3UKRG

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
136
Chain Sequence
ARFRKVDVGEYDENKFVDEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
molecule tags Structural protein
total genus 43
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3ukrG00
1TYQG 1U2VG 4JD2G 3DXMG 3RSEG 2P9SG 2P9PG 2P9UG 2P9KG 3ULEG 1K8KG 2P9IG 4XEIG 2P9NG 3DXKG 3UKRG 3DWLG 2P9LG 3UKUG
chains in the Genus database with same CATH superfamily
3IHYA 3MA5A 3ZIMA 1H6PA 1AP7A 2ETBA 3UT8A 1UW4B 2J07A 1K1BA 3ML8A 4QQIA 2WXHA 4BETA 3MKQA 1UN8A 3MJWA 3F6QA 3FUNA 4WAFA 4MRUA 4UWLA 5C2YA 4XE0A 3NB2A 3PS6A 1D8DA 4X8QA 2ZIRA 4I6GA 1ELKA 1SVXA 2KCKA 3QDNA 3FHEA 5EIDA 1E8ZA 4RQIA 4XKBA 4JHJA 2J49A 2RD0A 1OWNA 5FQ6A 2AXUA 4Q96A 2HO1A 3I4GA 4UQXA 1QNFA 4EECA 3PUKA 1Z6TA 3CHRA 5LFAA 4I6JA 3CV0A 5BW8C 3TJPA 3EHNA 5CECB 3KS2A 3Q47B 5EYPF 3FH5A 4C48B 4HB5A 1RZ4A 4UI9K 2XPIA 1IXVA 3URZA 3S7BA 1KZOA 3PZ4A 5AQBA 3UI2A 2YNQA 2LUHA 3QC1A 3DSWA 2FI7A 3R9AB 3Q75A 2P58C 4GYOA 3N71A 2FO1E 3FU0A 3TWUA 3EU9A 3PZ1A 3LY9A 3O4ZA 2BKKB 4MLPA 3HDXA 1TR4A 3Q7FA 4MS6A 3PVLA 4DPRA 2A5EA 1BI8B 2DYSE 1OWLA 2F37A 4FA6A 4HI8A 4CRWA 4H7YA 5KJLA 2EIME 2WPVA 3P1UA 2GW1A 1S63A 3KSLA 3ONKA 4GA0A 4N5QA 4YDEA 3CSFA 4F1PA 3CVNA 3APFA 4GZ5A 4BTAA 2WXIA 4AVXA 4LNBA 5FQ4A 4GA1A 3U9WA 1SW6A 3LPZA 4G2VA 2WXMA 4RVBA 2DCPA 4CDMA 1KT1A 2Y69E 3CHMA 4I1AA 1TNOA 2UWJG 2I1JA 4ACLA 4OYSA 3RK6A 3CKCA 1EPUA 3CK7A 3DSTA 4DRXE 2UY1A 2NSZA 2KM4A 3VTYA 4U63A 5BV0A 5J08A 4NURA 5B3SE 4U8VD 3C3RA 3ZN3A 4F7AA 3NQPA 1K8KG 4GU5A 4JXTA 3ONLA 2RG8A 1IYGA 5T8IA 2I2OA 4I1OB 3TWQA 3QOUA 5EIBE 2Y0BG 1WAO1 4KT6B 4I43A 2WXKA 1HZ4A 3D9OA 4WWNA 5CRVA 3SNXA 4FULA 1TN6A 1TN8A 2BEDA 2ZU6B 1LD8A 4N3AA 4WNDA 3ZHEA 2QC9A 4K5AB 3I5PA 3QWVA 3QK0A 5JHAA 3CLJA 1JWGA 2OEVA 1WM5A 3CHOA 4KXKB 5KJNA 2ETCA 3VLDA 1Q2ZA 2CHWA 2XCCA 4HLLA 5ENPD 3UT4A 4PUCA 3PEVB 2OOEA 3EIJA 1WDYA 5ANRA 5CMWA 4PDXA 2ZISA 2ILRA 2XZTG 2VGXA 3FWVA 3D9JA 1Z5SC 4LSZE 3HXCA 3HXDA 5AQAA 4F6RD 2J4DA 4YNDA 4WWPA 2DYRE 3D9NA 1HE8A 2WXFA 4UI9J 1LF8A 3TWRA 1HFAA 4BESA 3TL5A 4J8FA 1TNUA 1MZCA 1FVHA 3DWLG 5CCMA 2WB2A 3ZUVB 2J4BA 3UIOC 2IFUA 3SO8A 2X6KA 1FT1A 4GZ3A 1TNBA 2AVPA 4L2LA 2DBAA 4JZYA 2WMOA 3BG1B 3UKRG 3ZFWA 3ZGQA 2R02A 3LY7A 3W9GA 4FJZA 3CGHA 4G23A 2GRPB 3CVXA 5AARA 3D9MA 4GCOA 4U96D 2IO3C 5AJLA 2ZGGA 4H7XA 5FWQA 2WVIA 4L23A 3T5XA 3FP3A 5AENA 4EBAG 1N4RA 2R5SA 4Z68A 3SFZA 2KCLA 5LCWC 4CDRA 3BG0B 3NF1A 2A5UA 3MZLB 4GMLA 1EYHA 2BKGA 4FC8A 3TGOA 3UTMA 3B7RL 5CEDB 3L08A 2ZXWE 3OXGA 3RJVA 4CCAA 3ENEA 2Y4TA 3L82A 4DI4A 4GMRA 3NAWA 5D0QD 3SI5A 3EDTB 3SGHA 1NA0A 1H0AA 3CVQA 3X2QE 5EKQD 1NL4A 4JA7A 3P2BA 2Y4UA 2P2CP 1YMPA 4U07A 1OCZE 2HYZA 2JABA 2DZNA 2YQ8A 2R59A 3UM1A 1V55E 3ASDA 5BT1A 5D2MC 5AIJA 4HRMB 3B7UX 3FU6A 2FBNA 4K0RA 3LJNA 5FQ7A 3RRUA 4OAUC 5BV1A 2ONDA 3VLEA 4J8SA 5CEAA 2VSOE 3LDZA 5A7DB 2E2EA 2KZTA 1W3BA 4BY6A 2IF4A 3UM2A 5AYWD 4HS2A 1U3DA 3I4RB 1HX8A 3ZYMA 1E7VA 4HLEA 3AS5A 1ZB1A 2KATA 3HVEB 1KLXA 3RU0A 4AP2A 4B0ZA 4UQZA 1H2UA 5EX0A 1N4QA 4ANXA 2XEEA 4KVMA 4P29A 3UQ3A 3FUHA 5E76A 2R2LA 2MHKA 3ASNE 3CVVA 1NP7A 2XGMA 5JJTA 3FULA 4WNEA 1BI7B 2X6JA 3CQCB 3RRMB 3ZU7B 4GYWA 2J09A 3UINC 3MKRA 5D0OD 2XRZA 3C98A 4HOUA 5LOZA 4DX5D 3ZKJA 2IU1A 3FH8A 3DSXA 4DLQA 3UKUG 3QNKA 5KJMA 3O48A 3ZXPA 1JPLA 2X6IA 1HS6A 3DXMG 1TN7A 4K03A 3EHRA 2M63A 2NC9A 3QARA 4G11A 4FHKA 1K1AA 4TRQA 3B7SA 4UWHA 3RO2A 3PZDA 1INZA 3E4BA 2WXNA 3NBNB 4I6EA 4GYYA 2GGFA 3LYAA 2FO7A 4TXRA 3D9LA 3G2TA 3V31A 2V8SE 1N4SA 4GTMA 3LKUA 5D66A 2I6HA 3FH7A 2P9KG 4I9EA 2KCVA 4OVUA 3R7RA 2PQNA 2L6JA 1H19A 2F8YA 4YVOA 5ENSD 5BXOA 3CK8A 4L2YA 4UWFA 1OCCE 3JCKC 4JA9A 4JEHA 5G04J 3KD7A 4GB9A 1JCSA 5ENTD 1BD8A 4FHJA 4N5CA 1E8YA 4N2SA 4N3CA 5KCMA 4F3VA 2NYJA 4V3IA 3PH0C 2IO2C 3EJNA 4A1GA 5ARFA 2WXLA 1FPPA 2VSNA 1HXIA 3LVRE 2J9QA 1AWCB 1QZ2A 3MX3A 5CMYA 1OY3D 4ZHBA 1S70B 1FT2A 3PUJA 2XS8A 4GAAA 4JL0A 5FTPA 1HH8A 3MKQB 5JJ6A 1WY6A 3QB2A 5ENOD 4CT0A 5AN8A 2OCCE 1DCQA 1E96B 3U64A 4KZCA 4BTBA 2IONA 4DJAA 3IKOB 3TG5A 3L54A 3GZ2A 3U3WA 2J08A 2XEHA 5CBNA 4A3TA 2XPYA 1SA4A 2LAIA 1MJ0A 3ISMC 4GZDA 4NRHB 2GROB 1U2VG 2GRRB 3AU5A 4C0EA 3SY2A 4U7EB 5BUZA 4LUNU 1A17A 3TG4A 2OVFA 4BWRA 3AG1E 4J8YA 3S7DA 3GZ1A 4PS8A 5AQ7A 4GZCA 3VLFA 4C9BB 3SZ7A 5A23A 3G2VA 5KNHD 2EIJE 4GMJA 1JWFA 3CQGB 3L9TA 4PS7A 2CG3A 3ESKA 4JHRA 3B7TA 3FUJA 4JB8P 3Q5MA 1UOHA 4Y6CA 4O1PA 4BERA 3KEZA 4XEIG 1E8WA 2EIKE 2MRIA 4BSZB 4YDOA 4HORA 3B7BA 5B1BE 5DIZA 3Q9NC 1B89A 4CGWA 3NOCD 3L13A 2LO6A 4QFVA 5A6CA 3SFXA 2VTBA 5B1AE 4ACKA 4N3BA 1K3ZD 4CZ2D 1JCQA 1HO8A 3PZ3A 4TV3A 3CHSA 2PM6A 3EIQC 4U04A 4UWKA 1DVPA 3AG4E 2WXOA 4GTTA 4AIFA 3ML9A 5EYLA 5KJKA 3FTZA 4B8AA 2LSUA 3RKVA 2WQ6A 4IULA 4Q69A 2VJ8A 3IEGA 4WNFA 2RFAA 1BU9A 1MYOA 2PL2A 4J8EA 3FU5A 4EZJA 5AJDA 4Q94A 4FADA 3D9KA 2R03A 2YINA 2GRNB 5M72A 3FUKA 2LXLA 4FU3A 3PDNA 4GZ6A 3CVLA 3PRZA 2P9LG 4UI9C 4AOFA 1H6OA 3SQVA 3FTYA 2CFUA 2UY1B 3CK9A 4KYOB 4DX7D 2P9IG 2XZDG 2AXVA 1SA5A 1Z3XA 2WXGA 2V5FA 3RIBA 4N39A 4RLYA 4MKTA 4GTRA 3ULYA 3ZYKA 2HR2A 3VTXA 4U0ZA 3ASGA 2YHCA 3I3NA 4N2QA 3WG7E 1U3CA 4AJWA 1QYMA 4ATGA 3DEOA 3V79K 4G26A 4LNGA 4JVSA 2I9CA 1A5EA 3APDA 1P5QA 4MBGA 5HI7A 3CSTA 2P9UG 3T8MA 4CEMA 2RKKA 3TXMA 3OTNA 3SD5A 5G05J 2C0LA 3ZNGA 1QQEA 4M3OA 3ABLE 2XENA 2EQXA 3ZHEB 2HM8A 2X3MA 2DWZA 4KVOA 2VQ2A 5E75A 4EHMA 4A1SA 4TUUA 4I9CA 3JXIA 3ASOE 3C3QA 3G2WA 2PM7A 4XI0A 4G25A 1SZ9A 4ANVA 1JCRA 1OCOE 4L7TA 1O1RA 3FUDA 3UT7A 4URKA 1DNPA 1IKND 4NACA 3HXEA 3OAWA 5EILA 1N9AA 2V0PA 2IY0C 4E85A 1UJJA 4YDYA 5HRYA 2VGXB 3FTUA 3JYSA 3NOGD 1E7UA 5CRUA 1TJCA 4U95D 4GPKA 3AS8A 4AY6A 3SFYA 3RO3A 1NA3A 3TAXA 4Y6WA 2BF0X 3UX4A 1OWPA 4APOA 4HBDA 1TNZA 2WXJA 4GPMA 1N54A 2XGSA 3KAEA 3SHFA 1YCSB 4A55A 4JHKA 1MX2A 2FEZA 4OAVB 2XPZA 3FTXA 2WMNA 4HOSA 2H6GA 3EU5A 4B94A 3MEKA 1UJKA 4I2ZA 1H2VC 3NZSA 3B95A 2Q7FA 4O6FA 1WG0A 3K9IA 2BUGA 3EHQA 3KEAA 3FUFA 1BLXB 3CKBA 3ZPJA 3JUIA 5FT9A 1N0RA 3OXFA 3FUMA 3LEWA 4C0MA 4BT9A 4DX2A 2IOSA 1N0QA 3HYMB 1IQUA 4TXQA 4NIKA 3C3OA 4OVVA 4JPSA 3MV2B 3C72A 3DRAA 4FLHA 3CEQA 1N95A 2WXQA 2OVBA 3AS4A 2QY7A 2QYUA 1SQMA 4J7WA 5FJYA 5CHEE 4XIFA 4B8CB 3RRNB 1MX4A 1SZAA 1IHBA 3Q9UC 2H6IA 3ESLA 5JMND 4D10C 1HG5A 2L0IA 3HIZA 4ABNA 3EHMA 3C5RA 4HOTA 1PY1A 3PNTB 2CG2A 1LTXA 2IEJA 3PZ2A 1KPSB 3MCXA 5ENRD 3D9HA 2YHEA 3JQ0A 2WXRA 1TJFA 2X6FA 1OT8A 3JXJA 4JC8A 1KT0A 4JW1A 3ASFA 5J90A 2DIWA 4YDWA 2MYOA 1OWMA 2AWIA 2OV8A 5H7PA 1LD7A 2KZTB 2VYIA 3G2UA 5EX3A 4G1TA 1HU3A 5G04C 5BPPA 3DXKG 5FQ8A 4M7CA 5JA4D 3IBEA 5FZSA 2LAHA 1ZBPA 2PZIA 3T9KA 4HOQA 2XEVA 4KMOA 4EQFA 1S64A 3FTWA 4GCNA 3CHPA 4RG6A 4XZ4A 4J6IA 3TXNA 2V4HC 1RW2A 3GYZA 3LS8A 3Q78A 2J8SD 1N52A 3KSQA 3FY4A 4U8YD 4HFGA 3J5QB 3FEYA 1PAQA 3MGBA 5EN5D 4GTVA 4HVBA 5FZQA 3Q49B 2PQRA 3ULEG 2BTDA 2DZOA 5KNGA 5FINA 1D8EA 3OXLA 2V4LA 4ZFHA 1O5MA 3MV3B 3SBSA 3BUAA 1MHQA 4G8LA 4NQ0A 4JEUA 3HHMA 1KZPA 2XQ0A 4HI9A 5ENNA 5G55A 3EUVA 4FJYA 4WWOA 5IY5E 1MX6A 4EBAA 3GW4A 1YYHA 1HG2A 1VDYA 1Z3YA 1EF1C 1FVFA 3TWVA 5HKPA 3E37A 2JLBA 1OWOA 3MYVA 4DX1A 1X81A 4EZLA 4DI3A 4A63B 4IRUA 4HXIA 3E32A 4DK5A 2QZAA 3WXXA 4HNAD 3AU4A 3PE4A 4XX5A 2GRQB 2F0YA 4CDNA 4HRLA 3DBSA 1Y8MA 2R17C 4AEZC 2A4ZA 4DLOA 3TWXA 4LNUD 1L5JA 3D3MA 2WQHA 4KBQA 2B6CA 3GZSA 2WQ7A 4UQYA 3ZYLA 4F1SA 3LCAA 3CIAA 4PH4B 4A3VA 3E30A 3V2OA 4CYMD 5CERB 4HRNA 5HS0A 4B93B 3Q7AA 2QYJA 1OXJA 3CR3A 3IV0A 3DSUA 4LEUA 4J0UA 3FEXA 1QBQA 1IQRA 2P9NG 1OUVA 1UN9A 2KC7A 1UG3A 3UUXA 2IJGX 1Y6IA 3L17A 4LG6A 3ABME 3AG3E 3CVUA 2F8XK 5G2NA 3FUIA 4G8KA 4EPZA 4FP7A 2AJAA 2KXPC 1H2TC 2KBXA 3LJ3A 4BEPA 3DSVA 3T5VA 5BNWA 3QKYA 1V54E 2PNNA 4CT4A 1N4PA 4AXHA 4AM9A 3IHVA 3DSSA 2C2LA 3ZYQA 5BXUA 3LVQE 2NXPA 2XCBA 4K5BA 4E6HA 1XNFA 3ULQA 2V5QC 4U0UA 2CHZA 3TWSA 4BX8A 1S0PA 3UPVA 2L0TB 2WXPA 4HQDA 5EDSA 2I1KA 1DCEA 3BU8A 1N94A 3J5PA 1TNYA 3PNLB 3FUEA 1PC2A 2LNIA 4XKCA 5C1DA 1OCRE 3CHQA 2VSXE 3L16A 3DEPA 3QWWA 3V30A 3CVPA 1NZNA 2C0MA 3FU3A 2L6BA 3TWTA 4ILIA 3RSEG 5ANLA 1JUQA 2R05A 3CVWA 3QAQA 4AV7A 3JUEA 1G3NB 3BQOA 5AAOA 2GRMA 5KBAA 1HF8A 4BFRA 4JD2G 4G24A 3D9PA 2VTBB 1FCHA 3HXBA 4ME2A 2OEWA 1GW6A 5G05C 4BT8A 3T8KA 1BPOA 3DPDA 5ARGA 3D9IA 3PE3A 3CVYA 3UMVA 3HG0D 3SBTB 3U66A 3JQ1A 2WM9A 5HQ8A 2HE0A 2JEKA 2FF4A 2IQCA 3FDHA 4XI9A 5ENQD 1YA0A 3AAAC 5ITZF 3UM3A 3S7FA 2X6HA 4I2WA 2RFMA 2X38A 2P9SG 2XGOA 4BSXA 3AG2E 3B13A 1DC2A 5DBKA 5AQ9A 3L22A 1H6KA 4I17A 4EZKA 5JHBA 1IHGA 4FLBA 3UXGA 2QFCA 3Q15A 3W9FA 3ZRHA 3NZUA 2P9PG 2H6FA 3ZEFA 4GTOA 1NI1A 4L9PA 1O1SA 4LRZA 4YVQC 2H6HA 4ANWA 3E34A 3HVEA 3FTVA 2AXZA 3Q4AB 2XHEA 4L1BA 1XGWA 2ETAA 3AJIA 3IXEA 3R9MA 3PEUB 4PS3A 3R7QA 4RG9A 4GTPA 4APFA 4R7LA 4W9RA 2Y1LE 4K5CA 5T3RA 4IYPA 3ZXSA 3RAUA 4TXPA 4LERA 4AY5A 3BEEA 2EINE 4UUCA 4WNGA 4U0SA 3E33A 4GTQA 4ANUA 2Y3AA 5LCWJ 1TEZA 3S2AA 4TUMA 2DVWA 5T4YA 1TYQG 3V2XA 4O60A 3SF4A 4WUYA 3G2SA 4RSYA 5CBOA 2VGEA 3DPYA 3ABKE 1ZU2A 2ZGDA 3UIPC 2XS1A 2LSVA 4ILGA 3FTSA 1D9SA 3ASHA 4UWGA 1MQSA 3QJZA 4B89A 4I1MA 4ATZD 2FULA 2IOLA 4O1OA 4IN3B 4F53A 5LX8A 4ILHB 2LXMA 3L6AA 3TWWA 2MOWA 3LXUX 5JJ7A 3Q79A 3ZW3A 3U4TA 5KWDA 1X5BA 4GA2A 1ELWA 1EDUA 4U8HA 3S7JA 4DX6D 4GTSA 3HRAA 4J8DA 4LCTA 3QWPA 2CFZA 4DUIA 2VSYA 3ZVVA 3PREA 1NFIE 3UM0A 1E90A 2XRYA 2L9BA 2GRLA 5FZRA 2B0OE 5CCLA 2E0IA 2AW6A 3Q73A 4BX9A 5FIOA 1ELRA 2CHXA 1O1TA 3FFLA 2EILE 4KZ0A 4CGVA 3LY8A 2VGYA 3APCA 5LP0A 1N11A 3HXFA 1E8XA
chains in the Genus database with same CATH topology
1TYQG 1U2VG 4JD2G 3DXMG 3RSEG 2P9SG 2P9PG 2P9UG 2P9KG 3ULEG 1K8KG 2P9IG 4XEIG 2P9NG 3DXKG 3UKRG 3DWLG 2P9LG 3UKUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYQ G;  1U2V G;  4JD2 G;  3DXM G;  3RSE G;  2P9S G;  2P9P G;  2P9U G;  2P9K G;  3ULE G;  1K8K G;  2P9I G;  4XEI G;  2P9N G;  3DXK G;  3UKR G;  3DWL G;  2P9L G;  3UKU G; 
#chains in the Genus database with same CATH topology
 3IHY A;  3MA5 A;  3ZIM A;  1H6P A;  1AP7 A;  2ETB A;  3UT8 A;  1UW4 B;  2J07 A;  1K1B A;  3ML8 A;  4QQI A;  2WXH A;  4BET A;  3MKQ A;  1UN8 A;  3MJW A;  3F6Q A;  3FUN A;  4WAF A;  4MRU A;  4UWL A;  5C2Y A;  4XE0 A;  3NB2 A;  3PS6 A;  1D8D A;  4X8Q A;  2ZIR A;  4I6G A;  1ELK A;  1SVX A;  2KCK A;  3QDN A;  3FHE A;  5EID A;  1E8Z A;  4RQI A;  4XKB A;  4JHJ A;  2J49 A;  2RD0 A;  1OWN A;  5FQ6 A;  2AXU A;  4Q96 A;  2HO1 A;  3I4G A;  4UQX A;  1QNF A;  4EEC A;  3PUK A;  1Z6T A;  3CHR A;  5LFA A;  4I6J A;  3CV0 A;  5BW8 C;  3TJP A;  3EHN A;  5CEC B;  3KS2 A;  3Q47 B;  5EYP F;  3FH5 A;  4C48 B;  4HB5 A;  1RZ4 A;  4UI9 K;  2XPI A;  1IXV A;  3URZ A;  3S7B A;  1KZO A;  3PZ4 A;  5AQB A;  3UI2 A;  2YNQ A;  2LUH A;  3QC1 A;  3DSW A;  2FI7 A;  3R9A B;  3Q75 A;  2P58 C;  4GYO A;  3N71 A;  2FO1 E;  3FU0 A;  3TWU A;  3EU9 A;  3PZ1 A;  3LY9 A;  3O4Z A;  2BKK B;  4MLP A;  3HDX A;  1TR4 A;  3Q7F A;  4MS6 A;  3PVL A;  4DPR A;  2A5E A;  1BI8 B;  2DYS E;  1OWL A;  2F37 A;  4FA6 A;  4HI8 A;  4CRW A;  4H7Y A;  5KJL A;  2EIM E;  2WPV A;  3P1U A;  2GW1 A;  1S63 A;  3KSL A;  3ONK A;  4GA0 A;  4N5Q A;  4YDE A;  3CSF A;  4F1P A;  3CVN A;  3APF A;  4GZ5 A;  4BTA A;  2WXI A;  4AVX A;  4LNB A;  5FQ4 A;  4GA1 A;  3U9W A;  1SW6 A;  3LPZ A;  4G2V A;  2WXM A;  4RVB A;  2DCP A;  4CDM A;  1KT1 A;  2Y69 E;  3CHM A;  4I1A A;  1TNO A;  2UWJ G;  2I1J A;  4ACL A;  4OYS A;  3RK6 A;  3CKC A;  1EPU A;  3CK7 A;  3DST A;  4DRX E;  2UY1 A;  2NSZ A;  2KM4 A;  3VTY A;  4U63 A;  5BV0 A;  5J08 A;  4NUR A;  5B3S E;  4U8V D;  3C3R A;  3ZN3 A;  4F7A A;  3NQP A;  1K8K G;  4GU5 A;  4JXT A;  3ONL A;  2RG8 A;  1IYG A;  5T8I A;  2I2O A;  4I1O B;  3TWQ A;  3QOU A;  5EIB E;  2Y0B G;  1WAO 1;  4KT6 B;  4I43 A;  2WXK A;  1HZ4 A;  3D9O A;  4WWN A;  5CRV A;  3SNX A;  4FUL A;  1TN6 A;  1TN8 A;  2BED A;  2ZU6 B;  1LD8 A;  4N3A A;  4WND A;  3ZHE A;  2QC9 A;  4K5A B;  3I5P A;  3QWV A;  3QK0 A;  5JHA A;  3CLJ A;  1JWG A;  2OEV A;  1WM5 A;  3CHO A;  4KXK B;  5KJN A;  2ETC A;  3VLD A;  1Q2Z A;  2CHW A;  2XCC A;  4HLL A;  5ENP D;  3UT4 A;  4PUC A;  3PEV B;  2OOE A;  3EIJ A;  1WDY A;  5ANR A;  5CMW A;  4PDX A;  2ZIS A;  2ILR A;  2XZT G;  2VGX A;  3FWV A;  3D9J A;  1Z5S C;  4LSZ E;  3HXC A;  3HXD A;  5AQA A;  4F6R D;  2J4D A;  4YND A;  4WWP A;  2DYR E;  3D9N A;  1HE8 A;  2WXF A;  4UI9 J;  1LF8 A;  3TWR A;  1HFA A;  4BES A;  3TL5 A;  4J8F A;  1TNU A;  1MZC A;  1FVH A;  3DWL G;  5CCM A;  2WB2 A;  3ZUV B;  2J4B A;  3UIO C;  2IFU A;  3SO8 A;  2X6K A;  1FT1 A;  4GZ3 A;  1TNB A;  2AVP A;  4L2L A;  2DBA A;  4JZY A;  2WMO A;  3BG1 B;  3UKR G;  3ZFW A;  3ZGQ A;  2R02 A;  3LY7 A;  3W9G A;  4FJZ A;  3CGH A;  4G23 A;  2GRP B;  3CVX A;  5AAR A;  3D9M A;  4GCO A;  4U96 D;  2IO3 C;  5AJL A;  2ZGG A;  4H7X A;  5FWQ A;  2WVI A;  4L23 A;  3T5X A;  3FP3 A;  5AEN A;  4EBA G;  1N4R A;  2R5S A;  4Z68 A;  3SFZ A;  2KCL A;  5LCW C;  4CDR A;  3BG0 B;  3NF1 A;  2A5U A;  3MZL B;  4GML A;  1EYH A;  2BKG A;  4FC8 A;  3TGO A;  3UTM A;  3B7R L;  5CED B;  3L08 A;  2ZXW E;  3OXG A;  3RJV A;  4CCA A;  3ENE A;  2Y4T A;  3L82 A;  4DI4 A;  4GMR A;  3NAW A;  5D0Q D;  3SI5 A;  3EDT B;  3SGH A;  1NA0 A;  1H0A A;  3CVQ A;  3X2Q E;  5EKQ D;  1NL4 A;  4JA7 A;  3P2B A;  2Y4U A;  2P2C P;  1YMP A;  4U07 A;  1OCZ E;  2HYZ A;  2JAB A;  2DZN A;  2YQ8 A;  2R59 A;  3UM1 A;  1V55 E;  3ASD A;  5BT1 A;  5D2M C;  5AIJ A;  4HRM B;  3B7U X;  3FU6 A;  2FBN A;  4K0R A;  3LJN A;  5FQ7 A;  3RRU A;  4OAU C;  5BV1 A;  2OND A;  3VLE A;  4J8S A;  5CEA A;  2VSO E;  3LDZ A;  5A7D B;  2E2E A;  2KZT A;  1W3B A;  4BY6 A;  2IF4 A;  3UM2 A;  5AYW D;  4HS2 A;  1U3D A;  3I4R B;  1HX8 A;  3ZYM A;  1E7V A;  4HLE A;  3AS5 A;  1ZB1 A;  2KAT A;  3HVE B;  1KLX A;  3RU0 A;  4AP2 A;  4B0Z A;  4UQZ A;  1H2U A;  5EX0 A;  1N4Q A;  4ANX A;  2XEE A;  4KVM A;  4P29 A;  3UQ3 A;  3FUH A;  5E76 A;  2R2L A;  2MHK A;  3ASN E;  3CVV A;  1NP7 A;  2XGM A;  5JJT A;  3FUL A;  4WNE A;  1BI7 B;  2X6J A;  3CQC B;  3RRM B;  3ZU7 B;  4GYW A;  2J09 A;  3UIN C;  3MKR A;  5D0O D;  2XRZ A;  3C98 A;  4HOU A;  5LOZ A;  4DX5 D;  3ZKJ A;  2IU1 A;  3FH8 A;  3DSX A;  4DLQ A;  3UKU G;  3QNK A;  5KJM A;  3O48 A;  3ZXP A;  1JPL A;  2X6I A;  1HS6 A;  3DXM G;  1TN7 A;  4K03 A;  3EHR A;  2M63 A;  2NC9 A;  3QAR A;  4G11 A;  4FHK A;  1K1A A;  4TRQ A;  3B7S A;  4UWH A;  3RO2 A;  3PZD A;  1INZ A;  3E4B A;  2WXN A;  3NBN B;  4I6E A;  4GYY A;  2GGF A;  3LYA A;  2FO7 A;  4TXR A;  3D9L A;  3G2T A;  3V31 A;  2V8S E;  1N4S A;  4GTM A;  3LKU A;  5D66 A;  2I6H A;  3FH7 A;  2P9K G;  4I9E A;  2KCV A;  4OVU A;  3R7R A;  2PQN A;  2L6J A;  1H19 A;  2F8Y A;  4YVO A;  5ENS D;  5BXO A;  3CK8 A;  4L2Y A;  4UWF A;  1OCC E;  3JCK C;  4JA9 A;  4JEH A;  5G04 J;  3KD7 A;  4GB9 A;  1JCS A;  5ENT D;  1BD8 A;  4FHJ A;  4N5C A;  1E8Y A;  4N2S A;  4N3C A;  5KCM A;  4F3V A;  2NYJ A;  4V3I A;  3PH0 C;  2IO2 C;  3EJN A;  4A1G A;  5ARF A;  2WXL A;  1FPP A;  2VSN A;  1HXI A;  3LVR E;  2J9Q A;  1AWC B;  1QZ2 A;  3MX3 A;  5CMY A;  1OY3 D;  4ZHB A;  1S70 B;  1FT2 A;  3PUJ A;  2XS8 A;  4GAA A;  4JL0 A;  5FTP A;  1HH8 A;  3MKQ B;  5JJ6 A;  1WY6 A;  3QB2 A;  5ENO D;  4CT0 A;  5AN8 A;  2OCC E;  1DCQ A;  1E96 B;  3U64 A;  4KZC A;  4BTB A;  2ION A;  4DJA A;  3IKO B;  3TG5 A;  3L54 A;  3GZ2 A;  3U3W A;  2J08 A;  2XEH A;  5CBN A;  4A3T A;  2XPY A;  1SA4 A;  2LAI A;  1MJ0 A;  3ISM C;  4GZD A;  4NRH B;  2GRO B;  1U2V G;  2GRR B;  3AU5 A;  4C0E A;  3SY2 A;  4U7E B;  5BUZ A;  4LUN U;  1A17 A;  3TG4 A;  2OVF A;  4BWR A;  3AG1 E;  4J8Y A;  3S7D A;  3GZ1 A;  4PS8 A;  5AQ7 A;  4GZC A;  3VLF A;  4C9B B;  3SZ7 A;  5A23 A;  3G2V A;  5KNH D;  2EIJ E;  4GMJ A;  1JWF A;  3CQG B;  3L9T A;  4PS7 A;  2CG3 A;  3ESK A;  4JHR A;  3B7T A;  3FUJ A;  4JB8 P;  3Q5M A;  1UOH A;  4Y6C A;  4O1P A;  4BER A;  3KEZ A;  4XEI G;  1E8W A;  2EIK E;  2MRI A;  4BSZ B;  4YDO A;  4HOR A;  3B7B A;  5B1B E;  5DIZ A;  3Q9N C;  1B89 A;  4CGW A;  3NOC D;  3L13 A;  2LO6 A;  4QFV A;  5A6C A;  3SFX A;  2VTB A;  5B1A E;  4ACK A;  4N3B A;  1K3Z D;  4CZ2 D;  1JCQ A;  1HO8 A;  3PZ3 A;  4TV3 A;  3CHS A;  2PM6 A;  3EIQ C;  4U04 A;  4UWK A;  1DVP A;  3AG4 E;  2WXO A;  4GTT A;  4AIF A;  3ML9 A;  5EYL A;  5KJK A;  3FTZ A;  4B8A A;  2LSU A;  3RKV A;  2WQ6 A;  4IUL A;  4Q69 A;  2VJ8 A;  3IEG A;  4WNF A;  2RFA A;  1BU9 A;  1MYO A;  2PL2 A;  4J8E A;  3FU5 A;  4EZJ A;  5AJD A;  4Q94 A;  4FAD A;  3D9K A;  2R03 A;  2YIN A;  2GRN B;  5M72 A;  3FUK A;  2LXL A;  4FU3 A;  3PDN A;  4GZ6 A;  3CVL A;  3PRZ A;  2P9L G;  4UI9 C;  4AOF A;  1H6O A;  3SQV A;  3FTY A;  2CFU A;  2UY1 B;  3CK9 A;  4KYO B;  4DX7 D;  2P9I G;  2XZD G;  2AXV A;  1SA5 A;  1Z3X A;  2WXG A;  2V5F A;  3RIB A;  4N39 A;  4RLY A;  4MKT A;  4GTR A;  3ULY A;  3ZYK A;  2HR2 A;  3VTX A;  4U0Z A;  3ASG A;  2YHC A;  3I3N A;  4N2Q A;  3WG7 E;  1U3C A;  4AJW A;  1QYM A;  4ATG A;  3DEO A;  3V79 K;  4G26 A;  4LNG A;  4JVS A;  2I9C A;  1A5E A;  3APD A;  1P5Q A;  4MBG A;  5HI7 A;  3CST A;  2P9U G;  3T8M A;  4CEM A;  2RKK A;  3TXM A;  3OTN A;  3SD5 A;  5G05 J;  2C0L A;  3ZNG A;  1QQE A;  4M3O A;  3ABL E;  2XEN A;  2EQX A;  3ZHE B;  2HM8 A;  2X3M A;  2DWZ A;  4KVO A;  2VQ2 A;  5E75 A;  4EHM A;  4A1S A;  4TUU A;  4I9C A;  3JXI A;  3ASO E;  3C3Q A;  3G2W A;  2PM7 A;  4XI0 A;  4G25 A;  1SZ9 A;  4ANV A;  1JCR A;  1OCO E;  4L7T A;  1O1R A;  3FUD A;  3UT7 A;  4URK A;  1DNP A;  1IKN D;  4NAC A;  3HXE A;  3OAW A;  5EIL A;  1N9A A;  2V0P A;  2IY0 C;  4E85 A;  1UJJ A;  4YDY A;  5HRY A;  2VGX B;  3FTU A;  3JYS A;  3NOG D;  1E7U A;  5CRU A;  1TJC A;  4U95 D;  4GPK A;  3AS8 A;  4AY6 A;  3SFY A;  3RO3 A;  1NA3 A;  3TAX A;  4Y6W A;  2BF0 X;  3UX4 A;  1OWP A;  4APO A;  4HBD A;  1TNZ A;  2WXJ A;  4GPM A;  1N54 A;  2XGS A;  3KAE A;  3SHF A;  1YCS B;  4A55 A;  4JHK A;  1MX2 A;  2FEZ A;  4OAV B;  2XPZ A;  3FTX A;  2WMN A;  4HOS A;  2H6G A;  3EU5 A;  4B94 A;  3MEK A;  1UJK A;  4I2Z A;  1H2V C;  3NZS A;  3B95 A;  2Q7F A;  4O6F A;  1WG0 A;  3K9I A;  2BUG A;  3EHQ A;  3KEA A;  3FUF A;  1BLX B;  3CKB A;  3ZPJ A;  3JUI A;  5FT9 A;  1N0R A;  3OXF A;  3FUM A;  3LEW A;  4C0M A;  4BT9 A;  4DX2 A;  2IOS A;  1N0Q A;  3HYM B;  1IQU A;  4TXQ A;  4NIK A;  3C3O A;  4OVV A;  4JPS A;  3MV2 B;  3C72 A;  3DRA A;  4FLH A;  3CEQ A;  1N95 A;  2WXQ A;  2OVB A;  3AS4 A;  2QY7 A;  2QYU A;  1SQM A;  4J7W A;  5FJY A;  5CHE E;  4XIF A;  4B8C B;  3RRN B;  1MX4 A;  1SZA A;  1IHB A;  3Q9U C;  2H6I A;  3ESL A;  5JMN D;  4D10 C;  1HG5 A;  2L0I A;  3HIZ A;  4ABN A;  3EHM A;  3C5R A;  4HOT A;  1PY1 A;  3PNT B;  2CG2 A;  1LTX A;  2IEJ A;  3PZ2 A;  1KPS B;  3MCX A;  5ENR D;  3D9H A;  2YHE A;  3JQ0 A;  2WXR A;  1TJF A;  2X6F A;  1OT8 A;  3JXJ A;  4JC8 A;  1KT0 A;  4JW1 A;  3ASF A;  5J90 A;  2DIW A;  4YDW A;  2MYO A;  1OWM A;  2AWI A;  2OV8 A;  5H7P A;  1LD7 A;  2KZT B;  2VYI A;  3G2U A;  5EX3 A;  4G1T A;  1HU3 A;  5G04 C;  5BPP A;  3DXK G;  5FQ8 A;  4M7C A;  5JA4 D;  3IBE A;  5FZS A;  2LAH A;  1ZBP A;  2PZI A;  3T9K A;  4HOQ A;  2XEV A;  4KMO A;  4EQF A;  1S64 A;  3FTW A;  4GCN A;  3CHP A;  4RG6 A;  4XZ4 A;  4J6I A;  3TXN A;  2V4H C;  1RW2 A;  3GYZ A;  3LS8 A;  3Q78 A;  2J8S D;  1N52 A;  3KSQ A;  3FY4 A;  4U8Y D;  4HFG A;  3J5Q B;  3FEY A;  1PAQ A;  3MGB A;  5EN5 D;  4GTV A;  4HVB A;  5FZQ A;  3Q49 B;  2PQR A;  3ULE G;  2BTD A;  2DZO A;  5KNG A;  5FIN A;  1D8E A;  3OXL A;  2V4L A;  4ZFH A;  1O5M A;  3MV3 B;  3SBS A;  3BUA A;  1MHQ A;  4G8L A;  4NQ0 A;  4JEU A;  3HHM A;  1KZP A;  2XQ0 A;  4HI9 A;  5ENN A;  5G55 A;  3EUV A;  4FJY A;  4WWO A;  5IY5 E;  1MX6 A;  4EBA A;  3GW4 A;  1YYH A;  1HG2 A;  1VDY A;  1Z3Y A;  1EF1 C;  1FVF A;  3TWV A;  5HKP A;  3E37 A;  2JLB A;  1OWO A;  3MYV A;  4DX1 A;  1X81 A;  4EZL A;  4DI3 A;  4A63 B;  4IRU A;  4HXI A;  3E32 A;  4DK5 A;  2QZA A;  3WXX A;  4HNA D;  3AU4 A;  3PE4 A;  4XX5 A;  2GRQ B;  2F0Y A;  4CDN A;  4HRL A;  3DBS A;  1Y8M A;  2R17 C;  4AEZ C;  2A4Z A;  4DLO A;  3TWX A;  4LNU D;  1L5J A;  3D3M A;  2WQH A;  4KBQ A;  2B6C A;  3GZS A;  2WQ7 A;  4UQY A;  3ZYL A;  4F1S A;  3LCA A;  3CIA A;  4PH4 B;  4A3V A;  3E30 A;  3V2O A;  4CYM D;  5CER B;  4HRN A;  5HS0 A;  4B93 B;  3Q7A A;  2QYJ A;  1OXJ A;  3CR3 A;  3IV0 A;  3DSU A;  4LEU A;  4J0U A;  3FEX A;  1QBQ A;  1IQR A;  2P9N G;  1OUV A;  1UN9 A;  2KC7 A;  1UG3 A;  3UUX A;  2IJG X;  1Y6I A;  3L17 A;  4LG6 A;  3ABM E;  3AG3 E;  3CVU A;  2F8X K;  5G2N A;  3FUI A;  4G8K A;  4EPZ A;  4FP7 A;  2AJA A;  2KXP C;  1H2T C;  2KBX A;  3LJ3 A;  4BEP A;  3DSV A;  3T5V A;  5BNW A;  3QKY A;  1V54 E;  2PNN A;  4CT4 A;  1N4P A;  4AXH A;  4AM9 A;  3IHV A;  3DSS A;  2C2L A;  3ZYQ A;  5BXU A;  3LVQ E;  2NXP A;  2XCB A;  4K5B A;  4E6H A;  1XNF A;  3ULQ A;  2V5Q C;  4U0U A;  2CHZ A;  3TWS A;  4BX8 A;  1S0P A;  3UPV A;  2L0T B;  2WXP A;  4HQD A;  5EDS A;  2I1K A;  1DCE A;  3BU8 A;  1N94 A;  3J5P A;  1TNY A;  3PNL B;  3FUE A;  1PC2 A;  2LNI A;  4XKC A;  5C1D A;  1OCR E;  3CHQ A;  2VSX E;  3L16 A;  3DEP A;  3QWW A;  3V30 A;  3CVP A;  1NZN A;  2C0M A;  3FU3 A;  2L6B A;  3TWT A;  4ILI A;  3RSE G;  5ANL A;  1JUQ A;  2R05 A;  3CVW A;  3QAQ A;  4AV7 A;  3JUE A;  1G3N B;  3BQO A;  5AAO A;  2GRM A;  5KBA A;  1HF8 A;  4BFR A;  4JD2 G;  4G24 A;  3D9P A;  2VTB B;  1FCH A;  3HXB A;  4ME2 A;  2OEW A;  1GW6 A;  5G05 C;  4BT8 A;  3T8K A;  1BPO A;  3DPD A;  5ARG A;  3D9I A;  3PE3 A;  3CVY A;  3UMV A;  3HG0 D;  3SBT B;  3U66 A;  3JQ1 A;  2WM9 A;  5HQ8 A;  2HE0 A;  2JEK A;  2FF4 A;  2IQC A;  3FDH A;  4XI9 A;  5ENQ D;  1YA0 A;  3AAA C;  5ITZ F;  3UM3 A;  3S7F A;  2X6H A;  4I2W A;  2RFM A;  2X38 A;  2P9S G;  2XGO A;  4BSX A;  3AG2 E;  3B13 A;  1DC2 A;  5DBK A;  5AQ9 A;  3L22 A;  1H6K A;  4I17 A;  4EZK A;  5JHB A;  1IHG A;  4FLB A;  3UXG A;  2QFC A;  3Q15 A;  3W9F A;  3ZRH A;  3NZU A;  2P9P G;  2H6F A;  3ZEF A;  4GTO A;  1NI1 A;  4L9P A;  1O1S A;  4LRZ A;  4YVQ C;  2H6H A;  4ANW A;  3E34 A;  3HVE A;  3FTV A;  2AXZ A;  3Q4A B;  2XHE A;  4L1B A;  1XGW A;  2ETA A;  3AJI A;  3IXE A;  3R9M A;  3PEU B;  4PS3 A;  3R7Q A;  4RG9 A;  4GTP A;  4APF A;  4R7L A;  4W9R A;  2Y1L E;  4K5C A;  5T3R A;  4IYP A;  3ZXS A;  3RAU A;  4TXP A;  4LER A;  4AY5 A;  3BEE A;  2EIN E;  4UUC A;  4WNG A;  4U0S A;  3E33 A;  4GTQ A;  4ANU A;  2Y3A A;  5LCW J;  1TEZ A;  3S2A A;  4TUM A;  2DVW A;  5T4Y A;  1TYQ G;  3V2X A;  4O60 A;  3SF4 A;  4WUY A;  3G2S A;  4RSY A;  5CBO A;  2VGE A;  3DPY A;  3ABK E;  1ZU2 A;  2ZGD A;  3UIP C;  2XS1 A;  2LSV A;  4ILG A;  3FTS A;  1D9S A;  3ASH A;  4UWG A;  1MQS A;  3QJZ A;  4B89 A;  4I1M A;  4ATZ D;  2FUL A;  2IOL A;  4O1O A;  4IN3 B;  4F53 A;  5LX8 A;  4ILH B;  2LXM A;  3L6A A;  3TWW A;  2MOW A;  3LXU X;  5JJ7 A;  3Q79 A;  3ZW3 A;  3U4T A;  5KWD A;  1X5B A;  4GA2 A;  1ELW A;  1EDU A;  4U8H A;  3S7J A;  4DX6 D;  4GTS A;  3HRA A;  4J8D A;  4LCT A;  3QWP A;  2CFZ A;  4DUI A;  2VSY A;  3ZVV A;  3PRE A;  1NFI E;  3UM0 A;  1E90 A;  2XRY A;  2L9B A;  2GRL A;  5FZR A;  2B0O E;  5CCL A;  2E0I A;  2AW6 A;  3Q73 A;  4BX9 A;  5FIO A;  1ELR A;  2CHX A;  1O1T A;  3FFL A;  2EIL E;  4KZ0 A;  4CGV A;  3LY8 A;  2VGY A;  3APC A;  5LP0 A;  1N11 A;  3HXF A;  1E8X A; 
#chains in the Genus database with same CATH homology
 1TYQ G;  1U2V G;  4JD2 G;  3DXM G;  3RSE G;  2P9S G;  2P9P G;  2P9U G;  2P9K G;  3ULE G;  1K8K G;  2P9I G;  4XEI G;  2P9N G;  3DXK G;  3UKR G;  3DWL G;  2P9L G;  3UKU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...