1SA4A

Human protein farnesyltransferase complexed with fpp and r115777
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
315
structure length
315
Chain Sequence
FVSLDSPSYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSDKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type I
publication title Crystal Structures of the Anticancer Clinical Candidates R115777 (Tipifarnib) and BMS-214662 Complexed with Protein Farnesyltransferase Suggest a Mechanism of FTI Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 129
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2004-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1sa4A00
1SA4A 3PZ4A 1O1TA 4GTSA 1LTXA 2H6IA 3EUVA 4GTQA 3C72A 1TN6A 1D8DA 2R2LA 1JCQA 1FPPA 3HXDA 1TNBA 1S63A 3Q7AA 3SFXA 3Q73A 1N4SA 2H6FA 1N4RA 3PZ2A 1N94A 1N9AA 3DPYA 1SA5A 3PZ1A 3DSXA 3KSLA 1TNOA 1TNYA 1LD8A 1JCRA 3EU5A 1NI1A 3KSQA 3DRAA 4LNGA 4YDOA 1MZCA 2ZIRA 3Q78A 1DCEA 4MBGA 4GTTA 2H6GA 1D8EA 3Q75A 1QBQA 3HXBA 3Q7FA 1FT1A 3DSTA 2BEDA 4GTRA 3DSUA 1JCSA 1O1RA 3HXFA 2IEJA 3E32A 3SFYA 1FT2A 1S64A 3PZ3A 1KZOA 4GTVA 3E34A 1KZPA 4GTMA 2F0YA 3E37A 2ZISA 1TN7A 3DSSA 4L9PA 4EHMA 1N95A 1NL4A 1TNUA 3HXCA 4YDEA 4GTPA 1LD7A 4GTOA 1TN8A 1X81A 3Q79A 1TNZA 3DSWA 1O1SA 3DSVA 1N4QA 1O5MA 3E33A 3E30A 4LNBA 3HXEA 2H6HA 1N4PA
chains in the Genus database with same CATH superfamily
4J8YA 2FULA 3R9MA 2DIWA 2KZTA 3PZ4A 1LTXA 2H6IA 5CMYA 1Z5SC 2GRNB 2R03A 1VDYA 2R2LA 1U3CA 4RSYA 3ZVVA 3I3NA 1MX6A 3JCKC 3FY4A 3P1UA 2X6HA 3K9IA 4Q69A 2IF4A 3HVEB 1EYHA 4HRLA 4I6EA 4LERA 3V2XA 1QBQA 4CDRA 5CEDB 4N2QA 4L7TA 2KC7A 4CZ2D 3ASGA 1TEZA 3IEGA 1DCQA 1Y6IA 5D0QD 2KBXA 4YVQC 4HI8A 4BX9A 4G24A 3SFYA 4DPRA 3EHQA 3ZNGA 2XEHA 3L16A 4J8DA 3FH8A 4GZ5A 2R05A 2XS8A 2FO1E 1N95A 5AJDA 3ZFWA 2GRPB 3UTMA 3MX3A 2EILE 1O5MA 2AJAA 2E0IA 3EDTB 3LDZA 4U95D 3CK7A 3ENEA 3CK9A 2R59A 3HRAA 3SO8A 4QFVA 2YNQA 3O48A 4N5CA 3LY7A 1K8KG 2PM6A 2RFAA 4BT8A 1TNBA 1MX4A 3ASOE 4E6HA 3FEYA 4G8LA 2JABA 1TNYA 3KSQA 5T3RA 2L6JA 2OEWA 1BI8B 5CEAA 3RKVA 4XEIG 1UOHA 4N39A 2BF0X 5EILA 4HB5A 3ONLA 1INZA 3FHEA 3UM0A 4C48B 4U8HA 4EZKA 5ANRA 2MOWA 2XGSA 4O60A 3LVQE 2WXGA 2P9UG 2HYZA 2Y0BG 4GZ3A 4CT4A 1WDYA 1PC2A 4TRQA 4EHMA 3ZIMA 4GMRA 4KBQA 4W9RA 5D66A 5EX3A 1NL4A 5A7DB 2E2EA 2A5EA 3JXJA 5AENA 2XCBA 3UIPC 4BY6A 5FWQA 1H6OA 1SQMA 2J09A 2KZTB 2HE0A 1JUQA 2R5SA 3JQ1A 4J0UA 3ASNE 3ML9A 3SGHA 3CIAA 3ULYA 1WG0A 1NP7A 3KEAA 1Z3XA 5FINA 2UY1A 3G2WA 3HXDA 2XGOA 3ZGQA 3J5QB 1IXVA 3SBSA 4GU5A 1E90A 4B89A 3ZUVB 2XS1A 3DPYA 2PL2A 4L2LA 1HE8A 3JUIA 4HVBA 2WXKA 2M63A 3EU5A 3G2SA 3CKBA 3AU4A 3PNTB 3UIOC 1V54E 4K5CA 1IYGA 3WG7E 1E96B 2BTDA 2GGFA 3L22A 3IHVA 2X6JA 3NOCD 2KCVA 4GMLA 4B93B 1PY1A 5BV0A 2X6IA 4UWFA 1HXIA 4ATGA 3MJWA 4GTRA 3IKOB 5D0OD 2RKKA 2Y4TA 2CHXA 4PUCA 1IKND 3AS4A 3DXKG 3FTWA 3ONKA 3E34A 3AG2E 2V4HC 1SZAA 4HLEA 3U66A 4F1PA 1SZ9A 3OXLA 3AJIA 3FU5A 1N0QA 4KXKB 3S2AA 3UM3A 5G04J 4D10C 2WMOA 3FP3A 1O1SA 4ABNA 3PZDA 5E75A 5AYWD 2HR2A 2LAIA 1OWLA 3TWWA 3UT7A 4Z68A 4O6FA 3PE3A 3NB2A 5M72A 5LCWJ 3QARA 2L9BA 1TN6A 4UI9C 3F6QA 3U9WA 4DX2A 1WY6A 5BUZA 1A17A 3QNKA 1DNPA 4RQIA 2QFCA 4I1OB 4NURA 4U0SA 2IU1A 4FHJA 2L0TB 2V4LA 4UQZA 5HRYA 2KATA 5AQ7A 5BV1A 3VTYA 3HHMA 2PQRA 1JWFA 2MHKA 3EHNA 5AQAA 2GRMA 3QB2A 3FUIA 4CCAA 2FBNA 4JEHA 3RRMB 1HH8A 3MKQA 2WXQA 1E8XA 2I2OA 4IYPA 2F37A 1E7UA 3L17A 4MS6A 1JCSA 3ZYMA 2R02A 4GA2A 3IHYA 4JA7A 5FT9A 4KVOA 1S64A 4HRMB 4U8VD 3CV0A 5HI7A 4EQFA 1QYMA 3LCAA 1H6KA 4U96D 3ABLE 3GZSA 3C3QA 2GRRB 3PEUB 3CQCB 5AQBA 4FA6A 5LX8A 2ONDA 4LUNU 1N4QA 1JPLA 5H7PA 2OV8A 1N4PA 2V5FA 2I1JA 4KMOA 1HFAA 2R17C 2ETAA 4I9EA 4XE0A 4CYMD 3D3MA 4OAUC 2UY1B 4DX6D 4YVOA 3R7QA 2FEZA 2VSOE 1KPSB 5JJ7A 3PZ2A 3ZW3A 4U63A 4AEZC 3FUNA 2VTBA 2XZTG 1KLXA 3HIZA 3HXBA 3VLFA 2V5QC 2GW1A 3ZEFA 3SI5A 3VLEA 4ZFHA 3LEWA 5AJLA 2DCPA 4J8FA 2VJ8A 3SFZA 3D9LA 1FCHA 1B89A 4IN3B 4A63B 3AAAC 2LSVA 5JJTA 3NF1A 3HXFA 4ILGA 3O4ZA 2J8SD 3PE4A 4AJWA 3PZ3A 4APFA 4EZJA 4GAAA 2PZIA 1UW4B 4EBAG 1SVXA 2EIKE 3GW4A 4C0MA 2WM9A 4WWPA 2P9IG 1FVHA 4TXQA 2IQCA 4AP2A 2XZDG 1OWOA 2J08A 2V0PA 3FUHA 4BERA 2B0OE 3L13A 4AVXA 3UI2A 5BPPA 4JL0A 4O1OA 3LS8A 4C0EA 5ANLA 3Q15A 5JHBA 4CT0A 1DC2A 3MZLB 2CHWA 2ETCA 4A3VA 4B8CB 4H7YA 2ZGDA 5JJ6A 4ANWA 3D9MA 4ATZD 4AY6A 4FU3A 4G8KA 3QAQA 4U07A 2H6FA 1N9AA 4UUCA 4JHRA 3UM2A 3CVYA 3LJ3A 3BG1B 4FLHA 3FDHA 4PDXA 3S7BA 5AIJA 3EJNA 4GTTA 2XCCA 2P9LG 1K3ZD 3TWVA 3CVXA 4CRWA 5G2NA 2NC9A 3FUDA 2KCLA 3MKQB 2LSUA 3TXNA 4JW1A 2BEDA 2QY7A 5FTPA 2XQ0A 4M7CA 1YCSB 4HRNA 5FQ4A 4MRUA 3R7RA 2XHEA 5FQ8A 3BUAA 4ANXA 4JVSA 4K5BA 4BWRA 3PDNA 4BESA 2HM8A 4WNEA 1TN7A 4RG6A 2VGXB 3UINC 2WMNA 2IONA 3CKCA 2DBAA 3HXCA 3DEPA 2NXPA 4GTOA 3N71A 5KJKA 5EYLA 4UQYA 3QWPA 4X8QA 1UJKA 5ARGA 5T4YA 4HOQA 3RRNB 3L6AA 3Q4AB 2CHZA 2WXOA 2WXJA 5KNHD 1MX2A 2FF4A 3BEEA 1P5QA 2UWJG 3OTNA 4JA9A 1BU9A 3PUKA 3SFXA 3APCA 4WNDA 3PS6A 1SA5A 2IJGX 4I43A 3DSXA 4LNUD 4DUIA 2VTBB 4I17A 4DX7D 2XPZA 1Y8MA 3MYVA 3ZHEA 4YDOA 5KNGA 1H2VC 1YA0A 3KEZA 2ILRA 4WWNA 2P58C 3FH7A 2EIME 4AOFA 1NZNA 4J8SA 3AU5A 2AW6A 4GYOA 5JA4D 1SW6A 4K03A 4LCTA 2NSZA 4NIKA 3FU0A 4XKBA 2P9KG 4A55A 4GTVA 3CLJA 4U7EB 5ENNA 5CMWA 4V3IA 4GCNA 5CCMA 3CSFA 4YDEA 5KWDA 4IULA 4Y6WA 4G25A 1S70B 4HOSA 2P9PG 2CG3A 5KJLA 3U64A 3T5VA 5CBNA 2WXIA 4L2YA 2I1KA 2MYOA 3TL5A 3CVWA 3ESLA 2Y3AA 3CHQA 2C0LA 4FP7A 1E8YA 3DEOA 3CHSA 3UM1A 4QQIA 2LXLA 2WQHA 3KS2A 1N4RA 4RG9A 5LFAA 5JHAA 1OY3D 2AXUA 1MJ0A 1TJCA 2ZXWE 2IFUA 3CHMA 3D9IA 3FTVA 5FIOA 5JMND 3LKUA 4M3OA 1ZB1A 4CGVA 3PRZA 1K1AA 1EPUA 1NFIE 1YMPA 2Y69E 1E8ZA 2WXMA 2VYIA 3UT8A 4ILIA 1NA3A 4BX8A 1KT1A 3S7JA 2NYJA 5EIDA 3B7TA 3DSUA 4NRHB 2EINE 1HG5A 1ZU2A 4DI3A 1IQRA 4BSZB 5BNWA 3J5PA 3QWVA 3CVQA 5AQ9A 3HG0D 4XKCA 2JEKA 4FLBA 2MRIA 3NBNB 4HOTA 1L5JA 2Q7FA 2J4BA 3DSVA 3TG4A 3G2VA 3E30A 3D9NA 2OVFA 4KZCA 2CFUA 3FUMA 4G11A 4U8YD 4XX5A 4G23A 3RRUA 3FWVA 4ME2A 2RFMA 3X2QE 2FO7A 3G2TA 3E4BA 1TR4A 3IV0A 3FU3A 3ZHEB 3TWRA 3Q5MA 1NI1A 3CGHA 3DRAA 4LNGA 5B1BE 2GRQB 3JXIA 3AG1E 2ZU6B 4UWLA 1QZ2A 2YHCA 1E7VA 4KZ0A 4J8EA 3TXMA 5KBAA 3OXFA 1TYQG 5EDSA 1GW6A 3APDA 3FTYA 4FADA 3NZUA 2KM4A 2IEJA 3AG4E 3FUKA 3UT4A 1AWCB 1Z6TA 2IOLA 3ASDA 1OWPA 2X6KA 4I6GA 2OEVA 4LG6A 3OAWA 3ESKA 3CVPA 2PQNA 1QNFA 1HX8A 3SHFA 3ZXPA 1IQUA 1U3DA 1A5EA 4HOUA 4TUMA 3FUJA 2KCKA 2EQXA 4WNFA 4FJYA 4N5QA 3U3WA 3T8MA 4TUUA 3ABKE 2WXPA 3HVEA 2J49A 3C72A 3LXUX 1H6PA 4J6IA 3I4RB 4HS2A 1AP7A 4GYYA 1N4SA 3B13A 3QKYA 1N94A 4ACKA 4RVBA 1D9SA 3NZSA 3KSLA 1ELRA 4FJZA 1DCEA 4A1GA 1EDUA 4PS3A 2RG8A 4B8AA 5C2YA 3B7SA 4GB9A 3QOUA 4CGWA 3GZ1A 2HO1A 4LSZE 4GA0A 3C98A 3ML8A 4DRXE 2J9QA 3TWUA 5G55A 4UWHA 3LY9A 2AXZA 5FZSA 1XGWA 4CDMA 3T5XA 3MA5A 4PS8A 3R9AB 4GTMA 3D9HA 3L08A 2I9CA 5ENQD 2LNIA 2PM7A 4DX1A 2ZISA 4K0RA 4F7AA 2PNNA 2QYUA 1IHGA 2A5UA 1RW2A 3V30A 4N3AA 3EIJA 3CVVA 3BG0B 3NAWA 5CECB 3PNLB 2LXMA 4BTAA 4GTSA 4KYOB 2WPVA 5ENPD 4HLLA 5G04C 2VGYA 3AS8A 4ZHBA 1HF8A 2A4ZA 2XEEA 4OAVB 4IRUA 4G1TA 2VSXE 3RJVA 3FULA 4DI4A 1FPPA 4GMJA 1S63A 5ITZF 2VQ2A 3QC1A 3JUEA 2ZGGA 3FEXA 5LCWC 4F1SA 2WXNA 3Q9NC 5FQ6A 3AS5A 5CRVA 2JLBA 5B3SE 2YQ8A 1MZCA 3CHPA 3FH5A 3LYAA 3CVUA 3MV2B 4XIFA 3V79K 2XENA 3DSTA 3FUEA 3D9KA 3SNXA 4ANUA 1ZBPA 4EZLA 4B94A 1OUVA 3E32A 3IBEA 3SZ7A 4MKTA 3SD5A 1QQEA 3DSSA 3L54A 3ZN3A 1S0PA 1ELWA 4CEMA 4GTPA 1LD7A 3PH0C 4BTBA 1H19A 2DWZA 2DYRE 3HYMB 3QWWA 4AIFA 3Q49B 2WVIA 4DX5D 2QYJA 1OWMA 3QJZA 4WAFA 3D9JA 3ASFA 1BD8A 1RZ4A 4B0ZA 4AXHA 4BT9A 3Q73A 4JEUA 4XI9A 4I1MA 1HS6A 4GZCA 3PZ1A 2EIJE 4GA1A 1X5BA 3D9OA 1LD8A 3W9FA 1JCRA 4A1SA 1E8WA 2AWIA 2WB2A 3V31A 3EU9A 1D8EA 1BLXB 2C0MA 1PAQA 3AG3E 2X3MA 5ENSD 3EHRA 5EN5D 3C3RA 5BXOA 1FT1A 2C2LA 2DZNA 4NACA 5BT1A 1MYOA 3TAXA 3I4GA 5J90A 1HG2A 3EHMA 4N2SA 2L6BA 3T8KA 4DLOA 5A6CA 4OVUA 3SF4A 4JC8A 1EF1C 5ENTD 3HDXA 1OCRE 4FHKA 5AN8A 4AY5A 2BKGA 4YDWA 4GCOA 3V2OA 5AARA 1Q2ZA 3TJPA 3I5PA 3ZKJA 5LOZA 1X81A 1TNZA 3BU8A 4N3CA 5ARFA 4UI9J 5G05C 3HXEA 2H6HA 3GYZA 4WWOA 5T8IA 2XRZA 3VLDA 2Y1LE 3ZRHA 3EUVA 3LY8A 4DK5A 3PVLA 3UUXA 4BFRA 3FFLA 3UPVA 4HXIA 3ULQA 3ULEG 4GPMA 3RO3A 1UN8A 4RLYA 3UKUG 1N52A 3RO2A 2WQ6A 5A23A 4L1BA 4GZ6A 3RAUA 3CK8A 4HORA 5ENRD 3Q9UC 4TV3A 1N54A 2VSNA 5KJNA 2ZIRA 5BW8C 4Y6CA 3TWQA 3QDNA 4JD2G 2RD0A 3P2BA 3TWSA 3TG5A 3VTXA 2CG2A 4KVMA 4JPSA 4BSXA 5CHEE 1UN9A 4I1AA 1KT0A 2B6CA 1O1RA 3C3OA 3DWLG 1XNFA 1OCCE 1OXJA 2L0IA 3RSEG 3NOGD 3PUJA 3ZU7B 3FTXA 4EPZA 3TWXA 2F8XK 1JWGA 4ILHB 3CHOA 4L23A 2P2CP 2OOEA 2IOSA 3URZA 3EIQC 4NQ0A 2AXVA 4ANVA 5B1AE 1WM5A 1MHQA 4GTQA 3MCXA 2IY0C 5EIBE 4HNAD 1JCQA 2BUGA 3UQ3A 5ENOD 3S7DA 3GZ2A 3CR3A 1ELKA 1OCOE 5AAOA 4U04A 5HS0A 4K5AB 4I2WA 1TNOA 4O1PA 2I6HA 4A3TA 3FTZA 1YYHA 3B95A 3ABME 4AM9A 2P9SG 3T9KA 2AVPA 5DBKA 3MGBA 3ZYKA 3ZXSA 3FTSA 5J08A 1N0RA 4URKA 3CEQA 3SY2A 4I9CA 1TJFA 5FJYA 4YDYA 5EKQD 3B7UX 3U4TA 1KZPA 3ZYQA 3RK6A 2F0YA 3E37A 1BPOA 4UI9K 4I6JA 4KT6B 4OVVA 2BKKB 3JYSA 2J4DA 3DXMG 4I2ZA 4HFGA 4EECA 1TN8A 4WUYA 2CFZA 4HI9A 4U0UA 2VGEA 5HQ8A 4WNGA 4E85A 1N11A 3B7RL 3FTUA 1OT8A 4UWKA 5E76A 4G26A 3ZYLA 5IY5E 1O1TA 5CERB 2DVWA 4XZ4A 1D8DA 4FC8A 4FULA 4EBAA 2X38A 4XI0A 2Y4UA 3Q7AA 4JHKA 5CRUA 4APOA 4JXTA 2GROB 2QC9A 4N3BA 2GRLA 5KJMA 1H0AA 1BI7B 4OYSA 4UWGA 4CDNA 4ACLA 3MKRA 2WXRA 4Q96A 3OXGA 2XPIA 1OCZE 2H6GA 3CSTA 3TWTA 2X6FA 3DPDA 4C9BB 3ASHA 1U2VG 2VGXA 3UXGA 2DZOA 2IO3C 3RU0A 3BQOA 3FUFA 4JB8P 5DIZA 5KCMA 4F6RD 3W9GA 4JZYA 4BETA 1UJJA 1DVPA 1FT2A 1H2UA 4GZDA 3RIBA 5HKPA 4L9PA 3FU6A 1HO8A 4LRZA 1V55E 5FZQA 4JHJA 3S7FA 3SQVA 2J07A 2V8SE 5CBOA 2ETBA 3MEKA 1H2TC 4HQDA 3UX4A 3JQ0A 3UKRG 3CVLA 4GPKA 2QZAA 3E33A 2LAHA 3DBSA 3LJNA 2WXLA 3WXXA 2XGMA 1SA4A 5FZRA 1NA0A 5BXUA 4R7LA 5LP0A 3APFA 3ZPJA 4F53A 2P9NG 4UQXA 4MLPA 3QK0A 3CHRA 4AV7A 3L9TA 2F8YA 2XEVA 4TXPA 1K1BA 3PEVB 2WQ7A 2WXFA 3LPZA 1OWNA 2WXHA 3IXEA 1MQSA 3Q78A 4MBGA 3CQGB 3Q75A 4PH4B 1HU3A 2YINA 5CCLA 3SBTB 3NQPA 2OVBA 1FVFA 5D2MC 3ISMC 3Q7FA 2XPYA 2OCCE 2KXPC 3MV3B 1G3NB 5G05J 3Q47B 2DYSE 4BEPA 4HBDA 2VSYA 4PS7A 3LVRE 4DJAA 4LEUA 4TXRA 3UMVA 3KAEA 3B7BA 1UG3A 1WAO1 1KZOA 2IO2C 1W3BA 2LO6A 4Q94A 3D9PA 5EX0A 4H7XA 5C1DA 3G2UA 3C5RA 5EYPF 2FI7A 4U0ZA 4J7WA 2YHEA 3CVNA 3PREA 1TNUA 2XRYA 1HZ4A 3Q79A 1LF8A 3L82A 2LUHA 1IHBA 3DSWA 4G2VA 1Z3YA 4YNDA 4GYWA 5FQ7A 3KD7A 3TGOA 4DLQA 4P29A 4LNBA 4F3VA
chains in the Genus database with same CATH topology
1SA4A 3PZ4A 1O1TA 4GTSA 1LTXA 2H6IA 3EUVA 4GTQA 3C72A 1TN6A 1D8DA 2R2LA 1JCQA 1FPPA 3HXDA 1TNBA 1S63A 3Q7AA 3SFXA 3Q73A 1N4SA 2H6FA 1N4RA 3PZ2A 1N94A 1N9AA 3DPYA 1SA5A 3PZ1A 3DSXA 3KSLA 1TNOA 1TNYA 1LD8A 1JCRA 3EU5A 1NI1A 3KSQA 3DRAA 4LNGA 4YDOA 1MZCA 2ZIRA 3Q78A 1DCEA 4MBGA 4GTTA 2H6GA 1D8EA 3Q75A 1QBQA 3HXBA 3Q7FA 1FT1A 3DSTA 2BEDA 4GTRA 3DSUA 1JCSA 1O1RA 3HXFA 2IEJA 3E32A 3SFYA 1FT2A 1S64A 3PZ3A 1KZOA 4GTVA 3E34A 1KZPA 4GTMA 2F0YA 3E37A 2ZISA 1TN7A 3DSSA 4L9PA 4EHMA 1N95A 1NL4A 1TNUA 3HXCA 4YDEA 4GTPA 1LD7A 4GTOA 1TN8A 1X81A 3Q79A 1TNZA 3DSWA 1O1SA 3DSVA 1N4QA 1O5MA 3E33A 3E30A 4LNBA 3HXEA 2H6HA 1N4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SA4 A;  3PZ4 A;  1O1T A;  4GTS A;  1LTX A;  2H6I A;  3EUV A;  4GTQ A;  3C72 A;  1TN6 A;  1D8D A;  2R2L A;  1JCQ A;  1FPP A;  3HXD A;  1TNB A;  1S63 A;  3Q7A A;  3SFX A;  3Q73 A;  1N4S A;  2H6F A;  1N4R A;  3PZ2 A;  1N94 A;  1N9A A;  3DPY A;  1SA5 A;  3PZ1 A;  3DSX A;  3KSL A;  1TNO A;  1TNY A;  1LD8 A;  1JCR A;  3EU5 A;  1NI1 A;  3KSQ A;  3DRA A;  4LNG A;  4YDO A;  1MZC A;  2ZIR A;  3Q78 A;  1DCE A;  4MBG A;  4GTT A;  2H6G A;  1D8E A;  3Q75 A;  1QBQ A;  3HXB A;  3Q7F A;  1FT1 A;  3DST A;  2BED A;  4GTR A;  3DSU A;  1JCS A;  1O1R A;  3HXF A;  2IEJ A;  3E32 A;  3SFY A;  1FT2 A;  1S64 A;  3PZ3 A;  1KZO A;  4GTV A;  3E34 A;  1KZP A;  4GTM A;  2F0Y A;  3E37 A;  2ZIS A;  1TN7 A;  3DSS A;  4L9P A;  4EHM A;  1N95 A;  1NL4 A;  1TNU A;  3HXC A;  4YDE A;  4GTP A;  1LD7 A;  4GTO A;  1TN8 A;  1X81 A;  3Q79 A;  1TNZ A;  3DSW A;  1O1S A;  3DSV A;  1N4Q A;  1O5M A;  3E33 A;  3E30 A;  4LNB A;  3HXE A;  2H6H A;  1N4P A; 
#chains in the Genus database with same CATH topology
 4J8Y A;  2FUL A;  3R9M A;  2DIW A;  2KZT A;  3PZ4 A;  1LTX A;  2H6I A;  5CMY A;  1Z5S C;  2GRN B;  2R03 A;  1VDY A;  2R2L A;  1U3C A;  4RSY A;  3ZVV A;  3I3N A;  1MX6 A;  3JCK C;  3FY4 A;  3P1U A;  2X6H A;  3K9I A;  4Q69 A;  2IF4 A;  3HVE B;  1EYH A;  4HRL A;  4I6E A;  4LER A;  3V2X A;  1QBQ A;  4CDR A;  5CED B;  4N2Q A;  4L7T A;  2KC7 A;  4CZ2 D;  3ASG A;  1TEZ A;  3IEG A;  1DCQ A;  1Y6I A;  5D0Q D;  2KBX A;  4YVQ C;  4HI8 A;  4BX9 A;  4G24 A;  3SFY A;  4DPR A;  3EHQ A;  3ZNG A;  2XEH A;  3L16 A;  4J8D A;  3FH8 A;  4GZ5 A;  2R05 A;  2XS8 A;  2FO1 E;  1N95 A;  5AJD A;  3ZFW A;  2GRP B;  3UTM A;  3MX3 A;  2EIL E;  1O5M A;  2AJA A;  2E0I A;  3EDT B;  3LDZ A;  4U95 D;  3CK7 A;  3ENE A;  3CK9 A;  2R59 A;  3HRA A;  3SO8 A;  4QFV A;  2YNQ A;  3O48 A;  4N5C A;  3LY7 A;  1K8K G;  2PM6 A;  2RFA A;  4BT8 A;  1TNB A;  1MX4 A;  3ASO E;  4E6H A;  3FEY A;  4G8L A;  2JAB A;  1TNY A;  3KSQ A;  5T3R A;  2L6J A;  2OEW A;  1BI8 B;  5CEA A;  3RKV A;  4XEI G;  1UOH A;  4N39 A;  2BF0 X;  5EIL A;  4HB5 A;  3ONL A;  1INZ A;  3FHE A;  3UM0 A;  4C48 B;  4U8H A;  4EZK A;  5ANR A;  2MOW A;  2XGS A;  4O60 A;  3LVQ E;  2WXG A;  2P9U G;  2HYZ A;  2Y0B G;  4GZ3 A;  4CT4 A;  1WDY A;  1PC2 A;  4TRQ A;  4EHM A;  3ZIM A;  4GMR A;  4KBQ A;  4W9R A;  5D66 A;  5EX3 A;  1NL4 A;  5A7D B;  2E2E A;  2A5E A;  3JXJ A;  5AEN A;  2XCB A;  3UIP C;  4BY6 A;  5FWQ A;  1H6O A;  1SQM A;  2J09 A;  2KZT B;  2HE0 A;  1JUQ A;  2R5S A;  3JQ1 A;  4J0U A;  3ASN E;  3ML9 A;  3SGH A;  3CIA A;  3ULY A;  1WG0 A;  1NP7 A;  3KEA A;  1Z3X A;  5FIN A;  2UY1 A;  3G2W A;  3HXD A;  2XGO A;  3ZGQ A;  3J5Q B;  1IXV A;  3SBS A;  4GU5 A;  1E90 A;  4B89 A;  3ZUV B;  2XS1 A;  3DPY A;  2PL2 A;  4L2L A;  1HE8 A;  3JUI A;  4HVB A;  2WXK A;  2M63 A;  3EU5 A;  3G2S A;  3CKB A;  3AU4 A;  3PNT B;  3UIO C;  1V54 E;  4K5C A;  1IYG A;  3WG7 E;  1E96 B;  2BTD A;  2GGF A;  3L22 A;  3IHV A;  2X6J A;  3NOC D;  2KCV A;  4GML A;  4B93 B;  1PY1 A;  5BV0 A;  2X6I A;  4UWF A;  1HXI A;  4ATG A;  3MJW A;  4GTR A;  3IKO B;  5D0O D;  2RKK A;  2Y4T A;  2CHX A;  4PUC A;  1IKN D;  3AS4 A;  3DXK G;  3FTW A;  3ONK A;  3E34 A;  3AG2 E;  2V4H C;  1SZA A;  4HLE A;  3U66 A;  4F1P A;  1SZ9 A;  3OXL A;  3AJI A;  3FU5 A;  1N0Q A;  4KXK B;  3S2A A;  3UM3 A;  5G04 J;  4D10 C;  2WMO A;  3FP3 A;  1O1S A;  4ABN A;  3PZD A;  5E75 A;  5AYW D;  2HR2 A;  2LAI A;  1OWL A;  3TWW A;  3UT7 A;  4Z68 A;  4O6F A;  3PE3 A;  3NB2 A;  5M72 A;  5LCW J;  3QAR A;  2L9B A;  1TN6 A;  4UI9 C;  3F6Q A;  3U9W A;  4DX2 A;  1WY6 A;  5BUZ A;  1A17 A;  3QNK A;  1DNP A;  4RQI A;  2QFC A;  4I1O B;  4NUR A;  4U0S A;  2IU1 A;  4FHJ A;  2L0T B;  2V4L A;  4UQZ A;  5HRY A;  2KAT A;  5AQ7 A;  5BV1 A;  3VTY A;  3HHM A;  2PQR A;  1JWF A;  2MHK A;  3EHN A;  5AQA A;  2GRM A;  3QB2 A;  3FUI A;  4CCA A;  2FBN A;  4JEH A;  3RRM B;  1HH8 A;  3MKQ A;  2WXQ A;  1E8X A;  2I2O A;  4IYP A;  2F37 A;  1E7U A;  3L17 A;  4MS6 A;  1JCS A;  3ZYM A;  2R02 A;  4GA2 A;  3IHY A;  4JA7 A;  5FT9 A;  4KVO A;  1S64 A;  4HRM B;  4U8V D;  3CV0 A;  5HI7 A;  4EQF A;  1QYM A;  3LCA A;  1H6K A;  4U96 D;  3ABL E;  3GZS A;  3C3Q A;  2GRR B;  3PEU B;  3CQC B;  5AQB A;  4FA6 A;  5LX8 A;  2OND A;  4LUN U;  1N4Q A;  1JPL A;  5H7P A;  2OV8 A;  1N4P A;  2V5F A;  2I1J A;  4KMO A;  1HFA A;  2R17 C;  2ETA A;  4I9E A;  4XE0 A;  4CYM D;  3D3M A;  4OAU C;  2UY1 B;  4DX6 D;  4YVO A;  3R7Q A;  2FEZ A;  2VSO E;  1KPS B;  5JJ7 A;  3PZ2 A;  3ZW3 A;  4U63 A;  4AEZ C;  3FUN A;  2VTB A;  2XZT G;  1KLX A;  3HIZ A;  3HXB A;  3VLF A;  2V5Q C;  2GW1 A;  3ZEF A;  3SI5 A;  3VLE A;  4ZFH A;  3LEW A;  5AJL A;  2DCP A;  4J8F A;  2VJ8 A;  3SFZ A;  3D9L A;  1FCH A;  1B89 A;  4IN3 B;  4A63 B;  3AAA C;  2LSV A;  5JJT A;  3NF1 A;  3HXF A;  4ILG A;  3O4Z A;  2J8S D;  3PE4 A;  4AJW A;  3PZ3 A;  4APF A;  4EZJ A;  4GAA A;  2PZI A;  1UW4 B;  4EBA G;  1SVX A;  2EIK E;  3GW4 A;  4C0M A;  2WM9 A;  4WWP A;  2P9I G;  1FVH A;  4TXQ A;  2IQC A;  4AP2 A;  2XZD G;  1OWO A;  2J08 A;  2V0P A;  3FUH A;  4BER A;  2B0O E;  3L13 A;  4AVX A;  3UI2 A;  5BPP A;  4JL0 A;  4O1O A;  3LS8 A;  4C0E A;  5ANL A;  3Q15 A;  5JHB A;  4CT0 A;  1DC2 A;  3MZL B;  2CHW A;  2ETC A;  4A3V A;  4B8C B;  4H7Y A;  2ZGD A;  5JJ6 A;  4ANW A;  3D9M A;  4ATZ D;  4AY6 A;  4FU3 A;  4G8K A;  3QAQ A;  4U07 A;  2H6F A;  1N9A A;  4UUC A;  4JHR A;  3UM2 A;  3CVY A;  3LJ3 A;  3BG1 B;  4FLH A;  3FDH A;  4PDX A;  3S7B A;  5AIJ A;  3EJN A;  4GTT A;  2XCC A;  2P9L G;  1K3Z D;  3TWV A;  3CVX A;  4CRW A;  5G2N A;  2NC9 A;  3FUD A;  2KCL A;  3MKQ B;  2LSU A;  3TXN A;  4JW1 A;  2BED A;  2QY7 A;  5FTP A;  2XQ0 A;  4M7C A;  1YCS B;  4HRN A;  5FQ4 A;  4MRU A;  3R7R A;  2XHE A;  5FQ8 A;  3BUA A;  4ANX A;  4JVS A;  4K5B A;  4BWR A;  3PDN A;  4BES A;  2HM8 A;  4WNE A;  1TN7 A;  4RG6 A;  2VGX B;  3UIN C;  2WMN A;  2ION A;  3CKC A;  2DBA A;  3HXC A;  3DEP A;  2NXP A;  4GTO A;  3N71 A;  5KJK A;  5EYL A;  4UQY A;  3QWP A;  4X8Q A;  1UJK A;  5ARG A;  5T4Y A;  4HOQ A;  3RRN B;  3L6A A;  3Q4A B;  2CHZ A;  2WXO A;  2WXJ A;  5KNH D;  1MX2 A;  2FF4 A;  3BEE A;  1P5Q A;  2UWJ G;  3OTN A;  4JA9 A;  1BU9 A;  3PUK A;  3SFX A;  3APC A;  4WND A;  3PS6 A;  1SA5 A;  2IJG X;  4I43 A;  3DSX A;  4LNU D;  4DUI A;  2VTB B;  4I17 A;  4DX7 D;  2XPZ A;  1Y8M A;  3MYV A;  3ZHE A;  4YDO A;  5KNG A;  1H2V C;  1YA0 A;  3KEZ A;  2ILR A;  4WWN A;  2P58 C;  3FH7 A;  2EIM E;  4AOF A;  1NZN A;  4J8S A;  3AU5 A;  2AW6 A;  4GYO A;  5JA4 D;  1SW6 A;  4K03 A;  4LCT A;  2NSZ A;  4NIK A;  3FU0 A;  4XKB A;  2P9K G;  4A55 A;  4GTV A;  3CLJ A;  4U7E B;  5ENN A;  5CMW A;  4V3I A;  4GCN A;  5CCM A;  3CSF A;  4YDE A;  5KWD A;  4IUL A;  4Y6W A;  4G25 A;  1S70 B;  4HOS A;  2P9P G;  2CG3 A;  5KJL A;  3U64 A;  3T5V A;  5CBN A;  2WXI A;  4L2Y A;  2I1K A;  2MYO A;  3TL5 A;  3CVW A;  3ESL A;  2Y3A A;  3CHQ A;  2C0L A;  4FP7 A;  1E8Y A;  3DEO A;  3CHS A;  3UM1 A;  4QQI A;  2LXL A;  2WQH A;  3KS2 A;  1N4R A;  4RG9 A;  5LFA A;  5JHA A;  1OY3 D;  2AXU A;  1MJ0 A;  1TJC A;  2ZXW E;  2IFU A;  3CHM A;  3D9I A;  3FTV A;  5FIO A;  5JMN D;  3LKU A;  4M3O A;  1ZB1 A;  4CGV A;  3PRZ A;  1K1A A;  1EPU A;  1NFI E;  1YMP A;  2Y69 E;  1E8Z A;  2WXM A;  2VYI A;  3UT8 A;  4ILI A;  1NA3 A;  4BX8 A;  1KT1 A;  3S7J A;  2NYJ A;  5EID A;  3B7T A;  3DSU A;  4NRH B;  2EIN E;  1HG5 A;  1ZU2 A;  4DI3 A;  1IQR A;  4BSZ B;  5BNW A;  3J5P A;  3QWV A;  3CVQ A;  5AQ9 A;  3HG0 D;  4XKC A;  2JEK A;  4FLB A;  2MRI A;  3NBN B;  4HOT A;  1L5J A;  2Q7F A;  2J4B A;  3DSV A;  3TG4 A;  3G2V A;  3E30 A;  3D9N A;  2OVF A;  4KZC A;  2CFU A;  3FUM A;  4G11 A;  4U8Y D;  4XX5 A;  4G23 A;  3RRU A;  3FWV A;  4ME2 A;  2RFM A;  3X2Q E;  2FO7 A;  3G2T A;  3E4B A;  1TR4 A;  3IV0 A;  3FU3 A;  3ZHE B;  3TWR A;  3Q5M A;  1NI1 A;  3CGH A;  3DRA A;  4LNG A;  5B1B E;  2GRQ B;  3JXI A;  3AG1 E;  2ZU6 B;  4UWL A;  1QZ2 A;  2YHC A;  1E7V A;  4KZ0 A;  4J8E A;  3TXM A;  5KBA A;  3OXF A;  1TYQ G;  5EDS A;  1GW6 A;  3APD A;  3FTY A;  4FAD A;  3NZU A;  2KM4 A;  2IEJ A;  3AG4 E;  3FUK A;  3UT4 A;  1AWC B;  1Z6T A;  2IOL A;  3ASD A;  1OWP A;  2X6K A;  4I6G A;  2OEV A;  4LG6 A;  3OAW A;  3ESK A;  3CVP A;  2PQN A;  1QNF A;  1HX8 A;  3SHF A;  3ZXP A;  1IQU A;  1U3D A;  1A5E A;  4HOU A;  4TUM A;  3FUJ A;  2KCK A;  2EQX A;  4WNF A;  4FJY A;  4N5Q A;  3U3W A;  3T8M A;  4TUU A;  3ABK E;  2WXP A;  3HVE A;  2J49 A;  3C72 A;  3LXU X;  1H6P A;  4J6I A;  3I4R B;  4HS2 A;  1AP7 A;  4GYY A;  1N4S A;  3B13 A;  3QKY A;  1N94 A;  4ACK A;  4RVB A;  1D9S A;  3NZS A;  3KSL A;  1ELR A;  4FJZ A;  1DCE A;  4A1G A;  1EDU A;  4PS3 A;  2RG8 A;  4B8A A;  5C2Y A;  3B7S A;  4GB9 A;  3QOU A;  4CGW A;  3GZ1 A;  2HO1 A;  4LSZ E;  4GA0 A;  3C98 A;  3ML8 A;  4DRX E;  2J9Q A;  3TWU A;  5G55 A;  4UWH A;  3LY9 A;  2AXZ A;  5FZS A;  1XGW A;  4CDM A;  3T5X A;  3MA5 A;  4PS8 A;  3R9A B;  4GTM A;  3D9H A;  3L08 A;  2I9C A;  5ENQ D;  2LNI A;  2PM7 A;  4DX1 A;  2ZIS A;  4K0R A;  4F7A A;  2PNN A;  2QYU A;  1IHG A;  2A5U A;  1RW2 A;  3V30 A;  4N3A A;  3EIJ A;  3CVV A;  3BG0 B;  3NAW A;  5CEC B;  3PNL B;  2LXM A;  4BTA A;  4GTS A;  4KYO B;  2WPV A;  5ENP D;  4HLL A;  5G04 C;  2VGY A;  3AS8 A;  4ZHB A;  1HF8 A;  2A4Z A;  2XEE A;  4OAV B;  4IRU A;  4G1T A;  2VSX E;  3RJV A;  3FUL A;  4DI4 A;  1FPP A;  4GMJ A;  1S63 A;  5ITZ F;  2VQ2 A;  3QC1 A;  3JUE A;  2ZGG A;  3FEX A;  5LCW C;  4F1S A;  2WXN A;  3Q9N C;  5FQ6 A;  3AS5 A;  5CRV A;  2JLB A;  5B3S E;  2YQ8 A;  1MZC A;  3CHP A;  3FH5 A;  3LYA A;  3CVU A;  3MV2 B;  4XIF A;  3V79 K;  2XEN A;  3DST A;  3FUE A;  3D9K A;  3SNX A;  4ANU A;  1ZBP A;  4EZL A;  4B94 A;  1OUV A;  3E32 A;  3IBE A;  3SZ7 A;  4MKT A;  3SD5 A;  1QQE A;  3DSS A;  3L54 A;  3ZN3 A;  1S0P A;  1ELW A;  4CEM A;  4GTP A;  1LD7 A;  3PH0 C;  4BTB A;  1H19 A;  2DWZ A;  2DYR E;  3HYM B;  3QWW A;  4AIF A;  3Q49 B;  2WVI A;  4DX5 D;  2QYJ A;  1OWM A;  3QJZ A;  4WAF A;  3D9J A;  3ASF A;  1BD8 A;  1RZ4 A;  4B0Z A;  4AXH A;  4BT9 A;  3Q73 A;  4JEU A;  4XI9 A;  4I1M A;  1HS6 A;  4GZC A;  3PZ1 A;  2EIJ E;  4GA1 A;  1X5B A;  3D9O A;  1LD8 A;  3W9F A;  1JCR A;  4A1S A;  1E8W A;  2AWI A;  2WB2 A;  3V31 A;  3EU9 A;  1D8E A;  1BLX B;  2C0M A;  1PAQ A;  3AG3 E;  2X3M A;  5ENS D;  3EHR A;  5EN5 D;  3C3R A;  5BXO A;  1FT1 A;  2C2L A;  2DZN A;  4NAC A;  5BT1 A;  1MYO A;  3TAX A;  3I4G A;  5J90 A;  1HG2 A;  3EHM A;  4N2S A;  2L6B A;  3T8K A;  4DLO A;  5A6C A;  4OVU A;  3SF4 A;  4JC8 A;  1EF1 C;  5ENT D;  3HDX A;  1OCR E;  4FHK A;  5AN8 A;  4AY5 A;  2BKG A;  4YDW A;  4GCO A;  3V2O A;  5AAR A;  1Q2Z A;  3TJP A;  3I5P A;  3ZKJ A;  5LOZ A;  1X81 A;  1TNZ A;  3BU8 A;  4N3C A;  5ARF A;  4UI9 J;  5G05 C;  3HXE A;  2H6H A;  3GYZ A;  4WWO A;  5T8I A;  2XRZ A;  3VLD A;  2Y1L E;  3ZRH A;  3EUV A;  3LY8 A;  4DK5 A;  3PVL A;  3UUX A;  4BFR A;  3FFL A;  3UPV A;  4HXI A;  3ULQ A;  3ULE G;  4GPM A;  3RO3 A;  1UN8 A;  4RLY A;  3UKU G;  1N52 A;  3RO2 A;  2WQ6 A;  5A23 A;  4L1B A;  4GZ6 A;  3RAU A;  3CK8 A;  4HOR A;  5ENR D;  3Q9U C;  4TV3 A;  1N54 A;  2VSN A;  5KJN A;  2ZIR A;  5BW8 C;  4Y6C A;  3TWQ A;  3QDN A;  4JD2 G;  2RD0 A;  3P2B A;  3TWS A;  3TG5 A;  3VTX A;  2CG2 A;  4KVM A;  4JPS A;  4BSX A;  5CHE E;  1UN9 A;  4I1A A;  1KT0 A;  2B6C A;  1O1R A;  3C3O A;  3DWL G;  1XNF A;  1OCC E;  1OXJ A;  2L0I A;  3RSE G;  3NOG D;  3PUJ A;  3ZU7 B;  3FTX A;  4EPZ A;  3TWX A;  2F8X K;  1JWG A;  4ILH B;  3CHO A;  4L23 A;  2P2C P;  2OOE A;  2IOS A;  3URZ A;  3EIQ C;  4NQ0 A;  2AXV A;  4ANV A;  5B1A E;  1WM5 A;  1MHQ A;  4GTQ A;  3MCX A;  2IY0 C;  5EIB E;  4HNA D;  1JCQ A;  2BUG A;  3UQ3 A;  5ENO D;  3S7D A;  3GZ2 A;  3CR3 A;  1ELK A;  1OCO E;  5AAO A;  4U04 A;  5HS0 A;  4K5A B;  4I2W A;  1TNO A;  4O1P A;  2I6H A;  4A3T A;  3FTZ A;  1YYH A;  3B95 A;  3ABM E;  4AM9 A;  2P9S G;  3T9K A;  2AVP A;  5DBK A;  3MGB A;  3ZYK A;  3ZXS A;  3FTS A;  5J08 A;  1N0R A;  4URK A;  3CEQ A;  3SY2 A;  4I9C A;  1TJF A;  5FJY A;  4YDY A;  5EKQ D;  3B7U X;  3U4T A;  1KZP A;  3ZYQ A;  3RK6 A;  2F0Y A;  3E37 A;  1BPO A;  4UI9 K;  4I6J A;  4KT6 B;  4OVV A;  2BKK B;  3JYS A;  2J4D A;  3DXM G;  4I2Z A;  4HFG A;  4EEC A;  1TN8 A;  4WUY A;  2CFZ A;  4HI9 A;  4U0U A;  2VGE A;  5HQ8 A;  4WNG A;  4E85 A;  1N11 A;  3B7R L;  3FTU A;  1OT8 A;  4UWK A;  5E76 A;  4G26 A;  3ZYL A;  5IY5 E;  1O1T A;  5CER B;  2DVW A;  4XZ4 A;  1D8D A;  4FC8 A;  4FUL A;  4EBA A;  2X38 A;  4XI0 A;  2Y4U A;  3Q7A A;  4JHK A;  5CRU A;  4APO A;  4JXT A;  2GRO B;  2QC9 A;  4N3B A;  2GRL A;  5KJM A;  1H0A A;  1BI7 B;  4OYS A;  4UWG A;  4CDN A;  4ACL A;  3MKR A;  2WXR A;  4Q96 A;  3OXG A;  2XPI A;  1OCZ E;  2H6G A;  3CST A;  3TWT A;  2X6F A;  3DPD A;  4C9B B;  3ASH A;  1U2V G;  2VGX A;  3UXG A;  2DZO A;  2IO3 C;  3RU0 A;  3BQO A;  3FUF A;  4JB8 P;  5DIZ A;  5KCM A;  4F6R D;  3W9G A;  4JZY A;  4BET A;  1UJJ A;  1DVP A;  1FT2 A;  1H2U A;  4GZD A;  3RIB A;  5HKP A;  4L9P A;  3FU6 A;  1HO8 A;  4LRZ A;  1V55 E;  5FZQ A;  4JHJ A;  3S7F A;  3SQV A;  2J07 A;  2V8S E;  5CBO A;  2ETB A;  3MEK A;  1H2T C;  4HQD A;  3UX4 A;  3JQ0 A;  3UKR G;  3CVL A;  4GPK A;  2QZA A;  3E33 A;  2LAH A;  3DBS A;  3LJN A;  2WXL A;  3WXX A;  2XGM A;  1SA4 A;  5FZR A;  1NA0 A;  5BXU A;  4R7L A;  5LP0 A;  3APF A;  3ZPJ A;  4F53 A;  2P9N G;  4UQX A;  4MLP A;  3QK0 A;  3CHR A;  4AV7 A;  3L9T A;  2F8Y A;  2XEV A;  4TXP A;  1K1B A;  3PEV B;  2WQ7 A;  2WXF A;  3LPZ A;  1OWN A;  2WXH A;  3IXE A;  1MQS A;  3Q78 A;  4MBG A;  3CQG B;  3Q75 A;  4PH4 B;  1HU3 A;  2YIN A;  5CCL A;  3SBT B;  3NQP A;  2OVB A;  1FVF A;  5D2M C;  3ISM C;  3Q7F A;  2XPY A;  2OCC E;  2KXP C;  3MV3 B;  1G3N B;  5G05 J;  3Q47 B;  2DYS E;  4BEP A;  4HBD A;  2VSY A;  4PS7 A;  3LVR E;  4DJA A;  4LEU A;  4TXR A;  3UMV A;  3KAE A;  3B7B A;  1UG3 A;  1WAO 1;  1KZO A;  2IO2 C;  1W3B A;  2LO6 A;  4Q94 A;  3D9P A;  5EX0 A;  4H7X A;  5C1D A;  3G2U A;  3C5R A;  5EYP F;  2FI7 A;  4U0Z A;  4J7W A;  2YHE A;  3CVN A;  3PRE A;  1TNU A;  2XRY A;  1HZ4 A;  3Q79 A;  1LF8 A;  3L82 A;  2LUH A;  1IHB A;  3DSW A;  4G2V A;  1Z3Y A;  4YND A;  4GYW A;  5FQ7 A;  3KD7 A;  3TGO A;  4DLQ A;  4P29 A;  4LNB A;  4F3V A; 
#chains in the Genus database with same CATH homology
 1SA4 A;  3PZ4 A;  1O1T A;  4GTS A;  1LTX A;  2H6I A;  3EUV A;  4GTQ A;  3C72 A;  1TN6 A;  1D8D A;  2R2L A;  1JCQ A;  1FPP A;  3HXD A;  1TNB A;  1S63 A;  3Q7A A;  3SFX A;  3Q73 A;  1N4S A;  2H6F A;  1N4R A;  3PZ2 A;  1N94 A;  1N9A A;  3DPY A;  1SA5 A;  3PZ1 A;  3DSX A;  3KSL A;  1TNO A;  1TNY A;  1LD8 A;  1JCR A;  3EU5 A;  1NI1 A;  3KSQ A;  3DRA A;  4LNG A;  4YDO A;  1MZC A;  2ZIR A;  3Q78 A;  1DCE A;  4MBG A;  4GTT A;  2H6G A;  1D8E A;  3Q75 A;  1QBQ A;  3HXB A;  3Q7F A;  1FT1 A;  3DST A;  2BED A;  4GTR A;  3DSU A;  1JCS A;  1O1R A;  3HXF A;  2IEJ A;  3E32 A;  3SFY A;  1FT2 A;  1S64 A;  3PZ3 A;  1KZO A;  4GTV A;  3E34 A;  1KZP A;  4GTM A;  2F0Y A;  3E37 A;  2ZIS A;  1TN7 A;  3DSS A;  4L9P A;  4EHM A;  1N95 A;  1NL4 A;  1TNU A;  3HXC A;  4YDE A;  4GTP A;  1LD7 A;  4GTO A;  1TN8 A;  1X81 A;  3Q79 A;  1TNZ A;  3DSW A;  1O1S A;  3DSV A;  1N4Q A;  1O5M A;  3E33 A;  3E30 A;  4LNB A;  3HXE A;  2H6H A;  1N4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...