3U64A

The crystal structure of tat-t (tp0956)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
271
structure length
271
Chain Sequence
DFTRVFTEEDDLDLVAQSLPLVLKVYEALHLQNPAHRGLSLAVGRLYIMYANAFVQTPAQYLPEDEFEAQNEAYSRARKLYLRGARYALSSLETAYPGFTREVFSGDEQRLHKVLSRCTRVDVGTLYWVGTGYVAAFALTPLGSALPDTVHAAVMMLERACDLWPSYQEGAVWNVLTKFYAAAPESFGGGMEKAHTAFEHLTRYCSAHDPDHHITYADALCIPLNNRAGFDEALDRALAIDPESVPHNKLLVILSQKRARWLKAHVQDFFL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Protein TP_0956
publication title Structural, Bioinformatic, and In Vivo Analyses of Two Treponema pallidum Lipoproteins Reveal a Unique TRAP Transporter.
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum
total genus 106
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2011-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16811 TAtT TRAP transporter T-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.920 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3u64A00
4DI4A 4DI3A 3U64A
chains in the Genus database with same CATH superfamily
3FU6A 2WQ6A 1HU3A 4GPKA 4LUNU 4OVVA 2X6HA 2X6IA 4HRMB 1U2VG 1S70B 3IKOB 1UJKA 2VGYA 4G8LA 4YDOA 4QFVA 2XRZA 1IKND 2L9BA 3JQ1A 2RG8A 1TNUA 2V5FA 3DBSA 4CT4A 1N9AA 2VSYA 2QFCA 2L6BA 4APOA 1B89A 2A5EA 3C3RA 1H6KA 3KAEA 2DVWA 4DX2A 3HHMA 4H7XA 1K3ZD 3CVXA 3FDHA 1PY1A 4L2LA 1KLXA 4U8VD 4TRQA 3FH7A 2PQRA 3FUNA 2P9KG 3MX3A 4ANXA 5AARA 2ETBA 4OAVB 4UI9K 4L1BA 3ZVVA 5AN8A 2BKKB 2YHCA 4I17A 4DJAA 4U0ZA 1U3DA 4DUIA 2Q7FA 3MEKA 3L6AA 3NAWA 4TUMA 3T8MA 5BXOA 2Y1LE 3DSTA 3L9TA 5BT1A 5FQ4A 3I3NA 3RO3A 5BV1A 4JEHA 2XEVA 4GTOA 2YQ8A 2V4LA 2L0TB 3R9AB 4GMRA 4GB9A 5E76A 3MV2B 1MX4A 2LAIA 3CHRA 4GZCA 4UWFA 2HO1A 4U63A 4I1AA 2LUHA 3U66A 4GU5A 3CQCB 1N94A 5KCMA 4RLYA 3EJNA 5AJDA 4ANWA 1JCQA 4NRHB 3L08A 2Y4TA 4F53A 1Z6TA 5BUZA 1OWPA 5JHAA 3GZSA 4GZ3A 3KSQA 2X6FA 2XQ0A 4N2SA 4KXKB 2WMOA 3Q15A 3QDNA 5EN5D 3R7RA 3FUDA 2R17C 1NP7A 1DNPA 1NL4A 4GTPA 2DYRE 1IQRA 2J09A 4UQZA 5B1BE 5CBOA 5FTPA 3OXFA 1IHBA 4DRXE 1KT1A 4RG6A 2DZOA 5C1DA 1LF8A 5CMWA 1INZA 1H2VC 1O1RA 4XIFA 1DCQA 2CG2A 3CGHA 4ATGA 3TAXA 2WXHA 3AJIA 4B0ZA 3I4RB 4I9CA 2FBNA 2XPYA 2NXPA 5FT9A 3U64A 3Q73A 4X8QA 2OEWA 4WWNA 2XRYA 3QKYA 3IEGA 4YNDA 4DX6D 2HM8A 4ZFHA 2I6HA 4EBAG 2YHEA 2WXLA 2QZAA 1OCRE 4GYWA 4GZDA 2FF4A 4GTSA 4PDXA 3VLFA 4XI0A 3D9PA 3DSSA 2JEKA 2DYSE 3B7TA 3ZRHA 3ZPJA 3TG4A 4N3AA 3ZYLA 3EIJA 3ML8A 3CHPA 3PUKA 4HLEA 4NACA 4I6GA 2IOSA 5C2YA 3AAAC 3ABME 4L7TA 3EHQA 1XGWA 3EU5A 5JJ6A 2A4ZA 2P2CP 4GTTA 4DX5D 3C3OA 2NC9A 4N5CA 5ARFA 2QYUA 3FUKA 4N3CA 4HI9A 5CCMA 3VLEA 1H2UA 4BX9A 4DLOA 2NYJA 4JHJA 3G2VA 2L0IA 1TN7A 5HI7A 3CVUA 1KZPA 4APFA 2OVBA 1SQMA 3SY2A 5FWQA 3UINC 3X2QE 2H6IA 1JWGA 2P9LG 3CHQA 3V2XA 4G25A 2J08A 5ITZF 3C3QA 1HG2A 2DCPA 2WXGA 1H19A 4OYSA 1AWCB 2UWJG 3FEYA 3ASHA 3QNKA 4LNUD 5AQ9A 3UT7A 5KWDA 3FTWA 1MZCA 2MYOA 3PUJA 4EZJA 4HOQA 3PE4A 4CEMA 2VTBB 1E7UA 4U04A 3L17A 4Y6CA 4ACKA 3RKVA 3DRAA 1TNOA 1KPSB 2HYZA 2C0MA 2KM4A 2X6JA 4BY6A 1HXIA 2WXOA 1SZAA 5ENTD 4U96D 4BTAA 3NBNB 4HOSA 1K8KG 1GW6A 3CVQA 2ZXWE 2C2LA 5FJYA 3F6QA 5KBAA 2AWIA 5J90A 4CGWA 2ZISA 3HVEB 1ZBPA 4JA9A 3TG5A 4AM9A 4HS2A 4D10C 3C72A 4FP7A 4DI4A 3LJ3A 4A1GA 1TYQG 4PH4B 4M3OA 3BU8A 3CVNA 2Y4UA 2MHKA 3T5VA 5D0QD 3SQVA 5KJKA 5BPPA 3JQ0A 2LAHA 4AIFA 4I1OB 4MKTA 3UM2A 4E6HA 1TJFA 4WWPA 3TWSA 4C48B 2KZTA 5AIJA 4LRZA 3FWVA 2XZDG 1BD8A 3JUIA 2XS1A 4RG9A 5A7DB 3ESKA 5LCWJ 4B94A 4BEPA 4C9BB 2IO3C 2R02A 3ZU7B 4XE0A 2R2LA 1SA5A 4YVQC 1OCZE 3EDTB 2FI7A 4ANUA 3PEVB 3FY4A 3FULA 2KCLA 2IJGX 3UMVA 1UG3A 3ASGA 1XNFA 2QC9A 2I1JA 3U9WA 4TXQA 4A55A 4GTMA 3Q75A 1OWLA 3SD5A 3EIQC 4UQYA 4G11A 4AXHA 3FTSA 3ZW3A 3MKQA 2WXQA 4RSYA 4UQXA 4FLBA 4GTVA 1DC2A 5AQBA 3ASNE 3MZLB 3KS2A 4TXRA 2IO2C 5JMND 3RRUA 4HVBA 3L13A 4HXIA 3JUEA 2I2OA 5KJLA 4YDYA 3TWQA 3ZXSA 4TUUA 4JHKA 5CMYA 3U3WA 1DVPA 3GYZA 3FHEA 1ZB1A 3KEZA 1O1TA 5T3RA 3AS5A 3FUIA 2KC7A 3RAUA 2IU1A 3SBTB 4B93B 3G2UA 1TN6A 2LNIA 1N4QA 1PC2A 3HIZA 4BTBA 1YYHA 2P9SG 4F1SA 1S64A 3Q79A 3SNXA 4DI3A 4DX1A 3UPVA 1H6PA 4GTRA 4PS7A 1DCEA 4AVXA 5JJ7A 4I9EA 4G24A 2PL2A 1BU9A 1TJCA 4G26A 2P9IG 3FTZA 4BT8A 5FQ7A 3PE3A 4ATZD 4GZ5A 5ANLA 2X6KA 4WNEA 4U95D 4G23A 4G2VA 2DWZA 1E8ZA 3J5PA 3AS4A 3CQGB 4XI9A 4JD2G 3UT4A 2ILRA 2PM7A 3R7QA 3IHVA 4UUCA 4KYOB 3LPZA 1OWNA 3ENEA 5H7PA 2ETCA 5EILA 3QWWA 2WXMA 4AV7A 2GRNB 2KCVA 4WUYA 4XX5A 4CZ2D 1NZNA 5T4YA 3LXUX 4HBDA 4GPMA 1EYHA 4N5QA 5EYPF 4HI8A 4CDMA 1NFIE 4J8DA 5FZRA 3CKBA 1N0RA 4URKA 3C5RA 1NI1A 3E33A 1S0PA 3N71A 5A23A 2WXRA 3VTYA 1FVHA 3RO2A 5BV0A 3TJPA 4WNDA 4CCAA 4J8FA 4ACLA 3JCKC 3W9GA 1OCOE 1YCSB 4O1PA 5EDSA 3DPYA 2MRIA 1MX6A 2ZIRA 1WDYA 4K03A 4F7AA 1HF8A 4HORA 5G05C 4HRNA 1RZ4A 4FJZA 4XKBA 2XGSA 3WG7E 3SGHA 4U0SA 1QQEA 3D9JA 4A3VA 2RFAA 4BWRA 2AVPA 3HXEA 2EILE 4XZ4A 4JA7A 3D9LA 4CYMD 1MYOA 1N11A 3MYVA 2R03A 2I9CA 1EDUA 4DLQA 2GRPB 3ZXPA 3HG0D 3MA5A 3Q47B 4BESA 2BF0X 4MS6A 2AJAA 4N3BA 4E85A 3NZUA 5G04C 1OY3D 4HRLA 2LXMA 1WM5A 3GZ1A 3L82A 3P2BA 4HFGA 4YDEA 1SW6A 3MGBA 3QOUA 2IOLA 2OEVA 4H7YA 3TWXA 1QNFA 2JABA 4K5AB 1E96B 1Y6IA 3CVLA 5G2NA 2RKKA 2GRQB 4J7WA 4F6RD 3RIBA 2WXNA 3ML9A 3OAWA 1KZOA 4ILIA 5FQ6A 2VJ8A 1TR4A 4HLLA 2PQNA 2EIJE 5CEAA 1BLXB 2WM9A 3DSVA 4IN3B 3QC1A 4I1MA 5ENRD 3AS8A 3ASOE 3TWRA 5HS0A 2FO1E 3ZHEB 3HXBA 2F8XK 2CHZA 2VSNA 4YDWA 2XCCA 1WY6A 4AY6A 1HE8A 1MHQA 5KJNA 5ENOD 4IULA 1HX8A 1Q2ZA 2WPVA 4GCOA 4IRUA 1UN9A 2IF4A 4WNGA 3O48A 1H2TC 2ZU6B 3UM1A 3Q9UC 3CVPA 3PZ2A 1K1AA 4GYYA 2XGMA 2F8YA 4LCTA 2P9NG 3UKUG 3HDXA 3CHOA 2HE0A 4C0EA 3R9MA 4KT6B 2XEHA 1QZ2A 3DEOA 1BI8B 3RRMB 2ZGDA 3PH0C 4UI9C 1O5MA 5HKPA 2KCKA 1LD7A 3ZFWA 2CHWA 2J8SD 3BG0B 1P5QA 4CRWA 3VLDA 5IY5E 2JLBA 3SBSA 2PNNA 5EYLA 2VTBA 2GRRB 3ULQA 3FU3A 3PEUB 2EIKE 4LNGA 2Y0BG 3BQOA 3E34A 4EZLA 3Q4AB 3SF4A 5LFAA 4KMOA 2H6GA 4B8AA 1SVXA 5AYWD 4FHKA 4G8KA 1YMPA 1Z5SC 3O4ZA 4EPZA 3FU5A 4WNFA 2UY1A 4EBAA 2L6JA 4BSZB 4Q69A 3HVEA 4K5CA 3CV0A 4UWHA 4GA1A 2C0LA 5LOZA 4ME2A 5ENPD 3S2AA 4GTQA 4JHRA 2AXUA 3V2OA 3G2WA 3SHFA 3T5XA 3RU0A 2ZGGA 1BI7B 5EIBE 3GZ2A 3DXKG 3AG2E 3UIOC 1ZU2A 2J07A 2J4DA 4FULA 3B7BA 3CK8A 2XS8A 3K9IA 3TWVA 4L23A 2KATA 5JJTA 3CK9A 4I6JA 1S63A 2OV8A 3UX4A 2I1KA 4ILHB 1E8XA 2BKGA 3SI5A 5D66A 3LDZA 3PZ4A 5FQ8A 4NURA 5AAOA 2Y69E 1HH8A 3ABLE 3ISMC 3LCAA 3CKCA 3D9KA 3IV0A 3OTNA 3Q49B 4EQFA 1SZ9A 4XEIG 2R59A 3I4GA 5EIDA 3D9NA 4JW1A 3Q9NC 3ULEG 4JZYA 3V31A 5M72A 3ABKE 5JHBA 3QARA 2VGXB 3D9IA 4MBGA 1FVFA 1W3BA 3LVQE 4I2ZA 1VDYA 4KZ0A 3W9FA 3TWWA 3E32A 3MV3B 3T8KA 3B7SA 4O1OA 1FT2A 2V0PA 4HOUA 3SFZA 3S7BA 1HS6A 2YINA 1IYGA 4BETA 2FEZA 4YVOA 2WVIA 3G2TA 4UWLA 3QWVA 4HNAD 2R05A 3TXNA 3LS8A 1FPPA 2CHXA 5CRVA 4BERA 3FTUA 2B0OE 2PZIA 4R7LA 3OXGA 3PZ3A 4N39A 1ELKA 4L9PA 1ELRA 1UJJA 1Y8MA 2GRLA 5FZSA 2WQHA 3LJNA 2IY0C 3FTXA 2CG3A 2DZNA 3Q7FA 3PVLA 3ESLA 1JPLA 4JL0A 3OXLA 4AOFA 3DWLG 2AXZA 1MX2A 2WXKA 4K5BA 4I2WA 2XEEA 1N4PA 4J8EA 3ONKA 2WXFA 1EF1C 4DK5A 1YA0A 3CLJA 1RW2A 3B7UX 5G55A 4K0RA 1HZ4A 1ELWA 4GAAA 3JXIA 2HR2A 1AP7A 2RD0A 3TXMA 1E7VA 2IONA 1NA3A 4LNBA 5ENNA 3TGOA 1V55E 4ABNA 2A5UA 4J8SA 3NOGD 5E75A 3UIPC 4UWGA 4MRUA 3CSTA 5B1AE 5BNWA 3ZN3A 2EQXA 4RVBA 3LYAA 4FU3A 1IHGA 4N2QA 2DBAA 3CVYA 4F3VA 4EECA 2BTDA 3B7RL 4F1PA 4JB8P 1JUQA 2WXPA 3CR3A 2KXPC 2X3MA 2XCBA 3BG1B 3DXMG 4FLHA 2H6FA 4J8YA 2EINE 4KVMA 1H6OA 3S7JA 3QJZA 5LX8A 4U07A 1QBQA 2X38A 3CIAA 1L5JA 4BFRA 1MQSA 2Y3AA 1BPOA 3VTXA 2B6CA 3ZUVB 2VYIA 3QWPA 4LEUA 5CCLA 2NSZA 3RK6A 1LD8A 4A3TA 4O6FA 2BEDA 2DIWA 2LXLA 4CGVA 2EIME 4CDNA 3Q5MA 1FT1A 3RSEG 3AG4E 1E8YA 2J9QA 2XHEA 1UN8A 5BXUA 3CK7A 3QAQA 5T8IA 3DPDA 1FCHA 4GYOA 5EKQD 5G05J 1KT0A 2R5SA 3EU9A 4I6EA 4FA6A 4Z68A 5CECB 4NIKA 2FULA 1HO8A 3UQ3A 2XPZA 3E30A 2GRMA 3ZKJA 3JYSA 5EX0A 3DSUA 1V54E 3EHMA 2VSXE 4GA0A 3LY9A 3D9MA 4LERA 2H6HA 3NF1A 3GW4A 3QK0A 3ONLA 3EHNA 3ZYQA 1IQUA 1JCRA 5FIOA 4WAFA 1OWMA 4KBQA 2WXIA 3FUFA 1WG0A 3BUAA 4LG6A 4DPRA 1D8DA 3TWTA 5G04J 3PRZA 3E37A 2IFUA 4U8HA 3PREA 1D8EA 1OCCE 3EUVA 3L22A 5ENQD 3IXEA 4FADA 3UT8A 3V79K 2P9UG 4Y6WA 4J0UA 2YNQA 4AP2A 3ZHEA 5CBNA 4GA2A 2OVFA 4U7EB 3FTYA 4V3IA 2IQCA 3U4TA 4U0UA 2OOEA 5LP0A 3SZ7A 2XGOA 2RFMA 2J49A 2XENA 4ILGA 5D0OD 4C0MA 3ZGQA 3CEQA 3AG1E 3ZEFA 4TV3A 2AW6A 4O60A 2E0IA 3HRAA 4NQ0A 3L54A 4PS8A 1X81A 2AXVA 4HOTA 2LSVA 4UWKA 5J08A 3V30A 4AY5A 4G1TA 3D9OA 4P29A 1X5BA 3PDNA 4KZCA 4L2YA 3I5PA 1A17A 3LKUA 3EHRA 4A63B 3PNLB 3HYMB 3JXJA 4JC8A 3NZSA 5FINA 2OCCE 4ZHBA 1JCSA 5B3SE 5ANRA 3SO8A 4DX7D 4JEUA 1QYMA 1EPUA 4CDRA 1TNZA 5AJLA 2P58C 5CEDB 4RQIA 4B89A 4WWOA 5JA4D 2V5QC 3NB2A 4PS3A 3UKRG 4UI9J 1H0AA 1LTXA 3Q78A 3AG3E 3AU4A 1NA0A 2LSUA 1TNBA 1E90A 2QYJA 4HQDA 3IBEA 5ARGA 3FU0A 3ZYKA 2CFZA 3ZIMA 3L16A 3FH8A 3QB2A 1TNYA 3IHYA 4CT0A 5KNHD 1IXVA 2V8SE 3TWUA 4KVOA 3KD7A 2KBXA 2PM6A 3FH5A 3SFYA 5AENA 5AQ7A 5CERB 2VSOE 3UUXA 3CVVA 3KSLA 3FEXA 5EX3A 1N4RA 1SA4A 3UM0A 3PZ1A 4IYPA 3AU5A 2V4HC 3URZA 1N0QA 2M63A 3PS6A 3DSWA 5ENSD 4MLPA 2UY1B 4HB5A 5HQ8A 1U3CA 4BX8A 2FO7A 4PUCA 1E8WA 4OAUC 1UOHA 4EZKA 1D9SA 4GMLA 4GCNA 5HRYA 4QQIA 5KNGA 3ASFA 2E2EA 3PNTB 2GW1A 3HXFA 5CRUA 4FJYA 3UM3A 1K1BA 3ZYMA 1N52A 3FTVA 1HFAA 3DEPA 5CHEE 3Q7AA 4Q96A 2WQ7A 3FUMA 5D2MC 3CVWA 2XZTG 5DBKA 3MCXA 4BT9A 3TL5A 3HXCA 2VGEA 5LCWC 3D3MA 3FP3A 4J6IA 3FFLA 3S7FA 3KEAA 3MJWA 3APFA 3B95A 4FHJA 3FUHA 1JWFA 2J4BA 3J5QB 4B8CB 4M7CA 3SFXA 3UTMA 2IEJA 1Z3YA 1OT8A 3UXGA 2VGXA 2WMNA 3S7DA 3LY7A 3C98A 2KZTB 3LY8A 2ETAA 1OUVA 1TN8A 1A5EA 4AJWA 1Z3XA 3WXXA 2CFUA 4ANVA 1OXJA 3FUJA 3HXDA 4OVUA 4FC8A 3B13A 2GGFA 2F37A 3RJVA 3APCA 5A6CA 3CSFA 4GMJA 5KJMA 1OWOA 4W9RA 1N95A 1TEZA 5AQAA 2F0YA 5FZQA 4LSZE 3APDA 4JPSA 3RRNB 1N54A 1PAQA 3NOCD 5DIZA 4AEZC 3FUEA 1N4SA 2WB2A 1HG5A 3G2SA 3MKQB 3DSXA 2VQ2A 3CHMA 3D9HA 5BW8C 2BUGA 4TXPA 2LO6A 2ONDA 4EHMA 2WXJA 3LEWA 3CHSA 3ASDA 3ULYA 4GZ6A 4BSXA 3T9KA 4Q94A 2P9PG 4XKCA 3MKRA 1WAO1 3LVRE 4A1SA 3P1UA 2XPIA 3PZDA 3BEEA 3UI2A 2QY7A 4U8YD 2GROB 2MOWA 1MJ0A 1UW4B 1O1SA 4I43A 3E4BA 1G3NB 4JXTA 3NQPA 4JVSA 3ZNGA
chains in the Genus database with same CATH topology
3RRMB 4WWPA 3FU6A 2WQ6A 5AIJA 2KZTA 1HU3A 2FULA 3FWVA 3PH0C 1HO8A 4LRZA 4LUNU 4OVVA 4GPKA 2X6HA 2X6IA 2XPZA 4UI9C 3UQ3A 3JUIA 2GRMA 4RG9A 2KCKA 3JYSA 5EX0A 5A7DB 3IKOB 3ESKA 5LCWJ 3EHMA 2VSXE 4B94A 1UJKA 2VGYA 4C9BB 4GA0A 4XE0A 3LY9A 3ZFWA 3D9MA 4QFVA 4LERA 2XRZA 2L9BA 2CHWA 3NF1A 3JQ1A 3BG0B 3GW4A 4YVQC 3QK0A 3ONLA 1P5QA 3EHNA 4CRWA 2RG8A 3ZYQA 1IQUA 2V5FA 2FI7A 3DBSA 3EDTB 2VSYA 3FY4A 3PEVB 4WAFA 3VLDA 1OWMA 2QFCA 4ANUA 4KBQA 2JLBA 2WXIA 3FULA 4APOA 2KCLA 1B89A 3FUFA 3SBSA 2IJGX 3UMVA 4DPRA 1UG3A 3ASGA 4CT4A 2VTBA 1XNFA 1H6KA 2I1JA 3U9WA 3KAEA 3ULQA 5G04J 3FU3A 3PRZA 3PEUB 4A55A 3HHMA 4H7XA 2IFUA 4U8HA 3CVXA 3PREA 1OWLA 3SD5A 3EIQC 3FDHA 4UQYA 1PY1A 3L22A 4L2LA 4FADA 1KLXA 4G11A 4EZLA 4AXHA 3FTSA 3Q4AB 3UT8A 3ZW3A 3SF4A 4TRQA 3FH7A 4Y6WA 4J0UA 3MKQA 2WXQA 2PQRA 2YNQA 4AP2A 4KMOA 3FUNA 4RSYA 5LFAA 3ZHEA 4B8AA 4GA2A 3MX3A 4FLBA 4UQXA 5AYWD 4ANXA 4FHKA 4UI9K 4L1BA 3ZVVA 3O4ZA 4EPZA 3FU5A 4WNFA 2UY1A 2OVFA 4EBAA 2L6JA 3FTYA 2YHCA 4I17A 3MZLB 4V3IA 4Q69A 3KS2A 4DJAA 2IQCA 4U0ZA 3HVEA 3RRUA 4HVBA 3L13A 4HXIA 4U0UA 2OOEA 3U4TA 3CV0A 4UWHA 1U3DA 4GA1A 2C0LA 5LP0A 3SZ7A 2XGOA 2Q7FA 3MEKA 3L6AA 3T8MA 2J49A 5LOZA 2I2OA 4ME2A 4ILGA 5D0OD 4C0MA 5BT1A 5FQ4A 3I3NA 3RO3A 3ZGQA 5KJLA 3S2AA 3CEQA 5BV1A 4JEHA 2XEVA 3ZXSA 2YQ8A 2V4LA 4JHRA 2L0TB 2AXUA 4TUUA 4JHKA 5CMYA 3R9AB 1DVPA 3U3WA 3GYZA 3FHEA 4GB9A 3G2WA 3KEZA 3MV2B 5E76A 4TV3A 3SHFA 3ZEFA 2AW6A 2E0IA 5T3RA 3T5XA 3AS5A 3FUIA 2LAIA 4NQ0A 3CHRA 2KC7A 3L54A 4PS8A 3RU0A 4GZCA 2AXVA 4UWFA 4HOTA 2HO1A 4U63A 4I1AA 3U66A 2LSVA 2IU1A 3SBTB 4GU5A 4UWKA 5J08A 3CQCB 3GZ2A 4AY5A 3G2UA 5KCMA 2LNIA 4G1TA 3D9OA 1PC2A 4P29A 1X5BA 1ZU2A 3HIZA 4BTBA 3EJNA 3PDNA 5AJDA 4F1SA 2J07A 4KZCA 4L2YA 4ANWA 3I5PA 2J4DA 3L08A 4FULA 4NRHB 1A17A 2Y4TA 3CK8A 3LKUA 3SNXA 4F53A 1Z6TA 3K9IA 4DI3A 5BUZA 3PNLB 3HYMB 3UPVA 1OWPA 5JHAA 4PS7A 4JC8A 3GZSA 4GZ3A 4L23A 3NZSA 4AVXA 5JJ7A 4I9EA 2KATA 5JJTA 2X6FA 3CK9A 2XQ0A 4I6JA 4N2SA 4KXKB 5ANRA 2WMOA 3Q15A 4G24A 2OV8A 3QDNA 3UX4A 2I1KA 4JEUA 2PL2A 3R7RA 4ILHB 1EPUA 4CDRA 1E8XA 5AJLA 2P58C 3FUDA 2R17C 1TJCA 3SI5A 4B89A 3LDZA 4G26A 1NP7A 1DNPA 4WWOA 5FQ8A 3FTZA 1IQRA 2J09A 4PS3A 4NURA 4UQZA 4UI9J 1H0AA 4BT8A 1HH8A 3AU4A 5FQ7A 3PE3A 3LCAA 5FTPA 1NA0A 4GZ5A 3OXFA 2LSUA 2X6KA 4WNEA 5ANLA 3CKCA 1KT1A 3D9KA 3IV0A 4G23A 4RG6A 3OTNA 4G2VA 5C1DA 1E90A 1LF8A 5CMWA 3Q49B 1INZA 1H2VC 4EQFA 1SZ9A 4XIFA 1E8ZA 2R59A 3IBEA 5ARGA 2CG2A 3CGHA 3FU0A 3I4GA 3ZYKA 3TAXA 4ATGA 3AS4A 3CQGB 2WXHA 3D9NA 4XI9A 4JW1A 2CFZA 3ZIMA 3UT4A 2ILRA 4JZYA 4B0ZA 3I4RB 3L16A 3FH8A 3QB2A 4I9CA 2PM7A 5M72A 2FBNA 2XPYA 2NXPA 3IHVA 5FT9A 3R7QA 3U64A 5JHBA 3QARA 2VGXB 3IHYA 4CT0A 3D9IA 2V8SE 4KYOB 3LPZA 4WWNA 2XRYA 3QKYA 1FVFA 1OWNA 4KVOA 1W3BA 3ENEA 3KD7A 3IEGA 4YNDA 2HM8A 3LVQE 4I2ZA 2I6HA 2PM6A 1VDYA 3QWWA 2WXMA 4AV7A 4KZ0A 3MV3B 2KCVA 4EBAG 2YHEA 3B7SA 4WUYA 4XX5A 1NZNA 5T4YA 2WXLA 3FH5A 2V0PA 4HOUA 5AENA 3LXUX 3SFZA 2VSOE 3S7BA 3UUXA 1HS6A 2YINA 1EYHA 3CVVA 1IYGA 2FEZA 4GYWA 4GZDA 4YVOA 2FF4A 2WVIA 3G2TA 4UWLA 3QWVA 3FEXA 3TXNA 3LS8A 5EX3A 4CDMA 4PDXA 4J8DA 3VLFA 4XI0A 3D9PA 2JEKA 5FZRA 4IYPA 3CKBA 2CHXA 3B7TA 3ZRHA 3ZPJA 4URKA 3AU5A 3TG4A 4N3AA 3URZA 3FTUA 2M63A 3ZYLA 3PS6A 3EIJA 3ML8A 1S0PA 2PZIA 3CHPA 3PUKA 4NACA 4R7LA 4HLEA 3N71A 4I6GA 2IOSA 3OXGA 2UY1B 4MLPA 2WXRA 4N39A 1ELKA 5A23A 5C2YA 3VTYA 5HQ8A 1ELRA 1UJJA 1FVHA 3RO2A 4L7TA 1U3CA 4BX8A 5BV0A 3TJPA 2FO7A 4WNDA 4CCAA 1Y8MA 4PUCA 1E8WA 4J8FA 2GRLA 5FZSA 1XGWA 2WQHA 4ACLA 3JCKC 4EZKA 4GMLA 4GCNA 5JJ6A 3FTXA 2A4ZA 5EDSA 2CG3A 3ASFA 2MRIA 2E2EA 3PVLA 3ESLA 1JPLA 3PNTB 2GW1A 4FJYA 4K03A 4F7AA 2NC9A 1HF8A 4HORA 5G05C 3ZYMA 4JL0A 3OXLA 4N5CA 5ARFA 4AOFA 1N52A 3FUKA 4N3CA 3FTVA 1HFAA 4FJZA 4XKBA 5CHEE 2AXZA 4Q96A 2WQ7A 2XGSA 2WXKA 4I2WA 3FUMA 3SGHA 5CCMA 3CVWA 4J8EA 5DBKA 3ONKA 2WXFA 3VLEA 1EF1C 4U0SA 4DK5A 3MCXA 1H2UA 4BT9A 1QQEA 1YA0A 3CLJA 4BX9A 3TL5A 3D9JA 4A3VA 3B7UX 4DLOA 4BWRA 5G55A 2AVPA 4K0RA 1HZ4A 4JHJA 3G2VA 2L0IA 4XZ4A 1ELWA 5LCWC 4JA7A 3D3MA 3FP3A 3D9LA 4J6IA 4GAAA 5HI7A 3FFLA 3CVUA 4APFA 3S7FA 3MYVA 3MJWA 2I9CA 2OVBA 1SQMA 1EDUA 2HR2A 3APFA 4FHJA 2RD0A 4DLQA 3FUHA 3TXMA 1JWFA 5FWQA 2J4BA 4B8CB 1E7VA 2IONA 3MA5A 3Q47B 4FA6A 1NA3A 1JWGA 2BF0X 5ENNA 4MS6A 1Z3YA 4N3BA 3TGOA 3CHQA 4E85A 4ABNA 4G25A 2VGXA 2WMNA 3S7DA 2A5UA 3LY7A 3C98A 4J8SA 2KZTB 3NZUA 5E75A 3LY8A 5G04C 2J08A 1OUVA 1WM5A 4UWGA 1HG2A 1Z3XA 2DCPA 2WXGA 4MRUA 2CFUA 3WXXA 4AJWA 4ANVA 3GZ1A 1H19A 3CSTA 4OYSA 3FUJA 2UWJG 3P2BA 4OVUA 3FEYA 5BNWA 3ZN3A 4FC8A 2EQXA 3B13A 4HFGA 4RVBA 3MGBA 2GGFA 3LYAA 3ASHA 3QNKA 3QOUA 4FU3A 1IHGA 2IOLA 4N2QA 4H7YA 3RJVA 2DBAA 3APCA 1QNFA 3UT7A 5A6CA 3CVYA 3FTWA 3CSFA 4GMJA 5KJMA 1OWOA 4W9RA 1E96B 1Y6IA 3CVLA 3PUJA 4F3VA 4EZJA 5G2NA 4EECA 2BTDA 1TEZA 3B7RL 4HOQA 3PE4A 4CEMA 3RIBA 5FZQA 2VTBB 1E7UA 2WXNA 3APDA 3ML9A 3OAWA 4JPSA 1N54A 4U04A 3RRNB 1JUQA 1PAQA 3L17A 2WXPA 3CR3A 5DIZA 4ILIA 5FQ6A 2X3MA 2XCBA 3BG1B 2VJ8A 4AEZC 4Y6CA 2PQNA 4ACKA 3RKVA 4FLHA 3FUEA 2WM9A 4IN3B 3QC1A 2WB2A 2HYZA 1HG5A 2C0MA 2KM4A 2X6JA 3G2SA 4I1MA 3AS8A 4KVMA 4BY6A 3MKQB 1HXIA 3QJZA 3S7JA 2VQ2A 3CHMA 3ZHEB 5LX8A 2WXOA 4U07A 1SZAA 2X38A 2CHZA 3CIAA 4BTAA 2VSNA 1L5JA 4BFRA 4HOSA 1MQSA 5BW8C 2XCCA 2Y3AA 1GW6A 1BPOA 1WY6A 2BUGA 3VTXA 4AY6A 1HE8A 1MHQA 5KJNA 3CVQA 2VYIA 3QWPA 2C2LA 2LO6A 2ONDA 5FJYA 2AWIA 4LEUA 5J90A 4CGWA 5CCLA 2WXJA 3HVEB 3LEWA 2NSZA 4IULA 1HX8A 1ZBPA 3CHSA 3RK6A 4JA9A 3TG5A 4O6FA 4A3TA 3ASDA 4HS2A 4AM9A 2WPVA 4D10C 2DIWA 4FP7A 4GCOA 4CGVA 4CDNA 3Q5MA 4IRUA 4DI4A 1UN9A 4GZ6A 4BSXA 2IF4A 4WNGA 3O48A 3LJ3A 4A1GA 1H2TC 4Q94A 2ZU6B 4PH4B 4XKCA 4M3OA 3MKRA 3CVPA 1WAO1 3CVNA 3LVRE 2Y4UA 1E8YA 4A1SA 2MHKA 3P1UA 2XPIA 2J9QA 2XHEA 3PZDA 4GYYA 3T5VA 2XGMA 5D0QD 3BEEA 1UN8A 3CK7A 2QY7A 3QAQA 5T8IA 4LCTA 3DPDA 1FCHA 5KJKA 4GYOA 5BPPA 3JQ0A 3HDXA 2LAHA 3CHOA 4AIFA 2MOWA 5EKQD 1UW4B 4C0EA 4I1OB 5G05J 4KT6B 4MKTA 4I43A 1KT0A 2R5SA 3E4BA 4I6EA 4E6HA 4JXTA 1QZ2A 3NQPA 4JVSA 1TJFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI4 A;  4DI3 A;  3U64 A; 
#chains in the Genus database with same CATH topology
 3FU6 A;  2WQ6 A;  1HU3 A;  4GPK A;  4LUN U;  4OVV A;  2X6H A;  2X6I A;  4HRM B;  1U2V G;  1S70 B;  3IKO B;  1UJK A;  2VGY A;  4G8L A;  4YDO A;  4QFV A;  2XRZ A;  1IKN D;  2L9B A;  3JQ1 A;  2RG8 A;  1TNU A;  2V5F A;  3DBS A;  4CT4 A;  1N9A A;  2VSY A;  2QFC A;  2L6B A;  4APO A;  1B89 A;  2A5E A;  3C3R A;  1H6K A;  3KAE A;  2DVW A;  4DX2 A;  3HHM A;  4H7X A;  1K3Z D;  3CVX A;  3FDH A;  1PY1 A;  4L2L A;  1KLX A;  4U8V D;  4TRQ A;  3FH7 A;  2PQR A;  3FUN A;  2P9K G;  3MX3 A;  4ANX A;  5AAR A;  2ETB A;  4OAV B;  4UI9 K;  4L1B A;  3ZVV A;  5AN8 A;  2BKK B;  2YHC A;  4I17 A;  4DJA A;  4U0Z A;  1U3D A;  4DUI A;  2Q7F A;  3MEK A;  3L6A A;  3NAW A;  4TUM A;  3T8M A;  5BXO A;  2Y1L E;  3DST A;  3L9T A;  5BT1 A;  5FQ4 A;  3I3N A;  3RO3 A;  5BV1 A;  4JEH A;  2XEV A;  4GTO A;  2YQ8 A;  2V4L A;  2L0T B;  3R9A B;  4GMR A;  4GB9 A;  5E76 A;  3MV2 B;  1MX4 A;  2LAI A;  3CHR A;  4GZC A;  4UWF A;  2HO1 A;  4U63 A;  4I1A A;  2LUH A;  3U66 A;  4GU5 A;  3CQC B;  1N94 A;  5KCM A;  4RLY A;  3EJN A;  5AJD A;  4ANW A;  1JCQ A;  4NRH B;  3L08 A;  2Y4T A;  4F53 A;  1Z6T A;  5BUZ A;  1OWP A;  5JHA A;  3GZS A;  4GZ3 A;  3KSQ A;  2X6F A;  2XQ0 A;  4N2S A;  4KXK B;  2WMO A;  3Q15 A;  3QDN A;  5EN5 D;  3R7R A;  3FUD A;  2R17 C;  1NP7 A;  1DNP A;  1NL4 A;  4GTP A;  2DYR E;  1IQR A;  2J09 A;  4UQZ A;  5B1B E;  5CBO A;  5FTP A;  3OXF A;  1IHB A;  4DRX E;  1KT1 A;  4RG6 A;  2DZO A;  5C1D A;  1LF8 A;  5CMW A;  1INZ A;  1H2V C;  1O1R A;  4XIF A;  1DCQ A;  2CG2 A;  3CGH A;  4ATG A;  3TAX A;  2WXH A;  3AJI A;  4B0Z A;  3I4R B;  4I9C A;  2FBN A;  2XPY A;  2NXP A;  5FT9 A;  3U64 A;  3Q73 A;  4X8Q A;  2OEW A;  4WWN A;  2XRY A;  3QKY A;  3IEG A;  4YND A;  4DX6 D;  2HM8 A;  4ZFH A;  2I6H A;  4EBA G;  2YHE A;  2WXL A;  2QZA A;  1OCR E;  4GYW A;  4GZD A;  2FF4 A;  4GTS A;  4PDX A;  3VLF A;  4XI0 A;  3D9P A;  3DSS A;  2JEK A;  2DYS E;  3B7T A;  3ZRH A;  3ZPJ A;  3TG4 A;  4N3A A;  3ZYL A;  3EIJ A;  3ML8 A;  3CHP A;  3PUK A;  4HLE A;  4NAC A;  4I6G A;  2IOS A;  5C2Y A;  3AAA C;  3ABM E;  4L7T A;  3EHQ A;  1XGW A;  3EU5 A;  5JJ6 A;  2A4Z A;  2P2C P;  4GTT A;  4DX5 D;  3C3O A;  2NC9 A;  4N5C A;  5ARF A;  2QYU A;  3FUK A;  4N3C A;  4HI9 A;  5CCM A;  3VLE A;  1H2U A;  4BX9 A;  4DLO A;  2NYJ A;  4JHJ A;  3G2V A;  2L0I A;  1TN7 A;  5HI7 A;  3CVU A;  1KZP A;  4APF A;  2OVB A;  1SQM A;  3SY2 A;  5FWQ A;  3UIN C;  3X2Q E;  2H6I A;  1JWG A;  2P9L G;  3CHQ A;  3V2X A;  4G25 A;  2J08 A;  5ITZ F;  3C3Q A;  1HG2 A;  2DCP A;  2WXG A;  1H19 A;  4OYS A;  1AWC B;  2UWJ G;  3FEY A;  3ASH A;  3QNK A;  4LNU D;  5AQ9 A;  3UT7 A;  5KWD A;  3FTW A;  1MZC A;  2MYO A;  3PUJ A;  4EZJ A;  4HOQ A;  3PE4 A;  4CEM A;  2VTB B;  1E7U A;  4U04 A;  3L17 A;  4Y6C A;  4ACK A;  3RKV A;  3DRA A;  1TNO A;  1KPS B;  2HYZ A;  2C0M A;  2KM4 A;  2X6J A;  4BY6 A;  1HXI A;  2WXO A;  1SZA A;  5ENT D;  4U96 D;  4BTA A;  3NBN B;  4HOS A;  1K8K G;  1GW6 A;  3CVQ A;  2ZXW E;  2C2L A;  5FJY A;  3F6Q A;  5KBA A;  2AWI A;  5J90 A;  4CGW A;  2ZIS A;  3HVE B;  1ZBP A;  4JA9 A;  3TG5 A;  4AM9 A;  4HS2 A;  4D10 C;  3C72 A;  4FP7 A;  4DI4 A;  3LJ3 A;  4A1G A;  1TYQ G;  4PH4 B;  4M3O A;  3BU8 A;  3CVN A;  2Y4U A;  2MHK A;  3T5V A;  5D0Q D;  3SQV A;  5KJK A;  5BPP A;  3JQ0 A;  2LAH A;  4AIF A;  4I1O B;  4MKT A;  3UM2 A;  4E6H A;  1TJF A;  4WWP A;  3TWS A;  4C48 B;  2KZT A;  5AIJ A;  4LRZ A;  3FWV A;  2XZD G;  1BD8 A;  3JUI A;  2XS1 A;  4RG9 A;  5A7D B;  3ESK A;  5LCW J;  4B94 A;  4BEP A;  4C9B B;  2IO3 C;  2R02 A;  3ZU7 B;  4XE0 A;  2R2L A;  1SA5 A;  4YVQ C;  1OCZ E;  3EDT B;  2FI7 A;  4ANU A;  3PEV B;  3FY4 A;  3FUL A;  2KCL A;  2IJG X;  3UMV A;  1UG3 A;  3ASG A;  1XNF A;  2QC9 A;  2I1J A;  3U9W A;  4TXQ A;  4A55 A;  4GTM A;  3Q75 A;  1OWL A;  3SD5 A;  3EIQ C;  4UQY A;  4G11 A;  4AXH A;  3FTS A;  3ZW3 A;  3MKQ A;  2WXQ A;  4RSY A;  4UQX A;  4FLB A;  4GTV A;  1DC2 A;  5AQB A;  3ASN E;  3MZL B;  3KS2 A;  4TXR A;  2IO2 C;  5JMN D;  3RRU A;  4HVB A;  3L13 A;  4HXI A;  3JUE A;  2I2O A;  5KJL A;  4YDY A;  3TWQ A;  3ZXS A;  4TUU A;  4JHK A;  5CMY A;  3U3W A;  1DVP A;  3GYZ A;  3FHE A;  1ZB1 A;  3KEZ A;  1O1T A;  5T3R A;  3AS5 A;  3FUI A;  2KC7 A;  3RAU A;  2IU1 A;  3SBT B;  4B93 B;  3G2U A;  1TN6 A;  2LNI A;  1N4Q A;  1PC2 A;  3HIZ A;  4BTB A;  1YYH A;  2P9S G;  4F1S A;  1S64 A;  3Q79 A;  3SNX A;  4DI3 A;  4DX1 A;  3UPV A;  1H6P A;  4GTR A;  4PS7 A;  1DCE A;  4AVX A;  5JJ7 A;  4I9E A;  4G24 A;  2PL2 A;  1BU9 A;  1TJC A;  4G26 A;  2P9I G;  3FTZ A;  4BT8 A;  5FQ7 A;  3PE3 A;  4ATZ D;  4GZ5 A;  5ANL A;  2X6K A;  4WNE A;  4U95 D;  4G23 A;  4G2V A;  2DWZ A;  1E8Z A;  3J5P A;  3AS4 A;  3CQG B;  4XI9 A;  4JD2 G;  3UT4 A;  2ILR A;  2PM7 A;  3R7Q A;  3IHV A;  4UUC A;  4KYO B;  3LPZ A;  1OWN A;  3ENE A;  5H7P A;  2ETC A;  5EIL A;  3QWW A;  2WXM A;  4AV7 A;  2GRN B;  2KCV A;  4WUY A;  4XX5 A;  4CZ2 D;  1NZN A;  5T4Y A;  3LXU X;  4HBD A;  4GPM A;  1EYH A;  4N5Q A;  5EYP F;  4HI8 A;  4CDM A;  1NFI E;  4J8D A;  5FZR A;  3CKB A;  1N0R A;  4URK A;  3C5R A;  1NI1 A;  3E33 A;  1S0P A;  3N71 A;  5A23 A;  2WXR A;  3VTY A;  1FVH A;  3RO2 A;  5BV0 A;  3TJP A;  4WND A;  4CCA A;  4J8F A;  4ACL A;  3JCK C;  3W9G A;  1OCO E;  1YCS B;  4O1P A;  5EDS A;  3DPY A;  2MRI A;  1MX6 A;  2ZIR A;  1WDY A;  4K03 A;  4F7A A;  1HF8 A;  4HOR A;  5G05 C;  4HRN A;  1RZ4 A;  4FJZ A;  4XKB A;  2XGS A;  3WG7 E;  3SGH A;  4U0S A;  1QQE A;  3D9J A;  4A3V A;  2RFA A;  4BWR A;  2AVP A;  3HXE A;  2EIL E;  4XZ4 A;  4JA7 A;  3D9L A;  4CYM D;  1MYO A;  1N11 A;  3MYV A;  2R03 A;  2I9C A;  1EDU A;  4DLQ A;  2GRP B;  3ZXP A;  3HG0 D;  3MA5 A;  3Q47 B;  4BES A;  2BF0 X;  4MS6 A;  2AJA A;  4N3B A;  4E85 A;  3NZU A;  5G04 C;  1OY3 D;  4HRL A;  2LXM A;  1WM5 A;  3GZ1 A;  3L82 A;  3P2B A;  4HFG A;  4YDE A;  1SW6 A;  3MGB A;  3QOU A;  2IOL A;  2OEV A;  4H7Y A;  3TWX A;  1QNF A;  2JAB A;  4K5A B;  1E96 B;  1Y6I A;  3CVL A;  5G2N A;  2RKK A;  2GRQ B;  4J7W A;  4F6R D;  3RIB A;  2WXN A;  3ML9 A;  3OAW A;  1KZO A;  4ILI A;  5FQ6 A;  2VJ8 A;  1TR4 A;  4HLL A;  2PQN A;  2EIJ E;  5CEA A;  1BLX B;  2WM9 A;  3DSV A;  4IN3 B;  3QC1 A;  4I1M A;  5ENR D;  3AS8 A;  3ASO E;  3TWR A;  5HS0 A;  2FO1 E;  3ZHE B;  3HXB A;  2F8X K;  2CHZ A;  2VSN A;  4YDW A;  2XCC A;  1WY6 A;  4AY6 A;  1HE8 A;  1MHQ A;  5KJN A;  5ENO D;  4IUL A;  1HX8 A;  1Q2Z A;  2WPV A;  4GCO A;  4IRU A;  1UN9 A;  2IF4 A;  4WNG A;  3O48 A;  1H2T C;  2ZU6 B;  3UM1 A;  3Q9U C;  3CVP A;  3PZ2 A;  1K1A A;  4GYY A;  2XGM A;  2F8Y A;  4LCT A;  2P9N G;  3UKU G;  3HDX A;  3CHO A;  2HE0 A;  4C0E A;  3R9M A;  4KT6 B;  2XEH A;  1QZ2 A;  3DEO A;  1BI8 B;  3RRM B;  2ZGD A;  3PH0 C;  4UI9 C;  1O5M A;  5HKP A;  2KCK A;  1LD7 A;  3ZFW A;  2CHW A;  2J8S D;  3BG0 B;  1P5Q A;  4CRW A;  3VLD A;  5IY5 E;  2JLB A;  3SBS A;  2PNN A;  5EYL A;  2VTB A;  2GRR B;  3ULQ A;  3FU3 A;  3PEU B;  2EIK E;  4LNG A;  2Y0B G;  3BQO A;  3E34 A;  4EZL A;  3Q4A B;  3SF4 A;  5LFA A;  4KMO A;  2H6G A;  4B8A A;  1SVX A;  5AYW D;  4FHK A;  4G8K A;  1YMP A;  1Z5S C;  3O4Z A;  4EPZ A;  3FU5 A;  4WNF A;  2UY1 A;  4EBA A;  2L6J A;  4BSZ B;  4Q69 A;  3HVE A;  4K5C A;  3CV0 A;  4UWH A;  4GA1 A;  2C0L A;  5LOZ A;  4ME2 A;  5ENP D;  3S2A A;  4GTQ A;  4JHR A;  2AXU A;  3V2O A;  3G2W A;  3SHF A;  3T5X A;  3RU0 A;  2ZGG A;  1BI7 B;  5EIB E;  3GZ2 A;  3DXK G;  3AG2 E;  3UIO C;  1ZU2 A;  2J07 A;  2J4D A;  4FUL A;  3B7B A;  3CK8 A;  2XS8 A;  3K9I A;  3TWV A;  4L23 A;  2KAT A;  5JJT A;  3CK9 A;  4I6J A;  1S63 A;  2OV8 A;  3UX4 A;  2I1K A;  4ILH B;  1E8X A;  2BKG A;  3SI5 A;  5D66 A;  3LDZ A;  3PZ4 A;  5FQ8 A;  4NUR A;  5AAO A;  2Y69 E;  1HH8 A;  3ABL E;  3ISM C;  3LCA A;  3CKC A;  3D9K A;  3IV0 A;  3OTN A;  3Q49 B;  4EQF A;  1SZ9 A;  4XEI G;  2R59 A;  3I4G A;  5EID A;  3D9N A;  4JW1 A;  3Q9N C;  3ULE G;  4JZY A;  3V31 A;  5M72 A;  3ABK E;  5JHB A;  3QAR A;  2VGX B;  3D9I A;  4MBG A;  1FVF A;  1W3B A;  3LVQ E;  4I2Z A;  1VDY A;  4KZ0 A;  3W9F A;  3TWW A;  3E32 A;  3MV3 B;  3T8K A;  3B7S A;  4O1O A;  1FT2 A;  2V0P A;  4HOU A;  3SFZ A;  3S7B A;  1HS6 A;  2YIN A;  1IYG A;  4BET A;  2FEZ A;  4YVO A;  2WVI A;  3G2T A;  4UWL A;  3QWV A;  4HNA D;  2R05 A;  3TXN A;  3LS8 A;  1FPP A;  2CHX A;  5CRV A;  4BER A;  3FTU A;  2B0O E;  2PZI A;  4R7L A;  3OXG A;  3PZ3 A;  4N39 A;  1ELK A;  4L9P A;  1ELR A;  1UJJ A;  1Y8M A;  2GRL A;  5FZS A;  2WQH A;  3LJN A;  2IY0 C;  3FTX A;  2CG3 A;  2DZN A;  3Q7F A;  3PVL A;  3ESL A;  1JPL A;  4JL0 A;  3OXL A;  4AOF A;  3DWL G;  2AXZ A;  1MX2 A;  2WXK A;  4K5B A;  4I2W A;  2XEE A;  1N4P A;  4J8E A;  3ONK A;  2WXF A;  1EF1 C;  4DK5 A;  1YA0 A;  3CLJ A;  1RW2 A;  3B7U X;  5G55 A;  4K0R A;  1HZ4 A;  1ELW A;  4GAA A;  3JXI A;  2HR2 A;  1AP7 A;  2RD0 A;  3TXM A;  1E7V A;  2ION A;  1NA3 A;  4LNB A;  5ENN A;  3TGO A;  1V55 E;  4ABN A;  2A5U A;  4J8S A;  3NOG D;  5E75 A;  3UIP C;  4UWG A;  4MRU A;  3CST A;  5B1A E;  5BNW A;  3ZN3 A;  2EQX A;  4RVB A;  3LYA A;  4FU3 A;  1IHG A;  4N2Q A;  2DBA A;  3CVY A;  4F3V A;  4EEC A;  2BTD A;  3B7R L;  4F1P A;  4JB8 P;  1JUQ A;  2WXP A;  3CR3 A;  2KXP C;  2X3M A;  2XCB A;  3BG1 B;  3DXM G;  4FLH A;  2H6F A;  4J8Y A;  2EIN E;  4KVM A;  1H6O A;  3S7J A;  3QJZ A;  5LX8 A;  4U07 A;  1QBQ A;  2X38 A;  3CIA A;  1L5J A;  4BFR A;  1MQS A;  2Y3A A;  1BPO A;  3VTX A;  2B6C A;  3ZUV B;  2VYI A;  3QWP A;  4LEU A;  5CCL A;  2NSZ A;  3RK6 A;  1LD8 A;  4A3T A;  4O6F A;  2BED A;  2DIW A;  2LXL A;  4CGV A;  2EIM E;  4CDN A;  3Q5M A;  1FT1 A;  3RSE G;  3AG4 E;  1E8Y A;  2J9Q A;  2XHE A;  1UN8 A;  5BXU A;  3CK7 A;  3QAQ A;  5T8I A;  3DPD A;  1FCH A;  4GYO A;  5EKQ D;  5G05 J;  1KT0 A;  2R5S A;  3EU9 A;  4I6E A;  4FA6 A;  4Z68 A;  5CEC B;  4NIK A;  2FUL A;  1HO8 A;  3UQ3 A;  2XPZ A;  3E30 A;  2GRM A;  3ZKJ A;  3JYS A;  5EX0 A;  3DSU A;  1V54 E;  3EHM A;  2VSX E;  4GA0 A;  3LY9 A;  3D9M A;  4LER A;  2H6H A;  3NF1 A;  3GW4 A;  3QK0 A;  3ONL A;  3EHN A;  3ZYQ A;  1IQU A;  1JCR A;  5FIO A;  4WAF A;  1OWM A;  4KBQ A;  2WXI A;  3FUF A;  1WG0 A;  3BUA A;  4LG6 A;  4DPR A;  1D8D A;  3TWT A;  5G04 J;  3PRZ A;  3E37 A;  2IFU A;  4U8H A;  3PRE A;  1D8E A;  1OCC E;  3EUV A;  3L22 A;  5ENQ D;  3IXE A;  4FAD A;  3UT8 A;  3V79 K;  2P9U G;  4Y6W A;  4J0U A;  2YNQ A;  4AP2 A;  3ZHE A;  5CBN A;  4GA2 A;  2OVF A;  4U7E B;  3FTY A;  4V3I A;  2IQC A;  3U4T A;  4U0U A;  2OOE A;  5LP0 A;  3SZ7 A;  2XGO A;  2RFM A;  2J49 A;  2XEN A;  4ILG A;  5D0O D;  4C0M A;  3ZGQ A;  3CEQ A;  3AG1 E;  3ZEF A;  4TV3 A;  2AW6 A;  4O60 A;  2E0I A;  3HRA A;  4NQ0 A;  3L54 A;  4PS8 A;  1X81 A;  2AXV A;  4HOT A;  2LSV A;  4UWK A;  5J08 A;  3V30 A;  4AY5 A;  4G1T A;  3D9O A;  4P29 A;  1X5B A;  3PDN A;  4KZC A;  4L2Y A;  3I5P A;  1A17 A;  3LKU A;  3EHR A;  4A63 B;  3PNL B;  3HYM B;  3JXJ A;  4JC8 A;  3NZS A;  5FIN A;  2OCC E;  4ZHB A;  1JCS A;  5B3S E;  5ANR A;  3SO8 A;  4DX7 D;  4JEU A;  1QYM A;  1EPU A;  4CDR A;  1TNZ A;  5AJL A;  2P58 C;  5CED B;  4RQI A;  4B89 A;  4WWO A;  5JA4 D;  2V5Q C;  3NB2 A;  4PS3 A;  3UKR G;  4UI9 J;  1H0A A;  1LTX A;  3Q78 A;  3AG3 E;  3AU4 A;  1NA0 A;  2LSU A;  1TNB A;  1E90 A;  2QYJ A;  4HQD A;  3IBE A;  5ARG A;  3FU0 A;  3ZYK A;  2CFZ A;  3ZIM A;  3L16 A;  3FH8 A;  3QB2 A;  1TNY A;  3IHY A;  4CT0 A;  5KNH D;  1IXV A;  2V8S E;  3TWU A;  4KVO A;  3KD7 A;  2KBX A;  2PM6 A;  3FH5 A;  3SFY A;  5AEN A;  5AQ7 A;  5CER B;  2VSO E;  3UUX A;  3CVV A;  3KSL A;  3FEX A;  5EX3 A;  1N4R A;  1SA4 A;  3UM0 A;  3PZ1 A;  4IYP A;  3AU5 A;  2V4H C;  3URZ A;  1N0Q A;  2M63 A;  3PS6 A;  3DSW A;  5ENS D;  4MLP A;  2UY1 B;  4HB5 A;  5HQ8 A;  1U3C A;  4BX8 A;  2FO7 A;  4PUC A;  1E8W A;  4OAU C;  1UOH A;  4EZK A;  1D9S A;  4GML A;  4GCN A;  5HRY A;  4QQI A;  5KNG A;  3ASF A;  2E2E A;  3PNT B;  2GW1 A;  3HXF A;  5CRU A;  4FJY A;  3UM3 A;  1K1B A;  3ZYM A;  1N52 A;  3FTV A;  1HFA A;  3DEP A;  5CHE E;  3Q7A A;  4Q96 A;  2WQ7 A;  3FUM A;  5D2M C;  3CVW A;  2XZT G;  5DBK A;  3MCX A;  4BT9 A;  3TL5 A;  3HXC A;  2VGE A;  5LCW C;  3D3M A;  3FP3 A;  4J6I A;  3FFL A;  3S7F A;  3KEA A;  3MJW A;  3APF A;  3B95 A;  4FHJ A;  3FUH A;  1JWF A;  2J4B A;  3J5Q B;  4B8C B;  4M7C A;  3SFX A;  3UTM A;  2IEJ A;  1Z3Y A;  1OT8 A;  3UXG A;  2VGX A;  2WMN A;  3S7D A;  3LY7 A;  3C98 A;  2KZT B;  3LY8 A;  2ETA A;  1OUV A;  1TN8 A;  1A5E A;  4AJW A;  1Z3X A;  3WXX A;  2CFU A;  4ANV A;  1OXJ A;  3FUJ A;  3HXD A;  4OVU A;  4FC8 A;  3B13 A;  2GGF A;  2F37 A;  3RJV A;  3APC A;  5A6C A;  3CSF A;  4GMJ A;  5KJM A;  1OWO A;  4W9R A;  1N95 A;  1TEZ A;  5AQA A;  2F0Y A;  5FZQ A;  4LSZ E;  3APD A;  4JPS A;  3RRN B;  1N54 A;  1PAQ A;  3NOC D;  5DIZ A;  4AEZ C;  3FUE A;  1N4S A;  2WB2 A;  1HG5 A;  3G2S A;  3MKQ B;  3DSX A;  2VQ2 A;  3CHM A;  3D9H A;  5BW8 C;  2BUG A;  4TXP A;  2LO6 A;  2OND A;  4EHM A;  2WXJ A;  3LEW A;  3CHS A;  3ASD A;  3ULY A;  4GZ6 A;  4BSX A;  3T9K A;  4Q94 A;  2P9P G;  4XKC A;  3MKR A;  1WAO 1;  3LVR E;  4A1S A;  3P1U A;  2XPI A;  3PZD A;  3BEE A;  3UI2 A;  2QY7 A;  4U8Y D;  2GRO B;  2MOW A;  1MJ0 A;  1UW4 B;  1O1S A;  4I43 A;  3E4B A;  1G3N B;  4JXT A;  3NQP A;  4JVS A;  3ZNG A; 
#chains in the Genus database with same CATH homology
 3RRM B;  4WWP A;  3FU6 A;  2WQ6 A;  5AIJ A;  2KZT A;  1HU3 A;  2FUL A;  3FWV A;  3PH0 C;  1HO8 A;  4LRZ A;  4LUN U;  4OVV A;  4GPK A;  2X6H A;  2X6I A;  2XPZ A;  4UI9 C;  3UQ3 A;  3JUI A;  2GRM A;  4RG9 A;  2KCK A;  3JYS A;  5EX0 A;  5A7D B;  3IKO B;  3ESK A;  5LCW J;  3EHM A;  2VSX E;  4B94 A;  1UJK A;  2VGY A;  4C9B B;  4GA0 A;  4XE0 A;  3LY9 A;  3ZFW A;  3D9M A;  4QFV A;  4LER A;  2XRZ A;  2L9B A;  2CHW A;  3NF1 A;  3JQ1 A;  3BG0 B;  3GW4 A;  4YVQ C;  3QK0 A;  3ONL A;  1P5Q A;  3EHN A;  4CRW A;  2RG8 A;  3ZYQ A;  1IQU A;  2V5F A;  2FI7 A;  3DBS A;  3EDT B;  2VSY A;  3FY4 A;  3PEV B;  4WAF A;  3VLD A;  1OWM A;  2QFC A;  4ANU A;  4KBQ A;  2JLB A;  2WXI A;  3FUL A;  4APO A;  2KCL A;  1B89 A;  3FUF A;  3SBS A;  2IJG X;  3UMV A;  4DPR A;  1UG3 A;  3ASG A;  4CT4 A;  2VTB A;  1XNF A;  1H6K A;  2I1J A;  3U9W A;  3KAE A;  3ULQ A;  5G04 J;  3FU3 A;  3PRZ A;  3PEU B;  4A55 A;  3HHM A;  4H7X A;  2IFU A;  4U8H A;  3CVX A;  3PRE A;  1OWL A;  3SD5 A;  3EIQ C;  3FDH A;  4UQY A;  1PY1 A;  3L22 A;  4L2L A;  4FAD A;  1KLX A;  4G11 A;  4EZL A;  4AXH A;  3FTS A;  3Q4A B;  3UT8 A;  3ZW3 A;  3SF4 A;  4TRQ A;  3FH7 A;  4Y6W A;  4J0U A;  3MKQ A;  2WXQ A;  2PQR A;  2YNQ A;  4AP2 A;  4KMO A;  3FUN A;  4RSY A;  5LFA A;  3ZHE A;  4B8A A;  4GA2 A;  3MX3 A;  4FLB A;  4UQX A;  5AYW D;  4ANX A;  4FHK A;  4UI9 K;  4L1B A;  3ZVV A;  3O4Z A;  4EPZ A;  3FU5 A;  4WNF A;  2UY1 A;  2OVF A;  4EBA A;  2L6J A;  3FTY A;  2YHC A;  4I17 A;  3MZL B;  4V3I A;  4Q69 A;  3KS2 A;  4DJA A;  2IQC A;  4U0Z A;  3HVE A;  3RRU A;  4HVB A;  3L13 A;  4HXI A;  4U0U A;  2OOE A;  3U4T A;  3CV0 A;  4UWH A;  1U3D A;  4GA1 A;  2C0L A;  5LP0 A;  3SZ7 A;  2XGO A;  2Q7F A;  3MEK A;  3L6A A;  3T8M A;  2J49 A;  5LOZ A;  2I2O A;  4ME2 A;  4ILG A;  5D0O D;  4C0M A;  5BT1 A;  5FQ4 A;  3I3N A;  3RO3 A;  3ZGQ A;  5KJL A;  3S2A A;  3CEQ A;  5BV1 A;  4JEH A;  2XEV A;  3ZXS A;  2YQ8 A;  2V4L A;  4JHR A;  2L0T B;  2AXU A;  4TUU A;  4JHK A;  5CMY A;  3R9A B;  1DVP A;  3U3W A;  3GYZ A;  3FHE A;  4GB9 A;  3G2W A;  3KEZ A;  3MV2 B;  5E76 A;  4TV3 A;  3SHF A;  3ZEF A;  2AW6 A;  2E0I A;  5T3R A;  3T5X A;  3AS5 A;  3FUI A;  2LAI A;  4NQ0 A;  3CHR A;  2KC7 A;  3L54 A;  4PS8 A;  3RU0 A;  4GZC A;  2AXV A;  4UWF A;  4HOT A;  2HO1 A;  4U63 A;  4I1A A;  3U66 A;  2LSV A;  2IU1 A;  3SBT B;  4GU5 A;  4UWK A;  5J08 A;  3CQC B;  3GZ2 A;  4AY5 A;  3G2U A;  5KCM A;  2LNI A;  4G1T A;  3D9O A;  1PC2 A;  4P29 A;  1X5B A;  1ZU2 A;  3HIZ A;  4BTB A;  3EJN A;  3PDN A;  5AJD A;  4F1S A;  2J07 A;  4KZC A;  4L2Y A;  4ANW A;  3I5P A;  2J4D A;  3L08 A;  4FUL A;  4NRH B;  1A17 A;  2Y4T A;  3CK8 A;  3LKU A;  3SNX A;  4F53 A;  1Z6T A;  3K9I A;  4DI3 A;  5BUZ A;  3PNL B;  3HYM B;  3UPV A;  1OWP A;  5JHA A;  4PS7 A;  4JC8 A;  3GZS A;  4GZ3 A;  4L23 A;  3NZS A;  4AVX A;  5JJ7 A;  4I9E A;  2KAT A;  5JJT A;  2X6F A;  3CK9 A;  2XQ0 A;  4I6J A;  4N2S A;  4KXK B;  5ANR A;  2WMO A;  3Q15 A;  4G24 A;  2OV8 A;  3QDN A;  3UX4 A;  2I1K A;  4JEU A;  2PL2 A;  3R7R A;  4ILH B;  1EPU A;  4CDR A;  1E8X A;  5AJL A;  2P58 C;  3FUD A;  2R17 C;  1TJC A;  3SI5 A;  4B89 A;  3LDZ A;  4G26 A;  1NP7 A;  1DNP A;  4WWO A;  5FQ8 A;  3FTZ A;  1IQR A;  2J09 A;  4PS3 A;  4NUR A;  4UQZ A;  4UI9 J;  1H0A A;  4BT8 A;  1HH8 A;  3AU4 A;  5FQ7 A;  3PE3 A;  3LCA A;  5FTP A;  1NA0 A;  4GZ5 A;  3OXF A;  2LSU A;  2X6K A;  4WNE A;  5ANL A;  3CKC A;  1KT1 A;  3D9K A;  3IV0 A;  4G23 A;  4RG6 A;  3OTN A;  4G2V A;  5C1D A;  1E90 A;  1LF8 A;  5CMW A;  3Q49 B;  1INZ A;  1H2V C;  4EQF A;  1SZ9 A;  4XIF A;  1E8Z A;  2R59 A;  3IBE A;  5ARG A;  2CG2 A;  3CGH A;  3FU0 A;  3I4G A;  3ZYK A;  3TAX A;  4ATG A;  3AS4 A;  3CQG B;  2WXH A;  3D9N A;  4XI9 A;  4JW1 A;  2CFZ A;  3ZIM A;  3UT4 A;  2ILR A;  4JZY A;  4B0Z A;  3I4R B;  3L16 A;  3FH8 A;  3QB2 A;  4I9C A;  2PM7 A;  5M72 A;  2FBN A;  2XPY A;  2NXP A;  3IHV A;  5FT9 A;  3R7Q A;  3U64 A;  5JHB A;  3QAR A;  2VGX B;  3IHY A;  4CT0 A;  3D9I A;  2V8S E;  4KYO B;  3LPZ A;  4WWN A;  2XRY A;  3QKY A;  1FVF A;  1OWN A;  4KVO A;  1W3B A;  3ENE A;  3KD7 A;  3IEG A;  4YND A;  2HM8 A;  3LVQ E;  4I2Z A;  2I6H A;  2PM6 A;  1VDY A;  3QWW A;  2WXM A;  4AV7 A;  4KZ0 A;  3MV3 B;  2KCV A;  4EBA G;  2YHE A;  3B7S A;  4WUY A;  4XX5 A;  1NZN A;  5T4Y A;  2WXL A;  3FH5 A;  2V0P A;  4HOU A;  5AEN A;  3LXU X;  3SFZ A;  2VSO E;  3S7B A;  3UUX A;  1HS6 A;  2YIN A;  1EYH A;  3CVV A;  1IYG A;  2FEZ A;  4GYW A;  4GZD A;  4YVO A;  2FF4 A;  2WVI A;  3G2T A;  4UWL A;  3QWV A;  3FEX A;  3TXN A;  3LS8 A;  5EX3 A;  4CDM A;  4PDX A;  4J8D A;  3VLF A;  4XI0 A;  3D9P A;  2JEK A;  5FZR A;  4IYP A;  3CKB A;  2CHX A;  3B7T A;  3ZRH A;  3ZPJ A;  4URK A;  3AU5 A;  3TG4 A;  4N3A A;  3URZ A;  3FTU A;  2M63 A;  3ZYL A;  3PS6 A;  3EIJ A;  3ML8 A;  1S0P A;  2PZI A;  3CHP A;  3PUK A;  4NAC A;  4R7L A;  4HLE A;  3N71 A;  4I6G A;  2IOS A;  3OXG A;  2UY1 B;  4MLP A;  2WXR A;  4N39 A;  1ELK A;  5A23 A;  5C2Y A;  3VTY A;  5HQ8 A;  1ELR A;  1UJJ A;  1FVH A;  3RO2 A;  4L7T A;  1U3C A;  4BX8 A;  5BV0 A;  3TJP A;  2FO7 A;  4WND A;  4CCA A;  1Y8M A;  4PUC A;  1E8W A;  4J8F A;  2GRL A;  5FZS A;  1XGW A;  2WQH A;  4ACL A;  3JCK C;  4EZK A;  4GML A;  4GCN A;  5JJ6 A;  3FTX A;  2A4Z A;  5EDS A;  2CG3 A;  3ASF A;  2MRI A;  2E2E A;  3PVL A;  3ESL A;  1JPL A;  3PNT B;  2GW1 A;  4FJY A;  4K03 A;  4F7A A;  2NC9 A;  1HF8 A;  4HOR A;  5G05 C;  3ZYM A;  4JL0 A;  3OXL A;  4N5C A;  5ARF A;  4AOF A;  1N52 A;  3FUK A;  4N3C A;  3FTV A;  1HFA A;  4FJZ A;  4XKB A;  5CHE E;  2AXZ A;  4Q96 A;  2WQ7 A;  2XGS A;  2WXK A;  4I2W A;  3FUM A;  3SGH A;  5CCM A;  3CVW A;  4J8E A;  5DBK A;  3ONK A;  2WXF A;  3VLE A;  1EF1 C;  4U0S A;  4DK5 A;  3MCX A;  1H2U A;  4BT9 A;  1QQE A;  1YA0 A;  3CLJ A;  4BX9 A;  3TL5 A;  3D9J A;  4A3V A;  3B7U X;  4DLO A;  4BWR A;  5G55 A;  2AVP A;  4K0R A;  1HZ4 A;  4JHJ A;  3G2V A;  2L0I A;  4XZ4 A;  1ELW A;  5LCW C;  4JA7 A;  3D3M A;  3FP3 A;  3D9L A;  4J6I A;  4GAA A;  5HI7 A;  3FFL A;  3CVU A;  4APF A;  3S7F A;  3MYV A;  3MJW A;  2I9C A;  2OVB A;  1SQM A;  1EDU A;  2HR2 A;  3APF A;  4FHJ A;  2RD0 A;  4DLQ A;  3FUH A;  3TXM A;  1JWF A;  5FWQ A;  2J4B A;  4B8C B;  1E7V A;  2ION A;  3MA5 A;  3Q47 B;  4FA6 A;  1NA3 A;  1JWG A;  2BF0 X;  5ENN A;  4MS6 A;  1Z3Y A;  4N3B A;  3TGO A;  3CHQ A;  4E85 A;  4ABN A;  4G25 A;  2VGX A;  2WMN A;  3S7D A;  2A5U A;  3LY7 A;  3C98 A;  4J8S A;  2KZT B;  3NZU A;  5E75 A;  3LY8 A;  5G04 C;  2J08 A;  1OUV A;  1WM5 A;  4UWG A;  1HG2 A;  1Z3X A;  2DCP A;  2WXG A;  4MRU A;  2CFU A;  3WXX A;  4AJW A;  4ANV A;  3GZ1 A;  1H19 A;  3CST A;  4OYS A;  3FUJ A;  2UWJ G;  3P2B A;  4OVU A;  3FEY A;  5BNW A;  3ZN3 A;  4FC8 A;  2EQX A;  3B13 A;  4HFG A;  4RVB A;  3MGB A;  2GGF A;  3LYA A;  3ASH A;  3QNK A;  3QOU A;  4FU3 A;  1IHG A;  2IOL A;  4N2Q A;  4H7Y A;  3RJV A;  2DBA A;  3APC A;  1QNF A;  3UT7 A;  5A6C A;  3CVY A;  3FTW A;  3CSF A;  4GMJ A;  5KJM A;  1OWO A;  4W9R A;  1E96 B;  1Y6I A;  3CVL A;  3PUJ A;  4F3V A;  4EZJ A;  5G2N A;  4EEC A;  2BTD A;  1TEZ A;  3B7R L;  4HOQ A;  3PE4 A;  4CEM A;  3RIB A;  5FZQ A;  2VTB B;  1E7U A;  2WXN A;  3APD A;  3ML9 A;  3OAW A;  4JPS A;  1N54 A;  4U04 A;  3RRN B;  1JUQ A;  1PAQ A;  3L17 A;  2WXP A;  3CR3 A;  5DIZ A;  4ILI A;  5FQ6 A;  2X3M A;  2XCB A;  3BG1 B;  2VJ8 A;  4AEZ C;  4Y6C A;  2PQN A;  4ACK A;  3RKV A;  4FLH A;  3FUE A;  2WM9 A;  4IN3 B;  3QC1 A;  2WB2 A;  2HYZ A;  1HG5 A;  2C0M A;  2KM4 A;  2X6J A;  3G2S A;  4I1M A;  3AS8 A;  4KVM A;  4BY6 A;  3MKQ B;  1HXI A;  3QJZ A;  3S7J A;  2VQ2 A;  3CHM A;  3ZHE B;  5LX8 A;  2WXO A;  4U07 A;  1SZA A;  2X38 A;  2CHZ A;  3CIA A;  4BTA A;  2VSN A;  1L5J A;  4BFR A;  4HOS A;  1MQS A;  5BW8 C;  2XCC A;  2Y3A A;  1GW6 A;  1BPO A;  1WY6 A;  2BUG A;  3VTX A;  4AY6 A;  1HE8 A;  1MHQ A;  5KJN A;  3CVQ A;  2VYI A;  3QWP A;  2C2L A;  2LO6 A;  2OND A;  5FJY A;  2AWI A;  4LEU A;  5J90 A;  4CGW A;  5CCL A;  2WXJ A;  3HVE B;  3LEW A;  2NSZ A;  4IUL A;  1HX8 A;  1ZBP A;  3CHS A;  3RK6 A;  4JA9 A;  3TG5 A;  4O6F A;  4A3T A;  3ASD A;  4HS2 A;  4AM9 A;  2WPV A;  4D10 C;  2DIW A;  4FP7 A;  4GCO A;  4CGV A;  4CDN A;  3Q5M A;  4IRU A;  4DI4 A;  1UN9 A;  4GZ6 A;  4BSX A;  2IF4 A;  4WNG A;  3O48 A;  3LJ3 A;  4A1G A;  1H2T C;  4Q94 A;  2ZU6 B;  4PH4 B;  4XKC A;  4M3O A;  3MKR A;  3CVP A;  1WAO 1;  3CVN A;  3LVR E;  2Y4U A;  1E8Y A;  4A1S A;  2MHK A;  3P1U A;  2XPI A;  2J9Q A;  2XHE A;  3PZD A;  4GYY A;  3T5V A;  2XGM A;  5D0Q D;  3BEE A;  1UN8 A;  3CK7 A;  2QY7 A;  3QAQ A;  5T8I A;  4LCT A;  3DPD A;  1FCH A;  5KJK A;  4GYO A;  5BPP A;  3JQ0 A;  3HDX A;  2LAH A;  3CHO A;  4AIF A;  2MOW A;  5EKQ D;  1UW4 B;  4C0E A;  4I1O B;  5G05 J;  4KT6 B;  4MKT A;  4I43 A;  1KT0 A;  2R5S A;  3E4B A;  4I6E A;  4E6H A;  4JXT A;  1QZ2 A;  3NQP A;  4JVS A;  1TJF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...