2EQXA

Solution structure of the back domain of kelch repeat and btb domain-containing protein 4
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
105
structure length
105
Chain Sequence
GSSGSSGVQVGNCLQVMWLADRHSDPELYTAAKHCAKTHLAQLQNTEEFLHLPHRLLTDIISDGVPCSQNPTEAIEAWINFNKEEREAFAESLRTSLKEIGENVH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Kelch repeat and BTB domain-containing protein 4
publication title Solution structure of the BACK domain of Kelch repeat and BTB domain-containing protein 4
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 29
structure length 105
sequence length 105
ec nomenclature
pdb deposition date 2007-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07707 BACK BTB And C-terminal Kelch
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.420 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2eqxA01
4APFA 4HXIA 3HVEB 4HS2A 4AP2A 2EQXA 3HVEA 3I3NA
chains in the Genus database with same CATH superfamily
3C98A 4RG9A 3DXKG 4CDNA 3E37A 5D0OD 4BTAA 5FIOA 2V4HC 4C0MA 3J5PA 4LG6A 4HQDA 3QARA 3N71A 4GAAA 2RFAA 3Q75A 4DX2A 1YYHA 4IRUA 4FC8A 4FP7A 5FZQA 4BETA 5ARFA 3P1UA 2JEKA 4APFA 1OCRE 1SQMA 4OAVB 2IO2C 4B94A 5ENNA 3EHQA 1TNBA 3LJ3A 3I4RB 3ML9A 2EIME 2J4BA 2LAHA 2AVPA 5AARA 5DBKA 4JXTA 3IKOB 1E7VA 1Z3XA 2DZOA 3Q5MA 1KZPA 4ACKA 2P9KG 2AXZA 3CHPA 4N5QA 3ONKA 4FHKA 1N9AA 3B7UX 4YNDA 3CK9A 1GW6A 3MJWA 1EPUA 2KC7A 2Y69E 3IHVA 2ETAA 5ENPD 3PZDA 2FO1E 5EN5D 3TWXA 3CK8A 3B7BA 1WDYA 3D9LA 2DZNA 3PE3A 3C5RA 4L1BA 2NYJA 4XI0A 4AY5A 1N54A 3HXDA 3SHFA 3T8KA 4O6FA 2GRMA 4HB5A 2XGOA 4RLYA 2QYJA 1H0AA 4GMRA 3DSTA 5LP0A 2WXGA 2Y0BG 2YNQA 4FULA 4K5CA 2CHZA 4YDWA 3FUIA 4ATGA 4FLBA 5JJ7A 2V4LA 5JJ6A 3DSWA 1OT8A 3KS2A 2Y4TA 2OEWA 4GTMA 4PS3A 1O1TA 2FO7A 4YVOA 4M3OA 2IEJA 4JA9A 5BT1A 2J9QA 2FI7A 3MYVA 2H6IA 3IEGA 1BU9A 3D9OA 5HS0A 2F8XK 2ETCA 3C3RA 4C48B 4U95D 1FCHA 1Y6IA 1QZ2A 3VTYA 4I9EA 3U66A 4K03A 3PREA 2XPIA 5A7DB 4GTTA 2QZAA 1MZCA 3EHNA 3OXLA 3PUKA 3ZGQA 3DXMG 2IQCA 3LYAA 4BY6A 3PH0C 2F0YA 5ENOD 4LCTA 3C3QA 3X2QE 3ASOE 4V3IA 3AG2E 5KNGA 4UI9J 2I1JA 4HRNA 1TJCA 4U04A 1MX2A 3LY8A 2IU1A 2L0TB 2AJAA 2IFUA 3DEOA 3LXUX 5KJLA 3PZ2A 3SGHA 2PM7A 4N3AA 4DX6D 5E75A 3MKQB 5ITZF 5KBAA 3CHMA 3QJZA 2LAIA 4ANUA 3MCXA 5EYPF 2WB2A 3VLEA 1X81A 3MKQA 2XEEA 4H7XA 3NQPA 4G25A 4GTSA 3B7SA 3UQ3A 5AJDA 3L82A 1ZBPA 3MGBA 4MKTA 1H6KA 1TNZA 4R7LA 3PS6A 3UIPC 2PNNA 4M7CA 3L6AA 2WXHA 5JJTA 2GGFA 3LS8A 3RO3A 4I9CA 4XIFA 5H7PA 2EINE 3AAAC 3SFZA 4KT6B 3RO2A 1DNPA 4XE0A 1X5BA 4WNDA 3FUEA 2BF0X 4J6IA 5M72A 2KATA 4BT8A 3LPZA 1KT0A 3LJNA 4HORA 4HRMB 2RFMA 2ZISA 5A6CA 1HXIA 4HOSA 2DIWA 5EX0A 3VLFA 4ATZD 2XPZA 3C72A 3FTYA 2GRNB 3AG1E 3PZ4A 4PH4B 1U2VG 4U96D 2L0IA 1UG3A 1XGWA 4GZ5A 4I6GA 3TWTA 2GRRB 4UWHA 1IYGA 3RK6A 4MS6A 3D9PA 4U0UA 3LVQE 3PE4A 5ANRA 4GYWA 1HFAA 3ASHA 3KEZA 4UWKA 4Q96A 1MX6A 3Q73A 4HVBA 3EJNA 3L16A 3S7BA 3FTXA 4O1PA 5HKPA 2R02A 2HR2A 4K5AB 3DSVA 1D9SA 4EPZA 4I6JA 3G2SA 1O5MA 3L9TA 4HNAD 3JUEA 4JB8P 4RQIA 4BSXA 3WXXA 2FBNA 4AOFA 3LEWA 3G2TA 2XCCA 4AY6A 4G26A 3PRZA 5KWDA 2IY0C 4WNFA 3NZSA 4DRXE 1TNOA 1AWCB 1WY6A 4J8YA 3NBNB 1UN9A 5G04J 2YHEA 4K5BA 3W9FA 1QBQA 1DCQA 2EIJE 5B3SE 2KXPC 5KJKA 4FHJA 1MYOA 4HFGA 2WQ6A 3T9KA 4F1PA 2DVWA 2BUGA 3NB2A 3CEQA 4CGVA 3FEXA 4FADA 4YDYA 3HG0D 2P9IG 4O60A 3KAEA 3TGOA 5BW8C 3LY9A 3MKRA 2HM8A 2WMOA 3HDXA 1XNFA 1Z6TA 1TN6A 1OCOE 3TWVA 1N4RA 4J8SA 3E33A 3DSXA 4GZ6A 1MX4A 5ENTD 4EECA 4Y6CA 2DYSE 4I6EA 2F37A 5D2MC 3DPYA 3GZ2A 4GCOA 4UQXA 3WG7E 1KLXA 4GMLA 1H6OA 2CHWA 3ZVVA 1JUQA 3D9NA 4G24A 4KZCA 2OV8A 3TWWA 1E96B 3UM1A 3JXIA 2XGMA 3D9IA 3KSQA 3GYZA 5CBOA 4EZLA 3SZ7A 4GYOA 1K8KG 3EHMA 1N11A 1D8EA 4XI9A 4BTBA 3QWWA 4XZ4A 2VJ8A 3FTZA 2BKKB 3FUFA 2YINA 3NF1A 3UIOC 1BD8A 5ENRD 2ILRA 2KCVA 2P9PG 4JHKA 4GTOA 2I9CA 3S7JA 4GTRA 2QFCA 3QWVA 3SY2A 5EX3A 1PY1A 2FULA 5C1DA 2MHKA 4FJYA 2A5EA 4Z68A 4LEUA 2XZDG 5EDSA 1NL4A 3T5VA 3ZPJA 4KMOA 1V54E 2DYRE 3QDNA 2GRPB 2R17C 2GRQB 3AS5A 4EHMA 3U9WA 4GTPA 4OYSA 5FINA 3O4ZA 3Q79A 3CQGB 4P29A 3FTSA 1ELRA 4ANWA 2VSOE 2LXMA 4GZDA 3PDNA 4CYMD 4I2ZA 3CVQA 5D66A 3MX3A 3HRAA 3AS4A 3DWLG 1HH8A 4BT9A 4ANXA 4UWFA 1WM5A 4HXIA 4CDMA 3BEEA 4EZJA 3PZ3A 4GZ3A 3D9KA 1OY3D 3S2AA 3BQOA 4DX1A 1IKND 1NI1A 2L9BA 4L2LA 4ILIA 3I4GA 5G55A 2P58C 1FVFA 4IN3B 4NURA 4L2YA 1JWGA 3FEYA 4OVUA 5IY5E 4LSZE 3Q7AA 3T5XA 3UM0A 1HX8A 1JWFA 5G2NA 3QWPA 2WXIA 4BERA 2AXVA 2UY1B 3RIBA 3AG3E 5CCLA 3RJVA 5CRUA 2X6FA 4GCNA 3ABME 4TXRA 1NZNA 3UUXA 2ETBA 1FT2A 4AIFA 4CCAA 4Q69A 3QKYA 5BPPA 5AYWD 4MBGA 3BG0B 2FF4A 2WPVA 2H6GA 3LCAA 2BEDA 2UY1A 2M63A 1A5EA 4DJAA 1Y8MA 2LNIA 2KBXA 3SQVA 4AV7A 5CHEE 1H6PA 4X8QA 3KD7A 3PEUB 2WXMA 5BUZA 5KJMA 4ABNA 2WXJA 4JEUA 3LDZA 1RZ4A 2ZIRA 3FP3A 3MEKA 2LO6A 3LVRE 1PAQA 4GMJA 2L6BA 5AQ9A 4BX8A 2BTDA 4L9PA 3IV0A 1SW6A 1UN8A 5ANLA 3SI5A 2H6FA 3TL5A 3FFLA 4Q94A 3D9JA 3ASGA 3R9AB 5JHBA 5AN8A 4G8KA 3ZYLA 2DBAA 4GPKA 1Z3YA 4JL0A 4WWNA 3R7QA 3UT8A 3B7TA 3EU9A 4LNGA 4IULA 1OWOA 4N3BA 3Q4AB 3Q78A 2P9NG 2F8YA 4KZ0A 4ME2A 3ZEFA 2KCLA 3ASFA 3E4BA 4OAUC 2JLBA 3UMVA 4HLEA 2FEZA 4GPMA 3TWUA 2H6HA 2XEVA 4CDRA 4GZCA 1TYQG 4CZ2D 3L54A 4LERA 2HYZA 4MRUA 3CVUA 1EYHA 1H19A 4AP2A 3UINC 1NA0A 1N4QA 4JA7A 2HO1A 3LY7A 3ENEA 2XHEA 2IOLA 4IYPA 3E30A 1IHBA 2PQRA 1TJFA 1MQSA 2PZIA 1UJJA 1HO8A 3TJPA 4FA6A 3O48A 5FQ8A 5FT9A 3VTXA 4GB9A 1H2TC 4U0ZA 3FH8A 2IJGX 4AEZC 1OXJA 1KT1A 3RU0A 1TNYA 2Q7FA 3PNLB 3CKBA 4J8DA 4WAFA 4WWOA 4GTVA 3NOCD 1TEZA 1S63A 5ARGA 5AQBA 2OVBA 3ASDA 4U8VD 2L6JA 4DI3A 4N2QA 1E8ZA 4YVQC 3FUDA 3V2OA 3ESKA 4PS7A 5T4YA 1D8DA 4GA2A 3CHOA 3U64A 4B93B 5HI7A 4I17A 4E6HA 5BV0A 3I5PA 2MYOA 2WM9A 1ELKA 1N94A 4HOTA 5BXOA 1LD8A 5BNWA 2V8SE 4B8CB 2Y3AA 3SFYA 4JHJA 3ZKJA 3ZXPA 4PUCA 2KM4A 2XRYA 4TXPA 4KVMA 1S64A 2Y4UA 1Q2ZA 4CRWA 1VDYA 4U8YD 1YMPA 2VSYA 3K9IA 5ENSD 3DPDA 2DCPA 4TV3A 2B6CA 4J8FA 3APDA 4EQFA 3CHQA 3G2VA 2VSXE 2VSNA 5CCMA 2YQ8A 5FQ7A 5BXUA 2WQ7A 4J8EA 3B95A 4BFRA 1NFIE 4F53A 4UI9K 1TNUA 2P2CP 1SVXA 3FTUA 3NOGD 3ESLA 1SZAA 4G23A 3FY4A 2OVFA 2J09A 5CBNA 1ELWA 4G11A 3JQ1A 1FT1A 4TXQA 1HG5A 2MRIA 2VGYA 5JA4D 5FJYA 4AJWA 5CEAA 4WWPA 1RW2A 2X6JA 5FWQA 4DLOA 1FVHA 1QQEA 4A1SA 1SA5A 3EUVA 5KNHD 3AS8A 4AM9A 2XEHA 3FUHA 3QOUA 5EIDA 3HVEB 3I3NA 4ZFHA 1OCZE 5KCMA 3CVVA 1K3ZD 4EZKA 4JVSA 5J90A 2R59A 2CFUA 4E85A 4U07A 3HVEA 2CFZA 4WNEA 3ASNE 3FU6A 5JMND 4JD2G 2J8SD 1WG0A 5LFAA 2PL2A 2VQ2A 2J49A 2MOWA 4I1OB 3HXBA 5AENA 4J0UA 3CQCB 3F6QA 4UWLA 1LTXA 2RG8A 3TG4A 3V2XA 2IOSA 3UT7A 2EILE 4QQIA 2CHXA 1PC2A 4KVOA 2V5FA 3TWQA 3CHRA 2LSVA 3FH5A 4PDXA 3APCA 3ML8A 3FHEA 3OXFA 3SBTB 1N4PA 1DCEA 5JHAA 3IXEA 2NC9A 5CEDB 3ZN3A 4RG6A 4H7YA 4HRLA 1UJKA 2NXPA 4A55A 1HG2A 4F7AA 3U3WA 3FTWA 3Q9UC 4N39A 2LSUA 5EYLA 5G04C 1OUVA 1Z5SC 1ZU2A 4UQZA 3CKCA 3LKUA 2YHCA 2WXNA 4I2WA 3GZSA 1OWPA 3CHSA 1W3BA 2I2OA 4I43A 2XZTG 2R2LA 4GYYA 4OVVA 5G05C 4BX9A 1NP7A 1A17A 4LUNU 4DPRA 1QYMA 1TN8A 2WXKA 3TXNA 4U8HA 4YDEA 1V55E 1N0QA 5FQ6A 5LCWC 2OEVA 4GA1A 3KEAA 3DSUA 3RSEG 2P9LG 1N4SA 4NACA 4CEMA 5CRVA 2WXOA 3J5QB 3SNXA 5B1AE 1YA0A 1EDUA 3DEPA 1HE8A 2CG2A 3KSLA 2GRLA 3BUAA 4F3VA 1UOHA 2A4ZA 3JYSA 2ONDA 5HRYA 3Q15A 3DRAA 3L13A 4A1GA 4DK5A 5DIZA 4KYOB 3ZFWA 3UM3A 5A23A 4UUCA 3SBSA 4A3TA 3UT4A 4BEPA 3NAWA 2KCKA 4N3CA 3OAWA 1B89A 4UQYA 3PNTB 4Y6WA 4L23A 4C9BB 4U7EB 1O1SA 3TG5A 5FZSA 2XGSA 5T3RA 2WXPA 2ZXWE 4KXKB 1AP7A 1BLXB 4HI8A 4APOA 3Q9NC 4XKCA 3E34A 4ACLA 1BI7B 1G3NB 3V31A 3ISMC 2KZTB 2XCBA 1UW4B 5CECB 4XEIG 2R5SA 3PVLA 2I6HA 1U3CA 2PM6A 4B8AA 5AIJA 2KZTA 5FZRA 3R9MA 3NZUA 1P5QA 3CVLA 1N95A 3TWRA 3CVPA 4JW1A 4LRZA 5AJLA 2C2LA 3BG1B 3SF4A 3IBEA 2VYIA 3ONLA 2R05A 1L5JA 3ABLE 4KBQA 5HQ8A 2GROB 2ZGDA 2J07A 4HBDA 3JCKC 5EKQD 2X3MA 3JXJA 5E76A 2X6HA 3CIAA 4TUMA 4WUYA 2WXQA 5EIBE 2QC9A 3D9HA 2R03A 3TXMA 2VTBB 3FH7A 3MA5A 3MZLB 5C2YA 4DX5D 4FLHA 3FU3A 4BESA 4ZHBA 3EIJA 2DWZA 3IHYA 4CT0A 4A3VA 1ZB1A 4MLPA 3URZA 3ZHEB 1KPSB 1S0PA 3B7RL 1BPOA 3D3MA 2BKGA 3FWVA 2VTBA 3GW4A 4G2VA 4K0RA 5BV1A 5FQ4A 3ZYMA 2IONA 3CVXA 5T8IA 2XENA 3OTNA 4A63B 4U0SA 3ZHEA 4JZYA 1HF8A 3Q47B 2E2EA 3FUMA 3CSTA 1S70B 2WQHA 3ULEG 1DVPA 4N5CA 2J08A 3CSFA 3ULQA 1BI8B 3QK0A 3PZ1A 3TWSA 2AWIA 5CMYA 3AU4A 2LXLA 3JUIA 1MJ0A 1IQUA 3ABKE 3QB2A 2EQXA 3HHMA 1IHGA 2XQ0A 2Y1LE 4L7TA 4XKBA 4B89A 4WNGA 4AXHA 2WXLA 2X6KA 3L17A 1HS6A 3L22A 3CR3A 2XS1A 4HS2A 4AVXA 1HU3A 2AXUA 3MV3B 4TUUA 3RRUA 3RRMB 3ZRHA 4HOUA 3ZU7B 3FUJA 4ILHB 1E7UA 4GTQA 1H2VC 4BWRA 2OCCE 3V79K 4NQ0A 3UKUG 3G2UA 4JEHA 2PQNA 3OXGA 3APFA 2C0LA 1E8YA 4HOQA 1E90A 1SA4A 2B0OE 3S7DA 2J4DA 3CV0A 4EBAA 3W9GA 2IO3C 5KJNA 3FU5A 3GZ1A 2CG3A 2LUHA 3HXEA 1SZ9A 3UKRG 1LF8A 4DI4A 3BU8A 1FPPA 3C3OA 4ANVA 4UI9C 2GW1A 4I1MA 5B1BE 2ZU6B 1DC2A 3AJIA 2RKKA 3UTMA 3ZW3A 1N52A 3Q7FA 3UM2A 3L08A 3VLDA 3FULA 2P9UG 1K1AA 3RKVA 1N0RA 3R7RA 1U3DA 3ZIMA 4PS8A 4DX7D 2X38A 3FDHA 3RRNB 2E0IA 1IXVA 1JPLA 3QC1A 1OWMA 3ZYQA 3DSSA 4I1AA 2X6IA 4XX5A 4EBAG 5CMWA 3JQ0A 4ILGA 3EU5A 3V30A 1IQRA 4F1SA 4TRQA 4C0EA 1NA3A 3E32A 2ZGGA 4J7WA 2JABA 3AU5A 2QYUA 1JCRA 4FU3A 3QNKA 4U63A 3CGHA 4LNUD 3B13A 3FTVA 5D0QD 3CLJA 3SO8A 4FJZA 3ZYKA 3ULYA 1OWLA 4O1OA 3D9MA 1K1BA 4YDOA 2VGEA 3CK7A 4D10C 4QFVA 2V0PA 3EIQC 3PUJA 1TN7A 4JC8A 1TR4A 2NSZA 3RAUA 4HLLA 1O1RA 3ZUVB 2UWJG 1OWNA 3AG4E 3CVYA 5LOZA 5J08A 2I1KA 2V5QC 2XRZA 3G2WA 1YCSB 3QAQA 5G05J 4W9RA 5AQAA 4F6RD 1INZA 5LCWJ 2VGXB 4RSYA 4HI9A 3CVNA 4B0ZA 4UWGA 3SD5A 4DUIA 4N2SA 1JCQA 4CT4A 2IF4A 4LNBA 2EIKE 4DLQA 5AAOA 3CVWA 4GU5A 3UI2A 2A5UA 5EILA 2HE0A 3DBSA 3MV2B 4G8LA 3ZXSA 2RD0A 2VGXA 3P2BA 4JHRA 2AW6A 5CERB 3Q49B 4GA0A 2P9SG 4G1TA 3FUKA 3U4TA 2WXFA 2QY7A 3HXCA 1WAO1 1QNFA 3FUNA 3UPVA 4BSZB 3PEVB 1JCSA 2OOEA 3HXFA 4NRHB 1H2UA 1MHQA 4JPSA 2C0MA 3UXGA 1E8WA 2WVIA 3SFXA 1LD7A 5AQ7A 3HIZA 2XPYA 2XS8A 3EHRA 1OCCE 4URKA 1KZOA 4RVBA 3HYMB 3EDTB 2WXRA 3ZNGA 3UX4A 1EF1C 3FU0A 4CGWA 3T8MA 1HZ4A 5FTPA 3TAXA 3S7FA 5LX8A 5ENQD 2WMNA 1E8XA 4NIKA
chains in the Genus database with same CATH topology
3C98A 4RG9A 4CDNA 1H2TC 3CVPA 4JW1A 4U0ZA 5D0OD 4LRZA 3FH8A 5AJLA 2C2LA 4BTAA 3BG1B 3SF4A 2IJGX 3IBEA 1WY6A 4AEZC 1KT1A 1UN9A 5G04J 2YHEA 3RU0A 2VYIA 2Q7FA 3ONLA 4C0MA 3PNLB 1L5JA 3CKBA 4J8DA 4WAFA 3QARA 5KJKA 4WWOA 4KBQA 5HQ8A 3N71A 4GAAA 4FHJA 4IRUA 2J07A 4FC8A 4FP7A 4HFGA 2WQ6A 1TEZA 5ARGA 3JCKC 5FZQA 2BUGA 2OVBA 3ASDA 3CEQA 5EKQD 4CGVA 2X3MA 3FEXA 5ARFA 4FADA 3P1UA 2JEKA 2L6JA 3KAEA 4APFA 4DI3A 5E76A 4N2QA 2X6HA 3CIAA 1SQMA 3TGOA 5BW8C 1E8ZA 4WUYA 2WXQA 4YVQC 5ENNA 4B94A 3FUDA 3ESKA 3LY9A 3LJ3A 3I4RB 3ML9A 3MKRA 2HM8A 3TXMA 4PS7A 2VTBB 2J4BA 5T4YA 4GA2A 3U64A 3CHOA 3FH7A 3MA5A 2LAHA 2AVPA 3MZLB 4FLHA 5C2YA 3FU3A 2WMOA 3HDXA 1XNFA 1Z6TA 5HI7A 5DBKA 3EIJA 3IHYA 4JXTA 4CT0A 4I17A 4A3VA 4E6HA 3IKOB 1E7VA 1Z3XA 3Q5MA 4MLPA 3URZA 3ZHEB 5BV0A 4ACKA 3I5PA 1S0PA 3B7RL 1BPOA 2WM9A 1ELKA 4J8SA 4GZ6A 4EECA 3D3MA 4HOTA 2AXZA 3CHPA 4Y6CA 3FWVA 3ONKA 5BNWA 4FHKA 2V8SE 4B8CB 2VTBA 3GW4A 4I6EA 4G2VA 4K0RA 3B7UX 5BV1A 5FQ4A 3ZYMA 2Y3AA 2IONA 4YNDA 3CK9A 1GW6A 3CVXA 3MJWA 1EPUA 2KC7A 4JHJA 5T8IA 3IHVA 3OTNA 4PUCA 4U0SA 2KM4A 3ZHEA 2XRYA 4JZYA 1HF8A 3PZDA 4KVMA 2Y4UA 3GZ2A 3Q47B 2E2EA 3FUMA 3CSTA 4CRWA 4GCOA 4UQXA 1VDYA 1KLXA 3CK8A 2WQHA 4GMLA 2VSYA 3K9IA 3ZVVA 2CHWA 1JUQA 1DVPA 4N5CA 3D9NA 2DCPA 3DPDA 4G24A 4TV3A 3D9LA 2J08A 3CSFA 4KZCA 2OV8A 1E96B 3PE3A 4L1BA 3ULQA 4XI0A 4AY5A 3QK0A 2XGMA 1N54A 3D9IA 3GYZA 4EZLA 2AWIA 3SHFA 4J8FA 4O6FA 3APDA 5CMYA 3SZ7A 4EQFA 3CHQA 2GRMA 3AU4A 4GYOA 3G2VA 3EHMA 2XGOA 2VSXE 2VSNA 3JUIA 5CCMA 1IQUA 1H0AA 2YQ8A 4XI9A 4BTBA 3QB2A 2EQXA 5FQ7A 5LP0A 2WXGA 3HHMA 2WQ7A 1IHGA 3QWWA 2YNQA 4FULA 2CHZA 2XQ0A 4J8EA 4XZ4A 4BFRA 4F53A 2VJ8A 3FTZA 4UI9K 4L7TA 3FUIA 4XKBA 3FUFA 4FLBA 4ATGA 5JJ7A 2YINA 3NF1A 4WNGA 4AXHA 4B89A 2V4LA 5JJ6A 3FTUA 2WXLA 2X6KA 3L17A 3ESLA 1HS6A 1SZAA 4G23A 3KS2A 2Y4TA 3FY4A 2OVFA 3L22A 3CR3A 2J09A 4HS2A 4PS3A 4AVXA 1ELWA 4G11A 1HU3A 2AXUA 2FO7A 3JQ1A 3MV3B 4TUUA 2ILRA 2KCVA 3RRUA 4YVOA 1HG5A 4M3OA 4JHKA 2MRIA 4JA9A 2I9CA 3RRMB 3S7JA 5BT1A 2J9QA 3ZRHA 2FI7A 3MYVA 4HOUA 3FUJA 3IEGA 2VGYA 2QFCA 5FJYA 3D9OA 4ILHB 3QWVA 5EX3A 1E7UA 4AJWA 1PY1A 2FULA 1H2VC 4BWRA 4WWPA 5C1DA 4NQ0A 2MHKA 4FJYA 2X6JA 5FWQA 1FCHA 1Y6IA 4DLOA 1FVHA 1QZ2A 3G2UA 4JEHA 2PQNA 1QQEA 3VTYA 3OXGA 4LEUA 4A1SA 4I9EA 3U66A 3APFA 2C0LA 4K03A 1E8YA 5EDSA 3PREA 3AS8A 2XPIA 3T5VA 5A7DB 4HOQA 1E90A 3S7DA 3ZPJA 4KMOA 2J4DA 4AM9A 3CV0A 3FUHA 3QOUA 3HVEB 4EBAA 3EHNA 5KJNA 3OXLA 3QDNA 3FU5A 3GZ1A 3I3NA 3PUKA 2CG3A 3ZGQA 2IQCA 3LYAA 1SZ9A 3CVVA 5KCMA 1LF8A 4BY6A 4DI4A 4ANVA 4EZKA 3PH0C 2R17C 3AS5A 4UI9C 2GW1A 4JVSA 4I1MA 5J90A 3U9WA 4OYSA 4LCTA 2R59A 2ZU6B 3O4ZA 4P29A 3CQGB 2CFUA 4E85A 4U07A 3HVEA 3FTSA 1ELRA 2CFZA 4WNEA 4ANWA 2VSOE 3FU6A 4GZDA 3PDNA 5LFAA 2PL2A 2VQ2A 4V3IA 3ZW3A 4UI9J 2J49A 2MOWA 4I1OB 2I1JA 4I2ZA 3CVQA 1N52A 5AENA 4J0UA 3CQCB 1TJCA 3MX3A 3L08A 3VLDA 3FULA 4U04A 4UWLA 3AS4A 1HH8A 4BT9A 4ANXA 4UWFA 3LY8A 1WM5A 2RG8A 3RKVA 3TG4A 2IU1A 2L0TB 4HXIA 3R7RA 1U3DA 3ZIMA 4PS8A 2IFUA 2IOSA 3LXUX 3UT7A 5KJLA 4CDMA 3BEEA 2CHXA 2X38A 3FDHA 1PC2A 2E0IA 3RRNB 4EZJA 4GZ3A 3D9KA 4KVOA 3SGHA 3S2AA 2PM7A 4N3AA 2V5FA 1JPLA 3QC1A 1OWMA 5E75A 3MKQB 3ZYQA 2L9BA 4L2LA 4ILIA 3I4GA 5G55A 3CHRA 2P58C 4I1AA 2X6IA 2LSVA 3FH5A 4XX5A 1FVFA 4PDXA 4EBAG 3CHMA 4IN3B 5CMWA 3QJZA 3APCA 3JQ0A 4ILGA 3ML8A 4L2YA 4NURA 1IQRA 1JWGA 2LAIA 3FEYA 3FHEA 4ANUA 4F1SA 3OXFA 3SBTB 3MCXA 4TRQA 4C0EA 4OVUA 1NA3A 2WB2A 3T5XA 3VLEA 1HX8A 1JWFA 3MKQA 4H7XA 5JHAA 5G2NA 3AU5A 3NQPA 2WXIA 3QWPA 4G25A 3B7SA 3UQ3A 2AXVA 5AJDA 1ZBPA 2UY1B 4FU3A 3QNKA 4U63A 4RG6A 3RIBA 3MGBA 3ZN3A 3CGHA 4H7YA 4MKTA 3RJVA 5CCLA 1H6KA 2X6FA 1UJKA 4GCNA 3B13A 3FTVA 2NXPA 4A55A 1HG2A 4F7AA 1NZNA 4R7LA 5D0QD 3U3WA 3UUXA 3PS6A 3FTWA 4AIFA 4CCAA 4N39A 3CLJA 4Q69A 3QKYA 2LSUA 5BPPA 5AYWD 4FJZA 3BG0B 5G04C 1OUVA 2FF4A 1ZU2A 2WPVA 1OWLA 4UQZA 3ZYKA 3D9MA 3LCAA 3CKCA 2UY1A 2M63A 2YHCA 3L6AA 3LKUA 2WXNA 3CK7A 2WXHA 4I2WA 4D10C 4DJAA 3GZSA 1Y8MA 4QFVA 1OWPA 2LNIA 5JJTA 2GGFA 2V0PA 3LS8A 4AV7A 5CHEE 3RO3A 3CHSA 4I9CA 1W3BA 3EIQC 2I2OA 3PUJA 4I43A 4XIFA 4GYYA 4JC8A 3KD7A 4OVVA 5G05C 4BX9A 2NSZA 1NP7A 1A17A 3PEUB 4LUNU 4DPRA 2WXMA 5BUZA 2WXKA 5KJMA 3TXNA 4U8HA 4KT6B 5FQ6A 3SFZA 4ABNA 3RO2A 1DNPA 2WXJA 1X5BA 4JEUA 4WNDA 4XE0A 3FUEA 5LCWC 2BF0X 3LDZA 2UWJG 4GA1A 3FP3A 1OWNA 3MEKA 4J6IA 2LO6A 3CVYA 5M72A 3LVRE 2KATA 1PAQA 4GMJA 4NACA 5LOZA 2WXOA 3LPZA 4BT8A 4CEMA 5J08A 3SNXA 2I1KA 1KT0A 2XRZA 3G2WA 3QAQA 5G05J 4BX8A 4HORA 4W9RA 1YA0A 1EDUA 1INZA 5A6CA 1HXIA 5LCWJ 1HE8A 2CG2A 2BTDA 2GRLA 2VGXB 4F3VA 4HOSA 4RSYA 2A4ZA 3JYSA 3IV0A 2ONDA 3CVNA 1UN8A 2DIWA 4UWGA 5ANLA 5EX0A 3SD5A 4B0ZA 4N2SA 3SI5A 3TL5A 3VLFA 3Q15A 3FFLA 3L13A 4A1GA 4DK5A 4Q94A 2XPZA 3D9JA 4CT4A 2IF4A 3ASGA 3R9AB 3ZYLA 3FTYA 4KYOB 5DIZA 5JHBA 2DBAA 3ZFWA 4DLQA 5A23A 4GPKA 3SBSA 1Z3YA 4A3TA 3UT4A 3CVWA 4JL0A 4GU5A 4PH4B 4WWNA 3R7QA 3UT8A 2A5UA 3B7TA 2KCKA 3DBSA 3MV2B 4N3CA 3OAWA 3ZXSA 2L0IA 2RD0A 2VGXA 1B89A 3P2BA 4JHRA 4UQYA 1UG3A 1XGWA 4IULA 2AW6A 1OWOA 3PNTB 3Q49B 4GZ5A 4N3BA 4L23A 4Y6WA 4I6GA 4GA0A 4C9BB 3Q4AB 4G1TA 3TG5A 4UWHA 5FZSA 1IYGA 3RK6A 2XGSA 5T3RA 3FUKA 4KZ0A 2WXPA 4MS6A 3D9PA 3U4TA 4ME2A 4U0UA 3LVQE 2KCLA 3ZEFA 2WXFA 3PE4A 2QY7A 4KXKB 1WAO1 3ASFA 3E4BA 4APOA 5ANRA 2JLBA 4GYWA 3UMVA 1QNFA 3FUNA 3UPVA 1HFAA 2FEZA 4HLEA 3ASHA 3KEZA 3PEVB 4UWKA 4XKCA 4Q96A 2XEVA 4ACLA 4CDRA 2OOEA 4GZCA 4NRHB 4HVBA 1H2UA 1MHQA 3L54A 4LERA 2HYZA 4MRUA 4JPSA 3CVUA 3EJNA 1EYHA 1H19A 2C0MA 3L16A 4AP2A 1E8WA 2WVIA 2KZTB 2XCBA 3FTXA 1UW4B 3S7BA 1NA0A 4JA7A 2HO1A 2HR2A 3LY7A 2R5SA 4EPZA 4I6JA 3ENEA 2XHEA 3G2SA 3HIZA 2XPYA 3PVLA 2IOLA 2I6HA 1U3CA 4BSXA 4IYPA 3WXXA 2FBNA 2PM6A 2PQRA 4URKA 4AOFA 4B8AA 3LEWA 5AIJA 1TJFA 1MQSA 2KZTA 3G2TA 4RVBA 5FZRA 2XCCA 2PZIA 1UJJA 3HYMB 3EDTB 2WXRA 4G26A 3PRZA 3UX4A 4AY6A 1EF1C 3FU0A 1HO8A 3NZUA 1P5QA 4CGWA 3CVLA 3T8MA 3TJPA 4FA6A 1HZ4A 3O48A 5FQ8A 5FT9A 5FTPA 4WNFA 3S7FA 3TAXA 5LX8A 2WMNA 1E8XA 3VTXA 2NC9A 3NZSA 4GB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4APF A;  4HXI A;  3HVE B;  4HS2 A;  4AP2 A;  2EQX A;  3HVE A;  3I3N A; 
#chains in the Genus database with same CATH topology
 3C98 A;  4RG9 A;  3DXK G;  4CDN A;  3E37 A;  5D0O D;  4BTA A;  5FIO A;  2V4H C;  4C0M A;  3J5P A;  4LG6 A;  4HQD A;  3QAR A;  3N71 A;  4GAA A;  2RFA A;  3Q75 A;  4DX2 A;  1YYH A;  4IRU A;  4FC8 A;  4FP7 A;  5FZQ A;  4BET A;  5ARF A;  3P1U A;  2JEK A;  4APF A;  1OCR E;  1SQM A;  4OAV B;  2IO2 C;  4B94 A;  5ENN A;  3EHQ A;  1TNB A;  3LJ3 A;  3I4R B;  3ML9 A;  2EIM E;  2J4B A;  2LAH A;  2AVP A;  5AAR A;  5DBK A;  4JXT A;  3IKO B;  1E7V A;  1Z3X A;  2DZO A;  3Q5M A;  1KZP A;  4ACK A;  2P9K G;  2AXZ A;  3CHP A;  4N5Q A;  3ONK A;  4FHK A;  1N9A A;  3B7U X;  4YND A;  3CK9 A;  1GW6 A;  3MJW A;  1EPU A;  2KC7 A;  2Y69 E;  3IHV A;  2ETA A;  5ENP D;  3PZD A;  2FO1 E;  5EN5 D;  3TWX A;  3CK8 A;  3B7B A;  1WDY A;  3D9L A;  2DZN A;  3PE3 A;  3C5R A;  4L1B A;  2NYJ A;  4XI0 A;  4AY5 A;  1N54 A;  3HXD A;  3SHF A;  3T8K A;  4O6F A;  2GRM A;  4HB5 A;  2XGO A;  4RLY A;  2QYJ A;  1H0A A;  4GMR A;  3DST A;  5LP0 A;  2WXG A;  2Y0B G;  2YNQ A;  4FUL A;  4K5C A;  2CHZ A;  4YDW A;  3FUI A;  4ATG A;  4FLB A;  5JJ7 A;  2V4L A;  5JJ6 A;  3DSW A;  1OT8 A;  3KS2 A;  2Y4T A;  2OEW A;  4GTM A;  4PS3 A;  1O1T A;  2FO7 A;  4YVO A;  4M3O A;  2IEJ A;  4JA9 A;  5BT1 A;  2J9Q A;  2FI7 A;  3MYV A;  2H6I A;  3IEG A;  1BU9 A;  3D9O A;  5HS0 A;  2F8X K;  2ETC A;  3C3R A;  4C48 B;  4U95 D;  1FCH A;  1Y6I A;  1QZ2 A;  3VTY A;  4I9E A;  3U66 A;  4K03 A;  3PRE A;  2XPI A;  5A7D B;  4GTT A;  2QZA A;  1MZC A;  3EHN A;  3OXL A;  3PUK A;  3ZGQ A;  3DXM G;  2IQC A;  3LYA A;  4BY6 A;  3PH0 C;  2F0Y A;  5ENO D;  4LCT A;  3C3Q A;  3X2Q E;  3ASO E;  4V3I A;  3AG2 E;  5KNG A;  4UI9 J;  2I1J A;  4HRN A;  1TJC A;  4U04 A;  1MX2 A;  3LY8 A;  2IU1 A;  2L0T B;  2AJA A;  2IFU A;  3DEO A;  3LXU X;  5KJL A;  3PZ2 A;  3SGH A;  2PM7 A;  4N3A A;  4DX6 D;  5E75 A;  3MKQ B;  5ITZ F;  5KBA A;  3CHM A;  3QJZ A;  2LAI A;  4ANU A;  3MCX A;  5EYP F;  2WB2 A;  3VLE A;  1X81 A;  3MKQ A;  2XEE A;  4H7X A;  3NQP A;  4G25 A;  4GTS A;  3B7S A;  3UQ3 A;  5AJD A;  3L82 A;  1ZBP A;  3MGB A;  4MKT A;  1H6K A;  1TNZ A;  4R7L A;  3PS6 A;  3UIP C;  2PNN A;  4M7C A;  3L6A A;  2WXH A;  5JJT A;  2GGF A;  3LS8 A;  3RO3 A;  4I9C A;  4XIF A;  5H7P A;  2EIN E;  3AAA C;  3SFZ A;  4KT6 B;  3RO2 A;  1DNP A;  4XE0 A;  1X5B A;  4WND A;  3FUE A;  2BF0 X;  4J6I A;  5M72 A;  2KAT A;  4BT8 A;  3LPZ A;  1KT0 A;  3LJN A;  4HOR A;  4HRM B;  2RFM A;  2ZIS A;  5A6C A;  1HXI A;  4HOS A;  2DIW A;  5EX0 A;  3VLF A;  4ATZ D;  2XPZ A;  3C72 A;  3FTY A;  2GRN B;  3AG1 E;  3PZ4 A;  4PH4 B;  1U2V G;  4U96 D;  2L0I A;  1UG3 A;  1XGW A;  4GZ5 A;  4I6G A;  3TWT A;  2GRR B;  4UWH A;  1IYG A;  3RK6 A;  4MS6 A;  3D9P A;  4U0U A;  3LVQ E;  3PE4 A;  5ANR A;  4GYW A;  1HFA A;  3ASH A;  3KEZ A;  4UWK A;  4Q96 A;  1MX6 A;  3Q73 A;  4HVB A;  3EJN A;  3L16 A;  3S7B A;  3FTX A;  4O1P A;  5HKP A;  2R02 A;  2HR2 A;  4K5A B;  3DSV A;  1D9S A;  4EPZ A;  4I6J A;  3G2S A;  1O5M A;  3L9T A;  4HNA D;  3JUE A;  4JB8 P;  4RQI A;  4BSX A;  3WXX A;  2FBN A;  4AOF A;  3LEW A;  3G2T A;  2XCC A;  4AY6 A;  4G26 A;  3PRZ A;  5KWD A;  2IY0 C;  4WNF A;  3NZS A;  4DRX E;  1TNO A;  1AWC B;  1WY6 A;  4J8Y A;  3NBN B;  1UN9 A;  5G04 J;  2YHE A;  4K5B A;  3W9F A;  1QBQ A;  1DCQ A;  2EIJ E;  5B3S E;  2KXP C;  5KJK A;  4FHJ A;  1MYO A;  4HFG A;  2WQ6 A;  3T9K A;  4F1P A;  2DVW A;  2BUG A;  3NB2 A;  3CEQ A;  4CGV A;  3FEX A;  4FAD A;  4YDY A;  3HG0 D;  2P9I G;  4O60 A;  3KAE A;  3TGO A;  5BW8 C;  3LY9 A;  3MKR A;  2HM8 A;  2WMO A;  3HDX A;  1XNF A;  1Z6T A;  1TN6 A;  1OCO E;  3TWV A;  1N4R A;  4J8S A;  3E33 A;  3DSX A;  4GZ6 A;  1MX4 A;  5ENT D;  4EEC A;  4Y6C A;  2DYS E;  4I6E A;  2F37 A;  5D2M C;  3DPY A;  3GZ2 A;  4GCO A;  4UQX A;  3WG7 E;  1KLX A;  4GML A;  1H6O A;  2CHW A;  3ZVV A;  1JUQ A;  3D9N A;  4G24 A;  4KZC A;  2OV8 A;  3TWW A;  1E96 B;  3UM1 A;  3JXI A;  2XGM A;  3D9I A;  3KSQ A;  3GYZ A;  5CBO A;  4EZL A;  3SZ7 A;  4GYO A;  1K8K G;  3EHM A;  1N11 A;  1D8E A;  4XI9 A;  4BTB A;  3QWW A;  4XZ4 A;  2VJ8 A;  3FTZ A;  2BKK B;  3FUF A;  2YIN A;  3NF1 A;  3UIO C;  1BD8 A;  5ENR D;  2ILR A;  2KCV A;  2P9P G;  4JHK A;  4GTO A;  2I9C A;  3S7J A;  4GTR A;  2QFC A;  3QWV A;  3SY2 A;  5EX3 A;  1PY1 A;  2FUL A;  5C1D A;  2MHK A;  4FJY A;  2A5E A;  4Z68 A;  4LEU A;  2XZD G;  5EDS A;  1NL4 A;  3T5V A;  3ZPJ A;  4KMO A;  1V54 E;  2DYR E;  3QDN A;  2GRP B;  2R17 C;  2GRQ B;  3AS5 A;  4EHM A;  3U9W A;  4GTP A;  4OYS A;  5FIN A;  3O4Z A;  3Q79 A;  3CQG B;  4P29 A;  3FTS A;  1ELR A;  4ANW A;  2VSO E;  2LXM A;  4GZD A;  3PDN A;  4CYM D;  4I2Z A;  3CVQ A;  5D66 A;  3MX3 A;  3HRA A;  3AS4 A;  3DWL G;  1HH8 A;  4BT9 A;  4ANX A;  4UWF A;  1WM5 A;  4HXI A;  4CDM A;  3BEE A;  4EZJ A;  3PZ3 A;  4GZ3 A;  3D9K A;  1OY3 D;  3S2A A;  3BQO A;  4DX1 A;  1IKN D;  1NI1 A;  2L9B A;  4L2L A;  4ILI A;  3I4G A;  5G55 A;  2P58 C;  1FVF A;  4IN3 B;  4NUR A;  4L2Y A;  1JWG A;  3FEY A;  4OVU A;  5IY5 E;  4LSZ E;  3Q7A A;  3T5X A;  3UM0 A;  1HX8 A;  1JWF A;  5G2N A;  3QWP A;  2WXI A;  4BER A;  2AXV A;  2UY1 B;  3RIB A;  3AG3 E;  5CCL A;  3RJV A;  5CRU A;  2X6F A;  4GCN A;  3ABM E;  4TXR A;  1NZN A;  3UUX A;  2ETB A;  1FT2 A;  4AIF A;  4CCA A;  4Q69 A;  3QKY A;  5BPP A;  5AYW D;  4MBG A;  3BG0 B;  2FF4 A;  2WPV A;  2H6G A;  3LCA A;  2BED A;  2UY1 A;  2M63 A;  1A5E A;  4DJA A;  1Y8M A;  2LNI A;  2KBX A;  3SQV A;  4AV7 A;  5CHE E;  1H6P A;  4X8Q A;  3KD7 A;  3PEU B;  2WXM A;  5BUZ A;  5KJM A;  4ABN A;  2WXJ A;  4JEU A;  3LDZ A;  1RZ4 A;  2ZIR A;  3FP3 A;  3MEK A;  2LO6 A;  3LVR E;  1PAQ A;  4GMJ A;  2L6B A;  5AQ9 A;  4BX8 A;  2BTD A;  4L9P A;  3IV0 A;  1SW6 A;  1UN8 A;  5ANL A;  3SI5 A;  2H6F A;  3TL5 A;  3FFL A;  4Q94 A;  3D9J A;  3ASG A;  3R9A B;  5JHB A;  5AN8 A;  4G8K A;  3ZYL A;  2DBA A;  4GPK A;  1Z3Y A;  4JL0 A;  4WWN A;  3R7Q A;  3UT8 A;  3B7T A;  3EU9 A;  4LNG A;  4IUL A;  1OWO A;  4N3B A;  3Q4A B;  3Q78 A;  2P9N G;  2F8Y A;  4KZ0 A;  4ME2 A;  3ZEF A;  2KCL A;  3ASF A;  3E4B A;  4OAU C;  2JLB A;  3UMV A;  4HLE A;  2FEZ A;  4GPM A;  3TWU A;  2H6H A;  2XEV A;  4CDR A;  4GZC A;  1TYQ G;  4CZ2 D;  3L54 A;  4LER A;  2HYZ A;  4MRU A;  3CVU A;  1EYH A;  1H19 A;  4AP2 A;  3UIN C;  1NA0 A;  1N4Q A;  4JA7 A;  2HO1 A;  3LY7 A;  3ENE A;  2XHE A;  2IOL A;  4IYP A;  3E30 A;  1IHB A;  2PQR A;  1TJF A;  1MQS A;  2PZI A;  1UJJ A;  1HO8 A;  3TJP A;  4FA6 A;  3O48 A;  5FQ8 A;  5FT9 A;  3VTX A;  4GB9 A;  1H2T C;  4U0Z A;  3FH8 A;  2IJG X;  4AEZ C;  1OXJ A;  1KT1 A;  3RU0 A;  1TNY A;  2Q7F A;  3PNL B;  3CKB A;  4J8D A;  4WAF A;  4WWO A;  4GTV A;  3NOC D;  1TEZ A;  1S63 A;  5ARG A;  5AQB A;  2OVB A;  3ASD A;  4U8V D;  2L6J A;  4DI3 A;  4N2Q A;  1E8Z A;  4YVQ C;  3FUD A;  3V2O A;  3ESK A;  4PS7 A;  5T4Y A;  1D8D A;  4GA2 A;  3CHO A;  3U64 A;  4B93 B;  5HI7 A;  4I17 A;  4E6H A;  5BV0 A;  3I5P A;  2MYO A;  2WM9 A;  1ELK A;  1N94 A;  4HOT A;  5BXO A;  1LD8 A;  5BNW A;  2V8S E;  4B8C B;  2Y3A A;  3SFY A;  4JHJ A;  3ZKJ A;  3ZXP A;  4PUC A;  2KM4 A;  2XRY A;  4TXP A;  4KVM A;  1S64 A;  2Y4U A;  1Q2Z A;  4CRW A;  1VDY A;  4U8Y D;  1YMP A;  2VSY A;  3K9I A;  5ENS D;  3DPD A;  2DCP A;  4TV3 A;  2B6C A;  4J8F A;  3APD A;  4EQF A;  3CHQ A;  3G2V A;  2VSX E;  2VSN A;  5CCM A;  2YQ8 A;  5FQ7 A;  5BXU A;  2WQ7 A;  4J8E A;  3B95 A;  4BFR A;  1NFI E;  4F53 A;  4UI9 K;  1TNU A;  2P2C P;  1SVX A;  3FTU A;  3NOG D;  3ESL A;  1SZA A;  4G23 A;  3FY4 A;  2OVF A;  2J09 A;  5CBN A;  1ELW A;  4G11 A;  3JQ1 A;  1FT1 A;  4TXQ A;  1HG5 A;  2MRI A;  2VGY A;  5JA4 D;  5FJY A;  4AJW A;  5CEA A;  4WWP A;  1RW2 A;  2X6J A;  5FWQ A;  4DLO A;  1FVH A;  1QQE A;  4A1S A;  1SA5 A;  3EUV A;  5KNH D;  3AS8 A;  4AM9 A;  2XEH A;  3FUH A;  3QOU A;  5EID A;  3HVE B;  3I3N A;  4ZFH A;  1OCZ E;  5KCM A;  3CVV A;  1K3Z D;  4EZK A;  4JVS A;  5J90 A;  2R59 A;  2CFU A;  4E85 A;  4U07 A;  3HVE A;  2CFZ A;  4WNE A;  3ASN E;  3FU6 A;  5JMN D;  4JD2 G;  2J8S D;  1WG0 A;  5LFA A;  2PL2 A;  2VQ2 A;  2J49 A;  2MOW A;  4I1O B;  3HXB A;  5AEN A;  4J0U A;  3CQC B;  3F6Q A;  4UWL A;  1LTX A;  2RG8 A;  3TG4 A;  3V2X A;  2IOS A;  3UT7 A;  2EIL E;  4QQI A;  2CHX A;  1PC2 A;  4KVO A;  2V5F A;  3TWQ A;  3CHR A;  2LSV A;  3FH5 A;  4PDX A;  3APC A;  3ML8 A;  3FHE A;  3OXF A;  3SBT B;  1N4P A;  1DCE A;  5JHA A;  3IXE A;  2NC9 A;  5CED B;  3ZN3 A;  4RG6 A;  4H7Y A;  4HRL A;  1UJK A;  2NXP A;  4A55 A;  1HG2 A;  4F7A A;  3U3W A;  3FTW A;  3Q9U C;  4N39 A;  2LSU A;  5EYL A;  5G04 C;  1OUV A;  1Z5S C;  1ZU2 A;  4UQZ A;  3CKC A;  3LKU A;  2YHC A;  2WXN A;  4I2W A;  3GZS A;  1OWP A;  3CHS A;  1W3B A;  2I2O A;  4I43 A;  2XZT G;  2R2L A;  4GYY A;  4OVV A;  5G05 C;  4BX9 A;  1NP7 A;  1A17 A;  4LUN U;  4DPR A;  1QYM A;  1TN8 A;  2WXK A;  3TXN A;  4U8H A;  4YDE A;  1V55 E;  1N0Q A;  5FQ6 A;  5LCW C;  2OEV A;  4GA1 A;  3KEA A;  3DSU A;  3RSE G;  2P9L G;  1N4S A;  4NAC A;  4CEM A;  5CRV A;  2WXO A;  3J5Q B;  3SNX A;  5B1A E;  1YA0 A;  1EDU A;  3DEP A;  1HE8 A;  2CG2 A;  3KSL A;  2GRL A;  3BUA A;  4F3V A;  1UOH A;  2A4Z A;  3JYS A;  2OND A;  5HRY A;  3Q15 A;  3DRA A;  3L13 A;  4A1G A;  4DK5 A;  5DIZ A;  4KYO B;  3ZFW A;  3UM3 A;  5A23 A;  4UUC A;  3SBS A;  4A3T A;  3UT4 A;  4BEP A;  3NAW A;  2KCK A;  4N3C A;  3OAW A;  1B89 A;  4UQY A;  3PNT B;  4Y6W A;  4L23 A;  4C9B B;  4U7E B;  1O1S A;  3TG5 A;  5FZS A;  2XGS A;  5T3R A;  2WXP A;  2ZXW E;  4KXK B;  1AP7 A;  1BLX B;  4HI8 A;  4APO A;  3Q9N C;  4XKC A;  3E34 A;  4ACL A;  1BI7 B;  1G3N B;  3V31 A;  3ISM C;  2KZT B;  2XCB A;  1UW4 B;  5CEC B;  4XEI G;  2R5S A;  3PVL A;  2I6H A;  1U3C A;  2PM6 A;  4B8A A;  5AIJ A;  2KZT A;  5FZR A;  3R9M A;  3NZU A;  1P5Q A;  3CVL A;  1N95 A;  3TWR A;  3CVP A;  4JW1 A;  4LRZ A;  5AJL A;  2C2L A;  3BG1 B;  3SF4 A;  3IBE A;  2VYI A;  3ONL A;  2R05 A;  1L5J A;  3ABL E;  4KBQ A;  5HQ8 A;  2GRO B;  2ZGD A;  2J07 A;  4HBD A;  3JCK C;  5EKQ D;  2X3M A;  3JXJ A;  5E76 A;  2X6H A;  3CIA A;  4TUM A;  4WUY A;  2WXQ A;  5EIB E;  2QC9 A;  3D9H A;  2R03 A;  3TXM A;  2VTB B;  3FH7 A;  3MA5 A;  3MZL B;  5C2Y A;  4DX5 D;  4FLH A;  3FU3 A;  4BES A;  4ZHB A;  3EIJ A;  2DWZ A;  3IHY A;  4CT0 A;  4A3V A;  1ZB1 A;  4MLP A;  3URZ A;  3ZHE B;  1KPS B;  1S0P A;  3B7R L;  1BPO A;  3D3M A;  2BKG A;  3FWV A;  2VTB A;  3GW4 A;  4G2V A;  4K0R A;  5BV1 A;  5FQ4 A;  3ZYM A;  2ION A;  3CVX A;  5T8I A;  2XEN A;  3OTN A;  4A63 B;  4U0S A;  3ZHE A;  4JZY A;  1HF8 A;  3Q47 B;  2E2E A;  3FUM A;  3CST A;  1S70 B;  2WQH A;  3ULE G;  1DVP A;  4N5C A;  2J08 A;  3CSF A;  3ULQ A;  1BI8 B;  3QK0 A;  3PZ1 A;  3TWS A;  2AWI A;  5CMY A;  3AU4 A;  2LXL A;  3JUI A;  1MJ0 A;  1IQU A;  3ABK E;  3QB2 A;  2EQX A;  3HHM A;  1IHG A;  2XQ0 A;  2Y1L E;  4L7T A;  4XKB A;  4B89 A;  4WNG A;  4AXH A;  2WXL A;  2X6K A;  3L17 A;  1HS6 A;  3L22 A;  3CR3 A;  2XS1 A;  4HS2 A;  4AVX A;  1HU3 A;  2AXU A;  3MV3 B;  4TUU A;  3RRU A;  3RRM B;  3ZRH A;  4HOU A;  3ZU7 B;  3FUJ A;  4ILH B;  1E7U A;  4GTQ A;  1H2V C;  4BWR A;  2OCC E;  3V79 K;  4NQ0 A;  3UKU G;  3G2U A;  4JEH A;  2PQN A;  3OXG A;  3APF A;  2C0L A;  1E8Y A;  4HOQ A;  1E90 A;  1SA4 A;  2B0O E;  3S7D A;  2J4D A;  3CV0 A;  4EBA A;  3W9G A;  2IO3 C;  5KJN A;  3FU5 A;  3GZ1 A;  2CG3 A;  2LUH A;  3HXE A;  1SZ9 A;  3UKR G;  1LF8 A;  4DI4 A;  3BU8 A;  1FPP A;  3C3O A;  4ANV A;  4UI9 C;  2GW1 A;  4I1M A;  5B1B E;  2ZU6 B;  1DC2 A;  3AJI A;  2RKK A;  3UTM A;  3ZW3 A;  1N52 A;  3Q7F A;  3UM2 A;  3L08 A;  3VLD A;  3FUL A;  2P9U G;  1K1A A;  3RKV A;  1N0R A;  3R7R A;  1U3D A;  3ZIM A;  4PS8 A;  4DX7 D;  2X38 A;  3FDH A;  3RRN B;  2E0I A;  1IXV A;  1JPL A;  3QC1 A;  1OWM A;  3ZYQ A;  3DSS A;  4I1A A;  2X6I A;  4XX5 A;  4EBA G;  5CMW A;  3JQ0 A;  4ILG A;  3EU5 A;  3V30 A;  1IQR A;  4F1S A;  4TRQ A;  4C0E A;  1NA3 A;  3E32 A;  2ZGG A;  4J7W A;  2JAB A;  3AU5 A;  2QYU A;  1JCR A;  4FU3 A;  3QNK A;  4U63 A;  3CGH A;  4LNU D;  3B13 A;  3FTV A;  5D0Q D;  3CLJ A;  3SO8 A;  4FJZ A;  3ZYK A;  3ULY A;  1OWL A;  4O1O A;  3D9M A;  1K1B A;  4YDO A;  2VGE A;  3CK7 A;  4D10 C;  4QFV A;  2V0P A;  3EIQ C;  3PUJ A;  1TN7 A;  4JC8 A;  1TR4 A;  2NSZ A;  3RAU A;  4HLL A;  1O1R A;  3ZUV B;  2UWJ G;  1OWN A;  3AG4 E;  3CVY A;  5LOZ A;  5J08 A;  2I1K A;  2V5Q C;  2XRZ A;  3G2W A;  1YCS B;  3QAQ A;  5G05 J;  4W9R A;  5AQA A;  4F6R D;  1INZ A;  5LCW J;  2VGX B;  4RSY A;  4HI9 A;  3CVN A;  4B0Z A;  4UWG A;  3SD5 A;  4DUI A;  4N2S A;  1JCQ A;  4CT4 A;  2IF4 A;  4LNB A;  2EIK E;  4DLQ A;  5AAO A;  3CVW A;  4GU5 A;  3UI2 A;  2A5U A;  5EIL A;  2HE0 A;  3DBS A;  3MV2 B;  4G8L A;  3ZXS A;  2RD0 A;  2VGX A;  3P2B A;  4JHR A;  2AW6 A;  5CER B;  3Q49 B;  4GA0 A;  2P9S G;  4G1T A;  3FUK A;  3U4T A;  2WXF A;  2QY7 A;  3HXC A;  1WAO 1;  1QNF A;  3FUN A;  3UPV A;  4BSZ B;  3PEV B;  1JCS A;  2OOE A;  3HXF A;  4NRH B;  1H2U A;  1MHQ A;  4JPS A;  2C0M A;  3UXG A;  1E8W A;  2WVI A;  3SFX A;  1LD7 A;  5AQ7 A;  3HIZ A;  2XPY A;  2XS8 A;  3EHR A;  1OCC E;  4URK A;  1KZO A;  4RVB A;  3HYM B;  3EDT B;  2WXR A;  3ZNG A;  3UX4 A;  1EF1 C;  3FU0 A;  4CGW A;  3T8M A;  1HZ4 A;  5FTP A;  3TAX A;  3S7F A;  5LX8 A;  5ENQ D;  2WMN A;  1E8X A;  4NIK A; 
#chains in the Genus database with same CATH homology
 3C98 A;  4RG9 A;  4CDN A;  1H2T C;  3CVP A;  4JW1 A;  4U0Z A;  5D0O D;  4LRZ A;  3FH8 A;  5AJL A;  2C2L A;  4BTA A;  3BG1 B;  3SF4 A;  2IJG X;  3IBE A;  1WY6 A;  4AEZ C;  1KT1 A;  1UN9 A;  5G04 J;  2YHE A;  3RU0 A;  2VYI A;  2Q7F A;  3ONL A;  4C0M A;  3PNL B;  1L5J A;  3CKB A;  4J8D A;  4WAF A;  3QAR A;  5KJK A;  4WWO A;  4KBQ A;  5HQ8 A;  3N71 A;  4GAA A;  4FHJ A;  4IRU A;  2J07 A;  4FC8 A;  4FP7 A;  4HFG A;  2WQ6 A;  1TEZ A;  5ARG A;  3JCK C;  5FZQ A;  2BUG A;  2OVB A;  3ASD A;  3CEQ A;  5EKQ D;  4CGV A;  2X3M A;  3FEX A;  5ARF A;  4FAD A;  3P1U A;  2JEK A;  2L6J A;  3KAE A;  4APF A;  4DI3 A;  5E76 A;  4N2Q A;  2X6H A;  3CIA A;  1SQM A;  3TGO A;  5BW8 C;  1E8Z A;  4WUY A;  2WXQ A;  4YVQ C;  5ENN A;  4B94 A;  3FUD A;  3ESK A;  3LY9 A;  3LJ3 A;  3I4R B;  3ML9 A;  3MKR A;  2HM8 A;  3TXM A;  4PS7 A;  2VTB B;  2J4B A;  5T4Y A;  4GA2 A;  3U64 A;  3CHO A;  3FH7 A;  3MA5 A;  2LAH A;  2AVP A;  3MZL B;  4FLH A;  5C2Y A;  3FU3 A;  2WMO A;  3HDX A;  1XNF A;  1Z6T A;  5HI7 A;  5DBK A;  3EIJ A;  3IHY A;  4JXT A;  4CT0 A;  4I17 A;  4A3V A;  4E6H A;  3IKO B;  1E7V A;  1Z3X A;  3Q5M A;  4MLP A;  3URZ A;  3ZHE B;  5BV0 A;  4ACK A;  3I5P A;  1S0P A;  3B7R L;  1BPO A;  2WM9 A;  1ELK A;  4J8S A;  4GZ6 A;  4EEC A;  3D3M A;  4HOT A;  2AXZ A;  3CHP A;  4Y6C A;  3FWV A;  3ONK A;  5BNW A;  4FHK A;  2V8S E;  4B8C B;  2VTB A;  3GW4 A;  4I6E A;  4G2V A;  4K0R A;  3B7U X;  5BV1 A;  5FQ4 A;  3ZYM A;  2Y3A A;  2ION A;  4YND A;  3CK9 A;  1GW6 A;  3CVX A;  3MJW A;  1EPU A;  2KC7 A;  4JHJ A;  5T8I A;  3IHV A;  3OTN A;  4PUC A;  4U0S A;  2KM4 A;  3ZHE A;  2XRY A;  4JZY A;  1HF8 A;  3PZD A;  4KVM A;  2Y4U A;  3GZ2 A;  3Q47 B;  2E2E A;  3FUM A;  3CST A;  4CRW A;  4GCO A;  4UQX A;  1VDY A;  1KLX A;  3CK8 A;  2WQH A;  4GML A;  2VSY A;  3K9I A;  3ZVV A;  2CHW A;  1JUQ A;  1DVP A;  4N5C A;  3D9N A;  2DCP A;  3DPD A;  4G24 A;  4TV3 A;  3D9L A;  2J08 A;  3CSF A;  4KZC A;  2OV8 A;  1E96 B;  3PE3 A;  4L1B A;  3ULQ A;  4XI0 A;  4AY5 A;  3QK0 A;  2XGM A;  1N54 A;  3D9I A;  3GYZ A;  4EZL A;  2AWI A;  3SHF A;  4J8F A;  4O6F A;  3APD A;  5CMY A;  3SZ7 A;  4EQF A;  3CHQ A;  2GRM A;  3AU4 A;  4GYO A;  3G2V A;  3EHM A;  2XGO A;  2VSX E;  2VSN A;  3JUI A;  5CCM A;  1IQU A;  1H0A A;  2YQ8 A;  4XI9 A;  4BTB A;  3QB2 A;  2EQX A;  5FQ7 A;  5LP0 A;  2WXG A;  3HHM A;  2WQ7 A;  1IHG A;  3QWW A;  2YNQ A;  4FUL A;  2CHZ A;  2XQ0 A;  4J8E A;  4XZ4 A;  4BFR A;  4F53 A;  2VJ8 A;  3FTZ A;  4UI9 K;  4L7T A;  3FUI A;  4XKB A;  3FUF A;  4FLB A;  4ATG A;  5JJ7 A;  2YIN A;  3NF1 A;  4WNG A;  4AXH A;  4B89 A;  2V4L A;  5JJ6 A;  3FTU A;  2WXL A;  2X6K A;  3L17 A;  3ESL A;  1HS6 A;  1SZA A;  4G23 A;  3KS2 A;  2Y4T A;  3FY4 A;  2OVF A;  3L22 A;  3CR3 A;  2J09 A;  4HS2 A;  4PS3 A;  4AVX A;  1ELW A;  4G11 A;  1HU3 A;  2AXU A;  2FO7 A;  3JQ1 A;  3MV3 B;  4TUU A;  2ILR A;  2KCV A;  3RRU A;  4YVO A;  1HG5 A;  4M3O A;  4JHK A;  2MRI A;  4JA9 A;  2I9C A;  3RRM B;  3S7J A;  5BT1 A;  2J9Q A;  3ZRH A;  2FI7 A;  3MYV A;  4HOU A;  3FUJ A;  3IEG A;  2VGY A;  2QFC A;  5FJY A;  3D9O A;  4ILH B;  3QWV A;  5EX3 A;  1E7U A;  4AJW A;  1PY1 A;  2FUL A;  1H2V C;  4BWR A;  4WWP A;  5C1D A;  4NQ0 A;  2MHK A;  4FJY A;  2X6J A;  5FWQ A;  1FCH A;  1Y6I A;  4DLO A;  1FVH A;  1QZ2 A;  3G2U A;  4JEH A;  2PQN A;  1QQE A;  3VTY A;  3OXG A;  4LEU A;  4A1S A;  4I9E A;  3U66 A;  3APF A;  2C0L A;  4K03 A;  1E8Y A;  5EDS A;  3PRE A;  3AS8 A;  2XPI A;  3T5V A;  5A7D B;  4HOQ A;  1E90 A;  3S7D A;  3ZPJ A;  4KMO A;  2J4D A;  4AM9 A;  3CV0 A;  3FUH A;  3QOU A;  3HVE B;  4EBA A;  3EHN A;  5KJN A;  3OXL A;  3QDN A;  3FU5 A;  3GZ1 A;  3I3N A;  3PUK A;  2CG3 A;  3ZGQ A;  2IQC A;  3LYA A;  1SZ9 A;  3CVV A;  5KCM A;  1LF8 A;  4BY6 A;  4DI4 A;  4ANV A;  4EZK A;  3PH0 C;  2R17 C;  3AS5 A;  4UI9 C;  2GW1 A;  4JVS A;  4I1M A;  5J90 A;  3U9W A;  4OYS A;  4LCT A;  2R59 A;  2ZU6 B;  3O4Z A;  4P29 A;  3CQG B;  2CFU A;  4E85 A;  4U07 A;  3HVE A;  3FTS A;  1ELR A;  2CFZ A;  4WNE A;  4ANW A;  2VSO E;  3FU6 A;  4GZD A;  3PDN A;  5LFA A;  2PL2 A;  2VQ2 A;  4V3I A;  3ZW3 A;  4UI9 J;  2J49 A;  2MOW A;  4I1O B;  2I1J A;  4I2Z A;  3CVQ A;  1N52 A;  5AEN A;  4J0U A;  3CQC B;  1TJC A;  3MX3 A;  3L08 A;  3VLD A;  3FUL A;  4U04 A;  4UWL A;  3AS4 A;  1HH8 A;  4BT9 A;  4ANX A;  4UWF A;  3LY8 A;  1WM5 A;  2RG8 A;  3RKV A;  3TG4 A;  2IU1 A;  2L0T B;  4HXI A;  3R7R A;  1U3D A;  3ZIM A;  4PS8 A;  2IFU A;  2IOS A;  3LXU X;  3UT7 A;  5KJL A;  4CDM A;  3BEE A;  2CHX A;  2X38 A;  3FDH A;  1PC2 A;  2E0I A;  3RRN B;  4EZJ A;  4GZ3 A;  3D9K A;  4KVO A;  3SGH A;  3S2A A;  2PM7 A;  4N3A A;  2V5F A;  1JPL A;  3QC1 A;  1OWM A;  5E75 A;  3MKQ B;  3ZYQ A;  2L9B A;  4L2L A;  4ILI A;  3I4G A;  5G55 A;  3CHR A;  2P58 C;  4I1A A;  2X6I A;  2LSV A;  3FH5 A;  4XX5 A;  1FVF A;  4PDX A;  4EBA G;  3CHM A;  4IN3 B;  5CMW A;  3QJZ A;  3APC A;  3JQ0 A;  4ILG A;  3ML8 A;  4L2Y A;  4NUR A;  1IQR A;  1JWG A;  2LAI A;  3FEY A;  3FHE A;  4ANU A;  4F1S A;  3OXF A;  3SBT B;  3MCX A;  4TRQ A;  4C0E A;  4OVU A;  1NA3 A;  2WB2 A;  3T5X A;  3VLE A;  1HX8 A;  1JWF A;  3MKQ A;  4H7X A;  5JHA A;  5G2N A;  3AU5 A;  3NQP A;  2WXI A;  3QWP A;  4G25 A;  3B7S A;  3UQ3 A;  2AXV A;  5AJD A;  1ZBP A;  2UY1 B;  4FU3 A;  3QNK A;  4U63 A;  4RG6 A;  3RIB A;  3MGB A;  3ZN3 A;  3CGH A;  4H7Y A;  4MKT A;  3RJV A;  5CCL A;  1H6K A;  2X6F A;  1UJK A;  4GCN A;  3B13 A;  3FTV A;  2NXP A;  4A55 A;  1HG2 A;  4F7A A;  1NZN A;  4R7L A;  5D0Q D;  3U3W A;  3UUX A;  3PS6 A;  3FTW A;  4AIF A;  4CCA A;  4N39 A;  3CLJ A;  4Q69 A;  3QKY A;  2LSU A;  5BPP A;  5AYW D;  4FJZ A;  3BG0 B;  5G04 C;  1OUV A;  2FF4 A;  1ZU2 A;  2WPV A;  1OWL A;  4UQZ A;  3ZYK A;  3D9M A;  3LCA A;  3CKC A;  2UY1 A;  2M63 A;  2YHC A;  3L6A A;  3LKU A;  2WXN A;  3CK7 A;  2WXH A;  4I2W A;  4D10 C;  4DJA A;  3GZS A;  1Y8M A;  4QFV A;  1OWP A;  2LNI A;  5JJT A;  2GGF A;  2V0P A;  3LS8 A;  4AV7 A;  5CHE E;  3RO3 A;  3CHS A;  4I9C A;  1W3B A;  3EIQ C;  2I2O A;  3PUJ A;  4I43 A;  4XIF A;  4GYY A;  4JC8 A;  3KD7 A;  4OVV A;  5G05 C;  4BX9 A;  2NSZ A;  1NP7 A;  1A17 A;  3PEU B;  4LUN U;  4DPR A;  2WXM A;  5BUZ A;  2WXK A;  5KJM A;  3TXN A;  4U8H A;  4KT6 B;  5FQ6 A;  3SFZ A;  4ABN A;  3RO2 A;  1DNP A;  2WXJ A;  1X5B A;  4JEU A;  4WND A;  4XE0 A;  3FUE A;  5LCW C;  2BF0 X;  3LDZ A;  2UWJ G;  4GA1 A;  3FP3 A;  1OWN A;  3MEK A;  4J6I A;  2LO6 A;  3CVY A;  5M72 A;  3LVR E;  2KAT A;  1PAQ A;  4GMJ A;  4NAC A;  5LOZ A;  2WXO A;  3LPZ A;  4BT8 A;  4CEM A;  5J08 A;  3SNX A;  2I1K A;  1KT0 A;  2XRZ A;  3G2W A;  3QAQ A;  5G05 J;  4BX8 A;  4HOR A;  4W9R A;  1YA0 A;  1EDU A;  1INZ A;  5A6C A;  1HXI A;  5LCW J;  1HE8 A;  2CG2 A;  2BTD A;  2GRL A;  2VGX B;  4F3V A;  4HOS A;  4RSY A;  2A4Z A;  3JYS A;  3IV0 A;  2OND A;  3CVN A;  1UN8 A;  2DIW A;  4UWG A;  5ANL A;  5EX0 A;  3SD5 A;  4B0Z A;  4N2S A;  3SI5 A;  3TL5 A;  3VLF A;  3Q15 A;  3FFL A;  3L13 A;  4A1G A;  4DK5 A;  4Q94 A;  2XPZ A;  3D9J A;  4CT4 A;  2IF4 A;  3ASG A;  3R9A B;  3ZYL A;  3FTY A;  4KYO B;  5DIZ A;  5JHB A;  2DBA A;  3ZFW A;  4DLQ A;  5A23 A;  4GPK A;  3SBS A;  1Z3Y A;  4A3T A;  3UT4 A;  3CVW A;  4JL0 A;  4GU5 A;  4PH4 B;  4WWN A;  3R7Q A;  3UT8 A;  2A5U A;  3B7T A;  2KCK A;  3DBS A;  3MV2 B;  4N3C A;  3OAW A;  3ZXS A;  2L0I A;  2RD0 A;  2VGX A;  1B89 A;  3P2B A;  4JHR A;  4UQY A;  1UG3 A;  1XGW A;  4IUL A;  2AW6 A;  1OWO A;  3PNT B;  3Q49 B;  4GZ5 A;  4N3B A;  4L23 A;  4Y6W A;  4I6G A;  4GA0 A;  4C9B B;  3Q4A B;  4G1T A;  3TG5 A;  4UWH A;  5FZS A;  1IYG A;  3RK6 A;  2XGS A;  5T3R A;  3FUK A;  4KZ0 A;  2WXP A;  4MS6 A;  3D9P A;  3U4T A;  4ME2 A;  4U0U A;  3LVQ E;  2KCL A;  3ZEF A;  2WXF A;  3PE4 A;  2QY7 A;  4KXK B;  1WAO 1;  3ASF A;  3E4B A;  4APO A;  5ANR A;  2JLB A;  4GYW A;  3UMV A;  1QNF A;  3FUN A;  3UPV A;  1HFA A;  2FEZ A;  4HLE A;  3ASH A;  3KEZ A;  3PEV B;  4UWK A;  4XKC A;  4Q96 A;  2XEV A;  4ACL A;  4CDR A;  2OOE A;  4GZC A;  4NRH B;  4HVB A;  1H2U A;  1MHQ A;  3L54 A;  4LER A;  2HYZ A;  4MRU A;  4JPS A;  3CVU A;  3EJN A;  1EYH A;  1H19 A;  2C0M A;  3L16 A;  4AP2 A;  1E8W A;  2WVI A;  2KZT B;  2XCB A;  3FTX A;  1UW4 B;  3S7B A;  1NA0 A;  4JA7 A;  2HO1 A;  2HR2 A;  3LY7 A;  2R5S A;  4EPZ A;  4I6J A;  3ENE A;  2XHE A;  3G2S A;  3HIZ A;  2XPY A;  3PVL A;  2IOL A;  2I6H A;  1U3C A;  4BSX A;  4IYP A;  3WXX A;  2FBN A;  2PM6 A;  2PQR A;  4URK A;  4AOF A;  4B8A A;  3LEW A;  5AIJ A;  1TJF A;  1MQS A;  2KZT A;  3G2T A;  4RVB A;  5FZR A;  2XCC A;  2PZI A;  1UJJ A;  3HYM B;  3EDT B;  2WXR A;  4G26 A;  3PRZ A;  3UX4 A;  4AY6 A;  1EF1 C;  3FU0 A;  1HO8 A;  3NZU A;  1P5Q A;  4CGW A;  3CVL A;  3T8M A;  3TJP A;  4FA6 A;  1HZ4 A;  3O48 A;  5FQ8 A;  5FT9 A;  5FTP A;  4WNF A;  3S7F A;  3TAX A;  5LX8 A;  2WMN A;  1E8X A;  3VTX A;  2NC9 A;  3NZS A;  4GB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...