4GCNA

N-terminal domain of stress-induced protein-1 (sti-1) from c.elegans
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
127
structure length
127
Chain Sequence
SNAMTDAAIAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGRETRADYKLIAKAMSRAGNAFQKQNDLSLAVQWFHRSLSEFRDPELVKKVKELEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein STI-1
publication title N-terminal domain of stress-induced protein-1 (STI-1) from C.elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 60
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gcnA00
2R5SA 4U07A 3TG5A 2VGXB 3LY9A 3CK7A 1PC2A 4JA7A 4HOSA 4UQZA 2VQ2A 4J8FA 2P58C 4GYOA 4A1SA 2VSYA 2OOEA 5JJTA 5G05C 3CEQA 3RKVA 1NZNA 4GA1A 4IN3B 1YA0A 1E96B 4G2VA 2XGOA 1KT0A 5KJLA 5C1DA 2WQHA 5FTPA 2VYIA 2BUGA 4XI0A 5HI7A 2KCVA 3Q15A 2L6JA 5ARFA 5FT9A 5DBKA 1Y8MA 2C2LA 1WAO1 3OXFA 5HQ8A 3ZHEA 4KBQA 2FO7A 2YHCA 1FCHA 3LKUA 4H7XA 3RJVA 2NC9A 2Y4UA 2UWJG 1NA3A 3SF4A 4BTAA 4WNDA 4ABNA 5CCLA 2PL2A 4G23A 5A7DB 5LCWJ 2Q7FA 1OUVA 5FZQA 3S7FA 4HORA 3QDNA 4U04A 2VGXA 4UI9J 3CKCA 1IHGA 2IFUA 3AS4A 4N3BA 2FI7A 4N5CA 3CVPA 3GW4A 4UQYA 4Y6WA 4J8DA 2FBNA 4U0ZA 4WNGA 3Q47B 4I2ZA 2YQ8A 2FF4A 4I1AA 2V5FA 3PDNA 4WNEA 3S7BA 4AY5A 4HOUA 4NQ0A 3QWWA 3MV2B 1B89A 3OXGA 2ONDA 3CK9A 3ZN3A 4JL0A 3UQ3A 3R9AB 1ELWA 4UQXA 2JLBA 2KC7A 3LPZA 4I9EA 4YNDA 5KJNA 4GZ3A 1IYGA 3WXXA 4I2WA 3KS2A 4CGVA 4APOA 4Y6CA 3TGOA 2I6HA 2GW1A 4ME2A 4U0UA 5ARGA 3RU0A 3Q49B 3TAXA 4BT9A 5JJ7A 2PQRA 5EX3A 4GZ6A 4YVQC 2QFCA 3MV3B 3RO2A 3VTYA 5EKQD 3AS8A 3JYSA 4XIFA 4UI9K 4HOTA 3MEKA 2UY1B 1XNFA 4GYYA 5D0OD 1NA0A 2LSUA 5KJMA 4BTBA 2C0MA 3KD7A 2XCBA 3SZ7A 2XCCA 4AY6A 4F3VA 3OXLA 3GZ2A 1QZ2A 5D0QD 3PE3A 3FWVA 5LCWC 3LYAA 4CGWA 1HZ4A 1HXIA 3QOUA 4G26A 4AIFA 3KAEA 4UI9C 3PE4A 2J9QA 3ASFA 4U0SA 1P5QA 3FP3A 3QWVA 3UUXA 4BT8A 5A6CA 4I17A 4GPKA 2FEZA 1W3BA 3RIBA 3ASDA 3U3WA 3UPVA 4O6FA 5CHEE 4RG6A 5AYWD 5BW8C 3E4BA 3CVLA 2LNIA 3ZPJA 2KCKA 2XGSA 5BNWA 2E2EA 4WUYA 3FFLA 5G04J 3N71A 4B94A 4I9CA 1KT1A 4CDRA 2AVPA 4J0UA 2C0LA 3VTXA 3RO3A 4BWRA 5KJKA 3ASHA 3S7JA 1A17A 3ULQA 2XEVA 4GZ5A 1ZU2A 4JHRA 2PZIA 2HO1A 2UY1A 3K9IA 3HYMB 1WM5A 4G24A 3MKRA 4HOQA 2HR2A 5G05J 4H7YA 3GZ1A 4N3CA 3LY8A 4GYWA 3IEGA 4G25A 2HYZA 5FZRA 3S7DA 2PQNA 4GA2A 4W9RA 1ELRA 4G1TA 5FJYA 4LEUA 4GCOA 1ZBPA 4GA0A 3QWPA 5CCMA 2KATA 3Q4AB 2WPVA 2VSNA 2MHKA 2VGYA 4GCNA 3CVQA 3LCAA 5M72A 3URZA 3LY7A 3MA5A 3TG4A 4WNFA 3O48A 4AM9A 4NRHB 4N3AA 3Q5MA 3QKYA 2Y4TA 2XGMA 2IF4A 3NF1A 3CKBA 3U4TA 4YVOA 4XI9A 2KCLA 5BT1A 4N39A 4N2SA 3ZHEB 1HH8A 4KYOB 3GYZA 2DBAA 5EX0A 3CV0A 1QQEA 3AS5A 4KXKB 3CVNA 1KLXA 3ASGA 5G04C 3CK8A 4JA9A 5DIZA 4EQFA 3ESKA 5FZSA 2XPIA 3BEEA 5JJ6A 4RG9A 3ZGQA 3EDTB 2LSVA 3ZFWA 4J8EA 4N2QA 1TJCA
chains in the Genus database with same CATH superfamily
2R5SA 4U7EB 4HBDA 4OVUA 4J8FA 1Z6TA 3FUEA 1IQUA 1OCOE 4CYMD 5ENQD 1NI1A 1H6PA 1JCSA 3ZIMA 2H6GA 5G05C 3D3MA 2XEHA 3L9TA 3CEQA 1NZNA 3MGBA 4JC8A 2EQXA 1SA5A 1TNBA 2IY0C 3MZLB 1E96B 2XGOA 3Q75A 1KT0A 5KJLA 4HI9A 3DSSA 3ML8A 2VYIA 3L13A 4JXTA 5HI7A 4ILGA 5EIDA 2KCVA 3Q15A 2GRMA 3E37A 2ZIRA 2X6IA 3AG4E 3ASNE 4O60A 3EUVA 4BESA 4X8QA 2QYUA 2NC9A 2Y4UA 1NA3A 2X6HA 3TXMA 1U3CA 3DRAA 2LUHA 1N4RA 3AG2E 3UM2A 5JHBA 2PM7A 3JQ0A 4DUIA 3TWVA 2FO1E 5LCWJ 3L16A 4TV3A 5KBAA 1E8WA 3RSEG 3KSQA 3AG3E 2VGXA 2L9BA 1KZOA 4UI9J 3CKCA 2BF0X 4HQDA 3ZKJA 3FEYA 3DXMG 3SFZA 3AS4A 3MX3A 4N5CA 1HG2A 1DC2A 2ETBA 3T5XA 3B7RL 3RK6A 4U0ZA 1TYQG 4HFGA 4JZYA 2FF4A 4I1AA 4J8SA 2V5FA 2OCCE 3ZVVA 3BG0B 3TWUA 2MOWA 4NQ0A 1BPOA 3QWWA 4MKTA 3C3QA 3CK9A 3ZN3A 3UQ3A 1SW6A 2MYOA 3ONLA 2KC7A 3LPZA 4B0ZA 2R2LA 3WXXA 4I2WA 3AJIA 3KS2A 3IV0A 3LEWA 4HLEA 2I6HA 4YDWA 4LRZA 5KWDA 1S70B 2GW1A 2XZTG 5KNGA 4V3IA 2AWIA 1OT8A 3BUAA 4BT9A 4EBAA 1H2VC 2PQRA 3CLJA 4YVQC 2QFCA 1HG5A 3FTXA 4U8HA 4BERA 4ZFHA 1K1BA 1JWGA 3G2WA 3UKRG 1QNFA 3VTYA 5EKQD 3QB2A 2P2CP 4LNUD 4UI9K 4OVVA 3MEKA 4GYYA 3CGHA 1E90A 1MJ0A 2OV8A 5D0OD 5BV1A 4XKBA 2LSUA 4MLPA 3C5RA 2RFAA 1DCEA 1IKND 2XQ0A 4BTBA 2C0MA 1K1AA 4HRNA 2LO6A 2DVWA 4ILIA 2J49A 2XCBA 4AY6A 3OXLA 5ENOD 5CEAA 2EIJE 2ZGDA 4EBAG 5EIBE 2L0IA 1DVPA 3KAEA 4PH4B 2J9QA 1D8EA 3G2VA 4AVXA 3EHNA 3FP3A 3LJ3A 2GRPB 4WWOA 3V31A 4GPKA 4HRLA 4BSXA 1FPPA 2GRQB 3ASDA 2H6IA 2CFZA 5B1AE 2LNIA 2OEVA 2DCPA 3KEAA 3D9PA 4EPZA 2VSOE 4WUYA 3FFLA 3EIJA 4I9CA 3SO8A 4O1PA 1MYOA 4J0UA 2C0LA 2DWZA 2M63A 4Q96A 1A17A 2XEVA 3JQ1A 2IU1A 3IHVA 4RSYA 1FVHA 2HO1A 2X6FA 3TWTA 3SFYA 2J4BA 2NXPA 3OAWA 4G24A 3ZYMA 3DEPA 2P9PG 4DX7D 4URKA 2XPZA 3L82A 3DXKG 3LY8A 4GYWA 3TWXA 3IBEA 1WDYA 2R03A 4G25A 2XRZA 4QQIA 5ENNA 1OWNA 1TEZA 3L54A 4ATGA 2IOLA 1SZ9A 5FJYA 3TWWA 1ZBPA 2Y69E 4IYPA 5CCMA 3BG1B 3FY4A 3I5PA 3NZUA 4GMLA 3L22A 2Y0BG 2LAIA 4FHJA 2WPVA 3FUJA 2BEDA 3CHMA 4A3TA 1BD8A 5M72A 1LD8A 3LY7A 4DX6D 4LUNU 4AM9A 4DRXE 3KSLA 3HXCA 3FTVA 2XGMA 3NF1A 2YNQA 3CKBA 5JA4D 4YVOA 4K0RA 3DSTA 5BT1A 3L17A 5AJDA 1KZPA 1HH8A 3GYZA 4RLYA 3HVEB 3G2UA 1QQEA 2V4LA 1Y6IA 3UM0A 2J07A 4ACKA 5G04C 2EILE 4RVBA 3CIAA 3ZEFA 1ZB1A 5E76A 1Z3XA 4RG9A 3E32A 4J8EA 2GROB 3FH8A 2A5EA 2CHWA 2RD0A 3TG5A 3LY9A 4TUMA 4JVSA 5FQ7A 3APFA 4AP2A 2WVIA 3PZ2A 1IHBA 4CDNA 3OTNA 3FUKA 3HXFA 4F7AA 3BQOA 2XRYA 3APDA 3Q9NC 3I4RB 2V8SE 4LG6A 1YA0A 3TJPA 4G2VA 1YMPA 2B0OE 2WXJA 3FUFA 3SY2A 4MRUA 3I3NA 2I2OA 2I9CA 2WQ7A 4I1MA 1QYMA 4DJAA 3D9MA 2BUGA 5CRUA 3T5VA 4UWGA 4JHJA 5AQAA 5DBKA 3SBTB 2C2LA 1WAO1 3NOGD 3ZYKA 3RAUA 2LAHA 5JMND 1HX8A 1BU9A 2FO7A 4KZ0A 3UIPC 3UIOC 1L5JA 4GZDA 2P9LG 4YDEA 2UWJG 3FDHA 1IQRA 4WAFA 4CDMA 2X6KA 3SF4A 4BTAA 2XS1A 4GTSA 1RW2A 1U2VG 4ABNA 3UKUG 3HIZA 1OUVA 3MJWA 2KM4A 4K03A 3S7FA 2GRRB 2MRIA 1JWFA 3QDNA 4U04A 1UJKA 4PS7A 5B1BE 1N52A 1TN8A 3ZNGA 1IHGA 3CVPA 4MS6A 3R7QA 5AJLA 2YHEA 5B3SE 3HRAA 5BPPA 3UT7A 2DYSE 3S7BA 3SI5A 1EF1C 3CVVA 4XKCA 3U9WA 3EIQC 3JXIA 5LX8A 3MV2B 3EHMA 4UWLA 2ONDA 5T3RA 2NSZA 1AP7A 3ML9A 1QBQA 1N4QA 2GRNB 2XHEA 1N94A 1IYGA 4Z68A 1V55E 5EDSA 3CVUA 5FWQA 1LF8A 4CGVA 5CERB 4YDOA 4PS8A 3TGOA 4UWKA 2NYJA 2ZXWE 2QYJA 5ARGA 3JUIA 3RU0A 4I1OB 1BLXB 3TAXA 2KBXA 3U64A 4F53A 1DCQA 2ZU6B 1N0QA 4GZ6A 2ZISA 4PDXA 3IHYA 4U96D 3J5QB 1LTXA 4CRWA 1SQMA 3JYSA 4PUCA 2J08A 5LOZA 1EPUA 1S0PA 3T8MA 3SQVA 1JCRA 2GGFA 2EIKE 3KD7A 3SZ7A 4F3VA 2IEJA 3O4ZA 4EZLA 3QC1A 5D0QD 3FWVA 3UI2A 3QAQA 5BV0A 5LCWC 4JB8P 3FTUA 5G2NA 4CGWA 3FTZA 2V5QC 3ZXPA 1HZ4A 1HXIA 4RQIA 3APCA 4GU5A 4UI9C 3X2QE 3ASFA 4U0SA 3JUEA 1OWOA 4ZHBA 1LD7A 2VGEA 2FULA 1K3ZD 1HS6A 3U3WA 4CT4A 1UOHA 4HLLA 5CHEE 5AYWD 5AENA 3DPDA 3HXDA 5BNWA 2BTDA 5ITZF 1U3DA 3ZXSA 1KT1A 4GTQA 3FEXA 4AXHA 2IJGX 3ASOE 1A5EA 3NB2A 3ZU7B 4BWRA 4KMOA 1N11A 4GZ5A 4JPSA 3DSWA 2I1JA 4JHRA 5A23A 2WMNA 1PY1A 3G2SA 3K9IA 2OVFA 4I6JA 3HYMB 3FUMA 1WM5A 3FUHA 4HOQA 2QY7A 4CCAA 3PS6A 4ILHB 4GMRA 4N3CA 2R17C 1O1RA 5E75A 4F6RD 5ENPD 3S7DA 4ATZD 1NL4A 4K5AB 2PQNA 4W9RA 3B7BA 4EECA 3D9LA 4G1TA 5AARA 3Q7FA 1GW6A 3CHPA 4GA0A 4F1SA 1TN6A 2WXLA 3DPYA 2WXHA 3FH7A 3LCAA 3W9GA 3EHRA 2XS8A 1O1TA 3MA5A 1FT2A 3TWQA 4I6EA 3UM3A 4LERA 2Y4TA 2IF4A 1HO8A 3U4TA 4FADA 5LP0A 1HFAA 2KCLA 3PZ1A 4N39A 3ABLE 3ZHEB 2DBAA 3PVLA 2ETCA 3FUDA 1N4PA 1NFIE 2BKGA 4KXKB 3CVNA 3NAWA 1YCSB 4GTMA 1V54E 4JA9A 4A1GA 2AXZA 2XPIA 3ZGQA 3EDTB 5HRYA 5T8IA 4R7LA 3HXBA 4I6GA 4L9PA 1OCRE 4LNBA 4U07A 3CK7A 4JA7A 3CHQA 3R7RA 1TJFA 1TNOA 3CQCB 4A1SA 1H2TC 3UINC 2PNNA 4CZ2D 4HNAD 3ZRHA 4QFVA 5CECB 4FC8A 3C3OA 3PNTB 3FULA 5AQBA 3FH5A 4GA1A 4APFA 2VJ8A 4C0EA 4DK5A 5AIJA 1Q2ZA 5C1DA 5FTPA 4Q69A 2KZTB 3B13A 2IQCA 4XI0A 4FJZA 2ETAA 5ENTD 4L7TA 5FT9A 3PEVB 5JHAA 3C3RA 3OXFA 2F8YA 2VSXE 4XE0A 2F37A 4KBQA 4E85A 3EJNA 3HVEA 1FCHA 4H7XA 2IO3C 2EINE 3RJVA 4OAVB 5IY5E 1SVXA 3NOCD 1EDUA 3D9HA 4WNDA 1UN8A 5CCLA 1D9SA 4HB5A 3SBSA 3FU0A 2Q7FA 5C2YA 3NQPA 3PREA 4UWHA 4BFRA 3PNLB 2I1KA 3RRNB 4B89A 4N3BA 4GB9A 3MKQB 2VTBB 3SD5A 3GW4A 4UQYA 3V2OA 3G2TA 4DPRA 4FLHA 3ZUVB 4WWNA 2WXKA 1MQSA 4WNGA 3Q47B 4I2ZA 2YQ8A 5G55A 4DX5D 4C0MA 4ANWA 1UG3A 4WNEA 2OVBA 2X6JA 4AOFA 2DZNA 4L2LA 4HOUA 1N0RA 3OXGA 1G3NB 5EYPF 4JL0A 2GRLA 3R9AB 1ELWA 4JEUA 2F0YA 4GZ3A 1HF8A 3Q78A 2L0TB 4Y6CA 5FQ6A 3PRZA 3VLEA 4DX2A 2R05A 4U0UA 3HDXA 3Q49B 3T8KA 1N4SA 4FP7A 3FU3A 1Z3YA 4L2YA 2Y1LE 2A4ZA 4XIFA 4GTRA 4HOTA 1BI8B 2UY1B 1NA0A 3D9JA 2WXMA 4GZCA 4FU3A 3DWLG 3W9FA 3VLDA 1JCQA 3F6QA 4OYSA 1IXVA 3QJZA 3Q79A 2WXFA 3PUKA 1QZ2A 2AXUA 3PE3A 1SZAA 3ABKE 5EYLA 4M3OA 1AWCB 3P1UA 3QOUA 1OY3D 4G26A 1OWPA 3P2BA 4O1OA 3Q73A 4K5CA 1BI7B 4AIFA 4G8KA 3PZ4A 3PE4A 2WMOA 5ANRA 3TL5A 1O5MA 1NP7A 5CBNA 5H7PA 5AAOA 1E8XA 1P5QA 3HXEA 3QWVA 4U63A 3EU9A 4BT8A 5A6CA 2JEKA 4F1PA 3PZ3A 2A5UA 2JABA 3UM1A 4RG6A 1S64A 4DI3A 5T4YA 5BW8C 3SFXA 3ZYQA 3CVLA 4HI8A 2KCKA 3QNKA 2QC9A 2E2EA 4XEIG 1ELKA 1KPSB 4GPMA 3N71A 3AU4A 4CDRA 4GAAA 4HXIA 3CR3A 5BXUA 5J90A 3C72A 4C9BB 4IULA 1PAQA 5KJKA 3ASHA 3D9KA 4TXQA 3ULQA 1ZU2A 2L6BA 2PZIA 4JEHA 4G8LA 3ZW3A 4TXPA 2P9KG 3ISMC 3PZDA 4BX8A 5G05J 4FLBA 3FTSA 3ULEG 1FT1A 3EU5A 4FA6A 4AEZC 4B8AA 3IEGA 2P9SG 3LXUX 2HYZA 2WXPA 2XPYA 4J8YA 3UMVA 3E33A 3LS8A 4GA2A 3NBNB 2P9NG 1ELRA 3DSXA 3Q9UC 3DSUA 3ABME 5CRVA 3QARA 5HS0A 3FU6A 4PS3A 3TWRA 2E0IA 1N54A 1HU3A 2VSNA 2VGYA 4U8YD 3V79K 2B6CA 4GCNA 2AXVA 3UTMA 4HS2A 2AW6A 3AU5A 3CQGB 4I43A 4HVBA 4M7CA 3PH0C 4K5BA 1X5BA 3QK0A 1N9AA 4NRHB 4N3AA 4YDYA 3Q5MA 2R02A 3QKYA 4N5QA 4XI9A 3LVQE 5J08A 4N2SA 4EZJA 1D8DA 2H6HA 3SNXA 3CV0A 3SGHA 5D2MC 3CVWA 2DYRE 5CMYA 3AS5A 4LSZE 5CMWA 4GTVA 4AJWA 1JUQA 2WXRA 4ANUA 3BEEA 3JCKC 5EILA 2LSVA 2WQ6A 3TXNA 2X3MA 3ZFWA 3UXGA 4CEMA 2HE0A 4N2QA 1MHQA 2VGXB 3DBSA 1PC2A 4HOSA 3GZSA 4GTTA 5BUZA 4UQZA 2VQ2A 3S2AA 4XX5A 2P58C 4GYOA 2WB2A 4XZ4A 4EZKA 2VSYA 2Y3AA 2OOEA 5JJTA 1MZCA 1UW4B 3FUNA 2LXLA 2RG8A 2IO2C 3RKVA 2CHZA 1N95A 1H0AA 4AV7A 4IN3B 4NURA 3SHFA 1JPLA 2P9IG 4TUUA 3IXEA 4BY6A 2WQHA 3V30A 3R9MA 2XENA 1K8KG 2DZOA 4DX1A 2L6JA 5ARFA 4L23A 2P9UG 3LJNA 5CEDB 1Y8MA 2HM8A 2ZGGA 1E8YA 5HQ8A 3ZHEA 2WXGA 4JD2G 2YHCA 3D9OA 4D10C 3AG1E 5ANLA 3LKUA 4KVOA 4P29A 3MCXA 3E34A 2J8SD 1OCZE 2WXNA 2V0PA 4B93B 3RRUA 4L1BA 2PL2A 4OAUC 4G23A 4ANXA 3CSTA 1HE8A 5A7DB 5FZQA 1TNZA 3FHEA 3L6AA 4HORA 3PEUB 1TR4A 4NACA 4UWFA 2IFUA 3CVXA 2EIME 4A63B 2FI7A 4JHKA 2CHXA 5HKPA 3B7SA 4Y6WA 2WXQA 4J8DA 2FBNA 1OXJA 3DSVA 4DI4A 3Q7AA 3PDNA 4AY5A 2WXIA 2H6FA 4WWPA 2KZTA 4BETA 1OCCE 1B89A 4UUCA 5LFAA 4FHKA 4KT6B 2XEEA 4GTOA 4UQXA 1E7VA 2JLBA 4I9EA 4YNDA 5KJNA 1XGWA 1H19A 4MBGA 3NZSA 4APOA 1MX4A 3EHQA 1RZ4A 3L08A 4EHMA 4ME2A 3KEZA 3JXJA 2AJAA 1H6KA 5JJ7A 4ACLA 3B95A 1TNYA 5EX3A 5AQ9A 5FQ4A 5KCMA 1E7UA 3MV3B 3RO2A 1E8ZA 1YYHA 3AS8A 2YINA 5AN8A 5CBOA 4A3VA 4G11A 1WY6A 1XNFA 3ZYLA 2PM6A 5KJMA 1TN7A 2IOSA 3WG7E 3FUIA 3MKQA 2XCCA 4BSZB 2VTBA 4LNGA 3GZ2A 3D9NA 3UX4A 3LYAA 2CFUA 4J6IA 1X81A 2XZDG 2WXOA 3CVYA 3HHMA 4KVMA 3UT8A 1WG0A 3ULYA 4FJYA 3UUXA 2CG3A 4I17A 2FEZA 3TWSA 1W3BA 3B7UX 3RIBA 2J4DA 4BX9A 3UPVA 2CG2A 4O6FA 4HRMB 3FTYA 4BEPA 3E4BA 5ENSD 1VDYA 4TRQA 3ZPJA 2XGSA 5G04J 3LDZA 4B94A 3D9IA 4FULA 4GTPA 2AVPA 2QZAA 2J09A 3UT4A 3VTXA 1INZA 3RO3A 3S7JA 4KZCA 4CT0A 1S63A 5KNHD 2UY1A 1H6OA 2R59A 3U66A 4IRUA 3MKRA 4Q94A 4A55A 2HR2A 3FU5A 3MYVA 4C48B 4H7YA 3GZ1A 3VLFA 4JW1A 3LVRE 5D66A 4J7WA 3CHOA 1H2UA 4DLOA 2F8XK 2V4HC 5FZRA 1MX2A 5ENRD 1OWLA 1UN9A 5FQ8A 5AQ7A 3CHRA 4LEUA 1Z5SC 2RFMA 4GCOA 3BU8A 1MX6A 3QWPA 3CHSA 2X38A 3DEOA 2KATA 3T9KA 1OWMA 2IONA 3Q4AB 4DLQA 4GMJA 3C98A 1SA4A 2MHKA 3CVQA 3URZA 4TXRA 4U8VD 5BXOA 4NIKA 3TG4A 4WNFA 3O48A 3E30A 3HG0D 4E6HA 3V2XA 2BKKB 3IKOB 2DIWA 3ESLA 1TNUA 2LXMA 1UJJA 4KYOB 1EYHA 5EX0A 3CSFA 3J5PA 3RRMB 3I4GA 2KXPC 1DNPA 4U95D 4LCTA 4ANVA 1KLXA 3ASGA 3CK8A 3B7TA 5DIZA 5EN5D 4EQFA 3ESKA 5FZSA 5FIOA 5JJ6A 3AAAC 2OEWA 1FVFA 3ONKA 3ENEA 2WM9A 1O1SA 3PUJA 2RKKA 3FTWA 1TJCA 2ILRA 5FINA 4B8CB
chains in the Genus database with same CATH topology
2R5SA 2RD0A 4U07A 3TG5A 1MHQA 2VGXB 3DBSA 3LY9A 3CK7A 1PC2A 4JA7A 4OVUA 4HOSA 4JVSA 3CHQA 3GZSA 5FQ7A 4UQZA 2VQ2A 3R7RA 3APFA 3S2AA 5BUZA 1TJFA 4XX5A 4AP2A 3CQCB 4J8FA 1Z6TA 2P58C 3FUEA 1IQUA 4GYOA 2WVIA 4A1SA 2WB2A 1H2TC 4XZ4A 4EZKA 4CDNA 2VSYA 2Y3AA 3ZIMA 2OOEA 3FUKA 3OTNA 5JJTA 5G05C 3D3MA 4F7AA 1UW4B 3ZRHA 3FUNA 4QFVA 3CEQA 2RG8A 3RKVA 4FC8A 1NZNA 2XRYA 3APDA 2CHZA 3MGBA 3PNTB 4JC8A 3FULA 1H0AA 2EQXA 4AV7A 3FH5A 2V8SE 3I4RB 4GA1A 4APFA 4IN3B 3MZLB 4NURA 1YA0A 3SHFA 3TJPA 1JPLA 1E96B 2VJ8A 4G2VA 2WXJA 4TUUA 3FUFA 4C0EA 4DK5A 5AIJA 2XGOA 1KT0A 4BY6A 4MRUA 3I3NA 5KJLA 2I2OA 5C1DA 2WQHA 5FTPA 4Q69A 2I9CA 2KZTB 3B13A 2WQ7A 4I1MA 3ML8A 4DJAA 2IQCA 3D9MA 2VYIA 2BUGA 3L13A 4XI0A 4JXTA 5HI7A 4ILGA 3T5VA 2KCVA 3Q15A 4FJZA 4UWGA 4JHJA 2GRMA 2L6JA 5ARFA 2X6IA 4L7TA 4L23A 5FT9A 5DBKA 3PEVB 5JHAA 3SBTB 1Y8MA 2C2LA 2HM8A 1WAO1 3ZYKA 3OXFA 2LAHA 2VSXE 1E8YA 4XE0A 5HQ8A 1HX8A 2WXGA 3ZHEA 4KBQA 4E85A 3EJNA 2FO7A 2YHCA 3D9OA 3HVEA 4KZ0A 4D10C 1FCHA 5ANLA 3LKUA 4H7XA 1L5JA 4GZDA 4KVOA 4P29A 3RJVA 2NC9A 3MCXA 2Y4UA 2UWJG 3FDHA 1NA3A 1IQRA 2X6HA 4WAFA 2WXNA 2X6KA 3TXMA 2V0PA 4CDMA 3SF4A 1U3CA 4BTAA 1EDUA 4WNDA 1UN8A 3RRUA 4L1BA 4ABNA 5CCLA 5JHBA 2PL2A 2PM7A 3SBSA 3JQ0A 3FU0A 4G23A 4ANXA 3CSTA 1HE8A 3HIZA 5A7DB 5LCWJ 1OUVA 2Q7FA 5FZQA 3FHEA 3MJWA 2KM4A 5C2YA 4K03A 3L16A 4TV3A 3S7FA 3L6AA 1E8WA 2MRIA 1JWFA 3NQPA 4HORA 3PEUB 3PREA 3QDNA 4U04A 4UWHA 1UJKA 4BFRA 2VGXA 4PS7A 2L9BA 4NACA 1N52A 4UI9J 3CKCA 2BF0X 1IHGA 3PNLB 4UWFA 2IFUA 2I1KA 3FEYA 3RRNB 4B89A 3SFZA 3CVXA 3AS4A 4N3BA 3MX3A 4GB9A 3MKQB 2FI7A 4JHKA 4N5CA 3CVPA 2CHXA 1HG2A 2VTBB 3SD5A 4MS6A 3B7RL 3B7SA 3T5XA 3GW4A 3R7QA 4UQYA 5AJLA 3RK6A 4Y6WA 3G2TA 4DPRA 4FLHA 2WXQA 4J8DA 2FBNA 2YHEA 4U0ZA 4WWNA 2WXKA 1MQSA 4DI4A 4HFGA 4WNGA 3Q47B 4I2ZA 2YQ8A 4JZYA 5BPPA 5G55A 3UT7A 2FF4A 4I1AA 4J8SA 2V5FA 3PDNA 4ANWA 4C0MA 1UG3A 3ZVVA 4WNEA 2OVBA 3S7BA 3SI5A 2X6JA 1EF1C 4AOFA 4L2LA 4AY5A 2WXIA 4WWPA 3BG0B 4XKCA 3CVVA 3U9WA 2KZTA 4HOUA 3EIQC 2MOWA 4NQ0A 1BPOA 3QWWA 4MKTA 5LX8A 3MV2B 1B89A 3OXGA 3EHMA 4UWLA 2ONDA 3CK9A 4FHKA 3ZN3A 4JL0A 4KT6B 3UQ3A 5LFAA 2GRLA 5T3RA 3R9AB 1ELWA 4UQXA 2NSZA 1E7VA 2JLBA 3ONLA 2KC7A 3LPZA 4JEUA 4B0ZA 4I9EA 4YNDA 5KJNA 1XGWA 3ML9A 4GZ3A 1H19A 2XHEA 1IYGA 3WXXA 1HF8A 4I2WA 5EDSA 3NZSA 3CVUA 3KS2A 2L0TB 3IV0A 3LEWA 5FWQA 1LF8A 4CGVA 4HLEA 4APOA 4Y6CA 4PS8A 3TGOA 5FQ6A 2I6HA 3PRZA 4UWKA 3VLEA 4LRZA 2GW1A 3L08A 4ME2A 4U0UA 3KEZA 5ARGA 3HDXA 3JUIA 3RU0A 4V3IA 2AWIA 4I1OB 3Q49B 3TAXA 4BT9A 4EBAA 1H6KA 5JJ7A 4ACLA 3U64A 1H2VC 2PQRA 4F53A 2ZU6B 5EX3A 3CLJA 4GZ6A 4YVQC 2QFCA 1HG5A 3FTXA 4PDXA 4FP7A 4U8HA 3FU3A 1E7UA 3IHYA 3MV3B 1JWGA 5FQ4A 5KCMA 3RO2A 1Z3YA 1E8ZA 3G2WA 4L2YA 1QNFA 3VTYA 5EKQD 2A4ZA 3AS8A 4CRWA 1SQMA 3QB2A 2YINA 3JYSA 4PUCA 4XIFA 4UI9K 4A3VA 4OVVA 4HOTA 3MEKA 4G11A 2UY1B 1WY6A 1XNFA 2J08A 3CGHA 4GYYA 5LOZA 1E90A 2OV8A 5D0OD 1NA0A 3D9JA 1EPUA 5BV1A 4XKBA 3ZYLA 2LSUA 2WXMA 4GZCA 4FU3A 1S0PA 4MLPA 2PM6A 5KJMA 3T8MA 2XQ0A 3VLDA 4BTBA 2GGFA 2C0MA 4OYSA 2LO6A 4ILIA 2IOSA 2J49A 3FUIA 3MKQA 3KD7A 2XCBA 3SZ7A 3QJZA 2XCCA 4AY6A 4F3VA 2VTBA 2WXFA 3OXLA 3PUKA 3O4ZA 4EZLA 3GZ2A 1QZ2A 3QC1A 2AXUA 3PE3A 3FWVA 5D0QD 3D9NA 3QAQA 1SZAA 3UX4A 5BV0A 5LCWC 3FTUA 4M3OA 5G2NA 4EBAG 3LYAA 4CGWA 3FTZA 1HZ4A 2CFUA 3P1UA 1HXIA 3QOUA 4G26A 1OWPA 3P2BA 2L0IA 4J6IA 3APCA 1DVPA 3KAEA 4GU5A 4UI9C 4AIFA 2WXOA 4PH4B 3PE4A 2WMOA 5ANRA 2J9QA 3ASFA 3TL5A 3CVYA 4U0SA 1NP7A 3HHMA 3G2VA 4KVMA 1OWOA 3UT8A 4AVXA 1E8XA 1P5QA 2FULA 3EHNA 3FP3A 3QWVA 4U63A 4FJYA 3LJ3A 3UUXA 4WWOA 4BT8A 2CG3A 5A6CA 4I17A 2JEKA 2FEZA 4GPKA 1W3BA 4BSXA 3B7UX 3RIBA 1HS6A 3ASDA 2A5UA 2J4DA 4BX9A 4CT4A 3U3WA 2CFZA 3UPVA 2CG2A 4O6FA 5CHEE 4RG6A 4DI3A 5T4YA 5AYWD 5BW8C 3FTYA 5AENA 3E4BA 3CVLA 1VDYA 4TRQA 2LNIA 3ZYQA 3ZPJA 2DCPA 2KCKA 2XGSA 3DPDA 3QNKA 5BNWA 2BTDA 3D9PA 1U3DA 2E2EA 4EPZA 2VSOE 4WUYA 1ELKA 3FFLA 5G04J 3LDZA 3EIJA 3N71A 3AU4A 4I9CA 3ZXSA 4B94A 3D9IA 1KT1A 4FULA 4CDRA 3FEXA 4AXHA 4GAAA 4HXIA 2IJGX 2AVPA 3CR3A 5J90A 2J09A 3UT4A 4J0UA 2C0LA 4C9BB 4IULA 3VTXA 1INZA 3RO3A 1PAQA 2M63A 4Q96A 4BWRA 5KJKA 3ASHA 3D9KA 3S7JA 4KMOA 1A17A 4KZCA 3ULQA 2XEVA 3JQ1A 1ZU2A 2IU1A 3IHVA 4GZ5A 4JPSA 2I1JA 4JHRA 5A23A 4RSYA 2PZIA 1FVHA 2WMNA 4JEHA 2HO1A 1PY1A 3ZW3A 4CT0A 2X6FA 3G2SA 2UY1A 3K9IA 2OVFA 4I6JA 2J4BA 3HYMB 3FUMA 2R59A 2NXPA 3U66A 1WM5A 3FUHA 3OAWA 4IRUA 4G24A 3ZYMA 3PZDA 3MKRA 4Q94A 4A55A 4HOQA 4BX8A 2QY7A 2HR2A 3FU5A 3MYVA 4CCAA 4URKA 3PS6A 5G05J 4H7YA 4FLBA 3GZ1A 4ILHB 3VLFA 2XPZA 3FTSA 4N3CA 2R17C 4JW1A 3LVRE 5E75A 4FA6A 3LY8A 4GYWA 3CHOA 3IBEA 4AEZC 1H2UA 4B8AA 3IEGA 4G25A 3LXUX 4DLOA 2XRZA 2HYZA 2WXPA 5FZRA 2XPYA 5ENNA 3UMVA 3S7DA 1OWNA 3LS8A 2PQNA 4GA2A 4W9RA 1OWLA 1UN9A 1TEZA 4EECA 3L54A 4ATGA 1ELRA 3D9LA 5FQ8A 4G1TA 3CHRA 2IOLA 1SZ9A 5FJYA 4LEUA 1GW6A 4GCOA 3QARA 1ZBPA 3CHPA 4GA0A 3QWPA 4IYPA 5CCMA 3FU6A 4PS3A 3CHSA 3BG1B 2X38A 2KATA 3FY4A 3I5PA 3NZUA 4F1SA 4GMLA 2E0IA 3L22A 1N54A 1OWMA 2IONA 2LAIA 2WXLA 3Q4AB 4DLQA 4GMJA 1HU3A 2WPVA 2VSNA 2WXHA 3C98A 3FH7A 2MHKA 2VGYA 4FHJA 4GCNA 2AXVA 3CVQA 3FUJA 3LCAA 4HS2A 3CHMA 2AW6A 4A3TA 5M72A 3AU5A 3CQGB 4I43A 4HVBA 3URZA 3PH0C 3LY7A 3MA5A 4LUNU 3TG4A 4WNFA 1X5BA 3QK0A 3O48A 4I6EA 4E6HA 4AM9A 4NRHB 4N3AA 3Q5MA 3FTVA 4LERA 3QKYA 2Y4TA 2XGMA 2IF4A 2YNQA 1HO8A 3NF1A 3CKBA 3IKOB 3U4TA 4FADA 2DIWA 4YVOA 4XI9A 3LVQE 4K0RA 5J08A 5LP0A 1HFAA 2KCLA 5BT1A 4N39A 3L17A 5AJDA 3ESLA 4N2SA 1UJJA 3ZHEB 1HH8A 4KYOB 4EZJA 3GYZA 2DBAA 1EYHA 3HVEB 5EX0A 3CSFA 3G2UA 3RRMB 3PVLA 3SNXA 3CV0A 3SGHA 3CVWA 1QQEA 2V4LA 3I4GA 1DNPA 3FUDA 1Y6IA 4LCTA 2J07A 4ANVA 5CMYA 3AS5A 4KXKB 3CVNA 1KLXA 4ACKA 3ASGA 5G04C 5CMWA 3CK8A 4RVBA 3B7TA 4AJWA 1JUQA 2WXRA 3CIAA 3ZEFA 4ANUA 4JA9A 5E76A 4A1GA 2AXZA 1Z3XA 5DIZA 4EQFA 3ESKA 5FZSA 2XPIA 3BEEA 5JJ6A 4RG9A 3JCKC 1FVFA 3EDTB 3ONKA 3ZGQA 2LSVA 3ENEA 2WQ6A 3TXNA 2WM9A 2X3MA 3ZFWA 4CEMA 3PUJA 4J8EA 4R7LA 5T8IA 4I6GA 3FH8A 4N2QA 3FTWA 1TJCA 2ILRA 4B8CB 2CHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5S A;  4U07 A;  3TG5 A;  2VGX B;  3LY9 A;  3CK7 A;  1PC2 A;  4JA7 A;  4HOS A;  4UQZ A;  2VQ2 A;  4J8F A;  2P58 C;  4GYO A;  4A1S A;  2VSY A;  2OOE A;  5JJT A;  5G05 C;  3CEQ A;  3RKV A;  1NZN A;  4GA1 A;  4IN3 B;  1YA0 A;  1E96 B;  4G2V A;  2XGO A;  1KT0 A;  5KJL A;  5C1D A;  2WQH A;  5FTP A;  2VYI A;  2BUG A;  4XI0 A;  5HI7 A;  2KCV A;  3Q15 A;  2L6J A;  5ARF A;  5FT9 A;  5DBK A;  1Y8M A;  2C2L A;  1WAO 1;  3OXF A;  5HQ8 A;  3ZHE A;  4KBQ A;  2FO7 A;  2YHC A;  1FCH A;  3LKU A;  4H7X A;  3RJV A;  2NC9 A;  2Y4U A;  2UWJ G;  1NA3 A;  3SF4 A;  4BTA A;  4WND A;  4ABN A;  5CCL A;  2PL2 A;  4G23 A;  5A7D B;  5LCW J;  2Q7F A;  1OUV A;  5FZQ A;  3S7F A;  4HOR A;  3QDN A;  4U04 A;  2VGX A;  4UI9 J;  3CKC A;  1IHG A;  2IFU A;  3AS4 A;  4N3B A;  2FI7 A;  4N5C A;  3CVP A;  3GW4 A;  4UQY A;  4Y6W A;  4J8D A;  2FBN A;  4U0Z A;  4WNG A;  3Q47 B;  4I2Z A;  2YQ8 A;  2FF4 A;  4I1A A;  2V5F A;  3PDN A;  4WNE A;  3S7B A;  4AY5 A;  4HOU A;  4NQ0 A;  3QWW A;  3MV2 B;  1B89 A;  3OXG A;  2OND A;  3CK9 A;  3ZN3 A;  4JL0 A;  3UQ3 A;  3R9A B;  1ELW A;  4UQX A;  2JLB A;  2KC7 A;  3LPZ A;  4I9E A;  4YND A;  5KJN A;  4GZ3 A;  1IYG A;  3WXX A;  4I2W A;  3KS2 A;  4CGV A;  4APO A;  4Y6C A;  3TGO A;  2I6H A;  2GW1 A;  4ME2 A;  4U0U A;  5ARG A;  3RU0 A;  3Q49 B;  3TAX A;  4BT9 A;  5JJ7 A;  2PQR A;  5EX3 A;  4GZ6 A;  4YVQ C;  2QFC A;  3MV3 B;  3RO2 A;  3VTY A;  5EKQ D;  3AS8 A;  3JYS A;  4XIF A;  4UI9 K;  4HOT A;  3MEK A;  2UY1 B;  1XNF A;  4GYY A;  5D0O D;  1NA0 A;  2LSU A;  5KJM A;  4BTB A;  2C0M A;  3KD7 A;  2XCB A;  3SZ7 A;  2XCC A;  4AY6 A;  4F3V A;  3OXL A;  3GZ2 A;  1QZ2 A;  5D0Q D;  3PE3 A;  3FWV A;  5LCW C;  3LYA A;  4CGW A;  1HZ4 A;  1HXI A;  3QOU A;  4G26 A;  4AIF A;  3KAE A;  4UI9 C;  3PE4 A;  2J9Q A;  3ASF A;  4U0S A;  1P5Q A;  3FP3 A;  3QWV A;  3UUX A;  4BT8 A;  5A6C A;  4I17 A;  4GPK A;  2FEZ A;  1W3B A;  3RIB A;  3ASD A;  3U3W A;  3UPV A;  4O6F A;  5CHE E;  4RG6 A;  5AYW D;  5BW8 C;  3E4B A;  3CVL A;  2LNI A;  3ZPJ A;  2KCK A;  2XGS A;  5BNW A;  2E2E A;  4WUY A;  3FFL A;  5G04 J;  3N71 A;  4B94 A;  4I9C A;  1KT1 A;  4CDR A;  2AVP A;  4J0U A;  2C0L A;  3VTX A;  3RO3 A;  4BWR A;  5KJK A;  3ASH A;  3S7J A;  1A17 A;  3ULQ A;  2XEV A;  4GZ5 A;  1ZU2 A;  4JHR A;  2PZI A;  2HO1 A;  2UY1 A;  3K9I A;  3HYM B;  1WM5 A;  4G24 A;  3MKR A;  4HOQ A;  2HR2 A;  5G05 J;  4H7Y A;  3GZ1 A;  4N3C A;  3LY8 A;  4GYW A;  3IEG A;  4G25 A;  2HYZ A;  5FZR A;  3S7D A;  2PQN A;  4GA2 A;  4W9R A;  1ELR A;  4G1T A;  5FJY A;  4LEU A;  4GCO A;  1ZBP A;  4GA0 A;  3QWP A;  5CCM A;  2KAT A;  3Q4A B;  2WPV A;  2VSN A;  2MHK A;  2VGY A;  4GCN A;  3CVQ A;  3LCA A;  5M72 A;  3URZ A;  3LY7 A;  3MA5 A;  3TG4 A;  4WNF A;  3O48 A;  4AM9 A;  4NRH B;  4N3A A;  3Q5M A;  3QKY A;  2Y4T A;  2XGM A;  2IF4 A;  3NF1 A;  3CKB A;  3U4T A;  4YVO A;  4XI9 A;  2KCL A;  5BT1 A;  4N39 A;  4N2S A;  3ZHE B;  1HH8 A;  4KYO B;  3GYZ A;  2DBA A;  5EX0 A;  3CV0 A;  1QQE A;  3AS5 A;  4KXK B;  3CVN A;  1KLX A;  3ASG A;  5G04 C;  3CK8 A;  4JA9 A;  5DIZ A;  4EQF A;  3ESK A;  5FZS A;  2XPI A;  3BEE A;  5JJ6 A;  4RG9 A;  3ZGQ A;  3EDT B;  2LSV A;  3ZFW A;  4J8E A;  4N2Q A;  1TJC A; 
#chains in the Genus database with same CATH topology
 2R5S A;  4U7E B;  4HBD A;  4OVU A;  4J8F A;  1Z6T A;  3FUE A;  1IQU A;  1OCO E;  4CYM D;  5ENQ D;  1NI1 A;  1H6P A;  1JCS A;  3ZIM A;  2H6G A;  5G05 C;  3D3M A;  2XEH A;  3L9T A;  3CEQ A;  1NZN A;  3MGB A;  4JC8 A;  2EQX A;  1SA5 A;  1TNB A;  2IY0 C;  3MZL B;  1E96 B;  2XGO A;  3Q75 A;  1KT0 A;  5KJL A;  4HI9 A;  3DSS A;  3ML8 A;  2VYI A;  3L13 A;  4JXT A;  5HI7 A;  4ILG A;  5EID A;  2KCV A;  3Q15 A;  2GRM A;  3E37 A;  2ZIR A;  2X6I A;  3AG4 E;  3ASN E;  4O60 A;  3EUV A;  4BES A;  4X8Q A;  2QYU A;  2NC9 A;  2Y4U A;  1NA3 A;  2X6H A;  3TXM A;  1U3C A;  3DRA A;  2LUH A;  1N4R A;  3AG2 E;  3UM2 A;  5JHB A;  2PM7 A;  3JQ0 A;  4DUI A;  3TWV A;  2FO1 E;  5LCW J;  3L16 A;  4TV3 A;  5KBA A;  1E8W A;  3RSE G;  3KSQ A;  3AG3 E;  2VGX A;  2L9B A;  1KZO A;  4UI9 J;  3CKC A;  2BF0 X;  4HQD A;  3ZKJ A;  3FEY A;  3DXM G;  3SFZ A;  3AS4 A;  3MX3 A;  4N5C A;  1HG2 A;  1DC2 A;  2ETB A;  3T5X A;  3B7R L;  3RK6 A;  4U0Z A;  1TYQ G;  4HFG A;  4JZY A;  2FF4 A;  4I1A A;  4J8S A;  2V5F A;  2OCC E;  3ZVV A;  3BG0 B;  3TWU A;  2MOW A;  4NQ0 A;  1BPO A;  3QWW A;  4MKT A;  3C3Q A;  3CK9 A;  3ZN3 A;  3UQ3 A;  1SW6 A;  2MYO A;  3ONL A;  2KC7 A;  3LPZ A;  4B0Z A;  2R2L A;  3WXX A;  4I2W A;  3AJI A;  3KS2 A;  3IV0 A;  3LEW A;  4HLE A;  2I6H A;  4YDW A;  4LRZ A;  5KWD A;  1S70 B;  2GW1 A;  2XZT G;  5KNG A;  4V3I A;  2AWI A;  1OT8 A;  3BUA A;  4BT9 A;  4EBA A;  1H2V C;  2PQR A;  3CLJ A;  4YVQ C;  2QFC A;  1HG5 A;  3FTX A;  4U8H A;  4BER A;  4ZFH A;  1K1B A;  1JWG A;  3G2W A;  3UKR G;  1QNF A;  3VTY A;  5EKQ D;  3QB2 A;  2P2C P;  4LNU D;  4UI9 K;  4OVV A;  3MEK A;  4GYY A;  3CGH A;  1E90 A;  1MJ0 A;  2OV8 A;  5D0O D;  5BV1 A;  4XKB A;  2LSU A;  4MLP A;  3C5R A;  2RFA A;  1DCE A;  1IKN D;  2XQ0 A;  4BTB A;  2C0M A;  1K1A A;  4HRN A;  2LO6 A;  2DVW A;  4ILI A;  2J49 A;  2XCB A;  4AY6 A;  3OXL A;  5ENO D;  5CEA A;  2EIJ E;  2ZGD A;  4EBA G;  5EIB E;  2L0I A;  1DVP A;  3KAE A;  4PH4 B;  2J9Q A;  1D8E A;  3G2V A;  4AVX A;  3EHN A;  3FP3 A;  3LJ3 A;  2GRP B;  4WWO A;  3V31 A;  4GPK A;  4HRL A;  4BSX A;  1FPP A;  2GRQ B;  3ASD A;  2H6I A;  2CFZ A;  5B1A E;  2LNI A;  2OEV A;  2DCP A;  3KEA A;  3D9P A;  4EPZ A;  2VSO E;  4WUY A;  3FFL A;  3EIJ A;  4I9C A;  3SO8 A;  4O1P A;  1MYO A;  4J0U A;  2C0L A;  2DWZ A;  2M63 A;  4Q96 A;  1A17 A;  2XEV A;  3JQ1 A;  2IU1 A;  3IHV A;  4RSY A;  1FVH A;  2HO1 A;  2X6F A;  3TWT A;  3SFY A;  2J4B A;  2NXP A;  3OAW A;  4G24 A;  3ZYM A;  3DEP A;  2P9P G;  4DX7 D;  4URK A;  2XPZ A;  3L82 A;  3DXK G;  3LY8 A;  4GYW A;  3TWX A;  3IBE A;  1WDY A;  2R03 A;  4G25 A;  2XRZ A;  4QQI A;  5ENN A;  1OWN A;  1TEZ A;  3L54 A;  4ATG A;  2IOL A;  1SZ9 A;  5FJY A;  3TWW A;  1ZBP A;  2Y69 E;  4IYP A;  5CCM A;  3BG1 B;  3FY4 A;  3I5P A;  3NZU A;  4GML A;  3L22 A;  2Y0B G;  2LAI A;  4FHJ A;  2WPV A;  3FUJ A;  2BED A;  3CHM A;  4A3T A;  1BD8 A;  5M72 A;  1LD8 A;  3LY7 A;  4DX6 D;  4LUN U;  4AM9 A;  4DRX E;  3KSL A;  3HXC A;  3FTV A;  2XGM A;  3NF1 A;  2YNQ A;  3CKB A;  5JA4 D;  4YVO A;  4K0R A;  3DST A;  5BT1 A;  3L17 A;  5AJD A;  1KZP A;  1HH8 A;  3GYZ A;  4RLY A;  3HVE B;  3G2U A;  1QQE A;  2V4L A;  1Y6I A;  3UM0 A;  2J07 A;  4ACK A;  5G04 C;  2EIL E;  4RVB A;  3CIA A;  3ZEF A;  1ZB1 A;  5E76 A;  1Z3X A;  4RG9 A;  3E32 A;  4J8E A;  2GRO B;  3FH8 A;  2A5E A;  2CHW A;  2RD0 A;  3TG5 A;  3LY9 A;  4TUM A;  4JVS A;  5FQ7 A;  3APF A;  4AP2 A;  2WVI A;  3PZ2 A;  1IHB A;  4CDN A;  3OTN A;  3FUK A;  3HXF A;  4F7A A;  3BQO A;  2XRY A;  3APD A;  3Q9N C;  3I4R B;  2V8S E;  4LG6 A;  1YA0 A;  3TJP A;  4G2V A;  1YMP A;  2B0O E;  2WXJ A;  3FUF A;  3SY2 A;  4MRU A;  3I3N A;  2I2O A;  2I9C A;  2WQ7 A;  4I1M A;  1QYM A;  4DJA A;  3D9M A;  2BUG A;  5CRU A;  3T5V A;  4UWG A;  4JHJ A;  5AQA A;  5DBK A;  3SBT B;  2C2L A;  1WAO 1;  3NOG D;  3ZYK A;  3RAU A;  2LAH A;  5JMN D;  1HX8 A;  1BU9 A;  2FO7 A;  4KZ0 A;  3UIP C;  3UIO C;  1L5J A;  4GZD A;  2P9L G;  4YDE A;  2UWJ G;  3FDH A;  1IQR A;  4WAF A;  4CDM A;  2X6K A;  3SF4 A;  4BTA A;  2XS1 A;  4GTS A;  1RW2 A;  1U2V G;  4ABN A;  3UKU G;  3HIZ A;  1OUV A;  3MJW A;  2KM4 A;  4K03 A;  3S7F A;  2GRR B;  2MRI A;  1JWF A;  3QDN A;  4U04 A;  1UJK A;  4PS7 A;  5B1B E;  1N52 A;  1TN8 A;  3ZNG A;  1IHG A;  3CVP A;  4MS6 A;  3R7Q A;  5AJL A;  2YHE A;  5B3S E;  3HRA A;  5BPP A;  3UT7 A;  2DYS E;  3S7B A;  3SI5 A;  1EF1 C;  3CVV A;  4XKC A;  3U9W A;  3EIQ C;  3JXI A;  5LX8 A;  3MV2 B;  3EHM A;  4UWL A;  2OND A;  5T3R A;  2NSZ A;  1AP7 A;  3ML9 A;  1QBQ A;  1N4Q A;  2GRN B;  2XHE A;  1N94 A;  1IYG A;  4Z68 A;  1V55 E;  5EDS A;  3CVU A;  5FWQ A;  1LF8 A;  4CGV A;  5CER B;  4YDO A;  4PS8 A;  3TGO A;  4UWK A;  2NYJ A;  2ZXW E;  2QYJ A;  5ARG A;  3JUI A;  3RU0 A;  4I1O B;  1BLX B;  3TAX A;  2KBX A;  3U64 A;  4F53 A;  1DCQ A;  2ZU6 B;  1N0Q A;  4GZ6 A;  2ZIS A;  4PDX A;  3IHY A;  4U96 D;  3J5Q B;  1LTX A;  4CRW A;  1SQM A;  3JYS A;  4PUC A;  2J08 A;  5LOZ A;  1EPU A;  1S0P A;  3T8M A;  3SQV A;  1JCR A;  2GGF A;  2EIK E;  3KD7 A;  3SZ7 A;  4F3V A;  2IEJ A;  3O4Z A;  4EZL A;  3QC1 A;  5D0Q D;  3FWV A;  3UI2 A;  3QAQ A;  5BV0 A;  5LCW C;  4JB8 P;  3FTU A;  5G2N A;  4CGW A;  3FTZ A;  2V5Q C;  3ZXP A;  1HZ4 A;  1HXI A;  4RQI A;  3APC A;  4GU5 A;  4UI9 C;  3X2Q E;  3ASF A;  4U0S A;  3JUE A;  1OWO A;  4ZHB A;  1LD7 A;  2VGE A;  2FUL A;  1K3Z D;  1HS6 A;  3U3W A;  4CT4 A;  1UOH A;  4HLL A;  5CHE E;  5AYW D;  5AEN A;  3DPD A;  3HXD A;  5BNW A;  2BTD A;  5ITZ F;  1U3D A;  3ZXS A;  1KT1 A;  4GTQ A;  3FEX A;  4AXH A;  2IJG X;  3ASO E;  1A5E A;  3NB2 A;  3ZU7 B;  4BWR A;  4KMO A;  1N11 A;  4GZ5 A;  4JPS A;  3DSW A;  2I1J A;  4JHR A;  5A23 A;  2WMN A;  1PY1 A;  3G2S A;  3K9I A;  2OVF A;  4I6J A;  3HYM B;  3FUM A;  1WM5 A;  3FUH A;  4HOQ A;  2QY7 A;  4CCA A;  3PS6 A;  4ILH B;  4GMR A;  4N3C A;  2R17 C;  1O1R A;  5E75 A;  4F6R D;  5ENP D;  3S7D A;  4ATZ D;  1NL4 A;  4K5A B;  2PQN A;  4W9R A;  3B7B A;  4EEC A;  3D9L A;  4G1T A;  5AAR A;  3Q7F A;  1GW6 A;  3CHP A;  4GA0 A;  4F1S A;  1TN6 A;  2WXL A;  3DPY A;  2WXH A;  3FH7 A;  3LCA A;  3W9G A;  3EHR A;  2XS8 A;  1O1T A;  3MA5 A;  1FT2 A;  3TWQ A;  4I6E A;  3UM3 A;  4LER A;  2Y4T A;  2IF4 A;  1HO8 A;  3U4T A;  4FAD A;  5LP0 A;  1HFA A;  2KCL A;  3PZ1 A;  4N39 A;  3ABL E;  3ZHE B;  2DBA A;  3PVL A;  2ETC A;  3FUD A;  1N4P A;  1NFI E;  2BKG A;  4KXK B;  3CVN A;  3NAW A;  1YCS B;  4GTM A;  1V54 E;  4JA9 A;  4A1G A;  2AXZ A;  2XPI A;  3ZGQ A;  3EDT B;  5HRY A;  5T8I A;  4R7L A;  3HXB A;  4I6G A;  4L9P A;  1OCR E;  4LNB A;  4U07 A;  3CK7 A;  4JA7 A;  3CHQ A;  3R7R A;  1TJF A;  1TNO A;  3CQC B;  4A1S A;  1H2T C;  3UIN C;  2PNN A;  4CZ2 D;  4HNA D;  3ZRH A;  4QFV A;  5CEC B;  4FC8 A;  3C3O A;  3PNT B;  3FUL A;  5AQB A;  3FH5 A;  4GA1 A;  4APF A;  2VJ8 A;  4C0E A;  4DK5 A;  5AIJ A;  1Q2Z A;  5C1D A;  5FTP A;  4Q69 A;  2KZT B;  3B13 A;  2IQC A;  4XI0 A;  4FJZ A;  2ETA A;  5ENT D;  4L7T A;  5FT9 A;  3PEV B;  5JHA A;  3C3R A;  3OXF A;  2F8Y A;  2VSX E;  4XE0 A;  2F37 A;  4KBQ A;  4E85 A;  3EJN A;  3HVE A;  1FCH A;  4H7X A;  2IO3 C;  2EIN E;  3RJV A;  4OAV B;  5IY5 E;  1SVX A;  3NOC D;  1EDU A;  3D9H A;  4WND A;  1UN8 A;  5CCL A;  1D9S A;  4HB5 A;  3SBS A;  3FU0 A;  2Q7F A;  5C2Y A;  3NQP A;  3PRE A;  4UWH A;  4BFR A;  3PNL B;  2I1K A;  3RRN B;  4B89 A;  4N3B A;  4GB9 A;  3MKQ B;  2VTB B;  3SD5 A;  3GW4 A;  4UQY A;  3V2O A;  3G2T A;  4DPR A;  4FLH A;  3ZUV B;  4WWN A;  2WXK A;  1MQS A;  4WNG A;  3Q47 B;  4I2Z A;  2YQ8 A;  5G55 A;  4DX5 D;  4C0M A;  4ANW A;  1UG3 A;  4WNE A;  2OVB A;  2X6J A;  4AOF A;  2DZN A;  4L2L A;  4HOU A;  1N0R A;  3OXG A;  1G3N B;  5EYP F;  4JL0 A;  2GRL A;  3R9A B;  1ELW A;  4JEU A;  2F0Y A;  4GZ3 A;  1HF8 A;  3Q78 A;  2L0T B;  4Y6C A;  5FQ6 A;  3PRZ A;  3VLE A;  4DX2 A;  2R05 A;  4U0U A;  3HDX A;  3Q49 B;  3T8K A;  1N4S A;  4FP7 A;  3FU3 A;  1Z3Y A;  4L2Y A;  2Y1L E;  2A4Z A;  4XIF A;  4GTR A;  4HOT A;  1BI8 B;  2UY1 B;  1NA0 A;  3D9J A;  2WXM A;  4GZC A;  4FU3 A;  3DWL G;  3W9F A;  3VLD A;  1JCQ A;  3F6Q A;  4OYS A;  1IXV A;  3QJZ A;  3Q79 A;  2WXF A;  3PUK A;  1QZ2 A;  2AXU A;  3PE3 A;  1SZA A;  3ABK E;  5EYL A;  4M3O A;  1AWC B;  3P1U A;  3QOU A;  1OY3 D;  4G26 A;  1OWP A;  3P2B A;  4O1O A;  3Q73 A;  4K5C A;  1BI7 B;  4AIF A;  4G8K A;  3PZ4 A;  3PE4 A;  2WMO A;  5ANR A;  3TL5 A;  1O5M A;  1NP7 A;  5CBN A;  5H7P A;  5AAO A;  1E8X A;  1P5Q A;  3HXE A;  3QWV A;  4U63 A;  3EU9 A;  4BT8 A;  5A6C A;  2JEK A;  4F1P A;  3PZ3 A;  2A5U A;  2JAB A;  3UM1 A;  4RG6 A;  1S64 A;  4DI3 A;  5T4Y A;  5BW8 C;  3SFX A;  3ZYQ A;  3CVL A;  4HI8 A;  2KCK A;  3QNK A;  2QC9 A;  2E2E A;  4XEI G;  1ELK A;  1KPS B;  4GPM A;  3N71 A;  3AU4 A;  4CDR A;  4GAA A;  4HXI A;  3CR3 A;  5BXU A;  5J90 A;  3C72 A;  4C9B B;  4IUL A;  1PAQ A;  5KJK A;  3ASH A;  3D9K A;  4TXQ A;  3ULQ A;  1ZU2 A;  2L6B A;  2PZI A;  4JEH A;  4G8L A;  3ZW3 A;  4TXP A;  2P9K G;  3ISM C;  3PZD A;  4BX8 A;  5G05 J;  4FLB A;  3FTS A;  3ULE G;  1FT1 A;  3EU5 A;  4FA6 A;  4AEZ C;  4B8A A;  3IEG A;  2P9S G;  3LXU X;  2HYZ A;  2WXP A;  2XPY A;  4J8Y A;  3UMV A;  3E33 A;  3LS8 A;  4GA2 A;  3NBN B;  2P9N G;  1ELR A;  3DSX A;  3Q9U C;  3DSU A;  3ABM E;  5CRV A;  3QAR A;  5HS0 A;  3FU6 A;  4PS3 A;  3TWR A;  2E0I A;  1N54 A;  1HU3 A;  2VSN A;  2VGY A;  4U8Y D;  3V79 K;  2B6C A;  4GCN A;  2AXV A;  3UTM A;  4HS2 A;  2AW6 A;  3AU5 A;  3CQG B;  4I43 A;  4HVB A;  4M7C A;  3PH0 C;  4K5B A;  1X5B A;  3QK0 A;  1N9A A;  4NRH B;  4N3A A;  4YDY A;  3Q5M A;  2R02 A;  3QKY A;  4N5Q A;  4XI9 A;  3LVQ E;  5J08 A;  4N2S A;  4EZJ A;  1D8D A;  2H6H A;  3SNX A;  3CV0 A;  3SGH A;  5D2M C;  3CVW A;  2DYR E;  5CMY A;  3AS5 A;  4LSZ E;  5CMW A;  4GTV A;  4AJW A;  1JUQ A;  2WXR A;  4ANU A;  3BEE A;  3JCK C;  5EIL A;  2LSV A;  2WQ6 A;  3TXN A;  2X3M A;  3ZFW A;  3UXG A;  4CEM A;  2HE0 A;  4N2Q A;  1MHQ A;  2VGX B;  3DBS A;  1PC2 A;  4HOS A;  3GZS A;  4GTT A;  5BUZ A;  4UQZ A;  2VQ2 A;  3S2A A;  4XX5 A;  2P58 C;  4GYO A;  2WB2 A;  4XZ4 A;  4EZK A;  2VSY A;  2Y3A A;  2OOE A;  5JJT A;  1MZC A;  1UW4 B;  3FUN A;  2LXL A;  2RG8 A;  2IO2 C;  3RKV A;  2CHZ A;  1N95 A;  1H0A A;  4AV7 A;  4IN3 B;  4NUR A;  3SHF A;  1JPL A;  2P9I G;  4TUU A;  3IXE A;  4BY6 A;  2WQH A;  3V30 A;  3R9M A;  2XEN A;  1K8K G;  2DZO A;  4DX1 A;  2L6J A;  5ARF A;  4L23 A;  2P9U G;  3LJN A;  5CED B;  1Y8M A;  2HM8 A;  2ZGG A;  1E8Y A;  5HQ8 A;  3ZHE A;  2WXG A;  4JD2 G;  2YHC A;  3D9O A;  4D10 C;  3AG1 E;  5ANL A;  3LKU A;  4KVO A;  4P29 A;  3MCX A;  3E34 A;  2J8S D;  1OCZ E;  2WXN A;  2V0P A;  4B93 B;  3RRU A;  4L1B A;  2PL2 A;  4OAU C;  4G23 A;  4ANX A;  3CST A;  1HE8 A;  5A7D B;  5FZQ A;  1TNZ A;  3FHE A;  3L6A A;  4HOR A;  3PEU B;  1TR4 A;  4NAC A;  4UWF A;  2IFU A;  3CVX A;  2EIM E;  4A63 B;  2FI7 A;  4JHK A;  2CHX A;  5HKP A;  3B7S A;  4Y6W A;  2WXQ A;  4J8D A;  2FBN A;  1OXJ A;  3DSV A;  4DI4 A;  3Q7A A;  3PDN A;  4AY5 A;  2WXI A;  2H6F A;  4WWP A;  2KZT A;  4BET A;  1OCC E;  1B89 A;  4UUC A;  5LFA A;  4FHK A;  4KT6 B;  2XEE A;  4GTO A;  4UQX A;  1E7V A;  2JLB A;  4I9E A;  4YND A;  5KJN A;  1XGW A;  1H19 A;  4MBG A;  3NZS A;  4APO A;  1MX4 A;  3EHQ A;  1RZ4 A;  3L08 A;  4EHM A;  4ME2 A;  3KEZ A;  3JXJ A;  2AJA A;  1H6K A;  5JJ7 A;  4ACL A;  3B95 A;  1TNY A;  5EX3 A;  5AQ9 A;  5FQ4 A;  5KCM A;  1E7U A;  3MV3 B;  3RO2 A;  1E8Z A;  1YYH A;  3AS8 A;  2YIN A;  5AN8 A;  5CBO A;  4A3V A;  4G11 A;  1WY6 A;  1XNF A;  3ZYL A;  2PM6 A;  5KJM A;  1TN7 A;  2IOS A;  3WG7 E;  3FUI A;  3MKQ A;  2XCC A;  4BSZ B;  2VTB A;  4LNG A;  3GZ2 A;  3D9N A;  3UX4 A;  3LYA A;  2CFU A;  4J6I A;  1X81 A;  2XZD G;  2WXO A;  3CVY A;  3HHM A;  4KVM A;  3UT8 A;  1WG0 A;  3ULY A;  4FJY A;  3UUX A;  2CG3 A;  4I17 A;  2FEZ A;  3TWS A;  1W3B A;  3B7U X;  3RIB A;  2J4D A;  4BX9 A;  3UPV A;  2CG2 A;  4O6F A;  4HRM B;  3FTY A;  4BEP A;  3E4B A;  5ENS D;  1VDY A;  4TRQ A;  3ZPJ A;  2XGS A;  5G04 J;  3LDZ A;  4B94 A;  3D9I A;  4FUL A;  4GTP A;  2AVP A;  2QZA A;  2J09 A;  3UT4 A;  3VTX A;  1INZ A;  3RO3 A;  3S7J A;  4KZC A;  4CT0 A;  1S63 A;  5KNH D;  2UY1 A;  1H6O A;  2R59 A;  3U66 A;  4IRU A;  3MKR A;  4Q94 A;  4A55 A;  2HR2 A;  3FU5 A;  3MYV A;  4C48 B;  4H7Y A;  3GZ1 A;  3VLF A;  4JW1 A;  3LVR E;  5D66 A;  4J7W A;  3CHO A;  1H2U A;  4DLO A;  2F8X K;  2V4H C;  5FZR A;  1MX2 A;  5ENR D;  1OWL A;  1UN9 A;  5FQ8 A;  5AQ7 A;  3CHR A;  4LEU A;  1Z5S C;  2RFM A;  4GCO A;  3BU8 A;  1MX6 A;  3QWP A;  3CHS A;  2X38 A;  3DEO A;  2KAT A;  3T9K A;  1OWM A;  2ION A;  3Q4A B;  4DLQ A;  4GMJ A;  3C98 A;  1SA4 A;  2MHK A;  3CVQ A;  3URZ A;  4TXR A;  4U8V D;  5BXO A;  4NIK A;  3TG4 A;  4WNF A;  3O48 A;  3E30 A;  3HG0 D;  4E6H A;  3V2X A;  2BKK B;  3IKO B;  2DIW A;  3ESL A;  1TNU A;  2LXM A;  1UJJ A;  4KYO B;  1EYH A;  5EX0 A;  3CSF A;  3J5P A;  3RRM B;  3I4G A;  2KXP C;  1DNP A;  4U95 D;  4LCT A;  4ANV A;  1KLX A;  3ASG A;  3CK8 A;  3B7T A;  5DIZ A;  5EN5 D;  4EQF A;  3ESK A;  5FZS A;  5FIO A;  5JJ6 A;  3AAA C;  2OEW A;  1FVF A;  3ONK A;  3ENE A;  2WM9 A;  1O1S A;  3PUJ A;  2RKK A;  3FTW A;  1TJC A;  2ILR A;  5FIN A;  4B8C B; 
#chains in the Genus database with same CATH homology
 2R5S A;  2RD0 A;  4U07 A;  3TG5 A;  1MHQ A;  2VGX B;  3DBS A;  3LY9 A;  3CK7 A;  1PC2 A;  4JA7 A;  4OVU A;  4HOS A;  4JVS A;  3CHQ A;  3GZS A;  5FQ7 A;  4UQZ A;  2VQ2 A;  3R7R A;  3APF A;  3S2A A;  5BUZ A;  1TJF A;  4XX5 A;  4AP2 A;  3CQC B;  4J8F A;  1Z6T A;  2P58 C;  3FUE A;  1IQU A;  4GYO A;  2WVI A;  4A1S A;  2WB2 A;  1H2T C;  4XZ4 A;  4EZK A;  4CDN A;  2VSY A;  2Y3A A;  3ZIM A;  2OOE A;  3FUK A;  3OTN A;  5JJT A;  5G05 C;  3D3M A;  4F7A A;  1UW4 B;  3ZRH A;  3FUN A;  4QFV A;  3CEQ A;  2RG8 A;  3RKV A;  4FC8 A;  1NZN A;  2XRY A;  3APD A;  2CHZ A;  3MGB A;  3PNT B;  4JC8 A;  3FUL A;  1H0A A;  2EQX A;  4AV7 A;  3FH5 A;  2V8S E;  3I4R B;  4GA1 A;  4APF A;  4IN3 B;  3MZL B;  4NUR A;  1YA0 A;  3SHF A;  3TJP A;  1JPL A;  1E96 B;  2VJ8 A;  4G2V A;  2WXJ A;  4TUU A;  3FUF A;  4C0E A;  4DK5 A;  5AIJ A;  2XGO A;  1KT0 A;  4BY6 A;  4MRU A;  3I3N A;  5KJL A;  2I2O A;  5C1D A;  2WQH A;  5FTP A;  4Q69 A;  2I9C A;  2KZT B;  3B13 A;  2WQ7 A;  4I1M A;  3ML8 A;  4DJA A;  2IQC A;  3D9M A;  2VYI A;  2BUG A;  3L13 A;  4XI0 A;  4JXT A;  5HI7 A;  4ILG A;  3T5V A;  2KCV A;  3Q15 A;  4FJZ A;  4UWG A;  4JHJ A;  2GRM A;  2L6J A;  5ARF A;  2X6I A;  4L7T A;  4L23 A;  5FT9 A;  5DBK A;  3PEV B;  5JHA A;  3SBT B;  1Y8M A;  2C2L A;  2HM8 A;  1WAO 1;  3ZYK A;  3OXF A;  2LAH A;  2VSX E;  1E8Y A;  4XE0 A;  5HQ8 A;  1HX8 A;  2WXG A;  3ZHE A;  4KBQ A;  4E85 A;  3EJN A;  2FO7 A;  2YHC A;  3D9O A;  3HVE A;  4KZ0 A;  4D10 C;  1FCH A;  5ANL A;  3LKU A;  4H7X A;  1L5J A;  4GZD A;  4KVO A;  4P29 A;  3RJV A;  2NC9 A;  3MCX A;  2Y4U A;  2UWJ G;  3FDH A;  1NA3 A;  1IQR A;  2X6H A;  4WAF A;  2WXN A;  2X6K A;  3TXM A;  2V0P A;  4CDM A;  3SF4 A;  1U3C A;  4BTA A;  1EDU A;  4WND A;  1UN8 A;  3RRU A;  4L1B A;  4ABN A;  5CCL A;  5JHB A;  2PL2 A;  2PM7 A;  3SBS A;  3JQ0 A;  3FU0 A;  4G23 A;  4ANX A;  3CST A;  1HE8 A;  3HIZ A;  5A7D B;  5LCW J;  1OUV A;  2Q7F A;  5FZQ A;  3FHE A;  3MJW A;  2KM4 A;  5C2Y A;  4K03 A;  3L16 A;  4TV3 A;  3S7F A;  3L6A A;  1E8W A;  2MRI A;  1JWF A;  3NQP A;  4HOR A;  3PEU B;  3PRE A;  3QDN A;  4U04 A;  4UWH A;  1UJK A;  4BFR A;  2VGX A;  4PS7 A;  2L9B A;  4NAC A;  1N52 A;  4UI9 J;  3CKC A;  2BF0 X;  1IHG A;  3PNL B;  4UWF A;  2IFU A;  2I1K A;  3FEY A;  3RRN B;  4B89 A;  3SFZ A;  3CVX A;  3AS4 A;  4N3B A;  3MX3 A;  4GB9 A;  3MKQ B;  2FI7 A;  4JHK A;  4N5C A;  3CVP A;  2CHX A;  1HG2 A;  2VTB B;  3SD5 A;  4MS6 A;  3B7R L;  3B7S A;  3T5X A;  3GW4 A;  3R7Q A;  4UQY A;  5AJL A;  3RK6 A;  4Y6W A;  3G2T A;  4DPR A;  4FLH A;  2WXQ A;  4J8D A;  2FBN A;  2YHE A;  4U0Z A;  4WWN A;  2WXK A;  1MQS A;  4DI4 A;  4HFG A;  4WNG A;  3Q47 B;  4I2Z A;  2YQ8 A;  4JZY A;  5BPP A;  5G55 A;  3UT7 A;  2FF4 A;  4I1A A;  4J8S A;  2V5F A;  3PDN A;  4ANW A;  4C0M A;  1UG3 A;  3ZVV A;  4WNE A;  2OVB A;  3S7B A;  3SI5 A;  2X6J A;  1EF1 C;  4AOF A;  4L2L A;  4AY5 A;  2WXI A;  4WWP A;  3BG0 B;  4XKC A;  3CVV A;  3U9W A;  2KZT A;  4HOU A;  3EIQ C;  2MOW A;  4NQ0 A;  1BPO A;  3QWW A;  4MKT A;  5LX8 A;  3MV2 B;  1B89 A;  3OXG A;  3EHM A;  4UWL A;  2OND A;  3CK9 A;  4FHK A;  3ZN3 A;  4JL0 A;  4KT6 B;  3UQ3 A;  5LFA A;  2GRL A;  5T3R A;  3R9A B;  1ELW A;  4UQX A;  2NSZ A;  1E7V A;  2JLB A;  3ONL A;  2KC7 A;  3LPZ A;  4JEU A;  4B0Z A;  4I9E A;  4YND A;  5KJN A;  1XGW A;  3ML9 A;  4GZ3 A;  1H19 A;  2XHE A;  1IYG A;  3WXX A;  1HF8 A;  4I2W A;  5EDS A;  3NZS A;  3CVU A;  3KS2 A;  2L0T B;  3IV0 A;  3LEW A;  5FWQ A;  1LF8 A;  4CGV A;  4HLE A;  4APO A;  4Y6C A;  4PS8 A;  3TGO A;  5FQ6 A;  2I6H A;  3PRZ A;  4UWK A;  3VLE A;  4LRZ A;  2GW1 A;  3L08 A;  4ME2 A;  4U0U A;  3KEZ A;  5ARG A;  3HDX A;  3JUI A;  3RU0 A;  4V3I A;  2AWI A;  4I1O B;  3Q49 B;  3TAX A;  4BT9 A;  4EBA A;  1H6K A;  5JJ7 A;  4ACL A;  3U64 A;  1H2V C;  2PQR A;  4F53 A;  2ZU6 B;  5EX3 A;  3CLJ A;  4GZ6 A;  4YVQ C;  2QFC A;  1HG5 A;  3FTX A;  4PDX A;  4FP7 A;  4U8H A;  3FU3 A;  1E7U A;  3IHY A;  3MV3 B;  1JWG A;  5FQ4 A;  5KCM A;  3RO2 A;  1Z3Y A;  1E8Z A;  3G2W A;  4L2Y A;  1QNF A;  3VTY A;  5EKQ D;  2A4Z A;  3AS8 A;  4CRW A;  1SQM A;  3QB2 A;  2YIN A;  3JYS A;  4PUC A;  4XIF A;  4UI9 K;  4A3V A;  4OVV A;  4HOT A;  3MEK A;  4G11 A;  2UY1 B;  1WY6 A;  1XNF A;  2J08 A;  3CGH A;  4GYY A;  5LOZ A;  1E90 A;  2OV8 A;  5D0O D;  1NA0 A;  3D9J A;  1EPU A;  5BV1 A;  4XKB A;  3ZYL A;  2LSU A;  2WXM A;  4GZC A;  4FU3 A;  1S0P A;  4MLP A;  2PM6 A;  5KJM A;  3T8M A;  2XQ0 A;  3VLD A;  4BTB A;  2GGF A;  2C0M A;  4OYS A;  2LO6 A;  4ILI A;  2IOS A;  2J49 A;  3FUI A;  3MKQ A;  3KD7 A;  2XCB A;  3SZ7 A;  3QJZ A;  2XCC A;  4AY6 A;  4F3V A;  2VTB A;  2WXF A;  3OXL A;  3PUK A;  3O4Z A;  4EZL A;  3GZ2 A;  1QZ2 A;  3QC1 A;  2AXU A;  3PE3 A;  3FWV A;  5D0Q D;  3D9N A;  3QAQ A;  1SZA A;  3UX4 A;  5BV0 A;  5LCW C;  3FTU A;  4M3O A;  5G2N A;  4EBA G;  3LYA A;  4CGW A;  3FTZ A;  1HZ4 A;  2CFU A;  3P1U A;  1HXI A;  3QOU A;  4G26 A;  1OWP A;  3P2B A;  2L0I A;  4J6I A;  3APC A;  1DVP A;  3KAE A;  4GU5 A;  4UI9 C;  4AIF A;  2WXO A;  4PH4 B;  3PE4 A;  2WMO A;  5ANR A;  2J9Q A;  3ASF A;  3TL5 A;  3CVY A;  4U0S A;  1NP7 A;  3HHM A;  3G2V A;  4KVM A;  1OWO A;  3UT8 A;  4AVX A;  1E8X A;  1P5Q A;  2FUL A;  3EHN A;  3FP3 A;  3QWV A;  4U63 A;  4FJY A;  3LJ3 A;  3UUX A;  4WWO A;  4BT8 A;  2CG3 A;  5A6C A;  4I17 A;  2JEK A;  2FEZ A;  4GPK A;  1W3B A;  4BSX A;  3B7U X;  3RIB A;  1HS6 A;  3ASD A;  2A5U A;  2J4D A;  4BX9 A;  4CT4 A;  3U3W A;  2CFZ A;  3UPV A;  2CG2 A;  4O6F A;  5CHE E;  4RG6 A;  4DI3 A;  5T4Y A;  5AYW D;  5BW8 C;  3FTY A;  5AEN A;  3E4B A;  3CVL A;  1VDY A;  4TRQ A;  2LNI A;  3ZYQ A;  3ZPJ A;  2DCP A;  2KCK A;  2XGS A;  3DPD A;  3QNK A;  5BNW A;  2BTD A;  3D9P A;  1U3D A;  2E2E A;  4EPZ A;  2VSO E;  4WUY A;  1ELK A;  3FFL A;  5G04 J;  3LDZ A;  3EIJ A;  3N71 A;  3AU4 A;  4I9C A;  3ZXS A;  4B94 A;  3D9I A;  1KT1 A;  4FUL A;  4CDR A;  3FEX A;  4AXH A;  4GAA A;  4HXI A;  2IJG X;  2AVP A;  3CR3 A;  5J90 A;  2J09 A;  3UT4 A;  4J0U A;  2C0L A;  4C9B B;  4IUL A;  3VTX A;  1INZ A;  3RO3 A;  1PAQ A;  2M63 A;  4Q96 A;  4BWR A;  5KJK A;  3ASH A;  3D9K A;  3S7J A;  4KMO A;  1A17 A;  4KZC A;  3ULQ A;  2XEV A;  3JQ1 A;  1ZU2 A;  2IU1 A;  3IHV A;  4GZ5 A;  4JPS A;  2I1J A;  4JHR A;  5A23 A;  4RSY A;  2PZI A;  1FVH A;  2WMN A;  4JEH A;  2HO1 A;  1PY1 A;  3ZW3 A;  4CT0 A;  2X6F A;  3G2S A;  2UY1 A;  3K9I A;  2OVF A;  4I6J A;  2J4B A;  3HYM B;  3FUM A;  2R59 A;  2NXP A;  3U66 A;  1WM5 A;  3FUH A;  3OAW A;  4IRU A;  4G24 A;  3ZYM A;  3PZD A;  3MKR A;  4Q94 A;  4A55 A;  4HOQ A;  4BX8 A;  2QY7 A;  2HR2 A;  3FU5 A;  3MYV A;  4CCA A;  4URK A;  3PS6 A;  5G05 J;  4H7Y A;  4FLB A;  3GZ1 A;  4ILH B;  3VLF A;  2XPZ A;  3FTS A;  4N3C A;  2R17 C;  4JW1 A;  3LVR E;  5E75 A;  4FA6 A;  3LY8 A;  4GYW A;  3CHO A;  3IBE A;  4AEZ C;  1H2U A;  4B8A A;  3IEG A;  4G25 A;  3LXU X;  4DLO A;  2XRZ A;  2HYZ A;  2WXP A;  5FZR A;  2XPY A;  5ENN A;  3UMV A;  3S7D A;  1OWN A;  3LS8 A;  2PQN A;  4GA2 A;  4W9R A;  1OWL A;  1UN9 A;  1TEZ A;  4EEC A;  3L54 A;  4ATG A;  1ELR A;  3D9L A;  5FQ8 A;  4G1T A;  3CHR A;  2IOL A;  1SZ9 A;  5FJY A;  4LEU A;  1GW6 A;  4GCO A;  3QAR A;  1ZBP A;  3CHP A;  4GA0 A;  3QWP A;  4IYP A;  5CCM A;  3FU6 A;  4PS3 A;  3CHS A;  3BG1 B;  2X38 A;  2KAT A;  3FY4 A;  3I5P A;  3NZU A;  4F1S A;  4GML A;  2E0I A;  3L22 A;  1N54 A;  1OWM A;  2ION A;  2LAI A;  2WXL A;  3Q4A B;  4DLQ A;  4GMJ A;  1HU3 A;  2WPV A;  2VSN A;  2WXH A;  3C98 A;  3FH7 A;  2MHK A;  2VGY A;  4FHJ A;  4GCN A;  2AXV A;  3CVQ A;  3FUJ A;  3LCA A;  4HS2 A;  3CHM A;  2AW6 A;  4A3T A;  5M72 A;  3AU5 A;  3CQG B;  4I43 A;  4HVB A;  3URZ A;  3PH0 C;  3LY7 A;  3MA5 A;  4LUN U;  3TG4 A;  4WNF A;  1X5B A;  3QK0 A;  3O48 A;  4I6E A;  4E6H A;  4AM9 A;  4NRH B;  4N3A A;  3Q5M A;  3FTV A;  4LER A;  3QKY A;  2Y4T A;  2XGM A;  2IF4 A;  2YNQ A;  1HO8 A;  3NF1 A;  3CKB A;  3IKO B;  3U4T A;  4FAD A;  2DIW A;  4YVO A;  4XI9 A;  3LVQ E;  4K0R A;  5J08 A;  5LP0 A;  1HFA A;  2KCL A;  5BT1 A;  4N39 A;  3L17 A;  5AJD A;  3ESL A;  4N2S A;  1UJJ A;  3ZHE B;  1HH8 A;  4KYO B;  4EZJ A;  3GYZ A;  2DBA A;  1EYH A;  3HVE B;  5EX0 A;  3CSF A;  3G2U A;  3RRM B;  3PVL A;  3SNX A;  3CV0 A;  3SGH A;  3CVW A;  1QQE A;  2V4L A;  3I4G A;  1DNP A;  3FUD A;  1Y6I A;  4LCT A;  2J07 A;  4ANV A;  5CMY A;  3AS5 A;  4KXK B;  3CVN A;  1KLX A;  4ACK A;  3ASG A;  5G04 C;  5CMW A;  3CK8 A;  4RVB A;  3B7T A;  4AJW A;  1JUQ A;  2WXR A;  3CIA A;  3ZEF A;  4ANU A;  4JA9 A;  5E76 A;  4A1G A;  2AXZ A;  1Z3X A;  5DIZ A;  4EQF A;  3ESK A;  5FZS A;  2XPI A;  3BEE A;  5JJ6 A;  4RG9 A;  3JCK C;  1FVF A;  3EDT B;  3ONK A;  3ZGQ A;  2LSV A;  3ENE A;  2WQ6 A;  3TXN A;  2WM9 A;  2X3M A;  3ZFW A;  4CEM A;  3PUJ A;  4J8E A;  4R7L A;  5T8I A;  4I6G A;  3FH8 A;  4N2Q A;  3FTW A;  1TJC A;  2ILR A;  4B8C B;  2CHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...