2EQXA

Solution structure of the back domain of kelch repeat and btb domain-containing protein 4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
GSSGSSGVQVGNCLQVMWLADRHSDPELYTAAKHCAKTHLAQLQNTEEFLHLPHRLLTDIISDGVPCSQNPTEAIEAWINFNKEEREAFAESLRTSLKEIGENVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the BACK domain of Kelch repeat and BTB domain-containing protein 4
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords Kelch repeat and BTB domain-containing protein 4
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2eqxA01
4HXIA 3I3NA 2EQXA 4HS2A 4APFA 4AP2A 3HVEB 3HVEA
chains in the Genus database with same CATH superfamily
3Q4AB 4JZYA 3NZUA 4L7TA 3B7SA 4GTQA 3SFYA 4PDXA 3PH0C 3JQ0A 1OWLA 2XQ0A 4X8QA 4BWRA 2L6JA 5D66A 2XEVA 1TNOA 4CRWA 3CVUA 4G1TA 4YDYA 2P9LG 2V5FA 3AS5A 1A17A 4JB8P 1EPUA 1UN9A 4ABNA 4LEUA 4AP2A 4CDRA 3NOCD 4GZ3A 4C9BB 2OEVA 3UINC 2GW1A 3S7JA 2VTBA 3L9TA 4UWFA 3G2SA 4GYOA 4KZ0A 4DK5A 3ZHEB 3RRMB 1BPOA 2P9KG 2B6CA 1N9AA 1HG2A 4GB9A 2E0IA 5E76A 5B3SE 1S70B 3FY4A 4JXTA 3U64A 2DYRE 3AG2E 2IOLA 4PUCA 2ILRA 4LG6A 1UJJA 2BEDA 5E75A 2DVWA 1EDUA 4BX8A 3FUJA 4GZCA 3FTYA 2VGYA 3P1UA 3PZ3A 2I1KA 2A4ZA 3DPYA 4UWKA 4DX6D 3G2VA 3RK6A 3U4TA 3UTMA 2WXGA 2CHXA 4PS8A 4GYYA 2DCPA 4NRHB 2V4HC 3G2UA 4B0ZA 1TNUA 1JCQA 3J5QB 3ASOE 4BTBA 1O1RA 2V8SE 4HFGA 3ZPJA 4TUUA 3B7UX 4GA2A 1NA3A 4RSYA 4DJAA 2XGSA 3HVEA 2P2CP 3K9IA 3CQGB 4GMRA 3HHMA 3T8MA 4HRLA 2NYJA 5ITZF 3LYAA 4PH4B 1N11A 3FUMA 4E85A 3UM2A 1RW2A 4AEZC 3EHQA 1FT2A 3TWWA 5G05J 2FF4A 3ULYA 2X6JA 2XPZA 3DWLG 2XGMA 1IYGA 2YHEA 4LUNU 4N3AA 4J8FA 2IFUA 3Q7FA 2JEKA 5CERB 3LS8A 4KBQA 3QB2A 3ASNE 4DX7D 5BXOA 3CVLA 4ZFHA 4Y6WA 3UM3A 3DSXA 2KATA 3SQVA 4ATGA 2J08A 2NXPA 3ASDA 1NZNA 3E4BA 2ZXWE 3FU5A 4B89A 4K5BA 5KJLA 4KVOA 4F3VA 1H2TC 4YDWA 4J6IA 2WXJA 1N4SA 4BESA 2PM6A 3TG5A 3CHQA 4CCAA 4MLPA 5G55A 3BG0B 3AU4A 3ULQA 1MHQA 1BLXB 5ENTD 4DX2A 4K0RA 2WMNA 4F6RD 4I1OB 3HDXA 3Q47B 3ML8A 3RU0A 4O6FA 4B94A 5AQ7A 1MX4A 3TWRA 3SY2A 2XZTG 4GCNA 5C1DA 2L9BA 3D9HA 1KT1A 5LOZA 4HS2A 4JA7A 4FJZA 3UT7A 4GA0A 2XS1A 4J8YA 2XRZA 5KWDA 3R7QA 4HOSA 5AQBA 4HVBA 3TG4A 2DYSE 2Y4TA 4XEIG 3Q75A 2WXOA 1YCSB 4F1SA 3SFXA 2KCVA 5JMND 5EYPF 3HG0D 4AJWA 2PZIA 3Q78A 3CVYA 2QYUA 1TYQG 3FTSA 5LP0A 3CVWA 4HOTA 3S7BA 3RRNB 3ZYQA 2GROB 1PAQA 1FT1A 4WWPA 5BW8C 5FZQA 1QBQA 4G25A 3QJZA 1OY3D 2DWZA 3RO3A 4JL0A 1SW6A 1D9SA 2IU1A 1N54A 5H7PA 2F37A 2FEZA 3HYMB 2KCLA 3APDA 4U63A 1JCSA 3LJNA 3I4RB 3E32A 3OXGA 4CT0A 2E2EA 1TN7A 2LAHA 5LFAA 3MCXA 5BV1A 3SO8A 2X6FA 1SVXA 3OAWA 2C2LA 3RRUA 3R7RA 1E8ZA 3CVQA 2WXRA 5G05C 5KNGA 3LY8A 5AQAA 2LSVA 4CZ2D 3ASGA 1N52A 4EPZA 2XEHA 3PZ4A 3VTYA 3QC1A 3CVPA 2RG8A 1SZ9A 1QYMA 2F0YA 2YQ8A 2J07A 1YA0A 1OWNA 2XZDG 2AJAA 1U3DA 2CFZA 4UQZA 2RKKA 2DZNA 2I2OA 5CEAA 4K5CA 3ABME 3AG4E 1MX2A 2WXQA 1H0AA 4HNAD 2I6HA 5IY5E 3Q49B 5D2MC 2GRNB 2XEEA 2KZTB 4DX5D 4GYWA 1MYOA 3B7BA 5DIZA 1HU3A 3R9MA 3PNTB 4U8YD 4J8DA 2WXKA 3FTUA 1B89A 2RFMA 4GCOA 4I6JA 5JJ7A 2VSXE 4EBAA 1AP7A 1OWPA 2GRRB 5EX3A 4O1PA 4I17A 3CHRA 2WVIA 5LX8A 3FU0A 4BFRA 4M3OA 2P9PG 3JXIA 4EECA 2H6FA 1HH8A 3TWTA 5T3RA 4EQFA 1JCRA 1UN8A 3CIAA 1HXIA 4GTMA 3SD5A 3DPDA 1BI8B 2IJGX 3FU3A 5KBAA 3CLJA 2ONDA 1NL4A 3CKBA 4LNUD 3CVXA 1TR4A 3ZYMA 3MGBA 2IEJA 3S2AA 2P9NG 3RKVA 2WXMA 3PZ2A 4OVUA 3URZA 5ENSD 4J7WA 2J8SD 3UQ3A 3PE4A 2J09A 5AYWD 3NBNB 3Q15A 3FTWA 3NOGD 4U0SA 2EIME 2VTBB 4A63B 5LCWC 2CHZA 5T8IA 3L13A 1ZB1A 5EIBE 1MQSA 4KVMA 3I5PA 1JWFA 2CFUA 4QFVA 4GTPA 1HS6A 3E34A 3ABLE 4KXKB 4N3BA 3ZRHA 5CRVA 3APCA 3FHEA 1Q2ZA 2PM7A 4GTOA 2ETBA 4XZ4A 2LNIA 1OWMA 3SHFA 3BEEA 1KZOA 1ELKA 4CGVA 3B7TA 3FUIA 3NB2A 3QWVA 5EYLA 1WG0A 5ENOD 2FBNA 4PS3A 3MKQA 2XPYA 4K5AB 1WY6A 3ESKA 3O48A 1H2VC 4OAVB 3W9GA 5ARFA 4F7AA 3FEXA 3E37A 3SGHA 1X81A 3UT4A 4G26A 3EIQC 3RIBA 5ARGA 4N5CA 2R2LA 1UG3A 3MV2B 3MX3A 4JHRA 3AG1E 2JLBA 4XX5A 5CHEE 3C3OA 5AENA 2WXHA 1QZ2A 4DX1A 3LDZA 3MKQB 2MRIA 4XKCA 3CK8A 3KS2A 4L23A 1E8WA 2YINA 3MV3B 3VLFA 1S64A 1BD8A 1HFAA 3RO2A 3FUKA 2KBXA 1SQMA 5KCMA 4I2ZA 3CKCA 3FUNA 3RJVA 2IO3C 3CHOA 4MKTA 3J5PA 3B95A 1NP7A 2NSZA 2WXFA 4EZJA 3QWPA 1HX8A 4I6EA 3OTNA 4UI9K 4UI9C 3NF1A 1IHGA 4KZCA 5FTPA 1E7UA 4JEUA 3HXFA 3T5VA 3LPZA 2XENA 2Y3AA 2BUGA 3FU6A 5BUZA 1HZ4A 2L0TB 3IXEA 3IEGA 2I1JA 1LF8A 4YVQC 5A7DB 4WAFA 3L22A 4BT9A 3LXUX 4WNEA 3I3NA 1KPSB 5EX0A 5G2NA 1KLXA 1YMPA 3L08A 3TWQA 3NAWA 2WB2A 3DSUA 3DXKG 5CCLA 1DCQA 1BI7B 2XHEA 3NQPA 2GGFA 3AS8A 4G24A 4EBAG 4CGWA 3L82A 5CRUA 4U95D 3CV0A 2B0OE 4WUYA 3ZN3A 3MKRA 5D0QD 4JEHA 2EIJE 2P9SG 5AAOA 1O1TA 4ANUA 4BSZB 3ASFA 3UM0A 4TRQA 2J9QA 4J8EA 4K03A 4AXHA 5ENQD 4JHJA 1OCOE 2KXPC 3PRZA 4XI9A 3CEQA 1ELRA 4HRMB 4GTSA 5JHAA 3UX4A 3JQ1A 4DUIA 3QKYA 3ZYKA 4Q96A 2BKGA 2JABA 4L2LA 4RQIA 2FO1E 3W9FA 1W3BA 4ACLA 3FDHA 4I1MA 5JHBA 4BETA 5HI7A 4APOA 4TXQA 4BT8A 3L6AA 4I6GA 2OCCE 3KEZA 2KCKA 3HIZA 3PZDA 4L9PA 3CHPA 5AJDA 1JWGA 2AXUA 3PREA 1VDYA 3WG7E 2IONA 4V3IA 3KSLA 2GRPB 3FTVA 4GMLA 2WXNA 1H6PA 2LXMA 1X5BA 1V54E 5A23A 2QFCA 4RLYA 1E90A 2ETCA 4UWGA 2R5SA 1IQRA 4I1AA 4D10C 3FP3A 4IN3B 3DEOA 4BTAA 3AU5A 3UIOC 1N0RA 2P58C 2LXLA 3ABKE 3SBTB 3IHYA 1N4QA 5LCWJ 3GYZA 1FVHA 4WNFA 3ZXPA 2XCBA 4U07A 5HKPA 2FULA 4BEPA 2OVBA 2WM9A 3Q7AA 4I9CA 3EU9A 1E8XA 1DC2A 1O1SA 4IYPA 2HO1A 3AG3E 1RZ4A 1S63A 3VTXA 2VSOE 3QOUA 5CMYA 2MOWA 2WQ7A 3QNKA 4A1SA 1FCHA 5CBNA 1ZBPA 4ACKA 4RG6A 1EF1C 2VGXA 3N71A 4QQIA 2X6KA 2LSUA 3SFZA 3SBSA 3UMVA 1LTXA 2A5UA 4HOUA 5JJ6A 2QC9A 3Q5MA 3HXBA 2EILE 5ENNA 3PUJA 3MJWA 2P9IG 2R59A 3OXFA 2ETAA 2X3MA 3IKOB 3S7FA 1KZPA 1PC2A 1WDYA 3V2OA 2VGEA 1IQUA 5T4YA 3KEAA 2EINE 4O1OA 2CG2A 1U2VG 4ILHB 4L2YA 4M7CA 2Y0BG 1TNZA 2L6BA 1OCCE 4U0UA 4XE0A 3DSTA 4PS7A 4ANXA 4OVVA 3HXCA 5AARA 5BV0A 1SA4A 4ATZD 1AWCB 4XI0A 2I9CA 1TEZA 2L0IA 5ENRD 3C3QA 2KC7A 1NI1A 3GZ2A 4MS6A 2R17C 2F8YA 2WMOA 5AN8A 1Z3YA 5FZSA 2GRMA 1K3ZD 4ZHBA 3MZLB 3RSEG 3ZW3A 2GRLA 3LJ3A 4HOQA 2AXVA 2WPVA 3FULA 5B1AE 3UKRG 3PZ1A 5HQ8A 3FTXA 4MRUA 3ISMC 2UY1A 3D3MA 3ML9A 2AXZA 3HRAA 3G2WA 4A3TA 2AW6A 2BKKB 1OCZE 4XIFA 2M63A 3D9LA 3B13A 2X38A 3PE3A 4G11A 4N2SA 3P2BA 3UIPC 2V4LA 5FQ8A 4AY6A 2YNQA 1H2UA 1U3CA 3JUEA 4U8VD 5KJKA 5ENPD 4EHMA 3R9AB 4R7LA 5KNHD 2H6HA 2Y4UA 1G3NB 5CEDB 3LY9A 2QYJA 2V5QC 1DNPA 4OYSA 5J08A 2QZAA 4A1GA 1WAO1 3SI5A 4B8CB 4HORA 2CG3A 3FUDA 4U7EB 3FEYA 2Y69E 1MX6A 4U04A 4AY5A 3L17A 1TJFA 4KYOB 4UWHA 5CBOA 3FH8A 4B8AA 4HXIA 4FADA 5DBKA 1H19A 4TXPA 3ZEFA 2AVPA 3I4GA 1Y8MA 4JD2G 2RFAA 1E8YA 1HG5A 2VSNA 2FO7A 5HRYA 1O5MA 2CHWA 3GZSA 1DCEA 4LCTA 3D9JA 4B93B 4UQXA 3QDNA 3TAXA 5FZRA 3LY7A 4TV3A 3JCKC 4LRZA 2F8XK 4AM9A 5HS0A 4YDEA 5FJYA 3PNLB 3FUEA 1MJ0A 4JVSA 3UPVA 4HI8A 4Q69A 3V2XA 1P5QA 4I9EA 1E96B 3IBEA 3TXNA 3D9MA 1N4RA 4FHJA 5CCMA 4O60A 3QK0A 4G8KA 4F53A 3Q9UC 3AJIA 1UOHA 4NACA 5C2YA 2PQNA 5G04J 2J49A 4BY6A 5BXUA 5EKQD 1GW6A 3DEPA 4HRNA 2OVFA 3GZ1A 4APFA 5CMWA 5FT9A 3D9NA 4LERA 5A6CA 5KJNA 2HR2A 2QY7A 3CQCB 4GTRA 3MEKA 4Z68A 3BG1B 3D9KA 3EHRA 1K8KG 4NQ0A 3FH5A 5AQ9A 3BQOA 3EUVA 1QQEA 3DSVA 4C48B 2H6GA 3EDTB 2XGOA 2YHCA 1HF8A 2R05A 3EU5A 3F6QA 3ZUVB 4Q94A 4A55A 2C0LA 2MYOA 4DRXE 1D8EA 3HVEB 3DXMG 3CVNA 4DLOA 3TGOA 3U66A 1MZCA 3DBSA 3UUXA 5FWQA 1QNFA 3VLDA 3LCAA 4CDNA 4ANVA 1FVFA 4LNBA 3GW4A 4CDMA 4AIFA 2LAIA 3PEUB 2VJ8A 3ZKJA 3FWVA 4J8SA 5CECB 2HE0A 3L54A 4GZDA 4J0UA 5ANLA 3FUFA 4JA9A 1XNFA 3FUHA 4WWNA 1OT8A 4BSXA 5BNWA 2EQXA 2DBAA 4FJYA 3Q79A 2P9UG 1TN8A 2OV8A 3ZHEA 3KSQA 4JW1A 1JUQA 5D0OD 3JYSA 4FHKA 4TXRA 1N4PA 2Q7FA 4GMJA 3CK9A 5EN5D 4FULA 2NC9A 3CHSA 1IKND 5BPPA 2ZGGA 3NZSA 5AIJA 3CGHA 1Z5SC 1TNYA 3ZGQA 2IO2C 1IHBA 5KJMA 2WXPA 4URKA 4U96D 3TWVA 3QAQA 2J4DA 1H6KA 4JPSA 2VGXB 2AWIA 1OWOA 4F1PA 1SA5A 5EDSA 1PY1A 4FLBA 1KT0A 2BTDA 3ZYLA 3EIJA 4G2VA 1SZAA 4H7XA 4BERA 1UW4B 1V55E 3TWUA 2ZISA 1ZU2A 3UXGA 2PNNA 3WXXA 3B7RL 2HM8A 4HLEA 5EILA 2PQRA 1HE8A 3ASHA 3IHVA 4ME2A 5FQ7A 1D8DA 3L16A 1N94A 1OUVA 3PEVB 1LD7A 4YNDA 3C5RA 2KZTA 2VYIA 3PS6A 2X6IA 2OOEA 3T5XA 2DZOA 3TWSA 4FP7A 1XGWA 4LSZE 1L5JA 3OXLA 2XRYA 4P29A 5AJLA 4GTVA 5G04C 3EHNA 4E6HA 3QARA 4A3VA 3MA5A 4GZ6A 3CVVA 4FC8A 3ULEG 4MBGA 1TN6A 4CT4A 5JA4D 2IF4A 2XPIA 2LO6A 3D9IA 1Z3XA 4YVOA 5BT1A 3CHMA 2KM4A 2ZGDA 4ANWA 3S7DA 2HYZA 3TWXA 4UQYA 2EIKE 2ZIRA 4N5QA 3C98A 3FTZA 4UWLA 2X6HA 3APFA 1UJKA 3FH7A 3ONKA 1TNBA 4HI9A 3Q73A 4WNDA 2RD0A 3ZVVA 3UT8A 3V79K 1ELWA 4G23A 4HQDA 3U3WA 3CSFA 3PDNA 4AVXA 3DSSA 1N95A 4UI9J 4DI3A 2DIWA 3LVRE 4DPRA 4C0EA 3LKUA 4I2WA 4ILIA 3TJPA 4CEMA 3LVQE 3SF4A 5ANRA 3E30A 3ZXSA 1BU9A 4DI4A 3E33A 3BUAA 3CK7A 4HLLA 1S0PA 4JHKA 1H6OA 3JXJA 3CR3A 3CSTA 1NA0A 2IQCA 2XS8A 2VQ2A 2WXIA 4HB5A 3U9WA 1FPPA 4I43A 4GAAA 3EHMA 3QWWA 3V31A 5FQ6A 3Q9NC 3ZNGA 2C0MA 3DSWA 2VSYA 4LNGA 4UUCA 3KAEA 3T8KA 1INZA 3TL5A 1HO8A 5FIOA 4WWOA 5J90A 3ONLA 4C0MA 3T9KA 3PVLA 1A5EA 2XCCA 3ZFWA 4RVBA 4BX9A 3MYVA 2PL2A 3FFLA 3LEWA 4KT6B 4W9RA 1WM5A 4ILGA 4GTTA 4GZ5A 5B1BE 2MHKA 3ZIMA 3UI2A 4FU3A 5JJTA 4HBDA 1TJCA 4H7YA 3X2QE 3D9OA 2H6IA 4N39A 3ENEA 2ZU6B 1YYHA 1K1AA 3O4ZA 4GPKA 4EZKA 1Y6IA 4FA6A 4N3CA 4GU5A 4YDOA 3AAAC 3C3RA 4IRUA 3V30A 3UM1A 2WXLA 4WNGA 1IXVA 3TXMA 1JPLA 3D9PA 2WQHA 4U8HA 5FINA 2UWJG 1DVPA 3PUKA 2A5EA 4JC8A 3G2TA 4TUMA 4RG9A 2R02A 3SZ7A 2OEWA 4OAUC 3ESLA 4L1BA 2FI7A 2WQ6A 4NIKA 1K1BA 3DRAA 4G8LA 3C72A 3VLEA 4AV7A 2UY1B 1EYHA 3KD7A 5EIDA 4IULA 3AS4A 3SNXA 3HXEA 2GRQB 1OXJA 2LUHA 2Y1LE 1LD8A 4N2QA 4GA1A 4EZLA 3RAUA 4U0ZA 4KMOA 1NFIE 2R03A 2V0PA 2BF0X 4Y6CA 5M72A 3JUIA 1N0QA 2IY0C 4AOFA 2IOSA 4NURA 3UKUG 1E7VA 4DLQA 3EJNA 4CYMD 3HXDA 5FQ4A 3ZU7B 3IV0A 1OCRE 4XKBA 3BU8A 4FLHA 4GPMA 1Z6TA 2J4BA
chains in the Genus database with same CATH topology
3UUXA 2WXKA 3FTUA 1B89A 1IQRA 3Q4AB 5FWQA 4I1AA 1QNFA 4D10C 3FP3A 4GCOA 4I6JA 4IN3B 3VLDA 5JJ7A 2VSXE 4BTAA 3AU5A 4JZYA 3LCAA 4EBAA 3NZUA 4L7TA 3B7SA 1OWPA 2P58C 4PDXA 4CDNA 3PH0C 4ANVA 1FVFA 5EX3A 4I17A 3SBTB 3JQ0A 3IHYA 5LCWJ 3GW4A 4CDMA 1OWLA 3CHRA 4AIFA 3GYZA 1FVHA 4WNFA 2WVIA 2LAIA 2XCBA 2XQ0A 5LX8A 3PEUB 4BWRA 2L6JA 3FU0A 4U07A 2FULA 4BFRA 2VJ8A 2XEVA 4M3OA 3FWVA 4J8SA 2OVBA 3L54A 4GZDA 4J0UA 5ANLA 4CRWA 4EECA 3FUFA 3CVUA 2WM9A 1XNFA 4G1TA 4JA9A 1HH8A 3FUHA 4WWNA 4BSXA 5BNWA 2V5FA 2EQXA 2DBAA 4I9CA 4FJYA 3AS5A 5T3RA 4EQFA 1A17A 2OV8A 1EPUA 1UN8A 1E8XA 3CIAA 1HXIA 3ZHEA 4JW1A 3SD5A 4IYPA 3DPDA 1UN9A 4ABNA 2IJGX 3FU3A 4LEUA 2HO1A 1JUQA 5D0OD 3JYSA 4FHKA 4AP2A 4CDRA 2Q7FA 3CLJA 4GMJA 2ONDA 3CK9A 4GZ3A 3CKBA 3VTXA 2VSOE 4FULA 2NC9A 3QOUA 4C9BB 3CHSA 2GW1A 3CVXA 3S7JA 5BPPA 3NZSA 5CMYA 3ZYMA 3CGHA 5AIJA 2VTBA 3MGBA 3S2AA 3ZGQA 2MOWA 4UWFA 2WQ7A 3QNKA 5KJMA 2WXPA 3G2SA 4A1SA 3RKVA 4URKA 2WXMA 4OVUA 3URZA 1FCHA 3QAQA 2J4DA 1ZBPA 4GYOA 4ACKA 4KZ0A 1H6KA 3UQ3A 4RG6A 4DK5A 3PE4A 3ZHEB 1EF1C 2VGXA 2J09A 3N71A 1BPOA 2VGXB 2X6KA 4JPSA 5AYWD 3RRMB 2AWIA 1OWOA 2LSUA 3Q15A 3SFZA 1HG2A 5EDSA 1PY1A 3FTWA 3SBSA 4GB9A 2E0IA 3UMVA 4FLBA 1KT0A 5E76A 2BTDA 3ZYLA 3EIJA 2A5UA 3FY4A 1SZAA 4G2VA 4H7XA 4HOUA 1UW4B 4JXTA 4U0SA 5JJ6A 3U64A 2VTBB 2IOLA 3Q5MA 4PUCA 5LCWC 2CHZA 5ENNA 5T8IA 3PUJA 2ILRA 3MJWA 2R59A 3L13A 1UJJA 3OXFA 1MQSA 1ZU2A 2X3MA 4KVMA 3I5PA 5E75A 3IKOB 3S7FA 1JWFA 1PC2A 2CFUA 4QFVA 3WXXA 1HS6A 3B7RL 2HM8A 1IQUA 1EDUA 4HLEA 4KXKB 5T4YA 4BX8A 3FUJA 2PQRA 1HE8A 3ASHA 3IHVA 4N3BA 4GZCA 2CG2A 3FTYA 2VGYA 3ZRHA 4ILHB 3P1UA 3APCA 4ME2A 5FQ7A 2I1KA 2A4ZA 3FHEA 4L2YA 3L16A 2PM7A 1OUVA 3PEVB 4UWKA 4YNDA 4XZ4A 2KZTA 2VYIA 2LNIA 3G2VA 3PS6A 2X6IA 3RK6A 1OWMA 3SHFA 3U4TA 2OOEA 2WXGA 2CHXA 4PS8A 3BEEA 3T5XA 4U0UA 4XE0A 1ELKA 4PS7A 4FP7A 1XGWA 3B7TA 3FUIA 3QWVA 4OVVA 4ANXA 4CGVA 5BV0A 4GYYA 2DCPA 4NRHB 1L5JA 3OXLA 4XI0A 3G2UA 2FBNA 4B0ZA 2I9CA 4BTBA 2V8SE 4PS3A 2XRYA 4HFGA 4P29A 5AJLA 3ZPJA 4TUUA 3B7UX 5G04C 1TEZA 2L0IA 3EHNA 3MKQA 4GA2A 4E6HA 2XPYA 1NA3A 2KC7A 4RSYA 4DJAA 3GZ2A 2XGSA 1WY6A 3QARA 3MA5A 3ESKA 4A3VA 4GZ6A 3CVVA 4MS6A 3O48A 1H2VC 2R17C 3HVEA 4FC8A 5ARFA 3K9IA 4F7AA 3CQGB 3HHMA 2WMOA 4CT4A 3T8MA 1Z3YA 3FEXA 2IF4A 2XPIA 2LO6A 5FZSA 2GRMA 3SGHA 3D9IA 3LYAA 4G26A 1Z3XA 3UT4A 4PH4B 3EIQC 4YVOA 3RIBA 5ARGA 4N5CA 3FUMA 3MZLB 4E85A 3ZW3A 5BT1A 2GRLA 3LJ3A 4HOQA 1UG3A 2AXVA 3CHMA 2KM4A 3MV2B 4AEZC 3MX3A 2WPVA 5G05J 3FULA 2FF4A 4JHRA 4ANWA 3S7DA 2HYZA 2X6JA 2XPZA 4UQYA 2XGMA 2JLBA 1IYGA 2YHEA 4LUNU 4XX5A 5HQ8A 4N3AA 3C98A 5CHEE 3FTZA 4J8FA 4UWLA 3FTXA 4MRUA 2IFUA 2UY1A 2X6HA 3APFA 3D3MA 3ML9A 5AENA 2WXHA 1QZ2A 1UJKA 2AXZA 3FH7A 3G2WA 4A3TA 2AW6A 2JEKA 3ONKA 3LS8A 4KBQA 4XIFA 3LDZA 2M63A 3MKQB 2MRIA 3QB2A 3D9LA 3B13A 4WNDA 2RD0A 2X38A 3ZVVA 3UT8A 4XKCA 3CVLA 3CK8A 1ELWA 3KS2A 4L23A 3PE3A 4G23A 4Y6WA 1E8WA 2YINA 4G11A 3U3WA 3CSFA 3PDNA 3MV3B 3VLFA 4AVXA 4N2SA 3P2BA 1HFAA 3RO2A 4UI9J 4DI3A 3FUKA 2DIWA 2V4LA 2KATA 3LVRE 5FQ8A 2YNQA 4DPRA 1SQMA 3LKUA 4I2WA 4ILIA 5KCMA 3TJPA 4I2ZA 2J08A 4ATGA 4C0EA 2NXPA 3ASDA 4CEMA 1NZNA 3E4BA 3LVQE 1H2UA 3FU5A 1U3CA 3SF4A 5ANRA 3CKCA 3FUNA 3ZXSA 4B89A 3RJVA 4DI4A 5KJLA 3CHOA 4MKTA 5KJKA 3CK7A 1NP7A 4KVOA 4F3VA 1S0PA 1H2TC 2NSZA 2WXFA 4EZJA 3QWPA 4J6IA 2WXJA 4JHKA 3R9AB 1HX8A 3CR3A 4R7LA 2PM6A 4I6EA 3TG5A 3CSTA 3OTNA 4UI9K 1NA0A 4UI9C 2Y4UA 2IQCA 1IHGA 2VQ2A 3CHQA 2WXIA 3NF1A 4CCAA 3U9WA 3LY9A 4KZCA 4MLPA 5FTPA 3BG0B 1E7UA 5G55A 3AU4A 3ULQA 4I43A 1MHQA 1DNPA 4JEUA 4OYSA 3T5VA 4K0RA 4GAAA 5J08A 3EHMA 2WMNA 3LPZA 4A1GA 3QWWA 1WAO1 4I1OB 2Y3AA 2BUGA 3SI5A 3FU6A 4B8CB 3HDXA 1HZ4A 3Q47B 5BUZA 3ML8A 3RU0A 4HORA 4O6FA 2CG3A 5FQ6A 3FUDA 4B94A 2C0MA 2L0TB 3FEYA 4U04A 2VSYA 4AY5A 3L17A 4GCNA 3KAEA 1INZA 5C1DA 1TJFA 2L9BA 3IEGA 1KT1A 3TL5A 4KYOB 5LOZA 4HS2A 4JA7A 4UWHA 2I1JA 4FJZA 1HO8A 1LF8A 4YVQC 3FH8A 3UT7A 4HXIA 5A7DB 4B8AA 4FADA 4GA0A 4WWOA 5DBKA 4WAFA 5J90A 3L22A 4BT9A 3ONLA 4J8DA 3LXUX 2XRZA 4WNEA 4C0MA 3I3NA 3R7QA 1H19A 4HOSA 3PVLA 5EX0A 2XCCA 3ZEFA 5G2NA 2AVPA 1KLXA 3I4GA 3ZFWA 1Y8MA 4RVBA 4HVBA 3L08A 3TG4A 4BX9A 2Y4TA 2PL2A 3FFLA 3MYVA 3LEWA 1E8YA 4KT6B 4W9RA 1WM5A 1HG5A 2VSNA 2FO7A 2WXOA 2WB2A 4ILGA 4GZ5A 4F1SA 3ZIMA 2MHKA 2KCVA 5CCLA 2CHWA 3GZSA 4FU3A 5JJTA 4AJWA 1TJCA 2PZIA 4H7YA 3CVYA 2XHEA 4LCTA 3D9JA 4UQXA 3FTSA 3NQPA 5LP0A 3CVWA 3QDNA 2GGFA 3TAXA 4HOTA 3D9OA 3AS8A 3S7BA 4AY6A 4G24A 5FZRA 4N39A 3LY7A 4TV3A 3RRNB 4EBAG 3ZYQA 3ENEA 4CGWA 2ZU6B 1PAQA 3JCKC 4WWPA 5BW8C 4LRZA 5FZQA 4G25A 3QJZA 3O4ZA 4AM9A 4GPKA 3CV0A 5FJYA 3RO3A 4WUYA 4EZKA 3PNLB 4JL0A 1Y6IA 3ZN3A 3FUEA 3MKRA 5D0QD 4FA6A 2IU1A 4JVSA 1N54A 4N3CA 4JEHA 4GU5A 3UPVA 2FEZA 4ANUA 3HYMB 4IRUA 2KCLA 3APDA 2WXLA 4U63A 4WNGA 3TXMA 1JPLA 3ASFA 4Q69A 3I4RB 1P5QA 4TRQA 3D9PA 4I9EA 2WQHA 1E96B 2J9QA 3IBEA 3OXGA 3TXNA 4CT0A 2E2EA 4U8HA 4J8EA 2LAHA 3D9MA 4K03A 4AXHA 4JHJA 5LFAA 3MCXA 3PRZA 5BV1A 2UWJG 1DVPA 4FHJA 3CEQA 3QK0A 4XI9A 4F53A 3PUKA 1ELRA 2X6FA 5CCMA 4JC8A 4NACA 5C2YA 3G2TA 3OAWA 2C2LA 4RG9A 2PQNA 3R7RA 3RRUA 3JQ1A 5G04J 3SZ7A 3UX4A 5JHAA 2J49A 4BY6A 3QKYA 3ZYKA 4Q96A 5EKQD 1GW6A 1E8ZA 3CVQA 2WXRA 3ESLA 4L2LA 4L1BA 2FI7A 5G05C 2WQ6A 3LY8A 2OVFA 3GZ1A 2LSVA 4APFA 3ASGA 1N52A 1W3BA 5FT9A 3D9NA 4LERA 4ACLA 3FDHA 5CMWA 4I1MA 5A6CA 5KJNA 2HR2A 4EPZA 5JHBA 2QY7A 3CQCB 3VTYA 3MEKA 3QC1A 3CVPA 5HI7A 2RG8A 3BG1B 3VLEA 4APOA 1SZ9A 4AV7A 4BT8A 2UY1B 3D9KA 3L6AA 4I6GA 1EYHA 3KD7A 2YQ8A 2J07A 3KEZA 2KCKA 3AS4A 1YA0A 1OWNA 4IULA 3SNXA 3HIZA 4NQ0A 1U3DA 3FH5A 2CFZA 3PZDA 4N2QA 4UQZA 4GA1A 4EZLA 3CHPA 5AJDA 4U0ZA 4KMOA 1JWGA 1QQEA 2AXUA 3PREA 2I2OA 1VDYA 2V0PA 3EDTB 2IONA 2XGOA 2BF0X 4Y6CA 5M72A 2YHCA 1HF8A 3JUIA 4V3IA 3FTVA 2WXQA 4AOFA 1H0AA 2IOSA 4NURA 4GMLA 2WXNA 4Q94A 4A55A 1E7VA 4DLQA 2C0LA 3EJNA 2I6HA 1X5BA 3Q49B 5A23A 5FQ4A 3HVEB 2QFCA 3IV0A 4XKBA 2KZTB 1E90A 3CVNA 4FLHA 4UWGA 4GYWA 4DLOA 3TGOA 3U66A 2R5SA 5DIZA 1HU3A 1Z6TA 2J4BA 3PNTB 3DBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HXI A;  3I3N A;  2EQX A;  4HS2 A;  4APF A;  4AP2 A;  3HVE B;  3HVE A; 
#chains in the Genus database with same CATH topology
 3Q4A B;  4JZY A;  3NZU A;  4L7T A;  3B7S A;  4GTQ A;  3SFY A;  4PDX A;  3PH0 C;  3JQ0 A;  1OWL A;  2XQ0 A;  4X8Q A;  4BWR A;  2L6J A;  5D66 A;  2XEV A;  1TNO A;  4CRW A;  3CVU A;  4G1T A;  4YDY A;  2P9L G;  2V5F A;  3AS5 A;  1A17 A;  4JB8 P;  1EPU A;  1UN9 A;  4ABN A;  4LEU A;  4AP2 A;  4CDR A;  3NOC D;  4GZ3 A;  4C9B B;  2OEV A;  3UIN C;  2GW1 A;  3S7J A;  2VTB A;  3L9T A;  4UWF A;  3G2S A;  4GYO A;  4KZ0 A;  4DK5 A;  3ZHE B;  3RRM B;  1BPO A;  2P9K G;  2B6C A;  1N9A A;  1HG2 A;  4GB9 A;  2E0I A;  5E76 A;  5B3S E;  1S70 B;  3FY4 A;  4JXT A;  3U64 A;  2DYR E;  3AG2 E;  2IOL A;  4PUC A;  2ILR A;  4LG6 A;  1UJJ A;  2BED A;  5E75 A;  2DVW A;  1EDU A;  4BX8 A;  3FUJ A;  4GZC A;  3FTY A;  2VGY A;  3P1U A;  3PZ3 A;  2I1K A;  2A4Z A;  3DPY A;  4UWK A;  4DX6 D;  3G2V A;  3RK6 A;  3U4T A;  3UTM A;  2WXG A;  2CHX A;  4PS8 A;  4GYY A;  2DCP A;  4NRH B;  2V4H C;  3G2U A;  4B0Z A;  1TNU A;  1JCQ A;  3J5Q B;  3ASO E;  4BTB A;  1O1R A;  2V8S E;  4HFG A;  3ZPJ A;  4TUU A;  3B7U X;  4GA2 A;  1NA3 A;  4RSY A;  4DJA A;  2XGS A;  3HVE A;  2P2C P;  3K9I A;  3CQG B;  4GMR A;  3HHM A;  3T8M A;  4HRL A;  2NYJ A;  5ITZ F;  3LYA A;  4PH4 B;  1N11 A;  3FUM A;  4E85 A;  3UM2 A;  1RW2 A;  4AEZ C;  3EHQ A;  1FT2 A;  3TWW A;  5G05 J;  2FF4 A;  3ULY A;  2X6J A;  2XPZ A;  3DWL G;  2XGM A;  1IYG A;  2YHE A;  4LUN U;  4N3A A;  4J8F A;  2IFU A;  3Q7F A;  2JEK A;  5CER B;  3LS8 A;  4KBQ A;  3QB2 A;  3ASN E;  4DX7 D;  5BXO A;  3CVL A;  4ZFH A;  4Y6W A;  3UM3 A;  3DSX A;  2KAT A;  3SQV A;  4ATG A;  2J08 A;  2NXP A;  3ASD A;  1NZN A;  3E4B A;  2ZXW E;  3FU5 A;  4B89 A;  4K5B A;  5KJL A;  4KVO A;  4F3V A;  1H2T C;  4YDW A;  4J6I A;  2WXJ A;  1N4S A;  4BES A;  2PM6 A;  3TG5 A;  3CHQ A;  4CCA A;  4MLP A;  5G55 A;  3BG0 B;  3AU4 A;  3ULQ A;  1MHQ A;  1BLX B;  5ENT D;  4DX2 A;  4K0R A;  2WMN A;  4F6R D;  4I1O B;  3HDX A;  3Q47 B;  3ML8 A;  3RU0 A;  4O6F A;  4B94 A;  5AQ7 A;  1MX4 A;  3TWR A;  3SY2 A;  2XZT G;  4GCN A;  5C1D A;  2L9B A;  3D9H A;  1KT1 A;  5LOZ A;  4HS2 A;  4JA7 A;  4FJZ A;  3UT7 A;  4GA0 A;  2XS1 A;  4J8Y A;  2XRZ A;  5KWD A;  3R7Q A;  4HOS A;  5AQB A;  4HVB A;  3TG4 A;  2DYS E;  2Y4T A;  4XEI G;  3Q75 A;  2WXO A;  1YCS B;  4F1S A;  3SFX A;  2KCV A;  5JMN D;  5EYP F;  3HG0 D;  4AJW A;  2PZI A;  3Q78 A;  3CVY A;  2QYU A;  1TYQ G;  3FTS A;  5LP0 A;  3CVW A;  4HOT A;  3S7B A;  3RRN B;  3ZYQ A;  2GRO B;  1PAQ A;  1FT1 A;  4WWP A;  5BW8 C;  5FZQ A;  1QBQ A;  4G25 A;  3QJZ A;  1OY3 D;  2DWZ A;  3RO3 A;  4JL0 A;  1SW6 A;  1D9S A;  2IU1 A;  1N54 A;  5H7P A;  2F37 A;  2FEZ A;  3HYM B;  2KCL A;  3APD A;  4U63 A;  1JCS A;  3LJN A;  3I4R B;  3E32 A;  3OXG A;  4CT0 A;  2E2E A;  1TN7 A;  2LAH A;  5LFA A;  3MCX A;  5BV1 A;  3SO8 A;  2X6F A;  1SVX A;  3OAW A;  2C2L A;  3RRU A;  3R7R A;  1E8Z A;  3CVQ A;  2WXR A;  5G05 C;  5KNG A;  3LY8 A;  5AQA A;  2LSV A;  4CZ2 D;  3ASG A;  1N52 A;  4EPZ A;  2XEH A;  3PZ4 A;  3VTY A;  3QC1 A;  3CVP A;  2RG8 A;  1SZ9 A;  1QYM A;  2F0Y A;  2YQ8 A;  2J07 A;  1YA0 A;  1OWN A;  2XZD G;  2AJA A;  1U3D A;  2CFZ A;  4UQZ A;  2RKK A;  2DZN A;  2I2O A;  5CEA A;  4K5C A;  3ABM E;  3AG4 E;  1MX2 A;  2WXQ A;  1H0A A;  4HNA D;  2I6H A;  5IY5 E;  3Q49 B;  5D2M C;  2GRN B;  2XEE A;  2KZT B;  4DX5 D;  4GYW A;  1MYO A;  3B7B A;  5DIZ A;  1HU3 A;  3R9M A;  3PNT B;  4U8Y D;  4J8D A;  2WXK A;  3FTU A;  1B89 A;  2RFM A;  4GCO A;  4I6J A;  5JJ7 A;  2VSX E;  4EBA A;  1AP7 A;  1OWP A;  2GRR B;  5EX3 A;  4O1P A;  4I17 A;  3CHR A;  2WVI A;  5LX8 A;  3FU0 A;  4BFR A;  4M3O A;  2P9P G;  3JXI A;  4EEC A;  2H6F A;  1HH8 A;  3TWT A;  5T3R A;  4EQF A;  1JCR A;  1UN8 A;  3CIA A;  1HXI A;  4GTM A;  3SD5 A;  3DPD A;  1BI8 B;  2IJG X;  3FU3 A;  5KBA A;  3CLJ A;  2OND A;  1NL4 A;  3CKB A;  4LNU D;  3CVX A;  1TR4 A;  3ZYM A;  3MGB A;  2IEJ A;  3S2A A;  2P9N G;  3RKV A;  2WXM A;  3PZ2 A;  4OVU A;  3URZ A;  5ENS D;  4J7W A;  2J8S D;  3UQ3 A;  3PE4 A;  2J09 A;  5AYW D;  3NBN B;  3Q15 A;  3FTW A;  3NOG D;  4U0S A;  2EIM E;  2VTB B;  4A63 B;  5LCW C;  2CHZ A;  5T8I A;  3L13 A;  1ZB1 A;  5EIB E;  1MQS A;  4KVM A;  3I5P A;  1JWF A;  2CFU A;  4QFV A;  4GTP A;  1HS6 A;  3E34 A;  3ABL E;  4KXK B;  4N3B A;  3ZRH A;  5CRV A;  3APC A;  3FHE A;  1Q2Z A;  2PM7 A;  4GTO A;  2ETB A;  4XZ4 A;  2LNI A;  1OWM A;  3SHF A;  3BEE A;  1KZO A;  1ELK A;  4CGV A;  3B7T A;  3FUI A;  3NB2 A;  3QWV A;  5EYL A;  1WG0 A;  5ENO D;  2FBN A;  4PS3 A;  3MKQ A;  2XPY A;  4K5A B;  1WY6 A;  3ESK A;  3O48 A;  1H2V C;  4OAV B;  3W9G A;  5ARF A;  4F7A A;  3FEX A;  3E37 A;  3SGH A;  1X81 A;  3UT4 A;  4G26 A;  3EIQ C;  3RIB A;  5ARG A;  4N5C A;  2R2L A;  1UG3 A;  3MV2 B;  3MX3 A;  4JHR A;  3AG1 E;  2JLB A;  4XX5 A;  5CHE E;  3C3O A;  5AEN A;  2WXH A;  1QZ2 A;  4DX1 A;  3LDZ A;  3MKQ B;  2MRI A;  4XKC A;  3CK8 A;  3KS2 A;  4L23 A;  1E8W A;  2YIN A;  3MV3 B;  3VLF A;  1S64 A;  1BD8 A;  1HFA A;  3RO2 A;  3FUK A;  2KBX A;  1SQM A;  5KCM A;  4I2Z A;  3CKC A;  3FUN A;  3RJV A;  2IO3 C;  3CHO A;  4MKT A;  3J5P A;  3B95 A;  1NP7 A;  2NSZ A;  2WXF A;  4EZJ A;  3QWP A;  1HX8 A;  4I6E A;  3OTN A;  4UI9 K;  4UI9 C;  3NF1 A;  1IHG A;  4KZC A;  5FTP A;  1E7U A;  4JEU A;  3HXF A;  3T5V A;  3LPZ A;  2XEN A;  2Y3A A;  2BUG A;  3FU6 A;  5BUZ A;  1HZ4 A;  2L0T B;  3IXE A;  3IEG A;  2I1J A;  1LF8 A;  4YVQ C;  5A7D B;  4WAF A;  3L22 A;  4BT9 A;  3LXU X;  4WNE A;  3I3N A;  1KPS B;  5EX0 A;  5G2N A;  1KLX A;  1YMP A;  3L08 A;  3TWQ A;  3NAW A;  2WB2 A;  3DSU A;  3DXK G;  5CCL A;  1DCQ A;  1BI7 B;  2XHE A;  3NQP A;  2GGF A;  3AS8 A;  4G24 A;  4EBA G;  4CGW A;  3L82 A;  5CRU A;  4U95 D;  3CV0 A;  2B0O E;  4WUY A;  3ZN3 A;  3MKR A;  5D0Q D;  4JEH A;  2EIJ E;  2P9S G;  5AAO A;  1O1T A;  4ANU A;  4BSZ B;  3ASF A;  3UM0 A;  4TRQ A;  2J9Q A;  4J8E A;  4K03 A;  4AXH A;  5ENQ D;  4JHJ A;  1OCO E;  2KXP C;  3PRZ A;  4XI9 A;  3CEQ A;  1ELR A;  4HRM B;  4GTS A;  5JHA A;  3UX4 A;  3JQ1 A;  4DUI A;  3QKY A;  3ZYK A;  4Q96 A;  2BKG A;  2JAB A;  4L2L A;  4RQI A;  2FO1 E;  3W9F A;  1W3B A;  4ACL A;  3FDH A;  4I1M A;  5JHB A;  4BET A;  5HI7 A;  4APO A;  4TXQ A;  4BT8 A;  3L6A A;  4I6G A;  2OCC E;  3KEZ A;  2KCK A;  3HIZ A;  3PZD A;  4L9P A;  3CHP A;  5AJD A;  1JWG A;  2AXU A;  3PRE A;  1VDY A;  3WG7 E;  2ION A;  4V3I A;  3KSL A;  2GRP B;  3FTV A;  4GML A;  2WXN A;  1H6P A;  2LXM A;  1X5B A;  1V54 E;  5A23 A;  2QFC A;  4RLY A;  1E90 A;  2ETC A;  4UWG A;  2R5S A;  1IQR A;  4I1A A;  4D10 C;  3FP3 A;  4IN3 B;  3DEO A;  4BTA A;  3AU5 A;  3UIO C;  1N0R A;  2P58 C;  2LXL A;  3ABK E;  3SBT B;  3IHY A;  1N4Q A;  5LCW J;  3GYZ A;  1FVH A;  4WNF A;  3ZXP A;  2XCB A;  4U07 A;  5HKP A;  2FUL A;  4BEP A;  2OVB A;  2WM9 A;  3Q7A A;  4I9C A;  3EU9 A;  1E8X A;  1DC2 A;  1O1S A;  4IYP A;  2HO1 A;  3AG3 E;  1RZ4 A;  1S63 A;  3VTX A;  2VSO E;  3QOU A;  5CMY A;  2MOW A;  2WQ7 A;  3QNK A;  4A1S A;  1FCH A;  5CBN A;  1ZBP A;  4ACK A;  4RG6 A;  1EF1 C;  2VGX A;  3N71 A;  4QQI A;  2X6K A;  2LSU A;  3SFZ A;  3SBS A;  3UMV A;  1LTX A;  2A5U A;  4HOU A;  5JJ6 A;  2QC9 A;  3Q5M A;  3HXB A;  2EIL E;  5ENN A;  3PUJ A;  3MJW A;  2P9I G;  2R59 A;  3OXF A;  2ETA A;  2X3M A;  3IKO B;  3S7F A;  1KZP A;  1PC2 A;  1WDY A;  3V2O A;  2VGE A;  1IQU A;  5T4Y A;  3KEA A;  2EIN E;  4O1O A;  2CG2 A;  1U2V G;  4ILH B;  4L2Y A;  4M7C A;  2Y0B G;  1TNZ A;  2L6B A;  1OCC E;  4U0U A;  4XE0 A;  3DST A;  4PS7 A;  4ANX A;  4OVV A;  3HXC A;  5AAR A;  5BV0 A;  1SA4 A;  4ATZ D;  1AWC B;  4XI0 A;  2I9C A;  1TEZ A;  2L0I A;  5ENR D;  3C3Q A;  2KC7 A;  1NI1 A;  3GZ2 A;  4MS6 A;  2R17 C;  2F8Y A;  2WMO A;  5AN8 A;  1Z3Y A;  5FZS A;  2GRM A;  1K3Z D;  4ZHB A;  3MZL B;  3RSE G;  3ZW3 A;  2GRL A;  3LJ3 A;  4HOQ A;  2AXV A;  2WPV A;  3FUL A;  5B1A E;  3UKR G;  3PZ1 A;  5HQ8 A;  3FTX A;  4MRU A;  3ISM C;  2UY1 A;  3D3M A;  3ML9 A;  2AXZ A;  3HRA A;  3G2W A;  4A3T A;  2AW6 A;  2BKK B;  1OCZ E;  4XIF A;  2M63 A;  3D9L A;  3B13 A;  2X38 A;  3PE3 A;  4G11 A;  4N2S A;  3P2B A;  3UIP C;  2V4L A;  5FQ8 A;  4AY6 A;  2YNQ A;  1H2U A;  1U3C A;  3JUE A;  4U8V D;  5KJK A;  5ENP D;  4EHM A;  3R9A B;  4R7L A;  5KNH D;  2H6H A;  2Y4U A;  1G3N B;  5CED B;  3LY9 A;  2QYJ A;  2V5Q C;  1DNP A;  4OYS A;  5J08 A;  2QZA A;  4A1G A;  1WAO 1;  3SI5 A;  4B8C B;  4HOR A;  2CG3 A;  3FUD A;  4U7E B;  3FEY A;  2Y69 E;  1MX6 A;  4U04 A;  4AY5 A;  3L17 A;  1TJF A;  4KYO B;  4UWH A;  5CBO A;  3FH8 A;  4B8A A;  4HXI A;  4FAD A;  5DBK A;  1H19 A;  4TXP A;  3ZEF A;  2AVP A;  3I4G A;  1Y8M A;  4JD2 G;  2RFA A;  1E8Y A;  1HG5 A;  2VSN A;  2FO7 A;  5HRY A;  1O5M A;  2CHW A;  3GZS A;  1DCE A;  4LCT A;  3D9J A;  4B93 B;  4UQX A;  3QDN A;  3TAX A;  5FZR A;  3LY7 A;  4TV3 A;  3JCK C;  4LRZ A;  2F8X K;  4AM9 A;  5HS0 A;  4YDE A;  5FJY A;  3PNL B;  3FUE A;  1MJ0 A;  4JVS A;  3UPV A;  4HI8 A;  4Q69 A;  3V2X A;  1P5Q A;  4I9E A;  1E96 B;  3IBE A;  3TXN A;  3D9M A;  1N4R A;  4FHJ A;  5CCM A;  4O60 A;  3QK0 A;  4G8K A;  4F53 A;  3Q9U C;  3AJI A;  1UOH A;  4NAC A;  5C2Y A;  2PQN A;  5G04 J;  2J49 A;  4BY6 A;  5BXU A;  5EKQ D;  1GW6 A;  3DEP A;  4HRN A;  2OVF A;  3GZ1 A;  4APF A;  5CMW A;  5FT9 A;  3D9N A;  4LER A;  5A6C A;  5KJN A;  2HR2 A;  2QY7 A;  3CQC B;  4GTR A;  3MEK A;  4Z68 A;  3BG1 B;  3D9K A;  3EHR A;  1K8K G;  4NQ0 A;  3FH5 A;  5AQ9 A;  3BQO A;  3EUV A;  1QQE A;  3DSV A;  4C48 B;  2H6G A;  3EDT B;  2XGO A;  2YHC A;  1HF8 A;  2R05 A;  3EU5 A;  3F6Q A;  3ZUV B;  4Q94 A;  4A55 A;  2C0L A;  2MYO A;  4DRX E;  1D8E A;  3HVE B;  3DXM G;  3CVN A;  4DLO A;  3TGO A;  3U66 A;  1MZC A;  3DBS A;  3UUX A;  5FWQ A;  1QNF A;  3VLD A;  3LCA A;  4CDN A;  4ANV A;  1FVF A;  4LNB A;  3GW4 A;  4CDM A;  4AIF A;  2LAI A;  3PEU B;  2VJ8 A;  3ZKJ A;  3FWV A;  4J8S A;  5CEC B;  2HE0 A;  3L54 A;  4GZD A;  4J0U A;  5ANL A;  3FUF A;  4JA9 A;  1XNF A;  3FUH A;  4WWN A;  1OT8 A;  4BSX A;  5BNW A;  2EQX A;  2DBA A;  4FJY A;  3Q79 A;  2P9U G;  1TN8 A;  2OV8 A;  3ZHE A;  3KSQ A;  4JW1 A;  1JUQ A;  5D0O D;  3JYS A;  4FHK A;  4TXR A;  1N4P A;  2Q7F A;  4GMJ A;  3CK9 A;  5EN5 D;  4FUL A;  2NC9 A;  3CHS A;  1IKN D;  5BPP A;  2ZGG A;  3NZS A;  5AIJ A;  3CGH A;  1Z5S C;  1TNY A;  3ZGQ A;  2IO2 C;  1IHB A;  5KJM A;  2WXP A;  4URK A;  4U96 D;  3TWV A;  3QAQ A;  2J4D A;  1H6K A;  4JPS A;  2VGX B;  2AWI A;  1OWO A;  4F1P A;  1SA5 A;  5EDS A;  1PY1 A;  4FLB A;  1KT0 A;  2BTD A;  3ZYL A;  3EIJ A;  4G2V A;  1SZA A;  4H7X A;  4BER A;  1UW4 B;  1V55 E;  3TWU A;  2ZIS A;  1ZU2 A;  3UXG A;  2PNN A;  3WXX A;  3B7R L;  2HM8 A;  4HLE A;  5EIL A;  2PQR A;  1HE8 A;  3ASH A;  3IHV A;  4ME2 A;  5FQ7 A;  1D8D A;  3L16 A;  1N94 A;  1OUV A;  3PEV B;  1LD7 A;  4YND A;  3C5R A;  2KZT A;  2VYI A;  3PS6 A;  2X6I A;  2OOE A;  3T5X A;  2DZO A;  3TWS A;  4FP7 A;  1XGW A;  4LSZ E;  1L5J A;  3OXL A;  2XRY A;  4P29 A;  5AJL A;  4GTV A;  5G04 C;  3EHN A;  4E6H A;  3QAR A;  4A3V A;  3MA5 A;  4GZ6 A;  3CVV A;  4FC8 A;  3ULE G;  4MBG A;  1TN6 A;  4CT4 A;  5JA4 D;  2IF4 A;  2XPI A;  2LO6 A;  3D9I A;  1Z3X A;  4YVO A;  5BT1 A;  3CHM A;  2KM4 A;  2ZGD A;  4ANW A;  3S7D A;  2HYZ A;  3TWX A;  4UQY A;  2EIK E;  2ZIR A;  4N5Q A;  3C98 A;  3FTZ A;  4UWL A;  2X6H A;  3APF A;  1UJK A;  3FH7 A;  3ONK A;  1TNB A;  4HI9 A;  3Q73 A;  4WND A;  2RD0 A;  3ZVV A;  3UT8 A;  3V79 K;  1ELW A;  4G23 A;  4HQD A;  3U3W A;  3CSF A;  3PDN A;  4AVX A;  3DSS A;  1N95 A;  4UI9 J;  4DI3 A;  2DIW A;  3LVR E;  4DPR A;  4C0E A;  3LKU A;  4I2W A;  4ILI A;  3TJP A;  4CEM A;  3LVQ E;  3SF4 A;  5ANR A;  3E30 A;  3ZXS A;  1BU9 A;  4DI4 A;  3E33 A;  3BUA A;  3CK7 A;  4HLL A;  1S0P A;  4JHK A;  1H6O A;  3JXJ A;  3CR3 A;  3CST A;  1NA0 A;  2IQC A;  2XS8 A;  2VQ2 A;  2WXI A;  4HB5 A;  3U9W A;  1FPP A;  4I43 A;  4GAA A;  3EHM A;  3QWW A;  3V31 A;  5FQ6 A;  3Q9N C;  3ZNG A;  2C0M A;  3DSW A;  2VSY A;  4LNG A;  4UUC A;  3KAE A;  3T8K A;  1INZ A;  3TL5 A;  1HO8 A;  5FIO A;  4WWO A;  5J90 A;  3ONL A;  4C0M A;  3T9K A;  3PVL A;  1A5E A;  2XCC A;  3ZFW A;  4RVB A;  4BX9 A;  3MYV A;  2PL2 A;  3FFL A;  3LEW A;  4KT6 B;  4W9R A;  1WM5 A;  4ILG A;  4GTT A;  4GZ5 A;  5B1B E;  2MHK A;  3ZIM A;  3UI2 A;  4FU3 A;  5JJT A;  4HBD A;  1TJC A;  4H7Y A;  3X2Q E;  3D9O A;  2H6I A;  4N39 A;  3ENE A;  2ZU6 B;  1YYH A;  1K1A A;  3O4Z A;  4GPK A;  4EZK A;  1Y6I A;  4FA6 A;  4N3C A;  4GU5 A;  4YDO A;  3AAA C;  3C3R A;  4IRU A;  3V30 A;  3UM1 A;  2WXL A;  4WNG A;  1IXV A;  3TXM A;  1JPL A;  3D9P A;  2WQH A;  4U8H A;  5FIN A;  2UWJ G;  1DVP A;  3PUK A;  2A5E A;  4JC8 A;  3G2T A;  4TUM A;  4RG9 A;  2R02 A;  3SZ7 A;  2OEW A;  4OAU C;  3ESL A;  4L1B A;  2FI7 A;  2WQ6 A;  4NIK A;  1K1B A;  3DRA A;  4G8L A;  3C72 A;  3VLE A;  4AV7 A;  2UY1 B;  1EYH A;  3KD7 A;  5EID A;  4IUL A;  3AS4 A;  3SNX A;  3HXE A;  2GRQ B;  1OXJ A;  2LUH A;  2Y1L E;  1LD8 A;  4N2Q A;  4GA1 A;  4EZL A;  3RAU A;  4U0Z A;  4KMO A;  1NFI E;  2R03 A;  2V0P A;  2BF0 X;  4Y6C A;  5M72 A;  3JUI A;  1N0Q A;  2IY0 C;  4AOF A;  2IOS A;  4NUR A;  3UKU G;  1E7V A;  4DLQ A;  3EJN A;  4CYM D;  3HXD A;  5FQ4 A;  3ZU7 B;  3IV0 A;  1OCR E;  4XKB A;  3BU8 A;  4FLH A;  4GPM A;  1Z6T A;  2J4B A; 
#chains in the Genus database with same CATH homology
 3UUX A;  2WXK A;  3FTU A;  1B89 A;  1IQR A;  3Q4A B;  5FWQ A;  4I1A A;  1QNF A;  4D10 C;  3FP3 A;  4GCO A;  4I6J A;  4IN3 B;  3VLD A;  5JJ7 A;  2VSX E;  4BTA A;  3AU5 A;  4JZY A;  3LCA A;  4EBA A;  3NZU A;  4L7T A;  3B7S A;  1OWP A;  2P58 C;  4PDX A;  4CDN A;  3PH0 C;  4ANV A;  1FVF A;  5EX3 A;  4I17 A;  3SBT B;  3JQ0 A;  3IHY A;  5LCW J;  3GW4 A;  4CDM A;  1OWL A;  3CHR A;  4AIF A;  3GYZ A;  1FVH A;  4WNF A;  2WVI A;  2LAI A;  2XCB A;  2XQ0 A;  5LX8 A;  3PEU B;  4BWR A;  2L6J A;  3FU0 A;  4U07 A;  2FUL A;  4BFR A;  2VJ8 A;  2XEV A;  4M3O A;  3FWV A;  4J8S A;  2OVB A;  3L54 A;  4GZD A;  4J0U A;  5ANL A;  4CRW A;  4EEC A;  3FUF A;  3CVU A;  2WM9 A;  1XNF A;  4G1T A;  4JA9 A;  1HH8 A;  3FUH A;  4WWN A;  4BSX A;  5BNW A;  2V5F A;  2EQX A;  2DBA A;  4I9C A;  4FJY A;  3AS5 A;  5T3R A;  4EQF A;  1A17 A;  2OV8 A;  1EPU A;  1UN8 A;  1E8X A;  3CIA A;  1HXI A;  3ZHE A;  4JW1 A;  3SD5 A;  4IYP A;  3DPD A;  1UN9 A;  4ABN A;  2IJG X;  3FU3 A;  4LEU A;  2HO1 A;  1JUQ A;  5D0O D;  3JYS A;  4FHK A;  4AP2 A;  4CDR A;  2Q7F A;  3CLJ A;  4GMJ A;  2OND A;  3CK9 A;  4GZ3 A;  3CKB A;  3VTX A;  2VSO E;  4FUL A;  2NC9 A;  3QOU A;  4C9B B;  3CHS A;  2GW1 A;  3CVX A;  3S7J A;  5BPP A;  3NZS A;  5CMY A;  3ZYM A;  3CGH A;  5AIJ A;  2VTB A;  3MGB A;  3S2A A;  3ZGQ A;  2MOW A;  4UWF A;  2WQ7 A;  3QNK A;  5KJM A;  2WXP A;  3G2S A;  4A1S A;  3RKV A;  4URK A;  2WXM A;  4OVU A;  3URZ A;  1FCH A;  3QAQ A;  2J4D A;  1ZBP A;  4GYO A;  4ACK A;  4KZ0 A;  1H6K A;  3UQ3 A;  4RG6 A;  4DK5 A;  3PE4 A;  3ZHE B;  1EF1 C;  2VGX A;  2J09 A;  3N71 A;  1BPO A;  2VGX B;  2X6K A;  4JPS A;  5AYW D;  3RRM B;  2AWI A;  1OWO A;  2LSU A;  3Q15 A;  3SFZ A;  1HG2 A;  5EDS A;  1PY1 A;  3FTW A;  3SBS A;  4GB9 A;  2E0I A;  3UMV A;  4FLB A;  1KT0 A;  5E76 A;  2BTD A;  3ZYL A;  3EIJ A;  2A5U A;  3FY4 A;  1SZA A;  4G2V A;  4H7X A;  4HOU A;  1UW4 B;  4JXT A;  4U0S A;  5JJ6 A;  3U64 A;  2VTB B;  2IOL A;  3Q5M A;  4PUC A;  5LCW C;  2CHZ A;  5ENN A;  5T8I A;  3PUJ A;  2ILR A;  3MJW A;  2R59 A;  3L13 A;  1UJJ A;  3OXF A;  1MQS A;  1ZU2 A;  2X3M A;  4KVM A;  3I5P A;  5E75 A;  3IKO B;  3S7F A;  1JWF A;  1PC2 A;  2CFU A;  4QFV A;  3WXX A;  1HS6 A;  3B7R L;  2HM8 A;  1IQU A;  1EDU A;  4HLE A;  4KXK B;  5T4Y A;  4BX8 A;  3FUJ A;  2PQR A;  1HE8 A;  3ASH A;  3IHV A;  4N3B A;  4GZC A;  2CG2 A;  3FTY A;  2VGY A;  3ZRH A;  4ILH B;  3P1U A;  3APC A;  4ME2 A;  5FQ7 A;  2I1K A;  2A4Z A;  3FHE A;  4L2Y A;  3L16 A;  2PM7 A;  1OUV A;  3PEV B;  4UWK A;  4YND A;  4XZ4 A;  2KZT A;  2VYI A;  2LNI A;  3G2V A;  3PS6 A;  2X6I A;  3RK6 A;  1OWM A;  3SHF A;  3U4T A;  2OOE A;  2WXG A;  2CHX A;  4PS8 A;  3BEE A;  3T5X A;  4U0U A;  4XE0 A;  1ELK A;  4PS7 A;  4FP7 A;  1XGW A;  3B7T A;  3FUI A;  3QWV A;  4OVV A;  4ANX A;  4CGV A;  5BV0 A;  4GYY A;  2DCP A;  4NRH B;  1L5J A;  3OXL A;  4XI0 A;  3G2U A;  2FBN A;  4B0Z A;  2I9C A;  4BTB A;  2V8S E;  4PS3 A;  2XRY A;  4HFG A;  4P29 A;  5AJL A;  3ZPJ A;  4TUU A;  3B7U X;  5G04 C;  1TEZ A;  2L0I A;  3EHN A;  3MKQ A;  4GA2 A;  4E6H A;  2XPY A;  1NA3 A;  2KC7 A;  4RSY A;  4DJA A;  3GZ2 A;  2XGS A;  1WY6 A;  3QAR A;  3MA5 A;  3ESK A;  4A3V A;  4GZ6 A;  3CVV A;  4MS6 A;  3O48 A;  1H2V C;  2R17 C;  3HVE A;  4FC8 A;  5ARF A;  3K9I A;  4F7A A;  3CQG B;  3HHM A;  2WMO A;  4CT4 A;  3T8M A;  1Z3Y A;  3FEX A;  2IF4 A;  2XPI A;  2LO6 A;  5FZS A;  2GRM A;  3SGH A;  3D9I A;  3LYA A;  4G26 A;  1Z3X A;  3UT4 A;  4PH4 B;  3EIQ C;  4YVO A;  3RIB A;  5ARG A;  4N5C A;  3FUM A;  3MZL B;  4E85 A;  3ZW3 A;  5BT1 A;  2GRL A;  3LJ3 A;  4HOQ A;  1UG3 A;  2AXV A;  3CHM A;  2KM4 A;  3MV2 B;  4AEZ C;  3MX3 A;  2WPV A;  5G05 J;  3FUL A;  2FF4 A;  4JHR A;  4ANW A;  3S7D A;  2HYZ A;  2X6J A;  2XPZ A;  4UQY A;  2XGM A;  2JLB A;  1IYG A;  2YHE A;  4LUN U;  4XX5 A;  5HQ8 A;  4N3A A;  3C98 A;  5CHE E;  3FTZ A;  4J8F A;  4UWL A;  3FTX A;  4MRU A;  2IFU A;  2UY1 A;  2X6H A;  3APF A;  3D3M A;  3ML9 A;  5AEN A;  2WXH A;  1QZ2 A;  1UJK A;  2AXZ A;  3FH7 A;  3G2W A;  4A3T A;  2AW6 A;  2JEK A;  3ONK A;  3LS8 A;  4KBQ A;  4XIF A;  3LDZ A;  2M63 A;  3MKQ B;  2MRI A;  3QB2 A;  3D9L A;  3B13 A;  4WND A;  2RD0 A;  2X38 A;  3ZVV A;  3UT8 A;  4XKC A;  3CVL A;  3CK8 A;  1ELW A;  3KS2 A;  4L23 A;  3PE3 A;  4G23 A;  4Y6W A;  1E8W A;  2YIN A;  4G11 A;  3U3W A;  3CSF A;  3PDN A;  3MV3 B;  3VLF A;  4AVX A;  4N2S A;  3P2B A;  1HFA A;  3RO2 A;  4UI9 J;  4DI3 A;  3FUK A;  2DIW A;  2V4L A;  2KAT A;  3LVR E;  5FQ8 A;  2YNQ A;  4DPR A;  1SQM A;  3LKU A;  4I2W A;  4ILI A;  5KCM A;  3TJP A;  4I2Z A;  2J08 A;  4ATG A;  4C0E A;  2NXP A;  3ASD A;  4CEM A;  1NZN A;  3E4B A;  3LVQ E;  1H2U A;  3FU5 A;  1U3C A;  3SF4 A;  5ANR A;  3CKC A;  3FUN A;  3ZXS A;  4B89 A;  3RJV A;  4DI4 A;  5KJL A;  3CHO A;  4MKT A;  5KJK A;  3CK7 A;  1NP7 A;  4KVO A;  4F3V A;  1S0P A;  1H2T C;  2NSZ A;  2WXF A;  4EZJ A;  3QWP A;  4J6I A;  2WXJ A;  4JHK A;  3R9A B;  1HX8 A;  3CR3 A;  4R7L A;  2PM6 A;  4I6E A;  3TG5 A;  3CST A;  3OTN A;  4UI9 K;  1NA0 A;  4UI9 C;  2Y4U A;  2IQC A;  1IHG A;  2VQ2 A;  3CHQ A;  2WXI A;  3NF1 A;  4CCA A;  3U9W A;  3LY9 A;  4KZC A;  4MLP A;  5FTP A;  3BG0 B;  1E7U A;  5G55 A;  3AU4 A;  3ULQ A;  4I43 A;  1MHQ A;  1DNP A;  4JEU A;  4OYS A;  3T5V A;  4K0R A;  4GAA A;  5J08 A;  3EHM A;  2WMN A;  3LPZ A;  4A1G A;  3QWW A;  1WAO 1;  4I1O B;  2Y3A A;  2BUG A;  3SI5 A;  3FU6 A;  4B8C B;  3HDX A;  1HZ4 A;  3Q47 B;  5BUZ A;  3ML8 A;  3RU0 A;  4HOR A;  4O6F A;  2CG3 A;  5FQ6 A;  3FUD A;  4B94 A;  2C0M A;  2L0T B;  3FEY A;  4U04 A;  2VSY A;  4AY5 A;  3L17 A;  4GCN A;  3KAE A;  1INZ A;  5C1D A;  1TJF A;  2L9B A;  3IEG A;  1KT1 A;  3TL5 A;  4KYO B;  5LOZ A;  4HS2 A;  4JA7 A;  4UWH A;  2I1J A;  4FJZ A;  1HO8 A;  1LF8 A;  4YVQ C;  3FH8 A;  3UT7 A;  4HXI A;  5A7D B;  4B8A A;  4FAD A;  4GA0 A;  4WWO A;  5DBK A;  4WAF A;  5J90 A;  3L22 A;  4BT9 A;  3ONL A;  4J8D A;  3LXU X;  2XRZ A;  4WNE A;  4C0M A;  3I3N A;  3R7Q A;  1H19 A;  4HOS A;  3PVL A;  5EX0 A;  2XCC A;  3ZEF A;  5G2N A;  2AVP A;  1KLX A;  3I4G A;  3ZFW A;  1Y8M A;  4RVB A;  4HVB A;  3L08 A;  3TG4 A;  4BX9 A;  2Y4T A;  2PL2 A;  3FFL A;  3MYV A;  3LEW A;  1E8Y A;  4KT6 B;  4W9R A;  1WM5 A;  1HG5 A;  2VSN A;  2FO7 A;  2WXO A;  2WB2 A;  4ILG A;  4GZ5 A;  4F1S A;  3ZIM A;  2MHK A;  2KCV A;  5CCL A;  2CHW A;  3GZS A;  4FU3 A;  5JJT A;  4AJW A;  1TJC A;  2PZI A;  4H7Y A;  3CVY A;  2XHE A;  4LCT A;  3D9J A;  4UQX A;  3FTS A;  3NQP A;  5LP0 A;  3CVW A;  3QDN A;  2GGF A;  3TAX A;  4HOT A;  3D9O A;  3AS8 A;  3S7B A;  4AY6 A;  4G24 A;  5FZR A;  4N39 A;  3LY7 A;  4TV3 A;  3RRN B;  4EBA G;  3ZYQ A;  3ENE A;  4CGW A;  2ZU6 B;  1PAQ A;  3JCK C;  4WWP A;  5BW8 C;  4LRZ A;  5FZQ A;  4G25 A;  3QJZ A;  3O4Z A;  4AM9 A;  4GPK A;  3CV0 A;  5FJY A;  3RO3 A;  4WUY A;  4EZK A;  3PNL B;  4JL0 A;  1Y6I A;  3ZN3 A;  3FUE A;  3MKR A;  5D0Q D;  4FA6 A;  2IU1 A;  4JVS A;  1N54 A;  4N3C A;  4JEH A;  4GU5 A;  3UPV A;  2FEZ A;  4ANU A;  3HYM B;  4IRU A;  2KCL A;  3APD A;  2WXL A;  4U63 A;  4WNG A;  3TXM A;  1JPL A;  3ASF A;  4Q69 A;  3I4R B;  1P5Q A;  4TRQ A;  3D9P A;  4I9E A;  2WQH A;  1E96 B;  2J9Q A;  3IBE A;  3OXG A;  3TXN A;  4CT0 A;  2E2E A;  4U8H A;  4J8E A;  2LAH A;  3D9M A;  4K03 A;  4AXH A;  4JHJ A;  5LFA A;  3MCX A;  3PRZ A;  5BV1 A;  2UWJ G;  1DVP A;  4FHJ A;  3CEQ A;  3QK0 A;  4XI9 A;  4F53 A;  3PUK A;  1ELR A;  2X6F A;  5CCM A;  4JC8 A;  4NAC A;  5C2Y A;  3G2T A;  3OAW A;  2C2L A;  4RG9 A;  2PQN A;  3R7R A;  3RRU A;  3JQ1 A;  5G04 J;  3SZ7 A;  3UX4 A;  5JHA A;  2J49 A;  4BY6 A;  3QKY A;  3ZYK A;  4Q96 A;  5EKQ D;  1GW6 A;  1E8Z A;  3CVQ A;  2WXR A;  3ESL A;  4L2L A;  4L1B A;  2FI7 A;  5G05 C;  2WQ6 A;  3LY8 A;  2OVF A;  3GZ1 A;  2LSV A;  4APF A;  3ASG A;  1N52 A;  1W3B A;  5FT9 A;  3D9N A;  4LER A;  4ACL A;  3FDH A;  5CMW A;  4I1M A;  5A6C A;  5KJN A;  2HR2 A;  4EPZ A;  5JHB A;  2QY7 A;  3CQC B;  3VTY A;  3MEK A;  3QC1 A;  3CVP A;  5HI7 A;  2RG8 A;  3BG1 B;  3VLE A;  4APO A;  1SZ9 A;  4AV7 A;  4BT8 A;  2UY1 B;  3D9K A;  3L6A A;  4I6G A;  1EYH A;  3KD7 A;  2YQ8 A;  2J07 A;  3KEZ A;  2KCK A;  3AS4 A;  1YA0 A;  1OWN A;  4IUL A;  3SNX A;  3HIZ A;  4NQ0 A;  1U3D A;  3FH5 A;  2CFZ A;  3PZD A;  4N2Q A;  4UQZ A;  4GA1 A;  4EZL A;  3CHP A;  5AJD A;  4U0Z A;  4KMO A;  1JWG A;  1QQE A;  2AXU A;  3PRE A;  2I2O A;  1VDY A;  2V0P A;  3EDT B;  2ION A;  2XGO A;  2BF0 X;  4Y6C A;  5M72 A;  2YHC A;  1HF8 A;  3JUI A;  4V3I A;  3FTV A;  2WXQ A;  4AOF A;  1H0A A;  2IOS A;  4NUR A;  4GML A;  2WXN A;  4Q94 A;  4A55 A;  1E7V A;  4DLQ A;  2C0L A;  3EJN A;  2I6H A;  1X5B A;  3Q49 B;  5A23 A;  5FQ4 A;  3HVE B;  2QFC A;  3IV0 A;  4XKB A;  2KZT B;  1E90 A;  3CVN A;  4FLH A;  4UWG A;  4GYW A;  4DLO A;  3TGO A;  3U66 A;  2R5S A;  5DIZ A;  1HU3 A;  1Z6T A;  2J4B A;  3PNT B;  3DBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...