3UKRG

Crystal structure of bos taurus arp2/3 complex with bound inhibitor ck-666
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
143
structure length
136
Chain Sequence
ARFRKVDVGEYDENKFVDEAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-related protein 3
publication title Structural characterization and computer-aided optimization of a small-molecule inhibitor of the Arp2/3 complex, a key regulator of the actin cytoskeleton.
pubmed doi rcsb
total genus 43
structure length 136
sequence length 143
ec nomenclature
pdb deposition date 2011-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 3ukrG00
2P9PG 3RSEG 2P9IG 3ULEG 2P9KG 2P9NG 3DXMG 4XEIG 2P9LG 4JD2G 2P9SG 3UKRG 1U2VG 2P9UG 1K8KG 3DWLG 3UKUG 1TYQG 3DXKG
chains in the Genus database with same CATH superfamily
3LVQE 1S63A 4UQZA 2CG2A 1FPPA 3PUKA 2WXLA 1NA0A 3Q73A 2DBAA 1N4RA 1E8ZA 2Y4UA 3DRAA 3NBNB 4CZ2D 3S7FA 2C2LA 3FUEA 2EQXA 4O1OA 4BY6A 1XGWA 3TG5A 4U7EB 3ULQA 2XPIA 3CVWA 1NFIE 2UY1A 5BPPA 2QZAA 2KXPC 3LEWA 1JUQA 1MX4A 4CDRA 3O48A 3MV2B 4N39A 3HG0D 3FFLA 1TNYA 2RG8A 3UM2A 5T3RA 1UN8A 4BTBA 2DWZA 2PZIA 3ZPJA 2LNIA 5JMND 1HX8A 2AXUA 1HXIA 2L6BA 2OOEA 3D9IA 3GW4A 2GRPB 4HRLA 3DSTA 3SBTB 5LX8A 1A17A 3TWXA 3TWWA 2WMNA 1O1TA 3MKQB 1HO8A 3ZXSA 3G2UA 3PE4A 4EPZA 3TGOA 3EHMA 3U3WA 1JCSA 1ELWA 3TL5A 3B7UX 3AS8A 2BUGA 3JQ1A 2UWJG 4DPRA 3PE3A 3RSEG 2IO3C 4GYWA 4O1PA 3PZ3A 3TWTA 1FCHA 2PQNA 3APCA 1S0PA 3UKRG 1NL4A 5G04J 2WM9A 1SA4A 4GTQA 1FVFA 2F37A 1N52A 4EHMA 3B13A 4J8DA 3L13A 3HVEB 3F6QA 3G2VA 2P9NG 3RRNB 3CLJA 3E4BA 4KBQA 1IHBA 2XZDG 4W9RA 4J8EA 3BU8A 2YHCA 2EINE 1OUVA 3NZUA 5BNWA 3ABKE 5HI7A 4TXRA 4U95D 4RSYA 4JZYA 1H19A 3FTVA 3D9HA 3CGHA 5CERB 3QAQA 4HLLA 4DLOA 4BETA 3IXEA 2FULA 4M7CA 1QBQA 4FU3A 3DSSA 5G04C 3MX3A 3S2AA 2AJAA 3SZ7A 3O4ZA 1BPOA 3ZXPA 3QNKA 3CKCA 3RRUA 3IHYA 2BF0X 3PEUB 3ASOE 3JYSA 5D0QD 2YNQA 2RFMA 3CKBA 4HOQA 3ZUVB 2YINA 5KJMA 3ABME 2KC7A 4I6EA 2P9LG 3L9TA 5JHAA 1WDYA 1EYHA 4JXTA 3TWUA 2IY0C 5C2YA 3CSFA 1SA5A 3DXMG 4BX9A 4KZ0A 1U3CA 3I4RB 4UI9K 5BXOA 2J4DA 4O6FA 4FA6A 3HXFA 3APFA 2B0OE 2VSOE 1TYQG 4AEZC 3W9GA 4U07A 2LAIA 4DJAA 2LXLA 3EDTB 2R2LA 3TWQA 3CHSA 4YVOA 4EBAA 4UI9J 5HRYA 4JB8P 3ASGA 3MKQA 4ABNA 5KNGA 1V55E 3JCKC 4KMOA 4AM9A 5FZQA 1YMPA 3AG2E 2HYZA 2KBXA 3CHQA 3ZYLA 4LRZA 3UT7A 2EIKE 3PUJA 3R7RA 4NIKA 4E85A 1ZU2A 2VSXE 1IYGA 4F1SA 4JHJA 4LNBA 4MLPA 1LTXA 2DVWA 3UPVA 2OCCE 3RIBA 4Q96A 4PS7A 3PNLB 5A7DB 2XEVA 5G05J 3DSXA 3V31A 1IKND 1UW4B 4XX5A 3LY9A 2R17C 4MS6A 2F8XK 3B7TA 5KJLA 1OWMA 3ZHEB 2F0YA 1NI1A 5FINA 3OXLA 4UI9C 2V4HC 1MQSA 5AARA 5ANRA 3L54A 4TUUA 3HVEA 3QOUA 4J8YA 3D9PA 4GZ5A 2XRYA 4ACLA 4UWGA 5ANLA 4NQ0A 2X6FA 4WNDA 4WWNA 1MX2A 3DPYA 5CBNA 5FZSA 5G05C 4WNEA 5EYPF 4ANXA 3QWVA 3FH7A 4WNGA 4GYOA 3PZ2A 4DI3A 3HDXA 1TJFA 4LNUD 3Q7AA 2VTBB 1Z5SC 1TEZA 5JJTA 1E96B 3RO2A 3WXXA 1G3NB 1ZBPA 3ML8A 3KAEA 3ZGQA 1EDUA 4HOSA 1XNFA 4HI8A 2IOLA 3D9KA 5D66A 4DX7D 4I6JA 4KZCA 4NRHB 3ABLE 3ZYMA 2FBNA 3ESLA 4CT4A 3SQVA 1K8KG 3C72A 3UI2A 1KZPA 5JHBA 2BKGA 3IHVA 4G24A 2LUHA 2XEHA 1EF1C 1Y6IA 4L2YA 4K5CA 4GCNA 2LSVA 1RW2A 2H6HA 1H6OA 1AWCB 3C98A 3E30A 3DWLG 1Y8MA 4B93B 3FU6A 5KBAA 3AS4A 4U63A 5J90A 3PEVB 1WAO1 2P2CP 4IN3B 3ENEA 2P9KG 3SHFA 2CHXA 5C1DA 2AXVA 4HI9A 4GA2A 5JJ7A 4LSZE 4RG6A 4L7TA 2MHKA 2QFCA 3EU9A 3UKUG 4J8FA 2WXKA 4HS2A 2V4LA 3PS6A 1QNFA 3LKUA 3TG4A 1ZB1A 3T8MA 4KVOA 3AU4A 4XIFA 1HU3A 1Z3YA 5B1BE 2KCLA 3E33A 5A23A 4N3AA 3UM0A 3CSTA 4OYSA 1OY3D 1TN7A 4HVBA 4UQXA 3L22A 2J09A 4JHRA 1UOHA 2XPZA 3JXIA 2VSYA 3ZHEA 3MKRA 2X6IA 4XE0A 4GTMA 1N0RA 2L0IA 2VGEA 4GMRA 2I6HA 3OXGA 3U4TA 5BW8C 5A6CA 2I1JA 2ZGDA 2X6HA 1NP7A 4AY5A 4WWPA 3CR3A 4LUNU 2X3MA 5ENPD 5G2NA 2NYJA 2NC9A 3RK6A 5HS0A 4JA7A 3Q9NC 3RKVA 3SY2A 2WPVA 4D10C 5ARFA 3ZKJA 1D9SA 3EIQC 4UWFA 2PQRA 4WNFA 2VTBA 1H6KA 2BEDA 4K0RA 2WXRA 4G25A 1HG2A 4XI9A 4A63B 2GGFA 4BT9A 4K03A 4JD2G 4U8HA 1NA3A 1TNUA 4HOTA 4GB9A 1MHQA 3GYZA 4IYPA 5CHEE 2YQ8A 2X6KA 3EIJA 5BV1A 3C3QA 3G2TA 3S7DA 3MZLB 2AXZA 2X38A 4N3CA 1UJJA 4UWHA 4WWOA 4HFGA 4I2WA 1BI8B 5EDSA 3OTNA 3EHRA 3ZU7B 3CK9A 4UQYA 4CRWA 2ILRA 4XZ4A 1N9AA 2WVIA 4L9PA 3I4GA 5AQAA 2XRZA 4JW1A 3IBEA 1PC2A 3APDA 4KYOB 4U0ZA 5EYLA 3ZYQA 3UIPC 2IO2C 3N71A 3FWVA 3OXFA 4DUIA 3ESKA 4FC8A 2IQCA 5AQBA 4UWKA 4G8KA 3U66A 4YDYA 1L5JA 1WG0A 2JABA 4F7AA 5ITZF 2CHZA 3ONLA 1KPSB 2WQ7A 3QKYA 2VYIA 4K5BA 4AIFA 5CEDB 2EIJE 3Q7FA 4KVMA 5ENOD 4RLYA 4I1AA 2AWIA 4BX8A 3RRMB 4PH4B 3VTXA 2C0MA 3LPZA 4DX5D 4GTTA 2IOSA 3EU5A 3TWRA 5AQ9A 4ILGA 4GTSA 1OXJA 2HR2A 2XGSA 3SFXA 2ETAA 3UMVA 3FUNA 3FUHA 3GZ2A 5EX0A 4G2VA 3Q47B 3PZ4A 4CDNA 4TXQA 1AP7A 2GW1A 2WXHA 3L6AA 4OVVA 1JWGA 3PZDA 4BWRA 3P1UA 3ULEG 3FULA 1E8YA 4CCAA 3L08A 3NB2A 3FTSA 4BSZB 5FZRA 2DZNA 3HXDA 1YA0A 3FTYA 3PVLA 3CVLA 5D2MC 5JJ6A 3MV3B 2IJGX 3URZA 2KZTB 4GZ3A 4Q69A 4WAFA 1TN8A 4BFRA 4BSXA 1EPUA 2H6GA 3SBSA 4EZLA 5E75A 3FH8A 1MX6A 1HZ4A 4ILIA 1H0AA 4G8LA 2GRMA 2CG3A 1DCEA 4BT8A 1OWPA 4TXPA 3HRAA 4C48B 2WXPA 4G1TA 1DCQA 5AQ7A 2EILE 4GPKA 3DSWA 5EIBE 3RU0A 4I2ZA 5FJYA 3V2OA 4HQDA 4A1GA 4PUCA 3CQGB 4EBAG 1HG5A 1DC2A 3FU5A 1OWNA 1S70B 2FO7A 2ZGGA 2FI7A 1E8XA 3QK0A 4YDOA 2ZXWE 3EHNA 2E2EA 3LY8A 4ATGA 4HNAD 4YVQC 3NAWA 5EX3A 4H7XA 1O1SA 1SZ9A 3DEPA 2DCPA 3FY4A 3X2QE 3Q5MA 2L0TB 3SD5A 3UM3A 2NXPA 2V0PA 5E76A 3T5XA 4XI0A 3UIOC 3TJPA 1YYHA 5BT1A 2OEVA 3I5PA 3BG1B 2CHWA 2WXIA 3SO8A 2R5SA 1PAQA 4R7LA 4AOFA 5KJNA 4DK5A 4I1MA 1LD8A 3PZ1A 3QC1A 2MRIA 3SNXA 3PREA 4ACKA 4FADA 3CVNA 4U96D 4CGWA 3EJNA 1NZNA 5FIOA 1JCRA 2IEJA 4HORA 1PY1A 3QJZA 4JL0A 4FP7A 3P2BA 3V2XA 4LNGA 4JA9A 3FUJA 1SW6A 1HFAA 3SF4A 3BEEA 2VSNA 4AV7A 3ONKA 4ILHB 3HHMA 2OV8A 1LF8A 3MJWA 5ENNA 2WB2A 2J49A 3LJ3A 3L17A 4GTPA 3C3OA 4GCOA 4U0UA 3R7QA 4BERA 3JUEA 5LP0A 2XCBA 2DYRE 1RZ4A 3U64A 4LCTA 4HLEA 2HM8A 4ZHBA 3Q15A 5CCMA 4GTVA 2IF4A 5ENSD 2WQ6A 2VGXB 4JC8A 3CEQA 5BUZA 5KNHD 4QFVA 3QB2A 1KZOA 3R9AB 4G11A 5CMWA 3ZYKA 3G2WA 3CHMA 3ZNGA 4I6GA 3DSUA 4HRNA 2KZTA 4MRUA 4Z68A 1V54E 3E37A 1N4QA 4B0ZA 1TR4A 2CFZA 2ZU6B 2R02A 2XHEA 3FP3A 3FTXA 4BESA 1YCSB 4LG6A 3BUAA 4F1PA 1FT2A 2KCKA 1N94A 1OWLA 2XS8A 5LCWJ 4FLHA 5FWQA 1B89A 4A55A 1E90A 3RO3A 1UG3A 3AS5A 5AAOA 3LVRE 5HQ8A 3FEYA 1OCRE 5KJKA 3W9FA 1HS6A 3MCXA 3T9KA 4APFA 2ONDA 3MEKA 2AVPA 1DVPA 3QDNA 4C0EA 1D8EA 3B95A 3S7BA 1S64A 4AXHA 3CVQA 1OCOE 3U9WA 4U8YD 2NSZA 4ATZD 2R03A 4AVXA 3R9MA 4DLQA 4URKA 3DPDA 3UINC 4EZKA 4F6RD 1K3ZD 4O60A 3RAUA 2V5QC 4WUYA 4B8CB 5LCWC 3EUVA 4C9BB 3V79K 1LD7A 1BD8A 3S7JA 5FQ6A 4A1SA 3KSQA 2RKKA 5ENRD 3TAXA 3KS2A 2XGOA 3G2SA 2PM7A 1BU9A 3FEXA 3IKOB 5CECB 2IU1A 5H7PA 3E34A 4KT6B 2GROB 3QWPA 1KT1A 4JHKA 3E32A 3SI5A 3JXJA 3Q75A 3LXUX 1SQMA 4I9CA 3KEZA 4HB5A 5AN8A 2XEEA 2AW6A 3I3NA 1HF8A 4N3BA 3LYAA 3DXKG 4EQFA 3IEGA 1JWFA 5B1AE 2YHEA 3J5PA 4XEIG 3B7BA 1MZCA 3BG0B 1FVHA 2Q7FA 2CFUA 1IQRA 2VJ8A 3L16A 4APOA 3CVYA 2WXNA 3SFZA 5FQ7A 2L9BA 3Q78A 4U04A 2J8SD 5LOZA 4FHJA 3D9NA 3LJNA 1Q2ZA 4GTRA 4GMLA 1JCQA 2VGXA 4L2LA 1UN9A 3FTWA 3Q9UC 2DIWA 4EECA 3C3RA 1X81A 3DSVA 3CK8A 2H6FA 4CGVA 3UTMA 3FDHA 4MBGA 5CRVA 2XGMA 3DBSA 2RD0A 4CT0A 4UWLA 4AP2A 3ZVVA 2A5UA 4DX6D 3CVVA 3ASFA 3B7SA 3KEAA 3JUIA 3V30A 3D9JA 3NQPA 4Y6WA 4N2QA 5T8IA 1QZ2A 3VLEA 3L82A 5ENTD 4GTOA 3PNTB 4KXKB 4UUCA 2XPYA 3MA5A 4FULA 3LY7A 5DBKA 4GPMA 2LSUA 2QY7A 4TUMA 1INZA 3NOCD 3TWVA 4HBDA 4G23A 3ZW3A 2OVBA 3UT4A 3CHPA 3TWSA 4P29A 4N5CA 3ZFWA 1E7VA 4QQIA 4U0SA 4HOUA 3ASHA 1KT0A 3ASNE 2V8SE 2LO6A 2Y4TA 1VDYA 2WXGA 3ASDA 2V5FA 3C5RA 3UQ3A 2WXMA 2DZOA 4X8QA 4J6IA 1W3BA 3FUDA 2IFUA 2GRRB 2I1KA 4ME2A 2XENA 4RVBA 5CMYA 4FHKA 4GZ6A 4I17A 2P9PG 2KM4A 1OCZE 2GRQB 4GU5A 3ML9A 3AG4E 1ELKA 5AENA 2A5EA 3LCAA 5LFAA 4A3VA 1WY6A 2XQ0A 2C0LA 1IHGA 5AJLA 3NF1A 4Y6CA 4CYMD 3VTYA 3K9IA 3AAAC 4PS3A 3KD7A 5J08A 2XZTG 2J08A 4RG9A 3PH0C 2ZISA 1OT8A 3Q79A 4E6HA 3D3MA 3FTUA 5FTPA 4BTAA 2DYSE 2FO1E 2X6JA 2FEZA 2Y0BG 3ZIMA 4G26A 1UJKA 3Q4AB 3IV0A 2OEWA 1DNPA 3T8KA 3HYMB 2OVFA 3VLDA 4Q94A 1O1RA 3DEOA 2B6CA 2PNNA 1OWOA 2WXOA 5BXUA 3MGBA 1N54A 4I43A 4HRMB 1SZAA 5B3SE 2J9QA 2ETCA 3OAWA 2JEKA 5CRUA 3RJVA 4B8AA 1SVXA 2R05A 3NOGD 4DI4A 1Z6TA 1H2TC 2P58C 3TXNA 2RFAA 4K5AB 3FHEA 3SFYA 1QQEA 3CK7A 1HH8A 5G55A 1BLXB 1BI7B 2Y1LE 3FUKA 4GZCA 4HXIA 2KCVA 3PRZA 1KLXA 3CVUA 4F3VA 2R59A 5AJDA 3CHOA 1K1BA 1MJ0A 1N95A 3HXEA 3D9OA 5KCMA 3QARA 4OAVB 3Q49B 2J4BA 1N4SA 3CIAA 3SGHA 3CVXA 1D8DA 4TRQA 4N5QA 2XS1A 3CVPA 3VLFA 4A3TA 3B7RL 3UT8A 4JEHA 3CHRA 1N0QA 4V3IA 5D0OD 2PL2A 4MKTA 3UM1A 4GA1A 3HXBA 2QC9A 3AG3E 4YDEA 1H2VC 4DX1A 2P9UG 4ANUA 5EIDA 4M3OA 1E7UA 4LERA 5HKPA 3FUMA 5ENQD 1QYMA 4JVSA 5EILA 2F8YA 4FJZA 2JLBA 3D9LA 3LDZA 3D9MA 1K1AA 1TNZA 1TJCA 4U8VD 2GRLA 3CV0A 2VGYA 1OCCE 2P9SG 5FQ8A 3FUIA 3AU5A 1P5QA 2H6IA 1U3DA 1HE8A 2I9CA 2M63A 3KSLA 4XKBA 1TN6A 3FTZA 4B89A 4AY6A 3GZSA 4J7WA 4GA0A 2WMOA 3FU0A 4J8SA 1O5MA 4CDMA 4DRXE 4J0UA 3MYVA 2I2OA 5T4YA 5CEAA 3UUXA 2FF4A 3ISMC 2UY1B 2IONA 1WM5A 2J07A 2HO1A 2BKKB 3NZSA 4CEMA 1JPLA 5ARGA 5CBOA 5DIZA 4EZJA 5JA4D 4YDWA 1N4PA 4JPSA 2ZIRA 1Z3XA 1GW6A 3FU3A 2P9IG 2Y3AA 4L1BA 1ELRA 5FQ4A 2WQHA 3T5VA 2QYJA 3BQOA 5EKQD 4OAUC 1H6PA 2VQ2A 4IULA 4ZFHA 1A5EA 4PS8A 2MOWA 5BV0A 5IY5E 1TNBA 4ANVA 3AG1E 1U2VG 1TNOA 4GAAA 2GRNB 4I9EA 2WXFA 5KWDA 5AYWD 5FT9A 4OVUA 3ZN3A 2ETBA 4JEUA 3ZRHA 1MYOA 3ULYA 3JQ0A 1E8WA 3AJIA 4TV3A 4C0MA 2WXJA 2PM6A 3CQCB 4B94A 5M72A 4L23A 4N2SA 3ZEFA 3QWWA 4IRUA 4F53A 3HXCA 3EHQA 2QYUA 4LEUA 3WG7E 5EN5D 4DX2A 2WXQA 4BEPA 2L6JA 3LS8A 2HE0A 2E0IA 4GYYA 3GZ1A 5AIJA 4ANWA 5CCLA 1H2UA 1IXVA 2LAHA 2LXMA 3TXMA 3FH5A 4RQIA 3UXGA 1FT1A 3PDNA 3FUFA 2BTDA 2KATA 4NURA 2MYOA 2Y69E 3HIZA 4AJWA 2XCCA 4XKCA 4PDXA 2EIME 4GMJA 4NACA 4FJYA 4FLBA 2A4ZA 1N11A 4I1OB 4GZDA 4H7YA 3J5QB 3UX4A 1IQUA 1X5BA 4YNDA
chains in the Genus database with same CATH topology
2P9PG 3RSEG 2P9IG 3ULEG 2P9KG 2P9NG 3DXMG 4XEIG 2P9LG 4JD2G 2P9SG 3UKRG 1U2VG 2P9UG 1K8KG 3DWLG 3UKUG 1TYQG 3DXKG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9P G;  3RSE G;  2P9I G;  3ULE G;  2P9K G;  2P9N G;  3DXM G;  4XEI G;  2P9L G;  4JD2 G;  2P9S G;  3UKR G;  1U2V G;  2P9U G;  1K8K G;  3DWL G;  3UKU G;  1TYQ G;  3DXK G; 
#chains in the Genus database with same CATH topology
 3LVQ E;  1S63 A;  4UQZ A;  2CG2 A;  1FPP A;  3PUK A;  2WXL A;  1NA0 A;  3Q73 A;  2DBA A;  1N4R A;  1E8Z A;  2Y4U A;  3DRA A;  3NBN B;  4CZ2 D;  3S7F A;  2C2L A;  3FUE A;  2EQX A;  4O1O A;  4BY6 A;  1XGW A;  3TG5 A;  4U7E B;  3ULQ A;  2XPI A;  3CVW A;  1NFI E;  2UY1 A;  5BPP A;  2QZA A;  2KXP C;  3LEW A;  1JUQ A;  1MX4 A;  4CDR A;  3O48 A;  3MV2 B;  4N39 A;  3HG0 D;  3FFL A;  1TNY A;  2RG8 A;  3UM2 A;  5T3R A;  1UN8 A;  4BTB A;  2DWZ A;  2PZI A;  3ZPJ A;  2LNI A;  5JMN D;  1HX8 A;  2AXU A;  1HXI A;  2L6B A;  2OOE A;  3D9I A;  3GW4 A;  2GRP B;  4HRL A;  3DST A;  3SBT B;  5LX8 A;  1A17 A;  3TWX A;  3TWW A;  2WMN A;  1O1T A;  3MKQ B;  1HO8 A;  3ZXS A;  3G2U A;  3PE4 A;  4EPZ A;  3TGO A;  3EHM A;  3U3W A;  1JCS A;  1ELW A;  3TL5 A;  3B7U X;  3AS8 A;  2BUG A;  3JQ1 A;  2UWJ G;  4DPR A;  3PE3 A;  3RSE G;  2IO3 C;  4GYW A;  4O1P A;  3PZ3 A;  3TWT A;  1FCH A;  2PQN A;  3APC A;  1S0P A;  3UKR G;  1NL4 A;  5G04 J;  2WM9 A;  1SA4 A;  4GTQ A;  1FVF A;  2F37 A;  1N52 A;  4EHM A;  3B13 A;  4J8D A;  3L13 A;  3HVE B;  3F6Q A;  3G2V A;  2P9N G;  3RRN B;  3CLJ A;  3E4B A;  4KBQ A;  1IHB A;  2XZD G;  4W9R A;  4J8E A;  3BU8 A;  2YHC A;  2EIN E;  1OUV A;  3NZU A;  5BNW A;  3ABK E;  5HI7 A;  4TXR A;  4U95 D;  4RSY A;  4JZY A;  1H19 A;  3FTV A;  3D9H A;  3CGH A;  5CER B;  3QAQ A;  4HLL A;  4DLO A;  4BET A;  3IXE A;  2FUL A;  4M7C A;  1QBQ A;  4FU3 A;  3DSS A;  5G04 C;  3MX3 A;  3S2A A;  2AJA A;  3SZ7 A;  3O4Z A;  1BPO A;  3ZXP A;  3QNK A;  3CKC A;  3RRU A;  3IHY A;  2BF0 X;  3PEU B;  3ASO E;  3JYS A;  5D0Q D;  2YNQ A;  2RFM A;  3CKB A;  4HOQ A;  3ZUV B;  2YIN A;  5KJM A;  3ABM E;  2KC7 A;  4I6E A;  2P9L G;  3L9T A;  5JHA A;  1WDY A;  1EYH A;  4JXT A;  3TWU A;  2IY0 C;  5C2Y A;  3CSF A;  1SA5 A;  3DXM G;  4BX9 A;  4KZ0 A;  1U3C A;  3I4R B;  4UI9 K;  5BXO A;  2J4D A;  4O6F A;  4FA6 A;  3HXF A;  3APF A;  2B0O E;  2VSO E;  1TYQ G;  4AEZ C;  3W9G A;  4U07 A;  2LAI A;  4DJA A;  2LXL A;  3EDT B;  2R2L A;  3TWQ A;  3CHS A;  4YVO A;  4EBA A;  4UI9 J;  5HRY A;  4JB8 P;  3ASG A;  3MKQ A;  4ABN A;  5KNG A;  1V55 E;  3JCK C;  4KMO A;  4AM9 A;  5FZQ A;  1YMP A;  3AG2 E;  2HYZ A;  2KBX A;  3CHQ A;  3ZYL A;  4LRZ A;  3UT7 A;  2EIK E;  3PUJ A;  3R7R A;  4NIK A;  4E85 A;  1ZU2 A;  2VSX E;  1IYG A;  4F1S A;  4JHJ A;  4LNB A;  4MLP A;  1LTX A;  2DVW A;  3UPV A;  2OCC E;  3RIB A;  4Q96 A;  4PS7 A;  3PNL B;  5A7D B;  2XEV A;  5G05 J;  3DSX A;  3V31 A;  1IKN D;  1UW4 B;  4XX5 A;  3LY9 A;  2R17 C;  4MS6 A;  2F8X K;  3B7T A;  5KJL A;  1OWM A;  3ZHE B;  2F0Y A;  1NI1 A;  5FIN A;  3OXL A;  4UI9 C;  2V4H C;  1MQS A;  5AAR A;  5ANR A;  3L54 A;  4TUU A;  3HVE A;  3QOU A;  4J8Y A;  3D9P A;  4GZ5 A;  2XRY A;  4ACL A;  4UWG A;  5ANL A;  4NQ0 A;  2X6F A;  4WND A;  4WWN A;  1MX2 A;  3DPY A;  5CBN A;  5FZS A;  5G05 C;  4WNE A;  5EYP F;  4ANX A;  3QWV A;  3FH7 A;  4WNG A;  4GYO A;  3PZ2 A;  4DI3 A;  3HDX A;  1TJF A;  4LNU D;  3Q7A A;  2VTB B;  1Z5S C;  1TEZ A;  5JJT A;  1E96 B;  3RO2 A;  3WXX A;  1G3N B;  1ZBP A;  3ML8 A;  3KAE A;  3ZGQ A;  1EDU A;  4HOS A;  1XNF A;  4HI8 A;  2IOL A;  3D9K A;  5D66 A;  4DX7 D;  4I6J A;  4KZC A;  4NRH B;  3ABL E;  3ZYM A;  2FBN A;  3ESL A;  4CT4 A;  3SQV A;  1K8K G;  3C72 A;  3UI2 A;  1KZP A;  5JHB A;  2BKG A;  3IHV A;  4G24 A;  2LUH A;  2XEH A;  1EF1 C;  1Y6I A;  4L2Y A;  4K5C A;  4GCN A;  2LSV A;  1RW2 A;  2H6H A;  1H6O A;  1AWC B;  3C98 A;  3E30 A;  3DWL G;  1Y8M A;  4B93 B;  3FU6 A;  5KBA A;  3AS4 A;  4U63 A;  5J90 A;  3PEV B;  1WAO 1;  2P2C P;  4IN3 B;  3ENE A;  2P9K G;  3SHF A;  2CHX A;  5C1D A;  2AXV A;  4HI9 A;  4GA2 A;  5JJ7 A;  4LSZ E;  4RG6 A;  4L7T A;  2MHK A;  2QFC A;  3EU9 A;  3UKU G;  4J8F A;  2WXK A;  4HS2 A;  2V4L A;  3PS6 A;  1QNF A;  3LKU A;  3TG4 A;  1ZB1 A;  3T8M A;  4KVO A;  3AU4 A;  4XIF A;  1HU3 A;  1Z3Y A;  5B1B E;  2KCL A;  3E33 A;  5A23 A;  4N3A A;  3UM0 A;  3CST A;  4OYS A;  1OY3 D;  1TN7 A;  4HVB A;  4UQX A;  3L22 A;  2J09 A;  4JHR A;  1UOH A;  2XPZ A;  3JXI A;  2VSY A;  3ZHE A;  3MKR A;  2X6I A;  4XE0 A;  4GTM A;  1N0R A;  2L0I A;  2VGE A;  4GMR A;  2I6H A;  3OXG A;  3U4T A;  5BW8 C;  5A6C A;  2I1J A;  2ZGD A;  2X6H A;  1NP7 A;  4AY5 A;  4WWP A;  3CR3 A;  4LUN U;  2X3M A;  5ENP D;  5G2N A;  2NYJ A;  2NC9 A;  3RK6 A;  5HS0 A;  4JA7 A;  3Q9N C;  3RKV A;  3SY2 A;  2WPV A;  4D10 C;  5ARF A;  3ZKJ A;  1D9S A;  3EIQ C;  4UWF A;  2PQR A;  4WNF A;  2VTB A;  1H6K A;  2BED A;  4K0R A;  2WXR A;  4G25 A;  1HG2 A;  4XI9 A;  4A63 B;  2GGF A;  4BT9 A;  4K03 A;  4JD2 G;  4U8H A;  1NA3 A;  1TNU A;  4HOT A;  4GB9 A;  1MHQ A;  3GYZ A;  4IYP A;  5CHE E;  2YQ8 A;  2X6K A;  3EIJ A;  5BV1 A;  3C3Q A;  3G2T A;  3S7D A;  3MZL B;  2AXZ A;  2X38 A;  4N3C A;  1UJJ A;  4UWH A;  4WWO A;  4HFG A;  4I2W A;  1BI8 B;  5EDS A;  3OTN A;  3EHR A;  3ZU7 B;  3CK9 A;  4UQY A;  4CRW A;  2ILR A;  4XZ4 A;  1N9A A;  2WVI A;  4L9P A;  3I4G A;  5AQA A;  2XRZ A;  4JW1 A;  3IBE A;  1PC2 A;  3APD A;  4KYO B;  4U0Z A;  5EYL A;  3ZYQ A;  3UIP C;  2IO2 C;  3N71 A;  3FWV A;  3OXF A;  4DUI A;  3ESK A;  4FC8 A;  2IQC A;  5AQB A;  4UWK A;  4G8K A;  3U66 A;  4YDY A;  1L5J A;  1WG0 A;  2JAB A;  4F7A A;  5ITZ F;  2CHZ A;  3ONL A;  1KPS B;  2WQ7 A;  3QKY A;  2VYI A;  4K5B A;  4AIF A;  5CED B;  2EIJ E;  3Q7F A;  4KVM A;  5ENO D;  4RLY A;  4I1A A;  2AWI A;  4BX8 A;  3RRM B;  4PH4 B;  3VTX A;  2C0M A;  3LPZ A;  4DX5 D;  4GTT A;  2IOS A;  3EU5 A;  3TWR A;  5AQ9 A;  4ILG A;  4GTS A;  1OXJ A;  2HR2 A;  2XGS A;  3SFX A;  2ETA A;  3UMV A;  3FUN A;  3FUH A;  3GZ2 A;  5EX0 A;  4G2V A;  3Q47 B;  3PZ4 A;  4CDN A;  4TXQ A;  1AP7 A;  2GW1 A;  2WXH A;  3L6A A;  4OVV A;  1JWG A;  3PZD A;  4BWR A;  3P1U A;  3ULE G;  3FUL A;  1E8Y A;  4CCA A;  3L08 A;  3NB2 A;  3FTS A;  4BSZ B;  5FZR A;  2DZN A;  3HXD A;  1YA0 A;  3FTY A;  3PVL A;  3CVL A;  5D2M C;  5JJ6 A;  3MV3 B;  2IJG X;  3URZ A;  2KZT B;  4GZ3 A;  4Q69 A;  4WAF A;  1TN8 A;  4BFR A;  4BSX A;  1EPU A;  2H6G A;  3SBS A;  4EZL A;  5E75 A;  3FH8 A;  1MX6 A;  1HZ4 A;  4ILI A;  1H0A A;  4G8L A;  2GRM A;  2CG3 A;  1DCE A;  4BT8 A;  1OWP A;  4TXP A;  3HRA A;  4C48 B;  2WXP A;  4G1T A;  1DCQ A;  5AQ7 A;  2EIL E;  4GPK A;  3DSW A;  5EIB E;  3RU0 A;  4I2Z A;  5FJY A;  3V2O A;  4HQD A;  4A1G A;  4PUC A;  3CQG B;  4EBA G;  1HG5 A;  1DC2 A;  3FU5 A;  1OWN A;  1S70 B;  2FO7 A;  2ZGG A;  2FI7 A;  1E8X A;  3QK0 A;  4YDO A;  2ZXW E;  3EHN A;  2E2E A;  3LY8 A;  4ATG A;  4HNA D;  4YVQ C;  3NAW A;  5EX3 A;  4H7X A;  1O1S A;  1SZ9 A;  3DEP A;  2DCP A;  3FY4 A;  3X2Q E;  3Q5M A;  2L0T B;  3SD5 A;  3UM3 A;  2NXP A;  2V0P A;  5E76 A;  3T5X A;  4XI0 A;  3UIO C;  3TJP A;  1YYH A;  5BT1 A;  2OEV A;  3I5P A;  3BG1 B;  2CHW A;  2WXI A;  3SO8 A;  2R5S A;  1PAQ A;  4R7L A;  4AOF A;  5KJN A;  4DK5 A;  4I1M A;  1LD8 A;  3PZ1 A;  3QC1 A;  2MRI A;  3SNX A;  3PRE A;  4ACK A;  4FAD A;  3CVN A;  4U96 D;  4CGW A;  3EJN A;  1NZN A;  5FIO A;  1JCR A;  2IEJ A;  4HOR A;  1PY1 A;  3QJZ A;  4JL0 A;  4FP7 A;  3P2B A;  3V2X A;  4LNG A;  4JA9 A;  3FUJ A;  1SW6 A;  1HFA A;  3SF4 A;  3BEE A;  2VSN A;  4AV7 A;  3ONK A;  4ILH B;  3HHM A;  2OV8 A;  1LF8 A;  3MJW A;  5ENN A;  2WB2 A;  2J49 A;  3LJ3 A;  3L17 A;  4GTP A;  3C3O A;  4GCO A;  4U0U A;  3R7Q A;  4BER A;  3JUE A;  5LP0 A;  2XCB A;  2DYR E;  1RZ4 A;  3U64 A;  4LCT A;  4HLE A;  2HM8 A;  4ZHB A;  3Q15 A;  5CCM A;  4GTV A;  2IF4 A;  5ENS D;  2WQ6 A;  2VGX B;  4JC8 A;  3CEQ A;  5BUZ A;  5KNH D;  4QFV A;  3QB2 A;  1KZO A;  3R9A B;  4G11 A;  5CMW A;  3ZYK A;  3G2W A;  3CHM A;  3ZNG A;  4I6G A;  3DSU A;  4HRN A;  2KZT A;  4MRU A;  4Z68 A;  1V54 E;  3E37 A;  1N4Q A;  4B0Z A;  1TR4 A;  2CFZ A;  2ZU6 B;  2R02 A;  2XHE A;  3FP3 A;  3FTX A;  4BES A;  1YCS B;  4LG6 A;  3BUA A;  4F1P A;  1FT2 A;  2KCK A;  1N94 A;  1OWL A;  2XS8 A;  5LCW J;  4FLH A;  5FWQ A;  1B89 A;  4A55 A;  1E90 A;  3RO3 A;  1UG3 A;  3AS5 A;  5AAO A;  3LVR E;  5HQ8 A;  3FEY A;  1OCR E;  5KJK A;  3W9F A;  1HS6 A;  3MCX A;  3T9K A;  4APF A;  2OND A;  3MEK A;  2AVP A;  1DVP A;  3QDN A;  4C0E A;  1D8E A;  3B95 A;  3S7B A;  1S64 A;  4AXH A;  3CVQ A;  1OCO E;  3U9W A;  4U8Y D;  2NSZ A;  4ATZ D;  2R03 A;  4AVX A;  3R9M A;  4DLQ A;  4URK A;  3DPD A;  3UIN C;  4EZK A;  4F6R D;  1K3Z D;  4O60 A;  3RAU A;  2V5Q C;  4WUY A;  4B8C B;  5LCW C;  3EUV A;  4C9B B;  3V79 K;  1LD7 A;  1BD8 A;  3S7J A;  5FQ6 A;  4A1S A;  3KSQ A;  2RKK A;  5ENR D;  3TAX A;  3KS2 A;  2XGO A;  3G2S A;  2PM7 A;  1BU9 A;  3FEX A;  3IKO B;  5CEC B;  2IU1 A;  5H7P A;  3E34 A;  4KT6 B;  2GRO B;  3QWP A;  1KT1 A;  4JHK A;  3E32 A;  3SI5 A;  3JXJ A;  3Q75 A;  3LXU X;  1SQM A;  4I9C A;  3KEZ A;  4HB5 A;  5AN8 A;  2XEE A;  2AW6 A;  3I3N A;  1HF8 A;  4N3B A;  3LYA A;  3DXK G;  4EQF A;  3IEG A;  1JWF A;  5B1A E;  2YHE A;  3J5P A;  4XEI G;  3B7B A;  1MZC A;  3BG0 B;  1FVH A;  2Q7F A;  2CFU A;  1IQR A;  2VJ8 A;  3L16 A;  4APO A;  3CVY A;  2WXN A;  3SFZ A;  5FQ7 A;  2L9B A;  3Q78 A;  4U04 A;  2J8S D;  5LOZ A;  4FHJ A;  3D9N A;  3LJN A;  1Q2Z A;  4GTR A;  4GML A;  1JCQ A;  2VGX A;  4L2L A;  1UN9 A;  3FTW A;  3Q9U C;  2DIW A;  4EEC A;  3C3R A;  1X81 A;  3DSV A;  3CK8 A;  2H6F A;  4CGV A;  3UTM A;  3FDH A;  4MBG A;  5CRV A;  2XGM A;  3DBS A;  2RD0 A;  4CT0 A;  4UWL A;  4AP2 A;  3ZVV A;  2A5U A;  4DX6 D;  3CVV A;  3ASF A;  3B7S A;  3KEA A;  3JUI A;  3V30 A;  3D9J A;  3NQP A;  4Y6W A;  4N2Q A;  5T8I A;  1QZ2 A;  3VLE A;  3L82 A;  5ENT D;  4GTO A;  3PNT B;  4KXK B;  4UUC A;  2XPY A;  3MA5 A;  4FUL A;  3LY7 A;  5DBK A;  4GPM A;  2LSU A;  2QY7 A;  4TUM A;  1INZ A;  3NOC D;  3TWV A;  4HBD A;  4G23 A;  3ZW3 A;  2OVB A;  3UT4 A;  3CHP A;  3TWS A;  4P29 A;  4N5C A;  3ZFW A;  1E7V A;  4QQI A;  4U0S A;  4HOU A;  3ASH A;  1KT0 A;  3ASN E;  2V8S E;  2LO6 A;  2Y4T A;  1VDY A;  2WXG A;  3ASD A;  2V5F A;  3C5R A;  3UQ3 A;  2WXM A;  2DZO A;  4X8Q A;  4J6I A;  1W3B A;  3FUD A;  2IFU A;  2GRR B;  2I1K A;  4ME2 A;  2XEN A;  4RVB A;  5CMY A;  4FHK A;  4GZ6 A;  4I17 A;  2P9P G;  2KM4 A;  1OCZ E;  2GRQ B;  4GU5 A;  3ML9 A;  3AG4 E;  1ELK A;  5AEN A;  2A5E A;  3LCA A;  5LFA A;  4A3V A;  1WY6 A;  2XQ0 A;  2C0L A;  1IHG A;  5AJL A;  3NF1 A;  4Y6C A;  4CYM D;  3VTY A;  3K9I A;  3AAA C;  4PS3 A;  3KD7 A;  5J08 A;  2XZT G;  2J08 A;  4RG9 A;  3PH0 C;  2ZIS A;  1OT8 A;  3Q79 A;  4E6H A;  3D3M A;  3FTU A;  5FTP A;  4BTA A;  2DYS E;  2FO1 E;  2X6J A;  2FEZ A;  2Y0B G;  3ZIM A;  4G26 A;  1UJK A;  3Q4A B;  3IV0 A;  2OEW A;  1DNP A;  3T8K A;  3HYM B;  2OVF A;  3VLD A;  4Q94 A;  1O1R A;  3DEO A;  2B6C A;  2PNN A;  1OWO A;  2WXO A;  5BXU A;  3MGB A;  1N54 A;  4I43 A;  4HRM B;  1SZA A;  5B3S E;  2J9Q A;  2ETC A;  3OAW A;  2JEK A;  5CRU A;  3RJV A;  4B8A A;  1SVX A;  2R05 A;  3NOG D;  4DI4 A;  1Z6T A;  1H2T C;  2P58 C;  3TXN A;  2RFA A;  4K5A B;  3FHE A;  3SFY A;  1QQE A;  3CK7 A;  1HH8 A;  5G55 A;  1BLX B;  1BI7 B;  2Y1L E;  3FUK A;  4GZC A;  4HXI A;  2KCV A;  3PRZ A;  1KLX A;  3CVU A;  4F3V A;  2R59 A;  5AJD A;  3CHO A;  1K1B A;  1MJ0 A;  1N95 A;  3HXE A;  3D9O A;  5KCM A;  3QAR A;  4OAV B;  3Q49 B;  2J4B A;  1N4S A;  3CIA A;  3SGH A;  3CVX A;  1D8D A;  4TRQ A;  4N5Q A;  2XS1 A;  3CVP A;  3VLF A;  4A3T A;  3B7R L;  3UT8 A;  4JEH A;  3CHR A;  1N0Q A;  4V3I A;  5D0O D;  2PL2 A;  4MKT A;  3UM1 A;  4GA1 A;  3HXB A;  2QC9 A;  3AG3 E;  4YDE A;  1H2V C;  4DX1 A;  2P9U G;  4ANU A;  5EID A;  4M3O A;  1E7U A;  4LER A;  5HKP A;  3FUM A;  5ENQ D;  1QYM A;  4JVS A;  5EIL A;  2F8Y A;  4FJZ A;  2JLB A;  3D9L A;  3LDZ A;  3D9M A;  1K1A A;  1TNZ A;  1TJC A;  4U8V D;  2GRL A;  3CV0 A;  2VGY A;  1OCC E;  2P9S G;  5FQ8 A;  3FUI A;  3AU5 A;  1P5Q A;  2H6I A;  1U3D A;  1HE8 A;  2I9C A;  2M63 A;  3KSL A;  4XKB A;  1TN6 A;  3FTZ A;  4B89 A;  4AY6 A;  3GZS A;  4J7W A;  4GA0 A;  2WMO A;  3FU0 A;  4J8S A;  1O5M A;  4CDM A;  4DRX E;  4J0U A;  3MYV A;  2I2O A;  5T4Y A;  5CEA A;  3UUX A;  2FF4 A;  3ISM C;  2UY1 B;  2ION A;  1WM5 A;  2J07 A;  2HO1 A;  2BKK B;  3NZS A;  4CEM A;  1JPL A;  5ARG A;  5CBO A;  5DIZ A;  4EZJ A;  5JA4 D;  4YDW A;  1N4P A;  4JPS A;  2ZIR A;  1Z3X A;  1GW6 A;  3FU3 A;  2P9I G;  2Y3A A;  4L1B A;  1ELR A;  5FQ4 A;  2WQH A;  3T5V A;  2QYJ A;  3BQO A;  5EKQ D;  4OAU C;  1H6P A;  2VQ2 A;  4IUL A;  4ZFH A;  1A5E A;  4PS8 A;  2MOW A;  5BV0 A;  5IY5 E;  1TNB A;  4ANV A;  3AG1 E;  1U2V G;  1TNO A;  4GAA A;  2GRN B;  4I9E A;  2WXF A;  5KWD A;  5AYW D;  5FT9 A;  4OVU A;  3ZN3 A;  2ETB A;  4JEU A;  3ZRH A;  1MYO A;  3ULY A;  3JQ0 A;  1E8W A;  3AJI A;  4TV3 A;  4C0M A;  2WXJ A;  2PM6 A;  3CQC B;  4B94 A;  5M72 A;  4L23 A;  4N2S A;  3ZEF A;  3QWW A;  4IRU A;  4F53 A;  3HXC A;  3EHQ A;  2QYU A;  4LEU A;  3WG7 E;  5EN5 D;  4DX2 A;  2WXQ A;  4BEP A;  2L6J A;  3LS8 A;  2HE0 A;  2E0I A;  4GYY A;  3GZ1 A;  5AIJ A;  4ANW A;  5CCL A;  1H2U A;  1IXV A;  2LAH A;  2LXM A;  3TXM A;  3FH5 A;  4RQI A;  3UXG A;  1FT1 A;  3PDN A;  3FUF A;  2BTD A;  2KAT A;  4NUR A;  2MYO A;  2Y69 E;  3HIZ A;  4AJW A;  2XCC A;  4XKC A;  4PDX A;  2EIM E;  4GMJ A;  4NAC A;  4FJY A;  4FLB A;  2A4Z A;  1N11 A;  4I1O B;  4GZD A;  4H7Y A;  3J5Q B;  3UX4 A;  1IQU A;  1X5B A;  4YND A; 
#chains in the Genus database with same CATH homology
 2P9P G;  3RSE G;  2P9I G;  3ULE G;  2P9K G;  2P9N G;  3DXM G;  4XEI G;  2P9L G;  4JD2 G;  2P9S G;  3UKR G;  1U2V G;  2P9U G;  1K8K G;  3DWL G;  3UKU G;  1TYQ G;  3DXK G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...