1H0AA

Epsin enth bound to ins(1,4,5)p3
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
158
structure length
158
Chain Sequence
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPSIN
publication title Curvature of Clathrin-Coated Pits Driven by Epsin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 68
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2002-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1h0aA00
4Q94A 1PY1A 3G2UA 3ZYLA 2DCPA 3D9MA 1HG2A 5CMWA 1UJKA 2DIWA 1JWFA 4GZCA 3D9PA 3CLJA 1HF8A 1H0AA 1MHQA 1INZA 3D9LA 3D9IA 2LO6A 1DVPA 1ELKA 3G2TA 5CMYA 3ONLA 1EYHA 1JUQA 4HFGA 2KM4A 2L0IA 5LP0A 4FU3A 3LDZA 1X5BA 2BF0X 3G2SA 4FLBA 2L0TB 2V8SE 3D9JA 4Q96A 1EDUA 1XGWA 3ONKA 3ZYQA 3ZYMA 1VDYA 4JXTA 3D9NA 3ZYKA 2MOWA 1SZ9A 1HFAA 1UJJA 1JWGA 2QY7A 4GZDA 4NACA 1HX8A 3D9OA 3G2VA 5LOZA 3RRUA 4AVXA 3G2WA 5J08A 1SZAA 1HG5A 3D9KA 1LF8A 1JPLA
chains in the Genus database with same CATH superfamily
3EJNA 5LCWC 4JL0A 4KZCA 4XKBA 2X6JA 1HF8A 1N0QA 5CCMA 3WG7E 3VLDA 4I1AA 4AVXA 4B8AA 1P5QA 2R05A 2KCKA 5FQ7A 2H6FA 5CHEE 1HS6A 3P2BA 2IOLA 2VGXA 3PNTB 3UPVA 1HZ4A 2V0PA 5EKQD 4KMOA 1N9AA 3FTXA 1UOHA 3SY2A 3GZ2A 4F6RD 3CVXA 2FO1E 3DXMG 2NXPA 3QNKA 2J07A 4GMLA 3DSUA 1IQUA 3CVNA 3SFXA 4FC8A 1YA0A 2XS1A 4PUCA 4YVQC 5G04J 4WWPA 5J90A 3E37A 4J6IA 2HYZA 4EZJA 5D0QD 3FWVA 1AWCB 1EYHA 1N4QA 5FWQA 5G2NA 3E32A 2WQHA 1K3ZD 2WXGA 2ZISA 4JEUA 3QKYA 1H6OA 1NI1A 2WXFA 1FVFA 4J8YA 1H2UA 3G2UA 5E75A 1N52A 2YQ8A 1HU3A 4BSZB 3LCAA 3FTWA 1MZCA 2EIJE 2X38A 4AJWA 4HFGA 3ABME 4MBGA 4F1SA 3ZYQA 4ATZD 4J8DA 3TWXA 3V2OA 4A1SA 2NSZA 3FTSA 4AEZC 3ZKJA 4GA1A 4IYPA 4UWGA 4RG9A 5CCLA 2WQ7A 4DX1A 1E7VA 5KJMA 2L0IA 4HLEA 2PZIA 1X81A 2R17C 1SQMA 3ABKE 3AJIA 2J8SD 4FHJA 3X2QE 2P9NG 5JJTA 5ENOD 3VLEA 3OXLA 3RO2A 3EIJA 3IBEA 2ZGGA 1MX4A 3BUAA 3MX3A 3QWWA 4Q96A 5T3RA 1Z3YA 2R02A 4GU5A 2WB2A 2EQXA 1TNUA 4H7YA 5CERB 2J4BA 3ULEG 2LAIA 1E96B 2XEVA 3PS6A 4IN3B 3LVRE 4DX2A 4I6EA 2MHKA 1OWLA 4I43A 1KT0A 4GYYA 3DSVA 2XEHA 3LXUX 5ITZF 5FQ4A 4LNBA 3MYVA 3QC1A 5IY5E 2BEDA 3KSLA 5C2YA 4OAUC 2VYIA 4CDRA 2DVWA 5FJYA 2XGMA 3BG1B 4BESA 4NRHB 4GTPA 2F8XK 2GRNB 2A4ZA 3TWRA 2YHCA 1ZB1A 3RRNB 4DX7D 4MRUA 3K9IA 3CGHA 3AU4A 3SI5A 3GZ1A 4F1PA 4K03A 1VDYA 4HNAD 4TV3A 3Q5MA 4KBQA 1H19A 2ZXWE 4DLOA 4N5QA 4DRXE 5B1AE 2FEZA 3NOGD 4A1GA 3HVEA 2VGXB 3HXFA 2BF0X 4I1MA 5EX3A 3EU5A 4NQ0A 2WXRA 1OWPA 4BEPA 3NZSA 5A7DB 2HM8A 5KNHD 3JYSA 4BFRA 1WAO1 3FH5A 4HORA 2CG3A 1MHQA 3FHEA 2JABA 4XIFA 1SA5A 3VLFA 1TNBA 3HHMA 3DRAA 3N71A 3PE4A 3L16A 3Q15A 5AAOA 3CSTA 4J8EA 3LJ3A 4AY6A 5ENQD 4A55A 3MV3B 4BETA 2IO2C 4ILGA 3W9FA 1JUQA 4WNEA 3V2XA 5KJNA 2R2LA 2MRIA 3APCA 3UM2A 2A5UA 4L1BA 4C0EA 4BSXA 3HDXA 4HOQA 5AQ7A 3NZUA 2KATA 4C0MA 4JZYA 2A5EA 3CHPA 2F37A 1NA3A 4CEMA 3Q9UC 3ASNE 4GTMA 4A3TA 3D9OA 4G26A 1QZ2A 2VQ2A 1DC2A 3D3MA 5DIZA 5ENTD 3FTYA 2J08A 4U07A 2CHXA 2AXZA 3CVUA 3ONLA 5EDSA 5FINA 2GROB 4LSZE 4R7LA 2PM6A 4GA2A 4OVVA 1UN9A 4GTVA 3ZPJA 1Z3XA 5FQ8A 3CIAA 3ZXPA 2J4DA 3L82A 3ZW3A 5CRVA 2P9UG 3ULYA 3B95A 3FU5A 5CMWA 3G2TA 3NB2A 4GAAA 3SNXA 5BV0A 3OXFA 1IXVA 2VGYA 3G2SA 3ZVVA 3AG2E 1K1BA 4MLPA 2V4HC 1JCRA 3C3RA 2WVIA 2X6HA 1HG5A 5HRYA 1ELRA 4GTTA 1OCCE 1MQSA 4B89A 5A6CA 5BT1A 3CSFA 4JHKA 5LX8A 3BQOA 4BX8A 4TXRA 2LSUA 2ONDA 1N54A 1XGWA 3RKVA 3PE3A 1O1RA 4HOUA 3DSTA 4N39A 4ANUA 3HIZA 3G2WA 3FH8A 4CCAA 1N95A 4HOSA 2YHEA 1KT1A 3ASHA 3UKUG 3T8KA 4AM9A 3ML9A 2KM4A 1QBQA 4L23A 3SZ7A 5ARGA 3CK9A 5M72A 5JJ6A 2H6IA 3FTUA 3FU3A 3L08A 3B13A 1NA0A 3I5PA 5CBNA 3FUHA 3HRAA 4N3CA 2E2EA 4V3IA 3UUXA 2DBAA 3CKCA 1MJ0A 4APFA 3TWQA 2F0YA 2ETAA 5A23A 2RG8A 2J49A 1ZU2A 2MYOA 4FULA 5EIDA 3S7JA 2IONA 4GZ6A 4O6FA 2ZGDA 3MKRA 1OCRE 4K5AB 5ENNA 3Q75A 2IQCA 4JXTA 3C3QA 2X6KA 2EILE 1NZNA 3ZFWA 3IEGA 4DX6D 5EYLA 5BW8C 1O1TA 4TRQA 4GYOA 3LVQE 1SA4A 3B7TA 3OXGA 3UX4A 4ACLA 2WQ6A 4GCNA 3FUMA 3C72A 2HO1A 2IF4A 5HQ8A 3U64A 1KZPA 4CDNA 4ABNA 2I6HA 2QZAA 3FUFA 4RQIA 3QWPA 3FULA 3AG4E 1E8YA 1RZ4A 4BTAA 5ENPD 1PY1A 3ZHEB 2PQRA 3Q47B 2WXOA 4WNDA 2C0MA 4U63A 3D9IA 3JQ0A 3MA5A 1O1SA 1MYOA 5LFAA 4UQZA 3LPZA 5EIBE 4J7WA 2L6BA 4I6GA 3ULQA 2VSNA 2RFAA 4AY5A 1IQRA 3TWSA 3AS4A 2PQNA 3BEEA 4BY6A 4UI9C 3CLJA 1RW2A 4BERA 1DNPA 4BX9A 4AV7A 1E7UA 5C1DA 2HR2A 4RG6A 2OVBA 2V8SE 4FLHA 5T8IA 1TR4A 5D66A 2VTBB 3KSQA 2L9BA 5FZSA 4LERA 5AJDA 2Y3AA 3ENEA 4FADA 3LY9A 4GZ5A 2WXMA 4Y6CA 2OV8A 4DUIA 3SHFA 5AJLA 5LP0A 4O60A 2XZDG 2AWIA 3DPDA 2KBXA 4FP7A 3ISMC 1S64A 2UWJG 1OXJA 1IYGA 3NAWA 5EX0A 4K0RA 2Y1LE 4GA0A 1TJCA 2NYJA 2X6FA 3OTNA 4UWFA 3MCXA 1X5BA 3RU0A 4C48B 3ZN3A 3ML8A 5AARA 2WM9A 2P9PG 2BKKB 1H2VC 4U0UA 3C5RA 3RO3A 4NIKA 3U4TA 3I3NA 3SFYA 2XQ0A 4U96D 3PZ3A 4EBAG 5AENA 1EDUA 1OWNA 3AG3E 3PEVB 1NP7A 1UG3A 1ZBPA 3PUJA 2ZIRA 4XEIG 1A17A 2WPVA 5DBKA 4JC8A 1QNFA 3FUDA 3SF4A 3CK8A 5D0OD 1HX8A 3MV2B 3UMVA 4CZ2D 2MOWA 1N11A 3TJPA 5FIOA 3FP3A 5CMYA 4JHRA 3GZSA 2VJ8A 2L0TB 4A63B 1E8XA 1SZ9A 3B7BA 1WY6A 3CK7A 3E4BA 3UM3A 2IJGX 4TXPA 4RLYA 4XI9A 5BXOA 3UT8A 4K5CA 4X8QA 5AQ9A 3UQ3A 3L6AA 3ASOE 2KZTB 1N94A 5AQBA 1U3CA 1TN7A 3ZEFA 1TN6A 1TNZA 3I4GA 2DYRE 3ZUVB 1LD7A 4YVOA 5LCWJ 3S7BA 3EHMA 1BI8B 3BU8A 3EHNA 4URKA 5EYPF 2CG2A 3ZYLA 1OWOA 3ASGA 3R9MA 5G05C 3C98A 1L5JA 4GTRA 1DCEA 4XZ4A 2XRZA 4N2QA 3HXBA 5JA4D 2KXPC 4NACA 3UXGA 2VSXE 4U04A 4K5BA 2J09A 3CVQA 3F6QA 3LJNA 4ANWA 2AW6A 4CDMA 3QARA 3TWWA 4L2YA 3EDTB 4BTBA 3V79K 3PDNA 4U8HA 3DBSA 3CVVA 3KD7A 5ENSD 5AIJA 5EN5D 3VTXA 2XZTG 2WXLA 1UW4B 2FF4A 3U66A 4ACKA 3L13A 1TNYA 3KS2A 4HRMB 1YCSB 2IEJA 3VTYA 3D9HA 4HS2A 4WWOA 3JXIA 4H7XA 1BLXB 1MX2A 3ASFA 3CV0A 3LDZA 4CGVA 4XE0A 3D9NA 3UT7A 5KCMA 1N4RA 1H6PA 3TG4A 4FA6A 1JPLA 3ZHEA 3PH0C 1FT2A 4L2LA 2Y4TA 2GW1A 2J9QA 3DSSA 2LAHA 4HI8A 3TL5A 3V31A 3UTMA 1WG0A 2YNQA 2V5QC 1KZOA 4UI9K 4M3OA 2LNIA 3ZGQA 1JCSA 4N5CA 1UJKA 1INZA 4WWNA 5H7PA 3E33A 2XGOA 4XI0A 4N3BA 3RRMB 4HRNA 4UQYA 2KCVA 2JLBA 5BV1A 3RIBA 4KT6B 4DI4A 2VTBA 1HFAA 2OCCE 2CHWA 3Q9NC 3AS8A 3BG0B 5G04C 2GRRB 3HG0D 3ZXSA 1O5MA 1OUVA 1LD8A 4LG6A 4G2VA 4FU3A 4PS8A 4AIFA 1GW6A 1N0RA 4WNGA 3DEOA 3GW4A 4YDEA 3Q7FA 2I2OA 3HXCA 2WXJA 2Y0BG 4F3VA 2WXKA 4Q69A 1Q2ZA 3RK6A 2CHZA 2E0IA 3QWVA 4CYMD 3LKUA 1SW6A 4J0UA 2F8YA 2R5SA 1YYHA 4LNGA 2LUHA 3PZ4A 2CFUA 5EILA 2P9SG 5HKPA 1A5EA 1G3NB 4JB8P 1EF1C 4JEHA 2M63A 2UY1B 1K1AA 4GZ3A 3EHRA 3IHVA 3P1UA 1UJJA 4GZDA 3TAXA 4ZFHA 2AXVA 1IHGA 4APOA 2XCBA 4LCTA 5BUZA 4TUMA 4UWHA 1E90A 4OAVB 3SFZA 1QYMA 2H6HA 3PVLA 2RD0A 2V4LA 5B3SE 1Y6IA 1BD8A 4I17A 3NBNB 3JXJA 3KAEA 5ENRD 4N2SA 2EIME 2VSOE 3AS5A 2FULA 4LUNU 4I6JA 4PS3A 3FUKA 2LO6A 2BKGA 1S63A 3T9KA 3IHYA 3UIOC 1TN8A 3AAAC 4ATGA 1UN8A 2XPYA 5FT9A 2NC9A 3PNLB 5J08A 2HE0A 4E6HA 1KLXA 2R59A 3R7QA 3B7RL 3HXDA 4IULA 4DJAA 2OEVA 2XENA 1N4PA 4B8CB 3CVLA 5CECB 4DX5D 2KZTA 3EIQC 4GPMA 4LNUD 4HLLA 4O1PA 5FZQA 3NOCD 2P9KG 4AOFA 1OCOE 2P2CP 3AU5A 3UIPC 3UI2A 1DVPA 4P29A 2VGEA 2WMNA 3J5PA 3CVPA 3DSWA 3KEAA 2QYJA 3IXEA 3DWLG 2IU1A 4I9CA 2IO3C 4GCOA 3FEYA 1H0AA 2EINE 3SBSA 2KC7A 4B93B 4KVOA 3CQGB 5ARFA 4F7AA 3FDHA 5AN8A 3JUIA 3FFLA 2YINA 4DLQA 1Z6TA 3ZRHA 3FH7A 1BU9A 5E76A 5HS0A 3HXEA 4D10C 3AG1E 4ME2A 1ELKA 5CEDB 3Q78A 1TJFA 1HE8A 3FEXA 4HBDA 5FQ6A 3APDA 2QC9A 3RJVA 2OEWA 3QDNA 1OY3D 4DK5A 2V5FA 2XRYA 4GPKA 1FT1A 4HI9A 3ESKA 3Q49B 4U95D 2XGSA 5BPPA 4G1TA 3QJZA 3E30A 2B6CA 3L9TA 2OVFA 3NF1A 1Y8MA 3CEQA 3JQ1A 2IY0C 4HQDA 3TWVA 4DPRA 5JJ7A 3FU0A 1LF8A 4W9RA 4YNDA 3QB2A 4GTOA 2XPZA 3D9PA 1FCHA 2DYSE 1H6KA 2FBNA 2PM7A 3GYZA 4U7EB 4XKCA 2X3MA 4XX5A 3MKQB 4JPSA 3DSXA 4FHKA 2PL2A 1QQEA 3MJWA 3B7SA 4WNFA 3T8MA 2P9LG 4U0ZA 3FUEA 4Q94A 2AVPA 4JD2G 2I1KA 3LEWA 1B89A 2C0LA 4LRZA 4EECA 2EIKE 3PZ1A 4UQXA 3TGOA 3QK0A 1E8ZA 1FVHA 4I2WA 4BT9A 2LXMA 1OT8A 4CT4A 4Y6WA 3TXNA 3CR3A 1PC2A 3IV0A 3J5QB 4KYOB 2DIWA 3CHRA 4G11A 3ZIMA 2WMOA 4BT8A 3DXKG 3PEUB 1D9SA 2XCCA 5BXUA 3W9GA 1E8WA 2QY7A 1JWGA 4LEUA 3Q7AA 1W3BA 3LY8A 3CHSA 2P58C 2DWZA 3IKOB 2GRLA 4I2ZA 3O4ZA 4KZ0A 5CBOA 3TXMA 1U2VG 4AXHA 5ANRA 1HO8A 1XNFA 3UINC 3ASDA 1AP7A 4RVBA 3FUJA 5JHBA 2DCPA 3E34A 2R03A 3RSEG 1MX6A 2XEEA 3LS8A 1KPSB 4ILHB 5G55A 4JVSA 2XPIA 2UY1A 1N4SA 1TYQG 2AXUA 1IKND 3ZYMA 5KBAA 1H2TC 3EUVA 4C9BB 3CHOA 3SBTB 2KCLA 1JWFA 1NL4A 2OOEA 5KJLA 3QAQA 2WXQA 4TXQA 2BTDA 1ELWA 3MZLB 3RRUA 2H6GA 2ZU6B 3Q79A 2ETCA 2AJAA 4B94A 2WXHA 3WXXA 2CFZA 3TG5A 2Y4UA 1D8EA 4UUCA 4MS6A 3PZ2A 5KWDA 4O1OA 3DEPA 4JHJA 1LTXA 2GRMA 4WUYA 3UM0A 4BWRA 3L22A 1TNOA 4CRWA 3CVWA 2QFCA 1K8KG 3ESLA 3PRZA 1NFIE 3I4RB 2GGFA 3ABLE 5AQAA 3FTVA 3R9AB 4N3AA 1OCZE 4I9EA 4PH4B 2GRPB 4AP2A 3ZU7B 3SO8A 4QFVA 1Z5SC 4UI9J 4L7TA 1FPPA 1WDYA 3PZDA 3TWUA 3LYAA 3D9KA 4MKTA 2BUGA 4GMJA 4GZCA 3UM1A 4G24A 4GTQA 1OWMA 3S7FA 3O48A 4EBAA 4HB5A 2RFMA 4KVMA 2GRQB 4E85A 2XHEA 3HYMB 4F53A 2I1JA 2L6JA 3FY4A 2LXLA 4ANXA 4OYSA 4GMRA 3CKBA 5BNWA 3FUNA 4G25A 4JW1A 1S70B 4J8SA 5LOZA 3Q73A 4EPZA 4HOTA 2WXNA 3CHQA 4M7CA 2C2LA 5FTPA 3FTZA 4U0SA 3L17A 2WXIA 3URZA 4CT0A 4JA9A 3CVYA 1U3DA 3SGHA 4FLBA 4I1OB 3FUIA 3S2AA 4A3VA 3APFA 4ILIA 4GYWA 3PUKA 4U8VD 3EHQA 1YMPA 3UKRG 4G8KA 3D9LA 2LSVA 1TEZA 3V30A 2B0OE 1WM5A 2P9IG 3OAWA 3T5XA 5FZRA 1V54E 3B7UX 2FO7A 3KEZA 3UT4A 4ZHBA 3NQPA 3QOUA 3C3OA 3MKQA 1JCQA 1BI7B 1S0PA 4DI3A 2RKKA 2XS8A 3CQCB 4OVUA 3U3WA 4RSYA 3CHMA 3FU6A 1IHBA 4HXIA 3R7RA 4FJYA 4EHMA 3SQVA 5ANLA 3DPYA 4PDXA 3ONKA 2WXPA 3Q4AB 3RAUA 4L9PA 5CEAA 2ETBA 4G8LA 4CGWA 1D8DA 1HXIA 4UWKA 2IOSA 2VSYA 2IFUA 2I9CA 4HVBA 4EZKA 3ZYKA 4YDYA 4U8YD 5T4YA 1SZAA 2PNNA 1HH8A 4YDWA 3SD5A 3D9MA 4IRUA 3T5VA 3MEKA 4NURA 3TWTA 2JEKA 1SVXA 4GB9A 1BPOA 1PAQA 5HI7A 3U9WA 2Q7FA 4UWLA 4J8FA 4B0ZA 3LY7A 5JMND 5G05J 3HVEB 5AYWD 3JCKC 2X6IA 1HG2A 4JA7A 2DZOA 4EZLA 3ZNGA 5CRUA 4PS7A 2DZNA 4HRLA 4TUUA 4FJZA 2ILRA 5KJKA 3MGBA 4YDOA 2FI7A 4KXKB 4EQFA 5JHAA 3D9JA 2QYUA 3L54A 3PREA 1V55E 4QQIA 5KNGA 3S7DA 4ANVA 1DCQA 3JUEA 4GTSA 3G2VA 5B1BE 2Y69E 5D2MC 1EPUA 4Z68A 3EU9A 4G23A 4WAFA
chains in the Genus database with same CATH topology
1PC2A 3EJNA 5LCWC 1MQSA 3IV0A 4KYOB 4JL0A 4ANWA 4B89A 2AW6A 4CDMA 2DIWA 4KZCA 2X6JA 3CHRA 4G11A 1HF8A 3QARA 4XKBA 4L2YA 3ZIMA 5A6CA 3EDTB 2WMOA 4BT8A 5BT1A 3PEUB 4BTBA 3CSFA 3PDNA 4JHKA 5LX8A 4U8HA 3DBSA 2XCCA 3KD7A 4BX8A 5AIJA 3CVVA 5CCMA 2LSUA 2ONDA 3VTXA 1N54A 1XGWA 3RKVA 3PE3A 4HOUA 2WXLA 4N39A 1E8WA 1UW4B 2QY7A 4ANUA 1JWGA 2FF4A 3VLDA 4LEUA 4I1AA 3HIZA 4AVXA 3G2WA 3FH8A 4B8AA 1P5QA 4CCAA 3U66A 4ACKA 4HOSA 2YHEA 3L13A 3KS2A 1W3BA 3LY8A 2KCKA 1KT1A 5FQ7A 5CHEE 3ASHA 3VTYA 1HS6A 3CHSA 4HS2A 4WWOA 2P58C 3P2BA 3IKOB 4H7XA 2IOLA 2GRLA 2VGXA 3ASFA 3PNTB 4I2ZA 4AM9A 3CV0A 3ML9A 3UPVA 3O4ZA 4KZ0A 2KM4A 1HZ4A 2V0PA 3LDZA 4L23A 5EKQD 3SZ7A 3TXMA 4KMOA 5ARGA 3CK9A 3FTXA 4CGVA 5M72A 4AXHA 4XE0A 3D9NA 5ANRA 1HO8A 5JJ6A 1XNFA 3UT7A 3GZ2A 3CVXA 5KCMA 2NXPA 3ASDA 3FTUA 3FU3A 3L08A 3B13A 1NA0A 3QNKA 3TG4A 4FA6A 2J07A 1JPLA 4RVBA 3FUJA 5JHBA 3I5PA 2DCPA 4GMLA 3PH0C 3ZHEA 1IQUA 3FUHA 4L2LA 4N3CA 3CVNA 2E2EA 2Y4TA 3LS8A 2GW1A 4V3IA 4ILHB 5G55A 3UUXA 4JVSA 2J9QA 2XPIA 2UY1A 2DBAA 3CKCA 4FC8A 2AXUA 2LAHA 3TL5A 1YA0A 3ZYMA 4PUCA 4APFA 5A23A 2RG8A 4YVQC 5G04J 4WWPA 2J49A 1ZU2A 5J90A 1H2TC 2YNQA 4FULA 4J6IA 4UI9K 2HYZA 4EZJA 4C9BB 3CHOA 4M3OA 3S7JA 2LNIA 2IONA 3ZGQA 4GZ6A 5D0QD 3SBTB 3FWVA 4O6FA 4N5CA 2KCLA 1UJKA 1JWFA 1INZA 2OOEA 4WWNA 1EYHA 2XGOA 3MKRA 5FWQA 4XI0A 5G2NA 4N3BA 2WQHA 3RRMB 2WXGA 5KJLA 4JEUA 5ENNA 3QKYA 4UQYA 2KCVA 2JLBA 5BV1A 3RIBA 4KT6B 3QAQA 4DI4A 2WXQA 2VTBA 2IQCA 4JXTA 2BTDA 1HFAA 1ELWA 3MZLB 3RRUA 2WXFA 2CHWA 1FVFA 2X6KA 2ZU6B 1NZNA 3AS8A 4WAFA 3BG0B 1H2UA 3ZFWA 3G2UA 3IEGA 5E75A 4B94A 2WXHA 3WXXA 5BW8C 5G04C 1N52A 2CFZA 3TG5A 2Y4UA 1HU3A 2YQ8A 3LCAA 3FTWA 4TRQA 4MS6A 3ZXSA 2X38A 4GYOA 1OUVA 4AJWA 4HFGA 3LVQE 4JHJA 4G2VA 4FU3A 3B7TA 3OXGA 4PS8A 3UX4A 4F1SA 2GRMA 4AIFA 3ZYQA 4WUYA 1GW6A 4BWRA 3L22A 4WNGA 4ACLA 2WQ6A 4CRWA 4J8DA 4GCNA 4A1SA 3FUMA 3CVWA 2HO1A 2NSZA 2IF4A 2QFCA 3GW4A 5HQ8A 3U64A 3FTSA 2I2OA 3ESLA 4AEZC 3PRZA 4GA1A 4IYPA 3I4RB 4CDNA 2GGFA 4UWGA 4ABNA 2I6HA 4RG9A 2WXJA 5CCLA 3FTVA 3R9AB 3FUFA 4F3VA 2WQ7A 4N3AA 2WXKA 1E7VA 4Q69A 5KJMA 2L0IA 3RK6A 2PZIA 4I9EA 4HLEA 4PH4B 2CHZA 3QWPA 3FULA 4AP2A 2R17C 1SQMA 2E0IA 4QFVA 3QWVA 3LKUA 4UI9J 4J0UA 4L7TA 1E8YA 4FHJA 2R5SA 4BTAA 3PZDA 3LYAA 3D9KA 4MKTA 2CFUA 5JJTA 1PY1A 3ZHEB 2BUGA 2PQRA 3VLEA 3Q47B 4GMJA 3OXLA 2WXOA 4WNDA 4GZCA 2C0MA 4U63A 3D9IA 3JQ0A 3RO2A 3EIJA 3MA5A 4G24A 3IBEA 1EF1C 4JEHA 1OWMA 2M63A 2UY1B 5LFAA 3S7FA 3O48A 4UQZA 3LPZA 3MX3A 3QWWA 4GZ3A 4Q96A 4EBAA 5T3RA 4I6GA 1Z3YA 3IHVA 3P1UA 4GU5A 4KVMA 3ULQA 2WB2A 1UJJA 4GZDA 2VSNA 3TAXA 4AY5A 1IQRA 2EQXA 4E85A 2XHEA 3HYMB 4F53A 2I1JA 2AXVA 4H7YA 1IHGA 2J4BA 3AS4A 2PQNA 2LAIA 1E96B 2XEVA 3BEEA 4APOA 2L6JA 3PS6A 3FY4A 4IN3B 4BY6A 2XCBA 4LCTA 4UI9C 5BUZA 3LVRE 4UWHA 3CLJA 4I6EA 1E90A 1DNPA 4BX9A 2MHKA 3SFZA 4AV7A 1OWLA 1E7UA 4ANXA 5C1DA 2HR2A 3PVLA 2RD0A 4OYSA 2V4LA 4RG6A 2OVBA 4I43A 1KT0A 2V8SE 4FLHA 1Y6IA 3CKBA 4GYYA 5T8IA 5BNWA 2VTBB 3FUNA 4G25A 2L9BA 4I17A 5FZSA 4JW1A 4J8SA 4LERA 5AJDA 5LOZA 3LXUX 5FQ4A 4EPZA 3KAEA 4N2SA 4HOTA 4G23A 2Y3AA 2VSOE 3ENEA 2WXNA 2FULA 3AS5A 3CHQA 3MYVA 3QC1A 2C2LA 4FADA 3LY9A 4GZ5A 4LUNU 2WXMA 4Y6CA 5FTPA 5C2YA 2VYIA 3FTZA 4I6JA 4PS3A 2OV8A 2LO6A 3FUKA 4U0SA 3L17A 2WXIA 3URZA 4CT0A 4CDRA 3SHFA 4JA9A 3CVYA 5FJYA 1U3DA 2XGMA 3BG1B 3IHYA 5AJLA 3SGHA 4NRHB 5LP0A 4ATGA 4FLBA 4I1OB 2AWIA 1UN8A 3DPDA 3FUIA 2XPYA 4FP7A 3S2AA 5FT9A 2NC9A 3PNLB 4A3VA 5J08A 2A4ZA 2UWJG 3APFA 4ILIA 4GYWA 3PUKA 2YHCA 3RRNB 4MRUA 4E6HA 1KLXA 2R59A 1IYGA 3R7QA 3B7RL 5EX0A 4IULA 3K9IA 4GA0A 4K0RA 4DJAA 3D9LA 3CGHA 1TJCA 4UWFA 2X6FA 3AU4A 3OTNA 3SI5A 4B8CB 3CVLA 2LSVA 1TEZA 3MCXA 1X5BA 2KZTA 3RU0A 3GZ1A 3EIQC 4K03A 1WM5A 1VDYA 4TV3A 3Q5MA 4KBQA 3ZN3A 1H19A 3OAWA 4DLOA 3ML8A 5FZQA 3T5XA 5FZRA 2WM9A 4AOFA 2FEZA 3B7UX 3AU5A 4A1GA 2FO7A 3HVEA 1H2VC 3KEZA 3UT4A 1DVPA 2VGXB 4P29A 4U0UA 3RO3A 2WMNA 3NQPA 3U4TA 3I3NA 3QOUA 2XQ0A 2BF0X 4EBAG 3MKQA 5AENA 1EDUA 1S0PA 1OWNA 3CVPA 4I1MA 4NQ0A 5EX3A 4DI3A 3PEVB 1NP7A 2WXRA 1UG3A 1OWPA 1ZBPA 3PUJA 2IU1A 3CQCB 3NZSA 4I9CA 5A7DB 4OVUA 3U3WA 2HM8A 4RSYA 3CHMA 4GCOA 3FU6A 3JYSA 3FEYA 4BFRA 1WAO1 3FH5A 4HORA 2CG3A 1H0AA 1MHQA 3FHEA 4HXIA 4XIFA 1A17A 2WPVA 5DBKA 3R7RA 4FJYA 3SBSA 2KC7A 4JC8A 3VLFA 4KVOA 3CQGB 5ANLA 1QNFA 5ARFA 4F7AA 3FUDA 4PDXA 3FDHA 2WXPA 3ONKA 3SF4A 3JUIA 3HHMA 3FFLA 3Q4AB 3CK8A 3N71A 5D0OD 1HX8A 2YINA 3MV2B 4DLQA 3PE4A 3L16A 3UMVA 1Z6TA 3Q15A 3ZRHA 3FH7A 2MOWA 4CGWA 3CSTA 4J8EA 5E76A 3TJPA 3LJ3A 4AY6A 3FP3A 4A55A 3MV3B 1HXIA 4D10C 4ME2A 4ILGA 1ELKA 5CMYA 4UWKA 1JUQA 4WNEA 5KJNA 2IOSA 4JHRA 1TJFA 1HE8A 2VSYA 3GZSA 2IFUA 2MRIA 2L0TB 2VJ8A 2I9CA 3APCA 3FEXA 2A5UA 4L1BA 5FQ6A 1E8XA 4HVBA 4EZKA 3APDA 3ZYKA 1SZ9A 3RJVA 4C0EA 4BSXA 1WY6A 3CK7A 3HDXA 2V5FA 3QDNA 4HOQA 5T4YA 4DK5A 2XRYA 1SZAA 3E4BA 4GPKA 2IJGX 1HH8A 3NZUA 4XI9A 2KATA 3ESKA 3UT8A 3SD5A 3Q49B 3D9MA 4C0MA 4IRUA 4JZYA 3UQ3A 3T5VA 3MEKA 3L6AA 2XGSA 3CHPA 4NURA 5BPPA 2JEKA 1NA3A 4GB9A 1BPOA 2KZTB 4G1TA 1PAQA 5HI7A 3QJZA 1U3CA 4CEMA 2OVFA 3NF1A 3U9WA 1Y8MA 2Q7FA 3CEQA 3JQ1A 4UWLA 4A3TA 3D9OA 4G26A 3ZEFA 4J8FA 4DPRA 4B0ZA 1QZ2A 2VQ2A 5JJ7A 3LY7A 3FU0A 1LF8A 3D3MA 4W9RA 3I4GA 5DIZA 5G05J 3HVEB 4YNDA 3QB2A 5AYWD 3JCKC 2X6IA 1HG2A 3FTYA 2XPZA 2J08A 4U07A 4JA7A 2CHXA 3D9PA 1FCHA 1H6KA 2AXZA 3CVUA 2FBNA 2PM7A 3GYZA 3ONLA 4YVOA 4EZLA 5EDSA 4XKCA 2X3MA 4R7LA 2PM6A 4GA2A 4OVVA 4XX5A 3MKQB 1UN9A 4JPSA 4FHKA 4PS7A 2PL2A 1QQEA 3MJWA 5LCWJ 3B7SA 3ZPJA 3S7BA 4WNFA 3EHMA 1Z3XA 5FQ8A 3CIAA 3T8MA 2J4DA 3EHNA 4U0ZA 4TUUA 4URKA 3ZW3A 3FUEA 4Q94A 2AVPA 2CG2A 3ZYLA 1OWOA 2I1KA 4FJZA 3ASGA 2ILRA 3FU5A 3LEWA 5CMWA 5KJKA 3MGBA 2FI7A 1B89A 2C0LA 4LRZA 4EECA 4KXKB 3G2TA 4UQXA 4GAAA 5G05C 3C98A 3OXFA 3SNXA 3QK0A 2VGYA 1E8ZA 1L5JA 5BV0A 3TGOA 1FVHA 3G2SA 4EQFA 5JHAA 3ZVVA 4I2WA 3D9JA 4BT9A 4MLPA 3L54A 3PREA 4XZ4A 3S7DA 4ANVA 2XRZA 4N2QA 4CT4A 4NACA 3G2VA 2WVIA 4Y6WA 3TXNA 2X6HA 2VSXE 4U04A 1EPUA 1HG5A 3CR3A 2J09A 1ELRA 3CVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q94 A;  1PY1 A;  3G2U A;  3ZYL A;  2DCP A;  3D9M A;  1HG2 A;  5CMW A;  1UJK A;  2DIW A;  1JWF A;  4GZC A;  3D9P A;  3CLJ A;  1HF8 A;  1H0A A;  1MHQ A;  1INZ A;  3D9L A;  3D9I A;  2LO6 A;  1DVP A;  1ELK A;  3G2T A;  5CMY A;  3ONL A;  1EYH A;  1JUQ A;  4HFG A;  2KM4 A;  2L0I A;  5LP0 A;  4FU3 A;  3LDZ A;  1X5B A;  2BF0 X;  3G2S A;  4FLB A;  2L0T B;  2V8S E;  3D9J A;  4Q96 A;  1EDU A;  1XGW A;  3ONK A;  3ZYQ A;  3ZYM A;  1VDY A;  4JXT A;  3D9N A;  3ZYK A;  2MOW A;  1SZ9 A;  1HFA A;  1UJJ A;  1JWG A;  2QY7 A;  4GZD A;  4NAC A;  1HX8 A;  3D9O A;  3G2V A;  5LOZ A;  3RRU A;  4AVX A;  3G2W A;  5J08 A;  1SZA A;  1HG5 A;  3D9K A;  1LF8 A;  1JPL A; 
#chains in the Genus database with same CATH topology
 3EJN A;  5LCW C;  4JL0 A;  4KZC A;  4XKB A;  2X6J A;  1HF8 A;  1N0Q A;  5CCM A;  3WG7 E;  3VLD A;  4I1A A;  4AVX A;  4B8A A;  1P5Q A;  2R05 A;  2KCK A;  5FQ7 A;  2H6F A;  5CHE E;  1HS6 A;  3P2B A;  2IOL A;  2VGX A;  3PNT B;  3UPV A;  1HZ4 A;  2V0P A;  5EKQ D;  4KMO A;  1N9A A;  3FTX A;  1UOH A;  3SY2 A;  3GZ2 A;  4F6R D;  3CVX A;  2FO1 E;  3DXM G;  2NXP A;  3QNK A;  2J07 A;  4GML A;  3DSU A;  1IQU A;  3CVN A;  3SFX A;  4FC8 A;  1YA0 A;  2XS1 A;  4PUC A;  4YVQ C;  5G04 J;  4WWP A;  5J90 A;  3E37 A;  4J6I A;  2HYZ A;  4EZJ A;  5D0Q D;  3FWV A;  1AWC B;  1EYH A;  1N4Q A;  5FWQ A;  5G2N A;  3E32 A;  2WQH A;  1K3Z D;  2WXG A;  2ZIS A;  4JEU A;  3QKY A;  1H6O A;  1NI1 A;  2WXF A;  1FVF A;  4J8Y A;  1H2U A;  3G2U A;  5E75 A;  1N52 A;  2YQ8 A;  1HU3 A;  4BSZ B;  3LCA A;  3FTW A;  1MZC A;  2EIJ E;  2X38 A;  4AJW A;  4HFG A;  3ABM E;  4MBG A;  4F1S A;  3ZYQ A;  4ATZ D;  4J8D A;  3TWX A;  3V2O A;  4A1S A;  2NSZ A;  3FTS A;  4AEZ C;  3ZKJ A;  4GA1 A;  4IYP A;  4UWG A;  4RG9 A;  5CCL A;  2WQ7 A;  4DX1 A;  1E7V A;  5KJM A;  2L0I A;  4HLE A;  2PZI A;  1X81 A;  2R17 C;  1SQM A;  3ABK E;  3AJI A;  2J8S D;  4FHJ A;  3X2Q E;  2P9N G;  5JJT A;  5ENO D;  3VLE A;  3OXL A;  3RO2 A;  3EIJ A;  3IBE A;  2ZGG A;  1MX4 A;  3BUA A;  3MX3 A;  3QWW A;  4Q96 A;  5T3R A;  1Z3Y A;  2R02 A;  4GU5 A;  2WB2 A;  2EQX A;  1TNU A;  4H7Y A;  5CER B;  2J4B A;  3ULE G;  2LAI A;  1E96 B;  2XEV A;  3PS6 A;  4IN3 B;  3LVR E;  4DX2 A;  4I6E A;  2MHK A;  1OWL A;  4I43 A;  1KT0 A;  4GYY A;  3DSV A;  2XEH A;  3LXU X;  5ITZ F;  5FQ4 A;  4LNB A;  3MYV A;  3QC1 A;  5IY5 E;  2BED A;  3KSL A;  5C2Y A;  4OAU C;  2VYI A;  4CDR A;  2DVW A;  5FJY A;  2XGM A;  3BG1 B;  4BES A;  4NRH B;  4GTP A;  2F8X K;  2GRN B;  2A4Z A;  3TWR A;  2YHC A;  1ZB1 A;  3RRN B;  4DX7 D;  4MRU A;  3K9I A;  3CGH A;  3AU4 A;  3SI5 A;  3GZ1 A;  4F1P A;  4K03 A;  1VDY A;  4HNA D;  4TV3 A;  3Q5M A;  4KBQ A;  1H19 A;  2ZXW E;  4DLO A;  4N5Q A;  4DRX E;  5B1A E;  2FEZ A;  3NOG D;  4A1G A;  3HVE A;  2VGX B;  3HXF A;  2BF0 X;  4I1M A;  5EX3 A;  3EU5 A;  4NQ0 A;  2WXR A;  1OWP A;  4BEP A;  3NZS A;  5A7D B;  2HM8 A;  5KNH D;  3JYS A;  4BFR A;  1WAO 1;  3FH5 A;  4HOR A;  2CG3 A;  1MHQ A;  3FHE A;  2JAB A;  4XIF A;  1SA5 A;  3VLF A;  1TNB A;  3HHM A;  3DRA A;  3N71 A;  3PE4 A;  3L16 A;  3Q15 A;  5AAO A;  3CST A;  4J8E A;  3LJ3 A;  4AY6 A;  5ENQ D;  4A55 A;  3MV3 B;  4BET A;  2IO2 C;  4ILG A;  3W9F A;  1JUQ A;  4WNE A;  3V2X A;  5KJN A;  2R2L A;  2MRI A;  3APC A;  3UM2 A;  2A5U A;  4L1B A;  4C0E A;  4BSX A;  3HDX A;  4HOQ A;  5AQ7 A;  3NZU A;  2KAT A;  4C0M A;  4JZY A;  2A5E A;  3CHP A;  2F37 A;  1NA3 A;  4CEM A;  3Q9U C;  3ASN E;  4GTM A;  4A3T A;  3D9O A;  4G26 A;  1QZ2 A;  2VQ2 A;  1DC2 A;  3D3M A;  5DIZ A;  5ENT D;  3FTY A;  2J08 A;  4U07 A;  2CHX A;  2AXZ A;  3CVU A;  3ONL A;  5EDS A;  5FIN A;  2GRO B;  4LSZ E;  4R7L A;  2PM6 A;  4GA2 A;  4OVV A;  1UN9 A;  4GTV A;  3ZPJ A;  1Z3X A;  5FQ8 A;  3CIA A;  3ZXP A;  2J4D A;  3L82 A;  3ZW3 A;  5CRV A;  2P9U G;  3ULY A;  3B95 A;  3FU5 A;  5CMW A;  3G2T A;  3NB2 A;  4GAA A;  3SNX A;  5BV0 A;  3OXF A;  1IXV A;  2VGY A;  3G2S A;  3ZVV A;  3AG2 E;  1K1B A;  4MLP A;  2V4H C;  1JCR A;  3C3R A;  2WVI A;  2X6H A;  1HG5 A;  5HRY A;  1ELR A;  4GTT A;  1OCC E;  1MQS A;  4B89 A;  5A6C A;  5BT1 A;  3CSF A;  4JHK A;  5LX8 A;  3BQO A;  4BX8 A;  4TXR A;  2LSU A;  2OND A;  1N54 A;  1XGW A;  3RKV A;  3PE3 A;  1O1R A;  4HOU A;  3DST A;  4N39 A;  4ANU A;  3HIZ A;  3G2W A;  3FH8 A;  4CCA A;  1N95 A;  4HOS A;  2YHE A;  1KT1 A;  3ASH A;  3UKU G;  3T8K A;  4AM9 A;  3ML9 A;  2KM4 A;  1QBQ A;  4L23 A;  3SZ7 A;  5ARG A;  3CK9 A;  5M72 A;  5JJ6 A;  2H6I A;  3FTU A;  3FU3 A;  3L08 A;  3B13 A;  1NA0 A;  3I5P A;  5CBN A;  3FUH A;  3HRA A;  4N3C A;  2E2E A;  4V3I A;  3UUX A;  2DBA A;  3CKC A;  1MJ0 A;  4APF A;  3TWQ A;  2F0Y A;  2ETA A;  5A23 A;  2RG8 A;  2J49 A;  1ZU2 A;  2MYO A;  4FUL A;  5EID A;  3S7J A;  2ION A;  4GZ6 A;  4O6F A;  2ZGD A;  3MKR A;  1OCR E;  4K5A B;  5ENN A;  3Q75 A;  2IQC A;  4JXT A;  3C3Q A;  2X6K A;  2EIL E;  1NZN A;  3ZFW A;  3IEG A;  4DX6 D;  5EYL A;  5BW8 C;  1O1T A;  4TRQ A;  4GYO A;  3LVQ E;  1SA4 A;  3B7T A;  3OXG A;  3UX4 A;  4ACL A;  2WQ6 A;  4GCN A;  3FUM A;  3C72 A;  2HO1 A;  2IF4 A;  5HQ8 A;  3U64 A;  1KZP A;  4CDN A;  4ABN A;  2I6H A;  2QZA A;  3FUF A;  4RQI A;  3QWP A;  3FUL A;  3AG4 E;  1E8Y A;  1RZ4 A;  4BTA A;  5ENP D;  1PY1 A;  3ZHE B;  2PQR A;  3Q47 B;  2WXO A;  4WND A;  2C0M A;  4U63 A;  3D9I A;  3JQ0 A;  3MA5 A;  1O1S A;  1MYO A;  5LFA A;  4UQZ A;  3LPZ A;  5EIB E;  4J7W A;  2L6B A;  4I6G A;  3ULQ A;  2VSN A;  2RFA A;  4AY5 A;  1IQR A;  3TWS A;  3AS4 A;  2PQN A;  3BEE A;  4BY6 A;  4UI9 C;  3CLJ A;  1RW2 A;  4BER A;  1DNP A;  4BX9 A;  4AV7 A;  1E7U A;  5C1D A;  2HR2 A;  4RG6 A;  2OVB A;  2V8S E;  4FLH A;  5T8I A;  1TR4 A;  5D66 A;  2VTB B;  3KSQ A;  2L9B A;  5FZS A;  4LER A;  5AJD A;  2Y3A A;  3ENE A;  4FAD A;  3LY9 A;  4GZ5 A;  2WXM A;  4Y6C A;  2OV8 A;  4DUI A;  3SHF A;  5AJL A;  5LP0 A;  4O60 A;  2XZD G;  2AWI A;  3DPD A;  2KBX A;  4FP7 A;  3ISM C;  1S64 A;  2UWJ G;  1OXJ A;  1IYG A;  3NAW A;  5EX0 A;  4K0R A;  2Y1L E;  4GA0 A;  1TJC A;  2NYJ A;  2X6F A;  3OTN A;  4UWF A;  3MCX A;  1X5B A;  3RU0 A;  4C48 B;  3ZN3 A;  3ML8 A;  5AAR A;  2WM9 A;  2P9P G;  2BKK B;  1H2V C;  4U0U A;  3C5R A;  3RO3 A;  4NIK A;  3U4T A;  3I3N A;  3SFY A;  2XQ0 A;  4U96 D;  3PZ3 A;  4EBA G;  5AEN A;  1EDU A;  1OWN A;  3AG3 E;  3PEV B;  1NP7 A;  1UG3 A;  1ZBP A;  3PUJ A;  2ZIR A;  4XEI G;  1A17 A;  2WPV A;  5DBK A;  4JC8 A;  1QNF A;  3FUD A;  3SF4 A;  3CK8 A;  5D0O D;  1HX8 A;  3MV2 B;  3UMV A;  4CZ2 D;  2MOW A;  1N11 A;  3TJP A;  5FIO A;  3FP3 A;  5CMY A;  4JHR A;  3GZS A;  2VJ8 A;  2L0T B;  4A63 B;  1E8X A;  1SZ9 A;  3B7B A;  1WY6 A;  3CK7 A;  3E4B A;  3UM3 A;  2IJG X;  4TXP A;  4RLY A;  4XI9 A;  5BXO A;  3UT8 A;  4K5C A;  4X8Q A;  5AQ9 A;  3UQ3 A;  3L6A A;  3ASO E;  2KZT B;  1N94 A;  5AQB A;  1U3C A;  1TN7 A;  3ZEF A;  1TN6 A;  1TNZ A;  3I4G A;  2DYR E;  3ZUV B;  1LD7 A;  4YVO A;  5LCW J;  3S7B A;  3EHM A;  1BI8 B;  3BU8 A;  3EHN A;  4URK A;  5EYP F;  2CG2 A;  3ZYL A;  1OWO A;  3ASG A;  3R9M A;  5G05 C;  3C98 A;  1L5J A;  4GTR A;  1DCE A;  4XZ4 A;  2XRZ A;  4N2Q A;  3HXB A;  5JA4 D;  2KXP C;  4NAC A;  3UXG A;  2VSX E;  4U04 A;  4K5B A;  2J09 A;  3CVQ A;  3F6Q A;  3LJN A;  4ANW A;  2AW6 A;  4CDM A;  3QAR A;  3TWW A;  4L2Y A;  3EDT B;  4BTB A;  3V79 K;  3PDN A;  4U8H A;  3DBS A;  3CVV A;  3KD7 A;  5ENS D;  5AIJ A;  5EN5 D;  3VTX A;  2XZT G;  2WXL A;  1UW4 B;  2FF4 A;  3U66 A;  4ACK A;  3L13 A;  1TNY A;  3KS2 A;  4HRM B;  1YCS B;  2IEJ A;  3VTY A;  3D9H A;  4HS2 A;  4WWO A;  3JXI A;  4H7X A;  1BLX B;  1MX2 A;  3ASF A;  3CV0 A;  3LDZ A;  4CGV A;  4XE0 A;  3D9N A;  3UT7 A;  5KCM A;  1N4R A;  1H6P A;  3TG4 A;  4FA6 A;  1JPL A;  3ZHE A;  3PH0 C;  1FT2 A;  4L2L A;  2Y4T A;  2GW1 A;  2J9Q A;  3DSS A;  2LAH A;  4HI8 A;  3TL5 A;  3V31 A;  3UTM A;  1WG0 A;  2YNQ A;  2V5Q C;  1KZO A;  4UI9 K;  4M3O A;  2LNI A;  3ZGQ A;  1JCS A;  4N5C A;  1UJK A;  1INZ A;  4WWN A;  5H7P A;  3E33 A;  2XGO A;  4XI0 A;  4N3B A;  3RRM B;  4HRN A;  4UQY A;  2KCV A;  2JLB A;  5BV1 A;  3RIB A;  4KT6 B;  4DI4 A;  2VTB A;  1HFA A;  2OCC E;  2CHW A;  3Q9N C;  3AS8 A;  3BG0 B;  5G04 C;  2GRR B;  3HG0 D;  3ZXS A;  1O5M A;  1OUV A;  1LD8 A;  4LG6 A;  4G2V A;  4FU3 A;  4PS8 A;  4AIF A;  1GW6 A;  1N0R A;  4WNG A;  3DEO A;  3GW4 A;  4YDE A;  3Q7F A;  2I2O A;  3HXC A;  2WXJ A;  2Y0B G;  4F3V A;  2WXK A;  4Q69 A;  1Q2Z A;  3RK6 A;  2CHZ A;  2E0I A;  3QWV A;  4CYM D;  3LKU A;  1SW6 A;  4J0U A;  2F8Y A;  2R5S A;  1YYH A;  4LNG A;  2LUH A;  3PZ4 A;  2CFU A;  5EIL A;  2P9S G;  5HKP A;  1A5E A;  1G3N B;  4JB8 P;  1EF1 C;  4JEH A;  2M63 A;  2UY1 B;  1K1A A;  4GZ3 A;  3EHR A;  3IHV A;  3P1U A;  1UJJ A;  4GZD A;  3TAX A;  4ZFH A;  2AXV A;  1IHG A;  4APO A;  2XCB A;  4LCT A;  5BUZ A;  4TUM A;  4UWH A;  1E90 A;  4OAV B;  3SFZ A;  1QYM A;  2H6H A;  3PVL A;  2RD0 A;  2V4L A;  5B3S E;  1Y6I A;  1BD8 A;  4I17 A;  3NBN B;  3JXJ A;  3KAE A;  5ENR D;  4N2S A;  2EIM E;  2VSO E;  3AS5 A;  2FUL A;  4LUN U;  4I6J A;  4PS3 A;  3FUK A;  2LO6 A;  2BKG A;  1S63 A;  3T9K A;  3IHY A;  3UIO C;  1TN8 A;  3AAA C;  4ATG A;  1UN8 A;  2XPY A;  5FT9 A;  2NC9 A;  3PNL B;  5J08 A;  2HE0 A;  4E6H A;  1KLX A;  2R59 A;  3R7Q A;  3B7R L;  3HXD A;  4IUL A;  4DJA A;  2OEV A;  2XEN A;  1N4P A;  4B8C B;  3CVL A;  5CEC B;  4DX5 D;  2KZT A;  3EIQ C;  4GPM A;  4LNU D;  4HLL A;  4O1P A;  5FZQ A;  3NOC D;  2P9K G;  4AOF A;  1OCO E;  2P2C P;  3AU5 A;  3UIP C;  3UI2 A;  1DVP A;  4P29 A;  2VGE A;  2WMN A;  3J5P A;  3CVP A;  3DSW A;  3KEA A;  2QYJ A;  3IXE A;  3DWL G;  2IU1 A;  4I9C A;  2IO3 C;  4GCO A;  3FEY A;  1H0A A;  2EIN E;  3SBS A;  2KC7 A;  4B93 B;  4KVO A;  3CQG B;  5ARF A;  4F7A A;  3FDH A;  5AN8 A;  3JUI A;  3FFL A;  2YIN A;  4DLQ A;  1Z6T A;  3ZRH A;  3FH7 A;  1BU9 A;  5E76 A;  5HS0 A;  3HXE A;  4D10 C;  3AG1 E;  4ME2 A;  1ELK A;  5CED B;  3Q78 A;  1TJF A;  1HE8 A;  3FEX A;  4HBD A;  5FQ6 A;  3APD A;  2QC9 A;  3RJV A;  2OEW A;  3QDN A;  1OY3 D;  4DK5 A;  2V5F A;  2XRY A;  4GPK A;  1FT1 A;  4HI9 A;  3ESK A;  3Q49 B;  4U95 D;  2XGS A;  5BPP A;  4G1T A;  3QJZ A;  3E30 A;  2B6C A;  3L9T A;  2OVF A;  3NF1 A;  1Y8M A;  3CEQ A;  3JQ1 A;  2IY0 C;  4HQD A;  3TWV A;  4DPR A;  5JJ7 A;  3FU0 A;  1LF8 A;  4W9R A;  4YND A;  3QB2 A;  4GTO A;  2XPZ A;  3D9P A;  1FCH A;  2DYS E;  1H6K A;  2FBN A;  2PM7 A;  3GYZ A;  4U7E B;  4XKC A;  2X3M A;  4XX5 A;  3MKQ B;  4JPS A;  3DSX A;  4FHK A;  2PL2 A;  1QQE A;  3MJW A;  3B7S A;  4WNF A;  3T8M A;  2P9L G;  4U0Z A;  3FUE A;  4Q94 A;  2AVP A;  4JD2 G;  2I1K A;  3LEW A;  1B89 A;  2C0L A;  4LRZ A;  4EEC A;  2EIK E;  3PZ1 A;  4UQX A;  3TGO A;  3QK0 A;  1E8Z A;  1FVH A;  4I2W A;  4BT9 A;  2LXM A;  1OT8 A;  4CT4 A;  4Y6W A;  3TXN A;  3CR3 A;  1PC2 A;  3IV0 A;  3J5Q B;  4KYO B;  2DIW A;  3CHR A;  4G11 A;  3ZIM A;  2WMO A;  4BT8 A;  3DXK G;  3PEU B;  1D9S A;  2XCC A;  5BXU A;  3W9G A;  1E8W A;  2QY7 A;  1JWG A;  4LEU A;  3Q7A A;  1W3B A;  3LY8 A;  3CHS A;  2P58 C;  2DWZ A;  3IKO B;  2GRL A;  4I2Z A;  3O4Z A;  4KZ0 A;  5CBO A;  3TXM A;  1U2V G;  4AXH A;  5ANR A;  1HO8 A;  1XNF A;  3UIN C;  3ASD A;  1AP7 A;  4RVB A;  3FUJ A;  5JHB A;  2DCP A;  3E34 A;  2R03 A;  3RSE G;  1MX6 A;  2XEE A;  3LS8 A;  1KPS B;  4ILH B;  5G55 A;  4JVS A;  2XPI A;  2UY1 A;  1N4S A;  1TYQ G;  2AXU A;  1IKN D;  3ZYM A;  5KBA A;  1H2T C;  3EUV A;  4C9B B;  3CHO A;  3SBT B;  2KCL A;  1JWF A;  1NL4 A;  2OOE A;  5KJL A;  3QAQ A;  2WXQ A;  4TXQ A;  2BTD A;  1ELW A;  3MZL B;  3RRU A;  2H6G A;  2ZU6 B;  3Q79 A;  2ETC A;  2AJA A;  4B94 A;  2WXH A;  3WXX A;  2CFZ A;  3TG5 A;  2Y4U A;  1D8E A;  4UUC A;  4MS6 A;  3PZ2 A;  5KWD A;  4O1O A;  3DEP A;  4JHJ A;  1LTX A;  2GRM A;  4WUY A;  3UM0 A;  4BWR A;  3L22 A;  1TNO A;  4CRW A;  3CVW A;  2QFC A;  1K8K G;  3ESL A;  3PRZ A;  1NFI E;  3I4R B;  2GGF A;  3ABL E;  5AQA A;  3FTV A;  3R9A B;  4N3A A;  1OCZ E;  4I9E A;  4PH4 B;  2GRP B;  4AP2 A;  3ZU7 B;  3SO8 A;  4QFV A;  1Z5S C;  4UI9 J;  4L7T A;  1FPP A;  1WDY A;  3PZD A;  3TWU A;  3LYA A;  3D9K A;  4MKT A;  2BUG A;  4GMJ A;  4GZC A;  3UM1 A;  4G24 A;  4GTQ A;  1OWM A;  3S7F A;  3O48 A;  4EBA A;  4HB5 A;  2RFM A;  4KVM A;  2GRQ B;  4E85 A;  2XHE A;  3HYM B;  4F53 A;  2I1J A;  2L6J A;  3FY4 A;  2LXL A;  4ANX A;  4OYS A;  4GMR A;  3CKB A;  5BNW A;  3FUN A;  4G25 A;  4JW1 A;  1S70 B;  4J8S A;  5LOZ A;  3Q73 A;  4EPZ A;  4HOT A;  2WXN A;  3CHQ A;  4M7C A;  2C2L A;  5FTP A;  3FTZ A;  4U0S A;  3L17 A;  2WXI A;  3URZ A;  4CT0 A;  4JA9 A;  3CVY A;  1U3D A;  3SGH A;  4FLB A;  4I1O B;  3FUI A;  3S2A A;  4A3V A;  3APF A;  4ILI A;  4GYW A;  3PUK A;  4U8V D;  3EHQ A;  1YMP A;  3UKR G;  4G8K A;  3D9L A;  2LSV A;  1TEZ A;  3V30 A;  2B0O E;  1WM5 A;  2P9I G;  3OAW A;  3T5X A;  5FZR A;  1V54 E;  3B7U X;  2FO7 A;  3KEZ A;  3UT4 A;  4ZHB A;  3NQP A;  3QOU A;  3C3O A;  3MKQ A;  1JCQ A;  1BI7 B;  1S0P A;  4DI3 A;  2RKK A;  2XS8 A;  3CQC B;  4OVU A;  3U3W A;  4RSY A;  3CHM A;  3FU6 A;  1IHB A;  4HXI A;  3R7R A;  4FJY A;  4EHM A;  3SQV A;  5ANL A;  3DPY A;  4PDX A;  3ONK A;  2WXP A;  3Q4A B;  3RAU A;  4L9P A;  5CEA A;  2ETB A;  4G8L A;  4CGW A;  1D8D A;  1HXI A;  4UWK A;  2IOS A;  2VSY A;  2IFU A;  2I9C A;  4HVB A;  4EZK A;  3ZYK A;  4YDY A;  4U8Y D;  5T4Y A;  1SZA A;  2PNN A;  1HH8 A;  4YDW A;  3SD5 A;  3D9M A;  4IRU A;  3T5V A;  3MEK A;  4NUR A;  3TWT A;  2JEK A;  1SVX A;  4GB9 A;  1BPO A;  1PAQ A;  5HI7 A;  3U9W A;  2Q7F A;  4UWL A;  4J8F A;  4B0Z A;  3LY7 A;  5JMN D;  5G05 J;  3HVE B;  5AYW D;  3JCK C;  2X6I A;  1HG2 A;  4JA7 A;  2DZO A;  4EZL A;  3ZNG A;  5CRU A;  4PS7 A;  2DZN A;  4HRL A;  4TUU A;  4FJZ A;  2ILR A;  5KJK A;  3MGB A;  4YDO A;  2FI7 A;  4KXK B;  4EQF A;  5JHA A;  3D9J A;  2QYU A;  3L54 A;  3PRE A;  1V55 E;  4QQI A;  5KNG A;  3S7D A;  4ANV A;  1DCQ A;  3JUE A;  4GTS A;  3G2V A;  5B1B E;  2Y69 E;  5D2M C;  1EPU A;  4Z68 A;  3EU9 A;  4G23 A;  4WAF A; 
#chains in the Genus database with same CATH homology
 1PC2 A;  3EJN A;  5LCW C;  1MQS A;  3IV0 A;  4KYO B;  4JL0 A;  4ANW A;  4B89 A;  2AW6 A;  4CDM A;  2DIW A;  4KZC A;  2X6J A;  3CHR A;  4G11 A;  1HF8 A;  3QAR A;  4XKB A;  4L2Y A;  3ZIM A;  5A6C A;  3EDT B;  2WMO A;  4BT8 A;  5BT1 A;  3PEU B;  4BTB A;  3CSF A;  3PDN A;  4JHK A;  5LX8 A;  4U8H A;  3DBS A;  2XCC A;  3KD7 A;  4BX8 A;  5AIJ A;  3CVV A;  5CCM A;  2LSU A;  2OND A;  3VTX A;  1N54 A;  1XGW A;  3RKV A;  3PE3 A;  4HOU A;  2WXL A;  4N39 A;  1E8W A;  1UW4 B;  2QY7 A;  4ANU A;  1JWG A;  2FF4 A;  3VLD A;  4LEU A;  4I1A A;  3HIZ A;  4AVX A;  3G2W A;  3FH8 A;  4B8A A;  1P5Q A;  4CCA A;  3U66 A;  4ACK A;  4HOS A;  2YHE A;  3L13 A;  3KS2 A;  1W3B A;  3LY8 A;  2KCK A;  1KT1 A;  5FQ7 A;  5CHE E;  3ASH A;  3VTY A;  1HS6 A;  3CHS A;  4HS2 A;  4WWO A;  2P58 C;  3P2B A;  3IKO B;  4H7X A;  2IOL A;  2GRL A;  2VGX A;  3ASF A;  3PNT B;  4I2Z A;  4AM9 A;  3CV0 A;  3ML9 A;  3UPV A;  3O4Z A;  4KZ0 A;  2KM4 A;  1HZ4 A;  2V0P A;  3LDZ A;  4L23 A;  5EKQ D;  3SZ7 A;  3TXM A;  4KMO A;  5ARG A;  3CK9 A;  3FTX A;  4CGV A;  5M72 A;  4AXH A;  4XE0 A;  3D9N A;  5ANR A;  1HO8 A;  5JJ6 A;  1XNF A;  3UT7 A;  3GZ2 A;  3CVX A;  5KCM A;  2NXP A;  3ASD A;  3FTU A;  3FU3 A;  3L08 A;  3B13 A;  1NA0 A;  3QNK A;  3TG4 A;  4FA6 A;  2J07 A;  1JPL A;  4RVB A;  3FUJ A;  5JHB A;  3I5P A;  2DCP A;  4GML A;  3PH0 C;  3ZHE A;  1IQU A;  3FUH A;  4L2L A;  4N3C A;  3CVN A;  2E2E A;  2Y4T A;  3LS8 A;  2GW1 A;  4V3I A;  4ILH B;  5G55 A;  3UUX A;  4JVS A;  2J9Q A;  2XPI A;  2UY1 A;  2DBA A;  3CKC A;  4FC8 A;  2AXU A;  2LAH A;  3TL5 A;  1YA0 A;  3ZYM A;  4PUC A;  4APF A;  5A23 A;  2RG8 A;  4YVQ C;  5G04 J;  4WWP A;  2J49 A;  1ZU2 A;  5J90 A;  1H2T C;  2YNQ A;  4FUL A;  4J6I A;  4UI9 K;  2HYZ A;  4EZJ A;  4C9B B;  3CHO A;  4M3O A;  3S7J A;  2LNI A;  2ION A;  3ZGQ A;  4GZ6 A;  5D0Q D;  3SBT B;  3FWV A;  4O6F A;  4N5C A;  2KCL A;  1UJK A;  1JWF A;  1INZ A;  2OOE A;  4WWN A;  1EYH A;  2XGO A;  3MKR A;  5FWQ A;  4XI0 A;  5G2N A;  4N3B A;  2WQH A;  3RRM B;  2WXG A;  5KJL A;  4JEU A;  5ENN A;  3QKY A;  4UQY A;  2KCV A;  2JLB A;  5BV1 A;  3RIB A;  4KT6 B;  3QAQ A;  4DI4 A;  2WXQ A;  2VTB A;  2IQC A;  4JXT A;  2BTD A;  1HFA A;  1ELW A;  3MZL B;  3RRU A;  2WXF A;  2CHW A;  1FVF A;  2X6K A;  2ZU6 B;  1NZN A;  3AS8 A;  4WAF A;  3BG0 B;  1H2U A;  3ZFW A;  3G2U A;  3IEG A;  5E75 A;  4B94 A;  2WXH A;  3WXX A;  5BW8 C;  5G04 C;  1N52 A;  2CFZ A;  3TG5 A;  2Y4U A;  1HU3 A;  2YQ8 A;  3LCA A;  3FTW A;  4TRQ A;  4MS6 A;  3ZXS A;  2X38 A;  4GYO A;  1OUV A;  4AJW A;  4HFG A;  3LVQ E;  4JHJ A;  4G2V A;  4FU3 A;  3B7T A;  3OXG A;  4PS8 A;  3UX4 A;  4F1S A;  2GRM A;  4AIF A;  3ZYQ A;  4WUY A;  1GW6 A;  4BWR A;  3L22 A;  4WNG A;  4ACL A;  2WQ6 A;  4CRW A;  4J8D A;  4GCN A;  4A1S A;  3FUM A;  3CVW A;  2HO1 A;  2NSZ A;  2IF4 A;  2QFC A;  3GW4 A;  5HQ8 A;  3U64 A;  3FTS A;  2I2O A;  3ESL A;  4AEZ C;  3PRZ A;  4GA1 A;  4IYP A;  3I4R B;  4CDN A;  2GGF A;  4UWG A;  4ABN A;  2I6H A;  4RG9 A;  2WXJ A;  5CCL A;  3FTV A;  3R9A B;  3FUF A;  4F3V A;  2WQ7 A;  4N3A A;  2WXK A;  1E7V A;  4Q69 A;  5KJM A;  2L0I A;  3RK6 A;  2PZI A;  4I9E A;  4HLE A;  4PH4 B;  2CHZ A;  3QWP A;  3FUL A;  4AP2 A;  2R17 C;  1SQM A;  2E0I A;  4QFV A;  3QWV A;  3LKU A;  4UI9 J;  4J0U A;  4L7T A;  1E8Y A;  4FHJ A;  2R5S A;  4BTA A;  3PZD A;  3LYA A;  3D9K A;  4MKT A;  2CFU A;  5JJT A;  1PY1 A;  3ZHE B;  2BUG A;  2PQR A;  3VLE A;  3Q47 B;  4GMJ A;  3OXL A;  2WXO A;  4WND A;  4GZC A;  2C0M A;  4U63 A;  3D9I A;  3JQ0 A;  3RO2 A;  3EIJ A;  3MA5 A;  4G24 A;  3IBE A;  1EF1 C;  4JEH A;  1OWM A;  2M63 A;  2UY1 B;  5LFA A;  3S7F A;  3O48 A;  4UQZ A;  3LPZ A;  3MX3 A;  3QWW A;  4GZ3 A;  4Q96 A;  4EBA A;  5T3R A;  4I6G A;  1Z3Y A;  3IHV A;  3P1U A;  4GU5 A;  4KVM A;  3ULQ A;  2WB2 A;  1UJJ A;  4GZD A;  2VSN A;  3TAX A;  4AY5 A;  1IQR A;  2EQX A;  4E85 A;  2XHE A;  3HYM B;  4F53 A;  2I1J A;  2AXV A;  4H7Y A;  1IHG A;  2J4B A;  3AS4 A;  2PQN A;  2LAI A;  1E96 B;  2XEV A;  3BEE A;  4APO A;  2L6J A;  3PS6 A;  3FY4 A;  4IN3 B;  4BY6 A;  2XCB A;  4LCT A;  4UI9 C;  5BUZ A;  3LVR E;  4UWH A;  3CLJ A;  4I6E A;  1E90 A;  1DNP A;  4BX9 A;  2MHK A;  3SFZ A;  4AV7 A;  1OWL A;  1E7U A;  4ANX A;  5C1D A;  2HR2 A;  3PVL A;  2RD0 A;  4OYS A;  2V4L A;  4RG6 A;  2OVB A;  4I43 A;  1KT0 A;  2V8S E;  4FLH A;  1Y6I A;  3CKB A;  4GYY A;  5T8I A;  5BNW A;  2VTB B;  3FUN A;  4G25 A;  2L9B A;  4I17 A;  5FZS A;  4JW1 A;  4J8S A;  4LER A;  5AJD A;  5LOZ A;  3LXU X;  5FQ4 A;  4EPZ A;  3KAE A;  4N2S A;  4HOT A;  4G23 A;  2Y3A A;  2VSO E;  3ENE A;  2WXN A;  2FUL A;  3AS5 A;  3CHQ A;  3MYV A;  3QC1 A;  2C2L A;  4FAD A;  3LY9 A;  4GZ5 A;  4LUN U;  2WXM A;  4Y6C A;  5FTP A;  5C2Y A;  2VYI A;  3FTZ A;  4I6J A;  4PS3 A;  2OV8 A;  2LO6 A;  3FUK A;  4U0S A;  3L17 A;  2WXI A;  3URZ A;  4CT0 A;  4CDR A;  3SHF A;  4JA9 A;  3CVY A;  5FJY A;  1U3D A;  2XGM A;  3BG1 B;  3IHY A;  5AJL A;  3SGH A;  4NRH B;  5LP0 A;  4ATG A;  4FLB A;  4I1O B;  2AWI A;  1UN8 A;  3DPD A;  3FUI A;  2XPY A;  4FP7 A;  3S2A A;  5FT9 A;  2NC9 A;  3PNL B;  4A3V A;  5J08 A;  2A4Z A;  2UWJ G;  3APF A;  4ILI A;  4GYW A;  3PUK A;  2YHC A;  3RRN B;  4MRU A;  4E6H A;  1KLX A;  2R59 A;  1IYG A;  3R7Q A;  3B7R L;  5EX0 A;  4IUL A;  3K9I A;  4GA0 A;  4K0R A;  4DJA A;  3D9L A;  3CGH A;  1TJC A;  4UWF A;  2X6F A;  3AU4 A;  3OTN A;  3SI5 A;  4B8C B;  3CVL A;  2LSV A;  1TEZ A;  3MCX A;  1X5B A;  2KZT A;  3RU0 A;  3GZ1 A;  3EIQ C;  4K03 A;  1WM5 A;  1VDY A;  4TV3 A;  3Q5M A;  4KBQ A;  3ZN3 A;  1H19 A;  3OAW A;  4DLO A;  3ML8 A;  5FZQ A;  3T5X A;  5FZR A;  2WM9 A;  4AOF A;  2FEZ A;  3B7U X;  3AU5 A;  4A1G A;  2FO7 A;  3HVE A;  1H2V C;  3KEZ A;  3UT4 A;  1DVP A;  2VGX B;  4P29 A;  4U0U A;  3RO3 A;  2WMN A;  3NQP A;  3U4T A;  3I3N A;  3QOU A;  2XQ0 A;  2BF0 X;  4EBA G;  3MKQ A;  5AEN A;  1EDU A;  1S0P A;  1OWN A;  3CVP A;  4I1M A;  4NQ0 A;  5EX3 A;  4DI3 A;  3PEV B;  1NP7 A;  2WXR A;  1UG3 A;  1OWP A;  1ZBP A;  3PUJ A;  2IU1 A;  3CQC B;  3NZS A;  4I9C A;  5A7D B;  4OVU A;  3U3W A;  2HM8 A;  4RSY A;  3CHM A;  4GCO A;  3FU6 A;  3JYS A;  3FEY A;  4BFR A;  1WAO 1;  3FH5 A;  4HOR A;  2CG3 A;  1H0A A;  1MHQ A;  3FHE A;  4HXI A;  4XIF A;  1A17 A;  2WPV A;  5DBK A;  3R7R A;  4FJY A;  3SBS A;  2KC7 A;  4JC8 A;  3VLF A;  4KVO A;  3CQG B;  5ANL A;  1QNF A;  5ARF A;  4F7A A;  3FUD A;  4PDX A;  3FDH A;  2WXP A;  3ONK A;  3SF4 A;  3JUI A;  3HHM A;  3FFL A;  3Q4A B;  3CK8 A;  3N71 A;  5D0O D;  1HX8 A;  2YIN A;  3MV2 B;  4DLQ A;  3PE4 A;  3L16 A;  3UMV A;  1Z6T A;  3Q15 A;  3ZRH A;  3FH7 A;  2MOW A;  4CGW A;  3CST A;  4J8E A;  5E76 A;  3TJP A;  3LJ3 A;  4AY6 A;  3FP3 A;  4A55 A;  3MV3 B;  1HXI A;  4D10 C;  4ME2 A;  4ILG A;  1ELK A;  5CMY A;  4UWK A;  1JUQ A;  4WNE A;  5KJN A;  2IOS A;  4JHR A;  1TJF A;  1HE8 A;  2VSY A;  3GZS A;  2IFU A;  2MRI A;  2L0T B;  2VJ8 A;  2I9C A;  3APC A;  3FEX A;  2A5U A;  4L1B A;  5FQ6 A;  1E8X A;  4HVB A;  4EZK A;  3APD A;  3ZYK A;  1SZ9 A;  3RJV A;  4C0E A;  4BSX A;  1WY6 A;  3CK7 A;  3HDX A;  2V5F A;  3QDN A;  4HOQ A;  5T4Y A;  4DK5 A;  2XRY A;  1SZA A;  3E4B A;  4GPK A;  2IJG X;  1HH8 A;  3NZU A;  4XI9 A;  2KAT A;  3ESK A;  3UT8 A;  3SD5 A;  3Q49 B;  3D9M A;  4C0M A;  4IRU A;  4JZY A;  3UQ3 A;  3T5V A;  3MEK A;  3L6A A;  2XGS A;  3CHP A;  4NUR A;  5BPP A;  2JEK A;  1NA3 A;  4GB9 A;  1BPO A;  2KZT B;  4G1T A;  1PAQ A;  5HI7 A;  3QJZ A;  1U3C A;  4CEM A;  2OVF A;  3NF1 A;  3U9W A;  1Y8M A;  2Q7F A;  3CEQ A;  3JQ1 A;  4UWL A;  4A3T A;  3D9O A;  4G26 A;  3ZEF A;  4J8F A;  4DPR A;  4B0Z A;  1QZ2 A;  2VQ2 A;  5JJ7 A;  3LY7 A;  3FU0 A;  1LF8 A;  3D3M A;  4W9R A;  3I4G A;  5DIZ A;  5G05 J;  3HVE B;  4YND A;  3QB2 A;  5AYW D;  3JCK C;  2X6I A;  1HG2 A;  3FTY A;  2XPZ A;  2J08 A;  4U07 A;  4JA7 A;  2CHX A;  3D9P A;  1FCH A;  1H6K A;  2AXZ A;  3CVU A;  2FBN A;  2PM7 A;  3GYZ A;  3ONL A;  4YVO A;  4EZL A;  5EDS A;  4XKC A;  2X3M A;  4R7L A;  2PM6 A;  4GA2 A;  4OVV A;  4XX5 A;  3MKQ B;  1UN9 A;  4JPS A;  4FHK A;  4PS7 A;  2PL2 A;  1QQE A;  3MJW A;  5LCW J;  3B7S A;  3ZPJ A;  3S7B A;  4WNF A;  3EHM A;  1Z3X A;  5FQ8 A;  3CIA A;  3T8M A;  2J4D A;  3EHN A;  4U0Z A;  4TUU A;  4URK A;  3ZW3 A;  3FUE A;  4Q94 A;  2AVP A;  2CG2 A;  3ZYL A;  1OWO A;  2I1K A;  4FJZ A;  3ASG A;  2ILR A;  3FU5 A;  3LEW A;  5CMW A;  5KJK A;  3MGB A;  2FI7 A;  1B89 A;  2C0L A;  4LRZ A;  4EEC A;  4KXK B;  3G2T A;  4UQX A;  4GAA A;  5G05 C;  3C98 A;  3OXF A;  3SNX A;  3QK0 A;  2VGY A;  1E8Z A;  1L5J A;  5BV0 A;  3TGO A;  1FVH A;  3G2S A;  4EQF A;  5JHA A;  3ZVV A;  4I2W A;  3D9J A;  4BT9 A;  4MLP A;  3L54 A;  3PRE A;  4XZ4 A;  3S7D A;  4ANV A;  2XRZ A;  4N2Q A;  4CT4 A;  4NAC A;  3G2V A;  2WVI A;  4Y6W A;  3TXN A;  2X6H A;  2VSX E;  4U04 A;  1EPU A;  1HG5 A;  3CR3 A;  2J09 A;  1ELR A;  3CVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...