1SA4A

Human protein farnesyltransferase complexed with fpp and r115777
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of the Anticancer Clinical Candidates R115777 (Tipifarnib) and BMS-214662 Complexed with Protein Farnesyltransferase Suggest a Mechanism of FTI Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
total genus 129
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1sa4A00
1N4RA 3HXEA 3E34A 1N4QA 1TNOA 1FPPA 1N95A 1SA5A 1TN8A 3DSSA 1S64A 3HXDA 3PZ4A 3E37A 1FT1A 3SFXA 4GTOA 3E33A 3Q73A 3DSUA 1X81A 4YDEA 4LNBA 2F0YA 2H6IA 1DCEA 3PZ3A 2H6HA 4GTTA 1KZOA 3EUVA 2IEJA 1O1TA 1TNYA 1NI1A 3E30A 1TNZA 1D8EA 3Q7FA 1JCSA 2ZIRA 1O5MA 3DSXA 1LD7A 1LD8A 3HXBA 3Q79A 1NL4A 1JCRA 4GTSA 3EU5A 4GTPA 1MZCA 3DPYA 4GTVA 2H6FA 2R2LA 1JCQA 1SA4A 3C72A 1N4PA 3SFYA 1TN6A 1O1RA 3KSQA 3DSWA 4GTMA 4MBGA 1KZPA 3DSTA 4L9PA 1N94A 1FT2A 3PZ2A 1TN7A 3HXCA 1TNUA 3HXFA 3E32A 3Q7AA 1S63A 2ZISA 1TNBA 2H6GA 3PZ1A 2BEDA 3Q78A 3DSVA 4YDOA 4EHMA 1D8DA 1LTXA 4LNGA 1N4SA 4GTRA 1N9AA 1QBQA 3Q75A 3KSLA 4GTQA 1O1SA 3DRAA
chains in the Genus database with same CATH superfamily
3TG4A 1N95A 3TL5A 3TWTA 5T3RA 1QYMA 1TJCA 1S64A 3CQGB 2I2OA 1IKND 3DSUA 3WG7E 4EBAA 1ELKA 4LSZE 2PNNA 4FU3A 3PS6A 2CG2A 3AU5A 1BLXB 4F3VA 2WVIA 2WXRA 2XPIA 4OAUC 4AXHA 2HR2A 2KCKA 2JABA 4UI9K 2LSUA 3LY9A 1P5QA 3BU8A 4DUIA 3OXFA 3APFA 3UUXA 4GYWA 4N5QA 3PRZA 4XZ4A 4YVOA 3CEQA 3ML8A 3GW4A 3U9WA 2Y0BG 1O1RA 5AYWD 5CECB 4ANWA 4FHJA 3QWWA 2FO1E 3C98A 2GRQB 3EIJA 2IO3C 2H6GA 2ZU6B 2XPZA 4PS8A 3DSVA 3UIOC 3BG1B 3R9AB 4GB9A 1A5EA 3PUKA 3T8KA 3PVLA 4B8CB 4TXRA 5LFAA 1O1SA 4I43A 4KXKB 1KT1A 1TEZA 4KVOA 4Y6WA 2XRZA 2WMOA 2WXIA 3QKYA 2YINA 2WXGA 5H7PA 4GYOA 2VGXB 5B1AE 2YHEA 4L2LA 3AU4A 3GZSA 4J8SA 3ASOE 4O6FA 3SQVA 1H2VC 3G2UA 4RG9A 2AXVA 3L08A 2ZIRA 4KVMA 3J5PA 3BEEA 1GW6A 3DBSA 3LXUX 4JEHA 5JHBA 2V8SE 3ZU7B 3ZUVB 4ANXA 4OVUA 3LYAA 3FUIA 3S2AA 3CLJA 3AAAC 3FUKA 5JA4D 2HM8A 2F8XK 4FLBA 5JMND 4ABNA 3G2SA 3C72A 4U7EB 5BXOA 3AS4A 2GRRB 4B93B 4IN3B 5EN5D 3BG0B 3CVWA 1EF1C 3L82A 4F1PA 3IKOB 3LVRE 3J5QB 3JXJA 3T5VA 4J8EA 4U95D 1LTXA 1IHGA 2DWZA 3T9KA 4CCAA 4N3AA 4QFVA 2JEKA 3TXMA 5BUZA 3FTXA 3JXIA 1FVFA 1KLXA 4BWRA 2KBXA 2KATA 3S7BA 2XEVA 3AG4E 5FZRA 4HOUA 4LNBA 2P9SG 4KBQA 1UOHA 5B1BE 5ITZF 2KZTB 1IYGA 1W3BA 5A6CA 2LSVA 2JLBA 2XZTG 2VGYA 2EQXA 2KZTA 3UIPC 3FH7A 3CV0A 4BX9A 4GZ3A 3IHVA 3B95A 2KC7A 3Q79A 4CT4A 5ENNA 4HRNA 4I2ZA 2H6FA 3LJNA 3IXEA 1BI8B 1JCQA 3D9NA 5AARA 2I6HA 3SHFA 3ZIMA 3QAQA 4HRMB 1OT8A 4ATZD 4HQDA 2ETCA 1TNUA 3HXFA 3HVEA 1S63A 2UY1A 1QQEA 1HX8A 2BEDA 1OWPA 5KWDA 5LP0A 3HRAA 3NOCD 4CGVA 3V79K 4LCTA 1QBQA 4A1GA 3ZYMA 5KJLA 3CHSA 1B89A 4HOTA 3CVNA 3CVLA 5HKPA 5CRVA 3D9LA 3MZLB 3HDXA 3LCAA 3FU6A 1H6OA 2P9IG 4L23A 5G2NA 2FF4A 3Q49B 4GMJA 3ML9A 2VGXA 2VYIA 3SO8A 4UWKA 4N2QA 4LNUD 2A4ZA 4ILGA 2R05A 4N39A 1WDYA 1AP7A 3LS8A 1D8EA 2NC9A 5LCWC 4JVSA 1IQRA 3DSXA 4XEIG 2LUHA 4GTSA 3EHMA 1MZCA 4O60A 1HS6A 5EIBE 4U8VD 4HORA 2IFUA 3I3NA 2VTBB 3JUIA 5ENQD 5G05C 3FEYA 1E7UA 1NP7A 3KSQA 3DSWA 4LUNU 3HG0D 4G8KA 1MHQA 2PZIA 4JL0A 3D9IA 5ANRA 3TWRA 1HF8A 2ZGGA 3FUEA 3DPDA 4ILHB 5IY5E 1MX4A 4JHKA 3K9IA 3IV0A 5E75A 2WXJA 1HU3A 3MX3A 5AENA 2XS8A 3Q9NC 4DX5D 4DI3A 1IHBA 5ENPD 4GTQA 4Z68A 3HXEA 1K3ZD 2XHEA 2MYOA 5BT1A 3TG5A 3GZ1A 3L54A 1Z6TA 5E76A 3RO2A 1H2UA 3ULYA 3E4BA 4YDEA 1HZ4A 1OWNA 2L9BA 2IF4A 1SZAA 3B7UX 2IEJA 3HHMA 2M63A 3W9GA 4C0EA 1HO8A 3UTMA 4AM9A 4G23A 4AV7A 5CCMA 4B0ZA 1DC2A 4URKA 3ONKA 5FINA 3TJPA 3U66A 5EYLA 5BNWA 4BSZB 5JJ7A 4WUYA 1HH8A 3EU5A 3NB2A 1RW2A 3FULA 1K1BA 4NACA 1PY1A 2GRPB 3MYVA 3OXGA 1IXVA 3CR3A 3RRUA 4ATGA 3RU0A 1N94A 3JQ0A 2C2LA 3MKQA 5FTPA 3OAWA 2ZISA 4XE0A 4C9BB 2QY7A 3UT8A 4Q94A 1OWOA 3PEVB 5BV1A 4UQYA 4G2VA 5BXUA 3NAWA 3RRMB 3D9KA 2I1JA 4ANUA 3ZGQA 2VQ2A 3CHQA 3KSLA 4CT0A 5FQ4A 4G8LA 3LY7A 3Q73A 5CMYA 3FU3A 3UXGA 4HI9A 3FDHA 4FA6A 1G3NB 3ASFA 3PZ3A 1BI7B 5LCWJ 3E30A 3G2TA 4LRZA 2OEVA 1H6PA 3V2XA 1EPUA 2YNQA 2WQ6A 2WXOA 2PQNA 1JCRA 2OVFA 3CVXA 3AG3E 3Q5MA 2OEWA 5KNGA 2X38A 1MX2A 3PE3A 3ZN3A 4M7CA 4F6RD 5EILA 4G26A 1UJKA 4DX1A 4F1SA 3Q9UC 3O48A 1OCZE 4CDRA 3PNLB 4PS7A 4A63B 3E32A 5KJKA 3D9JA 3UI2A 4EBAG 3PZ1A 2L0IA 2RKKA 3JQ1A 2WMNA 1N11A 4KYOB 3ZEFA 2GGFA 4BTAA 3EHQA 4GTRA 5FT9A 3ZPJA 2P9NG 4U0SA 1A17A 4GA1A 2WXNA 4AIFA 4I1AA 5EIDA 1S0PA 2XS1A 3R9MA 3SF4A 3L16A 2XENA 3AS5A 1XNFA 4ZFHA 3C3OA 3B7SA 4WNGA 3KAEA 4Q96A 2VSOE 4BY6A 2IOLA 4U8YD 4TRQA 2F0YA 1KT0A 2L0TB 4N3CA 1PAQA 3VTXA 2LAIA 2DYSE 3NF1A 3VLFA 3ZFWA 4ACLA 4U96D 2EIME 4GPMA 1OCCE 2P2CP 3G2WA 2J09A 4GTPA 3DPYA 4CDMA 4AY6A 2WXHA 1UN9A 1WG0A 4MS6A 3MCXA 5B3SE 3MJWA 2CHZA 2MRIA 4WWNA 4AY5A 3ABME 3SBTB 4U04A 2V5FA 4MBGA 4IRUA 3RIBA 2CFZA 3C5RA 2KXPC 2WB2A 3CVVA 4UI9J 1OWLA 2ZXWE 3MV3B 5G04C 3FH5A 4N5CA 3CK8A 1MJ0A 4YDWA 2ETBA 1WM5A 2EINE 5CBOA 4EZLA 4ACKA 1ELWA 4B89A 3UKUG 2J9QA 5D2MC 4HI8A 3ONLA 3PREA 1MQSA 2GROB 1HXIA 5M72A 1FPPA 3ASHA 1D9SA 2I1KA 1U3DA 4GZ5A 4L1BA 2WXKA 3ZYQA 2BUGA 2V0PA 3WXXA 4PH4B 3X2QE 2P9LG 3KS2A 2NXPA 4DX2A 3L6AA 3UX4A 3DWLG 1TNYA 4WAFA 1AWCB 4TXQA 2J8SD 2P58C 2IOSA 3VLDA 3CVPA 4DLQA 4U0UA 1LD7A 3CK9A 5D66A 1NFIE 2RG8A 1JWGA 4JPSA 4MRUA 2DCPA 4O1PA 2BKGA 2L6JA 5CEAA 2VSNA 5J90A 4F53A 3CSFA 2YQ8A 3SY2A 1RZ4A 4I9CA 2X6HA 1TN6A 3MV2B 4L2YA 4JHJA 2GW1A 5HRYA 4GA2A 3CIAA 3CVUA 1Z5SC 4N3BA 4FLHA 5AJLA 3HVEB 3GZ2A 4H7XA 2OV8A 2C0MA 5CCLA 2PM7A 3FUDA 4BEPA 3PDNA 1E90A 1N9AA 3QJZA 4HOSA 3QB2A 3IBEA 3SFZA 1JWFA 3FFLA 4Y6CA 3SZ7A 2Y3AA 3AG2E 4GTMA 5CRUA 2J08A 4TV3A 5FWQA 1QNFA 2CG3A 3PZ4A 4RG6A 3JUEA 3ZW3A 1TYQG 4FC8A 2H6IA 4W9RA 4DLOA 3S7JA 1TJFA 4BFRA 3I4GA 5AQ9A 4JW1A 2X6JA 4J8YA 5ARGA 1H6KA 1TNZA 3Q4AB 4YDYA 5D0OD 4HNAD 3TGOA 2PM6A 4YNDA 3ASGA 3RK6A 2XGSA 3D9OA 3ESKA 5AQ7A 2IJGX 4C0MA 3V30A 3TAXA 3CKBA 5C1DA 4TXPA 4M3OA 1ZBPA 4XI0A 2LAHA 3I4RB 2ETAA 4GMLA 4XKCA 1SA4A 2QYJA 4G1TA 3NOGD 3FUMA 1N4PA 3DEOA 4HS2A 4XKBA 3L22A 5FJYA 4ZHBA 4GCOA 5JJ6A 1TN7A 1XGWA 4LEUA 3PEUB 2R03A 4GMRA 2ILRA 4FJYA 1N0QA 2HYZA 4FADA 3I5PA 5CHEE 4J0UA 3OXLA 4WNEA 3CHMA 2IONA 3ZHEA 3C3QA 1NZNA 4I6JA 1N4QA 3FP3A 3QDNA 1JPLA 4CGWA 3ZYKA 3FEXA 1SW6A 4JZYA 5G05J 3TWSA 4JXTA 1U2VG 2R17C 3RAUA 5ENRD 3QWVA 5CBNA 1MYOA 2NYJA 4NQ0A 3VTYA 2HE0A 3FY4A 4KT6B 2H6HA 1NA3A 1NA0A 2X6IA 4FHKA 3JCKC 3KEZA 3S7FA 4GZDA 3D9PA 3CVQA 1KPSB 4ME2A 1LD8A 4RVBA 2EIJE 4JHRA 1U3CA 1YA0A 4WNFA 3D9MA 3U4TA 4H7YA 5BW8C 3GYZA 2E2EA 3T5XA 5ANLA 3NQPA 3QWPA 1E7VA 2WQ7A 3R7RA 3BQOA 3APDA 4OYSA 4L7TA 2Y69E 3AJIA 4IYPA 1HFAA 3O4ZA 2F37A 5G04J 4L9PA 2AXZA 3IEGA 3UT4A 4I9EA 3NZUA 3FTVA 4EHMA 2R59A 1YYHA 3UKRG 4LNGA 2DZOA 1N4SA 3P1UA 1H0AA 5J08A 4LERA 5AAOA 3RJVA 1FVHA 3APCA 2R5SA 1E8YA 2AWIA 4CZ2D 3TWQA 4J8FA 1UN8A 3HXDA 1E96B 1FCHA 5BV0A 4EQFA 3DXKG 5AIJA 2F8YA 4HFGA 1S70B 5LOZA 2P9KG 3FHEA 2IQCA 1Z3YA 1WAO1 3CQCB 4BETA 4GA0A 5CMWA 3SNXA 2X3MA 4U07A 4G24A 5FZQA 4GZ6A 4PS3A 4HRLA 1Y6IA 2RD0A 2YHCA 3URZA 4K5AB 3ZRHA 3G2VA 3ISMC 4CEMA 2WQHA 4I1MA 1SQMA 4QQIA 2VJ8A 1YCSB 2BF0X 3AG1E 1OXJA 3PZ2A 5AJDA 4APOA 3ABLE 4BSXA 2BTDA 3TWUA 3Q78A 4U0ZA 4LG6A 2XCCA 3B7TA 1PC2A 3FUJA 2EILE 4N2SA 3FU0A 4U8HA 3L13A 3DEPA 4K5CA 4AJWA 2LXLA 1Y8MA 3S7DA 5C2YA 4MLPA 2AVPA 3L9TA 3ZVVA 5KCMA 1N4RA 5A23A 2XPYA 3FTYA 1OCRE 2AW6A 3HIZA 4B94A 3F6QA 1HG2A 3W9FA 1Z3XA 3MA5A 5G55A 2B6CA 4E85A 1SZ9A 3LY8A 2FBNA 3ZXSA 3ULEG 1ZB1A 4JA9A 3ULQA 4HBDA 2KCVA 3ZYLA 2Y4TA 5FQ8A 3FTUA 5A7DB 1DNPA 2MHKA 3AS8A 4EZJA 4PUCA 5CEDB 2PL2A 4K5BA 3B7BA 4C48B 4I2WA 2DBAA 1E8XA 4WNDA 3FUHA 5HS0A 3PNTB 5EKQD 3LJ3A 3FTSA 2J4DA 2GRLA 4KMOA 3CKCA 2A5UA 2KCLA 1EDUA 2IY0C 3TWVA 2DIWA 3B13A 3LVQE 2FULA 3SFYA 3ZHEB 5JJTA 2AXUA 2MOWA 1K8KG 1L5JA 3PUJA 3Q7AA 5T8IA 4BESA 2QFCA 3ENEA 4HXIA 3LKUA 1OWMA 3CHOA 2XCBA 3FH8A 4DPRA 1JUQA 2XEEA 3CVYA 5HQ8A 5ENTD 1N54A 2XEHA 4IULA 2UWJG 3N71A 4EZKA 5LX8A 2WM9A 1TN8A 3DSSA 2WXQA 1N52A 5EDSA 2DYRE 2XQ0A 3E37A 1ELRA 1FT1A 3LEWA 4HB5A 4G25A 3EDTB 1X81A 4FULA 3DXMG 3SGHA 3MKQB 1BD8A 4GTTA 5FIOA 1KZOA 2X6KA 3FWVA 4I1OB 4CRWA 2IO2C 1H19A 4GPKA 2XGOA 2Q7FA 3Q7FA 4HLLA 1JCSA 1UW4B 3ASDA 4X8QA 3SD5A 2RFAA 4GU5A 1V55E 3TWXA 3QOUA 4APFA 3PE4A 5ENOD 3TWWA 3MGBA 2LO6A 2R2LA 4DX6D 4K0RA 3BUAA 4AEZC 3EHNA 1TR4A 3MKRA 3ZNGA 5KBAA 2FEZA 3DSTA 4J6IA 3UINC 3UM3A 5AQBA 3SI5A 4KZCA 4JEUA 2WPVA 3UM0A 2L6BA 2V4HC 3NBNB 4HVBA 4J7WA 3QNKA 4CYMD 4XX5A 1UG3A 2GRMA 1D8DA 4JA7A 2LNIA 1V54E 4RQIA 3CHPA 3UT7A 4HLEA 4GAAA 2QC9A 4DK5A 4XIFA 1TNOA 1SA5A 3KD7A 4OAVB 1OCOE 4JD2G 2KM4A 2B0OE 3SFXA 3CSTA 3OTNA 5ENSD 3EHRA 3E33A 4J8DA 1VDYA 4A3VA 4EPZA 4UQXA 3L17A 2BKKB 2DVWA 2CFUA 1SVXA 4AP2A 2WXMA 2OVBA 2C0LA 3ASNE 2VTBA 2P9UG 4O1OA 3EIQC 1EYHA 3FUNA 2OOEA 3HXBA 1X5BA 2X6FA 4PDXA 3FTWA 2P9PG 2HO1A 5EYPF 2XZDG 3VLEA 4R7LA 2QZAA 1YMPA 5D0QD 1HG5A 5FQ6A 3B7RL 2VSYA 4RSYA 4V3IA 3UMVA 2Y4UA 3Q47B 2J4BA 5T4YA 1TNBA 1LF8A 3ZXPA 2NSZA 4YDOA 3D3MA 4I6EA 1DVPA 5AQAA 2XRYA 2ONDA 4G11A 4CDNA 4F7AA 2I9CA 3PZDA 4KZ0A 2UY1B 4AOFA 4UWHA 4GCNA 4U63A 2V5QC 4P29A 3RRNB 4D10C 3FU5A 3JYSA 4UUCA 3CK7A 1WY6A 2WXPA 3CGHA 1ZU2A 4GTOA 4BERA 2FO7A 4DRXE 1BPOA 4TUUA 1BU9A 5ARFA 3RSEG 5DIZA 2ZGDA 1O1TA 2WXFA 4RLYA 3HYMB 1O5MA 3ABKE 1NL4A 4OVVA 4WWOA 4B8AA 3PH0C 2A5EA 2LXMA 5EX3A 4UI9C 1KZPA 4TUMA 3D9HA 1FT2A 1QZ2A 1E8ZA 3KEAA 3UM1A 4A1SA 5DBKA 5KJNA 1IQUA 5KNHD 2R02A 3FUFA 1K1AA 1MX6A 5HI7A 3T8MA 4ILIA 3MEKA 4UWLA 2VGEA 3Q75A 4A55A 4XI9A 4BT8A 3FTZA 5JHAA 3CHRA 4K03A 4Q69A 3U64A 3LDZA 4YVQC 4DI4A 2J49A 3TXNA 3E34A 4E6HA 4UWGA 2E0IA 3QARA 3Q15A 1UJJA 4JB8P 3RKVA 3EJNA 3P2BA 5EX0A 1OUVA 3R7QA 1DCEA 4ANVA 4WWPA 4UWFA 1H2TC 3EUVA 3LPZA 1NI1A 3C3RA 2QYUA 2DZNA 4HOQA 3ESLA 1HE8A 2IU1A 2Y1LE 4DJAA 3QK0A 4UQZA 2GRNB 2XGMA 3V2OA 4GYYA 4I6GA 3ZKJA 2FI7A 2AJAA 4GTVA 2RFMA 4FP7A 5FQ7A 4MKTA 3EU9A 5CERB 5KJMA 3NZSA 1DCQA 1N0RA 3QC1A 4AVXA 3U3WA 2PQRA 2VSXE 3UPVA 3IHYA 1Q2ZA 1OY3D 4BX8A 4NRHB 4NIKA 4A3TA 2J07A 3HXCA 4NURA 3UQ3A 3RO3A 4BTBA 4JC8A 4BT9A 1E8WA 3UM2A 2OCCE 4I17A 4EECA 1INZA 4FJZA 2CHXA 4DX7D 2CHWA 3SBSA 5AN8A 4GZCA 2EIKE 5FZSA 2V4LA 5BPPA 2WXLA 3V31A 3DRAA
chains in the Genus database with same CATH topology
1N4RA 3HXEA 3E34A 1N4QA 1TNOA 1FPPA 1N95A 1SA5A 1TN8A 3DSSA 1S64A 3HXDA 3PZ4A 3E37A 1FT1A 3SFXA 4GTOA 3E33A 3Q73A 3DSUA 1X81A 4YDEA 4LNBA 2F0YA 2H6IA 1DCEA 3PZ3A 2H6HA 4GTTA 1KZOA 3EUVA 2IEJA 1O1TA 1TNYA 1NI1A 3E30A 1TNZA 1D8EA 3Q7FA 1JCSA 2ZIRA 1O5MA 3DSXA 1LD7A 1LD8A 3HXBA 3Q79A 1NL4A 1JCRA 4GTSA 3EU5A 4GTPA 1MZCA 3DPYA 4GTVA 2H6FA 2R2LA 1JCQA 1SA4A 3C72A 1N4PA 3SFYA 1TN6A 1O1RA 3KSQA 3DSWA 4GTMA 4MBGA 1KZPA 3DSTA 4L9PA 1N94A 1FT2A 3PZ2A 1TN7A 3HXCA 1TNUA 3HXFA 3E32A 3Q7AA 1S63A 2ZISA 1TNBA 2H6GA 3PZ1A 2BEDA 3Q78A 3DSVA 4YDOA 4EHMA 1D8DA 1LTXA 4LNGA 1N4SA 4GTRA 1N9AA 1QBQA 3Q75A 3KSLA 4GTQA 1O1SA 3DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4R A;  3HXE A;  3E34 A;  1N4Q A;  1TNO A;  1FPP A;  1N95 A;  1SA5 A;  1TN8 A;  3DSS A;  1S64 A;  3HXD A;  3PZ4 A;  3E37 A;  1FT1 A;  3SFX A;  4GTO A;  3E33 A;  3Q73 A;  3DSU A;  1X81 A;  4YDE A;  4LNB A;  2F0Y A;  2H6I A;  1DCE A;  3PZ3 A;  2H6H A;  4GTT A;  1KZO A;  3EUV A;  2IEJ A;  1O1T A;  1TNY A;  1NI1 A;  3E30 A;  1TNZ A;  1D8E A;  3Q7F A;  1JCS A;  2ZIR A;  1O5M A;  3DSX A;  1LD7 A;  1LD8 A;  3HXB A;  3Q79 A;  1NL4 A;  1JCR A;  4GTS A;  3EU5 A;  4GTP A;  1MZC A;  3DPY A;  4GTV A;  2H6F A;  2R2L A;  1JCQ A;  1SA4 A;  3C72 A;  1N4P A;  3SFY A;  1TN6 A;  1O1R A;  3KSQ A;  3DSW A;  4GTM A;  4MBG A;  1KZP A;  3DST A;  4L9P A;  1N94 A;  1FT2 A;  3PZ2 A;  1TN7 A;  3HXC A;  1TNU A;  3HXF A;  3E32 A;  3Q7A A;  1S63 A;  2ZIS A;  1TNB A;  2H6G A;  3PZ1 A;  2BED A;  3Q78 A;  3DSV A;  4YDO A;  4EHM A;  1D8D A;  1LTX A;  4LNG A;  1N4S A;  4GTR A;  1N9A A;  1QBQ A;  3Q75 A;  3KSL A;  4GTQ A;  1O1S A;  3DRA A; 
#chains in the Genus database with same CATH topology
 3TG4 A;  1N95 A;  3TL5 A;  3TWT A;  5T3R A;  1QYM A;  1TJC A;  1S64 A;  3CQG B;  2I2O A;  1IKN D;  3DSU A;  3WG7 E;  4EBA A;  1ELK A;  4LSZ E;  2PNN A;  4FU3 A;  3PS6 A;  2CG2 A;  3AU5 A;  1BLX B;  4F3V A;  2WVI A;  2WXR A;  2XPI A;  4OAU C;  4AXH A;  2HR2 A;  2KCK A;  2JAB A;  4UI9 K;  2LSU A;  3LY9 A;  1P5Q A;  3BU8 A;  4DUI A;  3OXF A;  3APF A;  3UUX A;  4GYW A;  4N5Q A;  3PRZ A;  4XZ4 A;  4YVO A;  3CEQ A;  3ML8 A;  3GW4 A;  3U9W A;  2Y0B G;  1O1R A;  5AYW D;  5CEC B;  4ANW A;  4FHJ A;  3QWW A;  2FO1 E;  3C98 A;  2GRQ B;  3EIJ A;  2IO3 C;  2H6G A;  2ZU6 B;  2XPZ A;  4PS8 A;  3DSV A;  3UIO C;  3BG1 B;  3R9A B;  4GB9 A;  1A5E A;  3PUK A;  3T8K A;  3PVL A;  4B8C B;  4TXR A;  5LFA A;  1O1S A;  4I43 A;  4KXK B;  1KT1 A;  1TEZ A;  4KVO A;  4Y6W A;  2XRZ A;  2WMO A;  2WXI A;  3QKY A;  2YIN A;  2WXG A;  5H7P A;  4GYO A;  2VGX B;  5B1A E;  2YHE A;  4L2L A;  3AU4 A;  3GZS A;  4J8S A;  3ASO E;  4O6F A;  3SQV A;  1H2V C;  3G2U A;  4RG9 A;  2AXV A;  3L08 A;  2ZIR A;  4KVM A;  3J5P A;  3BEE A;  1GW6 A;  3DBS A;  3LXU X;  4JEH A;  5JHB A;  2V8S E;  3ZU7 B;  3ZUV B;  4ANX A;  4OVU A;  3LYA A;  3FUI A;  3S2A A;  3CLJ A;  3AAA C;  3FUK A;  5JA4 D;  2HM8 A;  2F8X K;  4FLB A;  5JMN D;  4ABN A;  3G2S A;  3C72 A;  4U7E B;  5BXO A;  3AS4 A;  2GRR B;  4B93 B;  4IN3 B;  5EN5 D;  3BG0 B;  3CVW A;  1EF1 C;  3L82 A;  4F1P A;  3IKO B;  3LVR E;  3J5Q B;  3JXJ A;  3T5V A;  4J8E A;  4U95 D;  1LTX A;  1IHG A;  2DWZ A;  3T9K A;  4CCA A;  4N3A A;  4QFV A;  2JEK A;  3TXM A;  5BUZ A;  3FTX A;  3JXI A;  1FVF A;  1KLX A;  4BWR A;  2KBX A;  2KAT A;  3S7B A;  2XEV A;  3AG4 E;  5FZR A;  4HOU A;  4LNB A;  2P9S G;  4KBQ A;  1UOH A;  5B1B E;  5ITZ F;  2KZT B;  1IYG A;  1W3B A;  5A6C A;  2LSV A;  2JLB A;  2XZT G;  2VGY A;  2EQX A;  2KZT A;  3UIP C;  3FH7 A;  3CV0 A;  4BX9 A;  4GZ3 A;  3IHV A;  3B95 A;  2KC7 A;  3Q79 A;  4CT4 A;  5ENN A;  4HRN A;  4I2Z A;  2H6F A;  3LJN A;  3IXE A;  1BI8 B;  1JCQ A;  3D9N A;  5AAR A;  2I6H A;  3SHF A;  3ZIM A;  3QAQ A;  4HRM B;  1OT8 A;  4ATZ D;  4HQD A;  2ETC A;  1TNU A;  3HXF A;  3HVE A;  1S63 A;  2UY1 A;  1QQE A;  1HX8 A;  2BED A;  1OWP A;  5KWD A;  5LP0 A;  3HRA A;  3NOC D;  4CGV A;  3V79 K;  4LCT A;  1QBQ A;  4A1G A;  3ZYM A;  5KJL A;  3CHS A;  1B89 A;  4HOT A;  3CVN A;  3CVL A;  5HKP A;  5CRV A;  3D9L A;  3MZL B;  3HDX A;  3LCA A;  3FU6 A;  1H6O A;  2P9I G;  4L23 A;  5G2N A;  2FF4 A;  3Q49 B;  4GMJ A;  3ML9 A;  2VGX A;  2VYI A;  3SO8 A;  4UWK A;  4N2Q A;  4LNU D;  2A4Z A;  4ILG A;  2R05 A;  4N39 A;  1WDY A;  1AP7 A;  3LS8 A;  1D8E A;  2NC9 A;  5LCW C;  4JVS A;  1IQR A;  3DSX A;  4XEI G;  2LUH A;  4GTS A;  3EHM A;  1MZC A;  4O60 A;  1HS6 A;  5EIB E;  4U8V D;  4HOR A;  2IFU A;  3I3N A;  2VTB B;  3JUI A;  5ENQ D;  5G05 C;  3FEY A;  1E7U A;  1NP7 A;  3KSQ A;  3DSW A;  4LUN U;  3HG0 D;  4G8K A;  1MHQ A;  2PZI A;  4JL0 A;  3D9I A;  5ANR A;  3TWR A;  1HF8 A;  2ZGG A;  3FUE A;  3DPD A;  4ILH B;  5IY5 E;  1MX4 A;  4JHK A;  3K9I A;  3IV0 A;  5E75 A;  2WXJ A;  1HU3 A;  3MX3 A;  5AEN A;  2XS8 A;  3Q9N C;  4DX5 D;  4DI3 A;  1IHB A;  5ENP D;  4GTQ A;  4Z68 A;  3HXE A;  1K3Z D;  2XHE A;  2MYO A;  5BT1 A;  3TG5 A;  3GZ1 A;  3L54 A;  1Z6T A;  5E76 A;  3RO2 A;  1H2U A;  3ULY A;  3E4B A;  4YDE A;  1HZ4 A;  1OWN A;  2L9B A;  2IF4 A;  1SZA A;  3B7U X;  2IEJ A;  3HHM A;  2M63 A;  3W9G A;  4C0E A;  1HO8 A;  3UTM A;  4AM9 A;  4G23 A;  4AV7 A;  5CCM A;  4B0Z A;  1DC2 A;  4URK A;  3ONK A;  5FIN A;  3TJP A;  3U66 A;  5EYL A;  5BNW A;  4BSZ B;  5JJ7 A;  4WUY A;  1HH8 A;  3EU5 A;  3NB2 A;  1RW2 A;  3FUL A;  1K1B A;  4NAC A;  1PY1 A;  2GRP B;  3MYV A;  3OXG A;  1IXV A;  3CR3 A;  3RRU A;  4ATG A;  3RU0 A;  1N94 A;  3JQ0 A;  2C2L A;  3MKQ A;  5FTP A;  3OAW A;  2ZIS A;  4XE0 A;  4C9B B;  2QY7 A;  3UT8 A;  4Q94 A;  1OWO A;  3PEV B;  5BV1 A;  4UQY A;  4G2V A;  5BXU A;  3NAW A;  3RRM B;  3D9K A;  2I1J A;  4ANU A;  3ZGQ A;  2VQ2 A;  3CHQ A;  3KSL A;  4CT0 A;  5FQ4 A;  4G8L A;  3LY7 A;  3Q73 A;  5CMY A;  3FU3 A;  3UXG A;  4HI9 A;  3FDH A;  4FA6 A;  1G3N B;  3ASF A;  3PZ3 A;  1BI7 B;  5LCW J;  3E30 A;  3G2T A;  4LRZ A;  2OEV A;  1H6P A;  3V2X A;  1EPU A;  2YNQ A;  2WQ6 A;  2WXO A;  2PQN A;  1JCR A;  2OVF A;  3CVX A;  3AG3 E;  3Q5M A;  2OEW A;  5KNG A;  2X38 A;  1MX2 A;  3PE3 A;  3ZN3 A;  4M7C A;  4F6R D;  5EIL A;  4G26 A;  1UJK A;  4DX1 A;  4F1S A;  3Q9U C;  3O48 A;  1OCZ E;  4CDR A;  3PNL B;  4PS7 A;  4A63 B;  3E32 A;  5KJK A;  3D9J A;  3UI2 A;  4EBA G;  3PZ1 A;  2L0I A;  2RKK A;  3JQ1 A;  2WMN A;  1N11 A;  4KYO B;  3ZEF A;  2GGF A;  4BTA A;  3EHQ A;  4GTR A;  5FT9 A;  3ZPJ A;  2P9N G;  4U0S A;  1A17 A;  4GA1 A;  2WXN A;  4AIF A;  4I1A A;  5EID A;  1S0P A;  2XS1 A;  3R9M A;  3SF4 A;  3L16 A;  2XEN A;  3AS5 A;  1XNF A;  4ZFH A;  3C3O A;  3B7S A;  4WNG A;  3KAE A;  4Q96 A;  2VSO E;  4BY6 A;  2IOL A;  4U8Y D;  4TRQ A;  2F0Y A;  1KT0 A;  2L0T B;  4N3C A;  1PAQ A;  3VTX A;  2LAI A;  2DYS E;  3NF1 A;  3VLF A;  3ZFW A;  4ACL A;  4U96 D;  2EIM E;  4GPM A;  1OCC E;  2P2C P;  3G2W A;  2J09 A;  4GTP A;  3DPY A;  4CDM A;  4AY6 A;  2WXH A;  1UN9 A;  1WG0 A;  4MS6 A;  3MCX A;  5B3S E;  3MJW A;  2CHZ A;  2MRI A;  4WWN A;  4AY5 A;  3ABM E;  3SBT B;  4U04 A;  2V5F A;  4MBG A;  4IRU A;  3RIB A;  2CFZ A;  3C5R A;  2KXP C;  2WB2 A;  3CVV A;  4UI9 J;  1OWL A;  2ZXW E;  3MV3 B;  5G04 C;  3FH5 A;  4N5C A;  3CK8 A;  1MJ0 A;  4YDW A;  2ETB A;  1WM5 A;  2EIN E;  5CBO A;  4EZL A;  4ACK A;  1ELW A;  4B89 A;  3UKU G;  2J9Q A;  5D2M C;  4HI8 A;  3ONL A;  3PRE A;  1MQS A;  2GRO B;  1HXI A;  5M72 A;  1FPP A;  3ASH A;  1D9S A;  2I1K A;  1U3D A;  4GZ5 A;  4L1B A;  2WXK A;  3ZYQ A;  2BUG A;  2V0P A;  3WXX A;  4PH4 B;  3X2Q E;  2P9L G;  3KS2 A;  2NXP A;  4DX2 A;  3L6A A;  3UX4 A;  3DWL G;  1TNY A;  4WAF A;  1AWC B;  4TXQ A;  2J8S D;  2P58 C;  2IOS A;  3VLD A;  3CVP A;  4DLQ A;  4U0U A;  1LD7 A;  3CK9 A;  5D66 A;  1NFI E;  2RG8 A;  1JWG A;  4JPS A;  4MRU A;  2DCP A;  4O1P A;  2BKG A;  2L6J A;  5CEA A;  2VSN A;  5J90 A;  4F53 A;  3CSF A;  2YQ8 A;  3SY2 A;  1RZ4 A;  4I9C A;  2X6H A;  1TN6 A;  3MV2 B;  4L2Y A;  4JHJ A;  2GW1 A;  5HRY A;  4GA2 A;  3CIA A;  3CVU A;  1Z5S C;  4N3B A;  4FLH A;  5AJL A;  3HVE B;  3GZ2 A;  4H7X A;  2OV8 A;  2C0M A;  5CCL A;  2PM7 A;  3FUD A;  4BEP A;  3PDN A;  1E90 A;  1N9A A;  3QJZ A;  4HOS A;  3QB2 A;  3IBE A;  3SFZ A;  1JWF A;  3FFL A;  4Y6C A;  3SZ7 A;  2Y3A A;  3AG2 E;  4GTM A;  5CRU A;  2J08 A;  4TV3 A;  5FWQ A;  1QNF A;  2CG3 A;  3PZ4 A;  4RG6 A;  3JUE A;  3ZW3 A;  1TYQ G;  4FC8 A;  2H6I A;  4W9R A;  4DLO A;  3S7J A;  1TJF A;  4BFR A;  3I4G A;  5AQ9 A;  4JW1 A;  2X6J A;  4J8Y A;  5ARG A;  1H6K A;  1TNZ A;  3Q4A B;  4YDY A;  5D0O D;  4HNA D;  3TGO A;  2PM6 A;  4YND A;  3ASG A;  3RK6 A;  2XGS A;  3D9O A;  3ESK A;  5AQ7 A;  2IJG X;  4C0M A;  3V30 A;  3TAX A;  3CKB A;  5C1D A;  4TXP A;  4M3O A;  1ZBP A;  4XI0 A;  2LAH A;  3I4R B;  2ETA A;  4GML A;  4XKC A;  1SA4 A;  2QYJ A;  4G1T A;  3NOG D;  3FUM A;  1N4P A;  3DEO A;  4HS2 A;  4XKB A;  3L22 A;  5FJY A;  4ZHB A;  4GCO A;  5JJ6 A;  1TN7 A;  1XGW A;  4LEU A;  3PEU B;  2R03 A;  4GMR A;  2ILR A;  4FJY A;  1N0Q A;  2HYZ A;  4FAD A;  3I5P A;  5CHE E;  4J0U A;  3OXL A;  4WNE A;  3CHM A;  2ION A;  3ZHE A;  3C3Q A;  1NZN A;  4I6J A;  1N4Q A;  3FP3 A;  3QDN A;  1JPL A;  4CGW A;  3ZYK A;  3FEX A;  1SW6 A;  4JZY A;  5G05 J;  3TWS A;  4JXT A;  1U2V G;  2R17 C;  3RAU A;  5ENR D;  3QWV A;  5CBN A;  1MYO A;  2NYJ A;  4NQ0 A;  3VTY A;  2HE0 A;  3FY4 A;  4KT6 B;  2H6H A;  1NA3 A;  1NA0 A;  2X6I A;  4FHK A;  3JCK C;  3KEZ A;  3S7F A;  4GZD A;  3D9P A;  3CVQ A;  1KPS B;  4ME2 A;  1LD8 A;  4RVB A;  2EIJ E;  4JHR A;  1U3C A;  1YA0 A;  4WNF A;  3D9M A;  3U4T A;  4H7Y A;  5BW8 C;  3GYZ A;  2E2E A;  3T5X A;  5ANL A;  3NQP A;  3QWP A;  1E7V A;  2WQ7 A;  3R7R A;  3BQO A;  3APD A;  4OYS A;  4L7T A;  2Y69 E;  3AJI A;  4IYP A;  1HFA A;  3O4Z A;  2F37 A;  5G04 J;  4L9P A;  2AXZ A;  3IEG A;  3UT4 A;  4I9E A;  3NZU A;  3FTV A;  4EHM A;  2R59 A;  1YYH A;  3UKR G;  4LNG A;  2DZO A;  1N4S A;  3P1U A;  1H0A A;  5J08 A;  4LER A;  5AAO A;  3RJV A;  1FVH A;  3APC A;  2R5S A;  1E8Y A;  2AWI A;  4CZ2 D;  3TWQ A;  4J8F A;  1UN8 A;  3HXD A;  1E96 B;  1FCH A;  5BV0 A;  4EQF A;  3DXK G;  5AIJ A;  2F8Y A;  4HFG A;  1S70 B;  5LOZ A;  2P9K G;  3FHE A;  2IQC A;  1Z3Y A;  1WAO 1;  3CQC B;  4BET A;  4GA0 A;  5CMW A;  3SNX A;  2X3M A;  4U07 A;  4G24 A;  5FZQ A;  4GZ6 A;  4PS3 A;  4HRL A;  1Y6I A;  2RD0 A;  2YHC A;  3URZ A;  4K5A B;  3ZRH A;  3G2V A;  3ISM C;  4CEM A;  2WQH A;  4I1M A;  1SQM A;  4QQI A;  2VJ8 A;  1YCS B;  2BF0 X;  3AG1 E;  1OXJ A;  3PZ2 A;  5AJD A;  4APO A;  3ABL E;  4BSX A;  2BTD A;  3TWU A;  3Q78 A;  4U0Z A;  4LG6 A;  2XCC A;  3B7T A;  1PC2 A;  3FUJ A;  2EIL E;  4N2S A;  3FU0 A;  4U8H A;  3L13 A;  3DEP A;  4K5C A;  4AJW A;  2LXL A;  1Y8M A;  3S7D A;  5C2Y A;  4MLP A;  2AVP A;  3L9T A;  3ZVV A;  5KCM A;  1N4R A;  5A23 A;  2XPY A;  3FTY A;  1OCR E;  2AW6 A;  3HIZ A;  4B94 A;  3F6Q A;  1HG2 A;  3W9F A;  1Z3X A;  3MA5 A;  5G55 A;  2B6C A;  4E85 A;  1SZ9 A;  3LY8 A;  2FBN A;  3ZXS A;  3ULE G;  1ZB1 A;  4JA9 A;  3ULQ A;  4HBD A;  2KCV A;  3ZYL A;  2Y4T A;  5FQ8 A;  3FTU A;  5A7D B;  1DNP A;  2MHK A;  3AS8 A;  4EZJ A;  4PUC A;  5CED B;  2PL2 A;  4K5B A;  3B7B A;  4C48 B;  4I2W A;  2DBA A;  1E8X A;  4WND A;  3FUH A;  5HS0 A;  3PNT B;  5EKQ D;  3LJ3 A;  3FTS A;  2J4D A;  2GRL A;  4KMO A;  3CKC A;  2A5U A;  2KCL A;  1EDU A;  2IY0 C;  3TWV A;  2DIW A;  3B13 A;  3LVQ E;  2FUL A;  3SFY A;  3ZHE B;  5JJT A;  2AXU A;  2MOW A;  1K8K G;  1L5J A;  3PUJ A;  3Q7A A;  5T8I A;  4BES A;  2QFC A;  3ENE A;  4HXI A;  3LKU A;  1OWM A;  3CHO A;  2XCB A;  3FH8 A;  4DPR A;  1JUQ A;  2XEE A;  3CVY A;  5HQ8 A;  5ENT D;  1N54 A;  2XEH A;  4IUL A;  2UWJ G;  3N71 A;  4EZK A;  5LX8 A;  2WM9 A;  1TN8 A;  3DSS A;  2WXQ A;  1N52 A;  5EDS A;  2DYR E;  2XQ0 A;  3E37 A;  1ELR A;  1FT1 A;  3LEW A;  4HB5 A;  4G25 A;  3EDT B;  1X81 A;  4FUL A;  3DXM G;  3SGH A;  3MKQ B;  1BD8 A;  4GTT A;  5FIO A;  1KZO A;  2X6K A;  3FWV A;  4I1O B;  4CRW A;  2IO2 C;  1H19 A;  4GPK A;  2XGO A;  2Q7F A;  3Q7F A;  4HLL A;  1JCS A;  1UW4 B;  3ASD A;  4X8Q A;  3SD5 A;  2RFA A;  4GU5 A;  1V55 E;  3TWX A;  3QOU A;  4APF A;  3PE4 A;  5ENO D;  3TWW A;  3MGB A;  2LO6 A;  2R2L A;  4DX6 D;  4K0R A;  3BUA A;  4AEZ C;  3EHN A;  1TR4 A;  3MKR A;  3ZNG A;  5KBA A;  2FEZ A;  3DST A;  4J6I A;  3UIN C;  3UM3 A;  5AQB A;  3SI5 A;  4KZC A;  4JEU A;  2WPV A;  3UM0 A;  2L6B A;  2V4H C;  3NBN B;  4HVB A;  4J7W A;  3QNK A;  4CYM D;  4XX5 A;  1UG3 A;  2GRM A;  1D8D A;  4JA7 A;  2LNI A;  1V54 E;  4RQI A;  3CHP A;  3UT7 A;  4HLE A;  4GAA A;  2QC9 A;  4DK5 A;  4XIF A;  1TNO A;  1SA5 A;  3KD7 A;  4OAV B;  1OCO E;  4JD2 G;  2KM4 A;  2B0O E;  3SFX A;  3CST A;  3OTN A;  5ENS D;  3EHR A;  3E33 A;  4J8D A;  1VDY A;  4A3V A;  4EPZ A;  4UQX A;  3L17 A;  2BKK B;  2DVW A;  2CFU A;  1SVX A;  4AP2 A;  2WXM A;  2OVB A;  2C0L A;  3ASN E;  2VTB A;  2P9U G;  4O1O A;  3EIQ C;  1EYH A;  3FUN A;  2OOE A;  3HXB A;  1X5B A;  2X6F A;  4PDX A;  3FTW A;  2P9P G;  2HO1 A;  5EYP F;  2XZD G;  3VLE A;  4R7L A;  2QZA A;  1YMP A;  5D0Q D;  1HG5 A;  5FQ6 A;  3B7R L;  2VSY A;  4RSY A;  4V3I A;  3UMV A;  2Y4U A;  3Q47 B;  2J4B A;  5T4Y A;  1TNB A;  1LF8 A;  3ZXP A;  2NSZ A;  4YDO A;  3D3M A;  4I6E A;  1DVP A;  5AQA A;  2XRY A;  2OND A;  4G11 A;  4CDN A;  4F7A A;  2I9C A;  3PZD A;  4KZ0 A;  2UY1 B;  4AOF A;  4UWH A;  4GCN A;  4U63 A;  2V5Q C;  4P29 A;  3RRN B;  4D10 C;  3FU5 A;  3JYS A;  4UUC A;  3CK7 A;  1WY6 A;  2WXP A;  3CGH A;  1ZU2 A;  4GTO A;  4BER A;  2FO7 A;  4DRX E;  1BPO A;  4TUU A;  1BU9 A;  5ARF A;  3RSE G;  5DIZ A;  2ZGD A;  1O1T A;  2WXF A;  4RLY A;  3HYM B;  1O5M A;  3ABK E;  1NL4 A;  4OVV A;  4WWO A;  4B8A A;  3PH0 C;  2A5E A;  2LXM A;  5EX3 A;  4UI9 C;  1KZP A;  4TUM A;  3D9H A;  1FT2 A;  1QZ2 A;  1E8Z A;  3KEA A;  3UM1 A;  4A1S A;  5DBK A;  5KJN A;  1IQU A;  5KNH D;  2R02 A;  3FUF A;  1K1A A;  1MX6 A;  5HI7 A;  3T8M A;  4ILI A;  3MEK A;  4UWL A;  2VGE A;  3Q75 A;  4A55 A;  4XI9 A;  4BT8 A;  3FTZ A;  5JHA A;  3CHR A;  4K03 A;  4Q69 A;  3U64 A;  3LDZ A;  4YVQ C;  4DI4 A;  2J49 A;  3TXN A;  3E34 A;  4E6H A;  4UWG A;  2E0I A;  3QAR A;  3Q15 A;  1UJJ A;  4JB8 P;  3RKV A;  3EJN A;  3P2B A;  5EX0 A;  1OUV A;  3R7Q A;  1DCE A;  4ANV A;  4WWP A;  4UWF A;  1H2T C;  3EUV A;  3LPZ A;  1NI1 A;  3C3R A;  2QYU A;  2DZN A;  4HOQ A;  3ESL A;  1HE8 A;  2IU1 A;  2Y1L E;  4DJA A;  3QK0 A;  4UQZ A;  2GRN B;  2XGM A;  3V2O A;  4GYY A;  4I6G A;  3ZKJ A;  2FI7 A;  2AJA A;  4GTV A;  2RFM A;  4FP7 A;  5FQ7 A;  4MKT A;  3EU9 A;  5CER B;  5KJM A;  3NZS A;  1DCQ A;  1N0R A;  3QC1 A;  4AVX A;  3U3W A;  2PQR A;  2VSX E;  3UPV A;  3IHY A;  1Q2Z A;  1OY3 D;  4BX8 A;  4NRH B;  4NIK A;  4A3T A;  2J07 A;  3HXC A;  4NUR A;  3UQ3 A;  3RO3 A;  4BTB A;  4JC8 A;  4BT9 A;  1E8W A;  3UM2 A;  2OCC E;  4I17 A;  4EEC A;  1INZ A;  4FJZ A;  2CHX A;  4DX7 D;  2CHW A;  3SBS A;  5AN8 A;  4GZC A;  2EIK E;  5FZS A;  2V4L A;  5BPP A;  2WXL A;  3V31 A;  3DRA A; 
#chains in the Genus database with same CATH homology
 1N4R A;  3HXE A;  3E34 A;  1N4Q A;  1TNO A;  1FPP A;  1N95 A;  1SA5 A;  1TN8 A;  3DSS A;  1S64 A;  3HXD A;  3PZ4 A;  3E37 A;  1FT1 A;  3SFX A;  4GTO A;  3E33 A;  3Q73 A;  3DSU A;  1X81 A;  4YDE A;  4LNB A;  2F0Y A;  2H6I A;  1DCE A;  3PZ3 A;  2H6H A;  4GTT A;  1KZO A;  3EUV A;  2IEJ A;  1O1T A;  1TNY A;  1NI1 A;  3E30 A;  1TNZ A;  1D8E A;  3Q7F A;  1JCS A;  2ZIR A;  1O5M A;  3DSX A;  1LD7 A;  1LD8 A;  3HXB A;  3Q79 A;  1NL4 A;  1JCR A;  4GTS A;  3EU5 A;  4GTP A;  1MZC A;  3DPY A;  4GTV A;  2H6F A;  2R2L A;  1JCQ A;  1SA4 A;  3C72 A;  1N4P A;  3SFY A;  1TN6 A;  1O1R A;  3KSQ A;  3DSW A;  4GTM A;  4MBG A;  1KZP A;  3DST A;  4L9P A;  1N94 A;  1FT2 A;  3PZ2 A;  1TN7 A;  3HXC A;  1TNU A;  3HXF A;  3E32 A;  3Q7A A;  1S63 A;  2ZIS A;  1TNB A;  2H6G A;  3PZ1 A;  2BED A;  3Q78 A;  3DSV A;  4YDO A;  4EHM A;  1D8D A;  1LTX A;  4LNG A;  1N4S A;  4GTR A;  1N9A A;  1QBQ A;  3Q75 A;  3KSL A;  4GTQ A;  1O1S A;  3DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...