3UKRG

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
136
Chain Sequence
b'ARFRKVDVGEYDENKFVDEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-related protein 3
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
molecule tags Structural protein
total genus 43
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3ukrG00
3DXKG 2P9KG 4XEIG 1TYQG 3UKUG 2P9UG 1K8KG 2P9NG 2P9PG 3DXMG 3RSEG 1U2VG 4JD2G 3UKRG 3DWLG 3ULEG 2P9SG 2P9IG 2P9LG
chains in the Genus database with same CATH superfamily
3ENEA 1YMPA 4JHJA 3EHNA 3E34A 4A1SA 2AXUA 3UT7A 1X5BA 4LG6A 3LCAA 4GB9A 3DEPA 3APDA 4MKTA 3ASGA 3GYZA 4FHKA 4N5CA 4BX9A 5AJLA 4O1OA 5JJTA 3HDXA 4NIKA 3UTMA 4WNDA 4FHJA 3PREA 4QFVA 5KJKA 4I9EA 1QZ2A 3FUEA 3LY8A 3O4ZA 2UY1B 1S0PA 2F8YA 4ME2A 5E76A 5DBKA 1TR4A 4AEZC 2WXHA 2UY1A 3AS5A 4AM9A 4O1PA 2R59A 4JD2G 3K9IA 4OVUA 2XRZA 3LKUA 1ELRA 3MZLB 3UIOC 1O1SA 1BLXB 2L6JA 4I2ZA 1E7VA 3LXUX 3VTXA 1K3ZD 3ASHA 5KNHD 5T8IA 3S7JA 2IONA 2QC9A 4BSZB 1MHQA 3ONLA 4FLHA 1OT8A 1TNZA 4DX6D 1NFIE 4JEUA 1KT1A 3D9OA 4BTBA 3Q4AB 4JHKA 4J0UA 2GW1A 4FJZA 3NF1A 3FU3A 3UQ3A 2R2LA 3BUAA 3OXGA 1PY1A 3L82A 3NZSA 2KATA 3CEQA 3TWRA 1MZCA 2ILRA 2JEKA 2KC7A 4XI0A 4DJAA 5G05C 4F6RD 3PZ3A 3FUNA 4A3VA 5BT1A 4ABNA 3ABLE 4DX1A 3UM1A 2OV8A 2IJGX 3V31A 4B8AA 4HLEA 2E0IA 2XEHA 4B0ZA 1W3BA 2X3MA 5EN5D 2LSUA 3U64A 3U9WA 3C72A 1LF8A 1KT0A 2Y4TA 1HXIA 2BKKB 2BTDA 3Q15A 1ZU2A 3TXNA 2EIME 2DYSE 3DPDA 3SFXA 1E96B 3ZYMA 4U0ZA 3EHMA 1D9SA 3IHVA 4B94A 3FULA 3APCA 3BQOA 3TWXA 3AU5A 1UJKA 1N4QA 1Q2ZA 4J7WA 3NQPA 1OCCE 1YYHA 2P2CP 5LCWC 4TRQA 1OWPA 4N39A 3RO3A 2ZGGA 3DSUA 4UWLA 2GRMA 1S63A 5G2NA 3AG3E 1DCEA 3JXIA 4G8KA 1G3NB 2A5EA 4HI9A 4FULA 2IF4A 4LNBA 1EF1C 5FQ7A 3EIJA 3O48A 2YHEA 1OCZE 2LSVA 4GYOA 1TNOA 3QK0A 3FUMA 4UI9K 4UWGA 2I1KA 3EHRA 2Y3AA 4TXPA 3B7UX 3NBNB 3ZFWA 5G05J 3JUIA 2FF4A 1WG0A 4LRZA 3DBSA 3AG1E 4YVQC 3QWWA 1N0QA 5FWQA 3FH8A 4JB8P 4ATGA 4APOA 4C9BB 4K03A 1P5QA 2IO2C 5BPPA 4UWKA 3D9HA 2I2OA 3B7BA 1N9AA 1WAO1 2J49A 2QZAA 1K1AA 3HXBA 1H6OA 4JW1A 3ZPJA 3D9NA 2LAIA 3DRAA 3D9JA 3D9IA 2YINA 2LXMA 4DLQA 1E8YA 4PUCA 2F8XK 3ZN3A 3CVUA 1K8KG 4LNUD 2XZDG 5EYPF 1Y6IA 4GTTA 1N52A 2BF0X 3ESKA 2KCLA 3LJ3A 2BUGA 2IY0C 3VLFA 5FQ6A 3PZ4A 5LCWJ 3C3QA 2P9LG 3UXGA 1IHBA 4GAAA 1BI8B 4ANUA 2WM9A 2MRIA 2NXPA 2ZGDA 1H2UA 3RK6A 3ZNGA 4D10C 1A5EA 1OWLA 4XI9A 3CVLA 2PQRA 3AJIA 3B7TA 3TAXA 2XPZA 2GRQB 3MKQB 3WG7E 4LERA 4HNAD 2V4HC 1DC2A 2PM6A 3CKCA 1QBQA 4GTPA 2WXJA 5HQ8A 1O5MA 3JYSA 4UI9C 3EDTB 2KZTB 4PS7A 4XEIG 1YA0A 2WMNA 3PEUB 4BX8A 4UQXA 3FH5A 3U66A 2QYJA 4CT4A 3R9AB 1IQRA 3IXEA 2OCCE 2KZTA 2P9KG 4BESA 4XIFA 4XE0A 1FPPA 4F3VA 1LD7A 2WVIA 2MYOA 5HKPA 1DNPA 3FUFA 1LTXA 1SA4A 3ZYQA 1Z6TA 3L17A 3QWVA 3CVXA 4I6GA 2DZNA 4GA0A 2LNIA 4CRWA 2KCKA 4Q96A 5AENA 5JJ6A 4K5AB 3KSQA 1N0RA 5ENPD 2P9UG 2C0LA 4BTAA 4GZDA 2WB2A 4PS8A 3TWQA 4CDMA 4IRUA 3HG0D 2XS8A 1FVFA 4U8HA 3S2AA 3NZUA 4CGWA 2WXNA 2PNNA 5FTPA 5BW8C 2C2LA 1Z3YA 4LNGA 4HOQA 3L16A 3FUKA 4BETA 4YDWA 2Y69E 2WXKA 5CHEE 2AW6A 2WQ6A 4PH4B 3ML8A 1QYMA 5ENOD 3CVPA 4N2QA 3AG4E 2KM4A 2VSNA 3SF4A 2A5UA 2Y1LE 4AOFA 4A55A 4OYSA 4I1AA 3ZHEB 5CMWA 2GRPB 3RSEG 4NRHB 3LEWA 4UI9J 3C98A 3W9FA 3E37A 4RSYA 2R02A 4UQZA 3UT4A 1AP7A 1D8EA 3MX3A 3ZHEA 1INZA 4XKBA 4KZ0A 4UQYA 3QKYA 3UKUG 4FA6A 3FFLA 2H6FA 2VJ8A 2X38A 3Q7AA 3RKVA 3DEOA 3QNKA 3CQCB 2J8SD 4I17A 1ELKA 5B1AE 3P2BA 4XKCA 3ZU7B 2HO1A 5FT9A 2XHEA 3ZIMA 5CERB 4DI3A 2CFUA 2PM7A 3FTWA 3MCXA 4CCAA 2WXIA 4J8SA 4YDOA 5ENNA 2GROB 3AG2E 4C0EA 3CVWA 4DX5D 1OWNA 3T9KA 5LOZA 3PH0C 4JL0A 2J07A 4OAUC 5D0OD 3S7FA 3CLJA 4I43A 1D8DA 3Q9NC 4AY6A 3AAAC 3CV0A 1U3CA 4GA2A 4L23A 3T5XA 3CK7A 3EU9A 1V55E 3Q75A 4RQIA 4YDEA 3KEAA 3EUVA 4JZYA 4HRMB 3SBSA 3LPZA 2H6HA 3S7DA 2VGXA 3CVNA 3CHRA 4CT0A 5CBNA 3UINC 2X6JA 3PS6A 3CHPA 4DPRA 1HO8A 4TV3A 4AY5A 3ULYA 4U8VD 5AN8A 5H7PA 5B3SE 4GTSA 1TJFA 5HI7A 3PE4A 3FDHA 5LX8A 4I1MA 2J9QA 3UI2A 1N11A 3PZ1A 3SI5A 3CHMA 4LUNU 4EBAA 3CHQA 1MX6A 2B6CA 4L1BA 3DSWA 3ZXSA 1E8XA 1N54A 2R05A 5A23A 1L5JA 1TN8A 3ZVVA 4GYWA 4H7XA 2HM8A 1B89A 3Q7FA 2NC9A 2EINE 1KZPA 1WDYA 3G2TA 3FU6A 3DPYA 1OY3D 1UN8A 3X2QE 4P29A 5CRVA 1YCSB 1JPLA 3FH7A 1E90A 1MJ0A 1JCRA 3OAWA 3CKBA 2DWZA 3RJVA 4GPKA 3G2SA 2XS1A 4M7CA 3OTNA 4KVOA 3TJPA 4B93B 2NYJA 4ANXA 4EQFA 3PUJA 2ZISA 3HYMB 4HS2A 2L0IA 4M3OA 4ZHBA 2DVWA 5BV1A 3SHFA 5AYWD 3HHMA 3GW4A 3ZW3A 4HB5A 3BU8A 4URKA 4G26A 3ZEFA 3FU0A 5JHAA 5CEDB 4G2VA 4X8QA 3C5RA 4JA9A 2PQNA 2X6HA 2YHCA 2GRLA 2WQ7A 1OWOA 4JPSA 3KAEA 4U63A 4V3IA 2F37A 2J09A 4N3BA 1DVPA 4ACKA 4EECA 1HG2A 4TUMA 5EILA 4L9PA 2IO3C 4GU5A 4JXTA 4GMLA 2RKKA 5LP0A 4U8YD 4TXRA 1E8ZA 5D66A 4FJYA 3FP3A 2ZU6B 5G04J 3HRAA 4WWNA 5CBOA 5AQ7A 3MV2B 3KSLA 5KCMA 4MS6A 3EJNA 2IFUA 3D9MA 3UUXA 5AIJA 2VQ2A 3RRUA 1MX4A 5BV0A 3QJZA 4HFGA 3TXMA 3Q47B 5JJ7A 3MEKA 3LJNA 2CHWA 3L08A 4ACLA 4YDYA 2LUHA 2XEEA 1UJJA 3AS8A 4LSZE 4G8LA 4KXKB 2AXVA 5LFAA 2X6IA 3IV0A 2AJAA 2Y4UA 3QC1A 2WXLA 4GZ6A 1NP7A 3FTXA 3RRNB 1E8WA 4N2SA 1HS6A 4F53A 4IYPA 4C0MA 3TWTA 1H6PA 4WNGA 2LXLA 3NOGD 4DUIA 2KXPC 3SD5A 3MKRA 1FT2A 1H6KA 3KD7A 4RVBA 3QWPA 3VLDA 3TG4A 4JVSA 5CECB 3SZ7A 3OXLA 3UMVA 4CDNA 2L6BA 2C0MA 4HQDA 1RZ4A 1E7UA 3T5VA 3DXMG 2I1JA 2WXQA 3CHOA 4KVMA 2ETAA 5KJNA 5IY5E 2VTBB 3FWVA 3ULEG 4ILHB 2IU1A 1HX8A 2VYIA 2XGOA 4O6FA 4L2YA 2CHXA 5AQAA 4Q94A 2H6GA 5FZRA 3T8KA 1MQSA 1U2VG 3RO2A 5BUZA 3PEVB 2F0YA 3L13A 3SQVA 2BEDA 4U7EB 1EYHA 2ONDA 5BXUA 3MJWA 4AP2A 5ANRA 3ZYKA 2QYUA 3MKQA 5FJYA 1N4SA 3CSFA 2OOEA 4DRXE 4KT6B 1IQUA 4YNDA 2VGYA 1ZBPA 4HXIA 3J5QB 4EHMA 3KEZA 4JA7A 1KLXA 3BG1B 3FTZA 4MRUA 2XZTG 2XCBA 3CGHA 3LS8A 3FUHA 3R7RA 4G25A 5G55A 2WPVA 3QARA 3DSSA 3FTVA 1V54E 5ANLA 1TNUA 2J4DA 1S70B 2QFCA 3PZ2A 4E85A 4N3CA 3SBTB 4RG6A 3R9MA 3E30A 4JEHA 3FEYA 5CCMA 5E75A 1FVHA 3Q5MA 2AWIA 5AARA 5CCLA 4HBDA 4HI8A 3MV3B 3HXEA 2JABA 5KJMA 4J8FA 3FUJA 3V2OA 2OEWA 3ABME 4FC8A 3C3OA 1AWCB 2M63A 1OXJA 4WNFA 5ARGA 2FO1E 4N5QA 1HE8A 1BU9A 3LDZA 3V30A 4IN3B 1IHGA 3V2XA 2ETCA 1OWMA 2VSXE 4FLBA 4ILGA 3B95A 2P9NG 4I1OB 2WMOA 3G2UA 4OAVB 4B8CB 3G2WA 1TEZA 5HRYA 1GW6A 4GTOA 4MBGA 4AVXA 2GRRB 3NOCD 3JQ0A 2PZIA 2VSOE 4C48B 2FULA 1O1TA 1NZNA 1SZAA 1RW2A 1N95A 5ITZF 2XGMA 3CIAA 4N3AA 1SVXA 2J08A 2P9PG 5ARFA 2WXRA 3FTUA 3GZ1A 2Y0BG 4DLOA 4U0SA 4GYYA 1KZOA 2V5FA 5ENSD 4R7LA 3ASFA 2WXGA 3D9KA 4NQ0A 3PDNA 2GGFA 3PRZA 2L0TB 3JQ1A 4K0RA 4EZKA 1OCOE 4BT9A 5EIDA 4WUYA 4K5BA 3TWVA 1WY6A 4HORA 3UX4A 5ENTD 3BEEA 3ZXPA 2IEJA 2V4LA 3IEGA 3SGHA 2HR2A 5BNWA 4KBQA 4RLYA 3PVLA 1FCHA 1JWFA 3PNTB 3TL5A 4B89A 2HE0A 2AXZA 2J4BA 4BERA 1SA5A 1HU3A 3DXKG 1A17A 2MHKA 5HS0A 1LD8A 4U95D 5DIZA 4BSXA 4GA1A 4CDRA 2Q7FA 3HXDA 3HXFA 3CVVA 4HOSA 3TWWA 2P58C 3PZDA 3QOUA 4J6IA 4EBAG 2CG2A 2V5QC 1KPSB 1H2TC 3FY4A 3FTSA 3S7BA 4GTRA 3CK9A 3L22A 1Z3XA 5ENQD 1NA3A 3T8MA 2FI7A 1O1RA 3I3NA 5G04C 1H0AA 3QAQA 2MOWA 3ML9A 3MGBA 5KJLA 3UM0A 2XPIA 4U0UA 4HRNA 3RIBA 2CFZA 4ATZD 2VSYA 1QQEA 2IOSA 1BPOA 4TXQA 3LYAA 4HVBA 1JCSA 3IKOB 2A4ZA 2DIWA 2KCVA 4GZCA 4HOTA 3HIZA 3SFZA 3PNLB 1JCQA 3B13A 3JCKC 3QB2A 4GPMA 2YQ8A 4NACA 5FZSA 4J8YA 4XX5A 1IYGA 3Q79A 4ANWA 3TWUA 4IULA 3CQGB 5C2YA 4F1PA 1TYQG 1JWGA 2DCPA 4EPZA 1UW4B 3E4BA 3I4RB 3ZUVB 4Q69A 3MA5A 1HF8A 2HYZA 3RAUA 4MLPA 4L7TA 3PE3A 3QDNA 3I5PA 3B7RL 4Y6WA 3RRMB 2XEVA 2E2EA 3J5PA 1U3DA 3UIPC 5M72A 4WWPA 2FEZA 4GZ3A 4Z68A 3BG0B 4EZJA 3DSVA 5EYLA 1HZ4A 5JMND 4F7AA 2BKGA 3EU5A 4ZFHA 3E32A 1SZ9A 1UN9A 4A63B 3ISMC 4F1SA 4H7YA 3CHSA 1NL4A 5AJDA 3FHEA 4NURA 2OVBA 1IKND 3I4GA 4G23A 3HXCA 3AU4A 4GTMA 1VDYA 2UWJG 4PDXA 2XPYA 4GCOA 3SY2A 4UWHA 4JHRA 3LVQE 3ULQA 3SO8A 3JXJA 4GTQA 2RD0A 4KMOA 5KWDA 2H6IA 3CVQA 3FEXA 3SFYA 4JC8A 4GCNA 4Y6CA 1JUQA 1N94A 1NI1A 2QY7A 5A7DB 4O60A 4BY6A 2ZXWE 3L54A 3UT8A 4CGVA 1EPUA 2NSZA 1BD8A 3TGOA 2XENA 3L9TA 5CMYA 5C1DA 2LAHA 3W9GA 3B7SA 4CYMD 4U04A 2RG8A 4WNEA 5JA4D 5CEAA 5J90A 3UPVA 2FBNA 3FUIA 3TWSA 3DSXA 4BEPA 1S64A 3P1UA 5J08A 3LY9A 2ZIRA 2P9SG 2P9IG 3RU0A 1ELWA 3D9PA 1QNFA 2WQHA 4G24A 4OVVA 1DCQA 5AQ9A 4A3TA 3Q78A 2WXFA 2CG3A 1H2VC 3AS4A 1X81A 2WXMA 4APFA 4I6JA 4G1TA 1NA0A 4LEUA 2YNQA 2IOLA 3IHYA 5T4YA 5D2MC 2OEVA 3V79K 2R03A 1HFAA 3ZYLA 2VTBA 4HLLA 2LO6A 5CRUA 1EDUA 4K5CA 2VGEA 1XGWA 3OXFA 1FT1A 2I9CA 4UUCA 3GZ2A 3L6AA 1MX2A 1TN6A 3LY7A 4AXHA 1N4RA 5AQBA 3Q9UC 3ONKA 3JUEA 1TNYA 5EX3A 4I6EA 1SQMA 2EIKE 2RFMA 3APFA 3SNXA 4GTVA 3Q73A 3U3WA 1OCRE 2FO7A 3ESLA 2V0PA 4FP7A 5FIOA 5KNGA 1XNFA 5T3RA 4AJWA 5EKQD 4L2LA 4CEMA 4UWFA 4EZLA 4W9RA 3VLEA 3ZRHA 1PAQA 1PC2A 2JLBA 1BI7B 4E6HA 2DZOA 2RFAA 2X6KA 4GZ5A 3LVRE 4TUUA 3NB2A 4AIFA 5FQ8A 5EDSA 3URZA 1WM5A 4KZCA 2XRYA 5JHBA 2DYRE 3FTYA 3ABKE 3NAWA 4KYOB 5D0QD 2L9BA 3ZGQA 3EIQC 5EIBE 3ASDA 2EILE 1SW6A 3GZSA 4FU3A 3IBEA 4FADA 1HG5A 2PL2A 5AAOA 3F6QA 2R17C 2GRNB 3VTYA 3G2VA 3ASOE 4DX7D 4J8EA 3ZKJA 3UM3A 3DSTA 3D9LA 4AV7A 4WWOA 5A6CA 2CHZA 5FZQA 3TG5A 4DK5A 4DI4A 1TNBA 5BXOA 2KBXA 4HOUA 4CZ2D 2XCCA 3FU5A 4BWRA 3C3RA 1Y8MA 3R7QA 1Z5SC 1K1BA 1ZB1A 2R5SA 3CR3A 3CK8A 3MYVA 4WAFA 2I6HA 2WXPA 1MYOA 3N71A 3UKRG 3Q49B 2OVFA 4J8DA 2EQXA 3KS2A 4HRLA 3ASNE 3E33A 4GMJA 3CVYA 3EHQA 4G11A 3D3MA 4I9CA 3HVEB 2ETBA 3U4TA 2XGSA 1HH8A 1OUVA 4ILIA 2B0OE 5ENRD 5EX0A 3HVEA 4I2WA 1UG3A 4BT8A 1TJCA 2EIJE 2AVPA 2DBAA 5FQ4A 3WXXA 1IXVA 4GMRA 3UM2A 5FINA 4LCTA 1H19A 3PUKA 1UOHA 4DX2A 2XQ0A 4XZ4A 1TN7A 3CSTA 2IQCA 4A1GA 4U96D 2V8SE 1N4PA 4QQIA 4BFRA 4U07A 3FUDA 4YVOA 4ANVA 3DWLG 2WXOA 4PS3A 2VGXB 5B1BE 5KBAA 2X6FA 4RG9A
chains in the Genus database with same CATH topology
3DXKG 2P9KG 4XEIG 1TYQG 3UKUG 2P9UG 1K8KG 2P9NG 2P9PG 3DXMG 3RSEG 1U2VG 4JD2G 3UKRG 3DWLG 3ULEG 2P9SG 2P9IG 2P9LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXK G;  2P9K G;  4XEI G;  1TYQ G;  3UKU G;  2P9U G;  1K8K G;  2P9N G;  2P9P G;  3DXM G;  3RSE G;  1U2V G;  4JD2 G;  3UKR G;  3DWL G;  3ULE G;  2P9S G;  2P9I G;  2P9L G; 
#chains in the Genus database with same CATH topology
 3ENE A;  1YMP A;  4JHJ A;  3EHN A;  3E34 A;  4A1S A;  2AXU A;  3UT7 A;  1X5B A;  4LG6 A;  3LCA A;  4GB9 A;  3DEP A;  3APD A;  4MKT A;  3ASG A;  3GYZ A;  4FHK A;  4N5C A;  4BX9 A;  5AJL A;  4O1O A;  5JJT A;  3HDX A;  4NIK A;  3UTM A;  4WND A;  4FHJ A;  3PRE A;  4QFV A;  5KJK A;  4I9E A;  1QZ2 A;  3FUE A;  3LY8 A;  3O4Z A;  2UY1 B;  1S0P A;  2F8Y A;  4ME2 A;  5E76 A;  5DBK A;  1TR4 A;  4AEZ C;  2WXH A;  2UY1 A;  3AS5 A;  4AM9 A;  4O1P A;  2R59 A;  4JD2 G;  3K9I A;  4OVU A;  2XRZ A;  3LKU A;  1ELR A;  3MZL B;  3UIO C;  1O1S A;  1BLX B;  2L6J A;  4I2Z A;  1E7V A;  3LXU X;  3VTX A;  1K3Z D;  3ASH A;  5KNH D;  5T8I A;  3S7J A;  2ION A;  2QC9 A;  4BSZ B;  1MHQ A;  3ONL A;  4FLH A;  1OT8 A;  1TNZ A;  4DX6 D;  1NFI E;  4JEU A;  1KT1 A;  3D9O A;  4BTB A;  3Q4A B;  4JHK A;  4J0U A;  2GW1 A;  4FJZ A;  3NF1 A;  3FU3 A;  3UQ3 A;  2R2L A;  3BUA A;  3OXG A;  1PY1 A;  3L82 A;  3NZS A;  2KAT A;  3CEQ A;  3TWR A;  1MZC A;  2ILR A;  2JEK A;  2KC7 A;  4XI0 A;  4DJA A;  5G05 C;  4F6R D;  3PZ3 A;  3FUN A;  4A3V A;  5BT1 A;  4ABN A;  3ABL E;  4DX1 A;  3UM1 A;  2OV8 A;  2IJG X;  3V31 A;  4B8A A;  4HLE A;  2E0I A;  2XEH A;  4B0Z A;  1W3B A;  2X3M A;  5EN5 D;  2LSU A;  3U64 A;  3U9W A;  3C72 A;  1LF8 A;  1KT0 A;  2Y4T A;  1HXI A;  2BKK B;  2BTD A;  3Q15 A;  1ZU2 A;  3TXN A;  2EIM E;  2DYS E;  3DPD A;  3SFX A;  1E96 B;  3ZYM A;  4U0Z A;  3EHM A;  1D9S A;  3IHV A;  4B94 A;  3FUL A;  3APC A;  3BQO A;  3TWX A;  3AU5 A;  1UJK A;  1N4Q A;  1Q2Z A;  4J7W A;  3NQP A;  1OCC E;  1YYH A;  2P2C P;  5LCW C;  4TRQ A;  1OWP A;  4N39 A;  3RO3 A;  2ZGG A;  3DSU A;  4UWL A;  2GRM A;  1S63 A;  5G2N A;  3AG3 E;  1DCE A;  3JXI A;  4G8K A;  1G3N B;  2A5E A;  4HI9 A;  4FUL A;  2IF4 A;  4LNB A;  1EF1 C;  5FQ7 A;  3EIJ A;  3O48 A;  2YHE A;  1OCZ E;  2LSV A;  4GYO A;  1TNO A;  3QK0 A;  3FUM A;  4UI9 K;  4UWG A;  2I1K A;  3EHR A;  2Y3A A;  4TXP A;  3B7U X;  3NBN B;  3ZFW A;  5G05 J;  3JUI A;  2FF4 A;  1WG0 A;  4LRZ A;  3DBS A;  3AG1 E;  4YVQ C;  3QWW A;  1N0Q A;  5FWQ A;  3FH8 A;  4JB8 P;  4ATG A;  4APO A;  4C9B B;  4K03 A;  1P5Q A;  2IO2 C;  5BPP A;  4UWK A;  3D9H A;  2I2O A;  3B7B A;  1N9A A;  1WAO 1;  2J49 A;  2QZA A;  1K1A A;  3HXB A;  1H6O A;  4JW1 A;  3ZPJ A;  3D9N A;  2LAI A;  3DRA A;  3D9J A;  3D9I A;  2YIN A;  2LXM A;  4DLQ A;  1E8Y A;  4PUC A;  2F8X K;  3ZN3 A;  3CVU A;  1K8K G;  4LNU D;  2XZD G;  5EYP F;  1Y6I A;  4GTT A;  1N52 A;  2BF0 X;  3ESK A;  2KCL A;  3LJ3 A;  2BUG A;  2IY0 C;  3VLF A;  5FQ6 A;  3PZ4 A;  5LCW J;  3C3Q A;  2P9L G;  3UXG A;  1IHB A;  4GAA A;  1BI8 B;  4ANU A;  2WM9 A;  2MRI A;  2NXP A;  2ZGD A;  1H2U A;  3RK6 A;  3ZNG A;  4D10 C;  1A5E A;  1OWL A;  4XI9 A;  3CVL A;  2PQR A;  3AJI A;  3B7T A;  3TAX A;  2XPZ A;  2GRQ B;  3MKQ B;  3WG7 E;  4LER A;  4HNA D;  2V4H C;  1DC2 A;  2PM6 A;  3CKC A;  1QBQ A;  4GTP A;  2WXJ A;  5HQ8 A;  1O5M A;  3JYS A;  4UI9 C;  3EDT B;  2KZT B;  4PS7 A;  4XEI G;  1YA0 A;  2WMN A;  3PEU B;  4BX8 A;  4UQX A;  3FH5 A;  3U66 A;  2QYJ A;  4CT4 A;  3R9A B;  1IQR A;  3IXE A;  2OCC E;  2KZT A;  2P9K G;  4BES A;  4XIF A;  4XE0 A;  1FPP A;  4F3V A;  1LD7 A;  2WVI A;  2MYO A;  5HKP A;  1DNP A;  3FUF A;  1LTX A;  1SA4 A;  3ZYQ A;  1Z6T A;  3L17 A;  3QWV A;  3CVX A;  4I6G A;  2DZN A;  4GA0 A;  2LNI A;  4CRW A;  2KCK A;  4Q96 A;  5AEN A;  5JJ6 A;  4K5A B;  3KSQ A;  1N0R A;  5ENP D;  2P9U G;  2C0L A;  4BTA A;  4GZD A;  2WB2 A;  4PS8 A;  3TWQ A;  4CDM A;  4IRU A;  3HG0 D;  2XS8 A;  1FVF A;  4U8H A;  3S2A A;  3NZU A;  4CGW A;  2WXN A;  2PNN A;  5FTP A;  5BW8 C;  2C2L A;  1Z3Y A;  4LNG A;  4HOQ A;  3L16 A;  3FUK A;  4BET A;  4YDW A;  2Y69 E;  2WXK A;  5CHE E;  2AW6 A;  2WQ6 A;  4PH4 B;  3ML8 A;  1QYM A;  5ENO D;  3CVP A;  4N2Q A;  3AG4 E;  2KM4 A;  2VSN A;  3SF4 A;  2A5U A;  2Y1L E;  4AOF A;  4A55 A;  4OYS A;  4I1A A;  3ZHE B;  5CMW A;  2GRP B;  3RSE G;  4NRH B;  3LEW A;  4UI9 J;  3C98 A;  3W9F A;  3E37 A;  4RSY A;  2R02 A;  4UQZ A;  3UT4 A;  1AP7 A;  1D8E A;  3MX3 A;  3ZHE A;  1INZ A;  4XKB A;  4KZ0 A;  4UQY A;  3QKY A;  3UKU G;  4FA6 A;  3FFL A;  2H6F A;  2VJ8 A;  2X38 A;  3Q7A A;  3RKV A;  3DEO A;  3QNK A;  3CQC B;  2J8S D;  4I17 A;  1ELK A;  5B1A E;  3P2B A;  4XKC A;  3ZU7 B;  2HO1 A;  5FT9 A;  2XHE A;  3ZIM A;  5CER B;  4DI3 A;  2CFU A;  2PM7 A;  3FTW A;  3MCX A;  4CCA A;  2WXI A;  4J8S A;  4YDO A;  5ENN A;  2GRO B;  3AG2 E;  4C0E A;  3CVW A;  4DX5 D;  1OWN A;  3T9K A;  5LOZ A;  3PH0 C;  4JL0 A;  2J07 A;  4OAU C;  5D0O D;  3S7F A;  3CLJ A;  4I43 A;  1D8D A;  3Q9N C;  4AY6 A;  3AAA C;  3CV0 A;  1U3C A;  4GA2 A;  4L23 A;  3T5X A;  3CK7 A;  3EU9 A;  1V55 E;  3Q75 A;  4RQI A;  4YDE A;  3KEA A;  3EUV A;  4JZY A;  4HRM B;  3SBS A;  3LPZ A;  2H6H A;  3S7D A;  2VGX A;  3CVN A;  3CHR A;  4CT0 A;  5CBN A;  3UIN C;  2X6J A;  3PS6 A;  3CHP A;  4DPR A;  1HO8 A;  4TV3 A;  4AY5 A;  3ULY A;  4U8V D;  5AN8 A;  5H7P A;  5B3S E;  4GTS A;  1TJF A;  5HI7 A;  3PE4 A;  3FDH A;  5LX8 A;  4I1M A;  2J9Q A;  3UI2 A;  1N11 A;  3PZ1 A;  3SI5 A;  3CHM A;  4LUN U;  4EBA A;  3CHQ A;  1MX6 A;  2B6C A;  4L1B A;  3DSW A;  3ZXS A;  1E8X A;  1N54 A;  2R05 A;  5A23 A;  1L5J A;  1TN8 A;  3ZVV A;  4GYW A;  4H7X A;  2HM8 A;  1B89 A;  3Q7F A;  2NC9 A;  2EIN E;  1KZP A;  1WDY A;  3G2T A;  3FU6 A;  3DPY A;  1OY3 D;  1UN8 A;  3X2Q E;  4P29 A;  5CRV A;  1YCS B;  1JPL A;  3FH7 A;  1E90 A;  1MJ0 A;  1JCR A;  3OAW A;  3CKB A;  2DWZ A;  3RJV A;  4GPK A;  3G2S A;  2XS1 A;  4M7C A;  3OTN A;  4KVO A;  3TJP A;  4B93 B;  2NYJ A;  4ANX A;  4EQF A;  3PUJ A;  2ZIS A;  3HYM B;  4HS2 A;  2L0I A;  4M3O A;  4ZHB A;  2DVW A;  5BV1 A;  3SHF A;  5AYW D;  3HHM A;  3GW4 A;  3ZW3 A;  4HB5 A;  3BU8 A;  4URK A;  4G26 A;  3ZEF A;  3FU0 A;  5JHA A;  5CED B;  4G2V A;  4X8Q A;  3C5R A;  4JA9 A;  2PQN A;  2X6H A;  2YHC A;  2GRL A;  2WQ7 A;  1OWO A;  4JPS A;  3KAE A;  4U63 A;  4V3I A;  2F37 A;  2J09 A;  4N3B A;  1DVP A;  4ACK A;  4EEC A;  1HG2 A;  4TUM A;  5EIL A;  4L9P A;  2IO3 C;  4GU5 A;  4JXT A;  4GML A;  2RKK A;  5LP0 A;  4U8Y D;  4TXR A;  1E8Z A;  5D66 A;  4FJY A;  3FP3 A;  2ZU6 B;  5G04 J;  3HRA A;  4WWN A;  5CBO A;  5AQ7 A;  3MV2 B;  3KSL A;  5KCM A;  4MS6 A;  3EJN A;  2IFU A;  3D9M A;  3UUX A;  5AIJ A;  2VQ2 A;  3RRU A;  1MX4 A;  5BV0 A;  3QJZ A;  4HFG A;  3TXM A;  3Q47 B;  5JJ7 A;  3MEK A;  3LJN A;  2CHW A;  3L08 A;  4ACL A;  4YDY A;  2LUH A;  2XEE A;  1UJJ A;  3AS8 A;  4LSZ E;  4G8L A;  4KXK B;  2AXV A;  5LFA A;  2X6I A;  3IV0 A;  2AJA A;  2Y4U A;  3QC1 A;  2WXL A;  4GZ6 A;  1NP7 A;  3FTX A;  3RRN B;  1E8W A;  4N2S A;  1HS6 A;  4F53 A;  4IYP A;  4C0M A;  3TWT A;  1H6P A;  4WNG A;  2LXL A;  3NOG D;  4DUI A;  2KXP C;  3SD5 A;  3MKR A;  1FT2 A;  1H6K A;  3KD7 A;  4RVB A;  3QWP A;  3VLD A;  3TG4 A;  4JVS A;  5CEC B;  3SZ7 A;  3OXL A;  3UMV A;  4CDN A;  2L6B A;  2C0M A;  4HQD A;  1RZ4 A;  1E7U A;  3T5V A;  3DXM G;  2I1J A;  2WXQ A;  3CHO A;  4KVM A;  2ETA A;  5KJN A;  5IY5 E;  2VTB B;  3FWV A;  3ULE G;  4ILH B;  2IU1 A;  1HX8 A;  2VYI A;  2XGO A;  4O6F A;  4L2Y A;  2CHX A;  5AQA A;  4Q94 A;  2H6G A;  5FZR A;  3T8K A;  1MQS A;  1U2V G;  3RO2 A;  5BUZ A;  3PEV B;  2F0Y A;  3L13 A;  3SQV A;  2BED A;  4U7E B;  1EYH A;  2OND A;  5BXU A;  3MJW A;  4AP2 A;  5ANR A;  3ZYK A;  2QYU A;  3MKQ A;  5FJY A;  1N4S A;  3CSF A;  2OOE A;  4DRX E;  4KT6 B;  1IQU A;  4YND A;  2VGY A;  1ZBP A;  4HXI A;  3J5Q B;  4EHM A;  3KEZ A;  4JA7 A;  1KLX A;  3BG1 B;  3FTZ A;  4MRU A;  2XZT G;  2XCB A;  3CGH A;  3LS8 A;  3FUH A;  3R7R A;  4G25 A;  5G55 A;  2WPV A;  3QAR A;  3DSS A;  3FTV A;  1V54 E;  5ANL A;  1TNU A;  2J4D A;  1S70 B;  2QFC A;  3PZ2 A;  4E85 A;  4N3C A;  3SBT B;  4RG6 A;  3R9M A;  3E30 A;  4JEH A;  3FEY A;  5CCM A;  5E75 A;  1FVH A;  3Q5M A;  2AWI A;  5AAR A;  5CCL A;  4HBD A;  4HI8 A;  3MV3 B;  3HXE A;  2JAB A;  5KJM A;  4J8F A;  3FUJ A;  3V2O A;  2OEW A;  3ABM E;  4FC8 A;  3C3O A;  1AWC B;  2M63 A;  1OXJ A;  4WNF A;  5ARG A;  2FO1 E;  4N5Q A;  1HE8 A;  1BU9 A;  3LDZ A;  3V30 A;  4IN3 B;  1IHG A;  3V2X A;  2ETC A;  1OWM A;  2VSX E;  4FLB A;  4ILG A;  3B95 A;  2P9N G;  4I1O B;  2WMO A;  3G2U A;  4OAV B;  4B8C B;  3G2W A;  1TEZ A;  5HRY A;  1GW6 A;  4GTO A;  4MBG A;  4AVX A;  2GRR B;  3NOC D;  3JQ0 A;  2PZI A;  2VSO E;  4C48 B;  2FUL A;  1O1T A;  1NZN A;  1SZA A;  1RW2 A;  1N95 A;  5ITZ F;  2XGM A;  3CIA A;  4N3A A;  1SVX A;  2J08 A;  2P9P G;  5ARF A;  2WXR A;  3FTU A;  3GZ1 A;  2Y0B G;  4DLO A;  4U0S A;  4GYY A;  1KZO A;  2V5F A;  5ENS D;  4R7L A;  3ASF A;  2WXG A;  3D9K A;  4NQ0 A;  3PDN A;  2GGF A;  3PRZ A;  2L0T B;  3JQ1 A;  4K0R A;  4EZK A;  1OCO E;  4BT9 A;  5EID A;  4WUY A;  4K5B A;  3TWV A;  1WY6 A;  4HOR A;  3UX4 A;  5ENT D;  3BEE A;  3ZXP A;  2IEJ A;  2V4L A;  3IEG A;  3SGH A;  2HR2 A;  5BNW A;  4KBQ A;  4RLY A;  3PVL A;  1FCH A;  1JWF A;  3PNT B;  3TL5 A;  4B89 A;  2HE0 A;  2AXZ A;  2J4B A;  4BER A;  1SA5 A;  1HU3 A;  3DXK G;  1A17 A;  2MHK A;  5HS0 A;  1LD8 A;  4U95 D;  5DIZ A;  4BSX A;  4GA1 A;  4CDR A;  2Q7F A;  3HXD A;  3HXF A;  3CVV A;  4HOS A;  3TWW A;  2P58 C;  3PZD A;  3QOU A;  4J6I A;  4EBA G;  2CG2 A;  2V5Q C;  1KPS B;  1H2T C;  3FY4 A;  3FTS A;  3S7B A;  4GTR A;  3CK9 A;  3L22 A;  1Z3X A;  5ENQ D;  1NA3 A;  3T8M A;  2FI7 A;  1O1R A;  3I3N A;  5G04 C;  1H0A A;  3QAQ A;  2MOW A;  3ML9 A;  3MGB A;  5KJL A;  3UM0 A;  2XPI A;  4U0U A;  4HRN A;  3RIB A;  2CFZ A;  4ATZ D;  2VSY A;  1QQE A;  2IOS A;  1BPO A;  4TXQ A;  3LYA A;  4HVB A;  1JCS A;  3IKO B;  2A4Z A;  2DIW A;  2KCV A;  4GZC A;  4HOT A;  3HIZ A;  3SFZ A;  3PNL B;  1JCQ A;  3B13 A;  3JCK C;  3QB2 A;  4GPM A;  2YQ8 A;  4NAC A;  5FZS A;  4J8Y A;  4XX5 A;  1IYG A;  3Q79 A;  4ANW A;  3TWU A;  4IUL A;  3CQG B;  5C2Y A;  4F1P A;  1TYQ G;  1JWG A;  2DCP A;  4EPZ A;  1UW4 B;  3E4B A;  3I4R B;  3ZUV B;  4Q69 A;  3MA5 A;  1HF8 A;  2HYZ A;  3RAU A;  4MLP A;  4L7T A;  3PE3 A;  3QDN A;  3I5P A;  3B7R L;  4Y6W A;  3RRM B;  2XEV A;  2E2E A;  3J5P A;  1U3D A;  3UIP C;  5M72 A;  4WWP A;  2FEZ A;  4GZ3 A;  4Z68 A;  3BG0 B;  4EZJ A;  3DSV A;  5EYL A;  1HZ4 A;  5JMN D;  4F7A A;  2BKG A;  3EU5 A;  4ZFH A;  3E32 A;  1SZ9 A;  1UN9 A;  4A63 B;  3ISM C;  4F1S A;  4H7Y A;  3CHS A;  1NL4 A;  5AJD A;  3FHE A;  4NUR A;  2OVB A;  1IKN D;  3I4G A;  4G23 A;  3HXC A;  3AU4 A;  4GTM A;  1VDY A;  2UWJ G;  4PDX A;  2XPY A;  4GCO A;  3SY2 A;  4UWH A;  4JHR A;  3LVQ E;  3ULQ A;  3SO8 A;  3JXJ A;  4GTQ A;  2RD0 A;  4KMO A;  5KWD A;  2H6I A;  3CVQ A;  3FEX A;  3SFY A;  4JC8 A;  4GCN A;  4Y6C A;  1JUQ A;  1N94 A;  1NI1 A;  2QY7 A;  5A7D B;  4O60 A;  4BY6 A;  2ZXW E;  3L54 A;  3UT8 A;  4CGV A;  1EPU A;  2NSZ A;  1BD8 A;  3TGO A;  2XEN A;  3L9T A;  5CMY A;  5C1D A;  2LAH A;  3W9G A;  3B7S A;  4CYM D;  4U04 A;  2RG8 A;  4WNE A;  5JA4 D;  5CEA A;  5J90 A;  3UPV A;  2FBN A;  3FUI A;  3TWS A;  3DSX A;  4BEP A;  1S64 A;  3P1U A;  5J08 A;  3LY9 A;  2ZIR A;  2P9S G;  2P9I G;  3RU0 A;  1ELW A;  3D9P A;  1QNF A;  2WQH A;  4G24 A;  4OVV A;  1DCQ A;  5AQ9 A;  4A3T A;  3Q78 A;  2WXF A;  2CG3 A;  1H2V C;  3AS4 A;  1X81 A;  2WXM A;  4APF A;  4I6J A;  4G1T A;  1NA0 A;  4LEU A;  2YNQ A;  2IOL A;  3IHY A;  5T4Y A;  5D2M C;  2OEV A;  3V79 K;  2R03 A;  1HFA A;  3ZYL A;  2VTB A;  4HLL A;  2LO6 A;  5CRU A;  1EDU A;  4K5C A;  2VGE A;  1XGW A;  3OXF A;  1FT1 A;  2I9C A;  4UUC A;  3GZ2 A;  3L6A A;  1MX2 A;  1TN6 A;  3LY7 A;  4AXH A;  1N4R A;  5AQB A;  3Q9U C;  3ONK A;  3JUE A;  1TNY A;  5EX3 A;  4I6E A;  1SQM A;  2EIK E;  2RFM A;  3APF A;  3SNX A;  4GTV A;  3Q73 A;  3U3W A;  1OCR E;  2FO7 A;  3ESL A;  2V0P A;  4FP7 A;  5FIO A;  5KNG A;  1XNF A;  5T3R A;  4AJW A;  5EKQ D;  4L2L A;  4CEM A;  4UWF A;  4EZL A;  4W9R A;  3VLE A;  3ZRH A;  1PAQ A;  1PC2 A;  2JLB A;  1BI7 B;  4E6H A;  2DZO A;  2RFA A;  2X6K A;  4GZ5 A;  3LVR E;  4TUU A;  3NB2 A;  4AIF A;  5FQ8 A;  5EDS A;  3URZ A;  1WM5 A;  4KZC A;  2XRY A;  5JHB A;  2DYR E;  3FTY A;  3ABK E;  3NAW A;  4KYO B;  5D0Q D;  2L9B A;  3ZGQ A;  3EIQ C;  5EIB E;  3ASD A;  2EIL E;  1SW6 A;  3GZS A;  4FU3 A;  3IBE A;  4FAD A;  1HG5 A;  2PL2 A;  5AAO A;  3F6Q A;  2R17 C;  2GRN B;  3VTY A;  3G2V A;  3ASO E;  4DX7 D;  4J8E A;  3ZKJ A;  3UM3 A;  3DST A;  3D9L A;  4AV7 A;  4WWO A;  5A6C A;  2CHZ A;  5FZQ A;  3TG5 A;  4DK5 A;  4DI4 A;  1TNB A;  5BXO A;  2KBX A;  4HOU A;  4CZ2 D;  2XCC A;  3FU5 A;  4BWR A;  3C3R A;  1Y8M A;  3R7Q A;  1Z5S C;  1K1B A;  1ZB1 A;  2R5S A;  3CR3 A;  3CK8 A;  3MYV A;  4WAF A;  2I6H A;  2WXP A;  1MYO A;  3N71 A;  3UKR G;  3Q49 B;  2OVF A;  4J8D A;  2EQX A;  3KS2 A;  4HRL A;  3ASN E;  3E33 A;  4GMJ A;  3CVY A;  3EHQ A;  4G11 A;  3D3M A;  4I9C A;  3HVE B;  2ETB A;  3U4T A;  2XGS A;  1HH8 A;  1OUV A;  4ILI A;  2B0O E;  5ENR D;  5EX0 A;  3HVE A;  4I2W A;  1UG3 A;  4BT8 A;  1TJC A;  2EIJ E;  2AVP A;  2DBA A;  5FQ4 A;  3WXX A;  1IXV A;  4GMR A;  3UM2 A;  5FIN A;  4LCT A;  1H19 A;  3PUK A;  1UOH A;  4DX2 A;  2XQ0 A;  4XZ4 A;  1TN7 A;  3CST A;  2IQC A;  4A1G A;  4U96 D;  2V8S E;  1N4P A;  4QQI A;  4BFR A;  4U07 A;  3FUD A;  4YVO A;  4ANV A;  3DWL G;  2WXO A;  4PS3 A;  2VGX B;  5B1B E;  5KBA A;  2X6F A;  4RG9 A; 
#chains in the Genus database with same CATH homology
 3DXK G;  2P9K G;  4XEI G;  1TYQ G;  3UKU G;  2P9U G;  1K8K G;  2P9N G;  2P9P G;  3DXM G;  3RSE G;  1U2V G;  4JD2 G;  3UKR G;  3DWL G;  3ULE G;  2P9S G;  2P9I G;  2P9L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...