4GCNA

N-terminal domain of stress-induced protein-1 (sti-1) from c.elegans
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
127
structure length
127
Chain Sequence
b'SNAMTDAAIAEKDLGNAAYKQKDFEKAHVHYDKAIELDPSNITFYNNKAAVYFEEKKFAECVQFCEKAVEVGRETRADYKLIAKAMSRAGNAFQKQNDLSLAVQWFHRSLSEFRDPELVKKVKELEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein STI-1
publication title N-terminal domain of stress-induced protein-1 (STI-1) from C.elegans
rcsb
source organism Caenorhabditis elegans
molecule tags Protein binding
total genus 60
structure length 127
sequence length 127
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4gcnA00
4GPKA 4WNGA 2HO1A 4YVOA 2FF4A 2KCLA 5A7DB 4N3AA 2J9QA 2KATA 4ME2A 4A1SA 4HOQA 1ELWA 4WNEA 3RU0A 4BWRA 1KT1A 3GYZA 5ARGA 4B94A 3AS8A 3KD7A 4WNFA 5G04C 3GW4A 1KLXA 3ZFWA 2VGXA 3Q4AB 1E96B 3SZ7A 3Q5MA 3GZ2A 3QKYA 3URZA 3CEQA 3LY8A 3MKRA 5EX0A 2PL2A 4G24A 4UI9C 3RO3A 2PQRA 4G2VA 4O6FA 1YA0A 4HOUA 5DBKA 2C0MA 4GZ5A 4UQXA 3ASFA 4GZ6A 4YVQC 3S7JA 5CCLA 4N3BA 4I9CA 3UUXA 4H7XA 2PZIA 3RO2A 5KJKA 4KXKB 2VSNA 2KCKA 4WUYA 2UWJG 3R9AB 3GZ1A 1QQEA 3LYAA 5D0QD 5DIZA 3ASHA 1QZ2A 3RKVA 3PDNA 3HYMB 3PE4A 5M72A 2C2LA 3O48A 2LNIA 4CGWA 4WNDA 3ZN3A 3QDNA 3E4BA 2WQHA 3Q49B 5FZRA 3CVQA 3S7DA 4G23A 2I6HA 5EKQD 4AIFA 4U0UA 5KJMA 4IN3B 4I2ZA 2YHCA 3LY7A 3CK7A 2C0LA 4EQFA 2MHKA 2ONDA 3U3WA 1NZNA 2JLBA 4U0SA 4NQ0A 4KYOB 4JHRA 1W3BA 2KC7A 5G04J 1IHGA 3SF4A 1ELRA 4CDRA 1IYGA 4GZ3A 3CK9A 4G25A 4UI9K 4UI9J 5CCMA 4N3CA 3TG4A 4LEUA 1P5QA 5FTPA 3OXGA 4UQYA 3ESKA 2FI7A 4BTBA 3S7FA 3FP3A 4W9RA 2OOEA 4HORA 5LCWC 4J8FA 4RG9A 2BUGA 5A6CA 2VQ2A 4BT9A 3CVLA 2VSYA 2Q7FA 3Q47B 3VTXA 3TAXA 2IF4A 3UPVA 2VGXB 3CVPA 4J8DA 3WXXA 2UY1A 3LY9A 3UQ3A 5HQ8A 3KS2A 2XCBA 4GYWA 3TGOA 4I1AA 5AYWD 2DBAA 4I17A 5KJLA 5FJYA 5BT1A 2Y4TA 4JL0A 2PQNA 2KCVA 4ABNA 1HXIA 3ZHEA 1NA0A 4XI0A 1NA3A 4HOTA 4J8EA 4CGVA 3JYSA 4GA0A 4KBQA 3FWVA 2XCCA 2FBNA 1TJCA 4U0ZA 2FEZA 2P58C 2VGYA 3CVNA 1ZU2A 1WAO1 5EX3A 3AS5A 3FFLA 1KT0A 2YQ8A 3OXLA 1HZ4A 3K9IA 2GW1A 3QOUA 5BNWA 4N2QA 2LSUA 3ZPJA 4J0UA 3CK8A 5HI7A 3CKBA 1Y8MA 3QWWA 5CHEE 4G26A 4H7YA 5LCWJ 5ARFA 5G05C 3MEKA 4NRHB 5FZSA 3KAEA 5JJ6A 2XGMA 1ZBPA 2NC9A 2HYZA 3IEGA 1OUVA 4JA7A 2QFCA 3ASDA 5JJTA 4U07A 4N2SA 2XPIA 4GYOA 3Q15A 2VYIA 3LCAA 4UQZA 5FT9A 3EDTB 2FO7A 3MV2B 4AM9A 3ASGA 4I2WA 1A17A 1PC2A 2IFUA 2HR2A 3MV3B 4JA9A 4HOSA 3ULQA 2V5FA 4BTAA 4RG6A 4GCOA 5FZQA 3TG5A 3ZGQA 3QWVA 4XIFA 3CKCA 3S7BA 5BW8C 4GYYA 2AVPA 5KJNA 2UY1B 3RJVA 4GCNA 4F3VA 4BT8A 2XGOA 3MA5A 4I9EA 3VTYA 5D0OD 2Y4UA 4G1TA 3QWPA 1HH8A 3LPZA 5C1DA 1XNFA 3AS4A 1B89A 2WPVA 4XI9A 3ZHEB 3LKUA 4Y6WA 3OXFA 3BEEA 4AY5A 3N71A 4APOA 1FCHA 4N5CA 4U04A 5G05J 5JJ7A 4GA1A 4GA2A 4AY6A 2E2EA 2L6JA 4YNDA 4N39A 3RIBA 3U4TA 3CV0A 4Y6CA 2R5SA 2XGSA 2LSVA 1WM5A 3NF1A 2XEVA 3PE3A
chains in the Genus database with same CATH superfamily
2R17C 2V0PA 1E8YA 2KATA 2JABA 4F7AA 2OEVA 4WNEA 4BSXA 4L1BA 3FUIA 4ACLA 3ISMC 3TWTA 4CCAA 3GYZA 1TEZA 3FUMA 4EZKA 4I6EA 3C3RA 3T9KA 1Z5SC 5G04C 2WXLA 2VGXA 3Q4AB 3SZ7A 3Q5MA 4BFRA 2DZOA 2GRQB 1Z6TA 3URZA 3CHRA 5EX0A 4UWFA 4G24A 4UI9C 5KBAA 1KPSB 3CIAA 3DBSA 3SBTB 3QAQA 4U63A 3CHQA 5CECB 4UQXA 4LNGA 3CHOA 3S7JA 4JPSA 5CCLA 4ATZD 2X6HA 3IHYA 2XQ0A 3UUXA 3TWXA 4G8KA 3DSWA 4MLPA 3RRNB 3UM2A 3RO2A 3PVLA 2KCKA 2B6CA 4KZ0A 3AG3E 4XX5A 1UOHA 3R9AB 1QQEA 3LYAA 2Y3AA 2LXMA 3HXEA 3V30A 2GRNB 1K8KG 4EBAA 4PS8A 1MYOA 4C48B 4EZJA 2IONA 4CGWA 3PS6A 4WNDA 2J08A 3QDNA 3Q49B 2OEWA 5LX8A 3CVQA 3S7DA 4G23A 2I6HA 2NYJA 4AIFA 5T8IA 4DRXE 3DSSA 4I2ZA 4HXIA 4PS3A 4HNAD 3I4RB 2WXQA 4YDEA 3LJ3A 4KYOB 2KZTB 1FVFA 4Z68A 3ZU7B 3FTSA 4JC8A 3D9LA 1ELRA 2VTBB 3G2UA 1N4SA 3CK9A 5AQ9A 4E85A 1OWMA 4FLHA 3HRAA 4UI9K 4B89A 5BPPA 3G2WA 3TG4A 4D10C 3PZ4A 3CQCB 3FTUA 3FP3A 3ZYQA 3U64A 4W9RA 1V54E 4ANXA 2QYUA 5AQAA 2R05A 4C0MA 4O1OA 2VQ2A 3ULYA 3L17A 2Q7FA 3Q47B 3VTXA 2WB2A 4FA6A 2VGXB 1TN7A 4CT0A 2F37A 2P9IG 2UY1A 3UQ3A 2J4BA 3V2OA 5HQ8A 2XCBA 3TJPA 5HS0A 4PH4B 1H0AA 3APDA 4GTQA 4K0RA 4XE0A 2P9NG 1O5MA 2KCVA 5FQ8A 3MCXA 1TNBA 1HXIA 2GRLA 5CBOA 3RAUA 2HM8A 4XI0A 2ZIRA 1MJ0A 3L16A 1IQRA 4HOTA 1O1RA 4B8CB 3JYSA 4GA0A 1S0PA 2WMOA 1N11A 3DPYA 5FINA 4FJYA 2AXUA 5E75A 4XKBA 2IJGX 2P58C 3FULA 1E8WA 2RD0A 3CVNA 1ZU2A 5EX3A 5KNHD 3AS5A 3Q79A 1TN8A 2YQ8A 3FTXA 3PEUB 4BETA 1KZOA 3TWRA 4L9PA 4EECA 3FUNA 3QOUA 3VLEA 3ENEA 3ZXSA 3ZPJA 3BG1B 3V31A 2F8XK 5JMND 4F1SA 1Y8MA 2WXRA 2BEDA 4G26A 2IQCA 3JUEA 1DVPA 5ARFA 2ZISA 1BI8B 4N5QA 3APCA 3FU0A 4C9BB 3FHEA 1ZBPA 3RRMB 3FH8A 2HYZA 3IEGA 2H6IA 5EILA 4DLQA 4N2SA 5E76A 2XPIA 1NP7A 3ONKA 3Q15A 2L9BA 4TUMA 4Q69A 3SHFA 4OYSA 3FTWA 4RLYA 2WXFA 4RQIA 4J8YA 1E7VA 2FO7A 3I4GA 4I2WA 1A17A 4JA9A 2R59A 2WXIA 5CRVA 2R03A 4U7EB 2VSXE 4GMLA 5FZQA 3TG5A 3QWVA 2PM6A 2RFMA 4XIFA 3AAAC 3CKCA 5EDSA 3C5RA 3J5QB 2UY1B 3JUIA 3RJVA 3KSLA 3LVQE 4BT8A 1DC2A 2LXLA 4KVOA 3R9MA 2WQ6A 4TV3A 2I1JA 1B89A 2V8SE 3CHMA 1HS6A 3JQ0A 4WAFA 3CSTA 5CEAA 2EIME 1EDUA 3FUDA 3AG1E 3LKUA 3SFXA 5LFAA 2X6IA 3ZRHA 1BLXB 4BSZB 4N5CA 4F6RD 4GTSA 3Q7AA 5G05J 3LDZA 3DXMG 1H2UA 5ENRD 2E2EA 2X6FA 3ONLA 4N39A 5ENTD 3U4TA 4JXTA 3SO8A 3PZ1A 2XGSA 3EHRA 2WM9A 2HO1A 4YVOA 3ABLE 2FF4A 2KCLA 2GRRB 3T8MA 2J9QA 4ME2A 3U9WA 4LCTA 3JCKC 4BESA 5FIOA 4A3VA 2IOSA 5CMYA 2L0TB 1H2VC 1JWFA 2B0OE 4LNBA 2CG2A 3R7RA 3ZFWA 1QYMA 5IY5E 3GZ2A 3ZXPA 2XPYA 3CEQA 3PZ3A 1IXVA 3LY8A 1TR4A 4Q94A 2QYJA 2MRIA 3RO3A 4O6FA 1YA0A 4AV7A 1JCSA 4U95D 4DUIA 3D9IA 3G2SA 4GZ5A 3ASFA 4GZ6A 4YVQC 3G2VA 1OXJA 3RRUA 4A63B 4J7WA 1N9AA 2AJAA 3D9KA 4HS2A 3FUFA 1LD7A 4WWNA 2PZIA 5ANLA 5KJKA 4B93B 4FLBA 5BV1A 4KXKB 1U3CA 1YYHA 4GTMA 4J8SA 4DI3A 1WY6A 1IQUA 3E30A 3PRZA 3PNLB 3G2TA 3UKRG 2XEEA 3RKVA 3PDNA 1PY1A 1FT2A 4AJWA 3HYMB 5T4YA 2LNIA 3BU8A 1SW6A 5FZRA 3B7SA 5EKQD 4DPRA 1A5EA 1FPPA 5KJMA 4K5AB 4TUUA 4AXHA 2YHCA 4UWGA 3LY7A 4X8QA 5CERB 2MHKA 2ONDA 1NZNA 2JLBA 4U0SA 2BF0X 3UT4A 1LTXA 1GW6A 3CVWA 4JZYA 4JHRA 3EHMA 1W3BA 3ZIMA 1H6KA 5G04J 1IHGA 1JWGA 4C0EA 3T8KA 3CHPA 1IYGA 4EPZA 4BERA 3CVUA 2WMNA 3LEWA 3EUVA 4TXRA 2BKGA 1RW2A 4UI9J 3PEVB 3U66A 5CCMA 2R2LA 2CHWA 2X6JA 1AP7A 2VGEA 3KEZA 4LEUA 1TNOA 4QQIA 3B7UX 1X5BA 4BTBA 3D3MA 4GPMA 3B95A 4ATGA 5LCWC 2AWIA 1H2TC 3W9GA 3L08A 3E32A 2V4HC 4RG9A 4L2LA 2RFAA 1IHBA 1SA4A 5EIDA 4BT9A 5CEDB 3MKQA 3TAXA 1BI7B 2H6FA 3UPVA 2DYRE 1TJFA 3CHSA 4J8DA 3ZVVA 3JQ1A 5ENSD 3ZYLA 3LY9A 3O4ZA 3KS2A 3IXEA 3TWWA 4Q96A 3HDXA 2DBAA 1BU9A 1QNFA 3C3QA 3QK0A 2F8YA 3L6AA 4HB5A 2P9UG 1NA0A 1VDYA 2H6HA 2KBXA 4KBQA 3FWVA 4TXQA 3I3NA 1DCQA 1OCRE 1N54A 2P9KG 2WXKA 5AQ7A 2WXNA 3Q75A 2EQXA 4K5BA 1HO8A 4ACKA 2EIKE 3D9NA 3UINC 2A5EA 3PREA 2BKKB 4I6GA 4F1PA 3CVYA 3HHMA 5ITZF 3FTZA 5B1AE 1KT0A 1UN9A 4XZ4A 3K9IA 5ENOD 4ANWA 2GW1A 1N0QA 5CRUA 4HQDA 1X81A 4HBDA 4J0UA 3FU3A 1RZ4A 4CYMD 4ZFHA 5CHEE 4A55A 4UWLA 4V3IA 1WG0A 5JJ6A 2XGMA 1S64A 4JA7A 4L23A 4B0ZA 3KSQA 2DYSE 4FULA 4GYOA 3HXFA 2ZXWE 3CGHA 3MYVA 3AJIA 3L82A 3DEOA 3QB2A 3KEAA 3UX4A 5BXOA 3TL5A 1HG5A 3UIOC 2XHEA 3ESLA 4DX7D 1U2VG 3MV2B 3ASGA 5AENA 3RSEG 1PC2A 2IFUA 4GMJA 2OVFA 1MX2A 4HOSA 1N4QA 4L7TA 2LAHA 2YHEA 2IOLA 2GROB 3MKQB 1E7UA 3HIZA 1WDYA 1JCQA 1K1BA 3DSTA 4UUCA 4GU5A 5FQ7A 3S7BA 5LP0A 4HI8A 2J49A 4GCNA 1MZCA 2XGOA 4NACA 3MA5A 5D0OD 1DNPA 3V79K 3QWPA 1XNFA 3ZW3A 4GTPA 2XENA 1TNZA 2ZGGA 3DSXA 3BEEA 4UWHA 2I9CA 5BXUA 4OVUA 1MX4A 1BPOA 2V5QC 1HE8A 1YMPA 3SBSA 2VSOE 4GA1A 3NQPA 2VJ8A 4AY6A 4DLOA 4CT4A 5AIJA 3L54A 3HVEA 4Y6CA 2R5SA 2LSVA 1WM5A 1UJJA 5JHBA 3HXCA 2XZTG 4WNGA 4K03A 4FP7A 2J4DA 1FVHA 4AVXA 4A1SA 1EF1C 3RU0A 1OWOA 3QNKA 4BWRA 3UT7A 1H6PA 5FQ4A 3PUJA 1KT1A 1HFAA 4HRLA 4LNUD 5ARGA 3P1UA 5BV0A 3AS8A 3KD7A 4PS7A 1E96B 3QKYA 1SVXA 3TWQA 3APFA 3Q73A 4HFGA 5FWQA 3PH0C 4G2VA 1FT1A 1JPLA 3LJNA 4OAUC 2IU1A 5ENQD 4L2YA 4URKA 4ANUA 3B13A 2C0MA 3ZKJA 4U8VD 1G3NB 1HU3A 4N3BA 2I1KA 2CG3A 5G55A 3FUJA 4FHJA 3TWUA 1NI1A 4LG6A 4H7XA 3QC1A 4WUYA 3D9PA 2UWJG 3D9MA 2PNNA 1V55E 3I5PA 2OV8A 1AWCB 4GZDA 5D0QD 5ENNA 1ELKA 3ASHA 2L6BA 2XRYA 3NBNB 2C2LA 3O48A 1UW4B 3EU5A 1PAQA 3GZSA 1HX8A 2WQHA 2KM4A 1H19A 4CDNA 2DCPA 2WXJA 4IN3B 4IYPA 3CK7A 3FH7A 4EQFA 2IO2C 4BX8A 3DPDA 3CR3A 3NZUA 4NQ0A 5ANRA 2QC9A 1S63A 2DZNA 4MBGA 4ILIA 2YNQA 4CDRA 4XKCA 4LSZE 2DIWA 4GZ3A 3E33A 4G25A 2ETCA 4IULA 1MQSA 1N94A 4AOFA 3HVEB 1NL4A 4A3TA 5FTPA 4UQYA 3ESKA 1HG2A 4O1PA 4G11A 4HORA 1E8ZA 2RKKA 4U8YD 2NXPA 2DVWA 3MJWA 4J8FA 2BUGA 5A6CA 3DWLG 3J5PA 3CVLA 2VSYA 4I1OB 5KCMA 3CVPA 1OWPA 3Q9UC 5HRYA 3AU4A 3TGOA 4YDOA 2M63A 4KMOA 4I1AA 2J8SD 5AYWD 4I17A 5KJLA 3EHNA 1TNUA 3TWSA 2Y69E 1HF8A 1OWNA 4DJAA 2WXHA 3ASOE 4I6JA 3AG2E 5AN8A 1NA3A 5AQBA 3FTYA 5HKPA 2XCCA 3SQVA 4HVBA 1TJCA 5CMWA 4U0ZA 4TRQA 2WXGA 2GRPB 1KZPA 4ANVA 4OAVB 2FEZA 2VGYA 1D8DA 1UN8A 2OCCE 3T5VA 1WAO1 2ILRA 4DX1A 3MZLB 3CSFA 3OXLA 1HZ4A 2X6KA 4ILGA 4HRNA 3R7QA 2LSUA 2PM7A 3FUEA 4O60A 3CKBA 3QWWA 1NFIE 4JHKA 5LCWJ 2QY7A 3DEPA 3UM0A 1L5JA 3ASNE 1QBQA 4GB9A 3SD5A 2FO1E 3B7BA 2XZDG 3ZUVB 3MEKA 4B8AA 3NZSA 3KAEA 3W9FA 1LF8A 3ASDA 2CHXA 3BQOA 4QFVA 4U07A 1S70B 1SZ9A 4UWKA 4UQZA 3L9TA 3ZYKA 5AJLA 4P29A 4JEHA 4AM9A 4CRWA 2XEHA 4XEIG 3C72A 2HR2A 3EIQC 3BG0B 3ULQA 4BTAA 4RG6A 4GCOA 2H6GA 4CZ2D 3EHQA 1TNYA 1MHQA 5C2YA 3FEXA 3VLDA 5KNGA 5BW8C 4K5CA 5KJNA 3D9OA 4LUNU 4PDXA 4WWPA 4I9EA 5J90A 2Y4UA 5J08A 4G1TA 3NB2A 2AXZA 3DRAA 1HH8A 3LPZA 4RSYA 3NOGD 3AS4A 2FULA 1E90A 2A4ZA 2AW6A 2WXPA 2HE0A 4BEPA 2ETAA 3UTMA 4GTRA 3QJZA 4KT6B 3CLJA 3OXFA 2R02A 3QARA 3N71A 5ENPD 4APOA 3F6QA 4FHKA 1O1TA 1XGWA 4GAAA 3C3OA 4U04A 2ZU6B 4U8HA 2P9SG 3EU9A 5EYLA 2GRMA 5H7PA 1OT8A 2WQ7A 3CV0A 1EYHA 2XEVA 3EIJA 4KVMA 1SA5A 3D9JA 4GPKA 3VLFA 5A7DB 4N3AA 1N52A 1U3DA 3SFZA 4HOQA 1ELWA 1EPUA 3ML9A 1DCEA 2QZAA 4NURA 1YCSB 3P2BA 4B94A 4KZCA 1D8EA 3UIPC 3IKOB 3L13A 4WNFA 3GW4A 1KLXA 2E0IA 4AEZC 1Y6IA 3Q78A 3MKRA 3IV0A 3UT8A 2PL2A 3UKUG 2WXMA 2PQRA 4HOUA 5DBKA 1D9SA 1JUQA 5EN5D 2P9LG 4I9CA 1UJKA 3HXBA 3V2XA 3UM3A 4I1MA 2LAIA 4E6HA 2Y1LE 2VSNA 3SNXA 2EILE 4JW1A 4RVBA 2MYOA 4DK5A 2CFUA 3MGBA 3FU5A 2DWZA 2CHZA 2P2CP 3GZ1A 5G2NA 4TXPA 3JXJA 4LERA 2LO6A 3NAWA 3SFYA 4J6IA 3TXNA 2EINE 5DIZA 1QZ2A 1K3ZD 1O1SA 1OCCE 3FTVA 3PE4A 5M72A 4WWOA 3BUAA 3T5XA 3AG4E 4CEMA 3ZN3A 1Z3YA 3UXGA 3E4BA 4HI9A 3CVVA 5D2MC 5D66A 4U96D 3PUKA 4U0UA 3SGHA 2C0LA 4HLEA 4GMRA 2A5UA 3U3WA 5CBNA 2X3MA 2YINA 3L22A 4GTOA 4HLLA 4DX5D 2MOWA 2KC7A 3LXUX 1ZB1A 3SF4A 1OY3D 2L0IA 4GTTA 3RK6A 1OCOE 5AARA 3X2QE 3FEYA 4EZLA 5B1BE 4N3CA 3IHVA 3UMVA 2ETBA 4CDMA 1N4RA 1P5QA 3OXGA 4OVVA 2FI7A 3Q9NC 3S7FA 4EHMA 3SI5A 4JB8P 4JD2G 4M7CA 3FY4A 4GTVA 2OOEA 2J07A 4EBAG 3CQGB 3FH5A 1Q2ZA 1INZA 3C98A 2BTDA 2IF4A 4IRUA 3FDHA 3FUKA 3LVRE 3DSVA 3WXXA 4FU3A 4ILHB 2JEKA 3S2AA 4MRUA 4FC8A 4GYWA 3ZYMA 2GGFA 4F53A 4LRZA 1IKND 3ABME 1JCRA 2CFZA 2RG8A 2X38A 3TWVA 4ZHBA 3OAWA 1K1AA 5FJYA 2Y4TA 5BT1A 1MX6A 4JL0A 2PQNA 3AU5A 4YDWA 4ABNA 1N95A 3ZHEA 3E34A 4MKTA 4J8EA 3ZEFA 4CGVA 2WVIA 2NSZA 4DX6D 5JA4D 2OVBA 4YDYA 2FBNA 1SZAA 1H6OA 3D9HA 2KXPC 4HRMB 3ML8A 3MX3A 3Q7FA 3LS8A 1BD8A 1E8XA 3B7TA 5EIBE 3PZDA 3JXIA 4M3OA 3EJNA 4DI4A 3FFLA 3HXDA 2I2OA 3ZNGA 2XRZA 3PNTB 5B3SE 4FJZA 3WG7E 5BUZA 2V4LA 3HG0D 1LD8A 1TYQG 3SY2A 5BNWA 4G8LA 4N2QA 5A23A 3CK8A 5HI7A 4H7YA 3UM1A 3DSUA 5G05C 3FUHA 4JEUA 4NRHB 4PUCA 4FADA 2J09A 1OCZE 5FZSA 4GZCA 4BX9A 2NC9A 1OUVA 2QFCA 5JHAA 5JJTA 4R7LA 4A1GA 2VYIA 3LCAA 1UG3A 2AXVA 3NOCD 5FT9A 2IY0C 3EDTB 5AJDA 5AAOA 4MS6A 2F0YA 3DXKG 5EYPF 3IBEA 3E37A 4I43A 3MV3B 5LOZA 2IEJA 2V5FA 1Z3XA 3CVXA 3UI2A 1OWLA 3ZGQA 1SQMA 3OTNA 4GYYA 2AVPA 4JHJA 4F3VA 2XPZA 5T3RA 3VTYA 3FU6A 3PZ2A 4AP2A 4JVSA 2IO3C 2XS1A 5FQ6A 5C1DA 2WPVA 4APFA 4XI9A 3TXMA 3ZHEB 3ABKE 2LUHA 2ZGDA 4Y6WA 4NIKA 4AY5A 2XS8A 1FCHA 2KZTA 4BY6A 4DX2A 5JJ7A 3B7RL 1N4PA 2VTBA 2Y0BG 4GA2A 2L6JA 1N0RA 4YNDA 3ULEG 2EIJE 3RIBA 2P9PG 5KWDA 2WXOA 3NF1A 3PE3A 1TN6A
chains in the Genus database with same CATH topology
2WM9A 2R17C 3D9JA 4WNGA 2V0PA 4GPKA 4K03A 2HO1A 4FP7A 4YVOA 2J4DA 1E8YA 2FF4A 3VLFA 2KCLA 1FVHA 5A7DB 3T8MA 4AVXA 4N3AA 1N52A 1U3DA 2J9QA 2KATA 4ME2A 4A1SA 3SFZA 4HOQA 1ELWA 4F7AA 1EF1C 4WNEA 3RU0A 1OWOA 3QNKA 1EPUA 4BSXA 4BWRA 3ML9A 3U9WA 4L1BA 3FUIA 3UT7A 4ACLA 4NURA 3P2BA 5FQ4A 3PUJA 1KT1A 1HFAA 4CCAA 4LCTA 3GYZA 3JCKC 1TEZA 3FUMA 4EZKA 4I6EA 5ARGA 4A3VA 4B94A 4KZCA 2IOSA 3P1UA 5CMYA 5BV0A 2L0TB 1H2VC 1JWFA 3AS8A 3IKOB 3KD7A 3L13A 2CG2A 4PS7A 4WNFA 5G04C 2WXLA 1KLXA 3GW4A 2E0IA 2VGXA 3Q4AB 3ZFWA 1E96B 3SZ7A 3Q5MA 4BFRA 3GZ2A 1Z6TA 4AEZC 1Y6IA 3QKYA 2XPYA 3URZA 3CEQA 3LY8A 3MKRA 3IV0A 3UT8A 3CHRA 4Q94A 5EX0A 3APFA 2PL2A 4UWFA 4G24A 4HFGA 4UI9C 3PH0C 5FWQA 2MRIA 2WXMA 3RO3A 2PQRA 4G2VA 1JPLA 4O6FA 1YA0A 4AV7A 2IU1A 3CIAA 3DBSA 3SBTB 3QAQA 4U63A 4HOUA 3CHQA 5DBKA 3D9IA 4L2YA 4URKA 3G2SA 4ANUA 3B13A 2C0MA 1JUQA 4GZ5A 4UQXA 3ASFA 3CHOA 4GZ6A 3G2VA 4YVQC 3RRUA 3S7JA 4JPSA 5CCLA 1HU3A 4N3BA 2I1KA 3D9KA 2CG3A 2X6HA 5G55A 4I9CA 3IHYA 3FUJA 4FHJA 4HS2A 1UJKA 2XQ0A 3FUFA 3UUXA 4I1MA 4WWNA 4H7XA 2PZIA 4MLPA 2LAIA 3RRNB 5ANLA 3RO2A 3PVLA 4E6HA 5KJKA 3QC1A 4FLBA 5BV1A 4KXKB 1U3CA 2VSNA 2KCKA 4WUYA 4J8SA 3SNXA 4JW1A 4RVBA 4DI3A 4DK5A 2CFUA 3D9PA 2UWJG 3MGBA 3D9MA 1WY6A 3FU5A 1IQUA 4KZ0A 4XX5A 2CHZA 3R9AB 3GZ1A 3I5PA 2OV8A 5G2NA 1QQEA 3LYAA 2Y3AA 3PRZA 4LERA 2LO6A 3PNLB 4GZDA 5D0QD 3G2TA 4J6IA 5ENNA 3TXNA 5DIZA 1ELKA 3ASHA 1QZ2A 3RKVA 3FTVA 3PDNA 4EBAA 1PY1A 4AJWA 3HYMB 3PE4A 2XRYA 5M72A 4PS8A 2C2LA 5T4YA 3O48A 2LNIA 1UW4B 4WWOA 2IONA 4EZJA 4CGWA 3T5XA 1PAQA 3PS6A 4WNDA 4CEMA 3ZN3A 1Z3YA 3GZSA 2J08A 3QDNA 3E4BA 1HX8A 2WQHA 3Q49B 5FZRA 5LX8A 3B7SA 3CVQA 3S7DA 4G23A 2KM4A 2I6HA 5EKQD 1H19A 3CVVA 4AIFA 3PUKA 4CDNA 5T8IA 4DPRA 2DCPA 4U0UA 2WXJA 5KJMA 4IN3B 4IYPA 4I2ZA 4TUUA 4AXHA 3SGHA 4HXIA 2YHCA 4UWGA 3LY7A 3CK7A 2C0LA 3FH7A 4HLEA 4EQFA 4PS3A 2A5UA 3I4RB 2MHKA 2ONDA 3U3WA 2X3MA 2YINA 1NZNA 3L22A 2WXQA 2JLBA 4U0SA 2BF0X 4BX8A 3DPDA 3UT4A 3CR3A 3LJ3A 1GW6A 3NZUA 4NQ0A 5ANRA 4KYOB 2KZTB 1FVFA 3CVWA 4JZYA 2MOWA 3EHMA 1W3BA 4JHRA 2KC7A 3ZIMA 1H6KA 3LXUX 3FTSA 5G04J 4ILIA 1IHGA 1JWGA 4JC8A 3SF4A 4C0EA 3D9LA 3CHPA 1ELRA 2VTBB 2YNQA 4CDRA 1IYGA 3G2UA 4EPZA 2L0IA 4XKCA 2DIWA 4GZ3A 3CVUA 2WMNA 3CK9A 4G25A 4E85A 1OWMA 3LEWA 4IULA 3RK6A 1MQSA 4FLHA 3FEYA 4AOFA 4EZLA 4UI9K 3PEVB 4UI9J 3HVEB 3U66A 5CCMA 4B89A 4N3CA 3IHVA 2CHWA 5BPPA 2X6JA 3G2WA 3UMVA 3TG4A 3KEZA 4D10C 4CDMA 4A3TA 4LEUA 1P5QA 5FTPA 3B7UX 3CQCB 1X5BA 3OXGA 4OVVA 3FTUA 4UQYA 3ESKA 2FI7A 4BTBA 3S7FA 3FP3A 3ZYQA 3SI5A 3U64A 4W9RA 1HG2A 3D3MA 3FY4A 2OOEA 2J07A 4G11A 4ANXA 4EBAG 4ATGA 4HORA 1E8ZA 5LCWC 3CQGB 2AWIA 1H2TC 2NXPA 3L08A 3FH5A 3MJWA 4J8FA 4RG9A 2BUGA 4L2LA 4C0MA 5A6CA 2VQ2A 4BT9A 3MKQA 3L17A 3C98A 1INZA 2BTDA 3CVLA 2VSYA 2Q7FA 3Q47B 4I1OB 3VTXA 5KCMA 3TAXA 2WB2A 2IF4A 4IRUA 4FA6A 3UPVA 2VGXB 3FDHA 1TJFA 3FUKA 3LVRE 3CHSA 1OWPA 3CVPA 4CT0A 4J8DA 3ZVVA 3WXXA 4FU3A 3JQ1A 4ILHB 2JEKA 3S2AA 3ZYLA 2UY1A 3LY9A 5C1DA 3O4ZA 3UQ3A 4MRUA 4FC8A 2J4BA 5HQ8A 3KS2A 2XCBA 3AU4A 4GYWA 3TJPA 3TGOA 3ZYMA 2GGFA 4F53A 4PH4B 4LRZA 1H0AA 2M63A 4KMOA 4Q96A 4I1AA 3HDXA 5AYWD 2DBAA 4I17A 3APDA 3EHNA 4K0RA 5KJLA 4XE0A 2CFZA 2RG8A 1QNFA 2X38A 1HF8A 3OAWA 5FJYA 5BT1A 2Y4TA 1OWNA 4DJAA 4JL0A 2PQNA 3AU5A 3QK0A 2KCVA 2WXHA 5FQ8A 3MCXA 2GRLA 1HXIA 3L6AA 4ABNA 3ZHEA 4I6JA 2HM8A 1NA0A 1VDYA 4XI0A 4MKTA 3L16A 1NA3A 1IQRA 4HOTA 4J8EA 4B8CB 3ZEFA 3FTYA 3JYSA 4GA0A 4CGVA 2WVIA 4KBQA 1S0PA 3FWVA 2NSZA 2WMOA 2XCCA 2OVBA 4HVBA 4FJYA 2FBNA 1SZAA 1TJCA 3I3NA 2AXUA 5CMWA 5E75A 1N54A 4U0ZA 2WXKA 4TRQA 2WXNA 2EQXA 1HO8A 4XKBA 4ACKA 3D9NA 2WXGA 3PREA 4ANVA 4I6GA 3ML8A 2IJGX 2FEZA 2P58C 2VGYA 3FULA 1E8WA 3MX3A 2RD0A 3CVNA 3LS8A 1UN8A 1E8XA 3B7TA 1ZU2A 3T5VA 1WAO1 3CVYA 2ILRA 3HHMA 3PZDA 5EX3A 4M3OA 3AS5A 3FTZA 3EJNA 4DI4A 3FFLA 1KT0A 2YQ8A 3MZLB 3CSFA 2I2OA 3FTXA 2XRZA 1UN9A 3OXLA 1HZ4A 3PNTB 4XZ4A 3K9IA 2X6KA 3PEUB 4ANWA 4ILGA 4FJZA 3R7RA 2GW1A 4EECA 5BUZA 3FUNA 2V4LA 3QOUA 3VLEA 5BNWA 3ENEA 2LSUA 2PM7A 3R7QA 4N2QA 3ZXSA 3ZPJA 5A23A 3BG1B 3FUEA 4J0UA 3CK8A 5HI7A 4F1SA 3FU3A 3CKBA 1Y8MA 3QWWA 2WXRA 4JHKA 5CHEE 4G26A 4H7YA 5LCWJ 2QY7A 2IQCA 1L5JA 4A55A 1DVPA 4GB9A 3SD5A 5ARFA 4UWLA 5G05C 3FUHA 4V3IA 4KVMA 3APCA 3MEKA 3FU0A 4B8AA 4JEUA 4NRHB 4PUCA 4C9BB 4FADA 2J09A 5FZSA 3NZSA 3KAEA 5JJ6A 3FHEA 1LF8A 4GZCA 2XGMA 4BX9A 1ZBPA 3RRMB 2NC9A 3FH8A 2HYZA 3IEGA 1OUVA 4JA7A 2QFCA 4L23A 4B0ZA 5JHAA 3ASDA 2CHXA 5JJTA 4FULA 4DLQA 4QFVA 4U07A 4N2SA 4R7LA 5E76A 2XPIA 1NP7A 4GYOA 4A1GA 3ONKA 3Q15A 3CGHA 2L9BA 3MYVA 2VYIA 3LCAA 4Q69A 4UWKA 1SZ9A 1UG3A 2AXVA 3QB2A 4UQZA 3SHFA 4OYSA 5FT9A 3UX4A 3FTWA 3EDTB 5AJDA 3ZYKA 5AJLA 3TL5A 2WXFA 4P29A 1HG5A 4JEHA 2XHEA 1E7VA 3ESLA 2FO7A 3I4GA 4MS6A 3MV2B 4AM9A 3ASGA 4I2WA 5AENA 3IBEA 1A17A 1PC2A 4CRWA 2IFUA 4GMJA 2OVFA 2HR2A 4I43A 3MV3B 3EIQC 3BG0B 4JA9A 4HOSA 3ULQA 5LOZA 4L7TA 2R59A 2V5FA 4BTAA 2WXIA 2LAHA 2YHEA 1Z3XA 4RG6A 3CVXA 2IOLA 4GCOA 1OWLA 2VSXE 3MKQB 4GMLA 1E7UA 3HIZA 5FZQA 3TG5A 1MHQA 3ZGQA 1SQMA 3QWVA 2PM6A 4GU5A 4XIFA 5C2YA 3FEXA 3VLDA 3CKCA 5FQ7A 3S7BA 3OTNA 5EDSA 5LP0A 5BW8C 4GYYA 2AVPA 2J49A 3D9OA 4LUNU 5KJNA 4PDXA 2UY1B 3JUIA 3RJVA 4JHJA 4GCNA 4F3VA 3LVQE 4BT8A 2XPZA 2XGOA 4NACA 4WWPA 5T3RA 3MA5A 4I9EA 3VTYA 5J90A 5D0OD 2Y4UA 3FU6A 5J08A 4AP2A 4JVSA 1DNPA 4G1TA 5FQ6A 4KVOA 2WQ6A 2AXZA 4TV3A 3QWPA 1HH8A 3LPZA 2I1JA 1XNFA 4RSYA 3AS4A 1B89A 1E90A 2FULA 2WPVA 2V8SE 2A4ZA 2AW6A 3CHMA 4APFA 3ZW3A 1HS6A 3JQ0A 2WXPA 4XI9A 4WAFA 3CSTA 3TXMA 3ZHEB 1EDUA 3FUDA 3LKUA 3QJZA 4Y6WA 4KT6B 3CLJA 3OXFA 5LFAA 3BEEA 4AY5A 3QARA 2X6IA 4UWHA 3N71A 3ZRHA 4APOA 2I9CA 1FCHA 2KZTA 4FHKA 4BY6A 1XGWA 4GAAA 4N5CA 4OVUA 4U04A 2ZU6B 1BPOA 5G05J 5JJ7A 3B7RL 1HE8A 4U8HA 3SBSA 2VSOE 3LDZA 2VTBA 4GA1A 3NQPA 1H2UA 4GA2A 2VJ8A 4AY6A 2E2EA 2L6JA 2X6FA 4DLOA 3ONLA 4CT4A 4YNDA 5AIJA 2GRMA 3L54A 4N39A 2WQ7A 3RIBA 3U4TA 3HVEA 4JXTA 3CV0A 4Y6CA 2R5SA 1EYHA 2XGSA 2LSVA 1WM5A 2WXOA 3NF1A 1UJJA 2XEVA 3EIJA 5JHBA 3PE3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GPK A;  4WNG A;  2HO1 A;  4YVO A;  2FF4 A;  2KCL A;  5A7D B;  4N3A A;  2J9Q A;  2KAT A;  4ME2 A;  4A1S A;  4HOQ A;  1ELW A;  4WNE A;  3RU0 A;  4BWR A;  1KT1 A;  3GYZ A;  5ARG A;  4B94 A;  3AS8 A;  3KD7 A;  4WNF A;  5G04 C;  3GW4 A;  1KLX A;  3ZFW A;  2VGX A;  3Q4A B;  1E96 B;  3SZ7 A;  3Q5M A;  3GZ2 A;  3QKY A;  3URZ A;  3CEQ A;  3LY8 A;  3MKR A;  5EX0 A;  2PL2 A;  4G24 A;  4UI9 C;  3RO3 A;  2PQR A;  4G2V A;  4O6F A;  1YA0 A;  4HOU A;  5DBK A;  2C0M A;  4GZ5 A;  4UQX A;  3ASF A;  4GZ6 A;  4YVQ C;  3S7J A;  5CCL A;  4N3B A;  4I9C A;  3UUX A;  4H7X A;  2PZI A;  3RO2 A;  5KJK A;  4KXK B;  2VSN A;  2KCK A;  4WUY A;  2UWJ G;  3R9A B;  3GZ1 A;  1QQE A;  3LYA A;  5D0Q D;  5DIZ A;  3ASH A;  1QZ2 A;  3RKV A;  3PDN A;  3HYM B;  3PE4 A;  5M72 A;  2C2L A;  3O48 A;  2LNI A;  4CGW A;  4WND A;  3ZN3 A;  3QDN A;  3E4B A;  2WQH A;  3Q49 B;  5FZR A;  3CVQ A;  3S7D A;  4G23 A;  2I6H A;  5EKQ D;  4AIF A;  4U0U A;  5KJM A;  4IN3 B;  4I2Z A;  2YHC A;  3LY7 A;  3CK7 A;  2C0L A;  4EQF A;  2MHK A;  2OND A;  3U3W A;  1NZN A;  2JLB A;  4U0S A;  4NQ0 A;  4KYO B;  4JHR A;  1W3B A;  2KC7 A;  5G04 J;  1IHG A;  3SF4 A;  1ELR A;  4CDR A;  1IYG A;  4GZ3 A;  3CK9 A;  4G25 A;  4UI9 K;  4UI9 J;  5CCM A;  4N3C A;  3TG4 A;  4LEU A;  1P5Q A;  5FTP A;  3OXG A;  4UQY A;  3ESK A;  2FI7 A;  4BTB A;  3S7F A;  3FP3 A;  4W9R A;  2OOE A;  4HOR A;  5LCW C;  4J8F A;  4RG9 A;  2BUG A;  5A6C A;  2VQ2 A;  4BT9 A;  3CVL A;  2VSY A;  2Q7F A;  3Q47 B;  3VTX A;  3TAX A;  2IF4 A;  3UPV A;  2VGX B;  3CVP A;  4J8D A;  3WXX A;  2UY1 A;  3LY9 A;  3UQ3 A;  5HQ8 A;  3KS2 A;  2XCB A;  4GYW A;  3TGO A;  4I1A A;  5AYW D;  2DBA A;  4I17 A;  5KJL A;  5FJY A;  5BT1 A;  2Y4T A;  4JL0 A;  2PQN A;  2KCV A;  4ABN A;  1HXI A;  3ZHE A;  1NA0 A;  4XI0 A;  1NA3 A;  4HOT A;  4J8E A;  4CGV A;  3JYS A;  4GA0 A;  4KBQ A;  3FWV A;  2XCC A;  2FBN A;  1TJC A;  4U0Z A;  2FEZ A;  2P58 C;  2VGY A;  3CVN A;  1ZU2 A;  1WAO 1;  5EX3 A;  3AS5 A;  3FFL A;  1KT0 A;  2YQ8 A;  3OXL A;  1HZ4 A;  3K9I A;  2GW1 A;  3QOU A;  5BNW A;  4N2Q A;  2LSU A;  3ZPJ A;  4J0U A;  3CK8 A;  5HI7 A;  3CKB A;  1Y8M A;  3QWW A;  5CHE E;  4G26 A;  4H7Y A;  5LCW J;  5ARF A;  5G05 C;  3MEK A;  4NRH B;  5FZS A;  3KAE A;  5JJ6 A;  2XGM A;  1ZBP A;  2NC9 A;  2HYZ A;  3IEG A;  1OUV A;  4JA7 A;  2QFC A;  3ASD A;  5JJT A;  4U07 A;  4N2S A;  2XPI A;  4GYO A;  3Q15 A;  2VYI A;  3LCA A;  4UQZ A;  5FT9 A;  3EDT B;  2FO7 A;  3MV2 B;  4AM9 A;  3ASG A;  4I2W A;  1A17 A;  1PC2 A;  2IFU A;  2HR2 A;  3MV3 B;  4JA9 A;  4HOS A;  3ULQ A;  2V5F A;  4BTA A;  4RG6 A;  4GCO A;  5FZQ A;  3TG5 A;  3ZGQ A;  3QWV A;  4XIF A;  3CKC A;  3S7B A;  5BW8 C;  4GYY A;  2AVP A;  5KJN A;  2UY1 B;  3RJV A;  4GCN A;  4F3V A;  4BT8 A;  2XGO A;  3MA5 A;  4I9E A;  3VTY A;  5D0O D;  2Y4U A;  4G1T A;  3QWP A;  1HH8 A;  3LPZ A;  5C1D A;  1XNF A;  3AS4 A;  1B89 A;  2WPV A;  4XI9 A;  3ZHE B;  3LKU A;  4Y6W A;  3OXF A;  3BEE A;  4AY5 A;  3N71 A;  4APO A;  1FCH A;  4N5C A;  4U04 A;  5G05 J;  5JJ7 A;  4GA1 A;  4GA2 A;  4AY6 A;  2E2E A;  2L6J A;  4YND A;  4N39 A;  3RIB A;  3U4T A;  3CV0 A;  4Y6C A;  2R5S A;  2XGS A;  2LSV A;  1WM5 A;  3NF1 A;  2XEV A;  3PE3 A; 
#chains in the Genus database with same CATH topology
 2R17 C;  2V0P A;  1E8Y A;  2KAT A;  2JAB A;  4F7A A;  2OEV A;  4WNE A;  4BSX A;  4L1B A;  3FUI A;  4ACL A;  3ISM C;  3TWT A;  4CCA A;  3GYZ A;  1TEZ A;  3FUM A;  4EZK A;  4I6E A;  3C3R A;  3T9K A;  1Z5S C;  5G04 C;  2WXL A;  2VGX A;  3Q4A B;  3SZ7 A;  3Q5M A;  4BFR A;  2DZO A;  2GRQ B;  1Z6T A;  3URZ A;  3CHR A;  5EX0 A;  4UWF A;  4G24 A;  4UI9 C;  5KBA A;  1KPS B;  3CIA A;  3DBS A;  3SBT B;  3QAQ A;  4U63 A;  3CHQ A;  5CEC B;  4UQX A;  4LNG A;  3CHO A;  3S7J A;  4JPS A;  5CCL A;  4ATZ D;  2X6H A;  3IHY A;  2XQ0 A;  3UUX A;  3TWX A;  4G8K A;  3DSW A;  4MLP A;  3RRN B;  3UM2 A;  3RO2 A;  3PVL A;  2KCK A;  2B6C A;  4KZ0 A;  3AG3 E;  4XX5 A;  1UOH A;  3R9A B;  1QQE A;  3LYA A;  2Y3A A;  2LXM A;  3HXE A;  3V30 A;  2GRN B;  1K8K G;  4EBA A;  4PS8 A;  1MYO A;  4C48 B;  4EZJ A;  2ION A;  4CGW A;  3PS6 A;  4WND A;  2J08 A;  3QDN A;  3Q49 B;  2OEW A;  5LX8 A;  3CVQ A;  3S7D A;  4G23 A;  2I6H A;  2NYJ A;  4AIF A;  5T8I A;  4DRX E;  3DSS A;  4I2Z A;  4HXI A;  4PS3 A;  4HNA D;  3I4R B;  2WXQ A;  4YDE A;  3LJ3 A;  4KYO B;  2KZT B;  1FVF A;  4Z68 A;  3ZU7 B;  3FTS A;  4JC8 A;  3D9L A;  1ELR A;  2VTB B;  3G2U A;  1N4S A;  3CK9 A;  5AQ9 A;  4E85 A;  1OWM A;  4FLH A;  3HRA A;  4UI9 K;  4B89 A;  5BPP A;  3G2W A;  3TG4 A;  4D10 C;  3PZ4 A;  3CQC B;  3FTU A;  3FP3 A;  3ZYQ A;  3U64 A;  4W9R A;  1V54 E;  4ANX A;  2QYU A;  5AQA A;  2R05 A;  4C0M A;  4O1O A;  2VQ2 A;  3ULY A;  3L17 A;  2Q7F A;  3Q47 B;  3VTX A;  2WB2 A;  4FA6 A;  2VGX B;  1TN7 A;  4CT0 A;  2F37 A;  2P9I G;  2UY1 A;  3UQ3 A;  2J4B A;  3V2O A;  5HQ8 A;  2XCB A;  3TJP A;  5HS0 A;  4PH4 B;  1H0A A;  3APD A;  4GTQ A;  4K0R A;  4XE0 A;  2P9N G;  1O5M A;  2KCV A;  5FQ8 A;  3MCX A;  1TNB A;  1HXI A;  2GRL A;  5CBO A;  3RAU A;  2HM8 A;  4XI0 A;  2ZIR A;  1MJ0 A;  3L16 A;  1IQR A;  4HOT A;  1O1R A;  4B8C B;  3JYS A;  4GA0 A;  1S0P A;  2WMO A;  1N11 A;  3DPY A;  5FIN A;  4FJY A;  2AXU A;  5E75 A;  4XKB A;  2IJG X;  2P58 C;  3FUL A;  1E8W A;  2RD0 A;  3CVN A;  1ZU2 A;  5EX3 A;  5KNH D;  3AS5 A;  3Q79 A;  1TN8 A;  2YQ8 A;  3FTX A;  3PEU B;  4BET A;  1KZO A;  3TWR A;  4L9P A;  4EEC A;  3FUN A;  3QOU A;  3VLE A;  3ENE A;  3ZXS A;  3ZPJ A;  3BG1 B;  3V31 A;  2F8X K;  5JMN D;  4F1S A;  1Y8M A;  2WXR A;  2BED A;  4G26 A;  2IQC A;  3JUE A;  1DVP A;  5ARF A;  2ZIS A;  1BI8 B;  4N5Q A;  3APC A;  3FU0 A;  4C9B B;  3FHE A;  1ZBP A;  3RRM B;  3FH8 A;  2HYZ A;  3IEG A;  2H6I A;  5EIL A;  4DLQ A;  4N2S A;  5E76 A;  2XPI A;  1NP7 A;  3ONK A;  3Q15 A;  2L9B A;  4TUM A;  4Q69 A;  3SHF A;  4OYS A;  3FTW A;  4RLY A;  2WXF A;  4RQI A;  4J8Y A;  1E7V A;  2FO7 A;  3I4G A;  4I2W A;  1A17 A;  4JA9 A;  2R59 A;  2WXI A;  5CRV A;  2R03 A;  4U7E B;  2VSX E;  4GML A;  5FZQ A;  3TG5 A;  3QWV A;  2PM6 A;  2RFM A;  4XIF A;  3AAA C;  3CKC A;  5EDS A;  3C5R A;  3J5Q B;  2UY1 B;  3JUI A;  3RJV A;  3KSL A;  3LVQ E;  4BT8 A;  1DC2 A;  2LXL A;  4KVO A;  3R9M A;  2WQ6 A;  4TV3 A;  2I1J A;  1B89 A;  2V8S E;  3CHM A;  1HS6 A;  3JQ0 A;  4WAF A;  3CST A;  5CEA A;  2EIM E;  1EDU A;  3FUD A;  3AG1 E;  3LKU A;  3SFX A;  5LFA A;  2X6I A;  3ZRH A;  1BLX B;  4BSZ B;  4N5C A;  4F6R D;  4GTS A;  3Q7A A;  5G05 J;  3LDZ A;  3DXM G;  1H2U A;  5ENR D;  2E2E A;  2X6F A;  3ONL A;  4N39 A;  5ENT D;  3U4T A;  4JXT A;  3SO8 A;  3PZ1 A;  2XGS A;  3EHR A;  2WM9 A;  2HO1 A;  4YVO A;  3ABL E;  2FF4 A;  2KCL A;  2GRR B;  3T8M A;  2J9Q A;  4ME2 A;  3U9W A;  4LCT A;  3JCK C;  4BES A;  5FIO A;  4A3V A;  2IOS A;  5CMY A;  2L0T B;  1H2V C;  1JWF A;  2B0O E;  4LNB A;  2CG2 A;  3R7R A;  3ZFW A;  1QYM A;  5IY5 E;  3GZ2 A;  3ZXP A;  2XPY A;  3CEQ A;  3PZ3 A;  1IXV A;  3LY8 A;  1TR4 A;  4Q94 A;  2QYJ A;  2MRI A;  3RO3 A;  4O6F A;  1YA0 A;  4AV7 A;  1JCS A;  4U95 D;  4DUI A;  3D9I A;  3G2S A;  4GZ5 A;  3ASF A;  4GZ6 A;  4YVQ C;  3G2V A;  1OXJ A;  3RRU A;  4A63 B;  4J7W A;  1N9A A;  2AJA A;  3D9K A;  4HS2 A;  3FUF A;  1LD7 A;  4WWN A;  2PZI A;  5ANL A;  5KJK A;  4B93 B;  4FLB A;  5BV1 A;  4KXK B;  1U3C A;  1YYH A;  4GTM A;  4J8S A;  4DI3 A;  1WY6 A;  1IQU A;  3E30 A;  3PRZ A;  3PNL B;  3G2T A;  3UKR G;  2XEE A;  3RKV A;  3PDN A;  1PY1 A;  1FT2 A;  4AJW A;  3HYM B;  5T4Y A;  2LNI A;  3BU8 A;  1SW6 A;  5FZR A;  3B7S A;  5EKQ D;  4DPR A;  1A5E A;  1FPP A;  5KJM A;  4K5A B;  4TUU A;  4AXH A;  2YHC A;  4UWG A;  3LY7 A;  4X8Q A;  5CER B;  2MHK A;  2OND A;  1NZN A;  2JLB A;  4U0S A;  2BF0 X;  3UT4 A;  1LTX A;  1GW6 A;  3CVW A;  4JZY A;  4JHR A;  3EHM A;  1W3B A;  3ZIM A;  1H6K A;  5G04 J;  1IHG A;  1JWG A;  4C0E A;  3T8K A;  3CHP A;  1IYG A;  4EPZ A;  4BER A;  3CVU A;  2WMN A;  3LEW A;  3EUV A;  4TXR A;  2BKG A;  1RW2 A;  4UI9 J;  3PEV B;  3U66 A;  5CCM A;  2R2L A;  2CHW A;  2X6J A;  1AP7 A;  2VGE A;  3KEZ A;  4LEU A;  1TNO A;  4QQI A;  3B7U X;  1X5B A;  4BTB A;  3D3M A;  4GPM A;  3B95 A;  4ATG A;  5LCW C;  2AWI A;  1H2T C;  3W9G A;  3L08 A;  3E32 A;  2V4H C;  4RG9 A;  4L2L A;  2RFA A;  1IHB A;  1SA4 A;  5EID A;  4BT9 A;  5CED B;  3MKQ A;  3TAX A;  1BI7 B;  2H6F A;  3UPV A;  2DYR E;  1TJF A;  3CHS A;  4J8D A;  3ZVV A;  3JQ1 A;  5ENS D;  3ZYL A;  3LY9 A;  3O4Z A;  3KS2 A;  3IXE A;  3TWW A;  4Q96 A;  3HDX A;  2DBA A;  1BU9 A;  1QNF A;  3C3Q A;  3QK0 A;  2F8Y A;  3L6A A;  4HB5 A;  2P9U G;  1NA0 A;  1VDY A;  2H6H A;  2KBX A;  4KBQ A;  3FWV A;  4TXQ A;  3I3N A;  1DCQ A;  1OCR E;  1N54 A;  2P9K G;  2WXK A;  5AQ7 A;  2WXN A;  3Q75 A;  2EQX A;  4K5B A;  1HO8 A;  4ACK A;  2EIK E;  3D9N A;  3UIN C;  2A5E A;  3PRE A;  2BKK B;  4I6G A;  4F1P A;  3CVY A;  3HHM A;  5ITZ F;  3FTZ A;  5B1A E;  1KT0 A;  1UN9 A;  4XZ4 A;  3K9I A;  5ENO D;  4ANW A;  2GW1 A;  1N0Q A;  5CRU A;  4HQD A;  1X81 A;  4HBD A;  4J0U A;  3FU3 A;  1RZ4 A;  4CYM D;  4ZFH A;  5CHE E;  4A55 A;  4UWL A;  4V3I A;  1WG0 A;  5JJ6 A;  2XGM A;  1S64 A;  4JA7 A;  4L23 A;  4B0Z A;  3KSQ A;  2DYS E;  4FUL A;  4GYO A;  3HXF A;  2ZXW E;  3CGH A;  3MYV A;  3AJI A;  3L82 A;  3DEO A;  3QB2 A;  3KEA A;  3UX4 A;  5BXO A;  3TL5 A;  1HG5 A;  3UIO C;  2XHE A;  3ESL A;  4DX7 D;  1U2V G;  3MV2 B;  3ASG A;  5AEN A;  3RSE G;  1PC2 A;  2IFU A;  4GMJ A;  2OVF A;  1MX2 A;  4HOS A;  1N4Q A;  4L7T A;  2LAH A;  2YHE A;  2IOL A;  2GRO B;  3MKQ B;  1E7U A;  3HIZ A;  1WDY A;  1JCQ A;  1K1B A;  3DST A;  4UUC A;  4GU5 A;  5FQ7 A;  3S7B A;  5LP0 A;  4HI8 A;  2J49 A;  4GCN A;  1MZC A;  2XGO A;  4NAC A;  3MA5 A;  5D0O D;  1DNP A;  3V79 K;  3QWP A;  1XNF A;  3ZW3 A;  4GTP A;  2XEN A;  1TNZ A;  2ZGG A;  3DSX A;  3BEE A;  4UWH A;  2I9C A;  5BXU A;  4OVU A;  1MX4 A;  1BPO A;  2V5Q C;  1HE8 A;  1YMP A;  3SBS A;  2VSO E;  4GA1 A;  3NQP A;  2VJ8 A;  4AY6 A;  4DLO A;  4CT4 A;  5AIJ A;  3L54 A;  3HVE A;  4Y6C A;  2R5S A;  2LSV A;  1WM5 A;  1UJJ A;  5JHB A;  3HXC A;  2XZT G;  4WNG A;  4K03 A;  4FP7 A;  2J4D A;  1FVH A;  4AVX A;  4A1S A;  1EF1 C;  3RU0 A;  1OWO A;  3QNK A;  4BWR A;  3UT7 A;  1H6P A;  5FQ4 A;  3PUJ A;  1KT1 A;  1HFA A;  4HRL A;  4LNU D;  5ARG A;  3P1U A;  5BV0 A;  3AS8 A;  3KD7 A;  4PS7 A;  1E96 B;  3QKY A;  1SVX A;  3TWQ A;  3APF A;  3Q73 A;  4HFG A;  5FWQ A;  3PH0 C;  4G2V A;  1FT1 A;  1JPL A;  3LJN A;  4OAU C;  2IU1 A;  5ENQ D;  4L2Y A;  4URK A;  4ANU A;  3B13 A;  2C0M A;  3ZKJ A;  4U8V D;  1G3N B;  1HU3 A;  4N3B A;  2I1K A;  2CG3 A;  5G55 A;  3FUJ A;  4FHJ A;  3TWU A;  1NI1 A;  4LG6 A;  4H7X A;  3QC1 A;  4WUY A;  3D9P A;  2UWJ G;  3D9M A;  2PNN A;  1V55 E;  3I5P A;  2OV8 A;  1AWC B;  4GZD A;  5D0Q D;  5ENN A;  1ELK A;  3ASH A;  2L6B A;  2XRY A;  3NBN B;  2C2L A;  3O48 A;  1UW4 B;  3EU5 A;  1PAQ A;  3GZS A;  1HX8 A;  2WQH A;  2KM4 A;  1H19 A;  4CDN A;  2DCP A;  2WXJ A;  4IN3 B;  4IYP A;  3CK7 A;  3FH7 A;  4EQF A;  2IO2 C;  4BX8 A;  3DPD A;  3CR3 A;  3NZU A;  4NQ0 A;  5ANR A;  2QC9 A;  1S63 A;  2DZN A;  4MBG A;  4ILI A;  2YNQ A;  4CDR A;  4XKC A;  4LSZ E;  2DIW A;  4GZ3 A;  3E33 A;  4G25 A;  2ETC A;  4IUL A;  1MQS A;  1N94 A;  4AOF A;  3HVE B;  1NL4 A;  4A3T A;  5FTP A;  4UQY A;  3ESK A;  1HG2 A;  4O1P A;  4G11 A;  4HOR A;  1E8Z A;  2RKK A;  4U8Y D;  2NXP A;  2DVW A;  3MJW A;  4J8F A;  2BUG A;  5A6C A;  3DWL G;  3J5P A;  3CVL A;  2VSY A;  4I1O B;  5KCM A;  3CVP A;  1OWP A;  3Q9U C;  5HRY A;  3AU4 A;  3TGO A;  4YDO A;  2M63 A;  4KMO A;  4I1A A;  2J8S D;  5AYW D;  4I17 A;  5KJL A;  3EHN A;  1TNU A;  3TWS A;  2Y69 E;  1HF8 A;  1OWN A;  4DJA A;  2WXH A;  3ASO E;  4I6J A;  3AG2 E;  5AN8 A;  1NA3 A;  5AQB A;  3FTY A;  5HKP A;  2XCC A;  3SQV A;  4HVB A;  1TJC A;  5CMW A;  4U0Z A;  4TRQ A;  2WXG A;  2GRP B;  1KZP A;  4ANV A;  4OAV B;  2FEZ A;  2VGY A;  1D8D A;  1UN8 A;  2OCC E;  3T5V A;  1WAO 1;  2ILR A;  4DX1 A;  3MZL B;  3CSF A;  3OXL A;  1HZ4 A;  2X6K A;  4ILG A;  4HRN A;  3R7Q A;  2LSU A;  2PM7 A;  3FUE A;  4O60 A;  3CKB A;  3QWW A;  1NFI E;  4JHK A;  5LCW J;  2QY7 A;  3DEP A;  3UM0 A;  1L5J A;  3ASN E;  1QBQ A;  4GB9 A;  3SD5 A;  2FO1 E;  3B7B A;  2XZD G;  3ZUV B;  3MEK A;  4B8A A;  3NZS A;  3KAE A;  3W9F A;  1LF8 A;  3ASD A;  2CHX A;  3BQO A;  4QFV A;  4U07 A;  1S70 B;  1SZ9 A;  4UWK A;  4UQZ A;  3L9T A;  3ZYK A;  5AJL A;  4P29 A;  4JEH A;  4AM9 A;  4CRW A;  2XEH A;  4XEI G;  3C72 A;  2HR2 A;  3EIQ C;  3BG0 B;  3ULQ A;  4BTA A;  4RG6 A;  4GCO A;  2H6G A;  4CZ2 D;  3EHQ A;  1TNY A;  1MHQ A;  5C2Y A;  3FEX A;  3VLD A;  5KNG A;  5BW8 C;  4K5C A;  5KJN A;  3D9O A;  4LUN U;  4PDX A;  4WWP A;  4I9E A;  5J90 A;  2Y4U A;  5J08 A;  4G1T A;  3NB2 A;  2AXZ A;  3DRA A;  1HH8 A;  3LPZ A;  4RSY A;  3NOG D;  3AS4 A;  2FUL A;  1E90 A;  2A4Z A;  2AW6 A;  2WXP A;  2HE0 A;  4BEP A;  2ETA A;  3UTM A;  4GTR A;  3QJZ A;  4KT6 B;  3CLJ A;  3OXF A;  2R02 A;  3QAR A;  3N71 A;  5ENP D;  4APO A;  3F6Q A;  4FHK A;  1O1T A;  1XGW A;  4GAA A;  3C3O A;  4U04 A;  2ZU6 B;  4U8H A;  2P9S G;  3EU9 A;  5EYL A;  2GRM A;  5H7P A;  1OT8 A;  2WQ7 A;  3CV0 A;  1EYH A;  2XEV A;  3EIJ A;  4KVM A;  1SA5 A;  3D9J A;  4GPK A;  3VLF A;  5A7D B;  4N3A A;  1N52 A;  1U3D A;  3SFZ A;  4HOQ A;  1ELW A;  1EPU A;  3ML9 A;  1DCE A;  2QZA A;  4NUR A;  1YCS B;  3P2B A;  4B94 A;  4KZC A;  1D8E A;  3UIP C;  3IKO B;  3L13 A;  4WNF A;  3GW4 A;  1KLX A;  2E0I A;  4AEZ C;  1Y6I A;  3Q78 A;  3MKR A;  3IV0 A;  3UT8 A;  2PL2 A;  3UKU G;  2WXM A;  2PQR A;  4HOU A;  5DBK A;  1D9S A;  1JUQ A;  5EN5 D;  2P9L G;  4I9C A;  1UJK A;  3HXB A;  3V2X A;  3UM3 A;  4I1M A;  2LAI A;  4E6H A;  2Y1L E;  2VSN A;  3SNX A;  2EIL E;  4JW1 A;  4RVB A;  2MYO A;  4DK5 A;  2CFU A;  3MGB A;  3FU5 A;  2DWZ A;  2CHZ A;  2P2C P;  3GZ1 A;  5G2N A;  4TXP A;  3JXJ A;  4LER A;  2LO6 A;  3NAW A;  3SFY A;  4J6I A;  3TXN A;  2EIN E;  5DIZ A;  1QZ2 A;  1K3Z D;  1O1S A;  1OCC E;  3FTV A;  3PE4 A;  5M72 A;  4WWO A;  3BUA A;  3T5X A;  3AG4 E;  4CEM A;  3ZN3 A;  1Z3Y A;  3UXG A;  3E4B A;  4HI9 A;  3CVV A;  5D2M C;  5D66 A;  4U96 D;  3PUK A;  4U0U A;  3SGH A;  2C0L A;  4HLE A;  4GMR A;  2A5U A;  3U3W A;  5CBN A;  2X3M A;  2YIN A;  3L22 A;  4GTO A;  4HLL A;  4DX5 D;  2MOW A;  2KC7 A;  3LXU X;  1ZB1 A;  3SF4 A;  1OY3 D;  2L0I A;  4GTT A;  3RK6 A;  1OCO E;  5AAR A;  3X2Q E;  3FEY A;  4EZL A;  5B1B E;  4N3C A;  3IHV A;  3UMV A;  2ETB A;  4CDM A;  1N4R A;  1P5Q A;  3OXG A;  4OVV A;  2FI7 A;  3Q9N C;  3S7F A;  4EHM A;  3SI5 A;  4JB8 P;  4JD2 G;  4M7C A;  3FY4 A;  4GTV A;  2OOE A;  2J07 A;  4EBA G;  3CQG B;  3FH5 A;  1Q2Z A;  1INZ A;  3C98 A;  2BTD A;  2IF4 A;  4IRU A;  3FDH A;  3FUK A;  3LVR E;  3DSV A;  3WXX A;  4FU3 A;  4ILH B;  2JEK A;  3S2A A;  4MRU A;  4FC8 A;  4GYW A;  3ZYM A;  2GGF A;  4F53 A;  4LRZ A;  1IKN D;  3ABM E;  1JCR A;  2CFZ A;  2RG8 A;  2X38 A;  3TWV A;  4ZHB A;  3OAW A;  1K1A A;  5FJY A;  2Y4T A;  5BT1 A;  1MX6 A;  4JL0 A;  2PQN A;  3AU5 A;  4YDW A;  4ABN A;  1N95 A;  3ZHE A;  3E34 A;  4MKT A;  4J8E A;  3ZEF A;  4CGV A;  2WVI A;  2NSZ A;  4DX6 D;  5JA4 D;  2OVB A;  4YDY A;  2FBN A;  1SZA A;  1H6O A;  3D9H A;  2KXP C;  4HRM B;  3ML8 A;  3MX3 A;  3Q7F A;  3LS8 A;  1BD8 A;  1E8X A;  3B7T A;  5EIB E;  3PZD A;  3JXI A;  4M3O A;  3EJN A;  4DI4 A;  3FFL A;  3HXD A;  2I2O A;  3ZNG A;  2XRZ A;  3PNT B;  5B3S E;  4FJZ A;  3WG7 E;  5BUZ A;  2V4L A;  3HG0 D;  1LD8 A;  1TYQ G;  3SY2 A;  5BNW A;  4G8L A;  4N2Q A;  5A23 A;  3CK8 A;  5HI7 A;  4H7Y A;  3UM1 A;  3DSU A;  5G05 C;  3FUH A;  4JEU A;  4NRH B;  4PUC A;  4FAD A;  2J09 A;  1OCZ E;  5FZS A;  4GZC A;  4BX9 A;  2NC9 A;  1OUV A;  2QFC A;  5JHA A;  5JJT A;  4R7L A;  4A1G A;  2VYI A;  3LCA A;  1UG3 A;  2AXV A;  3NOC D;  5FT9 A;  2IY0 C;  3EDT B;  5AJD A;  5AAO A;  4MS6 A;  2F0Y A;  3DXK G;  5EYP F;  3IBE A;  3E37 A;  4I43 A;  3MV3 B;  5LOZ A;  2IEJ A;  2V5F A;  1Z3X A;  3CVX A;  3UI2 A;  1OWL A;  3ZGQ A;  1SQM A;  3OTN A;  4GYY A;  2AVP A;  4JHJ A;  4F3V A;  2XPZ A;  5T3R A;  3VTY A;  3FU6 A;  3PZ2 A;  4AP2 A;  4JVS A;  2IO3 C;  2XS1 A;  5FQ6 A;  5C1D A;  2WPV A;  4APF A;  4XI9 A;  3TXM A;  3ZHE B;  3ABK E;  2LUH A;  2ZGD A;  4Y6W A;  4NIK A;  4AY5 A;  2XS8 A;  1FCH A;  2KZT A;  4BY6 A;  4DX2 A;  5JJ7 A;  3B7R L;  1N4P A;  2VTB A;  2Y0B G;  4GA2 A;  2L6J A;  1N0R A;  4YND A;  3ULE G;  2EIJ E;  3RIB A;  2P9P G;  5KWD A;  2WXO A;  3NF1 A;  3PE3 A;  1TN6 A; 
#chains in the Genus database with same CATH homology
 2WM9 A;  2R17 C;  3D9J A;  4WNG A;  2V0P A;  4GPK A;  4K03 A;  2HO1 A;  4FP7 A;  4YVO A;  2J4D A;  1E8Y A;  2FF4 A;  3VLF A;  2KCL A;  1FVH A;  5A7D B;  3T8M A;  4AVX A;  4N3A A;  1N52 A;  1U3D A;  2J9Q A;  2KAT A;  4ME2 A;  4A1S A;  3SFZ A;  4HOQ A;  1ELW A;  4F7A A;  1EF1 C;  4WNE A;  3RU0 A;  1OWO A;  3QNK A;  1EPU A;  4BSX A;  4BWR A;  3ML9 A;  3U9W A;  4L1B A;  3FUI A;  3UT7 A;  4ACL A;  4NUR A;  3P2B A;  5FQ4 A;  3PUJ A;  1KT1 A;  1HFA A;  4CCA A;  4LCT A;  3GYZ A;  3JCK C;  1TEZ A;  3FUM A;  4EZK A;  4I6E A;  5ARG A;  4A3V A;  4B94 A;  4KZC A;  2IOS A;  3P1U A;  5CMY A;  5BV0 A;  2L0T B;  1H2V C;  1JWF A;  3AS8 A;  3IKO B;  3KD7 A;  3L13 A;  2CG2 A;  4PS7 A;  4WNF A;  5G04 C;  2WXL A;  1KLX A;  3GW4 A;  2E0I A;  2VGX A;  3Q4A B;  3ZFW A;  1E96 B;  3SZ7 A;  3Q5M A;  4BFR A;  3GZ2 A;  1Z6T A;  4AEZ C;  1Y6I A;  3QKY A;  2XPY A;  3URZ A;  3CEQ A;  3LY8 A;  3MKR A;  3IV0 A;  3UT8 A;  3CHR A;  4Q94 A;  5EX0 A;  3APF A;  2PL2 A;  4UWF A;  4G24 A;  4HFG A;  4UI9 C;  3PH0 C;  5FWQ A;  2MRI A;  2WXM A;  3RO3 A;  2PQR A;  4G2V A;  1JPL A;  4O6F A;  1YA0 A;  4AV7 A;  2IU1 A;  3CIA A;  3DBS A;  3SBT B;  3QAQ A;  4U63 A;  4HOU A;  3CHQ A;  5DBK A;  3D9I A;  4L2Y A;  4URK A;  3G2S A;  4ANU A;  3B13 A;  2C0M A;  1JUQ A;  4GZ5 A;  4UQX A;  3ASF A;  3CHO A;  4GZ6 A;  3G2V A;  4YVQ C;  3RRU A;  3S7J A;  4JPS A;  5CCL A;  1HU3 A;  4N3B A;  2I1K A;  3D9K A;  2CG3 A;  2X6H A;  5G55 A;  4I9C A;  3IHY A;  3FUJ A;  4FHJ A;  4HS2 A;  1UJK A;  2XQ0 A;  3FUF A;  3UUX A;  4I1M A;  4WWN A;  4H7X A;  2PZI A;  4MLP A;  2LAI A;  3RRN B;  5ANL A;  3RO2 A;  3PVL A;  4E6H A;  5KJK A;  3QC1 A;  4FLB A;  5BV1 A;  4KXK B;  1U3C A;  2VSN A;  2KCK A;  4WUY A;  4J8S A;  3SNX A;  4JW1 A;  4RVB A;  4DI3 A;  4DK5 A;  2CFU A;  3D9P A;  2UWJ G;  3MGB A;  3D9M A;  1WY6 A;  3FU5 A;  1IQU A;  4KZ0 A;  4XX5 A;  2CHZ A;  3R9A B;  3GZ1 A;  3I5P A;  2OV8 A;  5G2N A;  1QQE A;  3LYA A;  2Y3A A;  3PRZ A;  4LER A;  2LO6 A;  3PNL B;  4GZD A;  5D0Q D;  3G2T A;  4J6I A;  5ENN A;  3TXN A;  5DIZ A;  1ELK A;  3ASH A;  1QZ2 A;  3RKV A;  3FTV A;  3PDN A;  4EBA A;  1PY1 A;  4AJW A;  3HYM B;  3PE4 A;  2XRY A;  5M72 A;  4PS8 A;  2C2L A;  5T4Y A;  3O48 A;  2LNI A;  1UW4 B;  4WWO A;  2ION A;  4EZJ A;  4CGW A;  3T5X A;  1PAQ A;  3PS6 A;  4WND A;  4CEM A;  3ZN3 A;  1Z3Y A;  3GZS A;  2J08 A;  3QDN A;  3E4B A;  1HX8 A;  2WQH A;  3Q49 B;  5FZR A;  5LX8 A;  3B7S A;  3CVQ A;  3S7D A;  4G23 A;  2KM4 A;  2I6H A;  5EKQ D;  1H19 A;  3CVV A;  4AIF A;  3PUK A;  4CDN A;  5T8I A;  4DPR A;  2DCP A;  4U0U A;  2WXJ A;  5KJM A;  4IN3 B;  4IYP A;  4I2Z A;  4TUU A;  4AXH A;  3SGH A;  4HXI A;  2YHC A;  4UWG A;  3LY7 A;  3CK7 A;  2C0L A;  3FH7 A;  4HLE A;  4EQF A;  4PS3 A;  2A5U A;  3I4R B;  2MHK A;  2OND A;  3U3W A;  2X3M A;  2YIN A;  1NZN A;  3L22 A;  2WXQ A;  2JLB A;  4U0S A;  2BF0 X;  4BX8 A;  3DPD A;  3UT4 A;  3CR3 A;  3LJ3 A;  1GW6 A;  3NZU A;  4NQ0 A;  5ANR A;  4KYO B;  2KZT B;  1FVF A;  3CVW A;  4JZY A;  2MOW A;  3EHM A;  1W3B A;  4JHR A;  2KC7 A;  3ZIM A;  1H6K A;  3LXU X;  3FTS A;  5G04 J;  4ILI A;  1IHG A;  1JWG A;  4JC8 A;  3SF4 A;  4C0E A;  3D9L A;  3CHP A;  1ELR A;  2VTB B;  2YNQ A;  4CDR A;  1IYG A;  3G2U A;  4EPZ A;  2L0I A;  4XKC A;  2DIW A;  4GZ3 A;  3CVU A;  2WMN A;  3CK9 A;  4G25 A;  4E85 A;  1OWM A;  3LEW A;  4IUL A;  3RK6 A;  1MQS A;  4FLH A;  3FEY A;  4AOF A;  4EZL A;  4UI9 K;  3PEV B;  4UI9 J;  3HVE B;  3U66 A;  5CCM A;  4B89 A;  4N3C A;  3IHV A;  2CHW A;  5BPP A;  2X6J A;  3G2W A;  3UMV A;  3TG4 A;  3KEZ A;  4D10 C;  4CDM A;  4A3T A;  4LEU A;  1P5Q A;  5FTP A;  3B7U X;  3CQC B;  1X5B A;  3OXG A;  4OVV A;  3FTU A;  4UQY A;  3ESK A;  2FI7 A;  4BTB A;  3S7F A;  3FP3 A;  3ZYQ A;  3SI5 A;  3U64 A;  4W9R A;  1HG2 A;  3D3M A;  3FY4 A;  2OOE A;  2J07 A;  4G11 A;  4ANX A;  4EBA G;  4ATG A;  4HOR A;  1E8Z A;  5LCW C;  3CQG B;  2AWI A;  1H2T C;  2NXP A;  3L08 A;  3FH5 A;  3MJW A;  4J8F A;  4RG9 A;  2BUG A;  4L2L A;  4C0M A;  5A6C A;  2VQ2 A;  4BT9 A;  3MKQ A;  3L17 A;  3C98 A;  1INZ A;  2BTD A;  3CVL A;  2VSY A;  2Q7F A;  3Q47 B;  4I1O B;  3VTX A;  5KCM A;  3TAX A;  2WB2 A;  2IF4 A;  4IRU A;  4FA6 A;  3UPV A;  2VGX B;  3FDH A;  1TJF A;  3FUK A;  3LVR E;  3CHS A;  1OWP A;  3CVP A;  4CT0 A;  4J8D A;  3ZVV A;  3WXX A;  4FU3 A;  3JQ1 A;  4ILH B;  2JEK A;  3S2A A;  3ZYL A;  2UY1 A;  3LY9 A;  5C1D A;  3O4Z A;  3UQ3 A;  4MRU A;  4FC8 A;  2J4B A;  5HQ8 A;  3KS2 A;  2XCB A;  3AU4 A;  4GYW A;  3TJP A;  3TGO A;  3ZYM A;  2GGF A;  4F53 A;  4PH4 B;  4LRZ A;  1H0A A;  2M63 A;  4KMO A;  4Q96 A;  4I1A A;  3HDX A;  5AYW D;  2DBA A;  4I17 A;  3APD A;  3EHN A;  4K0R A;  5KJL A;  4XE0 A;  2CFZ A;  2RG8 A;  1QNF A;  2X38 A;  1HF8 A;  3OAW A;  5FJY A;  5BT1 A;  2Y4T A;  1OWN A;  4DJA A;  4JL0 A;  2PQN A;  3AU5 A;  3QK0 A;  2KCV A;  2WXH A;  5FQ8 A;  3MCX A;  2GRL A;  1HXI A;  3L6A A;  4ABN A;  3ZHE A;  4I6J A;  2HM8 A;  1NA0 A;  1VDY A;  4XI0 A;  4MKT A;  3L16 A;  1NA3 A;  1IQR A;  4HOT A;  4J8E A;  4B8C B;  3ZEF A;  3FTY A;  3JYS A;  4GA0 A;  4CGV A;  2WVI A;  4KBQ A;  1S0P A;  3FWV A;  2NSZ A;  2WMO A;  2XCC A;  2OVB A;  4HVB A;  4FJY A;  2FBN A;  1SZA A;  1TJC A;  3I3N A;  2AXU A;  5CMW A;  5E75 A;  1N54 A;  4U0Z A;  2WXK A;  4TRQ A;  2WXN A;  2EQX A;  1HO8 A;  4XKB A;  4ACK A;  3D9N A;  2WXG A;  3PRE A;  4ANV A;  4I6G A;  3ML8 A;  2IJG X;  2FEZ A;  2P58 C;  2VGY A;  3FUL A;  1E8W A;  3MX3 A;  2RD0 A;  3CVN A;  3LS8 A;  1UN8 A;  1E8X A;  3B7T A;  1ZU2 A;  3T5V A;  1WAO 1;  3CVY A;  2ILR A;  3HHM A;  3PZD A;  5EX3 A;  4M3O A;  3AS5 A;  3FTZ A;  3EJN A;  4DI4 A;  3FFL A;  1KT0 A;  2YQ8 A;  3MZL B;  3CSF A;  2I2O A;  3FTX A;  2XRZ A;  1UN9 A;  3OXL A;  1HZ4 A;  3PNT B;  4XZ4 A;  3K9I A;  2X6K A;  3PEU B;  4ANW A;  4ILG A;  4FJZ A;  3R7R A;  2GW1 A;  4EEC A;  5BUZ A;  3FUN A;  2V4L A;  3QOU A;  3VLE A;  5BNW A;  3ENE A;  2LSU A;  2PM7 A;  3R7Q A;  4N2Q A;  3ZXS A;  3ZPJ A;  5A23 A;  3BG1 B;  3FUE A;  4J0U A;  3CK8 A;  5HI7 A;  4F1S A;  3FU3 A;  3CKB A;  1Y8M A;  3QWW A;  2WXR A;  4JHK A;  5CHE E;  4G26 A;  4H7Y A;  5LCW J;  2QY7 A;  2IQC A;  1L5J A;  4A55 A;  1DVP A;  4GB9 A;  3SD5 A;  5ARF A;  4UWL A;  5G05 C;  3FUH A;  4V3I A;  4KVM A;  3APC A;  3MEK A;  3FU0 A;  4B8A A;  4JEU A;  4NRH B;  4PUC A;  4C9B B;  4FAD A;  2J09 A;  5FZS A;  3NZS A;  3KAE A;  5JJ6 A;  3FHE A;  1LF8 A;  4GZC A;  2XGM A;  4BX9 A;  1ZBP A;  3RRM B;  2NC9 A;  3FH8 A;  2HYZ A;  3IEG A;  1OUV A;  4JA7 A;  2QFC A;  4L23 A;  4B0Z A;  5JHA A;  3ASD A;  2CHX A;  5JJT A;  4FUL A;  4DLQ A;  4QFV A;  4U07 A;  4N2S A;  4R7L A;  5E76 A;  2XPI A;  1NP7 A;  4GYO A;  4A1G A;  3ONK A;  3Q15 A;  3CGH A;  2L9B A;  3MYV A;  2VYI A;  3LCA A;  4Q69 A;  4UWK A;  1SZ9 A;  1UG3 A;  2AXV A;  3QB2 A;  4UQZ A;  3SHF A;  4OYS A;  5FT9 A;  3UX4 A;  3FTW A;  3EDT B;  5AJD A;  3ZYK A;  5AJL A;  3TL5 A;  2WXF A;  4P29 A;  1HG5 A;  4JEH A;  2XHE A;  1E7V A;  3ESL A;  2FO7 A;  3I4G A;  4MS6 A;  3MV2 B;  4AM9 A;  3ASG A;  4I2W A;  5AEN A;  3IBE A;  1A17 A;  1PC2 A;  4CRW A;  2IFU A;  4GMJ A;  2OVF A;  2HR2 A;  4I43 A;  3MV3 B;  3EIQ C;  3BG0 B;  4JA9 A;  4HOS A;  3ULQ A;  5LOZ A;  4L7T A;  2R59 A;  2V5F A;  4BTA A;  2WXI A;  2LAH A;  2YHE A;  1Z3X A;  4RG6 A;  3CVX A;  2IOL A;  4GCO A;  1OWL A;  2VSX E;  3MKQ B;  4GML A;  1E7U A;  3HIZ A;  5FZQ A;  3TG5 A;  1MHQ A;  3ZGQ A;  1SQM A;  3QWV A;  2PM6 A;  4GU5 A;  4XIF A;  5C2Y A;  3FEX A;  3VLD A;  3CKC A;  5FQ7 A;  3S7B A;  3OTN A;  5EDS A;  5LP0 A;  5BW8 C;  4GYY A;  2AVP A;  2J49 A;  3D9O A;  4LUN U;  5KJN A;  4PDX A;  2UY1 B;  3JUI A;  3RJV A;  4JHJ A;  4GCN A;  4F3V A;  3LVQ E;  4BT8 A;  2XPZ A;  2XGO A;  4NAC A;  4WWP A;  5T3R A;  3MA5 A;  4I9E A;  3VTY A;  5J90 A;  5D0O D;  2Y4U A;  3FU6 A;  5J08 A;  4AP2 A;  4JVS A;  1DNP A;  4G1T A;  5FQ6 A;  4KVO A;  2WQ6 A;  2AXZ A;  4TV3 A;  3QWP A;  1HH8 A;  3LPZ A;  2I1J A;  1XNF A;  4RSY A;  3AS4 A;  1B89 A;  1E90 A;  2FUL A;  2WPV A;  2V8S E;  2A4Z A;  2AW6 A;  3CHM A;  4APF A;  3ZW3 A;  1HS6 A;  3JQ0 A;  2WXP A;  4XI9 A;  4WAF A;  3CST A;  3TXM A;  3ZHE B;  1EDU A;  3FUD A;  3LKU A;  3QJZ A;  4Y6W A;  4KT6 B;  3CLJ A;  3OXF A;  5LFA A;  3BEE A;  4AY5 A;  3QAR A;  2X6I A;  4UWH A;  3N71 A;  3ZRH A;  4APO A;  2I9C A;  1FCH A;  2KZT A;  4FHK A;  4BY6 A;  1XGW A;  4GAA A;  4N5C A;  4OVU A;  4U04 A;  2ZU6 B;  1BPO A;  5G05 J;  5JJ7 A;  3B7R L;  1HE8 A;  4U8H A;  3SBS A;  2VSO E;  3LDZ A;  2VTB A;  4GA1 A;  3NQP A;  1H2U A;  4GA2 A;  2VJ8 A;  4AY6 A;  2E2E A;  2L6J A;  2X6F A;  4DLO A;  3ONL A;  4CT4 A;  4YND A;  5AIJ A;  2GRM A;  3L54 A;  4N39 A;  2WQ7 A;  3RIB A;  3U4T A;  3HVE A;  4JXT A;  3CV0 A;  4Y6C A;  2R5S A;  1EYH A;  2XGS A;  2LSV A;  1WM5 A;  2WXO A;  3NF1 A;  1UJJ A;  2XEV A;  3EIJ A;  5JHB A;  3PE3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...