WB2 A;  3NF1 A;  4WWP A;  4B89 A;  3MV2 B;  3Q49 B;  4EZL A;  4URK A;  2WQ6 A;  3FTZ A;  4G1T A;  4CDR A;  4EBA G;  4JPS A;  2MOW A;  3PEU B;  4XIF A;  5CCM A;  1JPL A;  3CHM A;  3ESL A;  4DLO A;  1YA0 A;  1PY1 A;  1U3C A;  2L0I A;  2WXJ A;  4GYW A;  4UWH A;  4AVX A;  3CK7 A;  3MA5 A;  3PS6 A;  3ZFW A;  4EZK A;  4JW1 A;  4LRZ A;  5J08 A;  5KCM A;  5BV0 A;  1TEZ A;  2WPV A;  4WNG A;  3OAW A;  3FTY A;  2WXH A;  2UY1 A;  1ELR A;  3FH5 A;  2X6F A;  2XCB A;  3PVL A;  3Q47 B;  4BFR A;  3D9M A;  2YIN A;  3DPD A;  3QC1 A;  1OWL A;  2NSZ A;  4ABN A;  5LOZ A;  4KT6 B;  3SNX A;  4IYP A;  1UN9 A;  4LUN U;  3MX3 A;  3CK9 A;  3PE4 A;  4F7A A;  1B89 A;  5KJM A;  4UWL A;  3RRU A;  3KEZ A;  3D9L A;  4I9C A;  2AW6 A;  4GYO A;  4BTA A;  4JHR A;  3L17 A;  4GA1 A;  3S2A A;  5KJL A;  3CVU A;  4LER A;  3GYZ A;  4KBQ A;  1H0A A;  4FHJ A;  3FTW A;  3CV0 A;  3QAR A;  4G23 A;  2YQ8 A;  4P29 A;  2XGO A;  2XGS A;  4JA9 A;  3G2T A;  2XQ0 A;  4H7X A;  3ULQ A;  3GZ1 A;  3MYV A;  4G24 A;  4K0R A;  5EDS A;  1HU3 A;  4BT9 A;  1XNF A;  3ZIM A;  4EQF A;  3EHM A;  4JL0 A;  3S7J A;  1UJK A;  2QFC A;  2XGM A;  1TJF A;  4ACK A;  4PS8 A;  2KCL A;  2CG2 A;  5ARF A;  3G2W A;  2OND A;  2VSY A;  1HX8 A;  3LXU X;  4GZ3 A;  4YVQ C;  5JHA A;  4N3B A;  1E96 B;  2WXR A;  1HF8 A;  3O48 A;  4PUC A;  4ATG A;  4OVU A;  1E8X A;  4UQX A;  4BY6 A;  3OXL A;  4AV7 A;  3FY4 A;  4EPZ A;  4DI3 A;  3JCK C;  3L22 A;  3LJ3 A;  3QOU A;  3URZ A;  3TG5 A;  1IQU A;  4MKT A;  4TUU A;  2PQN A;  3NQP A;  2RG8 A;  3QWW A;  3G2V A;  1H19 A;  2VGY A;  3FU6 A;  3B7S A;  3EHN A;  3JYS A;  2VSN A;  3L54 A;  4I17 A;  1NA0 A;  3ASH A;  3IV0 A;  4RG9 A;  3FTU A;  3ZXS A;  3MKQ B;  3P2B A;  2OVF A;  1HS6 A;  3VLF A;  2VYI A;  3CVN A;  2GRL A;  3L6A A;  4Y6C A;  4BX8 A;  3Q4A B;  3QDN A;  1SQM A;  3CGH A;  5T3R A;  2JEK A;  2R17 C;  3RJV A;  2X3M A;  4MS6 A;  2WXN A;  5J90 A;  4APO A;  4FHK A;  3ZRH A;  4PDX A;  4ACL A;  2AXV A;  2L9B A;  2WM9 A;  3LYA A;  3LY9 A;  3FDH A;  4FU3 A;  1W3B A;  4F53 A;  2IF4 A;  5BW8 C;  5AJD A;  3IBE A;  5ENN A;  4N2S A;  2LSV A;  3ML9 A;  3S7B A;  1PC2 A;  2DIW A;  2J49 A;  3FHE A;  4FJY A;  3IHY A;  4YVO A;  4C0M A;  4DJA A;  3ZGQ A;  2PM7 A;  4U0S A;  4N3C A;  3DBS A;  4G25 A;  4QFV A;  3Q15 A;  4CGW A;  2FF4 A;  3LY7 A;  2PM6 A;  3PNL B;  4HFG A;  4MRU A;  4I9E A;  4U04 A;  4APF A;  4JZY A;  4CT4 A;  4D10 C;  1OWO A;  2A5U A;  3JUI A;  4FC8 A;  4ANV A;  5A23 A;  4JEH A;  2VTB A;  3SGH A;  4AY5 A;  2J4B A;  4PS3 A;  5JJ6 A;  3MKQ A;  4FUL A;  5HQ8 A;  2VSX E;  2X6H A;  2M63 A;  4GPK A;  3VTX A;  3CHO A;  4I6E A;  5BPP A;  4U07 A;  5DIZ A;  1HE8 A;  2UWJ G;  4KVM A;  3UQ3 A;  4AIF A;  3CHR A;  2WMO A;  2JLB A;  3HHM A;  3NZS A;  4TRQ A;  3FUM A;  3CSF A;  3U66 A;  4GU5 A;  3ZVV A;  3FEY A;  2PL2 A;  5FQ4 A;  5G04 C;  3MZL B;  1SZA A;  3OTN A;  2YNQ A;  4RSY A;  2KC7 A;  4NQ0 A;  2LO6 A;  5LX8 A;  3ML8 A;  3SFZ A;  1IHG A;  1E8W A;  2E2E A;  3FU3 A;  4AEZ C;  5FWQ A;  3LDZ A;  2PZI A;  2HO1 A;  2I1J A;  2HM8 A;  3CVY A;  3E4B A;  3GW4 A;  1UN8 A;  4AJW A;  3QWV A;  1VDY A;  3ZYK A;  2FO7 A;  4HS2 A;  4BWR A;  2WXM A;  2WXP A;  3ASD A;  2WMN A;  5BNW A;  4U63 A;  4I2Z A;  5FQ6 A;  5BV1 A;  5KJN A;  3I4G A;  4JEU A;  3AS8 A;  4EBA A;  4N3A A;  4WAF A;  5JHB A;  3N71 A;  2I2O A;  3ZEF A;  4MLP A;  3MKR A;  1HG2 A;  3HVE B;  4B0Z A;  2V8S E;  3UT4 A;  3CK8 A;  2IFU A;  2HYZ A;  1Z3X A;  3FH8 A;  5D0Q D;  4Y6W A;  5G05 J;  3TXM A;  4UWF A;  3NZU A;  3VLE A;  4DI4 A;  1IYG A;  3B7R L;  1MQS A;  3G2S A;  1PAQ A;  4PS7 A;  3SF4 A;  4Q96 A;  3U64 A;  3UT7 A;  1Z3Y A;  2CHX A;  3B7T A;  3CLJ A;  4F1S A;  1ZU2 A;  4FLH A;  4HOS A;  2Y4U A;  3TGO A;  3QK0 A;  3FH7 A;  1KLX A;  4J8E A;  2OV8 A;  3ZHE B;  4U8H A;  3T5V A;  3TXN A;  5CMW A;  5EX3 A;  3D9I A;  4NUR A;  2I9C A;  3LEW A;  5CHE E;  3RRN B;  1N52 A;  4A55 A;  3CEQ A;  1E7V A;  1E8Y A;  3FP3 A;  4I1A A;  4V3I A;  3FUN A;  3APD A;  4G26 A;  5FTP A;  4DLQ A;  4KYO B;  3EDT B;  5KJK A;  3OXG A;  5T4Y A;  4JXT A;  2J07 A;  4WND A;  2V4L A;  3I5P A;  4L2L A;  2IOL A;  4F3V A;  4L7T A;  1JWF A;  3QB2 A;  1IQR A;  4CDM A;  3LCA A;  3LVQ E;  2FEZ A;  3G2U A;  2WXK A;  3K9I A;  5G05 C;  3U4T A;  1KT1 A;  3ASG A;  4DK5 A;  1HH8 A;  5DBK A;  4AP2 A;  3D9J A;  4GZD A;  4FA6 A;  4E6H A;  2KAT A;  4J8D A;  1GW6 A;  1OWP A;  1JWG A;  1OWN A;  1ELW A;  3FUF A;  3SZ7 A;  1E8Z A;  4W9R A;  3AU5 A;  1NZN A;  2BUG A;  3TL5 A;  2XHE A;  1TJC A;  3ASF A;  4AM9 A;  4JVS A;  4KMO A;  2BF0 X;  3PRZ A;  3CHS A;  3FTS A;  2EQX A;  2L6J A;  3FUL A;  5FT9 A;  4GA0 A;  3RO2 A;  3P1U A;  3UT8 A;  4ILH B;  5BT1 A;  4B94 A;  2VJ8 A;  4O6F A;  3OXF A;  3CQG B;  5E76 A;  5M72 A;  4JHK A;  4A1G A;  2CHW A;  3LY8 A;  2WXF A;  3PEV B;  1OUV A;  3CHP A;  4J6I A;  4ANU A;  2WXI A;  5EKQ D;  1WAO 1;  3BEE A;  1WM5 A;  3ONK A;  4E85 A;  4XI9 A;  5BUZ A;  3ESK A;  1E90 A;  1A17 A;  3LVR E;  2ZU6 B;  3FUH A;  3HDX A;  5G55 A;  3RU0 A;  4JA7 A;  3U3W A;  4CRW A;  5LFA A;  2CFU A;  4CDN A;  2MRI A;  3ZN3 A;  4GML A;  5FQ8 A;  4J8F A;  1E7U A;  1HZ4 A;  2LAI A;  4CGV A;  1KT0 A;  2WQH A;  3L08 A;  4Q94 A;  3FUJ A;  3L16 A;  4K03 A;  3L13 A;  3QWP A;  4BT8 A;  4M3O A;  3TJP A;  3D9P A;  4GCN A;  3RK6 A;  3SBT B;  4UWG A;  4AOF A;  1EDU A;  4I43 A;  4BX9 A;  3AS5 A;  2X6I A;  2XCC A;  3APC A;  5C2Y A;  2Q7F A;  3JQ0 A;  2J4D A;  3EIQ C;  2VSO E;  2C0L A;  2I1K A;  4L2Y A;  4YND A;  3BG0 B;  3RRM B;  4XZ4 A;  5A7D B;  3CST A;  4JHJ A;  4UI9 J;  3PDN A;  2VQ2 A;  3FUI A;  4L23 A;  4A1S A;  3CVL A;  2V0P A;  2XRY A;  4CCA A;  4HLE A;  2I6H A;  1UG3 A;  3IKO B;  1HG5 A;  1Z6T A;  3R7R A;  1BPO A;  2VGX B;  1EYH A;  2UY1 B;  1H2U A;  1H6K A;  3LS8 A;  4PH4 B;  2R59 A;  4N39 A;  3TG4 A;  3T8M A;  5JJT A;  2CFZ A;  3UX4 A;  3RKV A;  2J09 A;  2PQR A;  1JUQ A;  2WXL A;  4WNE A;  2LNI A;  3O4Z A;  5AJL A;  2AXZ A;  4JC8 A;  4DPR A;  3FTX A;  1HFA A;  3AS4 A;  4ILG A;  5ANL A;  2C0M A;  5ANR A;  2Y4T A;  5FJY A;  3CVV A;  4WWO A;  2P58 C;  1SZ9 A;  2FUL A;  4GAA A;  3SBS A;  1EPU A;  5E75 A;  3QNK A;  4ANX A;  3FUK A;  4I1O B;  2WXQ A;  4KZ0 A;  2LAH A;  2YHE A;  4N5C A;  4UI9 K;  3ZYQ A;  1NP7 A;  4WWN A;  2GGF A;  3U9W A;  4FP7 A;  3D9K A;  5LP0 A;  4B8C B;  1ZBP A;  1MHQ A;  3FUD A;  4UI9 C;  2XPY A;  2FI7 A;  4L1B A;  3S7F A;  2X6K A;  2E0I A;  3MV3 B;  3MJW A;  4XKC A;  4BTB A;  3MGB A;  2VGX A;  2IQC A;  3HYM B;  4LEU A;  1QZ2 A;  4GB9 A;  4I6G A;  5CMY A;  3S7D A;  4UQZ A;  5AIJ A;  3FWV A;  3VTY A;  2QY7 A;  4B8A A;  2C2L A;  3APF A;  2FBN A;  2XPI A;  5LCW J;  5C1D A;  4Q69 A;  2X38 A;  1ELK A;  3WXX A;  1EF1 C;  2KCV A;  3CKB A;  2R5S A;  5AYW D;  3FTV A;  4GMJ A;  4GZC A;  2J9Q A;  4HOQ A;  4U0U A;  3UPV A;  3ONL A;  4IRU A;  3Q5M A;  5FZS A;  3QJZ A;  1H2V C;  2BTD A;  1H2T C;  4ME2 A;  4HOU A;  1INZ A;  3CIA A;  3HVE A;  4A3T A;  1Y6I A;  2GW1 A;  4WNF A;  3CVX A;  4C0E A;  3JQ1 A;  3CKC A;  3FEX A;  1FCH A;  3D9O A;  5HI7 A;  4FAD A;  3PZD A;  4WUY A;  4GCO A;  3UMV A;  5CCL A;  2CG3 A;  2CHZ A;  4I1M A;  1S0P A;  4OVV A;  4UQY A;  3D9N A;  3RIB A;  4XI0 A;  1DNP A;  2GRM A;  1DVP A;  3MEK A;  3CVQ A;  1NA3 A;  3ZYM A;  4FLB A;  3ZHE A;  3HIZ A;  4FJZ A;  3FU0 A;  4OYS A;  3UUX A;  4RG6 A;  1L5J A;  1X5B A;  3CQC B;  5LCW C;  2J08 A;  3FU5 A;  4ILI A;  2WXO A;  4H7Y A;  4HOR A;  5D0O D;  2HR2 A;  1XGW A;  2KZT B;  4GZ6 A;  3CR3 A;  3SI5 A;  4R7L A;  4TV3 A;  4UWK A;  2LSU A;  2XRZ A;  3R9A B;  1QNF A;  4G11 A;  2RD0 A;  3IEG A;  1U3D A;  4EZJ A;  5JJ7 A;  3QAQ A;  3TAX A;  4LCT A;  3ENE A;  2XEV A;  2MHK A;  3T5X A;  2IJG X;  2OOE A;  3PRE A;  1UW4 B;  5FZR A;  3PUJ A;  2IOS A;  2VTB B;  4AY6 A;  4GA2 A;  1Y8M A;  2OVB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...