1H0AA

Epsin enth bound to ins(1,4,5)p3
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
158
structure length
158
Chain Sequence
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords EPSIN
publication title Curvature of Clathrin-Coated Pits Driven by Epsin
pubmed doi rcsb
source organism Rattus norvegicus
total genus 68
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2002-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1h0aA00
1X5BA 3D9OA 1SZ9A 3ZYKA 5LP0A 1LF8A 2DIWA 2MOWA 3G2SA 5J08A 1UJJA 3G2UA 1SZAA 4GZCA 2LO6A 1JPLA 1MHQA 1UJKA 3G2VA 1EDUA 1DVPA 3RRUA 3D9PA 2V8SE 1JUQA 4GZDA 1HX8A 4NACA 4HFGA 1HF8A 1H0AA 1ELKA 4FU3A 4Q94A 3ZYQA 1HG2A 3ZYLA 5LOZA 1EYHA 2L0TB 3D9LA 4FLBA 1JWFA 1XGWA 4JXTA 4AVXA 3D9MA 1HFAA 2QY7A 3D9IA 2KM4A 3D9JA 3ONKA 5CMWA 3LDZA 1HG5A 1JWGA 3D9NA 1PY1A 2L0IA 1VDYA 3G2WA 3CLJA 3ONLA 5CMYA 2BF0X 3ZYMA 2DCPA 3G2TA 1INZA 3D9KA 4Q96A
chains in the Genus database with same CATH superfamily
4HORA 4H7YA 3HXFA 2IO2C 4B8CB 2XHEA 3MZLB 3FU3A 3Q79A 4KT6B 1OWPA 3TGOA 3PNLB 1QZ2A 4HOUA 1EPUA 2M63A 3ZUVB 2V4HC 3WG7E 3BG1B 4GA0A 4CEMA 5A6CA 4I6GA 3RRMB 4K0RA 5LX8A 3PUJA 4JL0A 4TV3A 2ZGDA 1TNOA 4DRXE 4J8YA 2IOSA 2DZOA 3TAXA 4QQIA 1NA0A 3EHNA 1MX2A 2WXPA 3U4TA 2ETAA 4ANXA 2R02A 2YINA 5ANRA 4JEUA 3ULQA 2WXFA 3UTMA 2MRIA 3HVEA 2QFCA 4JA9A 4G11A 5BT1A 4JHKA 2WXNA 4XIFA 2WMOA 1NA3A 1DNPA 4LUNU 4R7LA 3ZVVA 3NOGD 4N3BA 2PM6A 4I1AA 3G2SA 4CGWA 1UW4B 3HRAA 2I1KA 4GZ6A 5BW8C 4AJWA 1UOHA 3ZW3A 4FJZA 2R2LA 3IKOB 3MKRA 5HI7A 1MYOA 4OAVB 4DJAA 5LP0A 4RSYA 3TL5A 4BY6A 4WWOA 2EIKE 2V0PA 2OV8A 4U0UA 5HS0A 4YVOA 1HF8A 4TUMA 1SQMA 2H6GA 4CRWA 1PC2A 4EPZA 3O4ZA 4IN3B 4EZKA 4U0SA 5EYLA 4UWLA 3IEGA 1WG0A 1OWNA 3UXGA 4CDNA 3PE4A 4KXKB 1Z3XA 4YVQC 2IOLA 4JEHA 3ZU7B 3ASNE 5CBOA 1OCCE 5BUZA 3CKCA 4NIKA 5ENSD 3CQCB 3FH8A 2WXQA 1XNFA 4PS8A 1Y8MA 5ANLA 3CK9A 5ENRD 2VTBB 3L22A 3CVWA 2Y3AA 3K9IA 4MKTA 1KPSB 2R59A 4HBDA 2WB2A 2LAHA 4HVBA 4V3IA 2FO7A 4G2VA 3GZ1A 3ZYQA 3D9LA 2YQ8A 4LRZA 1H6KA 3GZ2A 3P1UA 3V2XA 1QQEA 3PE3A 4I6JA 3S7JA 4BSXA 1SVXA 3OTNA 3NAWA 2WPVA 1FT1A 2R5SA 3L54A 4J8EA 3OAWA 3S7BA 4F3VA 4KVOA 3R9MA 3UM1A 4CDRA 3I5PA 3JXIA 2ETCA 1IQRA 3ULEG 4I9CA 4NQ0A 3QWVA 5AIJA 4WUYA 3UT8A 3MEKA 1S0PA 5CCLA 5LFAA 4F1PA 3PVLA 2VGXA 3ZYKA 2AXZA 3FDHA 3DWLG 3UQ3A 2YHEA 4L1BA 4URKA 3E30A 3Q7FA 3TWTA 2XS8A 3L08A 3T9KA 1XGWA 1OCZE 3CHSA 5JJTA 3DSXA 4WNEA 3LS8A 3KEZA 2KZTB 1N0RA 2XGMA 2QC9A 4CYMD 4K5AB 1E8WA 3ZIMA 3LEWA 3B95A 4JB8P 2GRRB 2KXPC 4P29A 1N95A 3RJVA 2RG8A 1X81A 4J8SA 2GRPB 2QZAA 4AOFA 2IJGX 4O1OA 2Y69E 5BXUA 3FU5A 1UN8A 2V4LA 2LXLA 2RFMA 3LJ3A 3PZDA 4G1TA 3PEUB 2WXRA 4TXQA 3U66A 4ATGA 4A63B 3SFZA 3CHQA 5ENQD 3CK7A 2HYZA 2GRQB 3JYSA 3G2TA 3FFLA 4HB5A 3R9AB 4DPRA 4U07A 3RRUA 3ZXSA 3SBTB 2CFZA 2FF4A 4N2SA 3ESLA 1WM5A 4GTOA 4J8FA 1S64A 4DI4A 3BQOA 4HNAD 4C0MA 4ZFHA 3CGHA 3UT4A 5H7PA 3FUDA 1N4QA 3IV0A 5AENA 2XPZA 4LNUD 4OVVA 3SY2A 2XRZA 2MOWA 2DZNA 2CHXA 1KZPA 3Q49B 3QNKA 4BSZB 4TUUA 3EIJA 3KEAA 5KNGA 1IQUA 1D8EA 2RD0A 3B7UX 3FTUA 1HE8A 2L9BA 2PL2A 3DSTA 3HVEB 2F8YA 3B7TA 3LVQE 3FH7A 3KS2A 4HXIA 4G24A 3PDNA 4DX2A 3SBSA 3FU6A 2MYOA 4Y6CA 3FTZA 4GU5A 3UMVA 4ACLA 2WMNA 3SHFA 4JVSA 4WNDA 2LO6A 1MHQA 3ASDA 2VGEA 4LSZE 4U96D 3T5XA 4GTTA 4H7XA 3LJNA 2EIME 3ABKE 2QYJA 3LVRE 1BI7B 1N4SA 2OEVA 1TN6A 1H6PA 1H2UA 2X6IA 2XZDG 4K5CA 4XKBA 1Z3YA 1E8YA 1LTXA 4PH4B 3FTYA 3L13A 3UPVA 3AS8A 1NP7A 1LD7A 2AW6A 3B13A 3U64A 4ANWA 3FU0A 3UIPC 4J6IA 1BD8A 4IYPA 3ESKA 3GYZA 3TG5A 2GRMA 2VSYA 5EDSA 2OVBA 3G2VA 3E37A 3FUEA 4UI9K 1FT2A 3C72A 3QDNA 1MJ0A 1E8XA 5FTPA 5CECB 4O1PA 4AM9A 2ZU6B 2JLBA 3CVPA 2A5EA 1INZA 2WXIA 3SZ7A 5CEAA 1MX4A 4K03A 3X2QE 4GZDA 3B7BA 4JHRA 1U2VG 2XGSA 3R7QA 2I9CA 3MCXA 3I4RB 1DCQA 5KJLA 3D9JA 2VGXB 5AARA 3TG4A 4YNDA 1WAO1 3VLEA 3ML9A 3PZ1A 3J5PA 4KBQA 3ZN3A 1V54E 5D0OD 4G26A 2DVWA 3SD5A 4U95D 2XEEA 4F1SA 4FHJA 3HG0D 1E7UA 5CBNA 2LNIA 4HLLA 4HRMB 3NQPA 3ULYA 5HQ8A 4KYOB 3TWQA 3URZA 5BXOA 5ENPD 3W9FA 3C98A 3CSFA 4AP2A 4AXHA 5G05J 1PY1A 3ASHA 4FA6A 4KVMA 4GZ5A 1KT0A 5G04J 4L2LA 4U0ZA 3UINC 4BWRA 1TNYA 1SA4A 4WWNA 2UY1A 3FTSA 4XI0A 3E4BA 5AJLA 2WQ6A 3L6AA 4CDMA 3FHEA 1Z6TA 4GMLA 1FVFA 2HE0A 1TYQG 1TNZA 2GGFA 3HYMB 4A1SA 3TXNA 3PEVB 3SFYA 1N11A 5AQBA 4U7EB 3DSUA 4GTQA 4HOTA 3ZNGA 4JW1A 2L6BA 4WWPA 2HM8A 2XGOA 5CMWA 3CQGB 2IF4A 2LSVA 5AQAA 2J09A 3LY9A 3LCAA 3FY4A 2I1JA 5FQ8A 1U3DA 2RFAA 5JJ6A 2H6IA 3R7RA 2X6FA 1H0AA 4AY6A 3C3QA 3AS5A 4BX8A 1JCSA 4EECA 3DEOA 3G2UA 3Q75A 4GTSA 3JQ1A 4HFGA 2LUHA 4B94A 1EYHA 3DXKG 3CEQA 3CHOA 2P58C 4C48B 2WXLA 5ITZF 4I2ZA 2XEHA 3BUAA 4DX1A 5E75A 2IFUA 4GA2A 1AWCB 4GZCA 3APFA 3RIBA 2V8SE 2X38A 3EU9A 2J49A 5T3RA 1O1TA 2QY7A 1TJFA 2YHCA 4TRQA 1QYMA 2Y4TA 3V2OA 3FUJA 4LERA 5A7DB 1JCRA 4BESA 4DLQA 3JUEA 2P9IG 2XS1A 2WQHA 1EDUA 4EZJA 4Q94A 3CVLA 3UX4A 4CCAA 5KJMA 3D9NA 3MKQA 4YDWA 4BTAA 3CLJA 3PS6A 3PRZA 4GTVA 4Q96A 4L2YA 4JC8A 3GW4A 1S63A 5FIOA 1JPLA 3AU4A 1HU3A 1DVPA 4ME2A 2FBNA 3NB2A 1OWMA 1IHGA 4HI9A 2XQ0A 2X3MA 5EX3A 1TEZA 3D9MA 4HS2A 2KM4A 4FHKA 1B89A 4I6EA 4U8VD 2VSXE 2HR2A 4N39A 1HO8A 4DUIA 2E0IA 2B0OE 3C3OA 1ELKA 1OXJA 5CEDB 4JXTA 3VTYA 1L5JA 3S7DA 3L16A 3TWVA 4UWHA 3UM3A 1ZBPA 2PQNA 3MV3B 2E2EA 4D10C 4A3VA 1H2TC 3EUVA 2Y4UA 2BUGA 4NRHB 3T8MA 3N71A 4FU3A 1JWFA 1N4RA 1RZ4A 2RKKA 4U8HA 3MJWA 5ARFA 2OOEA 3DBSA 4AV7A 3S2AA 1E90A 3OXLA 4X8QA 2XPYA 3SGHA 3U3WA 3DEPA 4WNGA 4BT9A 4PS7A 3P2BA 1UG3A 4YDOA 4I9EA 3MA5A 3PZ2A 3ASFA 3FUMA 1YA0A 3QC1A 4G8KA 3AG1E 2DCPA 1W3BA 2DWZA 3FUIA 3FUHA 1TR4A 1SW6A 1IYGA 1FPPA 3IBEA 3B7RL 1U3CA 3ZYLA 4DX7D 4B93B 3BG0B 4KZ0A 3RAUA 1HFAA 3D9IA 3LDZA 2ZXWE 3J5QB 3ZXPA 3JXJA 3OXFA 5CRVA 4GTPA 5BPPA 1SZAA 3KD7A 4MRUA 4RLYA 2P9LG 4ANUA 3EIQC 3I3NA 3RSEG 4M3OA 2R03A 2DBAA 2UY1B 4I1MA 3ABME 1O1RA 2WVIA 3ZGQA 3E32A 4NACA 4AEZC 3SNXA 3JQ0A 1LD8A 3TWUA 4BT8A 3UI2A 4E6HA 4UWFA 2PQRA 4B8AA 3UM0A 2GRNB 3Q5MA 1TN7A 2P9PG 2CHWA 5T8IA 3UIOC 5AN8A 4RVBA 5G05C 3ZHEA 2VJ8A 4FLHA 1JWGA 3NF1A 3TWXA 5FZSA 1A17A 4FULA 1O5MA 5G04C 4UI9J 4UUCA 4WNFA 3UKUG 1UJJA 3B7SA 4HRLA 3LXUX 2Q7FA 1N54A 3FUFA 2LSUA 4I43A 3FTXA 3PUKA 1P5QA 1UN9A 4A3TA 5G55A 4HOQA 2EIJE 3HHMA 2PM7A 3PNTB 3DSSA 2P9NG 4LNBA 1A5EA 1V55E 3EDTB 2J08A 1HG2A 2YNQA 2JABA 1S70B 4HQDA 3NBNB 1DCEA 3ONLA 2JEKA 3ZYMA 4APOA 1X5BA 4RG6A 4AY5A 2VGYA 5FJYA 2F0YA 4TXRA 2GROB 2H6HA 1UJKA 4U04A 3IHYA 4N3AA 4GMRA 5J90A 1HX8A 2UWJG 3WXXA 1O1SA 4A55A 2IEJA 5AQ7A 1IHBA 3T5VA 2H6FA 3PZ4A 1YYHA 5FZQA 3EHQA 3ZEFA 3FWVA 4FJYA 1JUQA 4M7CA 3RO2A 3NZSA 2J4DA 2L6JA 4EBAA 3MKQB 5KCMA 3ZRHA 2XENA 1SZ9A 2Y1LE 4BERA 3QOUA 1TNBA 1MX6A 2R17C 1D8DA 3D9PA 3E33A 5BV1A 2P2CP 4DI3A 4IRUA 3FEYA 2KCKA 3UUXA 4LNGA 1ELRA 4XZ4A 5EILA 2WXJA 2CG3A 4U8YD 4GTMA 3ML8A 2NYJA 1QBQA 3ENEA 1K1BA 4I2WA 4JD2G 1WDYA 4BFRA 3EU5A 2F37A 3RU0A 3NZUA 3ONKA 4C9BB 2XEVA 2J8SD 3AJIA 3L9TA 4WAFA 1YCSB 2BTDA 4J0UA 5EYPF 5G2NA 1N0QA 5AQ9A 5ENTD 4GB9A 4LEUA 3W9GA 2CHZA 2LAIA 3FTVA 1AP7A 4GMJA 1D9SA 1E8ZA 5B3SE 4GYOA 3D9HA 3AG4E 2GRLA 1NI1A 3EHRA 3MYVA 4G8LA 4DX6D 3F6QA 2FO1E 3I4GA 3PREA 4L9PA 1ZU2A 4W9RA 3DPYA 1E7VA 3SQVA 3Q9UC 3MX3A 3GZSA 3CK8A 3C5RA 3EHMA 3QWWA 1N52A 4G23A 4CT4A 2I6HA 1OCRE 5FZRA 3IHVA 4HLEA 5C2YA 3CVQA 3E34A 3L82A 4F6RD 2ZIRA 3DRAA 3Q73A 4UWGA 1MQSA 3APDA 2IY0C 4RG9A 1NZNA 3DXMG 3RK6A 2GW1A 4BX9A 3TWSA 5AJDA 2OVFA 4ANVA 1G3NB 3MGBA 1NL4A 1BI8B 3Q15A 2BKGA 1OT8A 1ZB1A 3RKVA 4B89A 3D9KA 4XE0A 1H6OA 1E96B 5FQ6A 3FUKA 1PAQA 4GZ3A 4N2QA 5HKPA 3VLDA 5HRYA 5JA4D 4CGVA 3Q9NC 3IXEA 2BKKB 2EILE 1BLXB 3DPDA 2ILRA 4RQIA 3ABLE 2IU1A 5D2MC 2F8XK 5ENNA 1HH8A 3D3MA 4JHJA 4PS3A 2VSOE 4IULA 3ZHEB 5FWQA 1OUVA 1N4PA 2NC9A 2P9SG 3Q4AB 4OVUA 4BTBA 3ISMC 4ILIA 5CMYA 3HXBA 3Q7AA 3EJNA 2B6CA 2XCBA 2VQ2A 4UQXA 1TJCA 2LXMA 4ILHB 3HXCA 1RW2A 3Q78A 4BETA 3CHRA 3OXGA 4OAUC 2WXKA 1Z5SC 2CG2A 4MS6A 5E76A 3CVYA 2DIWA 2PNNA 4FADA 4N5QA 2EINE 3MV2B 4O6FA 3QJZA 4GTRA 2FI7A 4HI8A 2DYSE 4L23A 2XZTG 2AJAA 1Y6IA 2NSZA 4DX5D 2PZIA 2ETBA 2OEWA 3G2WA 4NURA 1H19A 4UI9C 4JPSA 3HXDA 2AXVA 4Q69A 2WXHA 3QWPA 4XX5A 5KJKA 4GCNA 3JUIA 1KZOA 5CHEE 1FVHA 4EHMA 3JCKC 1FCHA 4A1GA 4CT0A 5M72A 4O60A 2FEZA 2AXUA 3AG3E 1LF8A 3CSTA 3RO3A 3TXMA 2XCCA 1HS6A 2FULA 3UM2A 4C0EA 3KSLA 1ELWA 5BNWA 2VYIA 2AVPA 5JMND 1Q2ZA 4E85A 1YMPA 2L0IA 3CVXA 4DK5A 2P9UG 4K5BA 4XEIG 2J9QA 4L7TA 4MBGA 2HO1A 4N3CA 2V5QC 2IONA 2X6KA 2C2LA 4ZHBA 1K8KG 1OCOE 4ILGA 2KC7A 2OCCE 5KJNA 3U9WA 4JZYA 2KCLA 2AWIA 3FH5A 3FEXA 5JJ7A 4GYYA 1QNFA 5D0QD 4B0ZA 1SA5A 1MZCA 3SI5A 2V5FA 2NXPA 4ACKA 4FC8A 2DYRE 2VSNA 3NOCD 5LCWC 4LCTA 4F53A 3CKBA 3HXEA 4QFVA 5KNHD 3Q47B 2ZGGA 4DLOA 3CHMA 4J8DA 1BPOA 5ARGA 3KAEA 4KZCA 1HG5A 3HIZA 2ONDA 3VTXA 1DC2A 3PH0C 3V30A 2WXGA 4HRNA 4GPMA 2WXMA 4I17A 5FQ7A 3RRNB 2IQCA 1KT1A 3FP3A 5B1AE 3HDXA 5CCMA 2KBXA 5FINA 3S7FA 1N94A 5EIBE 5CRUA 4G25A 3PZ3A 2C0LA 4APFA 1HXIA 5EIDA 2WQ7A 3VLFA 3BEEA 2L0TB 4Y6WA 5FQ4A 3V31A 3APCA 3AAAC 4F7AA 3KSQA 2WXOA 2BF0X 4AVXA 1HZ4A 1IKND 5B1BE 3CVVA 3CHPA 4HOSA 3TJPA 5LOZA 3AS4A 2J07A 3C3RA 4OYSA 1N9AA 4EBAG 3QK0A 5C1DA 5JHAA 4TXPA 4GPKA 4UQYA 4EZLA 5CERB 2VTBA 1NFIE 3ZKJA 4GCOA 3TWWA 1GW6A 1K1AA 5DBKA 1OWOA 5EKQD 5KBAA 3ZFWA 1BU9A 4KMOA 4GYWA 2XRYA 4XI9A 3LPZA 4ATZD 1IXVA 4CZ2D 2CFUA 1KLXA 2J4BA 3O48A 2XPIA 3AU5A 1TN8A 4XKCA 5ENOD 5FT9A 3LKUA 4GA1A 2MHKA 3FUNA 5D66A 2BEDA 4BEPA 3D9OA 4UQZA 3L17A 4GAAA 3ASOE 3UKRG 2X6JA 3FULA 5BV0A 3QKYA 4UWKA 1VDYA 1H2VC 5DIZA 3CR3A 2C0MA 3DSWA 3CIAA 3SO8A 4LG6A 2KZTA 3FTWA 2A4ZA 3ZPJA 1EF1C 5LCWJ 3SF4A 3QAQA 1OWLA 3AG2E 3DSVA 3CV0A 2R05A 3CVUA 3BU8A 3T8KA 3V79K 2Y0BG 3QARA 4EQFA 4MLPA 4N5CA 1WY6A 4FP7A 1JCQA 5J08A 5JHBA 4YDYA 4YDEA 4PDXA 4J7WA 2A5UA 2I2OA 1TNUA 4AIFA 4U63A 2P9KG 5A23A 2X6HA 3CVNA 3QB2A 2EQXA 3SFXA 4Z68A 5AYWD 3UT7A 5KWDA 2KATA 4I1OB 5IY5E 5AAOA 3ASGA 2WM9A 4ABNA 3LY7A 2QYUA 1OY3D 3TWRA 3LY8A 2KCVA 4FLBA 3LYAA 1K3ZD 5EX0A 2IO3C 4JA7A 5EN5D 4PUCA 2ZISA 5T4YA
chains in the Genus database with same CATH topology
4HORA 2XCBA 4H7YA 2VQ2A 4UQXA 3FUHA 3LVRE 1TJCA 4ILHB 1IYGA 4B8CB 2XHEA 3MZLB 3IBEA 3B7RL 3FU3A 4KT6B 1OWPA 1U3CA 1H2UA 3ZYLA 3BG0B 2X6IA 3PNLB 1QZ2A 3CHRA 1EPUA 2M63A 3OXGA 4HOUA 4KZ0A 3TGOA 1HFAA 3D9IA 2WXKA 3BG1B 4GA0A 4XKBA 4CEMA 5A6CA 3LDZA 4I6GA 3RRMB 4K0RA 1Z3YA 5LX8A 3PUJA 4JL0A 2CG2A 4MS6A 4TV3A 5E76A 3CVYA 1E8YA 2DIWA 3OXFA 2IOSA 4FADA 5BPPA 4PH4B 1SZAA 3FTYA 3KD7A 3MV2B 3L13A 4MRUA 4O6FA 3AS8A 3QJZA 3TAXA 3UPVA 1NP7A 1NA0A 2AW6A 2FI7A 3EHNA 3B13A 4ANUA 4L23A 3U64A 4ANWA 2WXPA 3FU0A 1Y6IA 2NSZA 3EIQC 4J6IA 3U4TA 2PZIA 3I3NA 4ANXA 4IYPA 3ESKA 4M3OA 3G2WA 2YINA 3GYZA 5ANRA 4NURA 4JEUA 1H19A 4UI9C 3TG5A 4JPSA 3ULQA 2DBAA 2GRMA 2VSYA 5EDSA 2AXVA 2WXFA 2MRIA 2UY1B 3HVEA 4I1MA 4Q69A 2WXHA 3QWPA 4XX5A 2QFCA 2OVBA 4JA9A 2WVIA 3G2VA 3FUEA 4UI9K 3ZGQA 4G11A 5BT1A 4JHKA 2WXNA 3QDNA 4NACA 4XIFA 4AEZC 5KJKA 4GCNA 3SNXA 3JUIA 3JQ0A 5CHEE 1FVHA 1E8XA 5FTPA 4AM9A 4BT8A 2WMOA 1NA3A 2ZU6B 4E6HA 1DNPA 2JLBA 3JCKC 3CVPA 1FCHA 4LUNU 4UWFA 4R7LA 3ZVVA 4A1GA 1INZA 2PQRA 4B8AA 4CT0A 2FEZA 5M72A 2AXUA 2WXIA 4N3BA 2PM6A 3Q5MA 4I1AA 1LF8A 3G2SA 4CGWA 3SZ7A 3CSTA 1UW4B 3RO3A 3TXMA 2I1KA 2XCCA 4GZ6A 1HS6A 2FULA 4K03A 5BW8C 2CHWA 4GZDA 4AJWA 4C0EA 5T8IA 4JHRA 2XGSA 3R7QA 1ELWA 3ZW3A 2I9CA 3MCXA 2VYIA 3I4RB 4FJZA 4RVBA 5G05C 3ZHEA 3IKOB 2VJ8A 5BNWA 5KJLA 3D9JA 2AVPA 2VGXB 4FLHA 3TG4A 4E85A 4YNDA 1WAO1 1JWGA 3MKRA 5HI7A 3VLEA 2L0IA 3NF1A 3CVXA 5FZSA 1A17A 3ML9A 4DK5A 4DJAA 4FULA 5G04C 5LP0A 4RSYA 3TL5A 4BY6A 4UI9J 4WNFA 4WWOA 4KBQA 1UJJA 3ZN3A 2V0PA 3B7SA 2J9QA 2OV8A 4U0UA 3LXUX 4L7TA 2HO1A 4N3CA 2IONA 5D0OD 2X6KA 4G26A 3SD5A 2C2LA 2Q7FA 4YVOA 1HF8A 1N54A 3FUFA 1SQMA 2LSUA 4CRWA 4I43A 4F1SA 3FTXA 1PC2A 3PUKA 4FHJA 1P5QA 1UN9A 4EPZA 3O4ZA 4ILGA 2KC7A 4A3TA 5KJNA 3U9WA 1E7UA 4JZYA 5G55A 4IN3B 4EZKA 4HOQA 2LNIA 4U0SA 2KCLA 4UWLA 3IEGA 3HHMA 1OWNA 2PM7A 3PNTB 3NQPA 5HQ8A 4KYOB 4CDNA 2AWIA 3FH5A 3PE4A 4KXKB 3URZA 1Z3XA 4YVQC 2IOLA 4JEHA 3FEXA 5JJ7A 4GYYA 3EDTB 1QNFA 2J08A 3CKCA 5BUZA 3CQCB 1HG2A 5D0QD 4B0ZA 3C98A 3FH8A 2YNQA 2WXQA 1XNFA 3CSFA 3SI5A 2V5FA 4AP2A 4AXHA 4PS8A 2NXPA 5G05J 4ACKA 4FC8A 1Y8MA 1PY1A 3ASHA 3ONLA 2JEKA 5ANLA 4FA6A 3CK9A 2VSNA 4KVMA 3ZYMA 4APOA 2VTBB 3L22A 1X5BA 4GZ5A 4RG6A 5LCWC 3CVWA 4LCTA 2Y3AA 3K9IA 4MKTA 4AY5A 4F53A 3CKBA 2R59A 1KT0A 2VGYA 4L2LA 4U0ZA 5FJYA 5G04J 4BWRA 2WB2A 4QFVA 2LAHA 4HVBA 3Q47B 1UJKA 2UY1A 2FO7A 4U04A 4V3IA 3IHYA 3FTSA 4N3AA 4WWNA 4DLOA 3CHMA 5J90A 1HX8A 4J8DA 4XI0A 4G2VA 3E4BA 3GZ1A 5AJLA 3ZYQA 2WQ6A 2UWJG 3WXXA 3L6AA 1BPOA 4CDMA 5ARGA 3KAEA 3D9LA 2YQ8A 3FHEA 4A55A 1Z6TA 4LRZA 4KZCA 1H6KA 4GMLA 1FVFA 3GZ2A 3T5VA 3P1UA 1HG5A 3HIZA 2ONDA 1QQEA 3PE3A 4I6JA 3S7JA 5FZQA 4BSXA 3VTXA 3OTNA 3ZEFA 3FWVA 2WPVA 3HYMB 2GGFA 4A1SA 3TXNA 4FJYA 3PH0C 3PEVB 2R5SA 3L54A 4J8EA 2WXGA 3OAWA 3S7BA 4F3VA 4KVOA 1JUQA 4CDRA 2WXMA 3NZSA 2J4DA 3I5PA 4I17A 5FQ7A 2L6JA 3RO2A 3RRNB 4HOTA 1IQRA 4JW1A 4I9CA 2IQCA 1KT1A 3MKQB 4NQ0A 4EBAA 5KCMA 4WWPA 2HM8A 2XGOA 5CMWA 3FP3A 3QWVA 5AIJA 3CQGB 4WUYA 3HDXA 3UT8A 3ZRHA 5CCMA 2IF4A 1S0PA 3MEKA 5CCLA 5LFAA 2LSVA 3PVLA 2VGXA 3S7FA 2J09A 3LY9A 3LCAA 1SZ9A 3ZYKA 2AXZA 3FDHA 3FY4A 3UQ3A 2I1JA 4G25A 5FQ8A 1U3DA 2YHEA 4L1BA 4URKA 3QOUA 2C0LA 2R17C 4APFA 5JJ6A 3R7RA 1HXIA 3D9PA 2X6FA 2WQ7A 1H0AA 3VLFA 5BV1A 4DI3A 3BEEA 2L0TB 3L08A 4IRUA 4AY6A 1XGWA 4Y6WA 5FQ4A 3CHSA 3FEYA 2DCPA 2KCKA 3APCA 4F7AA 3UUXA 5JJTA 3AS5A 4WNEA 2WXOA 3LS8A 3KEZA 2KZTB 1ELRA 2BF0X 4XZ4A 4AVXA 2XGMA 4BX8A 2WXJA 1HZ4A 2CG3A 4EECA 3G2UA 3ML8A 3CVVA 3CHPA 4HOSA 3ENEA 1E8WA 3JQ1A 4HFGA 4I2WA 3TJPA 3ZIMA 4B94A 3LEWA 5LOZA 1EYHA 3AS4A 4BFRA 2J07A 3RU0A 3CEQA 4P29A 3NZUA 3CHOA 2P58C 3ONKA 4OYSA 4C9BB 2XEVA 2WXLA 2RG8A 3RJVA 4EBAG 4J8SA 3QK0A 4WAFA 5C1DA 5JHAA 2BTDA 4J0UA 4I2ZA 4AOFA 2IJGX 5E75A 4GPKA 5G2NA 4UQYA 3FU5A 2IFUA 4EZLA 2VTBA 4GA2A 1UN8A 2V4LA 4GZCA 4GB9A 3APFA 4LEUA 3LJ3A 3RIBA 3PZDA 2V8SE 4G1TA 3PEUB 2WXRA 2CHZA 2LAIA 2X38A 3FTVA 4GMJA 3U66A 1E8ZA 4GCOA 4ATGA 4GYOA 3SFZA 1GW6A 2J49A 5T3RA 2GRLA 5DBKA 2QY7A 1TJFA 3CHQA 1OWOA 3CK7A 2HYZA 2YHCA 4TRQA 5EKQD 2Y4TA 3ZFWA 3JYSA 4KMOA 3G2TA 3MYVA 3FFLA 3FUJA 4GYWA 4LERA 2XRYA 4XI9A 3LPZA 5A7DB 3I4GA 4DLQA 3PREA 1ZU2A 2CFUA 3R9AB 1KLXA 4W9RA 2J4BA 4DPRA 1E7VA 2WQHA 3O48A 1EDUA 4U07A 3RRUA 2XPIA 3AU5A 4EZJA 3ZXSA 3SBTB 3MX3A 3GZSA 3CK8A 4Q94A 4XKCA 3CVLA 5FT9A 3EHMA 3LKUA 3QWWA 1N52A 2CFZA 2FF4A 4N2SA 3ESLA 4G23A 2MHKA 4GA1A 4CT4A 3UX4A 2I6HA 4CCAA 3D9NA 3FUNA 5KJMA 1WM5A 3MKQA 5FZRA 3IHVA 4BTAA 3CLJA 4HLEA 3PS6A 3PRZA 5C2YA 3CVQA 4Q96A 3D9OA 4L2YA 4JC8A 3GW4A 4J8FA 4UQZA 3L17A 4DI4A 1JPLA 3AU4A 1HU3A 4GAAA 1DVPA 4UWGA 4ME2A 1MQSA 2FBNA 1OWMA 1IHGA 3APDA 2XQ0A 2X6JA 2X3MA 3FULA 4RG9A 5EX3A 4C0MA 1TEZA 3CGHA 3UT4A 3D9MA 5BV0A 3QKYA 4HS2A 1NZNA 2KM4A 4FHKA 4UWKA 3RK6A 3FUDA 3IV0A 1VDYA 5AENA 2GW1A 1H2VC 5DIZA 1B89A 2XPZA 2C0MA 3CR3A 4BX9A 4I6EA 4OVVA 3CIAA 2VSXE 2HR2A 2KZTA 3FTWA 2A4ZA 4N39A 2XRZA 2MOWA 1HO8A 1EF1C 3ZPJA 5AJDA 2OVFA 4ANVA 5LCWJ 2E0IA 3MGBA 3SF4A 2CHXA 3Q15A 3QAQA 3Q49B 1OWLA 3QNKA 1ELKA 4TUUA 3CV0A 3EIJA 4JXTA 3CVUA 1IQUA 2RD0A 3B7UX 3FTUA 1HE8A 2L9BA 2PL2A 3QARA 3RKVA 4EQFA 4MLPA 3VTYA 3HVEB 4N5CA 4B89A 3D9KA 1L5JA 1WY6A 4XE0A 3S7DA 4FP7A 3L16A 3B7TA 3LVQE 1E96B 4UWHA 5J08A 5JHBA 1ZBPA 2PQNA 3MV3B 5FQ6A 2E2EA 4D10C 4PDXA 4A3VA 1H2TC 3FH7A 2A5UA 1PAQA 2I2OA 3FUKA 3KS2A 4GZ3A 2Y4UA 4HXIA 3VLDA 2BUGA 4N2QA 4G24A 3PDNA 4NRHB 3T8MA 4AIFA 3N71A 4FU3A 4U63A 3SBSA 4CGVA 1JWFA 5A23A 2X6HA 3FU6A 3CVNA 4U8HA 3QB2A 3MJWA 2EQXA 4Y6CA 5ARFA 5AYWD 2OOEA 3DPDA 3FTZA 2ILRA 4GU5A 3UMVA 2IU1A 3DBSA 4ACLA 3UT7A 2WMNA 3S2AA 4AV7A 5ENNA 3SHFA 4JVSA 1E90A 3OXLA 2KATA 1HH8A 4I1OB 4WNDA 2LO6A 2XPYA 3D3MA 4JHJA 1MHQA 3SGHA 4PS3A 3ASDA 3ASGA 2WM9A 4ABNA 3LY7A 2VSOE 3U3WA 4IULA 3ZHEB 4WNGA 5FWQA 4BT9A 1OUVA 4PS7A 3LY8A 3P2BA 2KCVA 4FLBA 2NC9A 3LYAA 5EX0A 3Q4AB 1UG3A 3T5XA 4JA7A 4OVUA 4BTBA 4I9EA 3MA5A 3ASFA 3FUMA 4H7XA 1YA0A 4ILIA 3QC1A 4PUCA 5CMYA 3EJNA 1W3BA 5T4YA 3FUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X5B A;  3D9O A;  1SZ9 A;  3ZYK A;  5LP0 A;  1LF8 A;  2DIW A;  2MOW A;  3G2S A;  5J08 A;  1UJJ A;  3G2U A;  1SZA A;  4GZC A;  2LO6 A;  1JPL A;  1MHQ A;  1UJK A;  3G2V A;  1EDU A;  1DVP A;  3RRU A;  3D9P A;  2V8S E;  1JUQ A;  4GZD A;  1HX8 A;  4NAC A;  4HFG A;  1HF8 A;  1H0A A;  1ELK A;  4FU3 A;  4Q94 A;  3ZYQ A;  1HG2 A;  3ZYL A;  5LOZ A;  1EYH A;  2L0T B;  3D9L A;  4FLB A;  1JWF A;  1XGW A;  4JXT A;  4AVX A;  3D9M A;  1HFA A;  2QY7 A;  3D9I A;  2KM4 A;  3D9J A;  3ONK A;  5CMW A;  3LDZ A;  1HG5 A;  1JWG A;  3D9N A;  1PY1 A;  2L0I A;  1VDY A;  3G2W A;  3CLJ A;  3ONL A;  5CMY A;  2BF0 X;  3ZYM A;  2DCP A;  3G2T A;  1INZ A;  3D9K A;  4Q96 A; 
#chains in the Genus database with same CATH topology
 4HOR A;  4H7Y A;  3HXF A;  2IO2 C;  4B8C B;  2XHE A;  3MZL B;  3FU3 A;  3Q79 A;  4KT6 B;  1OWP A;  3TGO A;  3PNL B;  1QZ2 A;  4HOU A;  1EPU A;  2M63 A;  3ZUV B;  2V4H C;  3WG7 E;  3BG1 B;  4GA0 A;  4CEM A;  5A6C A;  4I6G A;  3RRM B;  4K0R A;  5LX8 A;  3PUJ A;  4JL0 A;  4TV3 A;  2ZGD A;  1TNO A;  4DRX E;  4J8Y A;  2IOS A;  2DZO A;  3TAX A;  4QQI A;  1NA0 A;  3EHN A;  1MX2 A;  2WXP A;  3U4T A;  2ETA A;  4ANX A;  2R02 A;  2YIN A;  5ANR A;  4JEU A;  3ULQ A;  2WXF A;  3UTM A;  2MRI A;  3HVE A;  2QFC A;  4JA9 A;  4G11 A;  5BT1 A;  4JHK A;  2WXN A;  4XIF A;  2WMO A;  1NA3 A;  1DNP A;  4LUN U;  4R7L A;  3ZVV A;  3NOG D;  4N3B A;  2PM6 A;  4I1A A;  3G2S A;  4CGW A;  1UW4 B;  3HRA A;  2I1K A;  4GZ6 A;  5BW8 C;  4AJW A;  1UOH A;  3ZW3 A;  4FJZ A;  2R2L A;  3IKO B;  3MKR A;  5HI7 A;  1MYO A;  4OAV B;  4DJA A;  5LP0 A;  4RSY A;  3TL5 A;  4BY6 A;  4WWO A;  2EIK E;  2V0P A;  2OV8 A;  4U0U A;  5HS0 A;  4YVO A;  1HF8 A;  4TUM A;  1SQM A;  2H6G A;  4CRW A;  1PC2 A;  4EPZ A;  3O4Z A;  4IN3 B;  4EZK A;  4U0S A;  5EYL A;  4UWL A;  3IEG A;  1WG0 A;  1OWN A;  3UXG A;  4CDN A;  3PE4 A;  4KXK B;  1Z3X A;  4YVQ C;  2IOL A;  4JEH A;  3ZU7 B;  3ASN E;  5CBO A;  1OCC E;  5BUZ A;  3CKC A;  4NIK A;  5ENS D;  3CQC B;  3FH8 A;  2WXQ A;  1XNF A;  4PS8 A;  1Y8M A;  5ANL A;  3CK9 A;  5ENR D;  2VTB B;  3L22 A;  3CVW A;  2Y3A A;  3K9I A;  4MKT A;  1KPS B;  2R59 A;  4HBD A;  2WB2 A;  2LAH A;  4HVB A;  4V3I A;  2FO7 A;  4G2V A;  3GZ1 A;  3ZYQ A;  3D9L A;  2YQ8 A;  4LRZ A;  1H6K A;  3GZ2 A;  3P1U A;  3V2X A;  1QQE A;  3PE3 A;  4I6J A;  3S7J A;  4BSX A;  1SVX A;  3OTN A;  3NAW A;  2WPV A;  1FT1 A;  2R5S A;  3L54 A;  4J8E A;  3OAW A;  3S7B A;  4F3V A;  4KVO A;  3R9M A;  3UM1 A;  4CDR A;  3I5P A;  3JXI A;  2ETC A;  1IQR A;  3ULE G;  4I9C A;  4NQ0 A;  3QWV A;  5AIJ A;  4WUY A;  3UT8 A;  3MEK A;  1S0P A;  5CCL A;  5LFA A;  4F1P A;  3PVL A;  2VGX A;  3ZYK A;  2AXZ A;  3FDH A;  3DWL G;  3UQ3 A;  2YHE A;  4L1B A;  4URK A;  3E30 A;  3Q7F A;  3TWT A;  2XS8 A;  3L08 A;  3T9K A;  1XGW A;  1OCZ E;  3CHS A;  5JJT A;  3DSX A;  4WNE A;  3LS8 A;  3KEZ A;  2KZT B;  1N0R A;  2XGM A;  2QC9 A;  4CYM D;  4K5A B;  1E8W A;  3ZIM A;  3LEW A;  3B95 A;  4JB8 P;  2GRR B;  2KXP C;  4P29 A;  1N95 A;  3RJV A;  2RG8 A;  1X81 A;  4J8S A;  2GRP B;  2QZA A;  4AOF A;  2IJG X;  4O1O A;  2Y69 E;  5BXU A;  3FU5 A;  1UN8 A;  2V4L A;  2LXL A;  2RFM A;  3LJ3 A;  3PZD A;  4G1T A;  3PEU B;  2WXR A;  4TXQ A;  3U66 A;  4ATG A;  4A63 B;  3SFZ A;  3CHQ A;  5ENQ D;  3CK7 A;  2HYZ A;  2GRQ B;  3JYS A;  3G2T A;  3FFL A;  4HB5 A;  3R9A B;  4DPR A;  4U07 A;  3RRU A;  3ZXS A;  3SBT B;  2CFZ A;  2FF4 A;  4N2S A;  3ESL A;  1WM5 A;  4GTO A;  4J8F A;  1S64 A;  4DI4 A;  3BQO A;  4HNA D;  4C0M A;  4ZFH A;  3CGH A;  3UT4 A;  5H7P A;  3FUD A;  1N4Q A;  3IV0 A;  5AEN A;  2XPZ A;  4LNU D;  4OVV A;  3SY2 A;  2XRZ A;  2MOW A;  2DZN A;  2CHX A;  1KZP A;  3Q49 B;  3QNK A;  4BSZ B;  4TUU A;  3EIJ A;  3KEA A;  5KNG A;  1IQU A;  1D8E A;  2RD0 A;  3B7U X;  3FTU A;  1HE8 A;  2L9B A;  2PL2 A;  3DST A;  3HVE B;  2F8Y A;  3B7T A;  3LVQ E;  3FH7 A;  3KS2 A;  4HXI A;  4G24 A;  3PDN A;  4DX2 A;  3SBS A;  3FU6 A;  2MYO A;  4Y6C A;  3FTZ A;  4GU5 A;  3UMV A;  4ACL A;  2WMN A;  3SHF A;  4JVS A;  4WND A;  2LO6 A;  1MHQ A;  3ASD A;  2VGE A;  4LSZ E;  4U96 D;  3T5X A;  4GTT A;  4H7X A;  3LJN A;  2EIM E;  3ABK E;  2QYJ A;  3LVR E;  1BI7 B;  1N4S A;  2OEV A;  1TN6 A;  1H6P A;  1H2U A;  2X6I A;  2XZD G;  4K5C A;  4XKB A;  1Z3Y A;  1E8Y A;  1LTX A;  4PH4 B;  3FTY A;  3L13 A;  3UPV A;  3AS8 A;  1NP7 A;  1LD7 A;  2AW6 A;  3B13 A;  3U64 A;  4ANW A;  3FU0 A;  3UIP C;  4J6I A;  1BD8 A;  4IYP A;  3ESK A;  3GYZ A;  3TG5 A;  2GRM A;  2VSY A;  5EDS A;  2OVB A;  3G2V A;  3E37 A;  3FUE A;  4UI9 K;  1FT2 A;  3C72 A;  3QDN A;  1MJ0 A;  1E8X A;  5FTP A;  5CEC B;  4O1P A;  4AM9 A;  2ZU6 B;  2JLB A;  3CVP A;  2A5E A;  1INZ A;  2WXI A;  3SZ7 A;  5CEA A;  1MX4 A;  4K03 A;  3X2Q E;  4GZD A;  3B7B A;  4JHR A;  1U2V G;  2XGS A;  3R7Q A;  2I9C A;  3MCX A;  3I4R B;  1DCQ A;  5KJL A;  3D9J A;  2VGX B;  5AAR A;  3TG4 A;  4YND A;  1WAO 1;  3VLE A;  3ML9 A;  3PZ1 A;  3J5P A;  4KBQ A;  3ZN3 A;  1V54 E;  5D0O D;  4G26 A;  2DVW A;  3SD5 A;  4U95 D;  2XEE A;  4F1S A;  4FHJ A;  3HG0 D;  1E7U A;  5CBN A;  2LNI A;  4HLL A;  4HRM B;  3NQP A;  3ULY A;  5HQ8 A;  4KYO B;  3TWQ A;  3URZ A;  5BXO A;  5ENP D;  3W9F A;  3C98 A;  3CSF A;  4AP2 A;  4AXH A;  5G05 J;  1PY1 A;  3ASH A;  4FA6 A;  4KVM A;  4GZ5 A;  1KT0 A;  5G04 J;  4L2L A;  4U0Z A;  3UIN C;  4BWR A;  1TNY A;  1SA4 A;  4WWN A;  2UY1 A;  3FTS A;  4XI0 A;  3E4B A;  5AJL A;  2WQ6 A;  3L6A A;  4CDM A;  3FHE A;  1Z6T A;  4GML A;  1FVF A;  2HE0 A;  1TYQ G;  1TNZ A;  2GGF A;  3HYM B;  4A1S A;  3TXN A;  3PEV B;  3SFY A;  1N11 A;  5AQB A;  4U7E B;  3DSU A;  4GTQ A;  4HOT A;  3ZNG A;  4JW1 A;  2L6B A;  4WWP A;  2HM8 A;  2XGO A;  5CMW A;  3CQG B;  2IF4 A;  2LSV A;  5AQA A;  2J09 A;  3LY9 A;  3LCA A;  3FY4 A;  2I1J A;  5FQ8 A;  1U3D A;  2RFA A;  5JJ6 A;  2H6I A;  3R7R A;  2X6F A;  1H0A A;  4AY6 A;  3C3Q A;  3AS5 A;  4BX8 A;  1JCS A;  4EEC A;  3DEO A;  3G2U A;  3Q75 A;  4GTS A;  3JQ1 A;  4HFG A;  2LUH A;  4B94 A;  1EYH A;  3DXK G;  3CEQ A;  3CHO A;  2P58 C;  4C48 B;  2WXL A;  5ITZ F;  4I2Z A;  2XEH A;  3BUA A;  4DX1 A;  5E75 A;  2IFU A;  4GA2 A;  1AWC B;  4GZC A;  3APF A;  3RIB A;  2V8S E;  2X38 A;  3EU9 A;  2J49 A;  5T3R A;  1O1T A;  2QY7 A;  1TJF A;  2YHC A;  4TRQ A;  1QYM A;  2Y4T A;  3V2O A;  3FUJ A;  4LER A;  5A7D B;  1JCR A;  4BES A;  4DLQ A;  3JUE A;  2P9I G;  2XS1 A;  2WQH A;  1EDU A;  4EZJ A;  4Q94 A;  3CVL A;  3UX4 A;  4CCA A;  5KJM A;  3D9N A;  3MKQ A;  4YDW A;  4BTA A;  3CLJ A;  3PS6 A;  3PRZ A;  4GTV A;  4Q96 A;  4L2Y A;  4JC8 A;  3GW4 A;  1S63 A;  5FIO A;  1JPL A;  3AU4 A;  1HU3 A;  1DVP A;  4ME2 A;  2FBN A;  3NB2 A;  1OWM A;  1IHG A;  4HI9 A;  2XQ0 A;  2X3M A;  5EX3 A;  1TEZ A;  3D9M A;  4HS2 A;  2KM4 A;  4FHK A;  1B89 A;  4I6E A;  4U8V D;  2VSX E;  2HR2 A;  4N39 A;  1HO8 A;  4DUI A;  2E0I A;  2B0O E;  3C3O A;  1ELK A;  1OXJ A;  5CED B;  4JXT A;  3VTY A;  1L5J A;  3S7D A;  3L16 A;  3TWV A;  4UWH A;  3UM3 A;  1ZBP A;  2PQN A;  3MV3 B;  2E2E A;  4D10 C;  4A3V A;  1H2T C;  3EUV A;  2Y4U A;  2BUG A;  4NRH B;  3T8M A;  3N71 A;  4FU3 A;  1JWF A;  1N4R A;  1RZ4 A;  2RKK A;  4U8H A;  3MJW A;  5ARF A;  2OOE A;  3DBS A;  4AV7 A;  3S2A A;  1E90 A;  3OXL A;  4X8Q A;  2XPY A;  3SGH A;  3U3W A;  3DEP A;  4WNG A;  4BT9 A;  4PS7 A;  3P2B A;  1UG3 A;  4YDO A;  4I9E A;  3MA5 A;  3PZ2 A;  3ASF A;  3FUM A;  1YA0 A;  3QC1 A;  4G8K A;  3AG1 E;  2DCP A;  1W3B A;  2DWZ A;  3FUI A;  3FUH A;  1TR4 A;  1SW6 A;  1IYG A;  1FPP A;  3IBE A;  3B7R L;  1U3C A;  3ZYL A;  4DX7 D;  4B93 B;  3BG0 B;  4KZ0 A;  3RAU A;  1HFA A;  3D9I A;  3LDZ A;  2ZXW E;  3J5Q B;  3ZXP A;  3JXJ A;  3OXF A;  5CRV A;  4GTP A;  5BPP A;  1SZA A;  3KD7 A;  4MRU A;  4RLY A;  2P9L G;  4ANU A;  3EIQ C;  3I3N A;  3RSE G;  4M3O A;  2R03 A;  2DBA A;  2UY1 B;  4I1M A;  3ABM E;  1O1R A;  2WVI A;  3ZGQ A;  3E32 A;  4NAC A;  4AEZ C;  3SNX A;  3JQ0 A;  1LD8 A;  3TWU A;  4BT8 A;  3UI2 A;  4E6H A;  4UWF A;  2PQR A;  4B8A A;  3UM0 A;  2GRN B;  3Q5M A;  1TN7 A;  2P9P G;  2CHW A;  5T8I A;  3UIO C;  5AN8 A;  4RVB A;  5G05 C;  3ZHE A;  2VJ8 A;  4FLH A;  1JWG A;  3NF1 A;  3TWX A;  5FZS A;  1A17 A;  4FUL A;  1O5M A;  5G04 C;  4UI9 J;  4UUC A;  4WNF A;  3UKU G;  1UJJ A;  3B7S A;  4HRL A;  3LXU X;  2Q7F A;  1N54 A;  3FUF A;  2LSU A;  4I43 A;  3FTX A;  3PUK A;  1P5Q A;  1UN9 A;  4A3T A;  5G55 A;  4HOQ A;  2EIJ E;  3HHM A;  2PM7 A;  3PNT B;  3DSS A;  2P9N G;  4LNB A;  1A5E A;  1V55 E;  3EDT B;  2J08 A;  1HG2 A;  2YNQ A;  2JAB A;  1S70 B;  4HQD A;  3NBN B;  1DCE A;  3ONL A;  2JEK A;  3ZYM A;  4APO A;  1X5B A;  4RG6 A;  4AY5 A;  2VGY A;  5FJY A;  2F0Y A;  4TXR A;  2GRO B;  2H6H A;  1UJK A;  4U04 A;  3IHY A;  4N3A A;  4GMR A;  5J90 A;  1HX8 A;  2UWJ G;  3WXX A;  1O1S A;  4A55 A;  2IEJ A;  5AQ7 A;  1IHB A;  3T5V A;  2H6F A;  3PZ4 A;  1YYH A;  5FZQ A;  3EHQ A;  3ZEF A;  3FWV A;  4FJY A;  1JUQ A;  4M7C A;  3RO2 A;  3NZS A;  2J4D A;  2L6J A;  4EBA A;  3MKQ B;  5KCM A;  3ZRH A;  2XEN A;  1SZ9 A;  2Y1L E;  4BER A;  3QOU A;  1TNB A;  1MX6 A;  2R17 C;  1D8D A;  3D9P A;  3E33 A;  5BV1 A;  2P2C P;  4DI3 A;  4IRU A;  3FEY A;  2KCK A;  3UUX A;  4LNG A;  1ELR A;  4XZ4 A;  5EIL A;  2WXJ A;  2CG3 A;  4U8Y D;  4GTM A;  3ML8 A;  2NYJ A;  1QBQ A;  3ENE A;  1K1B A;  4I2W A;  4JD2 G;  1WDY A;  4BFR A;  3EU5 A;  2F37 A;  3RU0 A;  3NZU A;  3ONK A;  4C9B B;  2XEV A;  2J8S D;  3AJI A;  3L9T A;  4WAF A;  1YCS B;  2BTD A;  4J0U A;  5EYP F;  5G2N A;  1N0Q A;  5AQ9 A;  5ENT D;  4GB9 A;  4LEU A;  3W9G A;  2CHZ A;  2LAI A;  3FTV A;  1AP7 A;  4GMJ A;  1D9S A;  1E8Z A;  5B3S E;  4GYO A;  3D9H A;  3AG4 E;  2GRL A;  1NI1 A;  3EHR A;  3MYV A;  4G8L A;  4DX6 D;  3F6Q A;  2FO1 E;  3I4G A;  3PRE A;  4L9P A;  1ZU2 A;  4W9R A;  3DPY A;  1E7V A;  3SQV A;  3Q9U C;  3MX3 A;  3GZS A;  3CK8 A;  3C5R A;  3EHM A;  3QWW A;  1N52 A;  4G23 A;  4CT4 A;  2I6H A;  1OCR E;  5FZR A;  3IHV A;  4HLE A;  5C2Y A;  3CVQ A;  3E34 A;  3L82 A;  4F6R D;  2ZIR A;  3DRA A;  3Q73 A;  4UWG A;  1MQS A;  3APD A;  2IY0 C;  4RG9 A;  1NZN A;  3DXM G;  3RK6 A;  2GW1 A;  4BX9 A;  3TWS A;  5AJD A;  2OVF A;  4ANV A;  1G3N B;  3MGB A;  1NL4 A;  1BI8 B;  3Q15 A;  2BKG A;  1OT8 A;  1ZB1 A;  3RKV A;  4B89 A;  3D9K A;  4XE0 A;  1H6O A;  1E96 B;  5FQ6 A;  3FUK A;  1PAQ A;  4GZ3 A;  4N2Q A;  5HKP A;  3VLD A;  5HRY A;  5JA4 D;  4CGV A;  3Q9N C;  3IXE A;  2BKK B;  2EIL E;  1BLX B;  3DPD A;  2ILR A;  4RQI A;  3ABL E;  2IU1 A;  5D2M C;  2F8X K;  5ENN A;  1HH8 A;  3D3M A;  4JHJ A;  4PS3 A;  2VSO E;  4IUL A;  3ZHE B;  5FWQ A;  1OUV A;  1N4P A;  2NC9 A;  2P9S G;  3Q4A B;  4OVU A;  4BTB A;  3ISM C;  4ILI A;  5CMY A;  3HXB A;  3Q7A A;  3EJN A;  2B6C A;  2XCB A;  2VQ2 A;  4UQX A;  1TJC A;  2LXM A;  4ILH B;  3HXC A;  1RW2 A;  3Q78 A;  4BET A;  3CHR A;  3OXG A;  4OAU C;  2WXK A;  1Z5S C;  2CG2 A;  4MS6 A;  5E76 A;  3CVY A;  2DIW A;  2PNN A;  4FAD A;  4N5Q A;  2EIN E;  3MV2 B;  4O6F A;  3QJZ A;  4GTR A;  2FI7 A;  4HI8 A;  2DYS E;  4L23 A;  2XZT G;  2AJA A;  1Y6I A;  2NSZ A;  4DX5 D;  2PZI A;  2ETB A;  2OEW A;  3G2W A;  4NUR A;  1H19 A;  4UI9 C;  4JPS A;  3HXD A;  2AXV A;  4Q69 A;  2WXH A;  3QWP A;  4XX5 A;  5KJK A;  4GCN A;  3JUI A;  1KZO A;  5CHE E;  1FVH A;  4EHM A;  3JCK C;  1FCH A;  4A1G A;  4CT0 A;  5M72 A;  4O60 A;  2FEZ A;  2AXU A;  3AG3 E;  1LF8 A;  3CST A;  3RO3 A;  3TXM A;  2XCC A;  1HS6 A;  2FUL A;  3UM2 A;  4C0E A;  3KSL A;  1ELW A;  5BNW A;  2VYI A;  2AVP A;  5JMN D;  1Q2Z A;  4E85 A;  1YMP A;  2L0I A;  3CVX A;  4DK5 A;  2P9U G;  4K5B A;  4XEI G;  2J9Q A;  4L7T A;  4MBG A;  2HO1 A;  4N3C A;  2V5Q C;  2ION A;  2X6K A;  2C2L A;  4ZHB A;  1K8K G;  1OCO E;  4ILG A;  2KC7 A;  2OCC E;  5KJN A;  3U9W A;  4JZY A;  2KCL A;  2AWI A;  3FH5 A;  3FEX A;  5JJ7 A;  4GYY A;  1QNF A;  5D0Q D;  4B0Z A;  1SA5 A;  1MZC A;  3SI5 A;  2V5F A;  2NXP A;  4ACK A;  4FC8 A;  2DYR E;  2VSN A;  3NOC D;  5LCW C;  4LCT A;  4F53 A;  3CKB A;  3HXE A;  4QFV A;  5KNH D;  3Q47 B;  2ZGG A;  4DLO A;  3CHM A;  4J8D A;  1BPO A;  5ARG A;  3KAE A;  4KZC A;  1HG5 A;  3HIZ A;  2OND A;  3VTX A;  1DC2 A;  3PH0 C;  3V30 A;  2WXG A;  4HRN A;  4GPM A;  2WXM A;  4I17 A;  5FQ7 A;  3RRN B;  2IQC A;  1KT1 A;  3FP3 A;  5B1A E;  3HDX A;  5CCM A;  2KBX A;  5FIN A;  3S7F A;  1N94 A;  5EIB E;  5CRU A;  4G25 A;  3PZ3 A;  2C0L A;  4APF A;  1HXI A;  5EID A;  2WQ7 A;  3VLF A;  3BEE A;  2L0T B;  4Y6W A;  5FQ4 A;  3V31 A;  3APC A;  3AAA C;  4F7A A;  3KSQ A;  2WXO A;  2BF0 X;  4AVX A;  1HZ4 A;  1IKN D;  5B1B E;  3CVV A;  3CHP A;  4HOS A;  3TJP A;  5LOZ A;  3AS4 A;  2J07 A;  3C3R A;  4OYS A;  1N9A A;  4EBA G;  3QK0 A;  5C1D A;  5JHA A;  4TXP A;  4GPK A;  4UQY A;  4EZL A;  5CER B;  2VTB A;  1NFI E;  3ZKJ A;  4GCO A;  3TWW A;  1GW6 A;  1K1A A;  5DBK A;  1OWO A;  5EKQ D;  5KBA A;  3ZFW A;  1BU9 A;  4KMO A;  4GYW A;  2XRY A;  4XI9 A;  3LPZ A;  4ATZ D;  1IXV A;  4CZ2 D;  2CFU A;  1KLX A;  2J4B A;  3O48 A;  2XPI A;  3AU5 A;  1TN8 A;  4XKC A;  5ENO D;  5FT9 A;  3LKU A;  4GA1 A;  2MHK A;  3FUN A;  5D66 A;  2BED A;  4BEP A;  3D9O A;  4UQZ A;  3L17 A;  4GAA A;  3ASO E;  3UKR G;  2X6J A;  3FUL A;  5BV0 A;  3QKY A;  4UWK A;  1VDY A;  1H2V C;  5DIZ A;  3CR3 A;  2C0M A;  3DSW A;  3CIA A;  3SO8 A;  4LG6 A;  2KZT A;  3FTW A;  2A4Z A;  3ZPJ A;  1EF1 C;  5LCW J;  3SF4 A;  3QAQ A;  1OWL A;  3AG2 E;  3DSV A;  3CV0 A;  2R05 A;  3CVU A;  3BU8 A;  3T8K A;  3V79 K;  2Y0B G;  3QAR A;  4EQF A;  4MLP A;  4N5C A;  1WY6 A;  4FP7 A;  1JCQ A;  5J08 A;  5JHB A;  4YDY A;  4YDE A;  4PDX A;  4J7W A;  2A5U A;  2I2O A;  1TNU A;  4AIF A;  4U63 A;  2P9K G;  5A23 A;  2X6H A;  3CVN A;  3QB2 A;  2EQX A;  3SFX A;  4Z68 A;  5AYW D;  3UT7 A;  5KWD A;  2KAT A;  4I1O B;  5IY5 E;  5AAO A;  3ASG A;  2WM9 A;  4ABN A;  3LY7 A;  2QYU A;  1OY3 D;  3TWR A;  3LY8 A;  2KCV A;  4FLB A;  3LYA A;  1K3Z D;  5EX0 A;  2IO3 C;  4JA7 A;  5EN5 D;  4PUC A;  2ZIS A;  5T4Y A; 
#chains in the Genus database with same CATH homology
 4HOR A;  2XCB A;  4H7Y A;  2VQ2 A;  4UQX A;  3FUH A;  3LVR E;  1TJC A;  4ILH B;  1IYG A;  4B8C B;  2XHE A;  3MZL B;  3IBE A;  3B7R L;  3FU3 A;  4KT6 B;  1OWP A;  1U3C A;  1H2U A;  3ZYL A;  3BG0 B;  2X6I A;  3PNL B;  1QZ2 A;  3CHR A;  1EPU A;  2M63 A;  3OXG A;  4HOU A;  4KZ0 A;  3TGO A;  1HFA A;  3D9I A;  2WXK A;  3BG1 B;  4GA0 A;  4XKB A;  4CEM A;  5A6C A;  3LDZ A;  4I6G A;  3RRM B;  4K0R A;  1Z3Y A;  5LX8 A;  3PUJ A;  4JL0 A;  2CG2 A;  4MS6 A;  4TV3 A;  5E76 A;  3CVY A;  1E8Y A;  2DIW A;  3OXF A;  2IOS A;  4FAD A;  5BPP A;  4PH4 B;  1SZA A;  3FTY A;  3KD7 A;  3MV2 B;  3L13 A;  4MRU A;  4O6F A;  3AS8 A;  3QJZ A;  3TAX A;  3UPV A;  1NP7 A;  1NA0 A;  2AW6 A;  2FI7 A;  3EHN A;  3B13 A;  4ANU A;  4L23 A;  3U64 A;  4ANW A;  2WXP A;  3FU0 A;  1Y6I A;  2NSZ A;  3EIQ C;  4J6I A;  3U4T A;  2PZI A;  3I3N A;  4ANX A;  4IYP A;  3ESK A;  4M3O A;  3G2W A;  2YIN A;  3GYZ A;  5ANR A;  4NUR A;  4JEU A;  1H19 A;  4UI9 C;  3TG5 A;  4JPS A;  3ULQ A;  2DBA A;  2GRM A;  2VSY A;  5EDS A;  2AXV A;  2WXF A;  2MRI A;  2UY1 B;  3HVE A;  4I1M A;  4Q69 A;  2WXH A;  3QWP A;  4XX5 A;  2QFC A;  2OVB A;  4JA9 A;  2WVI A;  3G2V A;  3FUE A;  4UI9 K;  3ZGQ A;  4G11 A;  5BT1 A;  4JHK A;  2WXN A;  3QDN A;  4NAC A;  4XIF A;  4AEZ C;  5KJK A;  4GCN A;  3SNX A;  3JUI A;  3JQ0 A;  5CHE E;  1FVH A;  1E8X A;  5FTP A;  4AM9 A;  4BT8 A;  2WMO A;  1NA3 A;  2ZU6 B;  4E6H A;  1DNP A;  2JLB A;  3JCK C;  3CVP A;  1FCH A;  4LUN U;  4UWF A;  4R7L A;  3ZVV A;  4A1G A;  1INZ A;  2PQR A;  4B8A A;  4CT0 A;  2FEZ A;  5M72 A;  2AXU A;  2WXI A;  4N3B A;  2PM6 A;  3Q5M A;  4I1A A;  1LF8 A;  3G2S A;  4CGW A;  3SZ7 A;  3CST A;  1UW4 B;  3RO3 A;  3TXM A;  2I1K A;  2XCC A;  4GZ6 A;  1HS6 A;  2FUL A;  4K03 A;  5BW8 C;  2CHW A;  4GZD A;  4AJW A;  4C0E A;  5T8I A;  4JHR A;  2XGS A;  3R7Q A;  1ELW A;  3ZW3 A;  2I9C A;  3MCX A;  2VYI A;  3I4R B;  4FJZ A;  4RVB A;  5G05 C;  3ZHE A;  3IKO B;  2VJ8 A;  5BNW A;  5KJL A;  3D9J A;  2AVP A;  2VGX B;  4FLH A;  3TG4 A;  4E85 A;  4YND A;  1WAO 1;  1JWG A;  3MKR A;  5HI7 A;  3VLE A;  2L0I A;  3NF1 A;  3CVX A;  5FZS A;  1A17 A;  3ML9 A;  4DK5 A;  4DJA A;  4FUL A;  5G04 C;  5LP0 A;  4RSY A;  3TL5 A;  4BY6 A;  4UI9 J;  4WNF A;  4WWO A;  4KBQ A;  1UJJ A;  3ZN3 A;  2V0P A;  3B7S A;  2J9Q A;  2OV8 A;  4U0U A;  3LXU X;  4L7T A;  2HO1 A;  4N3C A;  2ION A;  5D0O D;  2X6K A;  4G26 A;  3SD5 A;  2C2L A;  2Q7F A;  4YVO A;  1HF8 A;  1N54 A;  3FUF A;  1SQM A;  2LSU A;  4CRW A;  4I43 A;  4F1S A;  3FTX A;  1PC2 A;  3PUK A;  4FHJ A;  1P5Q A;  1UN9 A;  4EPZ A;  3O4Z A;  4ILG A;  2KC7 A;  4A3T A;  5KJN A;  3U9W A;  1E7U A;  4JZY A;  5G55 A;  4IN3 B;  4EZK A;  4HOQ A;  2LNI A;  4U0S A;  2KCL A;  4UWL A;  3IEG A;  3HHM A;  1OWN A;  2PM7 A;  3PNT B;  3NQP A;  5HQ8 A;  4KYO B;  4CDN A;  2AWI A;  3FH5 A;  3PE4 A;  4KXK B;  3URZ A;  1Z3X A;  4YVQ C;  2IOL A;  4JEH A;  3FEX A;  5JJ7 A;  4GYY A;  3EDT B;  1QNF A;  2J08 A;  3CKC A;  5BUZ A;  3CQC B;  1HG2 A;  5D0Q D;  4B0Z A;  3C98 A;  3FH8 A;  2YNQ A;  2WXQ A;  1XNF A;  3CSF A;  3SI5 A;  2V5F A;  4AP2 A;  4AXH A;  4PS8 A;  2NXP A;  5G05 J;  4ACK A;  4FC8 A;  1Y8M A;  1PY1 A;  3ASH A;  3ONL A;  2JEK A;  5ANL A;  4FA6 A;  3CK9 A;  2VSN A;  4KVM A;  3ZYM A;  4APO A;  2VTB B;  3L22 A;  1X5B A;  4GZ5 A;  4RG6 A;  5LCW C;  3CVW A;  4LCT A;  2Y3A A;  3K9I A;  4MKT A;  4AY5 A;  4F53 A;  3CKB A;  2R59 A;  1KT0 A;  2VGY A;  4L2L A;  4U0Z A;  5FJY A;  5G04 J;  4BWR A;  2WB2 A;  4QFV A;  2LAH A;  4HVB A;  3Q47 B;  1UJK A;  2UY1 A;  2FO7 A;  4U04 A;  4V3I A;  3IHY A;  3FTS A;  4N3A A;  4WWN A;  4DLO A;  3CHM A;  5J90 A;  1HX8 A;  4J8D A;  4XI0 A;  4G2V A;  3E4B A;  3GZ1 A;  5AJL A;  3ZYQ A;  2WQ6 A;  2UWJ G;  3WXX A;  3L6A A;  1BPO A;  4CDM A;  5ARG A;  3KAE A;  3D9L A;  2YQ8 A;  3FHE A;  4A55 A;  1Z6T A;  4LRZ A;  4KZC A;  1H6K A;  4GML A;  1FVF A;  3GZ2 A;  3T5V A;  3P1U A;  1HG5 A;  3HIZ A;  2OND A;  1QQE A;  3PE3 A;  4I6J A;  3S7J A;  5FZQ A;  4BSX A;  3VTX A;  3OTN A;  3ZEF A;  3FWV A;  2WPV A;  3HYM B;  2GGF A;  4A1S A;  3TXN A;  4FJY A;  3PH0 C;  3PEV B;  2R5S A;  3L54 A;  4J8E A;  2WXG A;  3OAW A;  3S7B A;  4F3V A;  4KVO A;  1JUQ A;  4CDR A;  2WXM A;  3NZS A;  2J4D A;  3I5P A;  4I17 A;  5FQ7 A;  2L6J A;  3RO2 A;  3RRN B;  4HOT A;  1IQR A;  4JW1 A;  4I9C A;  2IQC A;  1KT1 A;  3MKQ B;  4NQ0 A;  4EBA A;  5KCM A;  4WWP A;  2HM8 A;  2XGO A;  5CMW A;  3FP3 A;  3QWV A;  5AIJ A;  3CQG B;  4WUY A;  3HDX A;  3UT8 A;  3ZRH A;  5CCM A;  2IF4 A;  1S0P A;  3MEK A;  5CCL A;  5LFA A;  2LSV A;  3PVL A;  2VGX A;  3S7F A;  2J09 A;  3LY9 A;  3LCA A;  1SZ9 A;  3ZYK A;  2AXZ A;  3FDH A;  3FY4 A;  3UQ3 A;  2I1J A;  4G25 A;  5FQ8 A;  1U3D A;  2YHE A;  4L1B A;  4URK A;  3QOU A;  2C0L A;  2R17 C;  4APF A;  5JJ6 A;  3R7R A;  1HXI A;  3D9P A;  2X6F A;  2WQ7 A;  1H0A A;  3VLF A;  5BV1 A;  4DI3 A;  3BEE A;  2L0T B;  3L08 A;  4IRU A;  4AY6 A;  1XGW A;  4Y6W A;  5FQ4 A;  3CHS A;  3FEY A;  2DCP A;  2KCK A;  3APC A;  4F7A A;  3UUX A;  5JJT A;  3AS5 A;  4WNE A;  2WXO A;  3LS8 A;  3KEZ A;  2KZT B;  1ELR A;  2BF0 X;  4XZ4 A;  4AVX A;  2XGM A;  4BX8 A;  2WXJ A;  1HZ4 A;  2CG3 A;  4EEC A;  3G2U A;  3ML8 A;  3CVV A;  3CHP A;  4HOS A;  3ENE A;  1E8W A;  3JQ1 A;  4HFG A;  4I2W A;  3TJP A;  3ZIM A;  4B94 A;  3LEW A;  5LOZ A;  1EYH A;  3AS4 A;  4BFR A;  2J07 A;  3RU0 A;  3CEQ A;  4P29 A;  3NZU A;  3CHO A;  2P58 C;  3ONK A;  4OYS A;  4C9B B;  2XEV A;  2WXL A;  2RG8 A;  3RJV A;  4EBA G;  4J8S A;  3QK0 A;  4WAF A;  5C1D A;  5JHA A;  2BTD A;  4J0U A;  4I2Z A;  4AOF A;  2IJG X;  5E75 A;  4GPK A;  5G2N A;  4UQY A;  3FU5 A;  2IFU A;  4EZL A;  2VTB A;  4GA2 A;  1UN8 A;  2V4L A;  4GZC A;  4GB9 A;  3APF A;  4LEU A;  3LJ3 A;  3RIB A;  3PZD A;  2V8S E;  4G1T A;  3PEU B;  2WXR A;  2CHZ A;  2LAI A;  2X38 A;  3FTV A;  4GMJ A;  3U66 A;  1E8Z A;  4GCO A;  4ATG A;  4GYO A;  3SFZ A;  1GW6 A;  2J49 A;  5T3R A;  2GRL A;  5DBK A;  2QY7 A;  1TJF A;  3CHQ A;  1OWO A;  3CK7 A;  2HYZ A;  2YHC A;  4TRQ A;  5EKQ D;  2Y4T A;  3ZFW A;  3JYS A;  4KMO A;  3G2T A;  3MYV A;  3FFL A;  3FUJ A;  4GYW A;  4LER A;  2XRY A;  4XI9 A;  3LPZ A;  5A7D B;  3I4G A;  4DLQ A;  3PRE A;  1ZU2 A;  2CFU A;  3R9A B;  1KLX A;  4W9R A;  2J4B A;  4DPR A;  1E7V A;  2WQH A;  3O48 A;  1EDU A;  4U07 A;  3RRU A;  2XPI A;  3AU5 A;  4EZJ A;  3ZXS A;  3SBT B;  3MX3 A;  3GZS A;  3CK8 A;  4Q94 A;  4XKC A;  3CVL A;  5FT9 A;  3EHM A;  3LKU A;  3QWW A;  1N52 A;  2CFZ A;  2FF4 A;  4N2S A;  3ESL A;  4G23 A;  2MHK A;  4GA1 A;  4CT4 A;  3UX4 A;  2I6H A;  4CCA A;  3D9N A;  3FUN A;  5KJM A;  1WM5 A;  3MKQ A;  5FZR A;  3IHV A;  4BTA A;  3CLJ A;  4HLE A;  3PS6 A;  3PRZ A;  5C2Y A;  3CVQ A;  4Q96 A;  3D9O A;  4L2Y A;  4JC8 A;  3GW4 A;  4J8F A;  4UQZ A;  3L17 A;  4DI4 A;  1JPL A;  3AU4 A;  1HU3 A;  4GAA A;  1DVP A;  4UWG A;  4ME2 A;  1MQS A;  2FBN A;  1OWM A;  1IHG A;  3APD A;  2XQ0 A;  2X6J A;  2X3M A;  3FUL A;  4RG9 A;  5EX3 A;  4C0M A;  1TEZ A;  3CGH A;  3UT4 A;  3D9M A;  5BV0 A;  3QKY A;  4HS2 A;  1NZN A;  2KM4 A;  4FHK A;  4UWK A;  3RK6 A;  3FUD A;  3IV0 A;  1VDY A;  5AEN A;  2GW1 A;  1H2V C;  5DIZ A;  1B89 A;  2XPZ A;  2C0M A;  3CR3 A;  4BX9 A;  4I6E A;  4OVV A;  3CIA A;  2VSX E;  2HR2 A;  2KZT A;  3FTW A;  2A4Z A;  4N39 A;  2XRZ A;  2MOW A;  1HO8 A;  1EF1 C;  3ZPJ A;  5AJD A;  2OVF A;  4ANV A;  5LCW J;  2E0I A;  3MGB A;  3SF4 A;  2CHX A;  3Q15 A;  3QAQ A;  3Q49 B;  1OWL A;  3QNK A;  1ELK A;  4TUU A;  3CV0 A;  3EIJ A;  4JXT A;  3CVU A;  1IQU A;  2RD0 A;  3B7U X;  3FTU A;  1HE8 A;  2L9B A;  2PL2 A;  3QAR A;  3RKV A;  4EQF A;  4MLP A;  3VTY A;  3HVE B;  4N5C A;  4B89 A;  3D9K A;  1L5J A;  1WY6 A;  4XE0 A;  3S7D A;  4FP7 A;  3L16 A;  3B7T A;  3LVQ E;  1E96 B;  4UWH A;  5J08 A;  5JHB A;  1ZBP A;  2PQN A;  3MV3 B;  5FQ6 A;  2E2E A;  4D10 C;  4PDX A;  4A3V A;  1H2T C;  3FH7 A;  2A5U A;  1PAQ A;  2I2O A;  3FUK A;  3KS2 A;  4GZ3 A;  2Y4U A;  4HXI A;  3VLD A;  2BUG A;  4N2Q A;  4G24 A;  3PDN A;  4NRH B;  3T8M A;  4AIF A;  3N71 A;  4FU3 A;  4U63 A;  3SBS A;  4CGV A;  1JWF A;  5A23 A;  2X6H A;  3FU6 A;  3CVN A;  4U8H A;  3QB2 A;  3MJW A;  2EQX A;  4Y6C A;  5ARF A;  5AYW D;  2OOE A;  3DPD A;  3FTZ A;  2ILR A;  4GU5 A;  3UMV A;  2IU1 A;  3DBS A;  4ACL A;  3UT7 A;  2WMN A;  3S2A A;  4AV7 A;  5ENN A;  3SHF A;  4JVS A;  1E90 A;  3OXL A;  2KAT A;  1HH8 A;  4I1O B;  4WND A;  2LO6 A;  2XPY A;  3D3M A;  4JHJ A;  1MHQ A;  3SGH A;  4PS3 A;  3ASD A;  3ASG A;  2WM9 A;  4ABN A;  3LY7 A;  2VSO E;  3U3W A;  4IUL A;  3ZHE B;  4WNG A;  5FWQ A;  4BT9 A;  1OUV A;  4PS7 A;  3LY8 A;  3P2B A;  2KCV A;  4FLB A;  2NC9 A;  3LYA A;  5EX0 A;  3Q4A B;  1UG3 A;  3T5X A;  4JA7 A;  4OVU A;  4BTB A;  4I9E A;  3MA5 A;  3ASF A;  3FUM A;  4H7X A;  1YA0 A;  4ILI A;  3QC1 A;  4PUC A;  5CMY A;  3EJN A;  1W3B A;  5T4Y A;  3FUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...