3U64A

The crystal structure of tat-t (tp0956)
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
271
structure length
271
Chain Sequence
b'DFTRVFTEEDDLDLVAQSLPLVLKVYEALHLQNPAHRGLSLAVGRLYIMYANAFVQTPAQYLPEDEFEAQNEAYSRARKLYLRGARYALSSLETAYPGFTREVFSGDEQRLHKVLSRCTRVDVGTLYWVGTGYVAAFALTPLGSALPDTVHAAVMMLERACDLWPSYQEGAVWNVLTKFYAAAPESFGGGMEKAHTAFEHLTRYCSAHDPDHHITYADALCIPLNNRAGFDEALDRALAIDPESVPHNKLLVILSQKRARWLKAHVQDFFL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein TP_0956
publication title Structural, Bioinformatic, and In Vivo Analyses of Two Treponema pallidum Lipoproteins Reveal a Unique TRAP Transporter.
pubmed doi rcsb
source organism Treponema pallidum subsp. pallidum
molecule tags Transport protein
total genus 106
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2011-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16811 TAtT TRAP transporter T-component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.920 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3u64A00
4DI3A 3U64A 4DI4A
chains in the Genus database with same CATH superfamily
1N4SA 1E8YA 5B1BE 4OAVB 4BSZB 3SF4A 4HBDA 2OV8A 1IQUA 4HXIA 3ENEA 5T8IA 3B13A 4J8EA 4B8AA 1HF8A 3ESLA 1HS6A 1MYOA 5KNGA 1O5MA 1V54E 3CHMA 4IRUA 4Q96A 2VYIA 4CEMA 5C2YA 4XEIG 1K3ZD 2BF0X 4B8CB 3ZYQA 2P9UG 2ETAA 3MYVA 5AN8A 4O6FA 1OUVA 4I1AA 4OVVA 2J4BA 4KYOB 1H2UA 4XE0A 3TWWA 4AVXA 4A63B 4LNUD 1QQEA 2R03A 2IO2C 2EILE 4HVBA 4PUCA 3MV2B 4JVSA 2VSXE 4KZ0A 2VQ2A 3D9OA 2ONDA 4ATGA 3ULQA 3VTYA 4BETA 4JD2G 3TWTA 3DWLG 1D8DA 2XZTG 4GTSA 4D10C 1KZOA 4TUUA 4N3BA 1E8XA 4BTAA 2C2LA 3JXIA 4LCTA 3FTWA 3QNKA 3WXXA 4HI9A 1UJKA 2L6BA 2P9KG 4GCNA 2VGXB 2E2EA 2FF4A 2KZTB 4JPSA 2J49A 1ZB1A 3B7SA 2J07A 4IULA 4A3VA 3S2AA 3HVEB 3I4GA 3R7RA 1TNBA 4U8VD 4FADA 3LY8A 3ASFA 5EIBE 1HFAA 3RKVA 3ZRHA 4ACLA 2X3MA 4E6HA 4JEHA 4NACA 3EHRA 3PNLB 2V4LA 5AARA 3QDNA 4UWHA 3GZ1A 5FQ4A 1N95A 5G05J 4L23A 4AY5A 4GTTA 4YNDA 1E7VA 3F6QA 3UIOC 5ENOD 3ESKA 4C0EA 3ONKA 1OY3D 2FBNA 2RKKA 4HOSA 2CFUA 2CHWA 1PAQA 5AQ9A 3CHOA 4CYMD 1ELWA 2L0IA 4TV3A 5A7DB 1RZ4A 4A55A 3D9IA 2AXVA 2WQ7A 5HS0A 1DCEA 2KCLA 5ENTD 5EX0A 3LKUA 2WXRA 3CVQA 4W9RA 1VDYA 3FU6A 4GTRA 2MRIA 3AS4A 4UQYA 3LJNA 4U95D 4Y6WA 2XEVA 4DX5D 2C0LA 3CVPA 1MJ0A 3MKQA 2LSVA 4WNEA 3CV0A 3L08A 3V30A 4HLLA 4YDYA 2FI7A 4EQFA 3QARA 2WPVA 1EYHA 4B93B 3ZYMA 5LX8A 4APFA 3JXJA 3FH7A 3C72A 3GW4A 3CIAA 3URZA 2DBAA 2IU1A 2I9CA 4GZ5A 2AVPA 1MX2A 4EECA 1MX4A 4U04A 4N2QA 1N11A 3L6AA 2EINE 1H2TC 3CEQA 1YA0A 4WWOA 3EIJA 5FWQA 3TWSA 2XENA 2V4HC 4K5BA 4J8DA 4JB8P 4RQIA 3D9MA 1OWMA 3RK6A 3NOCD 3RSEG 1WM5A 1A17A 2UY1B 4DX2A 3PE4A 5EIDA 1WG0A 2NYJA 3QWVA 1OCZE 4O60A 1Y6IA 4QFVA 4BEPA 5HRYA 4AJWA 3CVNA 2X6FA 2GRRB 3KS2A 3UM2A 3MCXA 3P2BA 3ONLA 1JUQA 4YVOA 1TR4A 5BNWA 4NRHB 1QZ2A 3CQGB 5CBOA 4I43A 3JQ1A 3DPDA 4JZYA 5BUZA 4HFGA 1G3NB 5FINA 4DX1A 4U0ZA 4Y6CA 4BERA 1N4RA 4DI4A 5BPPA 2P2CP 4N39A 1KPSB 3NOGD 4I17A 2BKKB 4G1TA 3ISMC 3D3MA 2LAHA 4GTMA 3FDHA 3QKYA 3EDTB 4G24A 3S7JA 1KT0A 3JQ0A 4ME2A 3EU5A 3RO2A 3RRNB 1TNZA 4KMOA 2XPIA 4NURA 3T5XA 2GRLA 3ML8A 3SNXA 4CT0A 3DSUA 2AJAA 2Y4UA 4X8QA 3D9NA 2VTBB 1BU9A 2AWIA 4CDMA 3C3RA 1QNFA 2BEDA 4J0UA 3HDXA 3T8KA 2KM4A 2I1KA 2KBXA 4L1BA 4U0SA 3TWVA 2GRQB 5JMND 4LUNU 2MOWA 4O1PA 4AV7A 3Q9UC 2R5SA 3PDNA 3FTSA 2ZU6B 2P58C 3NF1A 4UI9C 1XNFA 5ARFA 3FUHA 2H6HA 2FO7A 3D9KA 2VGEA 2L0TB 1QBQA 4MKTA 4ACKA 4B94A 4URKA 3EHNA 3UM1A 3TG4A 2RFMA 1SA5A 2KC7A 3FH5A 1PC2A 4JC8A 3D9LA 2XRYA 3O48A 3HIZA 3PE3A 3PRZA 4PH4B 1LD7A 3UX4A 5FZSA 3SO8A 1JCSA 3V2XA 3U66A 4I1OB 5G04C 4AP2A 2LXMA 3Q7AA 3E33A 3UKRG 4CZ2D 2CHXA 2QYJA 3CVYA 5FQ6A 4Q94A 3NB2A 3O4ZA 4J7WA 5EDSA 4ILGA 2IF4A 5AQ7A 3APFA 2OCCE 4JW1A 3IBEA 4WWPA 3KD7A 4FLHA 1AWCB 2Y4TA 1UG3A 1INZA 3FY4A 4DX6D 4GYYA 3DPYA 4U7EB 2L6JA 3FWVA 4KVMA 3ZUVB 3NBNB 1L5JA 2PNNA 2ILRA 2EIKE 1YMPA 1D8EA 2MHKA 3FEXA 2EIJE 3Q15A 2JLBA 1Z3YA 1K1BA 3ZHEA 5A23A 4JA9A 4GZDA 1OCOE 4U0UA 3HRAA 4XIFA 3QK0A 3EJNA 3PUKA 4EZKA 2KZTA 1OWOA 1NA3A 4OAUC 4FHJA 3GZSA 3I4RB 3LVRE 4EZJA 5FZQA 4HQDA 1HU3A 3EHQA 5B1AE 4DUIA 1TN7A 1UJJA 2XS8A 1FT2A 3L9TA 4N3AA 2WXPA 3QAQA 3E32A 2Y1LE 3T5VA 2RD0A 2R2LA 4AXHA 1UW4B 4AEZC 2VSOE 4RG9A 3FTVA 1TYQG 4XZ4A 4BESA 2PL2A 2R02A 2E0IA 3KEAA 2L9BA 5LP0A 4WNDA 3MV3B 3Q78A 5BV1A 3IEGA 4F1SA 3I5PA 3SHFA 3HYMB 3G2UA 3ASOE 3Q73A 3AU5A 2QFCA 4N2SA 3B7BA 3QJZA 3E30A 4LERA 2XQ0A 1OCCE 4BX8A 4CDRA 2IO3C 1W3BA 1N0QA 4HI8A 2OVBA 2LUHA 3PZ4A 5JJ6A 1FVFA 3DSTA 4U07A 3FU5A 3LS8A 3B7RL 3SQVA 4DX7D 1H0AA 3RAUA 1O1RA 4EZLA 3QOUA 3T8MA 3AJIA 3V2OA 4UWGA 3CHPA 3LJ3A 3ML9A 1FT1A 3WG7E 4JA7A 3CK7A 4DI3A 4L9PA 1SQMA 3ASHA 1E7UA 4UWKA 4LRZA 3UT7A 4UWLA 3ZIMA 2BKGA 4GTOA 4DRXE 3SD5A 3B7UX 4EHMA 4U8HA 1Z6TA 3CQCB 3ZNGA 1OWNA 4HRLA 3L17A 4J8YA 4GZCA 2IONA 3S7DA 5LCWJ 2CHZA 3W9FA 2X6IA 2HYZA 3HXBA 3SGHA 5FZRA 5LOZA 2ZGDA 1FPPA 4ABNA 1BI7B 4H7YA 2R59A 2OVFA 3APDA 4BT9A 4H7XA 1TN6A 1DVPA 1UN8A 3RIBA 2CG3A 4B89A 3NAWA 5ITZF 1N4PA 3I3NA 2PZIA 4NIKA 2H6GA 5CECB 5JA4D 2ZIRA 3UQ3A 3LVQE 3UT8A 1WDYA 5A6CA 3FU0A 1EF1C 5HQ8A 1HXIA 2I1JA 2DZNA 5D0OD 5D2MC 3SBTB 3DSSA 2QY7A 3CHRA 5CBNA 1OWLA 4WNFA 4ANWA 3ZFWA 3CGHA 5HI7A 2XEHA 2PQRA 5JJTA 3KEZA 4G11A 3AS8A 2WM9A 4CCAA 3FEYA 2DYRE 1KLXA 1N52A 4BX9A 2YNQA 4JHJA 4GCOA 1IHGA 3Q49B 3UT4A 4MLPA 1IYGA 4YDOA 4DJAA 3FUNA 4DPRA 3ABLE 4APOA 4I6GA 1TNOA 4F7AA 2GW1A 3UM0A 1IXVA 1X81A 1NFIE 3G2VA 3N71A 4XKCA 3ZGQA 1BPOA 4U96D 4F3VA 4WUYA 3ABME 4G23A 3KSQA 1LD8A 3L54A 3ZU7B 3FTZA 5D66A 1ELRA 3ZPJA 1K8KG 3HXFA 1DCQA 3QB2A 5CRUA 4C48B 4WNGA 2GRNB 1H19A 1U2VG 3PH0C 5CMWA 3LEWA 2V8SE 4HRMB 4ILHB 3U4TA 1BLXB 1HG5A 1SZAA 3SFYA 3U9WA 3ASNE 1N0RA 2CFZA 3VLDA 3P1UA 3L16A 2P9LG 5HKPA 4GZ6A 1U3DA 5EYPF 3Q4AB 4FJZA 2FEZA 3LYAA 3QC1A 2M63A 2XZDG 5ANRA 3Q9NC 5CRVA 4L2LA 4I2WA 2X6HA 4WWNA 5H7PA 2ZGGA 1NI1A 2WVIA 2GGFA 4GMJA 5JJ7A 3ABKE 3PZ1A 5FT9A 2LO6A 1E8ZA 3GZ2A 4JHKA 2JABA 3DEPA 3CVWA 3IV0A 1TEZA 2KCVA 3Q79A 4FP7A 2EIME 2VGYA 5KNHD 3LCAA 3RJVA 3VLFA 3PEVB 4RG6A 2EQXA 1NA0A 3BQOA 3SBSA 1TNYA 4G26A 2F8YA 2LAIA 3RU0A 1B89A 3CKCA 1SVXA 3FUDA 3TWQA 3MKQB 2RFAA 3NZSA 4BT8A 3SY2A 3FFLA 4ZFHA 4KT6B 4KVOA 1HE8A 3ZYLA 3BG0B 4BWRA 2WXJA 2QYUA 3TWXA 5CCLA 4TXQA 4UI9K 1MQSA 3PUJA 3SFZA 3DBSA 3IXEA 1LF8A 5AENA 1JWGA 3RO3A 3R9AB 3W9GA 2XPZA 3UMVA 2H6FA 2WXOA 3FUKA 3GYZA 5JHBA 3CHSA 4CGWA 4DK5A 3E34A 4BFRA 3JCKC 4GB9A 3OXLA 5DIZA 1S0PA 1YYHA 1Y8MA 4HOQA 3CKBA 5EYLA 2P9IG 1Z5SC 2HR2A 2WQHA 3OXGA 3UTMA 3PREA 4P29A 2RG8A 5G55A 2H6IA 3S7BA 5ARGA 3MGBA 3NQPA 5CCMA 1HX8A 2PQNA 3DXKG 2F0YA 5EN5D 1AP7A 1H6KA 1EDUA 2DZOA 4N3CA 4GAAA 2XRZA 4GA1A 2V0PA 4YDEA 5E76A 5CMYA 3PZ2A 4EPZA 3FUJA 4F53A 3TWRA 2QC9A 3FUMA 3D9JA 4HORA 1UOHA 3RRUA 4RLYA 3CHQA 2FULA 2XEEA 1H6PA 2C0MA 2DWZA 3L22A 4AOFA 2WMOA 3R9MA 4FA6A 1IHBA 5AYWD 4JHRA 3MZLB 3LXUX 4U8YD 1SW6A 4ATZD 2DYSE 4UI9J 4I6EA 3E37A 2KATA 4CT4A 4I9EA 3PNTB 3UPVA 2VGXA 4G8LA 2XCBA 3FTUA 1SA4A 3G2WA 3NZUA 2OEWA 3ZVVA 3HVEA 4FLBA 3Q47B 3EIQC 1IKND 4B0ZA 5ENPD 1DNPA 2BTDA 3ZXPA 4GMRA 5J90A 4Q69A 3ZXSA 4F1PA 5CHEE 3FULA 5J08A 4FJYA 3FU3A 4AY6A 5KJKA 3HXEA 2WXFA 3BEEA 1HG2A 5FIOA 3UINC 3MEKA 4OVUA 4G25A 1QYMA 3J5QB 3IHYA 4GPKA 4JL0A 4M7CA 3CVLA 3OAWA 4GYOA 3PZDA 3U3WA 3EHMA 3AU4A 3MA5A 5ANLA 3AG1E 1OXJA 1JWFA 3FTXA 3PS6A 3CVVA 3TJPA 3ASGA 2V5QC 3AS5A 3DRAA 2X6JA 2DCPA 2JEKA 4KZCA 5FJYA 3FUEA 2XPYA 4LEUA 4HLEA 4CGVA 4PS3A 2OOEA 5LCWC 5CERB 3CSFA 5IY5E 3D9HA 4KXKB 3HG0D 1MHQA 5E75A 3TGOA 2WMNA 2IOLA 1MX6A 3ZKJA 5G05C 4HNAD 2KXPC 3FUIA 3UIPC 4Z68A 3IKOB 1ZBPA 3L82A 3LDZA 3CLJA 4J8SA 3CK8A 4BSXA 5LFAA 1P5QA 5T3RA 4ZHBA 2CG2A 5AQAA 2A4ZA 4N5QA 5ENNA 2IFUA 1HH8A 4BTBA 3BU8A 5BXUA 3ZHEB 4K5CA 4DLOA 2IEJA 3AG2E 1HO8A 4RVBA 2WXQA 1O1TA 3HHMA 2WXLA 3JYSA 4I9CA 1OT8A 3CVUA 1N54A 1U3CA 3C3OA 1OWPA 3Q7FA 4ANVA 5EX3A 2R17C 3C98A 3UI2A 1TJCA 3KAEA 1JCQA 1D9SA 4FHKA 4YVQC 1E96B 5BV0A 2Y0BG 3V79K 4A1SA 4CRWA 1Z3XA 4I1MA 4IYPA 1TN8A 1XGWA 3PEUB 3DEOA 2HO1A 1LTXA 2WXNA 4IN3B 2UY1A 2P9SG 5KWDA 1NZNA 2HE0A 3FUFA 4GTQA 4LG6A 5KJLA 1A5EA 3FH8A 2YHCA 3ASDA 4U63A 3JUIA 3Q5MA 4KBQA 4A3TA 2P9PG 4FULA 1MZCA 4HOUA 1DC2A 3APCA 1OCRE 1RW2A 3ZYKA 1BD8A 4I6JA 3MX3A 4JXTA 4GTPA 1WY6A 1KZPA 3J5PA 4EBAG 4UQZA 4XI9A 4OYSA 1EPUA 2X38A 3LY9A 4O1OA 4TRQA 1Q2ZA 1TJFA 4N5CA 4R7LA 5CEDB 2LNIA 2NXPA 1H6OA 3Q75A 4G8KA 4PDXA 4GMLA 5FTPA 5JHAA 2WQ6A 2WXHA 4PS8A 2YQ8A 1N9AA 2OEVA 5AQBA 2F37A 4GTVA 4M3OA 3AAAC 2DVWA 1JPLA 2GRMA 4JEUA 2YINA 5KBAA 4K03A 4GU5A 3TWUA 3DXMG 3L13A 4K5AB 3E4BA 4ANUA 2I6HA 4GZ3A 2Q7FA 4GA0A 5FQ7A 2VTBA 3BUAA 1S64A 4L2YA 5AAOA 3DSVA 4XI0A 4G2VA 5BT1A 2VJ8A 2BUGA 5BW8C 3AG3E 5ENQD 2IQCA 4L7TA 3QWPA 3IHVA 4LSZE 3C3QA 4UUCA 2XS1A 5C1DA 5B3SE 5ENRD 3B7TA 2AW6A 4HRNA 4AM9A 4TXPA 2LXLA 5AJLA 3HXCA 4V3IA 3B95A 5DBKA 3HXDA 2DIWA 4F6RD 1UN9A 3JUEA 3ULEG 3TAXA 4BY6A 3KSLA 2B0OE 2HM8A 3K9IA 5G2NA 4RSYA 1IQRA 2PM7A 3EU9A 4DLQA 1YCSB 3CK9A 2ZXWE 3T9KA 3RRMB 2KCKA 5BXOA 3MJWA 1O1SA 2FO1E 2ETCA 2Y69E 2MYOA 4TUMA 4TXRA 5KCMA 3ZN3A 5D0QD 4HOTA 4MBGA 1ZU2A 3X2QE 3V31A 3FHEA 1FCHA 2P9NG 3CSTA 3UKUG 2WB2A 4I2ZA 2XCCA 5KJMA 3UUXA 1NP7A 4MS6A 3PZ3A 3U64A 3TXNA 1HZ4A 4J8FA 4C9BB 1X5BA 2IY0C 3ZW3A 4K0RA 2GRPB 2X6KA 4XKBA 1PY1A 2QZAA 3OXFA 2NSZA 4XX5A 3AG4E 4ANXA 3UM3A 1K1AA 2Y3AA 2XGMA 1S70B 3R7QA 3TL5A 1ELKA 1V55E 2NC9A 2ETBA 4UWFA 2IOSA 3VTXA 3FP3A 4A1GA 5EILA 3G2SA 3CVXA 2A5EA 3ULYA 5CEAA 4J6IA 4FU3A 4HS2A 2IJGX 2XGOA 5FQ8A 2VSYA 1TNUA 3FTYA 4HB5A 4C0MA 3VLEA 4CDNA 1NL4A 2XHEA 4GA2A 4FC8A 1JCRA 1WAO1 4QQIA 3PVLA 2UWJG 4UQXA 4GPMA 1N4QA 2WXIA 2J9QA 4WAFA 3EUVA 1N94A 4GYWA 3MKRA 2J8SD 3S7FA 2F8XK 2AXUA 3TXMA 5M72A 2R05A 2AXZA 3SZ7A 3CR3A 2J09A 3SI5A 2J4DA 2ZISA 1H2VC 2J08A 1GW6A 4LNBA 1FVHA 3ZEFA 4LNGA 3DSWA 4ILIA 3LPZA 2WXGA 1E8WA 3QWWA 1S63A 3LY7A 5AJDA 3C5RA 2V5FA 3OTNA 5ENSD 3D9PA 2A5UA 5KJNA 1BI8B 4NQ0A 4PS7A 4MRUA 5G04J 1SZ9A 5T4YA 2YHEA 3TG5A 3SFXA 2WXKA 3UXGA 1KT1A 5AIJA 2WXMA 2I2OA 1E90A 2B6CA 3G2TA 2PM6A 2LSUA 3BG1B 2VSNA 4E85A 4EBAA 3DSXA 2XGSA 2GROB 5EKQD 4AIFA 4YDWA
chains in the Genus database with same CATH topology
3NF1A 2HO1A 1E8YA 2CFZA 1XNFA 3P1UA 4UI9C 5ARFA 2WXNA 3VLDA 3FUHA 4IN3B 2FO7A 2UY1A 3L16A 3D9KA 3SF4A 3ZVVA 2OV8A 1IQUA 4HXIA 2L0TB 4GZ6A 4MKTA 4ACKA 4B94A 3ENEA 4URKA 1U3DA 5T8IA 3B13A 1NZNA 3EHNA 3FUFA 3TG4A 4J8EA 3Q4AB 2KC7A 3FH5A 4B8AA 1PC2A 1HF8A 5KJLA 4FJZA 3ESLA 2YHCA 3ASDA 3FH8A 2FEZA 3LYAA 4U63A 1HS6A 4JC8A 3JUIA 3Q5MA 4KBQA 4A3TA 3D9LA 2XRYA 3O48A 3HIZA 2M63A 3PE3A 3QC1A 3PRZA 4FULA 4PH4B 4L2LA 5ANRA 4I2WA 2X6HA 5FZSA 3UX4A 4HOUA 4WWNA 3U66A 4I1OB 3CHMA 4IRUA 4Q96A 5G04C 2VYIA 4CEMA 5C2YA 3APCA 4AP2A 2WVIA 3ZYKA 2GGFA 2BF0X 4B8CB 4GMJA 3ZYQA 5JJ7A 2CHXA 4I6JA 3MX3A 4JXTA 3CVYA 5FT9A 3MYVA 4O6FA 1OUVA 2LO6A 1E8ZA 1WY6A 4I1AA 5FQ6A 4OVVA 3GZ2A 4Q94A 2J4BA 4JHKA 4KYOB 1H2UA 4XE0A 4EBAG 4AVXA 3CVWA 4UQZA 4XI9A 3IV0A 1TEZA 2KCVA 1QQEA 3O4ZA 4OYSA 5EDSA 1EPUA 4FP7A 2X38A 3LY9A 4TRQA 4ILGA 2IF4A 2VGYA 1TJFA 3LCAA 3APFA 4N5CA 3RJVA 3VLFA 3PEVB 4R7LA 4JW1A 3IBEA 4RG6A 2EQXA 4HVBA 1NA0A 4PUCA 2LNIA 2NXPA 3KD7A 3MV2B 2VSXE 4JVSA 4WWPA 3SBSA 4KZ0A 2VQ2A 4FLHA 4G26A 3D9OA 2ONDA 2Y4TA 4ATGA 1UG3A 2LAIA 3RU0A 1INZA 3FY4A 4PDXA 4GMLA 5FTPA 3ULQA 4GYYA 5JHAA 2WQ6A 1B89A 2WXHA 4PS8A 3CKCA 2L6JA 2YQ8A 3VTYA 3FWVA 4KVMA 3FUDA 1L5JA 3MKQB 3NZSA 4BT8A 2ILRA 2MHKA 3FFLA 3FEXA 4D10C 4KT6B 4TUUA 4N3BA 1E8XA 4KVOA 4M3OA 3Q15A 2JLBA 4BTAA 1HE8A 2C2LA 1Z3YA 3ZYLA 3BG0B 4BWRA 3ZHEA 5A23A 4LCTA 1JPLA 2GRMA 3FTWA 2WXJA 4JEUA 2YINA 3QNKA 3WXXA 4K03A 4GU5A 5CCLA 1UJKA 4UI9K 4JA9A 1MQSA 3L13A 3E4BA 4ANUA 2I6HA 3PUJA 4GZDA 4GZ3A 3SFZA 2Q7FA 4GA0A 4GCNA 4U0UA 4XIFA 5FQ7A 2VTBA 2VGXB 3DBSA 2E2EA 4L2YA 2FF4A 2KZTB 4JPSA 3QK0A 3EJNA 3PUKA 4XI0A 2J49A 4G2VA 3B7SA 4EZKA 1LF8A 2KZTA 1OWOA 1NA3A 5AENA 5BT1A 2VJ8A 1JWGA 3RO3A 3R9AB 2J07A 4FHJA 4IULA 2BUGA 2XPZA 5BW8C 3GZSA 3HVEB 3I4RB 3I4GA 3LVRE 3R7RA 3S2AA 3UMVA 4A3VA 4FADA 4EZJA 5FZQA 3LY8A 2WXOA 3ASFA 2IQCA 4L7TA 3FUKA 1HU3A 3GYZA 3QWPA 3IHVA 5JHBA 1HFAA 3CHSA 3RKVA 3ZRHA 4CGWA 4DK5A 5C1DA 1UJJA 4ACLA 4BFRA 2X3MA 3JCKC 4E6HA 4GB9A 3OXLA 4N3AA 4JEHA 4NACA 5DIZA 3PNLB 2WXPA 3QAQA 1S0PA 1Y8MA 2AW6A 2V4LA 3B7TA 2RD0A 4AM9A 3T5VA 4HOQA 4AXHA 3CKBA 1UW4B 4AEZC 3QDNA 4UWHA 3GZ1A 2VSOE 5FQ4A 5G05J 5AJLA 4L23A 4V3IA 2HR2A 4AY5A 2WQHA 4YNDA 5DBKA 1E7VA 3OXGA 4RG9A 2DIWA 3FTVA 1UN9A 4XZ4A 3PREA 2PL2A 4P29A 2RG8A 2E0IA 3TAXA 2L9BA 5G55A 4BY6A 5LP0A 4WNDA 3ESKA 3MV3B 3S7BA 5ARGA 5BV1A 2HM8A 3MGBA 4C0EA 3NQPA 5CCMA 1HX8A 2PQNA 3IEGA 3ONKA 4F1SA 3I5PA 2FBNA 3SHFA 4HOSA 3HYMB 3K9IA 1H6KA 3G2UA 1EDUA 2CFUA 2CHWA 5G2NA 3AU5A 4N3CA 1PAQA 2QFCA 4RSYA 4N2SA 3CHOA 4GAAA 2XRZA 3QJZA 4GA1A 1IQRA 2PM7A 1ELWA 2V0PA 4LERA 2XQ0A 4DLQA 5E76A 2L0IA 4TV3A 5A7DB 5CMYA 3CK9A 3D9IA 4A55A 2AXVA 2WQ7A 4EPZA 4BX8A 3RRMB 2KCLA 4CDRA 3FUJA 1W3BA 2KCKA 3MJWA 2OVBA 4F53A 3FUMA 5EX0A 3LKUA 5JJ6A 5KCMA 3ZN3A 3D9JA 4HORA 1FVFA 3RRUA 2WXRA 3CVQA 4U07A 5D0QD 3FU5A 4HOTA 3CHQA 3LS8A 2FULA 1VDYA 3FU6A 4W9RA 3B7RL 2MRIA 2C0MA 1ZU2A 3L22A 4AOFA 3AS4A 4UQYA 3FHEA 4Y6WA 2XEVA 1FCHA 2C0LA 1H0AA 2WMOA 4EZLA 3QOUA 3T8MA 4FA6A 5AYWD 3CSTA 3CVPA 4JHRA 3MZLB 4UWGA 3LXUX 3MKQA 2LSVA 3CHPA 3LJ3A 3ML9A 4UI9J 4I6EA 2WB2A 4I2ZA 4WNEA 4JA7A 3CV0A 3CK7A 3L08A 2XCCA 2KATA 5KJMA 4DI3A 3UUXA 1SQMA 3ASHA 4CT4A 1E7UA 1NP7A 4I9EA 4LRZA 4UWKA 3UT7A 2FI7A 4MS6A 4EQFA 4UWLA 3U64A 3ZIMA 3TXNA 1HZ4A 4J8FA 3QARA 1X5BA 3PNTB 2WPVA 4C9BB 1EYHA 3UPVA 2VGXA 3ZW3A 2XCBA 4K0RA 3SD5A 3ZYMA 5LX8A 3B7UX 3FTUA 4APFA 4U8HA 3G2WA 3NZUA 2X6KA 1Z6TA 4XKBA 1PY1A 3CQCB 1OWNA 3FH7A 3L17A 3OXFA 3GW4A 2NSZA 3CIAA 2DBAA 3HVEA 3URZA 4FLBA 2IU1A 2I9CA 3Q47B 2AVPA 4GZ5A 4XX5A 3EIQC 4EECA 4U04A 4GZCA 4N2QA 3L6AA 1H2TC 4ANXA 2Y3AA 3CEQA 2IONA 3S7DA 4B0ZA 2XGMA 2CHZA 5LCWJ 1YA0A 4WWOA 1DNPA 3R7QA 3TL5A 1ELKA 2BTDA 2X6IA 2NC9A 3EIJA 5FWQA 4UWFA 5J90A 2IOSA 3ZXSA 3VTXA 2HYZA 3FP3A 3SGHA 4A1GA 5CHEE 4Q69A 5FZRA 4J8DA 3FULA 5J08A 4FJYA 3FU3A 5LOZA 3G2SA 4AY6A 5KJKA 3D9MA 1OWMA 3CVXA 2WXFA 3RK6A 4ABNA 3BEEA 1HG2A 4H7YA 1WM5A 2R59A 1A17A 2OVFA 2UY1B 3APDA 4BT9A 4H7XA 3MEKA 4J6IA 3PE4A 4FU3A 1DVPA 1UN8A 4G25A 4OVUA 3RIBA 2CG3A 4HS2A 4B89A 2IJGX 3IHYA 3QWVA 3I3NA 2XGOA 1Y6IA 4GPKA 4QFVA 2PZIA 4JL0A 5FQ8A 2VSYA 3CVLA 3OAWA 4GYOA 3FTYA 3PZDA 3UQ3A 4AJWA 3CVNA 3LVQE 4C0MA 3U3WA 2X6FA 3EHMA 3AU4A 3MA5A 3KS2A 3UT8A 3VLEA 5ANLA 3MCXA 5A6CA 3FU0A 3P2BA 1EF1C 1JWFA 3ONLA 3FTXA 1JUQA 3PS6A 4CDNA 1HXIA 5HQ8A 2XHEA 2I1JA 4YVOA 4GA2A 3CVVA 5D0OD 4FC8A 3TJPA 3ASGA 5BNWA 4NRHB 3AS5A 1QZ2A 1WAO1 3SBTB 2X6JA 2DCPA 2JEKA 2QY7A 3CQGB 3PVLA 4KZCA 3CHRA 5FJYA 2UWJG 3FUEA 4UQXA 4I43A 3JQ1A 3DPDA 2XPYA 4JZYA 5BUZA 1OWLA 4LEUA 4WNFA 4HFGA 4ANWA 4HLEA 2WXIA 3ZFWA 4CGVA 4PS3A 2OOEA 2J9QA 5LCWC 4WAFA 3CSFA 4U0ZA 4GYWA 4KXKB 3CGHA 3MKRA 5HI7A 4Y6CA 4DI4A 5BPPA 4N39A 2PQRA 3S7FA 2AXUA 3TXMA 5M72A 1MHQA 2AXZA 5E75A 4I17A 3SZ7A 3CR3A 5JJTA 2J09A 3KEZA 4G1TA 3SI5A 2WMNA 2IOLA 4G11A 3AS8A 3TGOA 2WM9A 2J4DA 3D3MA 3FEYA 1H2VC 2J08A 5G05C 2LAHA 4CCAA 3FUIA 1GW6A 3FDHA 1KLXA 1N52A 4BX9A 2YNQA 3QKYA 3IKOB 1ZBPA 3LDZA 3EDTB 4G24A 3CLJA 4J8SA 4JHJA 1FVHA 4GCOA 3ZEFA 3S7JA 1KT0A 1IHGA 3CK8A 3Q49B 4BSXA 3JQ0A 4ME2A 5LFAA 4ILIA 3LPZA 3UT4A 1P5QA 2WXGA 4MLPA 1IYGA 5T3RA 4DJAA 1E8WA 3FUNA 4DPRA 3QWWA 3RO2A 3RRNB 2CG2A 4APOA 4I6GA 4KMOA 2XPIA 2A4ZA 4NURA 5ENNA 3T5XA 2IFUA 3LY7A 4F7AA 2GW1A 2GRLA 1HH8A 5AJDA 4BTBA 2V5FA 3ML8A 3OTNA 3SNXA 3ZHEB 4CT0A 3D9PA 2A5UA 5KJNA 4DLOA 3G2VA 3N71A 1HO8A 4RVBA 2WXQA 4NQ0A 3HHMA 4PS7A 2WXLA 4XKCA 3ZGQA 3JYSA 4I9CA 3CVUA 1BPOA 2Y4UA 4MRUA 4F3VA 3D9NA 4WUYA 2VTBB 5G04J 1SZ9A 5T4YA 1N54A 1U3CA 2AWIA 4G23A 4CDMA 1OWPA 2YHEA 1QNFA 3TG5A 3L54A 4ANVA 4J0UA 2WXKA 3FTZA 3HDXA 1KT1A 1ELRA 2KM4A 5EX3A 2I1KA 3ZPJA 2R17C 2WXMA 4L1BA 4U0SA 5AIJA 2I2OA 3C98A 3QB2A 1E90A 4WNGA 1TJCA 3KAEA 4LUNU 3G2TA 2MOWA 2PM6A 2LSUA 3BG1B 2VSNA 4FHKA 4YVQC 1H19A 4E85A 1E96B 4EBAA 5BV0A 3PH0C 5CMWA 3LEWA 2V8SE 4A1SA 4ILHB 3U4TA 4AV7A 4CRWA 2R5SA 1Z3XA 4AIFA 2XGSA 3PDNA 4I1MA 1HG5A 1SZAA 3FTSA 4IYPA 2ZU6B 5EKQD 3U9WA 1XGWA 3PEUB 2P58C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI3 A;  3U64 A;  4DI4 A; 
#chains in the Genus database with same CATH topology
 1N4S A;  1E8Y A;  5B1B E;  4OAV B;  4BSZ B;  3SF4 A;  4HBD A;  2OV8 A;  1IQU A;  4HXI A;  3ENE A;  5T8I A;  3B13 A;  4J8E A;  4B8A A;  1HF8 A;  3ESL A;  1HS6 A;  1MYO A;  5KNG A;  1O5M A;  1V54 E;  3CHM A;  4IRU A;  4Q96 A;  2VYI A;  4CEM A;  5C2Y A;  4XEI G;  1K3Z D;  2BF0 X;  4B8C B;  3ZYQ A;  2P9U G;  2ETA A;  3MYV A;  5AN8 A;  4O6F A;  1OUV A;  4I1A A;  4OVV A;  2J4B A;  4KYO B;  1H2U A;  4XE0 A;  3TWW A;  4AVX A;  4A63 B;  4LNU D;  1QQE A;  2R03 A;  2IO2 C;  2EIL E;  4HVB A;  4PUC A;  3MV2 B;  4JVS A;  2VSX E;  4KZ0 A;  2VQ2 A;  3D9O A;  2OND A;  4ATG A;  3ULQ A;  3VTY A;  4BET A;  4JD2 G;  3TWT A;  3DWL G;  1D8D A;  2XZT G;  4GTS A;  4D10 C;  1KZO A;  4TUU A;  4N3B A;  1E8X A;  4BTA A;  2C2L A;  3JXI A;  4LCT A;  3FTW A;  3QNK A;  3WXX A;  4HI9 A;  1UJK A;  2L6B A;  2P9K G;  4GCN A;  2VGX B;  2E2E A;  2FF4 A;  2KZT B;  4JPS A;  2J49 A;  1ZB1 A;  3B7S A;  2J07 A;  4IUL A;  4A3V A;  3S2A A;  3HVE B;  3I4G A;  3R7R A;  1TNB A;  4U8V D;  4FAD A;  3LY8 A;  3ASF A;  5EIB E;  1HFA A;  3RKV A;  3ZRH A;  4ACL A;  2X3M A;  4E6H A;  4JEH A;  4NAC A;  3EHR A;  3PNL B;  2V4L A;  5AAR A;  3QDN A;  4UWH A;  3GZ1 A;  5FQ4 A;  1N95 A;  5G05 J;  4L23 A;  4AY5 A;  4GTT A;  4YND A;  1E7V A;  3F6Q A;  3UIO C;  5ENO D;  3ESK A;  4C0E A;  3ONK A;  1OY3 D;  2FBN A;  2RKK A;  4HOS A;  2CFU A;  2CHW A;  1PAQ A;  5AQ9 A;  3CHO A;  4CYM D;  1ELW A;  2L0I A;  4TV3 A;  5A7D B;  1RZ4 A;  4A55 A;  3D9I A;  2AXV A;  2WQ7 A;  5HS0 A;  1DCE A;  2KCL A;  5ENT D;  5EX0 A;  3LKU A;  2WXR A;  3CVQ A;  4W9R A;  1VDY A;  3FU6 A;  4GTR A;  2MRI A;  3AS4 A;  4UQY A;  3LJN A;  4U95 D;  4Y6W A;  2XEV A;  4DX5 D;  2C0L A;  3CVP A;  1MJ0 A;  3MKQ A;  2LSV A;  4WNE A;  3CV0 A;  3L08 A;  3V30 A;  4HLL A;  4YDY A;  2FI7 A;  4EQF A;  3QAR A;  2WPV A;  1EYH A;  4B93 B;  3ZYM A;  5LX8 A;  4APF A;  3JXJ A;  3FH7 A;  3C72 A;  3GW4 A;  3CIA A;  3URZ A;  2DBA A;  2IU1 A;  2I9C A;  4GZ5 A;  2AVP A;  1MX2 A;  4EEC A;  1MX4 A;  4U04 A;  4N2Q A;  1N11 A;  3L6A A;  2EIN E;  1H2T C;  3CEQ A;  1YA0 A;  4WWO A;  3EIJ A;  5FWQ A;  3TWS A;  2XEN A;  2V4H C;  4K5B A;  4J8D A;  4JB8 P;  4RQI A;  3D9M A;  1OWM A;  3RK6 A;  3NOC D;  3RSE G;  1WM5 A;  1A17 A;  2UY1 B;  4DX2 A;  3PE4 A;  5EID A;  1WG0 A;  2NYJ A;  3QWV A;  1OCZ E;  4O60 A;  1Y6I A;  4QFV A;  4BEP A;  5HRY A;  4AJW A;  3CVN A;  2X6F A;  2GRR B;  3KS2 A;  3UM2 A;  3MCX A;  3P2B A;  3ONL A;  1JUQ A;  4YVO A;  1TR4 A;  5BNW A;  4NRH B;  1QZ2 A;  3CQG B;  5CBO A;  4I43 A;  3JQ1 A;  3DPD A;  4JZY A;  5BUZ A;  4HFG A;  1G3N B;  5FIN A;  4DX1 A;  4U0Z A;  4Y6C A;  4BER A;  1N4R A;  4DI4 A;  5BPP A;  2P2C P;  4N39 A;  1KPS B;  3NOG D;  4I17 A;  2BKK B;  4G1T A;  3ISM C;  3D3M A;  2LAH A;  4GTM A;  3FDH A;  3QKY A;  3EDT B;  4G24 A;  3S7J A;  1KT0 A;  3JQ0 A;  4ME2 A;  3EU5 A;  3RO2 A;  3RRN B;  1TNZ A;  4KMO A;  2XPI A;  4NUR A;  3T5X A;  2GRL A;  3ML8 A;  3SNX A;  4CT0 A;  3DSU A;  2AJA A;  2Y4U A;  4X8Q A;  3D9N A;  2VTB B;  1BU9 A;  2AWI A;  4CDM A;  3C3R A;  1QNF A;  2BED A;  4J0U A;  3HDX A;  3T8K A;  2KM4 A;  2I1K A;  2KBX A;  4L1B A;  4U0S A;  3TWV A;  2GRQ B;  5JMN D;  4LUN U;  2MOW A;  4O1P A;  4AV7 A;  3Q9U C;  2R5S A;  3PDN A;  3FTS A;  2ZU6 B;  2P58 C;  3NF1 A;  4UI9 C;  1XNF A;  5ARF A;  3FUH A;  2H6H A;  2FO7 A;  3D9K A;  2VGE A;  2L0T B;  1QBQ A;  4MKT A;  4ACK A;  4B94 A;  4URK A;  3EHN A;  3UM1 A;  3TG4 A;  2RFM A;  1SA5 A;  2KC7 A;  3FH5 A;  1PC2 A;  4JC8 A;  3D9L A;  2XRY A;  3O48 A;  3HIZ A;  3PE3 A;  3PRZ A;  4PH4 B;  1LD7 A;  3UX4 A;  5FZS A;  3SO8 A;  1JCS A;  3V2X A;  3U66 A;  4I1O B;  5G04 C;  4AP2 A;  2LXM A;  3Q7A A;  3E33 A;  3UKR G;  4CZ2 D;  2CHX A;  2QYJ A;  3CVY A;  5FQ6 A;  4Q94 A;  3NB2 A;  3O4Z A;  4J7W A;  5EDS A;  4ILG A;  2IF4 A;  5AQ7 A;  3APF A;  2OCC E;  4JW1 A;  3IBE A;  4WWP A;  3KD7 A;  4FLH A;  1AWC B;  2Y4T A;  1UG3 A;  1INZ A;  3FY4 A;  4DX6 D;  4GYY A;  3DPY A;  4U7E B;  2L6J A;  3FWV A;  4KVM A;  3ZUV B;  3NBN B;  1L5J A;  2PNN A;  2ILR A;  2EIK E;  1YMP A;  1D8E A;  2MHK A;  3FEX A;  2EIJ E;  3Q15 A;  2JLB A;  1Z3Y A;  1K1B A;  3ZHE A;  5A23 A;  4JA9 A;  4GZD A;  1OCO E;  4U0U A;  3HRA A;  4XIF A;  3QK0 A;  3EJN A;  3PUK A;  4EZK A;  2KZT A;  1OWO A;  1NA3 A;  4OAU C;  4FHJ A;  3GZS A;  3I4R B;  3LVR E;  4EZJ A;  5FZQ A;  4HQD A;  1HU3 A;  3EHQ A;  5B1A E;  4DUI A;  1TN7 A;  1UJJ A;  2XS8 A;  1FT2 A;  3L9T A;  4N3A A;  2WXP A;  3QAQ A;  3E32 A;  2Y1L E;  3T5V A;  2RD0 A;  2R2L A;  4AXH A;  1UW4 B;  4AEZ C;  2VSO E;  4RG9 A;  3FTV A;  1TYQ G;  4XZ4 A;  4BES A;  2PL2 A;  2R02 A;  2E0I A;  3KEA A;  2L9B A;  5LP0 A;  4WND A;  3MV3 B;  3Q78 A;  5BV1 A;  3IEG A;  4F1S A;  3I5P A;  3SHF A;  3HYM B;  3G2U A;  3ASO E;  3Q73 A;  3AU5 A;  2QFC A;  4N2S A;  3B7B A;  3QJZ A;  3E30 A;  4LER A;  2XQ0 A;  1OCC E;  4BX8 A;  4CDR A;  2IO3 C;  1W3B A;  1N0Q A;  4HI8 A;  2OVB A;  2LUH A;  3PZ4 A;  5JJ6 A;  1FVF A;  3DST A;  4U07 A;  3FU5 A;  3LS8 A;  3B7R L;  3SQV A;  4DX7 D;  1H0A A;  3RAU A;  1O1R A;  4EZL A;  3QOU A;  3T8M A;  3AJI A;  3V2O A;  4UWG A;  3CHP A;  3LJ3 A;  3ML9 A;  1FT1 A;  3WG7 E;  4JA7 A;  3CK7 A;  4DI3 A;  4L9P A;  1SQM A;  3ASH A;  1E7U A;  4UWK A;  4LRZ A;  3UT7 A;  4UWL A;  3ZIM A;  2BKG A;  4GTO A;  4DRX E;  3SD5 A;  3B7U X;  4EHM A;  4U8H A;  1Z6T A;  3CQC B;  3ZNG A;  1OWN A;  4HRL A;  3L17 A;  4J8Y A;  4GZC A;  2ION A;  3S7D A;  5LCW J;  2CHZ A;  3W9F A;  2X6I A;  2HYZ A;  3HXB A;  3SGH A;  5FZR A;  5LOZ A;  2ZGD A;  1FPP A;  4ABN A;  1BI7 B;  4H7Y A;  2R59 A;  2OVF A;  3APD A;  4BT9 A;  4H7X A;  1TN6 A;  1DVP A;  1UN8 A;  3RIB A;  2CG3 A;  4B89 A;  3NAW A;  5ITZ F;  1N4P A;  3I3N A;  2PZI A;  4NIK A;  2H6G A;  5CEC B;  5JA4 D;  2ZIR A;  3UQ3 A;  3LVQ E;  3UT8 A;  1WDY A;  5A6C A;  3FU0 A;  1EF1 C;  5HQ8 A;  1HXI A;  2I1J A;  2DZN A;  5D0O D;  5D2M C;  3SBT B;  3DSS A;  2QY7 A;  3CHR A;  5CBN A;  1OWL A;  4WNF A;  4ANW A;  3ZFW A;  3CGH A;  5HI7 A;  2XEH A;  2PQR A;  5JJT A;  3KEZ A;  4G11 A;  3AS8 A;  2WM9 A;  4CCA A;  3FEY A;  2DYR E;  1KLX A;  1N52 A;  4BX9 A;  2YNQ A;  4JHJ A;  4GCO A;  1IHG A;  3Q49 B;  3UT4 A;  4MLP A;  1IYG A;  4YDO A;  4DJA A;  3FUN A;  4DPR A;  3ABL E;  4APO A;  4I6G A;  1TNO A;  4F7A A;  2GW1 A;  3UM0 A;  1IXV A;  1X81 A;  1NFI E;  3G2V A;  3N71 A;  4XKC A;  3ZGQ A;  1BPO A;  4U96 D;  4F3V A;  4WUY A;  3ABM E;  4G23 A;  3KSQ A;  1LD8 A;  3L54 A;  3ZU7 B;  3FTZ A;  5D66 A;  1ELR A;  3ZPJ A;  1K8K G;  3HXF A;  1DCQ A;  3QB2 A;  5CRU A;  4C48 B;  4WNG A;  2GRN B;  1H19 A;  1U2V G;  3PH0 C;  5CMW A;  3LEW A;  2V8S E;  4HRM B;  4ILH B;  3U4T A;  1BLX B;  1HG5 A;  1SZA A;  3SFY A;  3U9W A;  3ASN E;  1N0R A;  2CFZ A;  3VLD A;  3P1U A;  3L16 A;  2P9L G;  5HKP A;  4GZ6 A;  1U3D A;  5EYP F;  3Q4A B;  4FJZ A;  2FEZ A;  3LYA A;  3QC1 A;  2M63 A;  2XZD G;  5ANR A;  3Q9N C;  5CRV A;  4L2L A;  4I2W A;  2X6H A;  4WWN A;  5H7P A;  2ZGG A;  1NI1 A;  2WVI A;  2GGF A;  4GMJ A;  5JJ7 A;  3ABK E;  3PZ1 A;  5FT9 A;  2LO6 A;  1E8Z A;  3GZ2 A;  4JHK A;  2JAB A;  3DEP A;  3CVW A;  3IV0 A;  1TEZ A;  2KCV A;  3Q79 A;  4FP7 A;  2EIM E;  2VGY A;  5KNH D;  3LCA A;  3RJV A;  3VLF A;  3PEV B;  4RG6 A;  2EQX A;  1NA0 A;  3BQO A;  3SBS A;  1TNY A;  4G26 A;  2F8Y A;  2LAI A;  3RU0 A;  1B89 A;  3CKC A;  1SVX A;  3FUD A;  3TWQ A;  3MKQ B;  2RFA A;  3NZS A;  4BT8 A;  3SY2 A;  3FFL A;  4ZFH A;  4KT6 B;  4KVO A;  1HE8 A;  3ZYL A;  3BG0 B;  4BWR A;  2WXJ A;  2QYU A;  3TWX A;  5CCL A;  4TXQ A;  4UI9 K;  1MQS A;  3PUJ A;  3SFZ A;  3DBS A;  3IXE A;  1LF8 A;  5AEN A;  1JWG A;  3RO3 A;  3R9A B;  3W9G A;  2XPZ A;  3UMV A;  2H6F A;  2WXO A;  3FUK A;  3GYZ A;  5JHB A;  3CHS A;  4CGW A;  4DK5 A;  3E34 A;  4BFR A;  3JCK C;  4GB9 A;  3OXL A;  5DIZ A;  1S0P A;  1YYH A;  1Y8M A;  4HOQ A;  3CKB A;  5EYL A;  2P9I G;  1Z5S C;  2HR2 A;  2WQH A;  3OXG A;  3UTM A;  3PRE A;  4P29 A;  2RG8 A;  5G55 A;  2H6I A;  3S7B A;  5ARG A;  3MGB A;  3NQP A;  5CCM A;  1HX8 A;  2PQN A;  3DXK G;  2F0Y A;  5EN5 D;  1AP7 A;  1H6K A;  1EDU A;  2DZO A;  4N3C A;  4GAA A;  2XRZ A;  4GA1 A;  2V0P A;  4YDE A;  5E76 A;  5CMY A;  3PZ2 A;  4EPZ A;  3FUJ A;  4F53 A;  3TWR A;  2QC9 A;  3FUM A;  3D9J A;  4HOR A;  1UOH A;  3RRU A;  4RLY A;  3CHQ A;  2FUL A;  2XEE A;  1H6P A;  2C0M A;  2DWZ A;  3L22 A;  4AOF A;  2WMO A;  3R9M A;  4FA6 A;  1IHB A;  5AYW D;  4JHR A;  3MZL B;  3LXU X;  4U8Y D;  1SW6 A;  4ATZ D;  2DYS E;  4UI9 J;  4I6E A;  3E37 A;  2KAT A;  4CT4 A;  4I9E A;  3PNT B;  3UPV A;  2VGX A;  4G8L A;  2XCB A;  3FTU A;  1SA4 A;  3G2W A;  3NZU A;  2OEW A;  3ZVV A;  3HVE A;  4FLB A;  3Q47 B;  3EIQ C;  1IKN D;  4B0Z A;  5ENP D;  1DNP A;  2BTD A;  3ZXP A;  4GMR A;  5J90 A;  4Q69 A;  3ZXS A;  4F1P A;  5CHE E;  3FUL A;  5J08 A;  4FJY A;  3FU3 A;  4AY6 A;  5KJK A;  3HXE A;  2WXF A;  3BEE A;  1HG2 A;  5FIO A;  3UIN C;  3MEK A;  4OVU A;  4G25 A;  1QYM A;  3J5Q B;  3IHY A;  4GPK A;  4JL0 A;  4M7C A;  3CVL A;  3OAW A;  4GYO A;  3PZD A;  3U3W A;  3EHM A;  3AU4 A;  3MA5 A;  5ANL A;  3AG1 E;  1OXJ A;  1JWF A;  3FTX A;  3PS6 A;  3CVV A;  3TJP A;  3ASG A;  2V5Q C;  3AS5 A;  3DRA A;  2X6J A;  2DCP A;  2JEK A;  4KZC A;  5FJY A;  3FUE A;  2XPY A;  4LEU A;  4HLE A;  4CGV A;  4PS3 A;  2OOE A;  5LCW C;  5CER B;  3CSF A;  5IY5 E;  3D9H A;  4KXK B;  3HG0 D;  1MHQ A;  5E75 A;  3TGO A;  2WMN A;  2IOL A;  1MX6 A;  3ZKJ A;  5G05 C;  4HNA D;  2KXP C;  3FUI A;  3UIP C;  4Z68 A;  3IKO B;  1ZBP A;  3L82 A;  3LDZ A;  3CLJ A;  4J8S A;  3CK8 A;  4BSX A;  5LFA A;  1P5Q A;  5T3R A;  4ZHB A;  2CG2 A;  5AQA A;  2A4Z A;  4N5Q A;  5ENN A;  2IFU A;  1HH8 A;  4BTB A;  3BU8 A;  5BXU A;  3ZHE B;  4K5C A;  4DLO A;  2IEJ A;  3AG2 E;  1HO8 A;  4RVB A;  2WXQ A;  1O1T A;  3HHM A;  2WXL A;  3JYS A;  4I9C A;  1OT8 A;  3CVU A;  1N54 A;  1U3C A;  3C3O A;  1OWP A;  3Q7F A;  4ANV A;  5EX3 A;  2R17 C;  3C98 A;  3UI2 A;  1TJC A;  3KAE A;  1JCQ A;  1D9S A;  4FHK A;  4YVQ C;  1E96 B;  5BV0 A;  2Y0B G;  3V79 K;  4A1S A;  4CRW A;  1Z3X A;  4I1M A;  4IYP A;  1TN8 A;  1XGW A;  3PEU B;  3DEO A;  2HO1 A;  1LTX A;  2WXN A;  4IN3 B;  2UY1 A;  2P9S G;  5KWD A;  1NZN A;  2HE0 A;  3FUF A;  4GTQ A;  4LG6 A;  5KJL A;  1A5E A;  3FH8 A;  2YHC A;  3ASD A;  4U63 A;  3JUI A;  3Q5M A;  4KBQ A;  4A3T A;  2P9P G;  4FUL A;  1MZC A;  4HOU A;  1DC2 A;  3APC A;  1OCR E;  1RW2 A;  3ZYK A;  1BD8 A;  4I6J A;  3MX3 A;  4JXT A;  4GTP A;  1WY6 A;  1KZP A;  3J5P A;  4EBA G;  4UQZ A;  4XI9 A;  4OYS A;  1EPU A;  2X38 A;  3LY9 A;  4O1O A;  4TRQ A;  1Q2Z A;  1TJF A;  4N5C A;  4R7L A;  5CED B;  2LNI A;  2NXP A;  1H6O A;  3Q75 A;  4G8K A;  4PDX A;  4GML A;  5FTP A;  5JHA A;  2WQ6 A;  2WXH A;  4PS8 A;  2YQ8 A;  1N9A A;  2OEV A;  5AQB A;  2F37 A;  4GTV A;  4M3O A;  3AAA C;  2DVW A;  1JPL A;  2GRM A;  4JEU A;  2YIN A;  5KBA A;  4K03 A;  4GU5 A;  3TWU A;  3DXM G;  3L13 A;  4K5A B;  3E4B A;  4ANU A;  2I6H A;  4GZ3 A;  2Q7F A;  4GA0 A;  5FQ7 A;  2VTB A;  3BUA A;  1S64 A;  4L2Y A;  5AAO A;  3DSV A;  4XI0 A;  4G2V A;  5BT1 A;  2VJ8 A;  2BUG A;  5BW8 C;  3AG3 E;  5ENQ D;  2IQC A;  4L7T A;  3QWP A;  3IHV A;  4LSZ E;  3C3Q A;  4UUC A;  2XS1 A;  5C1D A;  5B3S E;  5ENR D;  3B7T A;  2AW6 A;  4HRN A;  4AM9 A;  4TXP A;  2LXL A;  5AJL A;  3HXC A;  4V3I A;  3B95 A;  5DBK A;  3HXD A;  2DIW A;  4F6R D;  1UN9 A;  3JUE A;  3ULE G;  3TAX A;  4BY6 A;  3KSL A;  2B0O E;  2HM8 A;  3K9I A;  5G2N A;  4RSY A;  1IQR A;  2PM7 A;  3EU9 A;  4DLQ A;  1YCS B;  3CK9 A;  2ZXW E;  3T9K A;  3RRM B;  2KCK A;  5BXO A;  3MJW A;  1O1S A;  2FO1 E;  2ETC A;  2Y69 E;  2MYO A;  4TUM A;  4TXR A;  5KCM A;  3ZN3 A;  5D0Q D;  4HOT A;  4MBG A;  1ZU2 A;  3X2Q E;  3V31 A;  3FHE A;  1FCH A;  2P9N G;  3CST A;  3UKU G;  2WB2 A;  4I2Z A;  2XCC A;  5KJM A;  3UUX A;  1NP7 A;  4MS6 A;  3PZ3 A;  3U64 A;  3TXN A;  1HZ4 A;  4J8F A;  4C9B B;  1X5B A;  2IY0 C;  3ZW3 A;  4K0R A;  2GRP B;  2X6K A;  4XKB A;  1PY1 A;  2QZA A;  3OXF A;  2NSZ A;  4XX5 A;  3AG4 E;  4ANX A;  3UM3 A;  1K1A A;  2Y3A A;  2XGM A;  1S70 B;  3R7Q A;  3TL5 A;  1ELK A;  1V55 E;  2NC9 A;  2ETB A;  4UWF A;  2IOS A;  3VTX A;  3FP3 A;  4A1G A;  5EIL A;  3G2S A;  3CVX A;  2A5E A;  3ULY A;  5CEA A;  4J6I A;  4FU3 A;  4HS2 A;  2IJG X;  2XGO A;  5FQ8 A;  2VSY A;  1TNU A;  3FTY A;  4HB5 A;  4C0M A;  3VLE A;  4CDN A;  1NL4 A;  2XHE A;  4GA2 A;  4FC8 A;  1JCR A;  1WAO 1;  4QQI A;  3PVL A;  2UWJ G;  4UQX A;  4GPM A;  1N4Q A;  2WXI A;  2J9Q A;  4WAF A;  3EUV A;  1N94 A;  4GYW A;  3MKR A;  2J8S D;  3S7F A;  2F8X K;  2AXU A;  3TXM A;  5M72 A;  2R05 A;  2AXZ A;  3SZ7 A;  3CR3 A;  2J09 A;  3SI5 A;  2J4D A;  2ZIS A;  1H2V C;  2J08 A;  1GW6 A;  4LNB A;  1FVH A;  3ZEF A;  4LNG A;  3DSW A;  4ILI A;  3LPZ A;  2WXG A;  1E8W A;  3QWW A;  1S63 A;  3LY7 A;  5AJD A;  3C5R A;  2V5F A;  3OTN A;  5ENS D;  3D9P A;  2A5U A;  5KJN A;  1BI8 B;  4NQ0 A;  4PS7 A;  4MRU A;  5G04 J;  1SZ9 A;  5T4Y A;  2YHE A;  3TG5 A;  3SFX A;  2WXK A;  3UXG A;  1KT1 A;  5AIJ A;  2WXM A;  2I2O A;  1E90 A;  2B6C A;  3G2T A;  2PM6 A;  2LSU A;  3BG1 B;  2VSN A;  4E85 A;  4EBA A;  3DSX A;  2XGS A;  2GRO B;  5EKQ D;  4AIF A;  4YDW A; 
#chains in the Genus database with same CATH homology
 3NF1 A;  2HO1 A;  1E8Y A;  2CFZ A;  1XNF A;  3P1U A;  4UI9 C;  5ARF A;  2WXN A;  3VLD A;  3FUH A;  4IN3 B;  2FO7 A;  2UY1 A;  3L16 A;  3D9K A;  3SF4 A;  3ZVV A;  2OV8 A;  1IQU A;  4HXI A;  2L0T B;  4GZ6 A;  4MKT A;  4ACK A;  4B94 A;  3ENE A;  4URK A;  1U3D A;  5T8I A;  3B13 A;  1NZN A;  3EHN A;  3FUF A;  3TG4 A;  4J8E A;  3Q4A B;  2KC7 A;  3FH5 A;  4B8A A;  1PC2 A;  1HF8 A;  5KJL A;  4FJZ A;  3ESL A;  2YHC A;  3ASD A;  3FH8 A;  2FEZ A;  3LYA A;  4U63 A;  1HS6 A;  4JC8 A;  3JUI A;  3Q5M A;  4KBQ A;  4A3T A;  3D9L A;  2XRY A;  3O48 A;  3HIZ A;  2M63 A;  3PE3 A;  3QC1 A;  3PRZ A;  4FUL A;  4PH4 B;  4L2L A;  5ANR A;  4I2W A;  2X6H A;  5FZS A;  3UX4 A;  4HOU A;  4WWN A;  3U66 A;  4I1O B;  3CHM A;  4IRU A;  4Q96 A;  5G04 C;  2VYI A;  4CEM A;  5C2Y A;  3APC A;  4AP2 A;  2WVI A;  3ZYK A;  2GGF A;  2BF0 X;  4B8C B;  4GMJ A;  3ZYQ A;  5JJ7 A;  2CHX A;  4I6J A;  3MX3 A;  4JXT A;  3CVY A;  5FT9 A;  3MYV A;  4O6F A;  1OUV A;  2LO6 A;  1E8Z A;  1WY6 A;  4I1A A;  5FQ6 A;  4OVV A;  3GZ2 A;  4Q94 A;  2J4B A;  4JHK A;  4KYO B;  1H2U A;  4XE0 A;  4EBA G;  4AVX A;  3CVW A;  4UQZ A;  4XI9 A;  3IV0 A;  1TEZ A;  2KCV A;  1QQE A;  3O4Z A;  4OYS A;  5EDS A;  1EPU A;  4FP7 A;  2X38 A;  3LY9 A;  4TRQ A;  4ILG A;  2IF4 A;  2VGY A;  1TJF A;  3LCA A;  3APF A;  4N5C A;  3RJV A;  3VLF A;  3PEV B;  4R7L A;  4JW1 A;  3IBE A;  4RG6 A;  2EQX A;  4HVB A;  1NA0 A;  4PUC A;  2LNI A;  2NXP A;  3KD7 A;  3MV2 B;  2VSX E;  4JVS A;  4WWP A;  3SBS A;  4KZ0 A;  2VQ2 A;  4FLH A;  4G26 A;  3D9O A;  2OND A;  2Y4T A;  4ATG A;  1UG3 A;  2LAI A;  3RU0 A;  1INZ A;  3FY4 A;  4PDX A;  4GML A;  5FTP A;  3ULQ A;  4GYY A;  5JHA A;  2WQ6 A;  1B89 A;  2WXH A;  4PS8 A;  3CKC A;  2L6J A;  2YQ8 A;  3VTY A;  3FWV A;  4KVM A;  3FUD A;  1L5J A;  3MKQ B;  3NZS A;  4BT8 A;  2ILR A;  2MHK A;  3FFL A;  3FEX A;  4D10 C;  4KT6 B;  4TUU A;  4N3B A;  1E8X A;  4KVO A;  4M3O A;  3Q15 A;  2JLB A;  4BTA A;  1HE8 A;  2C2L A;  1Z3Y A;  3ZYL A;  3BG0 B;  4BWR A;  3ZHE A;  5A23 A;  4LCT A;  1JPL A;  2GRM A;  3FTW A;  2WXJ A;  4JEU A;  2YIN A;  3QNK A;  3WXX A;  4K03 A;  4GU5 A;  5CCL A;  1UJK A;  4UI9 K;  4JA9 A;  1MQS A;  3L13 A;  3E4B A;  4ANU A;  2I6H A;  3PUJ A;  4GZD A;  4GZ3 A;  3SFZ A;  2Q7F A;  4GA0 A;  4GCN A;  4U0U A;  4XIF A;  5FQ7 A;  2VTB A;  2VGX B;  3DBS A;  2E2E A;  4L2Y A;  2FF4 A;  2KZT B;  4JPS A;  3QK0 A;  3EJN A;  3PUK A;  4XI0 A;  2J49 A;  4G2V A;  3B7S A;  4EZK A;  1LF8 A;  2KZT A;  1OWO A;  1NA3 A;  5AEN A;  5BT1 A;  2VJ8 A;  1JWG A;  3RO3 A;  3R9A B;  2J07 A;  4FHJ A;  4IUL A;  2BUG A;  2XPZ A;  5BW8 C;  3GZS A;  3HVE B;  3I4R B;  3I4G A;  3LVR E;  3R7R A;  3S2A A;  3UMV A;  4A3V A;  4FAD A;  4EZJ A;  5FZQ A;  3LY8 A;  2WXO A;  3ASF A;  2IQC A;  4L7T A;  3FUK A;  1HU3 A;  3GYZ A;  3QWP A;  3IHV A;  5JHB A;  1HFA A;  3CHS A;  3RKV A;  3ZRH A;  4CGW A;  4DK5 A;  5C1D A;  1UJJ A;  4ACL A;  4BFR A;  2X3M A;  3JCK C;  4E6H A;  4GB9 A;  3OXL A;  4N3A A;  4JEH A;  4NAC A;  5DIZ A;  3PNL B;  2WXP A;  3QAQ A;  1S0P A;  1Y8M A;  2AW6 A;  2V4L A;  3B7T A;  2RD0 A;  4AM9 A;  3T5V A;  4HOQ A;  4AXH A;  3CKB A;  1UW4 B;  4AEZ C;  3QDN A;  4UWH A;  3GZ1 A;  2VSO E;  5FQ4 A;  5G05 J;  5AJL A;  4L23 A;  4V3I A;  2HR2 A;  4AY5 A;  2WQH A;  4YND A;  5DBK A;  1E7V A;  3OXG A;  4RG9 A;  2DIW A;  3FTV A;  1UN9 A;  4XZ4 A;  3PRE A;  2PL2 A;  4P29 A;  2RG8 A;  2E0I A;  3TAX A;  2L9B A;  5G55 A;  4BY6 A;  5LP0 A;  4WND A;  3ESK A;  3MV3 B;  3S7B A;  5ARG A;  5BV1 A;  2HM8 A;  3MGB A;  4C0E A;  3NQP A;  5CCM A;  1HX8 A;  2PQN A;  3IEG A;  3ONK A;  4F1S A;  3I5P A;  2FBN A;  3SHF A;  4HOS A;  3HYM B;  3K9I A;  1H6K A;  3G2U A;  1EDU A;  2CFU A;  2CHW A;  5G2N A;  3AU5 A;  4N3C A;  1PAQ A;  2QFC A;  4RSY A;  4N2S A;  3CHO A;  4GAA A;  2XRZ A;  3QJZ A;  4GA1 A;  1IQR A;  2PM7 A;  1ELW A;  2V0P A;  4LER A;  2XQ0 A;  4DLQ A;  5E76 A;  2L0I A;  4TV3 A;  5A7D B;  5CMY A;  3CK9 A;  3D9I A;  4A55 A;  2AXV A;  2WQ7 A;  4EPZ A;  4BX8 A;  3RRM B;  2KCL A;  4CDR A;  3FUJ A;  1W3B A;  2KCK A;  3MJW A;  2OVB A;  4F53 A;  3FUM A;  5EX0 A;  3LKU A;  5JJ6 A;  5KCM A;  3ZN3 A;  3D9J A;  4HOR A;  1FVF A;  3RRU A;  2WXR A;  3CVQ A;  4U07 A;  5D0Q D;  3FU5 A;  4HOT A;  3CHQ A;  3LS8 A;  2FUL A;  1VDY A;  3FU6 A;  4W9R A;  3B7R L;  2MRI A;  2C0M A;  1ZU2 A;  3L22 A;  4AOF A;  3AS4 A;  4UQY A;  3FHE A;  4Y6W A;  2XEV A;  1FCH A;  2C0L A;  1H0A A;  2WMO A;  4EZL A;  3QOU A;  3T8M A;  4FA6 A;  5AYW D;  3CST A;  3CVP A;  4JHR A;  3MZL B;  4UWG A;  3LXU X;  3MKQ A;  2LSV A;  3CHP A;  3LJ3 A;  3ML9 A;  4UI9 J;  4I6E A;  2WB2 A;  4I2Z A;  4WNE A;  4JA7 A;  3CV0 A;  3CK7 A;  3L08 A;  2XCC A;  2KAT A;  5KJM A;  4DI3 A;  3UUX A;  1SQM A;  3ASH A;  4CT4 A;  1E7U A;  1NP7 A;  4I9E A;  4LRZ A;  4UWK A;  3UT7 A;  2FI7 A;  4MS6 A;  4EQF A;  4UWL A;  3U64 A;  3ZIM A;  3TXN A;  1HZ4 A;  4J8F A;  3QAR A;  1X5B A;  3PNT B;  2WPV A;  4C9B B;  1EYH A;  3UPV A;  2VGX A;  3ZW3 A;  2XCB A;  4K0R A;  3SD5 A;  3ZYM A;  5LX8 A;  3B7U X;  3FTU A;  4APF A;  4U8H A;  3G2W A;  3NZU A;  2X6K A;  1Z6T A;  4XKB A;  1PY1 A;  3CQC B;  1OWN A;  3FH7 A;  3L17 A;  3OXF A;  3GW4 A;  2NSZ A;  3CIA A;  2DBA A;  3HVE A;  3URZ A;  4FLB A;  2IU1 A;  2I9C A;  3Q47 B;  2AVP A;  4GZ5 A;  4XX5 A;  3EIQ C;  4EEC A;  4U04 A;  4GZC A;  4N2Q A;  3L6A A;  1H2T C;  4ANX A;  2Y3A A;  3CEQ A;  2ION A;  3S7D A;  4B0Z A;  2XGM A;  2CHZ A;  5LCW J;  1YA0 A;  4WWO A;  1DNP A;  3R7Q A;  3TL5 A;  1ELK A;  2BTD A;  2X6I A;  2NC9 A;  3EIJ A;  5FWQ A;  4UWF A;  5J90 A;  2IOS A;  3ZXS A;  3VTX A;  2HYZ A;  3FP3 A;  3SGH A;  4A1G A;  5CHE E;  4Q69 A;  5FZR A;  4J8D A;  3FUL A;  5J08 A;  4FJY A;  3FU3 A;  5LOZ A;  3G2S A;  4AY6 A;  5KJK A;  3D9M A;  1OWM A;  3CVX A;  2WXF A;  3RK6 A;  4ABN A;  3BEE A;  1HG2 A;  4H7Y A;  1WM5 A;  2R59 A;  1A17 A;  2OVF A;  2UY1 B;  3APD A;  4BT9 A;  4H7X A;  3MEK A;  4J6I A;  3PE4 A;  4FU3 A;  1DVP A;  1UN8 A;  4G25 A;  4OVU A;  3RIB A;  2CG3 A;  4HS2 A;  4B89 A;  2IJG X;  3IHY A;  3QWV A;  3I3N A;  2XGO A;  1Y6I A;  4GPK A;  4QFV A;  2PZI A;  4JL0 A;  5FQ8 A;  2VSY A;  3CVL A;  3OAW A;  4GYO A;  3FTY A;  3PZD A;  3UQ3 A;  4AJW A;  3CVN A;  3LVQ E;  4C0M A;  3U3W A;  2X6F A;  3EHM A;  3AU4 A;  3MA5 A;  3KS2 A;  3UT8 A;  3VLE A;  5ANL A;  3MCX A;  5A6C A;  3FU0 A;  3P2B A;  1EF1 C;  1JWF A;  3ONL A;  3FTX A;  1JUQ A;  3PS6 A;  4CDN A;  1HXI A;  5HQ8 A;  2XHE A;  2I1J A;  4YVO A;  4GA2 A;  3CVV A;  5D0O D;  4FC8 A;  3TJP A;  3ASG A;  5BNW A;  4NRH B;  3AS5 A;  1QZ2 A;  1WAO 1;  3SBT B;  2X6J A;  2DCP A;  2JEK A;  2QY7 A;  3CQG B;  3PVL A;  4KZC A;  3CHR A;  5FJY A;  2UWJ G;  3FUE A;  4UQX A;  4I43 A;  3JQ1 A;  3DPD A;  2XPY A;  4JZY A;  5BUZ A;  1OWL A;  4LEU A;  4WNF A;  4HFG A;  4ANW A;  4HLE A;  2WXI A;  3ZFW A;  4CGV A;  4PS3 A;  2OOE A;  2J9Q A;  5LCW C;  4WAF A;  3CSF A;  4U0Z A;  4GYW A;  4KXK B;  3CGH A;  3MKR A;  5HI7 A;  4Y6C A;  4DI4 A;  5BPP A;  4N39 A;  2PQR A;  3S7F A;  2AXU A;  3TXM A;  5M72 A;  1MHQ A;  2AXZ A;  5E75 A;  4I17 A;  3SZ7 A;  3CR3 A;  5JJT A;  2J09 A;  3KEZ A;  4G1T A;  3SI5 A;  2WMN A;  2IOL A;  4G11 A;  3AS8 A;  3TGO A;  2WM9 A;  2J4D A;  3D3M A;  3FEY A;  1H2V C;  2J08 A;  5G05 C;  2LAH A;  4CCA A;  3FUI A;  1GW6 A;  3FDH A;  1KLX A;  1N52 A;  4BX9 A;  2YNQ A;  3QKY A;  3IKO B;  1ZBP A;  3LDZ A;  3EDT B;  4G24 A;  3CLJ A;  4J8S A;  4JHJ A;  1FVH A;  4GCO A;  3ZEF A;  3S7J A;  1KT0 A;  1IHG A;  3CK8 A;  3Q49 B;  4BSX A;  3JQ0 A;  4ME2 A;  5LFA A;  4ILI A;  3LPZ A;  3UT4 A;  1P5Q A;  2WXG A;  4MLP A;  1IYG A;  5T3R A;  4DJA A;  1E8W A;  3FUN A;  4DPR A;  3QWW A;  3RO2 A;  3RRN B;  2CG2 A;  4APO A;  4I6G A;  4KMO A;  2XPI A;  2A4Z A;  4NUR A;  5ENN A;  3T5X A;  2IFU A;  3LY7 A;  4F7A A;  2GW1 A;  2GRL A;  1HH8 A;  5AJD A;  4BTB A;  2V5F A;  3ML8 A;  3OTN A;  3SNX A;  3ZHE B;  4CT0 A;  3D9P A;  2A5U A;  5KJN A;  4DLO A;  3G2V A;  3N71 A;  1HO8 A;  4RVB A;  2WXQ A;  4NQ0 A;  3HHM A;  4PS7 A;  2WXL A;  4XKC A;  3ZGQ A;  3JYS A;  4I9C A;  3CVU A;  1BPO A;  2Y4U A;  4MRU A;  4F3V A;  3D9N A;  4WUY A;  2VTB B;  5G04 J;  1SZ9 A;  5T4Y A;  1N54 A;  1U3C A;  2AWI A;  4G23 A;  4CDM A;  1OWP A;  2YHE A;  1QNF A;  3TG5 A;  3L54 A;  4ANV A;  4J0U A;  2WXK A;  3FTZ A;  3HDX A;  1KT1 A;  1ELR A;  2KM4 A;  5EX3 A;  2I1K A;  3ZPJ A;  2R17 C;  2WXM A;  4L1B A;  4U0S A;  5AIJ A;  2I2O A;  3C98 A;  3QB2 A;  1E90 A;  4WNG A;  1TJC A;  3KAE A;  4LUN U;  3G2T A;  2MOW A;  2PM6 A;  2LSU A;  3BG1 B;  2VSN A;  4FHK A;  4YVQ C;  1H19 A;  4E85 A;  1E96 B;  4EBA A;  5BV0 A;  3PH0 C;  5CMW A;  3LEW A;  2V8S E;  4A1S A;  4ILH B;  3U4T A;  4AV7 A;  4CRW A;  2R5S A;  1Z3X A;  4AIF A;  2XGS A;  3PDN A;  4I1M A;  1HG5 A;  1SZA A;  3FTS A;  4IYP A;  2ZU6 B;  5EKQ D;  3U9W A;  1XGW A;  3PEU B;  2P58 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...