2EQXA

Solution structure of the back domain of kelch repeat and btb domain-containing protein 4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
GSSGSSGVQVGNCLQVMWLADRHSDPELYTAAKHCAKTHLAQLQNTEEFLHLPHRLLTDIISDGVPCSQNPTEAIEAWINFNKEEREAFAESLRTSLKEIGENVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Structural genomics, unknown function
molecule keywords Kelch repeat and BTB domain-containing protein 4
publication title Solution structure of the BACK domain of Kelch repeat and BTB domain-containing protein 4
rcsb
source organism Homo sapiens
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2eqxA01
4AP2A 4HS2A 3HVEB 4APFA 3I3NA 3HVEA 2EQXA 4HXIA
chains in the Genus database with same CATH superfamily
4DJAA 1Z6TA 4AP2A 3ZU7B 4O1OA 1NZNA 2XZDG 2ZIRA 4G26A 1HFAA 1FT1A 2IQCA 1H2VC 3I4GA 2HE0A 4FLBA 5HS0A 3ABKE 1SQMA 5BUZA 1HX8A 3QARA 3D9LA 4ILHB 3QOUA 5EDSA 1N4PA 4GTSA 1BD8A 4BX9A 2KZTA 4KBQA 5FQ8A 1N94A 2HR2A 5M72A 3ENEA 2MYOA 4HNAD 3CHSA 5EIDA 1P5QA 3FH5A 2LUHA 2GRLA 4KXKB 4K0RA 2L9BA 1IXVA 3BUAA 4L9PA 1AP7A 2DYSE 3CVVA 1TYQG 4I17A 4EPZA 3FUFA 2KCLA 3MGBA 3SFZA 3HYMB 2P9UG 3UM2A 3FTWA 3B13A 3MYVA 4KZCA 3SD5A 2RKKA 4HLLA 1G3NB 2EIME 2XGMA 1N95A 2RFMA 3D9IA 3GYZA 3D9OA 2F8YA 4M3OA 4JVSA 4ACKA 3JQ0A 3RO2A 3AS4A 4U63A 4GZCA 3QAQA 4FLHA 4GYOA 3L9TA 1H6PA 2X38A 2ZXWE 5FZSA 1QYMA 5AJLA 1TEZA 1N0QA 5HI7A 3AS5A 2H6HA 2FEZA 1A5EA 5ENTD 3QNKA 2WB2A 3PE3A 4G2VA 5E75A 3SFYA 4U8VD 1WDYA 4XZ4A 3RRMB 2IFUA 2BUGA 4OAVB 4LERA 3TXNA 5ARGA 4K5AB 4N3AA 1PC2A 2X6JA 4UWLA 3J5QB 4ANUA 2C0LA 5ENOD 4BT9A 2IU1A 3T5VA 3Q49B 4KMOA 3U66A 4ABNA 3V2XA 1N11A 4PUCA 1JWGA 3C3RA 3ZUVB 2PM6A 2R05A 3Q9NC 5JHAA 3MA5A 2DWZA 2WVIA 1BPOA 2CHZA 2R03A 5CMWA 4DRXE 3FUHA 2WQ7A 5ENQD 1KT1A 1INZA 4I6GA 2WXJA 3DEOA 5T8IA 5ENNA 1TJFA 3HXFA 3ZXSA 3VLFA 4JEHA 4GTVA 2MHKA 3C5RA 1HE8A 2F37A 1OT8A 1NL4A 3QK0A 3BG0B 3AG4E 3PRZA 5EYPF 2I9CA 2F0YA 3CHRA 3ASFA 3PNLB 3FUKA 3UT8A 4JD2G 2P9IG 2QFCA 2NXPA 4LEUA 1FPPA 2GRQB 3FEXA 2Y3AA 5EIBE 4J8DA 1S63A 3AS8A 3ASNE 2XRZA 2QZAA 2XPZA 1KPSB 3EIQC 4GA0A 5B1BE 3W9GA 3I4RB 3FH7A 4HOUA 5KWDA 3GZ1A 3CKCA 3ZEFA 2IF4A 1OWLA 2FULA 3SNXA 3LDZA 3ONLA 3AG1E 2X6IA 3CK7A 2DYRE 5FT9A 3CK8A 2XRYA 4YDYA 3PVLA 4IULA 3PDNA 3UUXA 4J8EA 4TXPA 4HS2A 3MV2B 1RW2A 3FTVA 1TN7A 4L7TA 2L6JA 4HOTA 3FUIA 1U2VG 3D9JA 4CT0A 1DVPA 2A5UA 4UQZA 4AV7A 3ZRHA 4BSXA 4DX2A 3ML9A 1PAQA 2IOSA 2ZU6B 3APFA 5BV0A 1HZ4A 5KNGA 5AJDA 4N2QA 1HU3A 3L54A 1HS6A 2OVFA 4LCTA 1Z3YA 2Q7FA 2KBXA 2ILRA 2WM9A 1SVXA 2R2LA 1OWPA 1N54A 3CEQA 3FFLA 4DK5A 4UI9J 3BU8A 2EILE 3Q79A 4W9RA 2XS8A 4B8CB 3P1UA 3TAXA 3RAUA 2XZTG 2BKGA 4J8FA 1LTXA 3ASOE 1WM5A 2P9SG 3TL5A 3EHQA 2V0PA 3JXJA 4R7LA 2ETBA 5D0QD 4UI9C 4ILIA 4CCAA 3ULQA 3ZYQA 2KC7A 1O1RA 2DZOA 3G2SA 2VSYA 2X6FA 3ZN3A 3HXBA 4LG6A 4BTAA 2V8SE 3LCAA 3QB2A 5AENA 4EQFA 4JHRA 3DRAA 3HG0D 4ZFHA 3ZVVA 4TUMA 1Y8MA 5CEAA 3P2BA 2FI7A 1N9AA 5CERB 1A17A 5A6CA 3R7QA 4UUCA 3ZXPA 1ELKA 4B89A 1MZCA 1V54E 2M63A 4RG6A 2V5FA 4B0ZA 5AYWD 2RFAA 2BTDA 5FJYA 4OAUC 4WUYA 2WXHA 5AQBA 5FQ6A 3U64A 4DLQA 4U04A 4PS3A 2WXRA 1D8DA 3TWSA 4K5CA 4LNBA 3SO8A 1XGWA 3CKBA 1ELRA 4B8AA 4F7AA 3CVLA 4HOQA 1Q2ZA 4MLPA 5BXUA 1X81A 4L1BA 4ANWA 2ZISA 2YNQA 4G25A 2P9PG 3URZA 1MHQA 3FUEA 1OCZE 3Q7AA 4FHKA 3CHOA 3GZSA 2AJAA 2WMOA 1KZOA 1KT0A 4ME2A 4KYOB 1U3CA 3SHFA 4GTMA 1H0AA 3E32A 3NZUA 1IKND 4KT6B 5BNWA 3DPYA 5G55A 4APFA 4A3TA 3PNTB 1HH8A 1FVHA 4MBGA 3RIBA 4I6EA 3QWVA 1E96B 3CLJA 5LX8A 3D9HA 3UKUG 5C1DA 3VTYA 2IO3C 3G2WA 1X5BA 2IJGX 4H7YA 3L17A 4NACA 3KD7A 1OXJA 3ESLA 1YMPA 5J90A 2F8XK 4TXQA 2YHCA 5CBOA 2B0OE 3ZYKA 1E90A 3BEEA 2V4HC 3EJNA 3IEGA 4YVQC 3NOGD 4O6FA 2EIKE 5JJ7A 4K5BA 1MX2A 2VQ2A 4J8YA 3CQCB 5DBKA 4GU5A 1MYOA 3RRNB 4AVXA 3U4TA 1HXIA 3FUMA 3E37A 3B95A 4DUIA 1VDYA 1AWCB 3ZYMA 1IHBA 2VSOE 3APDA 2CFZA 3SFXA 3KEZA 2AWIA 1E8YA 3NF1A 4A63B 4A55A 1EYHA 1UW4B 3S7BA 1JWFA 3N71A 4CZ2D 3TWXA 2EINE 3ASGA 1H2TC 3TG5A 3LKUA 1NA3A 3DXMG 3CGHA 3SI5A 4FP7A 4G1TA 3FTYA 2PM7A 2OVBA 1U3DA 3OXLA 4AXHA 2Y69E 4NURA 4K03A 5FZQA 4EZKA 1NFIE 4G24A 3LVRE 2I6HA 5EX0A 2LSVA 5BT1A 4LSZE 5CRUA 3TXMA 4BFRA 2EIJE 3BQOA 4UWKA 4N5CA 1E7UA 2VGEA 4GPMA 1O5MA 3JQ1A 4JHJA 4ANVA 2A4ZA 3HVEB 4G8LA 4C0MA 2JABA 4Q96A 1OCOE 4OVVA 4FULA 1RZ4A 5HQ8A 3UX4A 2XGSA 5ITZF 3OXGA 4EBAA 2LXLA 3TWTA 2DBAA 2Y1LE 2VTBB 4N3CA 3JCKC 3E30A 4UWFA 4IRUA 5HKPA 4JB8P 3Q7FA 2VSNA 2XEEA 5CMYA 5ANRA 2EQXA 3R9MA 3FH8A 2KCVA 3AU5A 1NA0A 5J08A 4GCOA 3FUNA 4J0UA 4F1SA 2UY1B 3EHNA 4MKTA 3GZ2A 4V3IA 1OWNA 1K8KG 4P29A 3CK9A 3LYAA 4HLEA 3V79K 3ZKJA 3V2OA 3SQVA 4N2SA 2XPIA 1TNZA 3AU4A 3C3QA 3T9KA 5T4YA 4FC8A 1MJ0A 1FCHA 1H2UA 5BV1A 1QBQA 2WMNA 2WPVA 3MKRA 4J6IA 3FUDA 2PZIA 5LCWJ 3I3NA 3UIPC 1Z5SC 1NP7A 3CVPA 4CGWA 3ABLE 5KJKA 4WAFA 4U07A 2WQ6A 3PUKA 3RK6A 2LAIA 4YDOA 4BX8A 3IHVA 4C0EA 4D10C 5A7DB 1OWMA 2J08A 2OCCE 2E0IA 4IN3B 4Y6CA 5LCWC 5LFAA 2FBNA 4HB5A 4LNGA 3VLDA 4U0UA 4A3VA 1W3BA 2HO1A 3D9KA 2P2CP 5FIOA 5BW8C 4GCNA 2XS1A 2MOWA 1H6OA 3TJPA 5G04J 4C48B 3TWVA 4HI8A 5ENPD 4C9BB 4F1PA 5AQ9A 1UJKA 3Q15A 3ZIMA 5B3SE 1KZPA 1E7VA 3HIZA 2I2OA 4O1PA 4HBDA 3IHYA 1S70B 3LS8A 1JCQA 4F3VA 3HXCA 4UQYA 5EN5D 1MQSA 2XCBA 2L6BA 5G04C 4A1SA 3ABME 4YVOA 2DVWA 3FUJA 3JUEA 4JZYA 4LRZA 1O1SA 4RQIA 2R02A 3SBSA 1TJCA 4AIFA 2VGYA 1YA0A 1UJJA 1YCSB 4BT8A 5EILA 5AQAA 4APOA 2HYZA 4U96D 4XKBA 2GRNB 3B7BA 4UI9K 2VTBA 1TR4A 2AXZA 4FADA 2PQNA 3RO3A 3B7RL 1DCQA 2H6GA 3IXEA 4I1OB 3CVYA 1N4RA 4IYPA 3FU6A 3FTSA 3O48A 1MX6A 4Z68A 2V5QC 1PY1A 1TNOA 1E8ZA 3FU3A 1N52A 5D2MC 4KVMA 3KSLA 3SZ7A 2P9NG 5CHEE 2XHEA 4HVBA 4Y6WA 3FULA 3KSQA 3AJIA 2KZTB 4OYSA 5A23A 2UY1A 5JJTA 3S7DA 4LNUD 4BSZB 3L22A 3Q9UC 4FJZA 4QQIA 2Y0BG 3QDNA 2J9QA 4U8YD 4NQ0A 5FWQA 5ENRD 3FTZA 3SY2A 1UN8A 4GA1A 3ASHA 3LXUX 5C2YA 4YDEA 3Q75A 4GYWA 1LD7A 2J8SD 4NRHB 1B89A 3Q4AB 3EU9A 1H6KA 2J07A 3RU0A 2NSZA 3ZHEB 4ACLA 5AAOA 4WWPA 3HXEA 5AQ7A 5BPPA 2FO1E 3LJ3A 4GTPA 3SBTB 5LOZA 4EHMA 3CVWA 3EDTB 5EKQD 3MV3B 3QWWA 4AOFA 4JEUA 4FHJA 2KATA 3AG3E 5LP0A 1K3ZD 3EIJA 3L6AA 1FVFA 2AW6A 5FQ7A 4YNDA 3MKQB 3ZPJA 3LY7A 2J49A 4BESA 4LUNU 4E85A 1TNUA 3IKOB 2WXIA 4I6JA 1GW6A 2B6CA 4I9EA 3PH0C 3MCXA 3T5XA 4Q69A 2VGXB 4U8HA 3IBEA 4DPRA 2DCPA 3UINC 5IY5E 4HRNA 2QC9A 4HFGA 2IOLA 4AY5A 1YYHA 1ZB1A 3ZW3A 2WXMA 4CEMA 3LEWA 1TNYA 2L0IA 3E34A 3ONKA 3QC1A 3CSTA 1MX4A 1WY6A 3ZFWA 5CCMA 4GAAA 1L5JA 4EECA 4N5QA 3WG7E 1HG2A 1BI8B 2AXVA 4HXIA 2IY0C 2C0MA 5B1AE 4GMRA 2NC9A 1N4SA 3MEKA 5ENSD 1TN6A 2GW1A 3APCA 4BERA 4FA6A 3S7JA 2WQHA 3V31A 2Y4TA 3UI2A 3TG4A 2LO6A 4GYYA 2YQ8A 3DXKG 4BETA 4PH4B 4WNFA 2XQ0A 4B94A 2I1KA 1XNFA 4NIKA 3AAAC 4JL0A 3TGOA 2NYJA 2J4BA 2J09A 3PS6A 3Q5MA 3B7TA 4WNGA 2DIWA 5G2NA 2R59A 2OEVA 3PEUB 2GRPB 5AARA 3FDHA 3J5PA 5CCLA 2BF0X 4YDWA 4DX6D 5KJMA 3Q47B 1ZU2A 4I9CA 2XPYA 4HRMB 3G2VA 2WXQA 1FT2A 4AY6A 1S64A 2KXPC 1SZ9A 1ZBPA 3PE4A 2CHXA 2JEKA 1SZAA 4ATGA 2ZGDA 3FU0A 3WXXA 2P58C 1O1TA 3UMVA 4X8QA 3CV0A 3UPVA 4WNEA 2YHEA 2LXMA 4JHKA 3ZGQA 1QZ2A 2RD0A 1K1AA 3CVQA 4CDMA 3CHMA 4WWNA 2PQRA 3LY8A 3UM0A 3QKYA 2I1JA 1JCSA 2P9KG 2C2LA 3NAWA 3ZHEA 5KCMA 3FU5A 3TWQA 2XEVA 1DC2A 4L2YA 4JPSA 4XX5A 3LJNA 2ZGGA 1E8XA 1JCRA 2FO7A 2X6HA 4CDRA 3MJWA 4GMLA 3PUJA 4JA7A 3NB2A 4N39A 3DSSA 4GTOA 3TWRA 3DSUA 1DCEA 4GZDA 2CHWA 3HXDA 3EU5A 3MKQA 4TRQA 3NQPA 3PZ2A 4MS6A 2AXUA 3S2AA 4BEPA 4DI3A 4CRWA 1IHGA 4RLYA 3L16A 1E8WA 1JUQA 4E6HA 3L82A 3CIAA 2OOEA 2VGXA 3CQGB 1OWOA 1N4QA 4TXRA 3S7FA 3ASDA 2WXKA 3D9PA 4UWGA 3IV0A 3UM1A 3EUVA 2KCKA 4URKA 3E4BA 3MZLB 2HM8A 5CECB 2XENA 3FP3A 3MX3A 3G2UA 3D3MA 4I43A 3T8KA 2X6KA 3C98A 2WXLA 1HG5A 1D8EA 3K9IA 3R7RA 2KM4A 4UWHA 3UXGA 3CR3A 4KVOA 3OTNA 4JC8A 3UTMA 3L13A 4GB9A 4KZ0A 1H19A 2XGOA 3LY9A 3UM3A 1WG0A 3PZ4A 4GZ3A 1NI1A 2IEJA 3F6QA 3ZYLA 2LSUA 3DSTA 4BY6A 4I1AA 3T8MA 3PEVB 4U0ZA 5KNHD 4B93B 3B7UX 5CEDB 2Y4UA 1SW6A 5HRYA 3G2TA 1KLXA 4DI4A 4HOSA 4HI9A 2R5SA 3FWVA 4Q94A 4RSYA 1UG3A 3NOCD 4PS7A 4WNDA 3CHPA 3D9MA 3TWUA 4F53A 3RJVA 3O4ZA 2PNNA 2GROB 5D0OD 4HRLA 4U0SA 4JW1A 1UOHA 2YINA 3KEAA 4G8KA 2H6FA 2BEDA 3Q78A 2WXOA 3C72A 3RSEG 4XI0A 3JUIA 3UIOC 3GW4A 2WXPA 1IQRA 2XEHA 5FZRA 3CHQA 3QWPA 3D9NA 4XE0A 1QNFA 2XCCA 2X3MA 5JJ6A 3Q73A 1WAO1 3PZ3A 2QY7A 1Y6IA 1IQUA 1HF8A 2E2EA 2L0TB 1OY3D 4G23A 3HVEA 5ARFA 2VJ8A 3FEYA 3ULEG 1QQEA 2ONDA 1BI7B 3VLEA 2J4DA 4WWOA 5EYLA 4UQXA 4RVBA 2UWJG 3X2QE 3HHMA 5CRVA 2H6IA 2GGFA 4CGVA 3LVQE 3HRAA 4J7WA 4TV3A 2V4LA 3SF4A 4EBAG 3DSVA 4DX7D 2WXFA 5KBAA 1K1BA 5ANLA 2FF4A 3JXIA 3DPDA 3UT4A 4CYMD 3EHRA 3CVNA 1S0PA 1OCRE 2OEWA 4ANXA 5KJNA 5FTPA 4GZ5A 2QYJA 1BU9A 3BG1B 1SA4A 4L23A 1BLXB 5H7PA 4GZ6A 4FU3A 3B7SA 4JXTA 3ULYA 3SGHA 3ESKA 4ZHBA 4I2WA 2JLBA 5T3RA 4JA9A 3HDXA 5JA4D 3DBSA 2WXNA 2CFUA 3PREA 3UKRG 3CSFA 3KS2A 4AM9A 4AJWA 4DLOA 4DX1A 3FY4A 1OCCE 5AIJA 2QYUA 5FINA 4AEZC 1D9SA 3ML8A 1IYGA 2A5EA 3C3OA 4M7CA 1EDUA 3PZ1A 4XKCA 2VYIA 5E76A 3CVXA 1EF1C 2GRRB 2MRIA 5CBNA 5EX3A 3DWLG 2RG8A 3TWWA 4N3BA 3LPZA 2VSXE 4I2ZA 5G05J 3CVUA 4I1MA 4F6RD 4J8SA 4BWRA 3EHMA 5JHBA 1LF8A 2CG2A 4XEIG 4GPKA 4EZJA 3AG2E 5D66A 4HQDA 3U9WA 2ETAA 3VTXA 3RKVA 3UT7A 4XI9A 4XIFA 1V55E 2ETCA 1HO8A 4U95D 5G05C 4GTTA 4U7EB 4H7XA 2R17C 4FJYA 2DZNA 4GMJA 3OXFA 4PS8A 4ILGA 1SA5A 3KAEA 1TN8A 4PDXA 3DEPA 4L2LA 2OV8A 5JMND 2WXGA 3V30A 4ATZD 3NZSA 3ISMC 4MRUA 1EPUA 1DNPA 2CG3A 3UQ3A 4GA2A 3DSWA 4O60A 1N0RA 3I5PA 5KJLA 1LD8A 4A1GA 2P9LG 5BXOA 3FHEA 3E33A 3JYSA 4CT4A 3OAWA 2AVPA 3RRUA 5AN8A 3DSXA 1JPLA 4EZLA 5DIZA 2IO2C 2BKKB 2IONA 2PL2A 3R9AB 4RG9A 3U3WA 4CDNA 1ELWA 3W9FA 2LAHA 1Z3XA 4G11A 2GRMA 3QJZA 3ZNGA 4OVUA 5FQ4A 4DX5D 4BTBA 4GTQA 4GTRA 4TUUA 3FTUA 3NBNB 2LNIA 4HORA 1UN9A 1TNBA 3L08A 4QFVA 3FTXA 1OUVA 3PZDA
chains in the Genus database with same CATH topology
1UJKA 3Q15A 1Z6TA 3ZIMA 4AP2A 4DJAA 1E7VA 3HIZA 2I2OA 4MS6A 2AXUA 3ZVVA 1NZNA 3S2AA 1Y8MA 3IHYA 5KJLA 4DI3A 3LS8A 4G26A 4CRWA 1IHGA 3P2BA 1HFAA 2FI7A 4F3VA 2IQCA 1A17A 1E8WA 3L16A 1H2VC 5A6CA 4UQYA 3R7QA 1JUQA 1MQSA 2XCBA 1ELKA 3I4GA 4E6HA 3CIAA 4B89A 2OOEA 4FLBA 2VGXA 5G04C 3CQGB 4A1SA 1OWOA 1SQMA 4YVOA 3FUJA 3S7FA 3ASDA 2M63A 2WXKA 3D9PA 5BUZA 4RG6A 4UWGA 3IV0A 1HX8A 2V5FA 2KCKA 4B0ZA 5AYWD 4URKA 3E4BA 2BTDA 3QARA 4JZYA 3D9LA 4LRZA 3MZLB 3QOUA 4ILHB 5FJYA 3SBSA 5EDSA 1TJCA 2HM8A 4WUYA 4AIFA 2WXHA 2VGYA 4BX9A 2KZTA 4KBQA 5FQ8A 1YA0A 3FP3A 3MX3A 5FQ6A 3U64A 3G2UA 3D3MA 1UJJA 4I43A 2HR2A 4DLQA 5M72A 2X6KA 3C98A 4BT8A 3ENEA 2WXLA 1HG5A 4U04A 4APOA 3K9IA 2HYZA 4PS3A 3R7RA 3CHSA 2KM4A 2WXRA 4XKBA 4UWHA 1P5QA 3CR3A 3FH5A 4KVOA 3OTNA 4UI9K 2VTBA 4JC8A 2GRLA 1XGWA 4KXKB 2AXZA 3CKBA 1ELRA 4K0RA 4B8AA 4F7AA 4FADA 2PQNA 3L13A 2L9BA 3B7RL 3RO3A 3CVLA 4GB9A 4KZ0A 1H19A 2XGOA 4HOQA 3LY9A 4I1OB 3CVYA 4MLPA 4GZ3A 4IYPA 3FU6A 4L1BA 3FTSA 4ANWA 3CVVA 3ZYLA 4I17A 3O48A 4EPZA 2LSUA 3FUFA 2YNQA 4G25A 2KCLA 3MGBA 4BY6A 4I1AA 1PY1A 3SFZA 3T8MA 3HYMB 3URZA 3PEVB 1MHQA 3FUEA 4U0ZA 1E8ZA 4FHKA 3CHOA 1N52A 3FU3A 3GZSA 4KVMA 2WMOA 3FTWA 3B13A 3SZ7A 1KT0A 3B7UX 3MYVA 5CHEE 2Y4UA 4KZCA 4ME2A 2XHEA 1U3CA 4KYOB 4Y6WA 3SD5A 3SHFA 4HVBA 1H0AA 3G2TA 3FULA 4OYSA 2KZTB 5A23A 1KLXA 2XGMA 4DI4A 3NZUA 4HOSA 2UY1A 2R5SA 4KT6B 3D9IA 5BNWA 5JJTA 3GYZA 3D9OA 3FWVA 4Q94A 5G55A 3S7DA 4APFA 4M3OA 4RSYA 4JVSA 1UG3A 4A3TA 4ACKA 3PNTB 3L22A 1HH8A 3JQ0A 4PS7A 4WNDA 4FJZA 3RO2A 1FVHA 3AS4A 3CHPA 3QDNA 4U63A 2J9QA 3D9MA 4NQ0A 3RIBA 4GZCA 4F53A 3RJVA 5FWQA 4I6EA 3O4ZA 3QWVA 1E96B 3QAQA 4FLHA 5D0OD 3CLJA 4GYOA 5LX8A 3FTZA 1UN8A 5C1DA 4GA1A 4U0SA 3ASHA 4JW1A 3VTYA 2X38A 3LXUX 5C2YA 2YINA 5FZSA 3G2WA 1X5BA 2IJGX 5AJLA 1TEZA 4H7YA 3L17A 4GYWA 4NRHB 1B89A 3Q4AB 5HI7A 4NACA 3KD7A 1H6KA 3AS5A 2WXOA 2FEZA 3ESLA 2J07A 3QNKA 5J90A 4XI0A 2YHCA 3JUIA 3GW4A 2WB2A 3PE3A 4G2VA 1E90A 3BEEA 5E75A 3RU0A 2WXPA 3ZYKA 3EJNA 1IQRA 3IEGA 4YVQC 5FZRA 3CHQA 3QWPA 3D9NA 4O6FA 4XE0A 2NSZA 5JJ7A 1QNFA 2VQ2A 3ZHEB 4ACLA 3CQCB 4WWPA 5DBKA 4XZ4A 4GU5A 3RRMB 2IFUA 2XCCA 3RRNB 4AVXA 5BPPA 3LJ3A 3U4TA 1HXIA 2BUGA 2X3MA 5JJ6A 3FUMA 1WAO1 4LERA 3SBTB 3TXNA 5ARGA 1VDYA 5LOZA 2QY7A 1Y6IA 3ZYMA 3CVWA 3EDTB 4N3AA 5EKQD 2VSOE 3APDA 3MV3B 3QWWA 1PC2A 2X6JA 4UWLA 2CFZA 4ANUA 1IQUA 1HF8A 2C0LA 4AOFA 2E2EA 3KEZA 4JEUA 2AWIA 1E8YA 3NF1A 4BT9A 2IU1A 2L0TB 3T5VA 3Q49B 4A55A 4KMOA 1EYHA 1UW4B 4FHJA 3S7BA 1JWFA 4G23A 3HVEA 3N71A 2KATA 5ARFA 2VJ8A 5LP0A 3EIJA 3ASGA 3L6AA 1H2TC 3TG5A 3FEYA 1FVFA 1NA3A 3LKUA 4ABNA 3U66A 3CGHA 1QQEA 4PUCA 1JWGA 2ONDA 2AW6A 2PM6A 3VLEA 3SI5A 4FP7A 2J4DA 4WWOA 4G1TA 5FQ7A 5JHAA 4YNDA 3MKQB 4UQXA 3ZPJA 4RVBA 2UWJG 3MA5A 2WVIA 1BPOA 3LY7A 2J49A 2CHZA 4LUNU 3FTYA 2PM7A 5CMWA 4E85A 2OVBA 3HHMA 3FUHA 2GGFA 4CGVA 1U3DA 3OXLA 3LVQE 4AXHA 3IKOB 4TV3A 2WXIA 2WQ7A 4I6JA 4NURA 2V4LA 3SF4A 4K03A 5FZQA 4EZKA 1KT1A 1INZA 1GW6A 4G24A 4EBAG 4I9EA 2WXJA 3PH0C 4I6GA 3LVRE 5T8IA 5ENNA 2WXFA 3MCXA 1TJFA 3T5XA 4Q69A 2I6HA 5EX0A 2LSVA 5BT1A 3ZXSA 2VGXB 4U8HA 5ANLA 3IBEA 3VLFA 4DPRA 2FF4A 3TXMA 2DCPA 4JEHA 4BFRA 3DPDA 2MHKA 3UT4A 1HE8A 3CVNA 4UWKA 4HFGA 1E7UA 4N5CA 1S0PA 2IOLA 4AY5A 4ANXA 3JQ1A 4JHJA 4ANVA 2A4ZA 3ZW3A 5KJNA 2WXMA 3HVEB 3QK0A 3BG0B 5FTPA 4CEMA 3PRZA 4GZ5A 4C0MA 4Q96A 3LEWA 4OVVA 2L0IA 3BG1B 4FULA 3ONKA 4L23A 3QC1A 4GZ6A 3CSTA 3UX4A 5HQ8A 2I9CA 4FU3A 3B7SA 4JXTA 2XGSA 3SGHA 3CHRA 3ESKA 3ASFA 4I2WA 3OXGA 1WY6A 2JLBA 3PNLB 3FUKA 3UT8A 5T3RA 4JA9A 3ZFWA 4EBAA 5CCMA 3HDXA 4GAAA 1L5JA 2DBAA 2VTBB 2QFCA 4EECA 3DBSA 2NXPA 4N3CA 3JCKC 2WXNA 1HG2A 2CFUA 4LEUA 3PREA 4UWFA 2AXVA 3CSFA 3KS2A 4AM9A 4HXIA 4AJWA 4DLOA 4IRUA 2C0MA 2NC9A 3FEXA 3MEKA 3FY4A 2Y3AA 5AIJA 4AEZC 2GW1A 3APCA 4J8DA 2VSNA 3ML8A 4FA6A 3S7JA 1IYGA 3AS8A 2XRZA 2WQHA 5CMYA 2Y4TA 5ANRA 2XPZA 3TG4A 1EDUA 2EQXA 2LO6A 3EIQC 4GA0A 4XKCA 3FH8A 2VYIA 5E76A 3I4RB 3CVXA 3FH7A 4HOUA 1EF1C 4GYYA 2YQ8A 2KCVA 3GZ1A 2MRIA 3AU5A 1NA0A 5EX3A 3CKCA 5J08A 4PH4B 2RG8A 4WNFA 3ZEFA 2XQ0A 4GCOA 3FUNA 2I1KA 4J0UA 4B94A 4F1SA 1XNFA 4N3BA 2UY1B 3LPZA 2VSXE 2IF4A 3EHNA 4MKTA 3GZ2A 4JL0A 3TGOA 1OWLA 2J4BA 4I2ZA 5G05J 2FULA 2J09A 3PS6A 3CVUA 3Q5MA 4I1MA 4V3IA 3B7TA 1OWNA 3SNXA 4J8SA 4WNGA 3LDZA 2DIWA 4BWRA 3ONLA 3EHMA 3CK9A 4P29A 3LYAA 5JHBA 1LF8A 2CG2A 4HLEA 5G2NA 2R59A 4GPKA 2X6IA 3CK7A 4EZJA 3PEUB 5FT9A 3FDHA 3CK8A 4N2SA 3U9WA 2XPIA 5CCLA 2XRYA 2BF0X 3VTXA 3AU4A 3PVLA 4IULA 3RKVA 3PDNA 3UUXA 4J8EA 3UT7A 5KJMA 5T4YA 4XIFA 4XI9A 4HS2A 4FC8A 3MV2B 3Q47B 1ZU2A 1HO8A 4I9CA 3FTVA 1FCHA 2XPYA 4L7TA 3G2VA 2WXQA 2L6JA 4HOTA 5G05C 1H2UA 3FUIA 5BV1A 4AY6A 4H7XA 1SZ9A 3D9JA 2R17C 4CT0A 1DVPA 4FJYA 2WMNA 2A5UA 2WPVA 1ZBPA 3MKRA 4UQZA 4GMJA 3PE4A 2CHXA 3OXFA 4PS8A 2JEKA 4AV7A 3ZRHA 4ILGA 1SZAA 4J6IA 4ATGA 4BSXA 3KAEA 3ML9A 4PDXA 3FUDA 1PAQA 2PZIA 4L2LA 2OV8A 3FU0A 2IOSA 2P58C 2ZU6B 3WXXA 5LCWJ 3UMVA 2WXGA 3APFA 3I3NA 5BV0A 1HZ4A 1NP7A 3CV0A 3UPVA 3NZSA 5AJDA 4WNEA 3CVPA 4CGWA 4N2QA 1HU3A 3L54A 1HS6A 5KJKA 4WAFA 2OVFA 4LCTA 4U07A 1Z3YA 2WQ6A 2Q7FA 3PUKA 2ILRA 4MRUA 1EPUA 2WM9A 1DNPA 2YHEA 2CG3A 3RK6A 4JHKA 3UQ3A 1OWPA 4GA2A 3ZGQA 1N54A 3CEQA 3I5PA 1QZ2A 2LAIA 2RD0A 3FFLA 3CVQA 4CDMA 3CHMA 4UI9J 4DK5A 4WWNA 2PQRA 4A1GA 3LY8A 4BX8A 3IHVA 3FHEA 4C0EA 3JYSA 4D10C 4W9RA 3QKYA 5A7DB 4CT4A 1OWMA 2I1JA 3OAWA 4B8CB 2J08A 3P1UA 2E0IA 4IN3B 4Y6CA 3TAXA 2AVPA 5LCWC 3RRUA 2C2LA 3ZHEA 5KCMA 4J8FA 3FU5A 2XEVA 1JPLA 4EZLA 5DIZA 2FBNA 4L2YA 5LFAA 1WM5A 4JPSA 4XX5A 2IONA 3TL5A 2PL2A 2V0PA 3VLDA 4R7LA 3R9AB 4RG9A 5D0QD 3U3WA 4CDNA 4UI9C 4ILIA 4CCAA 3ULQA 4U0UA 4A3VA 1W3BA 1ELWA 1E8XA 2HO1A 3D9KA 2LAHA 1Z3XA 4G11A 2FO7A 2GRMA 2X6HA 3QJZA 5BW8C 3ZYQA 4CDRA 2KC7A 3MJWA 4GCNA 4OVUA 5FQ4A 4GMLA 3PUJA 4BTBA 4JA7A 3G2SA 2VSYA 2X6FA 2MOWA 3ZN3A 4TUUA 4N39A 3FTUA 4BTAA 3TJPA 4GZDA 2V8SE 5G04J 3LCAA 3QB2A 2LNIA 2CHWA 3MKQA 5AENA 4TRQA 4HORA 3NQPA 1UN9A 3L08A 4EQFA 4JHRA 4QFVA 4C9BB 3FTXA 1OUVA 3PZDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AP2 A;  4HS2 A;  3HVE B;  4APF A;  3I3N A;  3HVE A;  2EQX A;  4HXI A; 
#chains in the Genus database with same CATH topology
 4DJA A;  1Z6T A;  4AP2 A;  3ZU7 B;  4O1O A;  1NZN A;  2XZD G;  2ZIR A;  4G26 A;  1HFA A;  1FT1 A;  2IQC A;  1H2V C;  3I4G A;  2HE0 A;  4FLB A;  5HS0 A;  3ABK E;  1SQM A;  5BUZ A;  1HX8 A;  3QAR A;  3D9L A;  4ILH B;  3QOU A;  5EDS A;  1N4P A;  4GTS A;  1BD8 A;  4BX9 A;  2KZT A;  4KBQ A;  5FQ8 A;  1N94 A;  2HR2 A;  5M72 A;  3ENE A;  2MYO A;  4HNA D;  3CHS A;  5EID A;  1P5Q A;  3FH5 A;  2LUH A;  2GRL A;  4KXK B;  4K0R A;  2L9B A;  1IXV A;  3BUA A;  4L9P A;  1AP7 A;  2DYS E;  3CVV A;  1TYQ G;  4I17 A;  4EPZ A;  3FUF A;  2KCL A;  3MGB A;  3SFZ A;  3HYM B;  2P9U G;  3UM2 A;  3FTW A;  3B13 A;  3MYV A;  4KZC A;  3SD5 A;  2RKK A;  4HLL A;  1G3N B;  2EIM E;  2XGM A;  1N95 A;  2RFM A;  3D9I A;  3GYZ A;  3D9O A;  2F8Y A;  4M3O A;  4JVS A;  4ACK A;  3JQ0 A;  3RO2 A;  3AS4 A;  4U63 A;  4GZC A;  3QAQ A;  4FLH A;  4GYO A;  3L9T A;  1H6P A;  2X38 A;  2ZXW E;  5FZS A;  1QYM A;  5AJL A;  1TEZ A;  1N0Q A;  5HI7 A;  3AS5 A;  2H6H A;  2FEZ A;  1A5E A;  5ENT D;  3QNK A;  2WB2 A;  3PE3 A;  4G2V A;  5E75 A;  3SFY A;  4U8V D;  1WDY A;  4XZ4 A;  3RRM B;  2IFU A;  2BUG A;  4OAV B;  4LER A;  3TXN A;  5ARG A;  4K5A B;  4N3A A;  1PC2 A;  2X6J A;  4UWL A;  3J5Q B;  4ANU A;  2C0L A;  5ENO D;  4BT9 A;  2IU1 A;  3T5V A;  3Q49 B;  4KMO A;  3U66 A;  4ABN A;  3V2X A;  1N11 A;  4PUC A;  1JWG A;  3C3R A;  3ZUV B;  2PM6 A;  2R05 A;  3Q9N C;  5JHA A;  3MA5 A;  2DWZ A;  2WVI A;  1BPO A;  2CHZ A;  2R03 A;  5CMW A;  4DRX E;  3FUH A;  2WQ7 A;  5ENQ D;  1KT1 A;  1INZ A;  4I6G A;  2WXJ A;  3DEO A;  5T8I A;  5ENN A;  1TJF A;  3HXF A;  3ZXS A;  3VLF A;  4JEH A;  4GTV A;  2MHK A;  3C5R A;  1HE8 A;  2F37 A;  1OT8 A;  1NL4 A;  3QK0 A;  3BG0 B;  3AG4 E;  3PRZ A;  5EYP F;  2I9C A;  2F0Y A;  3CHR A;  3ASF A;  3PNL B;  3FUK A;  3UT8 A;  4JD2 G;  2P9I G;  2QFC A;  2NXP A;  4LEU A;  1FPP A;  2GRQ B;  3FEX A;  2Y3A A;  5EIB E;  4J8D A;  1S63 A;  3AS8 A;  3ASN E;  2XRZ A;  2QZA A;  2XPZ A;  1KPS B;  3EIQ C;  4GA0 A;  5B1B E;  3W9G A;  3I4R B;  3FH7 A;  4HOU A;  5KWD A;  3GZ1 A;  3CKC A;  3ZEF A;  2IF4 A;  1OWL A;  2FUL A;  3SNX A;  3LDZ A;  3ONL A;  3AG1 E;  2X6I A;  3CK7 A;  2DYR E;  5FT9 A;  3CK8 A;  2XRY A;  4YDY A;  3PVL A;  4IUL A;  3PDN A;  3UUX A;  4J8E A;  4TXP A;  4HS2 A;  3MV2 B;  1RW2 A;  3FTV A;  1TN7 A;  4L7T A;  2L6J A;  4HOT A;  3FUI A;  1U2V G;  3D9J A;  4CT0 A;  1DVP A;  2A5U A;  4UQZ A;  4AV7 A;  3ZRH A;  4BSX A;  4DX2 A;  3ML9 A;  1PAQ A;  2IOS A;  2ZU6 B;  3APF A;  5BV0 A;  1HZ4 A;  5KNG A;  5AJD A;  4N2Q A;  1HU3 A;  3L54 A;  1HS6 A;  2OVF A;  4LCT A;  1Z3Y A;  2Q7F A;  2KBX A;  2ILR A;  2WM9 A;  1SVX A;  2R2L A;  1OWP A;  1N54 A;  3CEQ A;  3FFL A;  4DK5 A;  4UI9 J;  3BU8 A;  2EIL E;  3Q79 A;  4W9R A;  2XS8 A;  4B8C B;  3P1U A;  3TAX A;  3RAU A;  2XZT G;  2BKG A;  4J8F A;  1LTX A;  3ASO E;  1WM5 A;  2P9S G;  3TL5 A;  3EHQ A;  2V0P A;  3JXJ A;  4R7L A;  2ETB A;  5D0Q D;  4UI9 C;  4ILI A;  4CCA A;  3ULQ A;  3ZYQ A;  2KC7 A;  1O1R A;  2DZO A;  3G2S A;  2VSY A;  2X6F A;  3ZN3 A;  3HXB A;  4LG6 A;  4BTA A;  2V8S E;  3LCA A;  3QB2 A;  5AEN A;  4EQF A;  4JHR A;  3DRA A;  3HG0 D;  4ZFH A;  3ZVV A;  4TUM A;  1Y8M A;  5CEA A;  3P2B A;  2FI7 A;  1N9A A;  5CER B;  1A17 A;  5A6C A;  3R7Q A;  4UUC A;  3ZXP A;  1ELK A;  4B89 A;  1MZC A;  1V54 E;  2M63 A;  4RG6 A;  2V5F A;  4B0Z A;  5AYW D;  2RFA A;  2BTD A;  5FJY A;  4OAU C;  4WUY A;  2WXH A;  5AQB A;  5FQ6 A;  3U64 A;  4DLQ A;  4U04 A;  4PS3 A;  2WXR A;  1D8D A;  3TWS A;  4K5C A;  4LNB A;  3SO8 A;  1XGW A;  3CKB A;  1ELR A;  4B8A A;  4F7A A;  3CVL A;  4HOQ A;  1Q2Z A;  4MLP A;  5BXU A;  1X81 A;  4L1B A;  4ANW A;  2ZIS A;  2YNQ A;  4G25 A;  2P9P G;  3URZ A;  1MHQ A;  3FUE A;  1OCZ E;  3Q7A A;  4FHK A;  3CHO A;  3GZS A;  2AJA A;  2WMO A;  1KZO A;  1KT0 A;  4ME2 A;  4KYO B;  1U3C A;  3SHF A;  4GTM A;  1H0A A;  3E32 A;  3NZU A;  1IKN D;  4KT6 B;  5BNW A;  3DPY A;  5G55 A;  4APF A;  4A3T A;  3PNT B;  1HH8 A;  1FVH A;  4MBG A;  3RIB A;  4I6E A;  3QWV A;  1E96 B;  3CLJ A;  5LX8 A;  3D9H A;  3UKU G;  5C1D A;  3VTY A;  2IO3 C;  3G2W A;  1X5B A;  2IJG X;  4H7Y A;  3L17 A;  4NAC A;  3KD7 A;  1OXJ A;  3ESL A;  1YMP A;  5J90 A;  2F8X K;  4TXQ A;  2YHC A;  5CBO A;  2B0O E;  3ZYK A;  1E90 A;  3BEE A;  2V4H C;  3EJN A;  3IEG A;  4YVQ C;  3NOG D;  4O6F A;  2EIK E;  5JJ7 A;  4K5B A;  1MX2 A;  2VQ2 A;  4J8Y A;  3CQC B;  5DBK A;  4GU5 A;  1MYO A;  3RRN B;  4AVX A;  3U4T A;  1HXI A;  3FUM A;  3E37 A;  3B95 A;  4DUI A;  1VDY A;  1AWC B;  3ZYM A;  1IHB A;  2VSO E;  3APD A;  2CFZ A;  3SFX A;  3KEZ A;  2AWI A;  1E8Y A;  3NF1 A;  4A63 B;  4A55 A;  1EYH A;  1UW4 B;  3S7B A;  1JWF A;  3N71 A;  4CZ2 D;  3TWX A;  2EIN E;  3ASG A;  1H2T C;  3TG5 A;  3LKU A;  1NA3 A;  3DXM G;  3CGH A;  3SI5 A;  4FP7 A;  4G1T A;  3FTY A;  2PM7 A;  2OVB A;  1U3D A;  3OXL A;  4AXH A;  2Y69 E;  4NUR A;  4K03 A;  5FZQ A;  4EZK A;  1NFI E;  4G24 A;  3LVR E;  2I6H A;  5EX0 A;  2LSV A;  5BT1 A;  4LSZ E;  5CRU A;  3TXM A;  4BFR A;  2EIJ E;  3BQO A;  4UWK A;  4N5C A;  1E7U A;  2VGE A;  4GPM A;  1O5M A;  3JQ1 A;  4JHJ A;  4ANV A;  2A4Z A;  3HVE B;  4G8L A;  4C0M A;  2JAB A;  4Q96 A;  1OCO E;  4OVV A;  4FUL A;  1RZ4 A;  5HQ8 A;  3UX4 A;  2XGS A;  5ITZ F;  3OXG A;  4EBA A;  2LXL A;  3TWT A;  2DBA A;  2Y1L E;  2VTB B;  4N3C A;  3JCK C;  3E30 A;  4UWF A;  4IRU A;  5HKP A;  4JB8 P;  3Q7F A;  2VSN A;  2XEE A;  5CMY A;  5ANR A;  2EQX A;  3R9M A;  3FH8 A;  2KCV A;  3AU5 A;  1NA0 A;  5J08 A;  4GCO A;  3FUN A;  4J0U A;  4F1S A;  2UY1 B;  3EHN A;  4MKT A;  3GZ2 A;  4V3I A;  1OWN A;  1K8K G;  4P29 A;  3CK9 A;  3LYA A;  4HLE A;  3V79 K;  3ZKJ A;  3V2O A;  3SQV A;  4N2S A;  2XPI A;  1TNZ A;  3AU4 A;  3C3Q A;  3T9K A;  5T4Y A;  4FC8 A;  1MJ0 A;  1FCH A;  1H2U A;  5BV1 A;  1QBQ A;  2WMN A;  2WPV A;  3MKR A;  4J6I A;  3FUD A;  2PZI A;  5LCW J;  3I3N A;  3UIP C;  1Z5S C;  1NP7 A;  3CVP A;  4CGW A;  3ABL E;  5KJK A;  4WAF A;  4U07 A;  2WQ6 A;  3PUK A;  3RK6 A;  2LAI A;  4YDO A;  4BX8 A;  3IHV A;  4C0E A;  4D10 C;  5A7D B;  1OWM A;  2J08 A;  2OCC E;  2E0I A;  4IN3 B;  4Y6C A;  5LCW C;  5LFA A;  2FBN A;  4HB5 A;  4LNG A;  3VLD A;  4U0U A;  4A3V A;  1W3B A;  2HO1 A;  3D9K A;  2P2C P;  5FIO A;  5BW8 C;  4GCN A;  2XS1 A;  2MOW A;  1H6O A;  3TJP A;  5G04 J;  4C48 B;  3TWV A;  4HI8 A;  5ENP D;  4C9B B;  4F1P A;  5AQ9 A;  1UJK A;  3Q15 A;  3ZIM A;  5B3S E;  1KZP A;  1E7V A;  3HIZ A;  2I2O A;  4O1P A;  4HBD A;  3IHY A;  1S70 B;  3LS8 A;  1JCQ A;  4F3V A;  3HXC A;  4UQY A;  5EN5 D;  1MQS A;  2XCB A;  2L6B A;  5G04 C;  4A1S A;  3ABM E;  4YVO A;  2DVW A;  3FUJ A;  3JUE A;  4JZY A;  4LRZ A;  1O1S A;  4RQI A;  2R02 A;  3SBS A;  1TJC A;  4AIF A;  2VGY A;  1YA0 A;  1UJJ A;  1YCS B;  4BT8 A;  5EIL A;  5AQA A;  4APO A;  2HYZ A;  4U96 D;  4XKB A;  2GRN B;  3B7B A;  4UI9 K;  2VTB A;  1TR4 A;  2AXZ A;  4FAD A;  2PQN A;  3RO3 A;  3B7R L;  1DCQ A;  2H6G A;  3IXE A;  4I1O B;  3CVY A;  1N4R A;  4IYP A;  3FU6 A;  3FTS A;  3O48 A;  1MX6 A;  4Z68 A;  2V5Q C;  1PY1 A;  1TNO A;  1E8Z A;  3FU3 A;  1N52 A;  5D2M C;  4KVM A;  3KSL A;  3SZ7 A;  2P9N G;  5CHE E;  2XHE A;  4HVB A;  4Y6W A;  3FUL A;  3KSQ A;  3AJI A;  2KZT B;  4OYS A;  5A23 A;  2UY1 A;  5JJT A;  3S7D A;  4LNU D;  4BSZ B;  3L22 A;  3Q9U C;  4FJZ A;  4QQI A;  2Y0B G;  3QDN A;  2J9Q A;  4U8Y D;  4NQ0 A;  5FWQ A;  5ENR D;  3FTZ A;  3SY2 A;  1UN8 A;  4GA1 A;  3ASH A;  3LXU X;  5C2Y A;  4YDE A;  3Q75 A;  4GYW A;  1LD7 A;  2J8S D;  4NRH B;  1B89 A;  3Q4A B;  3EU9 A;  1H6K A;  2J07 A;  3RU0 A;  2NSZ A;  3ZHE B;  4ACL A;  5AAO A;  4WWP A;  3HXE A;  5AQ7 A;  5BPP A;  2FO1 E;  3LJ3 A;  4GTP A;  3SBT B;  5LOZ A;  4EHM A;  3CVW A;  3EDT B;  5EKQ D;  3MV3 B;  3QWW A;  4AOF A;  4JEU A;  4FHJ A;  2KAT A;  3AG3 E;  5LP0 A;  1K3Z D;  3EIJ A;  3L6A A;  1FVF A;  2AW6 A;  5FQ7 A;  4YND A;  3MKQ B;  3ZPJ A;  3LY7 A;  2J49 A;  4BES A;  4LUN U;  4E85 A;  1TNU A;  3IKO B;  2WXI A;  4I6J A;  1GW6 A;  2B6C A;  4I9E A;  3PH0 C;  3MCX A;  3T5X A;  4Q69 A;  2VGX B;  4U8H A;  3IBE A;  4DPR A;  2DCP A;  3UIN C;  5IY5 E;  4HRN A;  2QC9 A;  4HFG A;  2IOL A;  4AY5 A;  1YYH A;  1ZB1 A;  3ZW3 A;  2WXM A;  4CEM A;  3LEW A;  1TNY A;  2L0I A;  3E34 A;  3ONK A;  3QC1 A;  3CST A;  1MX4 A;  1WY6 A;  3ZFW A;  5CCM A;  4GAA A;  1L5J A;  4EEC A;  4N5Q A;  3WG7 E;  1HG2 A;  1BI8 B;  2AXV A;  4HXI A;  2IY0 C;  2C0M A;  5B1A E;  4GMR A;  2NC9 A;  1N4S A;  3MEK A;  5ENS D;  1TN6 A;  2GW1 A;  3APC A;  4BER A;  4FA6 A;  3S7J A;  2WQH A;  3V31 A;  2Y4T A;  3UI2 A;  3TG4 A;  2LO6 A;  4GYY A;  2YQ8 A;  3DXK G;  4BET A;  4PH4 B;  4WNF A;  2XQ0 A;  4B94 A;  2I1K A;  1XNF A;  4NIK A;  3AAA C;  4JL0 A;  3TGO A;  2NYJ A;  2J4B A;  2J09 A;  3PS6 A;  3Q5M A;  3B7T A;  4WNG A;  2DIW A;  5G2N A;  2R59 A;  2OEV A;  3PEU B;  2GRP B;  5AAR A;  3FDH A;  3J5P A;  5CCL A;  2BF0 X;  4YDW A;  4DX6 D;  5KJM A;  3Q47 B;  1ZU2 A;  4I9C A;  2XPY A;  4HRM B;  3G2V A;  2WXQ A;  1FT2 A;  4AY6 A;  1S64 A;  2KXP C;  1SZ9 A;  1ZBP A;  3PE4 A;  2CHX A;  2JEK A;  1SZA A;  4ATG A;  2ZGD A;  3FU0 A;  3WXX A;  2P58 C;  1O1T A;  3UMV A;  4X8Q A;  3CV0 A;  3UPV A;  4WNE A;  2YHE A;  2LXM A;  4JHK A;  3ZGQ A;  1QZ2 A;  2RD0 A;  1K1A A;  3CVQ A;  4CDM A;  3CHM A;  4WWN A;  2PQR A;  3LY8 A;  3UM0 A;  3QKY A;  2I1J A;  1JCS A;  2P9K G;  2C2L A;  3NAW A;  3ZHE A;  5KCM A;  3FU5 A;  3TWQ A;  2XEV A;  1DC2 A;  4L2Y A;  4JPS A;  4XX5 A;  3LJN A;  2ZGG A;  1E8X A;  1JCR A;  2FO7 A;  2X6H A;  4CDR A;  3MJW A;  4GML A;  3PUJ A;  4JA7 A;  3NB2 A;  4N39 A;  3DSS A;  4GTO A;  3TWR A;  3DSU A;  1DCE A;  4GZD A;  2CHW A;  3HXD A;  3EU5 A;  3MKQ A;  4TRQ A;  3NQP A;  3PZ2 A;  4MS6 A;  2AXU A;  3S2A A;  4BEP A;  4DI3 A;  4CRW A;  1IHG A;  4RLY A;  3L16 A;  1E8W A;  1JUQ A;  4E6H A;  3L82 A;  3CIA A;  2OOE A;  2VGX A;  3CQG B;  1OWO A;  1N4Q A;  4TXR A;  3S7F A;  3ASD A;  2WXK A;  3D9P A;  4UWG A;  3IV0 A;  3UM1 A;  3EUV A;  2KCK A;  4URK A;  3E4B A;  3MZL B;  2HM8 A;  5CEC B;  2XEN A;  3FP3 A;  3MX3 A;  3G2U A;  3D3M A;  4I43 A;  3T8K A;  2X6K A;  3C98 A;  2WXL A;  1HG5 A;  1D8E A;  3K9I A;  3R7R A;  2KM4 A;  4UWH A;  3UXG A;  3CR3 A;  4KVO A;  3OTN A;  4JC8 A;  3UTM A;  3L13 A;  4GB9 A;  4KZ0 A;  1H19 A;  2XGO A;  3LY9 A;  3UM3 A;  1WG0 A;  3PZ4 A;  4GZ3 A;  1NI1 A;  2IEJ A;  3F6Q A;  3ZYL A;  2LSU A;  3DST A;  4BY6 A;  4I1A A;  3T8M A;  3PEV B;  4U0Z A;  5KNH D;  4B93 B;  3B7U X;  5CED B;  2Y4U A;  1SW6 A;  5HRY A;  3G2T A;  1KLX A;  4DI4 A;  4HOS A;  4HI9 A;  2R5S A;  3FWV A;  4Q94 A;  4RSY A;  1UG3 A;  3NOC D;  4PS7 A;  4WND A;  3CHP A;  3D9M A;  3TWU A;  4F53 A;  3RJV A;  3O4Z A;  2PNN A;  2GRO B;  5D0O D;  4HRL A;  4U0S A;  4JW1 A;  1UOH A;  2YIN A;  3KEA A;  4G8K A;  2H6F A;  2BED A;  3Q78 A;  2WXO A;  3C72 A;  3RSE G;  4XI0 A;  3JUI A;  3UIO C;  3GW4 A;  2WXP A;  1IQR A;  2XEH A;  5FZR A;  3CHQ A;  3QWP A;  3D9N A;  4XE0 A;  1QNF A;  2XCC A;  2X3M A;  5JJ6 A;  3Q73 A;  1WAO 1;  3PZ3 A;  2QY7 A;  1Y6I A;  1IQU A;  1HF8 A;  2E2E A;  2L0T B;  1OY3 D;  4G23 A;  3HVE A;  5ARF A;  2VJ8 A;  3FEY A;  3ULE G;  1QQE A;  2OND A;  1BI7 B;  3VLE A;  2J4D A;  4WWO A;  5EYL A;  4UQX A;  4RVB A;  2UWJ G;  3X2Q E;  3HHM A;  5CRV A;  2H6I A;  2GGF A;  4CGV A;  3LVQ E;  3HRA A;  4J7W A;  4TV3 A;  2V4L A;  3SF4 A;  4EBA G;  3DSV A;  4DX7 D;  2WXF A;  5KBA A;  1K1B A;  5ANL A;  2FF4 A;  3JXI A;  3DPD A;  3UT4 A;  4CYM D;  3EHR A;  3CVN A;  1S0P A;  1OCR E;  2OEW A;  4ANX A;  5KJN A;  5FTP A;  4GZ5 A;  2QYJ A;  1BU9 A;  3BG1 B;  1SA4 A;  4L23 A;  1BLX B;  5H7P A;  4GZ6 A;  4FU3 A;  3B7S A;  4JXT A;  3ULY A;  3SGH A;  3ESK A;  4ZHB A;  4I2W A;  2JLB A;  5T3R A;  4JA9 A;  3HDX A;  5JA4 D;  3DBS A;  2WXN A;  2CFU A;  3PRE A;  3UKR G;  3CSF A;  3KS2 A;  4AM9 A;  4AJW A;  4DLO A;  4DX1 A;  3FY4 A;  1OCC E;  5AIJ A;  2QYU A;  5FIN A;  4AEZ C;  1D9S A;  3ML8 A;  1IYG A;  2A5E A;  3C3O A;  4M7C A;  1EDU A;  3PZ1 A;  4XKC A;  2VYI A;  5E76 A;  3CVX A;  1EF1 C;  2GRR B;  2MRI A;  5CBN A;  5EX3 A;  3DWL G;  2RG8 A;  3TWW A;  4N3B A;  3LPZ A;  2VSX E;  4I2Z A;  5G05 J;  3CVU A;  4I1M A;  4F6R D;  4J8S A;  4BWR A;  3EHM A;  5JHB A;  1LF8 A;  2CG2 A;  4XEI G;  4GPK A;  4EZJ A;  3AG2 E;  5D66 A;  4HQD A;  3U9W A;  2ETA A;  3VTX A;  3RKV A;  3UT7 A;  4XI9 A;  4XIF A;  1V55 E;  2ETC A;  1HO8 A;  4U95 D;  5G05 C;  4GTT A;  4U7E B;  4H7X A;  2R17 C;  4FJY A;  2DZN A;  4GMJ A;  3OXF A;  4PS8 A;  4ILG A;  1SA5 A;  3KAE A;  1TN8 A;  4PDX A;  3DEP A;  4L2L A;  2OV8 A;  5JMN D;  2WXG A;  3V30 A;  4ATZ D;  3NZS A;  3ISM C;  4MRU A;  1EPU A;  1DNP A;  2CG3 A;  3UQ3 A;  4GA2 A;  3DSW A;  4O60 A;  1N0R A;  3I5P A;  5KJL A;  1LD8 A;  4A1G A;  2P9L G;  5BXO A;  3FHE A;  3E33 A;  3JYS A;  4CT4 A;  3OAW A;  2AVP A;  3RRU A;  5AN8 A;  3DSX A;  1JPL A;  4EZL A;  5DIZ A;  2IO2 C;  2BKK B;  2ION A;  2PL2 A;  3R9A B;  4RG9 A;  3U3W A;  4CDN A;  1ELW A;  3W9F A;  2LAH A;  1Z3X A;  4G11 A;  2GRM A;  3QJZ A;  3ZNG A;  4OVU A;  5FQ4 A;  4DX5 D;  4BTB A;  4GTQ A;  4GTR A;  4TUU A;  3FTU A;  3NBN B;  2LNI A;  4HOR A;  1UN9 A;  1TNB A;  3L08 A;  4QFV A;  3FTX A;  1OUV A;  3PZD A; 
#chains in the Genus database with same CATH homology
 1UJK A;  3Q15 A;  1Z6T A;  3ZIM A;  4AP2 A;  4DJA A;  1E7V A;  3HIZ A;  2I2O A;  4MS6 A;  2AXU A;  3ZVV A;  1NZN A;  3S2A A;  1Y8M A;  3IHY A;  5KJL A;  4DI3 A;  3LS8 A;  4G26 A;  4CRW A;  1IHG A;  3P2B A;  1HFA A;  2FI7 A;  4F3V A;  2IQC A;  1A17 A;  1E8W A;  3L16 A;  1H2V C;  5A6C A;  4UQY A;  3R7Q A;  1JUQ A;  1MQS A;  2XCB A;  1ELK A;  3I4G A;  4E6H A;  3CIA A;  4B89 A;  2OOE A;  4FLB A;  2VGX A;  5G04 C;  3CQG B;  4A1S A;  1OWO A;  1SQM A;  4YVO A;  3FUJ A;  3S7F A;  3ASD A;  2M63 A;  2WXK A;  3D9P A;  5BUZ A;  4RG6 A;  4UWG A;  3IV0 A;  1HX8 A;  2V5F A;  2KCK A;  4B0Z A;  5AYW D;  4URK A;  3E4B A;  2BTD A;  3QAR A;  4JZY A;  3D9L A;  4LRZ A;  3MZL B;  3QOU A;  4ILH B;  5FJY A;  3SBS A;  5EDS A;  1TJC A;  2HM8 A;  4WUY A;  4AIF A;  2WXH A;  2VGY A;  4BX9 A;  2KZT A;  4KBQ A;  5FQ8 A;  1YA0 A;  3FP3 A;  3MX3 A;  5FQ6 A;  3U64 A;  3G2U A;  3D3M A;  1UJJ A;  4I43 A;  2HR2 A;  4DLQ A;  5M72 A;  2X6K A;  3C98 A;  4BT8 A;  3ENE A;  2WXL A;  1HG5 A;  4U04 A;  4APO A;  3K9I A;  2HYZ A;  4PS3 A;  3R7R A;  3CHS A;  2KM4 A;  2WXR A;  4XKB A;  4UWH A;  1P5Q A;  3CR3 A;  3FH5 A;  4KVO A;  3OTN A;  4UI9 K;  2VTB A;  4JC8 A;  2GRL A;  1XGW A;  4KXK B;  2AXZ A;  3CKB A;  1ELR A;  4K0R A;  4B8A A;  4F7A A;  4FAD A;  2PQN A;  3L13 A;  2L9B A;  3B7R L;  3RO3 A;  3CVL A;  4GB9 A;  4KZ0 A;  1H19 A;  2XGO A;  4HOQ A;  3LY9 A;  4I1O B;  3CVY A;  4MLP A;  4GZ3 A;  4IYP A;  3FU6 A;  4L1B A;  3FTS A;  4ANW A;  3CVV A;  3ZYL A;  4I17 A;  3O48 A;  4EPZ A;  2LSU A;  3FUF A;  2YNQ A;  4G25 A;  2KCL A;  3MGB A;  4BY6 A;  4I1A A;  1PY1 A;  3SFZ A;  3T8M A;  3HYM B;  3URZ A;  3PEV B;  1MHQ A;  3FUE A;  4U0Z A;  1E8Z A;  4FHK A;  3CHO A;  1N52 A;  3FU3 A;  3GZS A;  4KVM A;  2WMO A;  3FTW A;  3B13 A;  3SZ7 A;  1KT0 A;  3B7U X;  3MYV A;  5CHE E;  2Y4U A;  4KZC A;  4ME2 A;  2XHE A;  1U3C A;  4KYO B;  4Y6W A;  3SD5 A;  3SHF A;  4HVB A;  1H0A A;  3G2T A;  3FUL A;  4OYS A;  2KZT B;  5A23 A;  1KLX A;  2XGM A;  4DI4 A;  3NZU A;  4HOS A;  2UY1 A;  2R5S A;  4KT6 B;  3D9I A;  5BNW A;  5JJT A;  3GYZ A;  3D9O A;  3FWV A;  4Q94 A;  5G55 A;  3S7D A;  4APF A;  4M3O A;  4RSY A;  4JVS A;  1UG3 A;  4A3T A;  4ACK A;  3PNT B;  3L22 A;  1HH8 A;  3JQ0 A;  4PS7 A;  4WND A;  4FJZ A;  3RO2 A;  1FVH A;  3AS4 A;  3CHP A;  3QDN A;  4U63 A;  2J9Q A;  3D9M A;  4NQ0 A;  3RIB A;  4GZC A;  4F53 A;  3RJV A;  5FWQ A;  4I6E A;  3O4Z A;  3QWV A;  1E96 B;  3QAQ A;  4FLH A;  5D0O D;  3CLJ A;  4GYO A;  5LX8 A;  3FTZ A;  1UN8 A;  5C1D A;  4GA1 A;  4U0S A;  3ASH A;  4JW1 A;  3VTY A;  2X38 A;  3LXU X;  5C2Y A;  2YIN A;  5FZS A;  3G2W A;  1X5B A;  2IJG X;  5AJL A;  1TEZ A;  4H7Y A;  3L17 A;  4GYW A;  4NRH B;  1B89 A;  3Q4A B;  5HI7 A;  4NAC A;  3KD7 A;  1H6K A;  3AS5 A;  2WXO A;  2FEZ A;  3ESL A;  2J07 A;  3QNK A;  5J90 A;  4XI0 A;  2YHC A;  3JUI A;  3GW4 A;  2WB2 A;  3PE3 A;  4G2V A;  1E90 A;  3BEE A;  5E75 A;  3RU0 A;  2WXP A;  3ZYK A;  3EJN A;  1IQR A;  3IEG A;  4YVQ C;  5FZR A;  3CHQ A;  3QWP A;  3D9N A;  4O6F A;  4XE0 A;  2NSZ A;  5JJ7 A;  1QNF A;  2VQ2 A;  3ZHE B;  4ACL A;  3CQC B;  4WWP A;  5DBK A;  4XZ4 A;  4GU5 A;  3RRM B;  2IFU A;  2XCC A;  3RRN B;  4AVX A;  5BPP A;  3LJ3 A;  3U4T A;  1HXI A;  2BUG A;  2X3M A;  5JJ6 A;  3FUM A;  1WAO 1;  4LER A;  3SBT B;  3TXN A;  5ARG A;  1VDY A;  5LOZ A;  2QY7 A;  1Y6I A;  3ZYM A;  3CVW A;  3EDT B;  4N3A A;  5EKQ D;  2VSO E;  3APD A;  3MV3 B;  3QWW A;  1PC2 A;  2X6J A;  4UWL A;  2CFZ A;  4ANU A;  1IQU A;  1HF8 A;  2C0L A;  4AOF A;  2E2E A;  3KEZ A;  4JEU A;  2AWI A;  1E8Y A;  3NF1 A;  4BT9 A;  2IU1 A;  2L0T B;  3T5V A;  3Q49 B;  4A55 A;  4KMO A;  1EYH A;  1UW4 B;  4FHJ A;  3S7B A;  1JWF A;  4G23 A;  3HVE A;  3N71 A;  2KAT A;  5ARF A;  2VJ8 A;  5LP0 A;  3EIJ A;  3ASG A;  3L6A A;  1H2T C;  3TG5 A;  3FEY A;  1FVF A;  1NA3 A;  3LKU A;  4ABN A;  3U66 A;  3CGH A;  1QQE A;  4PUC A;  1JWG A;  2OND A;  2AW6 A;  2PM6 A;  3VLE A;  3SI5 A;  4FP7 A;  2J4D A;  4WWO A;  4G1T A;  5FQ7 A;  5JHA A;  4YND A;  3MKQ B;  4UQX A;  3ZPJ A;  4RVB A;  2UWJ G;  3MA5 A;  2WVI A;  1BPO A;  3LY7 A;  2J49 A;  2CHZ A;  4LUN U;  3FTY A;  2PM7 A;  5CMW A;  4E85 A;  2OVB A;  3HHM A;  3FUH A;  2GGF A;  4CGV A;  1U3D A;  3OXL A;  3LVQ E;  4AXH A;  3IKO B;  4TV3 A;  2WXI A;  2WQ7 A;  4I6J A;  4NUR A;  2V4L A;  3SF4 A;  4K03 A;  5FZQ A;  4EZK A;  1KT1 A;  1INZ A;  1GW6 A;  4G24 A;  4EBA G;  4I9E A;  2WXJ A;  3PH0 C;  4I6G A;  3LVR E;  5T8I A;  5ENN A;  2WXF A;  3MCX A;  1TJF A;  3T5X A;  4Q69 A;  2I6H A;  5EX0 A;  2LSV A;  5BT1 A;  3ZXS A;  2VGX B;  4U8H A;  5ANL A;  3IBE A;  3VLF A;  4DPR A;  2FF4 A;  3TXM A;  2DCP A;  4JEH A;  4BFR A;  3DPD A;  2MHK A;  3UT4 A;  1HE8 A;  3CVN A;  4UWK A;  4HFG A;  1E7U A;  4N5C A;  1S0P A;  2IOL A;  4AY5 A;  4ANX A;  3JQ1 A;  4JHJ A;  4ANV A;  2A4Z A;  3ZW3 A;  5KJN A;  2WXM A;  3HVE B;  3QK0 A;  3BG0 B;  5FTP A;  4CEM A;  3PRZ A;  4GZ5 A;  4C0M A;  4Q96 A;  3LEW A;  4OVV A;  2L0I A;  3BG1 B;  4FUL A;  3ONK A;  4L23 A;  3QC1 A;  4GZ6 A;  3CST A;  3UX4 A;  5HQ8 A;  2I9C A;  4FU3 A;  3B7S A;  4JXT A;  2XGS A;  3SGH A;  3CHR A;  3ESK A;  3ASF A;  4I2W A;  3OXG A;  1WY6 A;  2JLB A;  3PNL B;  3FUK A;  3UT8 A;  5T3R A;  4JA9 A;  3ZFW A;  4EBA A;  5CCM A;  3HDX A;  4GAA A;  1L5J A;  2DBA A;  2VTB B;  2QFC A;  4EEC A;  3DBS A;  2NXP A;  4N3C A;  3JCK C;  2WXN A;  1HG2 A;  2CFU A;  4LEU A;  3PRE A;  4UWF A;  2AXV A;  3CSF A;  3KS2 A;  4AM9 A;  4HXI A;  4AJW A;  4DLO A;  4IRU A;  2C0M A;  2NC9 A;  3FEX A;  3MEK A;  3FY4 A;  2Y3A A;  5AIJ A;  4AEZ C;  2GW1 A;  3APC A;  4J8D A;  2VSN A;  3ML8 A;  4FA6 A;  3S7J A;  1IYG A;  3AS8 A;  2XRZ A;  2WQH A;  5CMY A;  2Y4T A;  5ANR A;  2XPZ A;  3TG4 A;  1EDU A;  2EQX A;  2LO6 A;  3EIQ C;  4GA0 A;  4XKC A;  3FH8 A;  2VYI A;  5E76 A;  3I4R B;  3CVX A;  3FH7 A;  4HOU A;  1EF1 C;  4GYY A;  2YQ8 A;  2KCV A;  3GZ1 A;  2MRI A;  3AU5 A;  1NA0 A;  5EX3 A;  3CKC A;  5J08 A;  4PH4 B;  2RG8 A;  4WNF A;  3ZEF A;  2XQ0 A;  4GCO A;  3FUN A;  2I1K A;  4J0U A;  4B94 A;  4F1S A;  1XNF A;  4N3B A;  2UY1 B;  3LPZ A;  2VSX E;  2IF4 A;  3EHN A;  4MKT A;  3GZ2 A;  4JL0 A;  3TGO A;  1OWL A;  2J4B A;  4I2Z A;  5G05 J;  2FUL A;  2J09 A;  3PS6 A;  3CVU A;  3Q5M A;  4I1M A;  4V3I A;  3B7T A;  1OWN A;  3SNX A;  4J8S A;  4WNG A;  3LDZ A;  2DIW A;  4BWR A;  3ONL A;  3EHM A;  3CK9 A;  4P29 A;  3LYA A;  5JHB A;  1LF8 A;  2CG2 A;  4HLE A;  5G2N A;  2R59 A;  4GPK A;  2X6I A;  3CK7 A;  4EZJ A;  3PEU B;  5FT9 A;  3FDH A;  3CK8 A;  4N2S A;  3U9W A;  2XPI A;  5CCL A;  2XRY A;  2BF0 X;  3VTX A;  3AU4 A;  3PVL A;  4IUL A;  3RKV A;  3PDN A;  3UUX A;  4J8E A;  3UT7 A;  5KJM A;  5T4Y A;  4XIF A;  4XI9 A;  4HS2 A;  4FC8 A;  3MV2 B;  3Q47 B;  1ZU2 A;  1HO8 A;  4I9C A;  3FTV A;  1FCH A;  2XPY A;  4L7T A;  3G2V A;  2WXQ A;  2L6J A;  4HOT A;  5G05 C;  1H2U A;  3FUI A;  5BV1 A;  4AY6 A;  4H7X A;  1SZ9 A;  3D9J A;  2R17 C;  4CT0 A;  1DVP A;  4FJY A;  2WMN A;  2A5U A;  2WPV A;  1ZBP A;  3MKR A;  4UQZ A;  4GMJ A;  3PE4 A;  2CHX A;  3OXF A;  4PS8 A;  2JEK A;  4AV7 A;  3ZRH A;  4ILG A;  1SZA A;  4J6I A;  4ATG A;  4BSX A;  3KAE A;  3ML9 A;  4PDX A;  3FUD A;  1PAQ A;  2PZI A;  4L2L A;  2OV8 A;  3FU0 A;  2IOS A;  2P58 C;  2ZU6 B;  3WXX A;  5LCW J;  3UMV A;  2WXG A;  3APF A;  3I3N A;  5BV0 A;  1HZ4 A;  1NP7 A;  3CV0 A;  3UPV A;  3NZS A;  5AJD A;  4WNE A;  3CVP A;  4CGW A;  4N2Q A;  1HU3 A;  3L54 A;  1HS6 A;  5KJK A;  4WAF A;  2OVF A;  4LCT A;  4U07 A;  1Z3Y A;  2WQ6 A;  2Q7F A;  3PUK A;  2ILR A;  4MRU A;  1EPU A;  2WM9 A;  1DNP A;  2YHE A;  2CG3 A;  3RK6 A;  4JHK A;  3UQ3 A;  1OWP A;  4GA2 A;  3ZGQ A;  1N54 A;  3CEQ A;  3I5P A;  1QZ2 A;  2LAI A;  2RD0 A;  3FFL A;  3CVQ A;  4CDM A;  3CHM A;  4UI9 J;  4DK5 A;  4WWN A;  2PQR A;  4A1G A;  3LY8 A;  4BX8 A;  3IHV A;  3FHE A;  4C0E A;  3JYS A;  4D10 C;  4W9R A;  3QKY A;  5A7D B;  4CT4 A;  1OWM A;  2I1J A;  3OAW A;  4B8C B;  2J08 A;  3P1U A;  2E0I A;  4IN3 B;  4Y6C A;  3TAX A;  2AVP A;  5LCW C;  3RRU A;  2C2L A;  3ZHE A;  5KCM A;  4J8F A;  3FU5 A;  2XEV A;  1JPL A;  4EZL A;  5DIZ A;  2FBN A;  4L2Y A;  5LFA A;  1WM5 A;  4JPS A;  4XX5 A;  2ION A;  3TL5 A;  2PL2 A;  2V0P A;  3VLD A;  4R7L A;  3R9A B;  4RG9 A;  5D0Q D;  3U3W A;  4CDN A;  4UI9 C;  4ILI A;  4CCA A;  3ULQ A;  4U0U A;  4A3V A;  1W3B A;  1ELW A;  1E8X A;  2HO1 A;  3D9K A;  2LAH A;  1Z3X A;  4G11 A;  2FO7 A;  2GRM A;  2X6H A;  3QJZ A;  5BW8 C;  3ZYQ A;  4CDR A;  2KC7 A;  3MJW A;  4GCN A;  4OVU A;  5FQ4 A;  4GML A;  3PUJ A;  4BTB A;  4JA7 A;  3G2S A;  2VSY A;  2X6F A;  2MOW A;  3ZN3 A;  4TUU A;  4N39 A;  3FTU A;  4BTA A;  3TJP A;  4GZD A;  2V8S E;  5G04 J;  3LCA A;  3QB2 A;  2LNI A;  2CHW A;  3MKQ A;  5AEN A;  4TRQ A;  4HOR A;  3NQP A;  1UN9 A;  3L08 A;  4EQF A;  4JHR A;  4QFV A;  4C9B B;  3FTX A;  1OUV A;  3PZD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...