3UKRG

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
136
Chain Sequence
ARFRKVDVGEYDENKFVDEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
molecule tags Structural protein
total genus 43
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3ukrG00
2P9LG 3DXMG 2P9PG 1K8KG 3UKUG 3UKRG 1TYQG 4JD2G 3DXKG 4XEIG 3DWLG 3ULEG 2P9SG 1U2VG 2P9NG 2P9KG 3RSEG 2P9UG 2P9IG
chains in the Genus database with same CATH superfamily
5LCWC 3BG1B 3CK8A 3Q78A 4CGVA 4A3VA 1KZOA 1BLXB 3TWRA 4DLOA 4JHJA 4GYOA 1KLXA 1OY3D 1QYMA 3S7BA 4U0ZA 4UI9K 4K03A 3JQ0A 1E8WA 5AJDA 5EN5D 5CERB 1QQEA 3L9TA 1S70B 3JCKC 3QDNA 2YHCA 2DCPA 3ML9A 2V5QC 5EYLA 5A23A 3U4TA 2CG2A 2J09A 4AP2A 3V79K 3VLFA 3RKVA 4P29A 4LG6A 2QY7A 3ZYMA 5LFAA 5CCMA 3PVLA 2WXPA 5AQ9A 5HS0A 2V0PA 1OUVA 3JQ1A 5G55A 2JEKA 4TXRA 1L5JA 4GB9A 5AARA 4B89A 4AV7A 3FULA 3D3MA 3G2SA 3MEKA 4FC8A 1SA5A 1TN7A 3LXUX 3SBTB 3TG4A 2C0MA 5ARGA 4RLYA 2WQHA 5CHEE 3LY7A 4GCOA 4GTOA 3FU3A 1OXJA 4TXQA 2WQ7A 3VLEA 3CSFA 2XS1A 5DBKA 2KM4A 5JHBA 3AU5A 3LEWA 1EDUA 2I1KA 3Q15A 4ILHB 3ZNGA 3ZUVB 4RG9A 4M7CA 4JA7A 2V5FA 3R7QA 4H7XA 1IKND 3ZYKA 4UUCA 5LCWJ 2AXUA 1RW2A 3T8MA 4U0UA 3ZHEB 1TJCA 3B7RL 2KCKA 3ABLE 1LF8A 3TXNA 4J8YA 4DX7D 3GYZA 4CDNA 4HI9A 5KNGA 5M72A 3AJIA 1DCEA 4BESA 4N5CA 3MCXA 3HYMB 3PDNA 2B6CA 5ANRA 5KJNA 4UI9C 4KYOB 4UWFA 4J8FA 3LJNA 1XGWA 3UT8A 3NB2A 3JUEA 3RRNB 3E33A 1FVHA 3PE4A 3SO8A 2I2OA 4KBQA 4N2QA 4E85A 4K5AB 2UWJG 5T3RA 4I9CA 1JUQA 2UY1B 3PS6A 5CMYA 4EZJA 2VGXA 2FF4A 1H2UA 3DEPA 4GMLA 1OWOA 1N4PA 2HO1A 1TNOA 4UWLA 4YVQC 3RK6A 4AEZC 4HRMB 3UIPC 2MYOA 2J9QA 2XHEA 4CDRA 5ENTD 4G26A 1WY6A 2KC7A 2DYRE 3RIBA 3FU6A 3ZXPA 4A3TA 1RZ4A 3I3NA 3CK7A 3CVLA 4DJAA 1X81A 2V4HC 2CHWA 3IKOB 3DSUA 4U96D 5FQ4A 1KZPA 1K1BA 2VTBA 2Q7FA 1Z6TA 3FFLA 4YDEA 1OCCE 3D9LA 2YINA 1MX4A 3E30A 3W9GA 5JJ7A 2IJGX 4YNDA 3JXIA 4ILIA 4EBAG 1HX8A 1QZ2A 3IEGA 4QFVA 4HB5A 2RFAA 4GTTA 2I1JA 3Q73A 3U66A 5LP0A 5B3SE 4Y6WA 4U8YD 4HI8A 4BERA 3UQ3A 4DK5A 5KCMA 5EX3A 3ULEG 2ZGGA 3MYVA 3CHOA 4ME2A 4EQFA 4F3VA 2GRQB 3VTXA 3FUNA 4UI9J 3EHMA 3ASHA 3Q9NC 5ENPD 2R05A 3QOUA 3HG0D 1ZU2A 2WVIA 4ATGA 4OVVA 4LRZA 4F1SA 3QWWA 1HXIA 4I6EA 1HF8A 4NURA 1MX2A 3J5PA 3MKQB 4I6JA 4EBAA 3O48A 1DC2A 4WNGA 4HOTA 3UIOC 3HVEA 4MRUA 4ANXA 2PZIA 1HS6A 3TAXA 1A5EA 4EPZA 1OWNA 1HG2A 2DZNA 4G1TA 2WPVA 3EHRA 3E32A 4ILGA 5AQ7A 3O4ZA 4WWNA 4B8CB 2BKGA 3G2WA 2IOSA 2CFZA 2Y4UA 3UMVA 3CHMA 2A5EA 3TGOA 2OOEA 3NF1A 4LNGA 3UKUG 3S2AA 3FH5A 1U3DA 2IO3C 3LYAA 4G8LA 1X5BA 4F53A 2PQNA 3B7TA 5AN8A 4N3AA 3B13A 5C2YA 4XI9A 5FJYA 3LY8A 4LERA 3PZDA 2WXGA 1IQUA 1N54A 1QBQA 2L6BA 5EX0A 3D9IA 1UOHA 3T9KA 3DRAA 5B1BE 3FTZA 4K5CA 2P9IG 1HO8A 2OVFA 5AYWD 3PNTB 3PZ3A 2EILE 4LNBA 3CSTA 3GZ2A 4L9PA 4BX8A 4FULA 3BU8A 2ZU6B 2WXRA 3EUVA 3ZRHA 4BFRA 1KT0A 4JPSA 4R7LA 2R02A 3Q5MA 3CKCA 1INZA 4KMOA 4HNAD 2QYJA 3MA5A 4ZFHA 1ELKA 3B7SA 5ENQD 1Z5SC 4LEUA 3P1UA 2FBNA 4AY5A 3EIQC 3EIJA 3OTNA 3CVUA 3KEZA 1PY1A 5AQAA 4WNEA 2PM6A 3AS4A 4EZLA 2X6JA 2HE0A 3L22A 4I9EA 3CKBA 4O6FA 4GYWA 2YQ8A 5CEDB 3S7JA 3PUJA 1O1TA 4F6RD 4ATZD 1D8EA 1S63A 3DBSA 3BG0B 4OAUC 3IBEA 4PH4B 1S0PA 4C9BB 1G3NB 5BV0A 4JL0A 4KZ0A 2WXQA 2VGXB 4GZDA 4A1GA 3IHVA 3DSXA 1H0AA 4H7YA 3OAWA 4Q94A 2V4LA 4ANUA 4BEPA 4GA2A 1ELWA 4ANVA 4JHKA 2KZTA 4B94A 4J7WA 3FUKA 3DEOA 1JPLA 4HOUA 2EIME 3SFXA 2EIJE 4CGWA 3CHQA 4GPMA 4L2LA 2KXPC 2XRYA 1WM5A 4FLHA 3FHEA 3NOCD 1JCQA 3E37A 5A6CA 3PZ1A 4J6IA 5KNHD 5FQ7A 5LOZA 5AQBA 1ELRA 4XE0A 2NXPA 3ULYA 2VTBB 5A7DB 4GMRA 3I4GA 3VLDA 3TWWA 1EYHA 1TNBA 1OT8A 2GRMA 1Z3YA 2GRRB 4JC8A 3MX3A 4I1MA 3DSWA 4ACLA 2R59A 1TNYA 3E34A 3GZSA 1OCRE 3D9MA 4GTRA 4DUIA 5G05C 3V2XA 3I5PA 1SA4A 2IONA 2XRZA 3RRUA 4B93B 2GROB 5T4YA 5D0QD 3UPVA 2Y0BG 3CK9A 4IYPA 4G23A 3SFZA 3SF4A 3TWQA 2XCBA 4HFGA 4K0RA 4TXPA 4DX1A 4GZ6A 1W3BA 4GYYA 4OVUA 1OCOE 1KPSB 1VDYA 3ENEA 1O1RA 4OAVB 4U8HA 2E2EA 2X38A 4XZ4A 4XI0A 2J4BA 5G04C 1N9AA 2IU1A 3PZ4A 2X6FA 4EECA 1NP7A 2OVBA 4W9RA 3RO3A 3MKRA 3RU0A 3GZ1A 3PEUB 4NIKA 3ASNE 3FTSA 4KT6B 2X6HA 3UX4A 3CHRA 3LS8A 2LNIA 1N95A 1U2VG 2HR2A 3HDXA 3HVEB 2LXLA 3UM0A 3NQPA 3AG2E 1FT1A 4A1SA 2YHEA 3R9MA 1E7VA 3WG7E 3B7UX 1JCRA 4XX5A 4XKBA 3FUJA 3C3QA 5FINA 2WXLA 2PL2A 4UQXA 4GTQA 2DWZA 4J0UA 2R03A 3CVXA 3ZW3A 3OXFA 1E96B 5E75A 3APDA 2VSYA 3JYSA 3QAQA 2GW1A 4U7EB 4BT8A 4BY6A 1UN9A 3C3OA 3TXMA 3ABKE 4E6HA 3FTYA 4CCAA 3SQVA 3L16A 5KJLA 1Z3XA 2AVPA 4C0MA 5AIJA 3FP3A 3PRZA 3KD7A 3HXDA 3AG1E 2B0OE 4JHRA 1YYHA 2DIWA 4FHKA 4APFA 2HM8A 2AW6A 4L1BA 5FQ8A 3TWTA 5EIDA 5G05J 1SW6A 3EDTB 1HFAA 1HH8A 2NYJA 3T5VA 2HYZA 4CDMA 4G25A 2WQ6A 1Y6IA 3HXBA 3MV2B 5HI7A 1NA3A 3OXGA 5FIOA 3D9NA 2F0YA 3L13A 4HRNA 3ZN3A 2XEEA 3V31A 2WXIA 4QQIA 4B0ZA 4XIFA 4FJZA 4ZHBA 4DX5D 2ILRA 3CVPA 1E8XA 4JZYA 4D10C 3UINC 3LVQE 3CGHA 4ANWA 3JUIA 2LAHA 3FTWA 3RRMB 2J08A 3MJWA 5G04J 3L54A 3PH0C 4FP7A 2P9LG 2VJ8A 4JXTA 1OWMA 2RKKA 2VQ2A 2E0IA 2WXMA 1TN6A 3PNLB 3UI2A 2GGFA 2XGOA 3L82A 5HQ8A 1BD8A 3D9HA 3PUKA 2H6GA 3PE3A 4GAAA 4DI4A 2MOWA 2AJAA 3QWVA 4WNFA 2VSXE 4N3CA 2VSNA 1K1AA 4GPKA 1TR4A 4GA0A 3KS2A 2J8SD 1SQMA 2ETCA 4O60A 4IULA 2R2LA 3LKUA 5BXOA 1A17A 3U64A 4HS2A 3ZEFA 2FEZA 3EU9A 3UM3A 1TNUA 4N5QA 4Y6CA 4I17A 2F37A 1D9SA 4GU5A 2J07A 3MZLB 4TUMA 3ASGA 4GTMA 1FVFA 3C72A 4HQDA 4O1PA 3FU5A 4UWGA 3CVYA 1MYOA 5T8IA 3SFYA 4BETA 5KBAA 2BF0X 3ZFWA 1O5MA 1H2TC 2NSZA 2OEWA 3W9FA 1JWGA 4OYSA 3FUEA 5FZSA 2CG3A 2P58C 4DI3A 4GMJA 2LAIA 2KZTB 5FZQA 3UXGA 3EJNA 2L6JA 4M3OA 5IY5E 5BUZA 2IEJA 3CEQA 5DIZA 3QC1A 4U07A 3ESKA 1N4SA 1NZNA 3ZKJA 1U3CA 1OCZE 3LJ3A 4PS7A 1FCHA 4LCTA 1E7UA 1HG5A 4A55A 2XEVA 1IXVA 3KSQA 2ETBA 2BUGA 5BPPA 2MHKA 4I2WA 2P2CP 2F8YA 3HXFA 2X6IA 4BSZB 4GTVA 2XQ0A 3J5QB 1ZB1A 3ASDA 1PAQA 3K9IA 5BNWA 5CMWA 4GTSA 5BV1A 1MX6A 4G8KA 2ZISA 3IHYA 3QK0A 4LSZE 4U95D 2XPZA 3ABME 5E76A 2EQXA 3D9PA 5JA4D 3IV0A 1H6OA 4IN3B 4DRXE 2PM7A 5CRUA 2QZAA 5AJLA 5BXUA 1LD7A 2ZGDA 4JVSA 3B7BA 2VGEA 2RG8A 4GZ5A 5CBOA 3L6AA 3UT4A 4AIFA 3FTVA 3SBSA 5D0OD 4N39A 3D9JA 2ZXWE 1LTXA 4HOSA 1B89A 1HE8A 5ANLA 5CEAA 3HXCA 2P9SG 3NAWA 4MBGA 4YDYA 3TJPA 3TWXA 4UQZA 3FUDA 1N94A 2NC9A 3CIAA 4JW1A 4MKTA 3I4RB 1DNPA 3CQCB 1K8KG 2VYIA 4JA9A 3S7DA 4N2SA 1FT2A 5FTPA 2DYSE 2IF4A 3NBNB 3KSLA 2CHXA 2Y3AA 4F7AA 4G2VA 1UG3A 4JEUA 3FUMA 1AWCB 4HXIA 4F1PA 5ENSD 3MGBA 3TL5A 1IHBA 3FH7A 1GW6A 3RAUA 5ARFA 4APOA 4DPRA 3SGHA 5EILA 5ITZF 1DCQA 1IHGA 3FH8A 4FU3A 3Q79A 2JLBA 2KCLA 3UTMA 3QARA 2WMNA 1EPUA 2A4ZA 4NQ0A 4CZ2D 5J08A 2FI7A 1N52A 3DPDA 3ONLA 4MLPA 3ASFA 3G2VA 3DWLG 5D66A 1PC2A 4AM9A 3CVNA 4PS8A 3KAEA 2AXVA 4Z68A 4Q96A 3NZSA 2BEDA 2X6KA 2RFMA 5ENRD 4HOQA 4TV3A 5J90A 3T5XA 3FDHA 1BPOA 1H6KA 1MJ0A 3HRAA 2ONDA 1N0RA 3ZU7B 4PUCA 3WXXA 4HRLA 1N0QA 5EYPF 2CFUA 3GW4A 1E8YA 2C2LA 2Y69E 3Q4AB 2J4DA 5KWDA 4JEHA 4MS6A 4BSXA 2H6IA 2LXMA 5JJTA 3T8KA 4WWOA 3FEYA 3D9OA 1V54E 4IRUA 4WUYA 1V55E 4I2ZA 5EIBE 1P5QA 3HHMA 3FY4A 2GRPB 4DX6D 3BQOA 4GTPA 2MRIA 2OEVA 5FT9A 2DBAA 1NA0A 3QNKA 1SZ9A 3RO2A 1KT1A 1SVXA 2KATA 4FHJA 4GA1A 3TG5A 3G2TA 2GRNB 4PS3A 3UM1A 3VTYA 2P9NG 4RVBA 3SZ7A 1HZ4A 5AENA 3BEEA 2IOLA 4WAFA 5JMND 4CRWA 4BTAA 4G11A 5JHAA 3CVVA 3G2UA 3UKRG 4FADA 1TNZA 3DXKG 4CEMA 1WG0A 2XENA 2XGMA 4HLEA 2LO6A 2KBXA 4C48B 1HU3A 4YDWA 4V3IA 4KVOA 2J49A 2WXHA 4U0SA 5EDSA 2IQCA 3LVRE 5CRVA 3SD5A 1OWLA 5ENOD 4FA6A 3AU4A 2P9PG 4YVOA 1BI7B 3APCA 5HKPA 3DSTA 4RSYA 3PEVB 3TWUA 4URKA 4Q69A 3LPZA 4HLLA 3E4BA 2P9KG 3LDZA 3F6QA 4ABNA 1E8ZA 3C98A 2Y1LE 2FO1E 1UN8A 2A5UA 4FLBA 4I43A 3NZUA 2L0TB 1E90A 5BW8C 1H2VC 5FWQA 2IO2C 3CV0A 4J8DA 5FZRA 3L17A 3APFA 1YCSB 2BKKB 4UWKA 4YDOA 3TWSA 1UJJA 2PNNA 2H6FA 2PQRA 2XCCA 1LD8A 3ZIMA 1EF1C 4BTBA 4BT9A 2WM9A 1N4QA 4KXKB 1NFIE 3AG4E 5KJKA 4I1AA 1DVPA 3PREA 3DXMG 4JB8P 4PDXA 2LSUA 2WXKA 4XEIG 3DPYA 4O1OA 3Q47B 1S64A 2QFCA 3ZYQA 3KEAA 2KCVA 3NOGD 5C1DA 2M63A 3Q75A 4FJYA 3SY2A 2WXFA 1Q2ZA 1BU9A 2EINE 1O1SA 2XPYA 4BWRA 3SI5A 2JABA 2L0IA 2C0LA 1XNFA 3BUAA 2ETAA 1MQSA 3Q9UC 4NRHB 5AAOA 2P9UG 2H6HA 4X8QA 3P2BA 3DSVA 1K3ZD 3EU5A 2LSVA 3FTXA 4RG6A 4HVBA 4UWHA 1ZBPA 5CBNA 3AAAC 3AG3E 4AJWA 4L7TA 4J8EA 3CR3A 5ENNA 5CECB 3EHNA 3X2QE 3U3WA 3ULQA 1TEZA 1BI8B 2FULA 4L23A 3CVWA 3OXLA 2OCCE 3CHSA 3UT7A 4AVXA 3Q49B 5KJMA 4KVMA 2XZTG 4CYMD 3LY9A 4N3BA 5JJ6A 4HORA 3ISMC 2Y4TA 4TUUA 4NACA 4G24A 4CT0A 2I6HA 1NI1A 3HIZA 3ONKA 4EHMA 4AY6A 4GZ3A 3ZHEA 4GCNA 3QWPA 2XPIA 1WDYA 2RD0A 4I6GA 3N71A 3CQGB 4XKCA 4J8SA 2EIKE 1IQRA 1D8DA 3JXJA 3SNXA 3SHFA 3UM2A 1N4RA 2I9CA 2WXOA 2XGSA 2XZDG 2R17C 3LCAA 1NL4A 3FEXA 2VGYA 1WAO1 3TWVA 3D9KA 2IFUA 4DX2A 2WXNA 5CCLA 4C0EA 3ZPJA 3Q7FA 3QJZA 2AXZA 3CHPA 3R9AB 3ZXSA 3C5RA 3UUXA 3R7RA 3AS5A 3B95A 2ZIRA 4WNDA 3DSSA 2UY1A 3C3RA 1MZCA 4GZCA 2BTDA 3CVQA 3Q7AA 2QC9A 3L08A 2AWIA 1AP7A 2YNQA 2F8XK 3FU0A 2V8SE 3FWVA 4A63B 4B8AA 3ZGQA 4TRQA 1JCSA 2WXJA 5B1AE 1H19A 2LUHA 3RJVA 5H7PA 2FO7A 5FQ6A 1H6PA 3RSEG 3URZA 4K5BA 2X3MA 4KZCA 4L2YA 1YA0A 3FUHA 4BX9A 4LNUD 2R5SA 3S7FA 3V30A 3ASOE 2VSOE 3AS8A 5G2NA 3QKYA 1JWFA 4RQIA 2QYUA 5HRYA 2XS8A 3PZ2A 3ML8A 3HXEA 1UJKA 3ZVVA 2OV8A 1QNFA 4I1OB 5EKQD 1OWPA 3EHQA 1TYQG 5D2MC 4UQYA 4DLQA 2IY0C 2CHZA 4U04A 3IXEA 3V2OA 4AOFA 3MV3B 3U9WA 1N11A 2L9BA 4WWPA 3FUFA 1YMPA 1FPPA 3ESLA 4AXHA 1TJFA 3FTUA 1Y8MA 4U63A 2DZOA 2XEHA 4CT4A 4ACKA 1MHQA 3CLJA 4EZKA 5LX8A 4JD2G 3ZYLA 2GRLA 5BT1A 4U8VD 3FUIA 2DVWA 2WB2A 1TN8A 1SZAA 1UW4B 3QB2A 3MKQA 4HBDA 2WMOA 4LUNU 1IYGA
chains in the Genus database with same CATH topology
2P9LG 3DXMG 2P9PG 1K8KG 3UKUG 3UKRG 1TYQG 4JD2G 3DXKG 4XEIG 3DWLG 3ULEG 2P9SG 1U2VG 2P9NG 2P9KG 3RSEG 2P9UG 2P9IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9L G;  3DXM G;  2P9P G;  1K8K G;  3UKU G;  3UKR G;  1TYQ G;  4JD2 G;  3DXK G;  4XEI G;  3DWL G;  3ULE G;  2P9S G;  1U2V G;  2P9N G;  2P9K G;  3RSE G;  2P9U G;  2P9I G; 
#chains in the Genus database with same CATH topology
 5LCW C;  3BG1 B;  3CK8 A;  3Q78 A;  4CGV A;  4A3V A;  1KZO A;  1BLX B;  3TWR A;  4DLO A;  4JHJ A;  4GYO A;  1KLX A;  1OY3 D;  1QYM A;  3S7B A;  4U0Z A;  4UI9 K;  4K03 A;  3JQ0 A;  1E8W A;  5AJD A;  5EN5 D;  5CER B;  1QQE A;  3L9T A;  1S70 B;  3JCK C;  3QDN A;  2YHC A;  2DCP A;  3ML9 A;  2V5Q C;  5EYL A;  5A23 A;  3U4T A;  2CG2 A;  2J09 A;  4AP2 A;  3V79 K;  3VLF A;  3RKV A;  4P29 A;  4LG6 A;  2QY7 A;  3ZYM A;  5LFA A;  5CCM A;  3PVL A;  2WXP A;  5AQ9 A;  5HS0 A;  2V0P A;  1OUV A;  3JQ1 A;  5G55 A;  2JEK A;  4TXR A;  1L5J A;  4GB9 A;  5AAR A;  4B89 A;  4AV7 A;  3FUL A;  3D3M A;  3G2S A;  3MEK A;  4FC8 A;  1SA5 A;  1TN7 A;  3LXU X;  3SBT B;  3TG4 A;  2C0M A;  5ARG A;  4RLY A;  2WQH A;  5CHE E;  3LY7 A;  4GCO A;  4GTO A;  3FU3 A;  1OXJ A;  4TXQ A;  2WQ7 A;  3VLE A;  3CSF A;  2XS1 A;  5DBK A;  2KM4 A;  5JHB A;  3AU5 A;  3LEW A;  1EDU A;  2I1K A;  3Q15 A;  4ILH B;  3ZNG A;  3ZUV B;  4RG9 A;  4M7C A;  4JA7 A;  2V5F A;  3R7Q A;  4H7X A;  1IKN D;  3ZYK A;  4UUC A;  5LCW J;  2AXU A;  1RW2 A;  3T8M A;  4U0U A;  3ZHE B;  1TJC A;  3B7R L;  2KCK A;  3ABL E;  1LF8 A;  3TXN A;  4J8Y A;  4DX7 D;  3GYZ A;  4CDN A;  4HI9 A;  5KNG A;  5M72 A;  3AJI A;  1DCE A;  4BES A;  4N5C A;  3MCX A;  3HYM B;  3PDN A;  2B6C A;  5ANR A;  5KJN A;  4UI9 C;  4KYO B;  4UWF A;  4J8F A;  3LJN A;  1XGW A;  3UT8 A;  3NB2 A;  3JUE A;  3RRN B;  3E33 A;  1FVH A;  3PE4 A;  3SO8 A;  2I2O A;  4KBQ A;  4N2Q A;  4E85 A;  4K5A B;  2UWJ G;  5T3R A;  4I9C A;  1JUQ A;  2UY1 B;  3PS6 A;  5CMY A;  4EZJ A;  2VGX A;  2FF4 A;  1H2U A;  3DEP A;  4GML A;  1OWO A;  1N4P A;  2HO1 A;  1TNO A;  4UWL A;  4YVQ C;  3RK6 A;  4AEZ C;  4HRM B;  3UIP C;  2MYO A;  2J9Q A;  2XHE A;  4CDR A;  5ENT D;  4G26 A;  1WY6 A;  2KC7 A;  2DYR E;  3RIB A;  3FU6 A;  3ZXP A;  4A3T A;  1RZ4 A;  3I3N A;  3CK7 A;  3CVL A;  4DJA A;  1X81 A;  2V4H C;  2CHW A;  3IKO B;  3DSU A;  4U96 D;  5FQ4 A;  1KZP A;  1K1B A;  2VTB A;  2Q7F A;  1Z6T A;  3FFL A;  4YDE A;  1OCC E;  3D9L A;  2YIN A;  1MX4 A;  3E30 A;  3W9G A;  5JJ7 A;  2IJG X;  4YND A;  3JXI A;  4ILI A;  4EBA G;  1HX8 A;  1QZ2 A;  3IEG A;  4QFV A;  4HB5 A;  2RFA A;  4GTT A;  2I1J A;  3Q73 A;  3U66 A;  5LP0 A;  5B3S E;  4Y6W A;  4U8Y D;  4HI8 A;  4BER A;  3UQ3 A;  4DK5 A;  5KCM A;  5EX3 A;  3ULE G;  2ZGG A;  3MYV A;  3CHO A;  4ME2 A;  4EQF A;  4F3V A;  2GRQ B;  3VTX A;  3FUN A;  4UI9 J;  3EHM A;  3ASH A;  3Q9N C;  5ENP D;  2R05 A;  3QOU A;  3HG0 D;  1ZU2 A;  2WVI A;  4ATG A;  4OVV A;  4LRZ A;  4F1S A;  3QWW A;  1HXI A;  4I6E A;  1HF8 A;  4NUR A;  1MX2 A;  3J5P A;  3MKQ B;  4I6J A;  4EBA A;  3O48 A;  1DC2 A;  4WNG A;  4HOT A;  3UIO C;  3HVE A;  4MRU A;  4ANX A;  2PZI A;  1HS6 A;  3TAX A;  1A5E A;  4EPZ A;  1OWN A;  1HG2 A;  2DZN A;  4G1T A;  2WPV A;  3EHR A;  3E32 A;  4ILG A;  5AQ7 A;  3O4Z A;  4WWN A;  4B8C B;  2BKG A;  3G2W A;  2IOS A;  2CFZ A;  2Y4U A;  3UMV A;  3CHM A;  2A5E A;  3TGO A;  2OOE A;  3NF1 A;  4LNG A;  3UKU G;  3S2A A;  3FH5 A;  1U3D A;  2IO3 C;  3LYA A;  4G8L A;  1X5B A;  4F53 A;  2PQN A;  3B7T A;  5AN8 A;  4N3A A;  3B13 A;  5C2Y A;  4XI9 A;  5FJY A;  3LY8 A;  4LER A;  3PZD A;  2WXG A;  1IQU A;  1N54 A;  1QBQ A;  2L6B A;  5EX0 A;  3D9I A;  1UOH A;  3T9K A;  3DRA A;  5B1B E;  3FTZ A;  4K5C A;  2P9I G;  1HO8 A;  2OVF A;  5AYW D;  3PNT B;  3PZ3 A;  2EIL E;  4LNB A;  3CST A;  3GZ2 A;  4L9P A;  4BX8 A;  4FUL A;  3BU8 A;  2ZU6 B;  2WXR A;  3EUV A;  3ZRH A;  4BFR A;  1KT0 A;  4JPS A;  4R7L A;  2R02 A;  3Q5M A;  3CKC A;  1INZ A;  4KMO A;  4HNA D;  2QYJ A;  3MA5 A;  4ZFH A;  1ELK A;  3B7S A;  5ENQ D;  1Z5S C;  4LEU A;  3P1U A;  2FBN A;  4AY5 A;  3EIQ C;  3EIJ A;  3OTN A;  3CVU A;  3KEZ A;  1PY1 A;  5AQA A;  4WNE A;  2PM6 A;  3AS4 A;  4EZL A;  2X6J A;  2HE0 A;  3L22 A;  4I9E A;  3CKB A;  4O6F A;  4GYW A;  2YQ8 A;  5CED B;  3S7J A;  3PUJ A;  1O1T A;  4F6R D;  4ATZ D;  1D8E A;  1S63 A;  3DBS A;  3BG0 B;  4OAU C;  3IBE A;  4PH4 B;  1S0P A;  4C9B B;  1G3N B;  5BV0 A;  4JL0 A;  4KZ0 A;  2WXQ A;  2VGX B;  4GZD A;  4A1G A;  3IHV A;  3DSX A;  1H0A A;  4H7Y A;  3OAW A;  4Q94 A;  2V4L A;  4ANU A;  4BEP A;  4GA2 A;  1ELW A;  4ANV A;  4JHK A;  2KZT A;  4B94 A;  4J7W A;  3FUK A;  3DEO A;  1JPL A;  4HOU A;  2EIM E;  3SFX A;  2EIJ E;  4CGW A;  3CHQ A;  4GPM A;  4L2L A;  2KXP C;  2XRY A;  1WM5 A;  4FLH A;  3FHE A;  3NOC D;  1JCQ A;  3E37 A;  5A6C A;  3PZ1 A;  4J6I A;  5KNH D;  5FQ7 A;  5LOZ A;  5AQB A;  1ELR A;  4XE0 A;  2NXP A;  3ULY A;  2VTB B;  5A7D B;  4GMR A;  3I4G A;  3VLD A;  3TWW A;  1EYH A;  1TNB A;  1OT8 A;  2GRM A;  1Z3Y A;  2GRR B;  4JC8 A;  3MX3 A;  4I1M A;  3DSW A;  4ACL A;  2R59 A;  1TNY A;  3E34 A;  3GZS A;  1OCR E;  3D9M A;  4GTR A;  4DUI A;  5G05 C;  3V2X A;  3I5P A;  1SA4 A;  2ION A;  2XRZ A;  3RRU A;  4B93 B;  2GRO B;  5T4Y A;  5D0Q D;  3UPV A;  2Y0B G;  3CK9 A;  4IYP A;  4G23 A;  3SFZ A;  3SF4 A;  3TWQ A;  2XCB A;  4HFG A;  4K0R A;  4TXP A;  4DX1 A;  4GZ6 A;  1W3B A;  4GYY A;  4OVU A;  1OCO E;  1KPS B;  1VDY A;  3ENE A;  1O1R A;  4OAV B;  4U8H A;  2E2E A;  2X38 A;  4XZ4 A;  4XI0 A;  2J4B A;  5G04 C;  1N9A A;  2IU1 A;  3PZ4 A;  2X6F A;  4EEC A;  1NP7 A;  2OVB A;  4W9R A;  3RO3 A;  3MKR A;  3RU0 A;  3GZ1 A;  3PEU B;  4NIK A;  3ASN E;  3FTS A;  4KT6 B;  2X6H A;  3UX4 A;  3CHR A;  3LS8 A;  2LNI A;  1N95 A;  1U2V G;  2HR2 A;  3HDX A;  3HVE B;  2LXL A;  3UM0 A;  3NQP A;  3AG2 E;  1FT1 A;  4A1S A;  2YHE A;  3R9M A;  1E7V A;  3WG7 E;  3B7U X;  1JCR A;  4XX5 A;  4XKB A;  3FUJ A;  3C3Q A;  5FIN A;  2WXL A;  2PL2 A;  4UQX A;  4GTQ A;  2DWZ A;  4J0U A;  2R03 A;  3CVX A;  3ZW3 A;  3OXF A;  1E96 B;  5E75 A;  3APD A;  2VSY A;  3JYS A;  3QAQ A;  2GW1 A;  4U7E B;  4BT8 A;  4BY6 A;  1UN9 A;  3C3O A;  3TXM A;  3ABK E;  4E6H A;  3FTY A;  4CCA A;  3SQV A;  3L16 A;  5KJL A;  1Z3X A;  2AVP A;  4C0M A;  5AIJ A;  3FP3 A;  3PRZ A;  3KD7 A;  3HXD A;  3AG1 E;  2B0O E;  4JHR A;  1YYH A;  2DIW A;  4FHK A;  4APF A;  2HM8 A;  2AW6 A;  4L1B A;  5FQ8 A;  3TWT A;  5EID A;  5G05 J;  1SW6 A;  3EDT B;  1HFA A;  1HH8 A;  2NYJ A;  3T5V A;  2HYZ A;  4CDM A;  4G25 A;  2WQ6 A;  1Y6I A;  3HXB A;  3MV2 B;  5HI7 A;  1NA3 A;  3OXG A;  5FIO A;  3D9N A;  2F0Y A;  3L13 A;  4HRN A;  3ZN3 A;  2XEE A;  3V31 A;  2WXI A;  4QQI A;  4B0Z A;  4XIF A;  4FJZ A;  4ZHB A;  4DX5 D;  2ILR A;  3CVP A;  1E8X A;  4JZY A;  4D10 C;  3UIN C;  3LVQ E;  3CGH A;  4ANW A;  3JUI A;  2LAH A;  3FTW A;  3RRM B;  2J08 A;  3MJW A;  5G04 J;  3L54 A;  3PH0 C;  4FP7 A;  2P9L G;  2VJ8 A;  4JXT A;  1OWM A;  2RKK A;  2VQ2 A;  2E0I A;  2WXM A;  1TN6 A;  3PNL B;  3UI2 A;  2GGF A;  2XGO A;  3L82 A;  5HQ8 A;  1BD8 A;  3D9H A;  3PUK A;  2H6G A;  3PE3 A;  4GAA A;  4DI4 A;  2MOW A;  2AJA A;  3QWV A;  4WNF A;  2VSX E;  4N3C A;  2VSN A;  1K1A A;  4GPK A;  1TR4 A;  4GA0 A;  3KS2 A;  2J8S D;  1SQM A;  2ETC A;  4O60 A;  4IUL A;  2R2L A;  3LKU A;  5BXO A;  1A17 A;  3U64 A;  4HS2 A;  3ZEF A;  2FEZ A;  3EU9 A;  3UM3 A;  1TNU A;  4N5Q A;  4Y6C A;  4I17 A;  2F37 A;  1D9S A;  4GU5 A;  2J07 A;  3MZL B;  4TUM A;  3ASG A;  4GTM A;  1FVF A;  3C72 A;  4HQD A;  4O1P A;  3FU5 A;  4UWG A;  3CVY A;  1MYO A;  5T8I A;  3SFY A;  4BET A;  5KBA A;  2BF0 X;  3ZFW A;  1O5M A;  1H2T C;  2NSZ A;  2OEW A;  3W9F A;  1JWG A;  4OYS A;  3FUE A;  5FZS A;  2CG3 A;  2P58 C;  4DI3 A;  4GMJ A;  2LAI A;  2KZT B;  5FZQ A;  3UXG A;  3EJN A;  2L6J A;  4M3O A;  5IY5 E;  5BUZ A;  2IEJ A;  3CEQ A;  5DIZ A;  3QC1 A;  4U07 A;  3ESK A;  1N4S A;  1NZN A;  3ZKJ A;  1U3C A;  1OCZ E;  3LJ3 A;  4PS7 A;  1FCH A;  4LCT A;  1E7U A;  1HG5 A;  4A55 A;  2XEV A;  1IXV A;  3KSQ A;  2ETB A;  2BUG A;  5BPP A;  2MHK A;  4I2W A;  2P2C P;  2F8Y A;  3HXF A;  2X6I A;  4BSZ B;  4GTV A;  2XQ0 A;  3J5Q B;  1ZB1 A;  3ASD A;  1PAQ A;  3K9I A;  5BNW A;  5CMW A;  4GTS A;  5BV1 A;  1MX6 A;  4G8K A;  2ZIS A;  3IHY A;  3QK0 A;  4LSZ E;  4U95 D;  2XPZ A;  3ABM E;  5E76 A;  2EQX A;  3D9P A;  5JA4 D;  3IV0 A;  1H6O A;  4IN3 B;  4DRX E;  2PM7 A;  5CRU A;  2QZA A;  5AJL A;  5BXU A;  1LD7 A;  2ZGD A;  4JVS A;  3B7B A;  2VGE A;  2RG8 A;  4GZ5 A;  5CBO A;  3L6A A;  3UT4 A;  4AIF A;  3FTV A;  3SBS A;  5D0O D;  4N39 A;  3D9J A;  2ZXW E;  1LTX A;  4HOS A;  1B89 A;  1HE8 A;  5ANL A;  5CEA A;  3HXC A;  2P9S G;  3NAW A;  4MBG A;  4YDY A;  3TJP A;  3TWX A;  4UQZ A;  3FUD A;  1N94 A;  2NC9 A;  3CIA A;  4JW1 A;  4MKT A;  3I4R B;  1DNP A;  3CQC B;  1K8K G;  2VYI A;  4JA9 A;  3S7D A;  4N2S A;  1FT2 A;  5FTP A;  2DYS E;  2IF4 A;  3NBN B;  3KSL A;  2CHX A;  2Y3A A;  4F7A A;  4G2V A;  1UG3 A;  4JEU A;  3FUM A;  1AWC B;  4HXI A;  4F1P A;  5ENS D;  3MGB A;  3TL5 A;  1IHB A;  3FH7 A;  1GW6 A;  3RAU A;  5ARF A;  4APO A;  4DPR A;  3SGH A;  5EIL A;  5ITZ F;  1DCQ A;  1IHG A;  3FH8 A;  4FU3 A;  3Q79 A;  2JLB A;  2KCL A;  3UTM A;  3QAR A;  2WMN A;  1EPU A;  2A4Z A;  4NQ0 A;  4CZ2 D;  5J08 A;  2FI7 A;  1N52 A;  3DPD A;  3ONL A;  4MLP A;  3ASF A;  3G2V A;  3DWL G;  5D66 A;  1PC2 A;  4AM9 A;  3CVN A;  4PS8 A;  3KAE A;  2AXV A;  4Z68 A;  4Q96 A;  3NZS A;  2BED A;  2X6K A;  2RFM A;  5ENR D;  4HOQ A;  4TV3 A;  5J90 A;  3T5X A;  3FDH A;  1BPO A;  1H6K A;  1MJ0 A;  3HRA A;  2OND A;  1N0R A;  3ZU7 B;  4PUC A;  3WXX A;  4HRL A;  1N0Q A;  5EYP F;  2CFU A;  3GW4 A;  1E8Y A;  2C2L A;  2Y69 E;  3Q4A B;  2J4D A;  5KWD A;  4JEH A;  4MS6 A;  4BSX A;  2H6I A;  2LXM A;  5JJT A;  3T8K A;  4WWO A;  3FEY A;  3D9O A;  1V54 E;  4IRU A;  4WUY A;  1V55 E;  4I2Z A;  5EIB E;  1P5Q A;  3HHM A;  3FY4 A;  2GRP B;  4DX6 D;  3BQO A;  4GTP A;  2MRI A;  2OEV A;  5FT9 A;  2DBA A;  1NA0 A;  3QNK A;  1SZ9 A;  3RO2 A;  1KT1 A;  1SVX A;  2KAT A;  4FHJ A;  4GA1 A;  3TG5 A;  3G2T A;  2GRN B;  4PS3 A;  3UM1 A;  3VTY A;  2P9N G;  4RVB A;  3SZ7 A;  1HZ4 A;  5AEN A;  3BEE A;  2IOL A;  4WAF A;  5JMN D;  4CRW A;  4BTA A;  4G11 A;  5JHA A;  3CVV A;  3G2U A;  3UKR G;  4FAD A;  1TNZ A;  3DXK G;  4CEM A;  1WG0 A;  2XEN A;  2XGM A;  4HLE A;  2LO6 A;  2KBX A;  4C48 B;  1HU3 A;  4YDW A;  4V3I A;  4KVO A;  2J49 A;  2WXH A;  4U0S A;  5EDS A;  2IQC A;  3LVR E;  5CRV A;  3SD5 A;  1OWL A;  5ENO D;  4FA6 A;  3AU4 A;  2P9P G;  4YVO A;  1BI7 B;  3APC A;  5HKP A;  3DST A;  4RSY A;  3PEV B;  3TWU A;  4URK A;  4Q69 A;  3LPZ A;  4HLL A;  3E4B A;  2P9K G;  3LDZ A;  3F6Q A;  4ABN A;  1E8Z A;  3C98 A;  2Y1L E;  2FO1 E;  1UN8 A;  2A5U A;  4FLB A;  4I43 A;  3NZU A;  2L0T B;  1E90 A;  5BW8 C;  1H2V C;  5FWQ A;  2IO2 C;  3CV0 A;  4J8D A;  5FZR A;  3L17 A;  3APF A;  1YCS B;  2BKK B;  4UWK A;  4YDO A;  3TWS A;  1UJJ A;  2PNN A;  2H6F A;  2PQR A;  2XCC A;  1LD8 A;  3ZIM A;  1EF1 C;  4BTB A;  4BT9 A;  2WM9 A;  1N4Q A;  4KXK B;  1NFI E;  3AG4 E;  5KJK A;  4I1A A;  1DVP A;  3PRE A;  3DXM G;  4JB8 P;  4PDX A;  2LSU A;  2WXK A;  4XEI G;  3DPY A;  4O1O A;  3Q47 B;  1S64 A;  2QFC A;  3ZYQ A;  3KEA A;  2KCV A;  3NOG D;  5C1D A;  2M63 A;  3Q75 A;  4FJY A;  3SY2 A;  2WXF A;  1Q2Z A;  1BU9 A;  2EIN E;  1O1S A;  2XPY A;  4BWR A;  3SI5 A;  2JAB A;  2L0I A;  2C0L A;  1XNF A;  3BUA A;  2ETA A;  1MQS A;  3Q9U C;  4NRH B;  5AAO A;  2P9U G;  2H6H A;  4X8Q A;  3P2B A;  3DSV A;  1K3Z D;  3EU5 A;  2LSV A;  3FTX A;  4RG6 A;  4HVB A;  4UWH A;  1ZBP A;  5CBN A;  3AAA C;  3AG3 E;  4AJW A;  4L7T A;  4J8E A;  3CR3 A;  5ENN A;  5CEC B;  3EHN A;  3X2Q E;  3U3W A;  3ULQ A;  1TEZ A;  1BI8 B;  2FUL A;  4L23 A;  3CVW A;  3OXL A;  2OCC E;  3CHS A;  3UT7 A;  4AVX A;  3Q49 B;  5KJM A;  4KVM A;  2XZT G;  4CYM D;  3LY9 A;  4N3B A;  5JJ6 A;  4HOR A;  3ISM C;  2Y4T A;  4TUU A;  4NAC A;  4G24 A;  4CT0 A;  2I6H A;  1NI1 A;  3HIZ A;  3ONK A;  4EHM A;  4AY6 A;  4GZ3 A;  3ZHE A;  4GCN A;  3QWP A;  2XPI A;  1WDY A;  2RD0 A;  4I6G A;  3N71 A;  3CQG B;  4XKC A;  4J8S A;  2EIK E;  1IQR A;  1D8D A;  3JXJ A;  3SNX A;  3SHF A;  3UM2 A;  1N4R A;  2I9C A;  2WXO A;  2XGS A;  2XZD G;  2R17 C;  3LCA A;  1NL4 A;  3FEX A;  2VGY A;  1WAO 1;  3TWV A;  3D9K A;  2IFU A;  4DX2 A;  2WXN A;  5CCL A;  4C0E A;  3ZPJ A;  3Q7F A;  3QJZ A;  2AXZ A;  3CHP A;  3R9A B;  3ZXS A;  3C5R A;  3UUX A;  3R7R A;  3AS5 A;  3B95 A;  2ZIR A;  4WND A;  3DSS A;  2UY1 A;  3C3R A;  1MZC A;  4GZC A;  2BTD A;  3CVQ A;  3Q7A A;  2QC9 A;  3L08 A;  2AWI A;  1AP7 A;  2YNQ A;  2F8X K;  3FU0 A;  2V8S E;  3FWV A;  4A63 B;  4B8A A;  3ZGQ A;  4TRQ A;  1JCS A;  2WXJ A;  5B1A E;  1H19 A;  2LUH A;  3RJV A;  5H7P A;  2FO7 A;  5FQ6 A;  1H6P A;  3RSE G;  3URZ A;  4K5B A;  2X3M A;  4KZC A;  4L2Y A;  1YA0 A;  3FUH A;  4BX9 A;  4LNU D;  2R5S A;  3S7F A;  3V30 A;  3ASO E;  2VSO E;  3AS8 A;  5G2N A;  3QKY A;  1JWF A;  4RQI A;  2QYU A;  5HRY A;  2XS8 A;  3PZ2 A;  3ML8 A;  3HXE A;  1UJK A;  3ZVV A;  2OV8 A;  1QNF A;  4I1O B;  5EKQ D;  1OWP A;  3EHQ A;  1TYQ G;  5D2M C;  4UQY A;  4DLQ A;  2IY0 C;  2CHZ A;  4U04 A;  3IXE A;  3V2O A;  4AOF A;  3MV3 B;  3U9W A;  1N11 A;  2L9B A;  4WWP A;  3FUF A;  1YMP A;  1FPP A;  3ESL A;  4AXH A;  1TJF A;  3FTU A;  1Y8M A;  4U63 A;  2DZO A;  2XEH A;  4CT4 A;  4ACK A;  1MHQ A;  3CLJ A;  4EZK A;  5LX8 A;  4JD2 G;  3ZYL A;  2GRL A;  5BT1 A;  4U8V D;  3FUI A;  2DVW A;  2WB2 A;  1TN8 A;  1SZA A;  1UW4 B;  3QB2 A;  3MKQ A;  4HBD A;  2WMO A;  4LUN U;  1IYG A; 
#chains in the Genus database with same CATH homology
 2P9L G;  3DXM G;  2P9P G;  1K8K G;  3UKU G;  3UKR G;  1TYQ G;  4JD2 G;  3DXK G;  4XEI G;  3DWL G;  3ULE G;  2P9S G;  1U2V G;  2P9N G;  2P9K G;  3RSE G;  2P9U G;  2P9I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...