1SA4A

Human protein farnesyltransferase complexed with fpp and r115777
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Crystal Structures of the Anticancer Clinical Candidates R115777 (Tipifarnib) and BMS-214662 Complexed with Protein Farnesyltransferase Suggest a Mechanism of FTI Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 129
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1sa4A00
3PZ1A 4GTRA 4MBGA 3Q78A 1TNUA 3HXFA 1JCRA 3E30A 1O1TA 1TNOA 1D8DA 1LTXA 1DCEA 1TNYA 3PZ4A 3DSSA 1S63A 1JCQA 2H6IA 3Q7FA 1QBQA 1NL4A 1TN7A 3DPYA 4LNBA 2IEJA 2H6HA 2BEDA 1O1RA 3HXDA 1NI1A 1FT1A 3DSVA 3DSXA 3PZ3A 3SFXA 4GTTA 3C72A 2ZIRA 3E32A 3HXEA 1N4RA 3KSLA 3E33A 3Q7AA 4EHMA 3DSTA 4L9PA 1JCSA 1SA5A 1MZCA 3KSQA 1SA4A 2F0YA 1N95A 1N4PA 3DRAA 4GTOA 4LNGA 3HXCA 1N4QA 1FT2A 3Q79A 1S64A 4YDEA 3HXBA 1N94A 1KZPA 3SFYA 4GTQA 3Q73A 2H6GA 4GTMA 3DSUA 1O5MA 3E34A 1TNBA 3EU5A 2ZISA 3PZ2A 1N9AA 1N4SA 1X81A 2H6FA 4GTSA 3DSWA 1FPPA 1LD8A 3EUVA 1TNZA 1D8EA 2R2LA 1TN8A 3E37A 1O1SA 1LD7A 1KZOA 3Q75A 4GTPA 4YDOA 4GTVA 1TN6A
chains in the Genus database with same CATH superfamily
2WM9A 2ETBA 3HYMB 4U8YD 4N39A 3Q78A 3AG2E 1TJCA 4Y6WA 3S2AA 4I6JA 2CFUA 5J90A 4DJAA 1D8DA 3CHRA 1BPOA 4CZ2D 4L23A 4WUYA 3ZVVA 3DEPA 3FUJA 5CEAA 3NOCD 2H6HA 3MA5A 2Y4TA 3FHEA 1MYOA 3IEGA 3QNKA 4RG6A 3ASNE 3ZXSA 2C2LA 3S7FA 3APFA 4JB8P 2ZIRA 4KMOA 3TWTA 3DSTA 2WB2A 4CDMA 4DX7D 4GPKA 3JCKC 3CVPA 2XPIA 1S64A 2WMOA 5AQAA 1OCRE 4CGVA 1Y8MA 3FEYA 4GTQA 1A5EA 3T9KA 2H6GA 4TXRA 2GW1A 5CBNA 2WXMA 4RVBA 3SGHA 2ZISA 4DLQA 3PREA 2H6FA 3B7BA 4HOSA 3X2QE 4HOTA 3QWPA 3GW4A 1OWOA 4LSZE 4DI3A 4LEUA 3V2XA 3D9JA 4JHRA 3Q5MA 4ATZD 4PS8A 5CRUA 3K9IA 1O1TA 3B95A 3EHRA 1JCQA 2YHEA 3FULA 3BU8A 4AY5A 2EIJE 3C3QA 3S7DA 2IJGX 5EYPF 4G24A 4HFGA 1V54E 3QKYA 4F1SA 4I2ZA 4HS2A 4B94A 2QZAA 2BEDA 5KJMA 3ISMC 3L22A 3MV2B 2F8XK 2WMNA 3GYZA 3UMVA 3PZ3A 5BV0A 2VGEA 3BEEA 1SZ9A 4IYPA 3KSQA 4DX2A 2X6KA 2CHWA 3CGHA 3C5RA 3HXBA 2R5SA 4BT8A 2VSNA 4F3VA 4Z68A 2Y0BG 1QQEA 3L13A 3TG5A 5CECB 2NSZA 2VGXA 5BV1A 5AIJA 4HRNA 3SI5A 1UW4B 1WG0A 4WNEA 1ELKA 3V31A 3MZLB 4AM9A 2IF4A 4M3OA 4FJYA 2MYOA 3FU3A 4YDOA 4I43A 3FUFA 1OCZE 4MBGA 2Y4UA 3FEXA 2XRYA 4V3IA 1HS6A 2XQ0A 5EN5D 2XGMA 2H6IA 3RJVA 2UWJG 2YINA 3MKRA 3QAQA 4G23A 3BG0B 2DYRE 3OXGA 1ELRA 3QB2A 4UQYA 5KWDA 1RZ4A 3MJWA 4B89A 2KATA 1S70B 3PEUB 2P9NG 2LXMA 4ANUA 3OXFA 1N4RA 3FUNA 2P58C 1K1AA 2VGYA 1JCSA 1MZCA 1AWCB 4NIKA 3GZSA 4BT9A 2P9IG 1UOHA 3J5PA 3HXCA 4UQXA 4U04A 3RAUA 3MEKA 3SFYA 1LF8A 4AV7A 1WAO1 3RRMB 2XPYA 3EU5A 4BERA 2WXLA 1NP7A 4PS3A 3UKRG 2ZU6B 3UXGA 5AJLA 2J49A 3RSEG 2L0TB 2ETCA 3CEQA 3UI2A 4I6GA 4OVUA 1H0AA 3PVLA 3WXXA 4H7XA 4GTPA 4TXPA 2WXFA 5H7PA 4U63A 4A63B 2KC7A 3EDTB 4MKTA 3NB2A 4JXTA 3B7RL 4BY6A 3SY2A 4J8DA 2R59A 4XIFA 3IXEA 5G2NA 1E96B 1TNYA 3MYVA 2OVFA 4LNUD 5M72A 2WVIA 2EQXA 1MQSA 3FTYA 2J4BA 3B7TA 1O1RA 4AIFA 3FTVA 1HX8A 4HNAD 3ZW3A 3DSXA 3PE3A 3T5VA 4GTTA 3CVYA 3U3WA 4EBAG 3UINC 3ZUVB 4E6HA 5BT1A 1L5JA 3SNXA 5BPPA 3CQCB 3FY4A 4I1OB 4BSXA 2ZGDA 5CHEE 5ENTD 5AARA 3LCAA 4B8CB 4RSYA 3EIJA 3ZHEB 3ABLE 3SF4A 1N4SA 4URKA 3ML8A 3OAWA 2DCPA 1H2VC 3LDZA 3NAWA 4TXQA 2MHKA 2PM7A 1KZOA 5AYWD 5T3RA 1EDUA 3HHMA 4L1BA 4XI0A 2FO7A 4RLYA 5HS0A 4U07A 4J6IA 1NA3A 4ILGA 5CEDB 3KAEA 4U0UA 4YNDA 5D0OD 3UM3A 2LO6A 4J8EA 3E4BA 3FTWA 3SO8A 1SVXA 1OUVA 2MOWA 2NXPA 2LNIA 2LSUA 5ANLA 2XZTG 2WQHA 2QC9A 3LS8A 1DCQA 5BXUA 4HLEA 1U3DA 2WXHA 3HVEB 3F6QA 3O4ZA 2A4ZA 3APDA 4I6EA 5C2YA 1SA5A 4LG6A 3RK6A 1SA4A 4GPMA 2P9UG 2AJAA 4U95D 4LNGA 3DEOA 4K5CA 4U8VD 4OYSA 1KZPA 2EIME 2R17C 2XPZA 2WPVA 4K5AB 3IHVA 3CKCA 1NZNA 5AQ7A 3E34A 1TNBA 5BNWA 3PNLB 5G05C 2QY7A 1HZ4A 3CHSA 4NACA 2WXOA 2JEKA 4HOUA 4OAUC 3ZXPA 3O48A 1TNZA 5KJLA 4GYOA 1IHGA 4A1SA 2I1KA 3AS4A 4W9RA 5G05J 1PC2A 1TNUA 4GCNA 2BF0X 2ONDA 4XZ4A 3VLFA 4G1TA 1D9SA 5LX8A 5C1DA 3AJIA 3QARA 2XEEA 4B8AA 2B6CA 1PAQA 4BETA 2LSVA 2DVWA 4O1PA 3SBSA 3Q9UC 4WWPA 4JL0A 2FBNA 3ZGQA 1RW2A 3AG1E 4XEIG 2PQNA 3HRAA 2RG8A 4CGWA 1FT1A 2WXGA 4ILHB 4A3TA 2EIKE 3L16A 2VSOE 1Q2ZA 3E32A 4TUMA 1DVPA 4B93B 4JD2G 3AG4E 3JQ1A 2ZXWE 1Z3YA 3D9HA 4O1OA 1N95A 1N4PA 3VLEA 4CDNA 2MRIA 3UTMA 4N2SA 1EYHA 3RKVA 1FT2A 4APFA 3DXKG 3D9IA 3LYAA 1H19A 4HLLA 4BX8A 4HVBA 3QWVA 4M7CA 4U0SA 4C48B 4K0RA 3DSUA 4C0EA 3ABME 4UWHA 2NC9A 3T8MA 1N9AA 2WQ7A 4K5BA 3HVEA 4KT6B 4G8LA 4J7WA 4DLOA 4AVXA 1LD8A 3RU0A 4LUNU 2JLBA 4WWOA 3QWWA 1HE8A 4EQFA 3PDNA 5CCLA 1A17A 1INZA 3LXUX 2XRZA 1E8YA 2XCCA 4KZ0A 4UI9K 1JWFA 4YDWA 4WAFA 2YNQA 3C3RA 1TNOA 5EYLA 4L7TA 1QBQA 3MV3B 4LERA 1TN7A 3Q15A 2VJ8A 2WQ6A 3DPYA 3G2SA 4HOQA 4DX6D 3ULEG 3I4GA 1H2UA 2HM8A 3NOGD 5JMND 2X6FA 3DSVA 4J0UA 4XX5A 2Y1LE 2DZOA 3D9LA 5G55A 3EHMA 3I3NA 5LP0A 3FTZA 2JABA 3TL5A 4J8YA 3DRAA 5HQ8A 1ELWA 2EINE 3D3MA 3MCXA 4ANWA 4GZ6A 2WXNA 3EU9A 1NA0A 3Q73A 5ENQD 4N2QA 3GZ2A 1O5MA 4I9EA 3QC1A 3CK9A 3D9NA 1U2VG 3ZRHA 4EZLA 2YQ8A 4TV3A 1YA0A 4GTSA 5JHAA 3FDHA 2J4DA 2GGFA 3AU5A 2AWIA 3ASOE 2GRPB 2DIWA 1O1SA 4PDXA 2PL2A 3IHYA 5ENPD 3ZYLA 3UQ3A 1YYHA 1JCRA 3URZA 1WY6A 5FWQA 2J8SD 4UWGA 4CEMA 4F53A 1ZB1A 3ASHA 1H6PA 1W3BA 1NL4A 3TGOA 1XGWA 3CHQA 4AEZC 3NBNB 2CG3A 3TXNA 3APCA 3QDNA 5BW8C 2ZGGA 1YCSB 4JHKA 3FUDA 2IU1A 1Z6TA 1EPUA 3KSLA 3E33A 3TWUA 3TWVA 3ZYMA 4A1GA 4A3VA 2X6IA 1OWPA 4GZDA 1FCHA 3EHQA 2WXPA 3RRNB 3ASDA 1B89A 1N54A 4MS6A 3TWWA 2VSYA 1K8KG 2P9LG 5ARGA 4ANXA 1OY3D 4N3BA 1OCCE 4IULA 5FINA 3TXMA 2PQRA 3P2BA 3BUAA 4ZFHA 2P9PG 3BQOA 3NZSA 4N3AA 1ZU2A 5FZQA 4G11A 2LXLA 2KBXA 3UT8A 3RIBA 1DC2A 3T8KA 3UIOC 4HBDA 3PZ1A 4JVSA 3V30A 4BFRA 4YDYA 3VTYA 4MLPA 2EILE 2J07A 3UKUG 3AS8A 4ATGA 3NZUA 4GZ3A 2WXJA 4I9CA 3ESLA 4G25A 4IN3B 1BI8B 2HE0A 4LNBA 1MX4A 1TR4A 3CSFA 3W9FA 1OWLA 2IO3C 3LKUA 1SQMA 1UJJA 4DI4A 3MX3A 5ITZF 2I2OA 1IHBA 3CHOA 4FADA 4UWFA 4YVQC 3EIQC 3ML9A 1IQUA 3UM1A 2FO1E 4GYWA 5EX3A 4L2LA 3V79K 5ENOD 2KXPC 4G8KA 3SD5A 3FH8A 3CQGB 4G26A 1Y6IA 4UUCA 4WNDA 2KCLA 4ABNA 5FZRA 5FIOA 2IONA 3PNTB 3I5PA 3PZ2A 4GYYA 1JWGA 1QZ2A 2A5EA 3DSWA 3FTXA 3EHNA 4Q94A 3WG7E 3U4TA 2I9CA 4EPZA 2V0PA 5FT9A 1XNFA 4FA6A 2HO1A 1E7VA 3SBTB 1LD7A 2X3MA 3MKQB 1VDYA 3CHMA 3Q49B 3L9TA 1HFAA 3PZDA 2RD0A 3SFZA 3LY8A 5AJDA 5JHBA 4JW1A 5EILA 3JUEA 1V55E 5A6CA 1UG3A 2IQCA 3FTSA 2BKGA 4JEHA 3FP3A 4FP7A 2VQ2A 4FLHA 2RFAA 4Q69A 3CVVA 2OVBA 4AOFA 4CT4A 4OVVA 5KCMA 3R9MA 2OOEA 2I6HA 3G2VA 3W9GA 3D9OA 4EHMA 3SQVA 3KS2A 2F37A 4N5QA 2E2EA 3LVQE 5FQ6A 3UM0A 1KLXA 2XGOA 3CLJA 1MX2A 3LPZA 3PS6A 5CERB 3NF1A 5ARFA 4GMLA 1Z3XA 3FUIA 4BSZB 5KBAA 3AS5A 2AXZA 5ENSD 1MJ0A 1HU3A 4XKCA 3ASGA 4FJZA 2RKKA 4R7LA 2F8YA 3CVNA 4CCAA 4Y6CA 3UIPC 5DIZA 3L82A 3NQPA 4ME2A 2I1JA 3V2OA 2QYJA 3AG3E 1UJKA 5A23A 2IY0C 4O6FA 3DSSA 1IQRA 1HH8A 4HQDA 4APOA 4GCOA 4ACKA 5CBOA 3CIAA 2KCVA 2GROB 2X38A 3PH0C 3ENEA 4I1MA 5EX0A 4OAVB 2L0IA 5E75A 3MKQA 2KCKA 1MHQA 2PZIA 4QQIA 3ZHEA 5JJTA 1PY1A 2X6HA 1OT8A 5G04C 3Q4AB 3U66A 3ABKE 3R7RA 2ILRA 3Q7AA 4EECA 3UX4A 3ZNGA 4CYMD 4FU3A 4JPSA 1G3NB 1OCOE 2VSXE 4GTOA 3PEVB 4FHKA 4UWKA 3Q79A 3PRZA 3TJPA 3ULQA 3R9AB 5FJYA 1E90A 4ANVA 1AP7A 2J9QA 5G04J 3FUKA 5KJNA 2UY1B 3KEZA 2XS8A 4B0ZA 2KZTB 1BLXB 5JJ7A 2PNNA 4N5CA 2LUHA 3AU4A 1X81A 2Y69E 1ZBPA 3G2UA 1TJFA 5T4YA 4XE0A 3UT7A 4Q96A 2IOLA 5D2MC 2OCCE 1TN8A 5LCWC 5JA4D 3KD7A 3PE4A 2IOSA 4GTVA 3PUJA 1E8XA 4J8FA 3FUHA 4WNFA 5B1BE 2VGXB 3HIZA 5ANRA 2Y3AA 1SZAA 2XEVA 2M63A 2IFUA 3D9PA 4BEPA 5LCWJ 4AY6A 4NQ0A 2HR2A 3FTUA 3IKOB 3IBEA 2LAIA 4JC8A 2GRRB 4BTAA 1JPLA 1NI1A 3AAAC 2DBAA 4UI9C 2P9SG 3Q47B 3B13A 4RG9A 3SFXA 5HI7A 3LJNA 4DK5A 1KT1A 3CVXA 3OXLA 4ACLA 1BI7B 3JXIA 3B7SA 5IY5E 2GRLA 2PM6A 1KT0A 1P5QA 4UI9J 5CMWA 3CVUA 2BUGA 3FU6A 5AQ9A 4DUIA 3CVQA 4U0ZA 2Q7FA 3B7UX 1E8WA 5CRVA 3J5QB 3FU5A 2V4HC 4ZHBA 1BU9A 3CHPA 2FULA 1X5BA 5CCMA 1D8EA 2ETAA 4HXIA 1EF1C 2V4LA 3CSTA 3EJNA 4E85A 2A5UA 4JA7A 4AP2A 1N52A 2IO2C 4U96D 3I4RB 2UY1A 1U3CA 4BTBA 3HXFA 2DWZA 4TUUA 2FF4A 3TWXA 3QK0A 2KZTA 5BUZA 4BESA 5FQ7A 4HI9A 4CDRA 2XEHA 1DCEA 3PZ4A 4YVOA 4HORA 2VTBB 1H6KA 5HKPA 1TYQG 3UUXA 1OXJA 2WXRA 2R03A 2RFMA 3U9WA 2AXVA 4XKBA 4I17A 4GA0A 3HXDA 4MRUA 5B3SE 3FWVA 3QOUA 3C72A 4LCTA 4ILIA 4EZKA 3ZYKA 4KZCA 3LJ3A 2F0YA 4C9BB 1HG5A 5ENRD 4F6RD 4JEUA 3CV0A 1FVFA 1TEZA 4JHJA 3TAXA 4DX1A 3LY7A 4PH4B 3UPVA 3D9KA 4KXKB 4GB9A 3TWRA 3LVRE 5AAOA 2WXKA 1SW6A 3RO2A 3HG0D 4KBQA 1FPPA 4EZJA 4GA2A 4GMJA 4KYOB 4HB5A 3ZIMA 2WXQA 3UT4A 3S7BA 1TN6A 5FQ4A 4GTRA 5LFAA 1HF8A 4X8QA 5HRYA 3U64A 3VLDA 4LRZA 5KNHD 3DXMG 2L6BA 3FH5A 3S7JA 1LTXA 2XGSA 3SHFA 1HG2A 1H2TC 2AW6A 4F1PA 2J08A 2DYSE 2WXIA 1IXVA 4L2YA 2C0LA 3KEAA 2AVPA 4FHJA 5EKQD 2V8SE 4CT0A 4JA9A 1E7UA 5E76A 5LOZA 1IYGA 3PUKA 2L6JA 1MX6A 2NYJA 3CR3A 2CG2A 4I1AA 4JZYA 2VTBA 3FUMA 4N3CA 4GZCA 4YDEA 3ZFWA 1K1BA 5B1AE 2FI7A 1FVHA 3FUEA 4PUCA 4GTMA 1N11A 4NRHB 1KPSB 3ONKA 2L9BA 3L54A 2XS1A 2R05A 1UN9A 5AENA 2QFCA 3JQ0A 5EDSA 4BX9A 4TRQA 3RRUA 1WDYA 2B0OE 5FZSA 1WM5A 3CVWA 3ULYA 3EUVA 2CHXA 3JUIA 3SZ7A 4CRWA 5J08A 2FEZA 3OTNA 4GA1A 3E37A 2BKKB 3T5XA 4A55A 2X6JA 2C0MA 5EIDA 2LAHA 2GRMA 2OV8A 3E30A 5A7DB 4GMRA 4PS7A 4G2VA 3Q7FA 2XENA 4NURA 4UQZA 2GRQB 2R02A 4AJWA 3D9MA 5CMYA 2IEJA 4FC8A 1BD8A 3DWLG 4U8HA 3RO3A 4DX5D 1HO8A 3TG4A 2E0IA 3G2WA 2BTDA 4HRMB 5FTPA 3TWSA 4L9PA 4K03A 4DPRA 5BXOA 3CKBA 4KVOA 1Z5SC 1N4QA 5ENNA 3FFLA 3ONLA 1N94A 3ASFA 2OEVA 2CHZA 4WNGA 5AN8A 3VTXA 3ZN3A 1UN8A 2QYUA 2KM4A 1QYMA 3LY9A 4O60A 3HDXA 3MGBA 3QJZA 5D0QD 3C98A 2VYIA 3LEWA 1N0RA 2AXUA 3UM2A 1NFIE 1OWNA 4QFVA 1N0QA 2R2LA 3ZEFA 3CK8A 2P9KG 4J8SA 4XI9A 2CFZA 3FH7A 2DZNA 4D10C 4UWLA 4FULA 1H6OA 1YMPA 2V5FA 3P1UA 4GU5A 1S63A 4WWNA 4FLBA 2XHEA 4HI8A 4DRXE 1HXIA 1E8ZA 3ZYQA 3IV0A 3G2TA 2XCBA 1JUQA 3L08A 3CK7A 1K3ZD 3CVLA 1GW6A 3JYSA 4EBAA 2V5QC 3JXJA 4U7EB 5T8IA 3FU0A 3HXEA 3BG1B 5FQ8A 2YHCA 4KVMA 4IRUA 5KJKA 1QNFA 3ZPJA 5KNGA 1DNPA 3L6AA 3TWQA 3ZKJA 5DBKA 3DPDA 3N71A 3R7QA 3Q9NC 1S0PA 2XZDG 4H7YA 3GZ1A 1IKND 4P29A 4RQIA 3ESKA 5AQBA 2OEWA 4I2WA 4C0MA 3L17A 4F7AA 1OWMA 4GZ5A 5JJ6A 3DBSA 4GAAA 4BWRA 2P2CP 2HYZA 2J09A 5EIBE 4HRLA 3C3OA 4AXHA 3ZU7B 5D66A 3Q75A 2GRNB
chains in the Genus database with same CATH topology
3PZ1A 4GTRA 4MBGA 3Q78A 1TNUA 3HXFA 1JCRA 3E30A 1O1TA 1TNOA 1D8DA 1LTXA 1DCEA 1TNYA 3PZ4A 3DSSA 1S63A 1JCQA 2H6IA 3Q7FA 1QBQA 1NL4A 1TN7A 3DPYA 4LNBA 2IEJA 2H6HA 2BEDA 1O1RA 3HXDA 1NI1A 1FT1A 3DSVA 3DSXA 3PZ3A 3SFXA 4GTTA 3C72A 2ZIRA 3E32A 3HXEA 1N4RA 3KSLA 3E33A 3Q7AA 4EHMA 3DSTA 4L9PA 1JCSA 1SA5A 1MZCA 3KSQA 1SA4A 2F0YA 1N95A 1N4PA 3DRAA 4GTOA 4LNGA 3HXCA 1N4QA 1FT2A 3Q79A 1S64A 4YDEA 3HXBA 1N94A 1KZPA 3SFYA 4GTQA 3Q73A 2H6GA 4GTMA 3DSUA 1O5MA 3E34A 1TNBA 3EU5A 2ZISA 3PZ2A 1N9AA 1N4SA 1X81A 2H6FA 4GTSA 3DSWA 1FPPA 1LD8A 3EUVA 1TNZA 1D8EA 2R2LA 1TN8A 3E37A 1O1SA 1LD7A 1KZOA 3Q75A 4GTPA 4YDOA 4GTVA 1TN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ1 A;  4GTR A;  4MBG A;  3Q78 A;  1TNU A;  3HXF A;  1JCR A;  3E30 A;  1O1T A;  1TNO A;  1D8D A;  1LTX A;  1DCE A;  1TNY A;  3PZ4 A;  3DSS A;  1S63 A;  1JCQ A;  2H6I A;  3Q7F A;  1QBQ A;  1NL4 A;  1TN7 A;  3DPY A;  4LNB A;  2IEJ A;  2H6H A;  2BED A;  1O1R A;  3HXD A;  1NI1 A;  1FT1 A;  3DSV A;  3DSX A;  3PZ3 A;  3SFX A;  4GTT A;  3C72 A;  2ZIR A;  3E32 A;  3HXE A;  1N4R A;  3KSL A;  3E33 A;  3Q7A A;  4EHM A;  3DST A;  4L9P A;  1JCS A;  1SA5 A;  1MZC A;  3KSQ A;  1SA4 A;  2F0Y A;  1N95 A;  1N4P A;  3DRA A;  4GTO A;  4LNG A;  3HXC A;  1N4Q A;  1FT2 A;  3Q79 A;  1S64 A;  4YDE A;  3HXB A;  1N94 A;  1KZP A;  3SFY A;  4GTQ A;  3Q73 A;  2H6G A;  4GTM A;  3DSU A;  1O5M A;  3E34 A;  1TNB A;  3EU5 A;  2ZIS A;  3PZ2 A;  1N9A A;  1N4S A;  1X81 A;  2H6F A;  4GTS A;  3DSW A;  1FPP A;  1LD8 A;  3EUV A;  1TNZ A;  1D8E A;  2R2L A;  1TN8 A;  3E37 A;  1O1S A;  1LD7 A;  1KZO A;  3Q75 A;  4GTP A;  4YDO A;  4GTV A;  1TN6 A; 
#chains in the Genus database with same CATH topology
 2WM9 A;  2ETB A;  3HYM B;  4U8Y D;  4N39 A;  3Q78 A;  3AG2 E;  1TJC A;  4Y6W A;  3S2A A;  4I6J A;  2CFU A;  5J90 A;  4DJA A;  1D8D A;  3CHR A;  1BPO A;  4CZ2 D;  4L23 A;  4WUY A;  3ZVV A;  3DEP A;  3FUJ A;  5CEA A;  3NOC D;  2H6H A;  3MA5 A;  2Y4T A;  3FHE A;  1MYO A;  3IEG A;  3QNK A;  4RG6 A;  3ASN E;  3ZXS A;  2C2L A;  3S7F A;  3APF A;  4JB8 P;  2ZIR A;  4KMO A;  3TWT A;  3DST A;  2WB2 A;  4CDM A;  4DX7 D;  4GPK A;  3JCK C;  3CVP A;  2XPI A;  1S64 A;  2WMO A;  5AQA A;  1OCR E;  4CGV A;  1Y8M A;  3FEY A;  4GTQ A;  1A5E A;  3T9K A;  2H6G A;  4TXR A;  2GW1 A;  5CBN A;  2WXM A;  4RVB A;  3SGH A;  2ZIS A;  4DLQ A;  3PRE A;  2H6F A;  3B7B A;  4HOS A;  3X2Q E;  4HOT A;  3QWP A;  3GW4 A;  1OWO A;  4LSZ E;  4DI3 A;  4LEU A;  3V2X A;  3D9J A;  4JHR A;  3Q5M A;  4ATZ D;  4PS8 A;  5CRU A;  3K9I A;  1O1T A;  3B95 A;  3EHR A;  1JCQ A;  2YHE A;  3FUL A;  3BU8 A;  4AY5 A;  2EIJ E;  3C3Q A;  3S7D A;  2IJG X;  5EYP F;  4G24 A;  4HFG A;  1V54 E;  3QKY A;  4F1S A;  4I2Z A;  4HS2 A;  4B94 A;  2QZA A;  2BED A;  5KJM A;  3ISM C;  3L22 A;  3MV2 B;  2F8X K;  2WMN A;  3GYZ A;  3UMV A;  3PZ3 A;  5BV0 A;  2VGE A;  3BEE A;  1SZ9 A;  4IYP A;  3KSQ A;  4DX2 A;  2X6K A;  2CHW A;  3CGH A;  3C5R A;  3HXB A;  2R5S A;  4BT8 A;  2VSN A;  4F3V A;  4Z68 A;  2Y0B G;  1QQE A;  3L13 A;  3TG5 A;  5CEC B;  2NSZ A;  2VGX A;  5BV1 A;  5AIJ A;  4HRN A;  3SI5 A;  1UW4 B;  1WG0 A;  4WNE A;  1ELK A;  3V31 A;  3MZL B;  4AM9 A;  2IF4 A;  4M3O A;  4FJY A;  2MYO A;  3FU3 A;  4YDO A;  4I43 A;  3FUF A;  1OCZ E;  4MBG A;  2Y4U A;  3FEX A;  2XRY A;  4V3I A;  1HS6 A;  2XQ0 A;  5EN5 D;  2XGM A;  2H6I A;  3RJV A;  2UWJ G;  2YIN A;  3MKR A;  3QAQ A;  4G23 A;  3BG0 B;  2DYR E;  3OXG A;  1ELR A;  3QB2 A;  4UQY A;  5KWD A;  1RZ4 A;  3MJW A;  4B89 A;  2KAT A;  1S70 B;  3PEU B;  2P9N G;  2LXM A;  4ANU A;  3OXF A;  1N4R A;  3FUN A;  2P58 C;  1K1A A;  2VGY A;  1JCS A;  1MZC A;  1AWC B;  4NIK A;  3GZS A;  4BT9 A;  2P9I G;  1UOH A;  3J5P A;  3HXC A;  4UQX A;  4U04 A;  3RAU A;  3MEK A;  3SFY A;  1LF8 A;  4AV7 A;  1WAO 1;  3RRM B;  2XPY A;  3EU5 A;  4BER A;  2WXL A;  1NP7 A;  4PS3 A;  3UKR G;  2ZU6 B;  3UXG A;  5AJL A;  2J49 A;  3RSE G;  2L0T B;  2ETC A;  3CEQ A;  3UI2 A;  4I6G A;  4OVU A;  1H0A A;  3PVL A;  3WXX A;  4H7X A;  4GTP A;  4TXP A;  2WXF A;  5H7P A;  4U63 A;  4A63 B;  2KC7 A;  3EDT B;  4MKT A;  3NB2 A;  4JXT A;  3B7R L;  4BY6 A;  3SY2 A;  4J8D A;  2R59 A;  4XIF A;  3IXE A;  5G2N A;  1E96 B;  1TNY A;  3MYV A;  2OVF A;  4LNU D;  5M72 A;  2WVI A;  2EQX A;  1MQS A;  3FTY A;  2J4B A;  3B7T A;  1O1R A;  4AIF A;  3FTV A;  1HX8 A;  4HNA D;  3ZW3 A;  3DSX A;  3PE3 A;  3T5V A;  4GTT A;  3CVY A;  3U3W A;  4EBA G;  3UIN C;  3ZUV B;  4E6H A;  5BT1 A;  1L5J A;  3SNX A;  5BPP A;  3CQC B;  3FY4 A;  4I1O B;  4BSX A;  2ZGD A;  5CHE E;  5ENT D;  5AAR A;  3LCA A;  4B8C B;  4RSY A;  3EIJ A;  3ZHE B;  3ABL E;  3SF4 A;  1N4S A;  4URK A;  3ML8 A;  3OAW A;  2DCP A;  1H2V C;  3LDZ A;  3NAW A;  4TXQ A;  2MHK A;  2PM7 A;  1KZO A;  5AYW D;  5T3R A;  1EDU A;  3HHM A;  4L1B A;  4XI0 A;  2FO7 A;  4RLY A;  5HS0 A;  4U07 A;  4J6I A;  1NA3 A;  4ILG A;  5CED B;  3KAE A;  4U0U A;  4YND A;  5D0O D;  3UM3 A;  2LO6 A;  4J8E A;  3E4B A;  3FTW A;  3SO8 A;  1SVX A;  1OUV A;  2MOW A;  2NXP A;  2LNI A;  2LSU A;  5ANL A;  2XZT G;  2WQH A;  2QC9 A;  3LS8 A;  1DCQ A;  5BXU A;  4HLE A;  1U3D A;  2WXH A;  3HVE B;  3F6Q A;  3O4Z A;  2A4Z A;  3APD A;  4I6E A;  5C2Y A;  1SA5 A;  4LG6 A;  3RK6 A;  1SA4 A;  4GPM A;  2P9U G;  2AJA A;  4U95 D;  4LNG A;  3DEO A;  4K5C A;  4U8V D;  4OYS A;  1KZP A;  2EIM E;  2R17 C;  2XPZ A;  2WPV A;  4K5A B;  3IHV A;  3CKC A;  1NZN A;  5AQ7 A;  3E34 A;  1TNB A;  5BNW A;  3PNL B;  5G05 C;  2QY7 A;  1HZ4 A;  3CHS A;  4NAC A;  2WXO A;  2JEK A;  4HOU A;  4OAU C;  3ZXP A;  3O48 A;  1TNZ A;  5KJL A;  4GYO A;  1IHG A;  4A1S A;  2I1K A;  3AS4 A;  4W9R A;  5G05 J;  1PC2 A;  1TNU A;  4GCN A;  2BF0 X;  2OND A;  4XZ4 A;  3VLF A;  4G1T A;  1D9S A;  5LX8 A;  5C1D A;  3AJI A;  3QAR A;  2XEE A;  4B8A A;  2B6C A;  1PAQ A;  4BET A;  2LSV A;  2DVW A;  4O1P A;  3SBS A;  3Q9U C;  4WWP A;  4JL0 A;  2FBN A;  3ZGQ A;  1RW2 A;  3AG1 E;  4XEI G;  2PQN A;  3HRA A;  2RG8 A;  4CGW A;  1FT1 A;  2WXG A;  4ILH B;  4A3T A;  2EIK E;  3L16 A;  2VSO E;  1Q2Z A;  3E32 A;  4TUM A;  1DVP A;  4B93 B;  4JD2 G;  3AG4 E;  3JQ1 A;  2ZXW E;  1Z3Y A;  3D9H A;  4O1O A;  1N95 A;  1N4P A;  3VLE A;  4CDN A;  2MRI A;  3UTM A;  4N2S A;  1EYH A;  3RKV A;  1FT2 A;  4APF A;  3DXK G;  3D9I A;  3LYA A;  1H19 A;  4HLL A;  4BX8 A;  4HVB A;  3QWV A;  4M7C A;  4U0S A;  4C48 B;  4K0R A;  3DSU A;  4C0E A;  3ABM E;  4UWH A;  2NC9 A;  3T8M A;  1N9A A;  2WQ7 A;  4K5B A;  3HVE A;  4KT6 B;  4G8L A;  4J7W A;  4DLO A;  4AVX A;  1LD8 A;  3RU0 A;  4LUN U;  2JLB A;  4WWO A;  3QWW A;  1HE8 A;  4EQF A;  3PDN A;  5CCL A;  1A17 A;  1INZ A;  3LXU X;  2XRZ A;  1E8Y A;  2XCC A;  4KZ0 A;  4UI9 K;  1JWF A;  4YDW A;  4WAF A;  2YNQ A;  3C3R A;  1TNO A;  5EYL A;  4L7T A;  1QBQ A;  3MV3 B;  4LER A;  1TN7 A;  3Q15 A;  2VJ8 A;  2WQ6 A;  3DPY A;  3G2S A;  4HOQ A;  4DX6 D;  3ULE G;  3I4G A;  1H2U A;  2HM8 A;  3NOG D;  5JMN D;  2X6F A;  3DSV A;  4J0U A;  4XX5 A;  2Y1L E;  2DZO A;  3D9L A;  5G55 A;  3EHM A;  3I3N A;  5LP0 A;  3FTZ A;  2JAB A;  3TL5 A;  4J8Y A;  3DRA A;  5HQ8 A;  1ELW A;  2EIN E;  3D3M A;  3MCX A;  4ANW A;  4GZ6 A;  2WXN A;  3EU9 A;  1NA0 A;  3Q73 A;  5ENQ D;  4N2Q A;  3GZ2 A;  1O5M A;  4I9E A;  3QC1 A;  3CK9 A;  3D9N A;  1U2V G;  3ZRH A;  4EZL A;  2YQ8 A;  4TV3 A;  1YA0 A;  4GTS A;  5JHA A;  3FDH A;  2J4D A;  2GGF A;  3AU5 A;  2AWI A;  3ASO E;  2GRP B;  2DIW A;  1O1S A;  4PDX A;  2PL2 A;  3IHY A;  5ENP D;  3ZYL A;  3UQ3 A;  1YYH A;  1JCR A;  3URZ A;  1WY6 A;  5FWQ A;  2J8S D;  4UWG A;  4CEM A;  4F53 A;  1ZB1 A;  3ASH A;  1H6P A;  1W3B A;  1NL4 A;  3TGO A;  1XGW A;  3CHQ A;  4AEZ C;  3NBN B;  2CG3 A;  3TXN A;  3APC A;  3QDN A;  5BW8 C;  2ZGG A;  1YCS B;  4JHK A;  3FUD A;  2IU1 A;  1Z6T A;  1EPU A;  3KSL A;  3E33 A;  3TWU A;  3TWV A;  3ZYM A;  4A1G A;  4A3V A;  2X6I A;  1OWP A;  4GZD A;  1FCH A;  3EHQ A;  2WXP A;  3RRN B;  3ASD A;  1B89 A;  1N54 A;  4MS6 A;  3TWW A;  2VSY A;  1K8K G;  2P9L G;  5ARG A;  4ANX A;  1OY3 D;  4N3B A;  1OCC E;  4IUL A;  5FIN A;  3TXM A;  2PQR A;  3P2B A;  3BUA A;  4ZFH A;  2P9P G;  3BQO A;  3NZS A;  4N3A A;  1ZU2 A;  5FZQ A;  4G11 A;  2LXL A;  2KBX A;  3UT8 A;  3RIB A;  1DC2 A;  3T8K A;  3UIO C;  4HBD A;  3PZ1 A;  4JVS A;  3V30 A;  4BFR A;  4YDY A;  3VTY A;  4MLP A;  2EIL E;  2J07 A;  3UKU G;  3AS8 A;  4ATG A;  3NZU A;  4GZ3 A;  2WXJ A;  4I9C A;  3ESL A;  4G25 A;  4IN3 B;  1BI8 B;  2HE0 A;  4LNB A;  1MX4 A;  1TR4 A;  3CSF A;  3W9F A;  1OWL A;  2IO3 C;  3LKU A;  1SQM A;  1UJJ A;  4DI4 A;  3MX3 A;  5ITZ F;  2I2O A;  1IHB A;  3CHO A;  4FAD A;  4UWF A;  4YVQ C;  3EIQ C;  3ML9 A;  1IQU A;  3UM1 A;  2FO1 E;  4GYW A;  5EX3 A;  4L2L A;  3V79 K;  5ENO D;  2KXP C;  4G8K A;  3SD5 A;  3FH8 A;  3CQG B;  4G26 A;  1Y6I A;  4UUC A;  4WND A;  2KCL A;  4ABN A;  5FZR A;  5FIO A;  2ION A;  3PNT B;  3I5P A;  3PZ2 A;  4GYY A;  1JWG A;  1QZ2 A;  2A5E A;  3DSW A;  3FTX A;  3EHN A;  4Q94 A;  3WG7 E;  3U4T A;  2I9C A;  4EPZ A;  2V0P A;  5FT9 A;  1XNF A;  4FA6 A;  2HO1 A;  1E7V A;  3SBT B;  1LD7 A;  2X3M A;  3MKQ B;  1VDY A;  3CHM A;  3Q49 B;  3L9T A;  1HFA A;  3PZD A;  2RD0 A;  3SFZ A;  3LY8 A;  5AJD A;  5JHB A;  4JW1 A;  5EIL A;  3JUE A;  1V55 E;  5A6C A;  1UG3 A;  2IQC A;  3FTS A;  2BKG A;  4JEH A;  3FP3 A;  4FP7 A;  2VQ2 A;  4FLH A;  2RFA A;  4Q69 A;  3CVV A;  2OVB A;  4AOF A;  4CT4 A;  4OVV A;  5KCM A;  3R9M A;  2OOE A;  2I6H A;  3G2V A;  3W9G A;  3D9O A;  4EHM A;  3SQV A;  3KS2 A;  2F37 A;  4N5Q A;  2E2E A;  3LVQ E;  5FQ6 A;  3UM0 A;  1KLX A;  2XGO A;  3CLJ A;  1MX2 A;  3LPZ A;  3PS6 A;  5CER B;  3NF1 A;  5ARF A;  4GML A;  1Z3X A;  3FUI A;  4BSZ B;  5KBA A;  3AS5 A;  2AXZ A;  5ENS D;  1MJ0 A;  1HU3 A;  4XKC A;  3ASG A;  4FJZ A;  2RKK A;  4R7L A;  2F8Y A;  3CVN A;  4CCA A;  4Y6C A;  3UIP C;  5DIZ A;  3L82 A;  3NQP A;  4ME2 A;  2I1J A;  3V2O A;  2QYJ A;  3AG3 E;  1UJK A;  5A23 A;  2IY0 C;  4O6F A;  3DSS A;  1IQR A;  1HH8 A;  4HQD A;  4APO A;  4GCO A;  4ACK A;  5CBO A;  3CIA A;  2KCV A;  2GRO B;  2X38 A;  3PH0 C;  3ENE A;  4I1M A;  5EX0 A;  4OAV B;  2L0I A;  5E75 A;  3MKQ A;  2KCK A;  1MHQ A;  2PZI A;  4QQI A;  3ZHE A;  5JJT A;  1PY1 A;  2X6H A;  1OT8 A;  5G04 C;  3Q4A B;  3U66 A;  3ABK E;  3R7R A;  2ILR A;  3Q7A A;  4EEC A;  3UX4 A;  3ZNG A;  4CYM D;  4FU3 A;  4JPS A;  1G3N B;  1OCO E;  2VSX E;  4GTO A;  3PEV B;  4FHK A;  4UWK A;  3Q79 A;  3PRZ A;  3TJP A;  3ULQ A;  3R9A B;  5FJY A;  1E90 A;  4ANV A;  1AP7 A;  2J9Q A;  5G04 J;  3FUK A;  5KJN A;  2UY1 B;  3KEZ A;  2XS8 A;  4B0Z A;  2KZT B;  1BLX B;  5JJ7 A;  2PNN A;  4N5C A;  2LUH A;  3AU4 A;  1X81 A;  2Y69 E;  1ZBP A;  3G2U A;  1TJF A;  5T4Y A;  4XE0 A;  3UT7 A;  4Q96 A;  2IOL A;  5D2M C;  2OCC E;  1TN8 A;  5LCW C;  5JA4 D;  3KD7 A;  3PE4 A;  2IOS A;  4GTV A;  3PUJ A;  1E8X A;  4J8F A;  3FUH A;  4WNF A;  5B1B E;  2VGX B;  3HIZ A;  5ANR A;  2Y3A A;  1SZA A;  2XEV A;  2M63 A;  2IFU A;  3D9P A;  4BEP A;  5LCW J;  4AY6 A;  4NQ0 A;  2HR2 A;  3FTU A;  3IKO B;  3IBE A;  2LAI A;  4JC8 A;  2GRR B;  4BTA A;  1JPL A;  1NI1 A;  3AAA C;  2DBA A;  4UI9 C;  2P9S G;  3Q47 B;  3B13 A;  4RG9 A;  3SFX A;  5HI7 A;  3LJN A;  4DK5 A;  1KT1 A;  3CVX A;  3OXL A;  4ACL A;  1BI7 B;  3JXI A;  3B7S A;  5IY5 E;  2GRL A;  2PM6 A;  1KT0 A;  1P5Q A;  4UI9 J;  5CMW A;  3CVU A;  2BUG A;  3FU6 A;  5AQ9 A;  4DUI A;  3CVQ A;  4U0Z A;  2Q7F A;  3B7U X;  1E8W A;  5CRV A;  3J5Q B;  3FU5 A;  2V4H C;  4ZHB A;  1BU9 A;  3CHP A;  2FUL A;  1X5B A;  5CCM A;  1D8E A;  2ETA A;  4HXI A;  1EF1 C;  2V4L A;  3CST A;  3EJN A;  4E85 A;  2A5U A;  4JA7 A;  4AP2 A;  1N52 A;  2IO2 C;  4U96 D;  3I4R B;  2UY1 A;  1U3C A;  4BTB A;  3HXF A;  2DWZ A;  4TUU A;  2FF4 A;  3TWX A;  3QK0 A;  2KZT A;  5BUZ A;  4BES A;  5FQ7 A;  4HI9 A;  4CDR A;  2XEH A;  1DCE A;  3PZ4 A;  4YVO A;  4HOR A;  2VTB B;  1H6K A;  5HKP A;  1TYQ G;  3UUX A;  1OXJ A;  2WXR A;  2R03 A;  2RFM A;  3U9W A;  2AXV A;  4XKB A;  4I17 A;  4GA0 A;  3HXD A;  4MRU A;  5B3S E;  3FWV A;  3QOU A;  3C72 A;  4LCT A;  4ILI A;  4EZK A;  3ZYK A;  4KZC A;  3LJ3 A;  2F0Y A;  4C9B B;  1HG5 A;  5ENR D;  4F6R D;  4JEU A;  3CV0 A;  1FVF A;  1TEZ A;  4JHJ A;  3TAX A;  4DX1 A;  3LY7 A;  4PH4 B;  3UPV A;  3D9K A;  4KXK B;  4GB9 A;  3TWR A;  3LVR E;  5AAO A;  2WXK A;  1SW6 A;  3RO2 A;  3HG0 D;  4KBQ A;  1FPP A;  4EZJ A;  4GA2 A;  4GMJ A;  4KYO B;  4HB5 A;  3ZIM A;  2WXQ A;  3UT4 A;  3S7B A;  1TN6 A;  5FQ4 A;  4GTR A;  5LFA A;  1HF8 A;  4X8Q A;  5HRY A;  3U64 A;  3VLD A;  4LRZ A;  5KNH D;  3DXM G;  2L6B A;  3FH5 A;  3S7J A;  1LTX A;  2XGS A;  3SHF A;  1HG2 A;  1H2T C;  2AW6 A;  4F1P A;  2J08 A;  2DYS E;  2WXI A;  1IXV A;  4L2Y A;  2C0L A;  3KEA A;  2AVP A;  4FHJ A;  5EKQ D;  2V8S E;  4CT0 A;  4JA9 A;  1E7U A;  5E76 A;  5LOZ A;  1IYG A;  3PUK A;  2L6J A;  1MX6 A;  2NYJ A;  3CR3 A;  2CG2 A;  4I1A A;  4JZY A;  2VTB A;  3FUM A;  4N3C A;  4GZC A;  4YDE A;  3ZFW A;  1K1B A;  5B1A E;  2FI7 A;  1FVH A;  3FUE A;  4PUC A;  4GTM A;  1N11 A;  4NRH B;  1KPS B;  3ONK A;  2L9B A;  3L54 A;  2XS1 A;  2R05 A;  1UN9 A;  5AEN A;  2QFC A;  3JQ0 A;  5EDS A;  4BX9 A;  4TRQ A;  3RRU A;  1WDY A;  2B0O E;  5FZS A;  1WM5 A;  3CVW A;  3ULY A;  3EUV A;  2CHX A;  3JUI A;  3SZ7 A;  4CRW A;  5J08 A;  2FEZ A;  3OTN A;  4GA1 A;  3E37 A;  2BKK B;  3T5X A;  4A55 A;  2X6J A;  2C0M A;  5EID A;  2LAH A;  2GRM A;  2OV8 A;  3E30 A;  5A7D B;  4GMR A;  4PS7 A;  4G2V A;  3Q7F A;  2XEN A;  4NUR A;  4UQZ A;  2GRQ B;  2R02 A;  4AJW A;  3D9M A;  5CMY A;  2IEJ A;  4FC8 A;  1BD8 A;  3DWL G;  4U8H A;  3RO3 A;  4DX5 D;  1HO8 A;  3TG4 A;  2E0I A;  3G2W A;  2BTD A;  4HRM B;  5FTP A;  3TWS A;  4L9P A;  4K03 A;  4DPR A;  5BXO A;  3CKB A;  4KVO A;  1Z5S C;  1N4Q A;  5ENN A;  3FFL A;  3ONL A;  1N94 A;  3ASF A;  2OEV A;  2CHZ A;  4WNG A;  5AN8 A;  3VTX A;  3ZN3 A;  1UN8 A;  2QYU A;  2KM4 A;  1QYM A;  3LY9 A;  4O60 A;  3HDX A;  3MGB A;  3QJZ A;  5D0Q D;  3C98 A;  2VYI A;  3LEW A;  1N0R A;  2AXU A;  3UM2 A;  1NFI E;  1OWN A;  4QFV A;  1N0Q A;  2R2L A;  3ZEF A;  3CK8 A;  2P9K G;  4J8S A;  4XI9 A;  2CFZ A;  3FH7 A;  2DZN A;  4D10 C;  4UWL A;  4FUL A;  1H6O A;  1YMP A;  2V5F A;  3P1U A;  4GU5 A;  1S63 A;  4WWN A;  4FLB A;  2XHE A;  4HI8 A;  4DRX E;  1HXI A;  1E8Z A;  3ZYQ A;  3IV0 A;  3G2T A;  2XCB A;  1JUQ A;  3L08 A;  3CK7 A;  1K3Z D;  3CVL A;  1GW6 A;  3JYS A;  4EBA A;  2V5Q C;  3JXJ A;  4U7E B;  5T8I A;  3FU0 A;  3HXE A;  3BG1 B;  5FQ8 A;  2YHC A;  4KVM A;  4IRU A;  5KJK A;  1QNF A;  3ZPJ A;  5KNG A;  1DNP A;  3L6A A;  3TWQ A;  3ZKJ A;  5DBK A;  3DPD A;  3N71 A;  3R7Q A;  3Q9N C;  1S0P A;  2XZD G;  4H7Y A;  3GZ1 A;  1IKN D;  4P29 A;  4RQI A;  3ESK A;  5AQB A;  2OEW A;  4I2W A;  4C0M A;  3L17 A;  4F7A A;  1OWM A;  4GZ5 A;  5JJ6 A;  3DBS A;  4GAA A;  4BWR A;  2P2C P;  2HYZ A;  2J09 A;  5EIB E;  4HRL A;  3C3O A;  4AXH A;  3ZU7 B;  5D66 A;  3Q75 A;  2GRN B; 
#chains in the Genus database with same CATH homology
 3PZ1 A;  4GTR A;  4MBG A;  3Q78 A;  1TNU A;  3HXF A;  1JCR A;  3E30 A;  1O1T A;  1TNO A;  1D8D A;  1LTX A;  1DCE A;  1TNY A;  3PZ4 A;  3DSS A;  1S63 A;  1JCQ A;  2H6I A;  3Q7F A;  1QBQ A;  1NL4 A;  1TN7 A;  3DPY A;  4LNB A;  2IEJ A;  2H6H A;  2BED A;  1O1R A;  3HXD A;  1NI1 A;  1FT1 A;  3DSV A;  3DSX A;  3PZ3 A;  3SFX A;  4GTT A;  3C72 A;  2ZIR A;  3E32 A;  3HXE A;  1N4R A;  3KSL A;  3E33 A;  3Q7A A;  4EHM A;  3DST A;  4L9P A;  1JCS A;  1SA5 A;  1MZC A;  3KSQ A;  1SA4 A;  2F0Y A;  1N95 A;  1N4P A;  3DRA A;  4GTO A;  4LNG A;  3HXC A;  1N4Q A;  1FT2 A;  3Q79 A;  1S64 A;  4YDE A;  3HXB A;  1N94 A;  1KZP A;  3SFY A;  4GTQ A;  3Q73 A;  2H6G A;  4GTM A;  3DSU A;  1O5M A;  3E34 A;  1TNB A;  3EU5 A;  2ZIS A;  3PZ2 A;  1N9A A;  1N4S A;  1X81 A;  2H6F A;  4GTS A;  3DSW A;  1FPP A;  1LD8 A;  3EUV A;  1TNZ A;  1D8E A;  2R2L A;  1TN8 A;  3E37 A;  1O1S A;  1LD7 A;  1KZO A;  3Q75 A;  4GTP A;  4YDO A;  4GTV A;  1TN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...