1H0AA

Epsin enth bound to ins(1,4,5)p3
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
158
structure length
158
Chain Sequence
b'MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPSIN
molecule tags Endocytosis
source organism Rattus norvegicus
publication title Curvature of Clathrin-Coated Pits Driven by Epsin
pubmed doi rcsb
total genus 68
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2002-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1h0aA00
4JXTA 1EYHA 1HG2A 1HFAA 2V8SE 3D9PA 3ZYMA 2DIWA 4FLBA 4NACA 2L0IA 1EDUA 1DVPA 1MHQA 3G2SA 3G2WA 3ZYLA 3G2TA 3D9KA 1HG5A 2BF0X 3G2UA 1X5BA 2LO6A 1JUQA 1JWFA 4Q94A 3D9LA 3D9OA 3RRUA 3ZYKA 5J08A 5LOZA 2QY7A 1VDYA 1ELKA 3G2VA 3D9JA 1SZAA 4FU3A 4GZDA 1HX8A 3ONLA 4AVXA 1XGWA 2KM4A 1UJKA 1UJJA 1H0AA 2DCPA 3D9IA 3ONKA 1LF8A 4HFGA 3LDZA 5CMWA 5LP0A 1SZ9A 1JWGA 2L0TB 4GZCA 1PY1A 5CMYA 4Q96A 1INZA 2MOWA 3D9MA 3ZYQA 3CLJA 3D9NA 1HF8A 1JPLA
chains in the Genus database with same CATH superfamily
1K3ZD 2WXRA 1HZ4A 4FJYA 4CCAA 2HM8A 1N4RA 4UWGA 4XEIG 1SZAA 4ACLA 4I6JA 3U66A 2KATA 3AS5A 3NOCD 2R05A 1AWCB 3ABLE 4OAUC 2OOEA 5ARGA 1UW4B 4J8DA 3HG0D 3MGBA 4OYSA 4BERA 2GRLA 1JWFA 4HRMB 5T4YA 4GTTA 4F6RD 4PS8A 3Q15A 4I1AA 3MKQB 1E8ZA 1D8DA 4WUYA 4OVUA 1WM5A 3NBNB 3LDZA 4GYOA 4N39A 3UT7A 3TWVA 2PL2A 3FUJA 3DSWA 3DBSA 1SA4A 2XHEA 1VDYA 1BPOA 2BTDA 1RZ4A 5AJLA 4GPMA 4F53A 4G25A 4AEZC 1N11A 2WXKA 4G26A 1UJJA 2PQRA 4PH4B 3FULA 3JXJA 4DRXE 3RU0A 3VTYA 1Z6TA 1H6PA 3S7JA 2V5FA 3SF4A 3NB2A 1N54A 1TNZA 5HRYA 3WG7E 2IF4A 4A63B 4JL0A 3ONLA 4N5CA 3RRNB 3E30A 3MX3A 3DSTA 3TWRA 5FIOA 1YCSB 4EBAA 2R02A 4EZJA 1ELWA 2XQ0A 3L6AA 1OCOE 3CK7A 3T8MA 4LCTA 4BEPA 4N2QA 2ZGGA 3UIOC 2HR2A 2IJGX 4N3BA 2BUGA 2XGOA 2WM9A 1TNBA 4U96D 4U07A 3LJNA 2P9LG 4GA0A 4IYPA 1TN6A 1JCRA 3TXMA 5EKQD 3UI2A 2J08A 4K5AB 2R2LA 1OCCE 3AS8A 2CG3A 3CVUA 2KM4A 3PZ3A 4CRWA 4LRZA 3UXGA 4BT8A 4JC8A 1JCSA 4L23A 3HVEA 2WXIA 1FPPA 5AENA 1ZBPA 3KEZA 3OXGA 4U7EB 1HG5A 2CHXA 3DEOA 5FWQA 4I6EA 2RG8A 3L13A 2WMNA 5G04C 4GTOA 1HE8A 1HS6A 1U2VG 4GU5A 1IQUA 4ACKA 3UPVA 2LNIA 4HI8A 1H2VC 4DPRA 4UWLA 3ZKJA 2YNQA 3UINC 4O1OA 2IFUA 5D0QD 4ILIA 3UX4A 3CVLA 1BLXB 2Y4TA 5CBOA 3TWTA 3BU8A 3X2QE 4RSYA 1UOHA 2Q7FA 4AM9A 1DCEA 2JEKA 3FUIA 3U3WA 4LNGA 2BEDA 4LUNU 4RQIA 1KZOA 5D66A 3RJVA 2H6GA 3SZ7A 3I3NA 3RO2A 5BT1A 3ML9A 2DYSE 4RLYA 2A4ZA 4LNBA 4K5BA 3UM3A 3T5VA 3EDTB 2OVBA 3EHNA 4LEUA 4Q94A 4M7CA 1N94A 3TWXA 2XPZA 4V3IA 1E90A 4UUCA 4KYOB 3CHSA 3QWVA 4YVQC 3DPYA 4JEUA 3D9NA 1HF8A 5FQ4A 5CEDB 2V0PA 2L0IA 1G3NB 1E8XA 4AY5A 4HOUA 2RKKA 2F0YA 1KT0A 2XZDG 4G8KA 4IRUA 3CSFA 3B7BA 4J8YA 1FVHA 4GTPA 5HI7A 2DBAA 4MLPA 4J8EA 2DYRE 2XRYA 3QWPA 3NF1A 5AQAA 5CHEE 3TWWA 2IEJA 5AQBA 4EPZA 1IYGA 3V2OA 4FHJA 2AWIA 3ULQA 3D3MA 3GZSA 4BTAA 1WY6A 1JPLA 2P9UG 4UQZA 1YA0A 3DXKG 3EIQC 3DSXA 5FT9A 2WMOA 1MHQA 3PZ2A 3Q9UC 4PUCA 5EX0A 4XI9A 3SD5A 4HLLA 1Q2ZA 1TJFA 3C3QA 4GA2A 3S7FA 2V4HC 4UI9K 1GW6A 5DIZA 1N0RA 4J8FA 5D0OD 1YYHA 1DVPA 3G2TA 3PREA 4AOFA 4N2SA 3PZ4A 2VSOE 4WWOA 4CDNA 2C0LA 2EIJE 3TL5A 1FCHA 5B3SE 1K8KG 2EIME 4G1TA 4DX1A 3FH7A 5FJYA 3FTWA 3EU5A 2H6FA 5KJLA 3D9MA 2L9BA 3RKVA 2DIWA 2EIKE 4MRUA 3D9OA 2WVIA 3CQCB 5BUZA 3Q47B 5AARA 5LCWC 3HDXA 2MHKA 4I2ZA 4A3TA 3TAXA 4BX8A 4ZHBA 1WG0A 2XS8A 3ESLA 1W3BA 4G2VA 3R7QA 3FEXA 5G05J 4BSXA 1O1RA 1HXIA 4E6HA 5ENNA 3EJNA 4ANVA 1KLXA 4ANUA 3UIPC 4GPKA 1WDYA 4C48B 4KT6B 3AAAC 1N4SA 2XZTG 3CHPA 4JVSA 2ETAA 3EHMA 1UG3A 4WWPA 5ITZF 5G04J 4JEHA 3D9KA 3PE3A 3ESKA 4EECA 3B7RL 5H7PA 3ZUVB 2AVPA 3OAWA 1P5QA 4PS3A 5AAOA 1X81A 3KEAA 3EUVA 4U8YD 5M72A 4TUMA 4OAVB 1S0PA 2LSUA 2Y69E 4XI0A 4L2YA 3LVQE 1NFIE 4O1PA 3IKOB 3FTVA 5FINA 2WXOA 3CVVA 1OWLA 3B13A 2R03A 3B7SA 3PNLB 3FTXA 3E37A 5KBAA 2OVFA 1K1BA 3TWSA 2NC9A 2A5EA 4F3VA 2DZNA 3CHRA 3E33A 1SW6A 4DJAA 4CGVA 5JHBA 2RFMA 2X6FA 3FU3A 4DI4A 1OWOA 3CVNA 5CMYA 2FO7A 4NQ0A 5C1DA 1QNFA 4EZKA 1A17A 3PS6A 4UQXA 1ELKA 3ZXSA 2RFAA 4YDYA 3FTYA 5A23A 2IOLA 3ZYQA 4GZ5A 3DWLG 5DBKA 2F37A 3G2WA 3ZEFA 3PUJA 2OV8A 4G8LA 2QY7A 3HXCA 5AQ7A 4CT4A 2IY0C 4BY6A 3ZYKA 4QFVA 4NIKA 2C0MA 4EHMA 4GTVA 1X5BA 2LO6A 2KCVA 5CEAA 3OXLA 4G11A 3UTMA 4Z68A 3URZA 4I9EA 3O4ZA 3FUEA 4BESA 4A55A 3ASHA 2V8SE 3SNXA 3W9GA 2NSZA 1N9AA 3IEGA 2JABA 2NXPA 5JJTA 3CK9A 3FY4A 2WXPA 4AIFA 4HXIA 3CQGB 1H0AA 2B6CA 4HFGA 1TYQG 1TNOA 5FQ8A 3PZ1A 2GGFA 3HXFA 1S64A 4X8QA 3LY9A 3ASGA 5BW8C 3AS4A 4JD2G 3ABKE 1OCZE 4YVOA 2ILRA 4FU3A 3SQVA 5AYWD 2KBXA 5G55A 4GTSA 2QZAA 3DSUA 2I2OA 2X6KA 3D9HA 4L7TA 2Y0BG 1HG2A 4K5CA 4XKCA 1DC2A 2XGSA 3K9IA 4UI9C 1AP7A 2B0OE 3ZYLA 5FZQA 4I17A 2R5SA 4DX5D 4BWRA 4AXHA 4B94A 3FHEA 2KZTA 3RO3A 4HLEA 5CRUA 4TXRA 3L16A 3R7RA 4GMLA 3ZXPA 3T9KA 2QFCA 3UT8A 4WNFA 2H6IA 4C0MA 3Q49B 2ZIRA 4FC8A 3PZDA 2UWJG 4HB5A 3APFA 2XPIA 4FHKA 4RG6A 4EBAG 3FH5A 3L17A 3QJZA 4KVOA 3ZYMA 2L6BA 2VSXE 3TGOA 3LXUX 3LPZA 4QQIA 3ZPJA 3AU5A 2UY1B 4B8AA 1XGWA 4A1SA 3HXDA 3APCA 3DSVA 4GZCA 4Q96A 2LAHA 3NQPA 4BX9A 4ATZD 4C9BB 4AY6A 3R9AB 3ASDA 4JHKA 4KMOA 5T3RA 4TRQA 4I9CA 1TEZA 1EPUA 3FUMA 4AP2A 5E75A 4CGWA 1BI8B 5B1BE 1Y6IA 3LYAA 2MOWA 3MV2B 2QYJA 2V5QC 2VSNA 1A5EA 4PS7A 2YQ8A 1JUQA 2WB2A 2M63A 4GTMA 1SVXA 3CKBA 2WQHA 1NZNA 1RW2A 1MX6A 4XX5A 4HORA 4D10C 4B0ZA 3FEYA 2Y4UA 4LSZE 2BKKB 5EYPF 2GRPB 5ENSD 3Q7AA 3MYVA 3S7DA 4U63A 3MCXA 1HU3A 4MS6A 4Q69A 2DCPA 5HS0A 3F6QA 2P9NG 1HFAA 4FLBA 2C2LA 1S63A 4TV3A 2KXPC 5CCLA 3APDA 4K03A 3AG2E 1MX2A 2QYUA 2ZGDA 2XEHA 5EIDA 4G24A 4BETA 5AN8A 4GMRA 2PNNA 3ZW3A 4U0UA 2FI7A 1ELRA 3QWWA 5EYLA 4YDEA 3LY7A 4A3VA 3AG1E 4CT0A 3G2VA 3L54A 3IHVA 4DX6D 4Y6CA 4YDOA 2VSYA 4GYWA 2YINA 2X6HA 2QC9A 2AW6A 3CIAA 4LNUD 5FZSA 3C3RA 4OVVA 5ENQD 4WWNA 2IU1A 3BQOA 3N71A 1K1AA 2J07A 4KVMA 3ZHEA 5CERB 3ZHEB 3UM0A 5CECB 4YNDA 3UUXA 3LY8A 4GAAA 3IV0A 4NACA 5CRVA 1MQSA 3QOUA 1H6KA 4RVBA 3BUAA 3I5PA 3QB2A 3SHFA 4O6FA 3SY2A 2V4LA 3BG1B 4CEMA 1IHBA 4BTBA 1UN8A 2I1JA 2F8XK 3UQ3A 4WNDA 2GROB 3PRZA 4U8HA 3I4GA 1MZCA 4URKA 4GYYA 3CGHA 4NURA 2BF0X 2YHEA 4WNGA 2LSVA 1MYOA 1IKND 4DK5A 4I1MA 1NA3A 3B95A 3V30A 5ARFA 5HKPA 3QKYA 2WQ6A 2IO3C 4F1SA 1KZPA 3HYMB 3UKRG 4N3CA 2FULA 1LD8A 1OWPA 1XNFA 3EHQA 4U0ZA 1LF8A 5ANLA 3IHYA 2EQXA 5A6CA 3Q78A 3JXIA 1SQMA 4P29A 3LJ3A 2FO1E 5CBNA 3JUIA 1ZU2A 1HH8A 2XEVA 3ULEG 5KJKA 3UT4A 2R17C 1NI1A 4GB9A 3HRAA 3TJPA 3BEEA 3T5XA 1Z5SC 3MZLB 1UN9A 3ZU7B 3D9LA 3V79K 4L9PA 5C2YA 4GA1A 5G05C 3CV0A 2WXMA 5A7DB 4JHJA 3QDNA 2AXUA 3AG3E 1D9SA 3UKUG 4ABNA 4YDWA 2I6HA 1LTXA 5B1AE 3ONKA 4DLQA 2GRQB 3ULYA 2LAIA 1OXJA 4UWHA 5EX3A 2DVWA 4TUUA 4B93B 3RK6A 1TN8A 3PDNA 5FZRA 2HE0A 2GRNB 3FTSA 1KT1A 3HVEB 5FTPA 1FT1A 3EHRA 2HYZA 2Y1LE 2VGXB 5JHAA 1ZB1A 2VGEA 4K0RA 3ZGQA 3MJWA 4E85A 3ZVVA 3B7TA 3PEUB 3CEQA 4WNEA 3W9FA 4GMJA 4L2LA 1PC2A 2L6JA 2LXMA 3JQ1A 3FFLA 2WXQA 4CDRA 5EN5D 1OUVA 3FTZA 2OEWA 3JQ0A 2DZOA 1N52A 3Q4AB 4JA7A 2I1KA 2F8YA 4UWKA 3VLEA 3CR3A 2LUHA 5EIBE 1QQEA 3MEKA 3SBTB 4FADA 3R9MA 3HIZA 4HRNA 3ZFWA 5JJ6A 2AXZA 3FU0A 5BPPA 4HI9A 1U3CA 1QZ2A 2X38A 3RRMB 5LFAA 1YMPA 5D2MC 3V31A 4ILGA 2PM7A 4BSZB 5BNWA 4H7YA 3L9TA 4EQFA 2L0TB 2J09A 4I2WA 3JYSA 4DI3A 3ISMC 4GZ3A 2J8SD 3AJIA 3L22A 3CKCA 3WXXA 3CHOA 1N0QA 5ENPD 1UJKA 2J49A 2MRIA 2XGMA 2ZU6B 2CHWA 1V54E 5LP0A 1OY3D 4L1BA 1EDUA 3TWQA 3PEVB 5LCWJ 2JLBA 5T8IA 4CYMD 4W9RA 4FULA 2OCCE 3FH8A 4UI9J 3SO8A 2FEZA 4TXQA 4O60A 4JXTA 2OEVA 4ANXA 3QAQA 1TJCA 3U64A 4CZ2D 1E7VA 4G23A 3RAUA 3KAEA 3CSTA 2VGYA 1KPSB 1PY1A 3I4RB 3IBEA 2KC7A 4FLHA 3DPDA 4XIFA 3OTNA 4MKTA 1IXVA 2VYIA 3FDHA 1FVFA 1O1SA 1U3DA 3PH0C 1JCQA 1OWMA 4JHRA 3HXEA 3HHMA 3FUDA 1SZ9A 3KSLA 3Q7FA 3E34A 1OWNA 3VTXA 1TNUA 3RIBA 3E32A 3AU4A 4I43A 5KJNA 1SA5A 5ENOD 1DCQA 1S70B 2X3MA 2WPVA 2ETCA 4B8CB 4CDMA 3KS2A 3IXEA 3GZ2A 5KJMA 2WXNA 3ASNE 3E4BA 3CVWA 3SBSA 4LERA 4HNAD 5AQ9A 5G2NA 2E2EA 3CVYA 1WAO1 2PZIA 2E0IA 4TXPA 5JJ7A 3LCAA 4GTRA 3Q79A 2WXGA 4U95D 3ASOE 4H7XA 3L82A 2XENA 3MKQA 5KNHD 3CHQA 4WAFA 2VGXA 3D9IA 3LKUA 4IULA 4LG6A 1BI7B 1NA0A 4GTQA 3C72A 2KCLA 3KD7A 3SI5A 4ANWA 3G2SA 3CVQA 3AG4E 2FBNA 2H6HA 2CFUA 5EILA 2ETBA 2VQ2A 2MYOA 4KXKB 3CVPA 3ENEA 2IOSA 4RG9A 3C3OA 2P58C 4BT9A 4J7WA 1N4PA 1MX4A 2J9QA 2YHCA 5J90A 3FU5A 1Y8MA 3Q75A 4Y6WA 4ATGA 3FTUA 4APOA 1EF1C 3HXBA 4I6GA 4ILHB 1JWGA 3TG5A 3NZUA 2WQ7A 3T8KA 4N3AA 4EZLA 2IQCA 1E8WA 2UY1A 4U8VD 1TNYA 1L5JA 2ONDA 3LS8A 3FP3A 4ME2A 1PAQA 4HOTA 1INZA 5IY5E 3QARA 4N5QA 2A5UA 4JW1A 4IN3B 3MA5A 1OT8A 4ZFHA 2X6IA 3SFZA 4DX2A 3VLFA 5EDSA 2CHZA 1QYMA 4JPSA 3S7BA 1N4QA 1EYHA 2EINE 2AJAA 5ANRA 3FUKA 2CFZA 1MJ0A 3DEPA 3DSSA 1Z3YA 5CCMA 5BV0A 3C98A 5HQ8A 2XS1A 1FT2A 4DLOA 2GRRB 4HRLA 3OXFA 3CHMA 4U04A 3QC1A 3FUFA 3QNKA 4J6IA 3P2BA 1E7UA 3PUKA 3CLJA 2R59A 2WXLA 3Q73A 3MV3B 4HVBA 1E96B 3ZRHA 2IO2C 2P9SG 3RRUA 5J08A 1BU9A 4HOQA 4KZ0A 3ZIMA 5KWDA 3C5RA 3DRAA 2P9IG 3EIJA 4DUIA 5JA4D 3G2UA 3PNTB 5ENTD 3SFYA 5KCMA 2VTBB 4GZDA 2VJ8A 2Y3AA 1Z3XA 3SGHA 1QBQA 4HS2A 4HBDA 5JMND 3L08A 2AXVA 2GRMA 4NRHB 3DXMG 1H19A 4C0EA 2X6JA 3ZN3A 4GCOA 2NYJA 4KZCA 4F1PA 2I9CA 3D9JA 4AJWA 2BKGA 1O5MA 4JA9A 2RD0A 3TWUA 2J4DA 1N95A 4PDXA 4BFRA 3FUNA 2XRZA 3FU6A 2ZXWE 3FWVA 5BXOA 3VLDA 4XZ4A 3UM2A 3ZNGA 3JCKC 5ENRD 4U0SA 5LOZA 1TN7A 3P1UA 1D8EA 1HX8A 4AVXA 2XCCA 2DWZA 5AJDA 3TG4A 1IHGA 4JB8P 3SFXA 3J5QB 5CMWA 2FF4A 4R7LA 4XE0A 1DNPA 4FJZA 3MKRA 4I1OB 3UM1A 4J8SA 1O1TA 4J0UA 3PE4A 3U4TA 1OCRE 5AIJA 3KSQA 4GZ6A 3ML8A 3TXNA 3QK0A 3GYZA 1NL4A 3D9PA 3UMVA 4DX7D 4UWFA 1H6OA 2KZTB 1B89A 4B89A 2XEEA 3FUHA 3CK8A 3NAWA 5BV1A 4HOSA 3ABME 2WXFA 3BG0B 2VTBA 3PVLA 2J4BA 4APFA 4AV7A 1HO8A 1IQRA 4UQYA 2WXJA 3ASFA 3NOGD 4MBGA 2HO1A 3RSEG 4A1GA 5E76A 4GCNA 5BXUA 3GZ1A 2ZISA 3O48A 4HQDA 1E8YA 3LEWA 4FP7A 3S2AA 2EILE 4XKBA 2CG2A 2KCKA 3JUEA 3B7UX 3U9WA 5LX8A 4M3OA 2LXLA 5FQ7A 2PM6A 1NP7A 2WXHA 3Q9NC 1BD8A 1LD7A 3LVRE 3J5PA 2IONA 4KBQA 2PQNA 3GW4A 2P9PG 3V2XA 1H2UA 2XCBA 2P9KG 3Q5MA 4JZYA 2P2CP 5FQ6A 3NZSA 4FA6A 1TR4A 3EU9A 1H2TC 4F7AA 5KNGA 2XPYA 1V55E 3CVXA 2GW1A
chains in the Genus database with same CATH topology
4WWPA 3CIAA 5FZSA 5G04J 2WXRA 3KS2A 1HZ4A 4OVVA 4JEHA 4FJYA 4CCAA 4WWNA 2IU1A 3D9KA 3PE3A 3GZ2A 2HM8A 3ESKA 4EECA 3N71A 5KJMA 2WXNA 2J07A 4UWGA 3B7RL 1SZAA 3E4BA 4ACLA 4I6JA 2AVPA 3CVWA 3SBSA 3OAWA 4LERA 3U66A 2KATA 4KVMA 1P5QA 5G2NA 4PS3A 3AS5A 3ZHEA 2E2EA 3ZHEB 3CVYA 4YNDA 1WAO1 2OOEA 3UUXA 2PZIA 5M72A 2E0IA 5ARGA 5JJ7A 1UW4B 3LCAA 3LY8A 4GAAA 4J8DA 3IV0A 4NACA 1S0PA 2LSUA 3MGBA 2WXGA 1MQSA 4XI0A 4OYSA 3QOUA 4L2YA 2GRLA 1H6KA 3LVQE 1JWFA 5T4YA 4RVBA 4H7XA 3I5PA 3QB2A 3SHFA 3IKOB 3FTVA 4O6FA 4PS8A 3MKQA 2V4LA 2WXOA 3Q15A 3CHQA 3BG1B 3MKQB 2VGXA 4I1AA 1UN8A 2I1JA 1E8ZA 4WAFA 4BTBA 3D9IA 1OWLA 4WUYA 3UQ3A 4OVUA 4WNDA 3CVVA 1WM5A 3B13A 3LDZA 3LKUA 3B7SA 4IULA 3PRZA 3PNLB 4U8HA 4GYOA 4N39A 3UT7A 1NA0A 3FTXA 2PL2A 3I4GA 2OVFA 2KCLA 3FUJA 2NC9A 3KD7A 3SI5A 3G2SA 3CVQA 3DBSA 4ANWA 4URKA 4GYYA 4F3VA 3CGHA 4NURA 2BF0X 2FBNA 3CHRA 2CFUA 2XHEA 2VQ2A 2YHEA 2LSVA 4WNGA 4DJAA 1VDYA 4CGVA 4KXKB 1BPOA 4DK5A 4I1MA 5JHBA 2BTDA 1NA3A 5AJLA 4F53A 5ARFA 4G25A 3CVPA 4AEZC 2WXKA 2X6FA 3ENEA 3FU3A 2IOSA 1UJJA 4G26A 4RG9A 2PQRA 4DI4A 4PH4B 1OWOA 3CVNA 2P58C 3FULA 5CMYA 2FO7A 3QKYA 4BT9A 3RU0A 2WQ6A 3VTYA 1Z6TA 4NQ0A 4F1SA 5C1DA 3S7JA 1QNFA 2V5FA 3SF4A 4EZKA 1N54A 1A17A 3PS6A 2J9QA 3HYMB 2IF4A 2YHCA 4N3CA 4UQXA 5J90A 4JL0A 1ELKA 3ZXSA 2FULA 3FU5A 1Y8MA 1OWPA 3ONLA 4N5CA 1XNFA 4Y6WA 4ATGA 3FTUA 3FTYA 3RRNB 4APOA 4U0ZA 3MX3A 1EF1C 5A23A 1LF8A 5ANLA 4I6GA 4ILHB 3IHYA 1JWGA 2IOLA 2EQXA 3TG5A 3NZUA 2WQ7A 3ZYQA 4EBAA 4GZ5A 5A6CA 4EZJA 4N3AA 1ELWA 2XQ0A 5DBKA 4EZLA 3L6AA 3G2WA 2IQCA 1E8WA 3ZEFA 3PUJA 2UY1A 2OV8A 1SQMA 3CK7A 4P29A 3T8MA 4LCTA 4N2QA 1L5JA 3LJ3A 3JUIA 2QY7A 1ZU2A 1HH8A 4CT4A 2ONDA 3LS8A 3FP3A 2XEVA 5KJKA 2HR2A 4ME2A 2IJGX 4N3BA 1PAQA 2BUGA 2R17C 4GB9A 3UT4A 4HOTA 2XGOA 1INZA 3QARA 2WM9A 3TJPA 3ZYKA 4BY6A 2A5UA 4QFVA 3BEEA 4U07A 4GA0A 3T5XA 4IYPA 4JW1A 4IN3B 2C0MA 3MA5A 3MZLB 1UN9A 3TXMA 2X6IA 5EKQD 1X5BA 2LO6A 3SFZA 3D9LA 2KCVA 2J08A 3OXLA 3AS8A 2CG3A 4G11A 3VLFA 5C2YA 2KM4A 3CVUA 3URZA 4I9EA 4GA1A 4CRWA 3O4ZA 4LRZA 5EDSA 5G05C 3FUEA 2CHZA 4JC8A 3CV0A 4BT8A 4JPSA 4L23A 3HVEA 3S7BA 2WXMA 5A7DB 2WXIA 4A55A 3ASHA 1EYHA 2V8SE 4JHJA 3SNXA 5AENA 5ANRA 1ZBPA 3FUKA 3KEZA 3QDNA 2CFZA 2AXUA 2NSZA 3OXGA 3IEGA 1HG5A 2NXPA 1Z3YA 5JJTA 5CCMA 4ABNA 5BV0A 3C98A 2CHXA 3CK9A 3FY4A 5HQ8A 5FWQA 4I6EA 2WXPA 4DLOA 2RG8A 4AIFA 4HXIA 3OXFA 2I6HA 3L13A 2WMNA 3CHMA 4U04A 5G04C 3CQGB 1H0AA 3ONKA 4HFGA 3QC1A 3FUFA 3QNKA 4DLQA 4J6IA 3P2BA 1HE8A 1E7UA 5FQ8A 1HS6A 3PUKA 3CLJA 4GU5A 1IQUA 2LAIA 4ACKA 2R59A 2GGFA 2WXLA 3UPVA 4UWHA 2LNIA 4TUUA 5EX3A 3MV3B 1H2VC 4DPRA 4UWLA 3LY9A 4HVBA 1E96B 3ZRHA 3RK6A 3ASGA 5BW8C 2YNQA 3PDNA 3RRUA 4CEMA 5J08A 3AS4A 2IFUA 4YVOA 2ILRA 4HOQA 5FZRA 4FU3A 5D0QD 3FTSA 5AYWD 1KT1A 5G55A 4ILIA 3UX4A 3CVLA 4KZ0A 3HVEB 2Y4TA 3ZIMA 5FTPA 2HYZA 2I2OA 4RSYA 2X6KA 2VGXB 4L7TA 2Q7FA 4AM9A 5JHAA 1HG2A 4XKCA 4K0RA 2XGSA 3K9IA 3ZGQA 3MJWA 2JEKA 4UI9C 3FUIA 4E85A 3U3WA 3EIJA 5FZQA 3ZYLA 4I17A 2R5SA 3G2UA 3PNTB 4LUNU 4BWRA 3ZVVA 4AXHA 3B7TA 3PEUB 3CEQA 5KCMA 4WNEA 4GMJA 4L2LA 3RJVA 4B94A 4GZDA 3FHEA 2VTBB 2VJ8A 1PC2A 2L6JA 2KZTA 3SZ7A 2Y3AA 3I3NA 3RO3A 3RO2A 3JQ1A 1Z3XA 4HLEA 3FFLA 2WXQA 4CDRA 3SGHA 5BT1A 1OUVA 4HS2A 3FTZA 3L16A 3R7RA 3ML9A 3JQ0A 1N52A 3Q4AB 4GMLA 2A4ZA 4JA7A 2I1KA 4UWKA 3VLEA 2QFCA 3L08A 2AXVA 2GRMA 4NRHB 4WNFA 3CR3A 3UT8A 3T5VA 1H19A 3EDTB 4C0MA 2OVBA 4C0EA 3EHNA 4LEUA 3Q49B 1QQEA 2X6JA 3MEKA 3ZN3A 4GCOA 4Q94A 3SBTB 4KZCA 4FC8A 2I9CA 3PZDA 3D9JA 4AJWA 2UWJG 4FADA 3HIZA 4JA9A 3ZFWA 5JJ6A 2RD0A 3APFA 2AXZA 3FU0A 2XPZA 2XPIA 4V3IA 1E90A 2J4DA 4FHKA 4KYOB 5BPPA 4PDXA 4RG6A 3CHSA 3QWVA 3FH5A 3L17A 3QJZA 3FUNA 4YVQC 1U3CA 4BFRA 4JEUA 4KVOA 4EBAG 3D9NA 1HF8A 5FQ4A 3FU6A 2XRZA 1QZ2A 2X38A 3RRMB 3ZYMA 3FWVA 2V0PA 5LFAA 2L0IA 2VSXE 3TGOA 3VLDA 3LXUX 3LPZA 4XZ4A 3ZPJA 3AU5A 1E8XA 3JCKC 4AY5A 4ILGA 2UY1B 4HOUA 4U0SA 2PM7A 5LOZA 4B8AA 3P1UA 1KT0A 5BNWA 4H7YA 1HX8A 4IRUA 4AVXA 3CSFA 2XCCA 1XGWA 4A1SA 1FVHA 3APCA 5AJDA 5HI7A 3TG4A 1IHGA 2DBAA 4EQFA 5CMWA 2L0TB 4GZCA 4MLPA 2J09A 4I2WA 4Q96A 2LAHA 3JYSA 3NQPA 4BX9A 4GZ3A 4DI3A 2FF4A 4R7LA 4XE0A 1DNPA 4FJZA 3MKRA 4J8EA 4C9BB 4AY6A 2XRYA 3QWPA 4I1OB 3R9AB 3NF1A 3ASDA 4J8SA 3L22A 4JHKA 4KMOA 5CHEE 5T3RA 4TRQA 3CKCA 3WXXA 3CHOA 4I9CA 1TEZA 4J0UA 3PE4A 4EPZA 3U4TA 1IYGA 4FHJA 2AWIA 1EPUA 3FUMA 4AP2A 1UJKA 2J49A 5AIJA 2MRIA 2XGMA 5E75A 3ULQA 2ZU6B 3ML8A 2CHWA 4GZ6A 4CGWA 3TXNA 3CVXA 3QK0A 1Y6IA 5LP0A 3D3MA 3GZSA 4BTAA 3LYAA 1WY6A 2MOWA 4L1BA 3MV2B 3GYZA 1JPLA 3D9PA 2VSNA 4UQZA 1YA0A 3UMVA 3EIQC 5FT9A 4PS7A 1EDUA 1MHQA 2WMOA 4UWFA 2KZTB 2YQ8A 3PEVB 1JUQA 4PUCA 5EX0A 2M63A 1B89A 5LCWJ 3CKBA 4XI9A 3SD5A 4B89A 2JLBA 2WQHA 3FUHA 5T8IA 3CK8A 4W9RA 4FULA 1TJFA 2WB2A 4GA2A 3S7FA 3FH8A 4UI9J 1NZNA 5BV1A 5CCLA 4XX5A 4HORA 4HOSA 4UI9K 1GW6A 2WXFA 3BG0B 5DIZA 2VTBA 2FEZA 3PVLA 2J4BA 4APFA 4AV7A 4J8FA 4D10C 1HO8A 1IQRA 4JXTA 4UQYA 2WXJA 3ASFA 5D0OD 2HO1A 4ANXA 1DVPA 4B0ZA 3FEYA 3G2TA 3PREA 4A1GA 2Y4UA 5E76A 4AOFA 3QAQA 4GCNA 1TJCA 4N2SA 3U64A 2VSOE 3GZ1A 3MYVA 3S7DA 1E7VA 4G23A 4WWOA 2C0LA 4CDNA 4U63A 1FCHA 3KAEA 3TL5A 3O48A 1E8YA 3LEWA 3MCXA 3CSTA 4G1TA 4FP7A 1HU3A 3S2AA 4MS6A 2VGYA 3FH7A 4Q69A 2DCPA 5FJYA 4XKBA 2CG2A 3FTWA 2KCKA 1PY1A 3B7UX 5KJLA 3D9MA 2L9BA 3I4RB 3RKVA 3IBEA 3U9WA 1HFAA 2DIWA 4FLBA 2KC7A 4FLHA 5LX8A 2C2LA 3DPDA 4XIFA 4M3OA 4TV3A 5FQ7A 3OTNA 3APDA 3D9OA 2WVIA 4K03A 4MKTA 3CQCB 2PM6A 1NP7A 2VYIA 3FDHA 4MRUA 1FVFA 3Q47B 5BUZA 2WXHA 5LCWC 1U3DA 2MHKA 3HDXA 3LVRE 4G24A 4I2ZA 3PH0C 4A3TA 3TAXA 4BX8A 1OWMA 4JHRA 2IONA 3HHMA 4KBQA 2PQNA 3FUDA 3ZW3A 1SZ9A 3ESLA 1W3BA 4G2VA 3R7QA 3FEXA 5G05J 4U0UA 2FI7A 3GW4A 4BSXA 1ELRA 3QWWA 1HXIA 4E6HA 5ENNA 3EJNA 3LY7A 1H2UA 4ANVA 1OWNA 3VTXA 4A3VA 3RIBA 2XCBA 4CT0A 1KLXA 4ANUA 3Q5MA 4JZYA 4GPKA 3G2VA 3L54A 3AU4A 5FQ6A 3IHVA 3NZSA 4I43A 4KT6B 4FA6A 1H2TC 5KJNA 4F7AA 4Y6CA 2VSYA 4GYWA 3CHPA 2XPYA 4JVSA 2YINA 2X6HA 3EHMA 2X3MA 2WPVA 1UG3A 4B8CB 2AW6A 4CDMA 2GW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXT A;  1EYH A;  1HG2 A;  1HFA A;  2V8S E;  3D9P A;  3ZYM A;  2DIW A;  4FLB A;  4NAC A;  2L0I A;  1EDU A;  1DVP A;  1MHQ A;  3G2S A;  3G2W A;  3ZYL A;  3G2T A;  3D9K A;  1HG5 A;  2BF0 X;  3G2U A;  1X5B A;  2LO6 A;  1JUQ A;  1JWF A;  4Q94 A;  3D9L A;  3D9O A;  3RRU A;  3ZYK A;  5J08 A;  5LOZ A;  2QY7 A;  1VDY A;  1ELK A;  3G2V A;  3D9J A;  1SZA A;  4FU3 A;  4GZD A;  1HX8 A;  3ONL A;  4AVX A;  1XGW A;  2KM4 A;  1UJK A;  1UJJ A;  1H0A A;  2DCP A;  3D9I A;  3ONK A;  1LF8 A;  4HFG A;  3LDZ A;  5CMW A;  5LP0 A;  1SZ9 A;  1JWG A;  2L0T B;  4GZC A;  1PY1 A;  5CMY A;  4Q96 A;  1INZ A;  2MOW A;  3D9M A;  3ZYQ A;  3CLJ A;  3D9N A;  1HF8 A;  1JPL A; 
#chains in the Genus database with same CATH topology
 1K3Z D;  2WXR A;  1HZ4 A;  4FJY A;  4CCA A;  2HM8 A;  1N4R A;  4UWG A;  4XEI G;  1SZA A;  4ACL A;  4I6J A;  3U66 A;  2KAT A;  3AS5 A;  3NOC D;  2R05 A;  1AWC B;  3ABL E;  4OAU C;  2OOE A;  5ARG A;  1UW4 B;  4J8D A;  3HG0 D;  3MGB A;  4OYS A;  4BER A;  2GRL A;  1JWF A;  4HRM B;  5T4Y A;  4GTT A;  4F6R D;  4PS8 A;  3Q15 A;  4I1A A;  3MKQ B;  1E8Z A;  1D8D A;  4WUY A;  4OVU A;  1WM5 A;  3NBN B;  3LDZ A;  4GYO A;  4N39 A;  3UT7 A;  3TWV A;  2PL2 A;  3FUJ A;  3DSW A;  3DBS A;  1SA4 A;  2XHE A;  1VDY A;  1BPO A;  2BTD A;  1RZ4 A;  5AJL A;  4GPM A;  4F53 A;  4G25 A;  4AEZ C;  1N11 A;  2WXK A;  4G26 A;  1UJJ A;  2PQR A;  4PH4 B;  3FUL A;  3JXJ A;  4DRX E;  3RU0 A;  3VTY A;  1Z6T A;  1H6P A;  3S7J A;  2V5F A;  3SF4 A;  3NB2 A;  1N54 A;  1TNZ A;  5HRY A;  3WG7 E;  2IF4 A;  4A63 B;  4JL0 A;  3ONL A;  4N5C A;  3RRN B;  3E30 A;  3MX3 A;  3DST A;  3TWR A;  5FIO A;  1YCS B;  4EBA A;  2R02 A;  4EZJ A;  1ELW A;  2XQ0 A;  3L6A A;  1OCO E;  3CK7 A;  3T8M A;  4LCT A;  4BEP A;  4N2Q A;  2ZGG A;  3UIO C;  2HR2 A;  2IJG X;  4N3B A;  2BUG A;  2XGO A;  2WM9 A;  1TNB A;  4U96 D;  4U07 A;  3LJN A;  2P9L G;  4GA0 A;  4IYP A;  1TN6 A;  1JCR A;  3TXM A;  5EKQ D;  3UI2 A;  2J08 A;  4K5A B;  2R2L A;  1OCC E;  3AS8 A;  2CG3 A;  3CVU A;  2KM4 A;  3PZ3 A;  4CRW A;  4LRZ A;  3UXG A;  4BT8 A;  4JC8 A;  1JCS A;  4L23 A;  3HVE A;  2WXI A;  1FPP A;  5AEN A;  1ZBP A;  3KEZ A;  3OXG A;  4U7E B;  1HG5 A;  2CHX A;  3DEO A;  5FWQ A;  4I6E A;  2RG8 A;  3L13 A;  2WMN A;  5G04 C;  4GTO A;  1HE8 A;  1HS6 A;  1U2V G;  4GU5 A;  1IQU A;  4ACK A;  3UPV A;  2LNI A;  4HI8 A;  1H2V C;  4DPR A;  4UWL A;  3ZKJ A;  2YNQ A;  3UIN C;  4O1O A;  2IFU A;  5D0Q D;  4ILI A;  3UX4 A;  3CVL A;  1BLX B;  2Y4T A;  5CBO A;  3TWT A;  3BU8 A;  3X2Q E;  4RSY A;  1UOH A;  2Q7F A;  4AM9 A;  1DCE A;  2JEK A;  3FUI A;  3U3W A;  4LNG A;  2BED A;  4LUN U;  4RQI A;  1KZO A;  5D66 A;  3RJV A;  2H6G A;  3SZ7 A;  3I3N A;  3RO2 A;  5BT1 A;  3ML9 A;  2DYS E;  4RLY A;  2A4Z A;  4LNB A;  4K5B A;  3UM3 A;  3T5V A;  3EDT B;  2OVB A;  3EHN A;  4LEU A;  4Q94 A;  4M7C A;  1N94 A;  3TWX A;  2XPZ A;  4V3I A;  1E90 A;  4UUC A;  4KYO B;  3CHS A;  3QWV A;  4YVQ C;  3DPY A;  4JEU A;  3D9N A;  1HF8 A;  5FQ4 A;  5CED B;  2V0P A;  2L0I A;  1G3N B;  1E8X A;  4AY5 A;  4HOU A;  2RKK A;  2F0Y A;  1KT0 A;  2XZD G;  4G8K A;  4IRU A;  3CSF A;  3B7B A;  4J8Y A;  1FVH A;  4GTP A;  5HI7 A;  2DBA A;  4MLP A;  4J8E A;  2DYR E;  2XRY A;  3QWP A;  3NF1 A;  5AQA A;  5CHE E;  3TWW A;  2IEJ A;  5AQB A;  4EPZ A;  1IYG A;  3V2O A;  4FHJ A;  2AWI A;  3ULQ A;  3D3M A;  3GZS A;  4BTA A;  1WY6 A;  1JPL A;  2P9U G;  4UQZ A;  1YA0 A;  3DXK G;  3EIQ C;  3DSX A;  5FT9 A;  2WMO A;  1MHQ A;  3PZ2 A;  3Q9U C;  4PUC A;  5EX0 A;  4XI9 A;  3SD5 A;  4HLL A;  1Q2Z A;  1TJF A;  3C3Q A;  4GA2 A;  3S7F A;  2V4H C;  4UI9 K;  1GW6 A;  5DIZ A;  1N0R A;  4J8F A;  5D0O D;  1YYH A;  1DVP A;  3G2T A;  3PRE A;  4AOF A;  4N2S A;  3PZ4 A;  2VSO E;  4WWO A;  4CDN A;  2C0L A;  2EIJ E;  3TL5 A;  1FCH A;  5B3S E;  1K8K G;  2EIM E;  4G1T A;  4DX1 A;  3FH7 A;  5FJY A;  3FTW A;  3EU5 A;  2H6F A;  5KJL A;  3D9M A;  2L9B A;  3RKV A;  2DIW A;  2EIK E;  4MRU A;  3D9O A;  2WVI A;  3CQC B;  5BUZ A;  3Q47 B;  5AAR A;  5LCW C;  3HDX A;  2MHK A;  4I2Z A;  4A3T A;  3TAX A;  4BX8 A;  4ZHB A;  1WG0 A;  2XS8 A;  3ESL A;  1W3B A;  4G2V A;  3R7Q A;  3FEX A;  5G05 J;  4BSX A;  1O1R A;  1HXI A;  4E6H A;  5ENN A;  3EJN A;  4ANV A;  1KLX A;  4ANU A;  3UIP C;  4GPK A;  1WDY A;  4C48 B;  4KT6 B;  3AAA C;  1N4S A;  2XZT G;  3CHP A;  4JVS A;  2ETA A;  3EHM A;  1UG3 A;  4WWP A;  5ITZ F;  5G04 J;  4JEH A;  3D9K A;  3PE3 A;  3ESK A;  4EEC A;  3B7R L;  5H7P A;  3ZUV B;  2AVP A;  3OAW A;  1P5Q A;  4PS3 A;  5AAO A;  1X81 A;  3KEA A;  3EUV A;  4U8Y D;  5M72 A;  4TUM A;  4OAV B;  1S0P A;  2LSU A;  2Y69 E;  4XI0 A;  4L2Y A;  3LVQ E;  1NFI E;  4O1P A;  3IKO B;  3FTV A;  5FIN A;  2WXO A;  3CVV A;  1OWL A;  3B13 A;  2R03 A;  3B7S A;  3PNL B;  3FTX A;  3E37 A;  5KBA A;  2OVF A;  1K1B A;  3TWS A;  2NC9 A;  2A5E A;  4F3V A;  2DZN A;  3CHR A;  3E33 A;  1SW6 A;  4DJA A;  4CGV A;  5JHB A;  2RFM A;  2X6F A;  3FU3 A;  4DI4 A;  1OWO A;  3CVN A;  5CMY A;  2FO7 A;  4NQ0 A;  5C1D A;  1QNF A;  4EZK A;  1A17 A;  3PS6 A;  4UQX A;  1ELK A;  3ZXS A;  2RFA A;  4YDY A;  3FTY A;  5A23 A;  2IOL A;  3ZYQ A;  4GZ5 A;  3DWL G;  5DBK A;  2F37 A;  3G2W A;  3ZEF A;  3PUJ A;  2OV8 A;  4G8L A;  2QY7 A;  3HXC A;  5AQ7 A;  4CT4 A;  2IY0 C;  4BY6 A;  3ZYK A;  4QFV A;  4NIK A;  2C0M A;  4EHM A;  4GTV A;  1X5B A;  2LO6 A;  2KCV A;  5CEA A;  3OXL A;  4G11 A;  3UTM A;  4Z68 A;  3URZ A;  4I9E A;  3O4Z A;  3FUE A;  4BES A;  4A55 A;  3ASH A;  2V8S E;  3SNX A;  3W9G A;  2NSZ A;  1N9A A;  3IEG A;  2JAB A;  2NXP A;  5JJT A;  3CK9 A;  3FY4 A;  2WXP A;  4AIF A;  4HXI A;  3CQG B;  1H0A A;  2B6C A;  4HFG A;  1TYQ G;  1TNO A;  5FQ8 A;  3PZ1 A;  2GGF A;  3HXF A;  1S64 A;  4X8Q A;  3LY9 A;  3ASG A;  5BW8 C;  3AS4 A;  4JD2 G;  3ABK E;  1OCZ E;  4YVO A;  2ILR A;  4FU3 A;  3SQV A;  5AYW D;  2KBX A;  5G55 A;  4GTS A;  2QZA A;  3DSU A;  2I2O A;  2X6K A;  3D9H A;  4L7T A;  2Y0B G;  1HG2 A;  4K5C A;  4XKC A;  1DC2 A;  2XGS A;  3K9I A;  4UI9 C;  1AP7 A;  2B0O E;  3ZYL A;  5FZQ A;  4I17 A;  2R5S A;  4DX5 D;  4BWR A;  4AXH A;  4B94 A;  3FHE A;  2KZT A;  3RO3 A;  4HLE A;  5CRU A;  4TXR A;  3L16 A;  3R7R A;  4GML A;  3ZXP A;  3T9K A;  2QFC A;  3UT8 A;  4WNF A;  2H6I A;  4C0M A;  3Q49 B;  2ZIR A;  4FC8 A;  3PZD A;  2UWJ G;  4HB5 A;  3APF A;  2XPI A;  4FHK A;  4RG6 A;  4EBA G;  3FH5 A;  3L17 A;  3QJZ A;  4KVO A;  3ZYM A;  2L6B A;  2VSX E;  3TGO A;  3LXU X;  3LPZ A;  4QQI A;  3ZPJ A;  3AU5 A;  2UY1 B;  4B8A A;  1XGW A;  4A1S A;  3HXD A;  3APC A;  3DSV A;  4GZC A;  4Q96 A;  2LAH A;  3NQP A;  4BX9 A;  4ATZ D;  4C9B B;  4AY6 A;  3R9A B;  3ASD A;  4JHK A;  4KMO A;  5T3R A;  4TRQ A;  4I9C A;  1TEZ A;  1EPU A;  3FUM A;  4AP2 A;  5E75 A;  4CGW A;  1BI8 B;  5B1B E;  1Y6I A;  3LYA A;  2MOW A;  3MV2 B;  2QYJ A;  2V5Q C;  2VSN A;  1A5E A;  4PS7 A;  2YQ8 A;  1JUQ A;  2WB2 A;  2M63 A;  4GTM A;  1SVX A;  3CKB A;  2WQH A;  1NZN A;  1RW2 A;  1MX6 A;  4XX5 A;  4HOR A;  4D10 C;  4B0Z A;  3FEY A;  2Y4U A;  4LSZ E;  2BKK B;  5EYP F;  2GRP B;  5ENS D;  3Q7A A;  3MYV A;  3S7D A;  4U63 A;  3MCX A;  1HU3 A;  4MS6 A;  4Q69 A;  2DCP A;  5HS0 A;  3F6Q A;  2P9N G;  1HFA A;  4FLB A;  2C2L A;  1S63 A;  4TV3 A;  2KXP C;  5CCL A;  3APD A;  4K03 A;  3AG2 E;  1MX2 A;  2QYU A;  2ZGD A;  2XEH A;  5EID A;  4G24 A;  4BET A;  5AN8 A;  4GMR A;  2PNN A;  3ZW3 A;  4U0U A;  2FI7 A;  1ELR A;  3QWW A;  5EYL A;  4YDE A;  3LY7 A;  4A3V A;  3AG1 E;  4CT0 A;  3G2V A;  3L54 A;  3IHV A;  4DX6 D;  4Y6C A;  4YDO A;  2VSY A;  4GYW A;  2YIN A;  2X6H A;  2QC9 A;  2AW6 A;  3CIA A;  4LNU D;  5FZS A;  3C3R A;  4OVV A;  5ENQ D;  4WWN A;  2IU1 A;  3BQO A;  3N71 A;  1K1A A;  2J07 A;  4KVM A;  3ZHE A;  5CER B;  3ZHE B;  3UM0 A;  5CEC B;  4YND A;  3UUX A;  3LY8 A;  4GAA A;  3IV0 A;  4NAC A;  5CRV A;  1MQS A;  3QOU A;  1H6K A;  4RVB A;  3BUA A;  3I5P A;  3QB2 A;  3SHF A;  4O6F A;  3SY2 A;  2V4L A;  3BG1 B;  4CEM A;  1IHB A;  4BTB A;  1UN8 A;  2I1J A;  2F8X K;  3UQ3 A;  4WND A;  2GRO B;  3PRZ A;  4U8H A;  3I4G A;  1MZC A;  4URK A;  4GYY A;  3CGH A;  4NUR A;  2BF0 X;  2YHE A;  4WNG A;  2LSV A;  1MYO A;  1IKN D;  4DK5 A;  4I1M A;  1NA3 A;  3B95 A;  3V30 A;  5ARF A;  5HKP A;  3QKY A;  2WQ6 A;  2IO3 C;  4F1S A;  1KZP A;  3HYM B;  3UKR G;  4N3C A;  2FUL A;  1LD8 A;  1OWP A;  1XNF A;  3EHQ A;  4U0Z A;  1LF8 A;  5ANL A;  3IHY A;  2EQX A;  5A6C A;  3Q78 A;  3JXI A;  1SQM A;  4P29 A;  3LJ3 A;  2FO1 E;  5CBN A;  3JUI A;  1ZU2 A;  1HH8 A;  2XEV A;  3ULE G;  5KJK A;  3UT4 A;  2R17 C;  1NI1 A;  4GB9 A;  3HRA A;  3TJP A;  3BEE A;  3T5X A;  1Z5S C;  3MZL B;  1UN9 A;  3ZU7 B;  3D9L A;  3V79 K;  4L9P A;  5C2Y A;  4GA1 A;  5G05 C;  3CV0 A;  2WXM A;  5A7D B;  4JHJ A;  3QDN A;  2AXU A;  3AG3 E;  1D9S A;  3UKU G;  4ABN A;  4YDW A;  2I6H A;  1LTX A;  5B1A E;  3ONK A;  4DLQ A;  2GRQ B;  3ULY A;  2LAI A;  1OXJ A;  4UWH A;  5EX3 A;  2DVW A;  4TUU A;  4B93 B;  3RK6 A;  1TN8 A;  3PDN A;  5FZR A;  2HE0 A;  2GRN B;  3FTS A;  1KT1 A;  3HVE B;  5FTP A;  1FT1 A;  3EHR A;  2HYZ A;  2Y1L E;  2VGX B;  5JHA A;  1ZB1 A;  2VGE A;  4K0R A;  3ZGQ A;  3MJW A;  4E85 A;  3ZVV A;  3B7T A;  3PEU B;  3CEQ A;  4WNE A;  3W9F A;  4GMJ A;  4L2L A;  1PC2 A;  2L6J A;  2LXM A;  3JQ1 A;  3FFL A;  2WXQ A;  4CDR A;  5EN5 D;  1OUV A;  3FTZ A;  2OEW A;  3JQ0 A;  2DZO A;  1N52 A;  3Q4A B;  4JA7 A;  2I1K A;  2F8Y A;  4UWK A;  3VLE A;  3CR3 A;  2LUH A;  5EIB E;  1QQE A;  3MEK A;  3SBT B;  4FAD A;  3R9M A;  3HIZ A;  4HRN A;  3ZFW A;  5JJ6 A;  2AXZ A;  3FU0 A;  5BPP A;  4HI9 A;  1U3C A;  1QZ2 A;  2X38 A;  3RRM B;  5LFA A;  1YMP A;  5D2M C;  3V31 A;  4ILG A;  2PM7 A;  4BSZ B;  5BNW A;  4H7Y A;  3L9T A;  4EQF A;  2L0T B;  2J09 A;  4I2W A;  3JYS A;  4DI3 A;  3ISM C;  4GZ3 A;  2J8S D;  3AJI A;  3L22 A;  3CKC A;  3WXX A;  3CHO A;  1N0Q A;  5ENP D;  1UJK A;  2J49 A;  2MRI A;  2XGM A;  2ZU6 B;  2CHW A;  1V54 E;  5LP0 A;  1OY3 D;  4L1B A;  1EDU A;  3TWQ A;  3PEV B;  5LCW J;  2JLB A;  5T8I A;  4CYM D;  4W9R A;  4FUL A;  2OCC E;  3FH8 A;  4UI9 J;  3SO8 A;  2FEZ A;  4TXQ A;  4O60 A;  4JXT A;  2OEV A;  4ANX A;  3QAQ A;  1TJC A;  3U64 A;  4CZ2 D;  1E7V A;  4G23 A;  3RAU A;  3KAE A;  3CST A;  2VGY A;  1KPS B;  1PY1 A;  3I4R B;  3IBE A;  2KC7 A;  4FLH A;  3DPD A;  4XIF A;  3OTN A;  4MKT A;  1IXV A;  2VYI A;  3FDH A;  1FVF A;  1O1S A;  1U3D A;  3PH0 C;  1JCQ A;  1OWM A;  4JHR A;  3HXE A;  3HHM A;  3FUD A;  1SZ9 A;  3KSL A;  3Q7F A;  3E34 A;  1OWN A;  3VTX A;  1TNU A;  3RIB A;  3E32 A;  3AU4 A;  4I43 A;  5KJN A;  1SA5 A;  5ENO D;  1DCQ A;  1S70 B;  2X3M A;  2WPV A;  2ETC A;  4B8C B;  4CDM A;  3KS2 A;  3IXE A;  3GZ2 A;  5KJM A;  2WXN A;  3ASN E;  3E4B A;  3CVW A;  3SBS A;  4LER A;  4HNA D;  5AQ9 A;  5G2N A;  2E2E A;  3CVY A;  1WAO 1;  2PZI A;  2E0I A;  4TXP A;  5JJ7 A;  3LCA A;  4GTR A;  3Q79 A;  2WXG A;  4U95 D;  3ASO E;  4H7X A;  3L82 A;  2XEN A;  3MKQ A;  5KNH D;  3CHQ A;  4WAF A;  2VGX A;  3D9I A;  3LKU A;  4IUL A;  4LG6 A;  1BI7 B;  1NA0 A;  4GTQ A;  3C72 A;  2KCL A;  3KD7 A;  3SI5 A;  4ANW A;  3G2S A;  3CVQ A;  3AG4 E;  2FBN A;  2H6H A;  2CFU A;  5EIL A;  2ETB A;  2VQ2 A;  2MYO A;  4KXK B;  3CVP A;  3ENE A;  2IOS A;  4RG9 A;  3C3O A;  2P58 C;  4BT9 A;  4J7W A;  1N4P A;  1MX4 A;  2J9Q A;  2YHC A;  5J90 A;  3FU5 A;  1Y8M A;  3Q75 A;  4Y6W A;  4ATG A;  3FTU A;  4APO A;  1EF1 C;  3HXB A;  4I6G A;  4ILH B;  1JWG A;  3TG5 A;  3NZU A;  2WQ7 A;  3T8K A;  4N3A A;  4EZL A;  2IQC A;  1E8W A;  2UY1 A;  4U8V D;  1TNY A;  1L5J A;  2OND A;  3LS8 A;  3FP3 A;  4ME2 A;  1PAQ A;  4HOT A;  1INZ A;  5IY5 E;  3QAR A;  4N5Q A;  2A5U A;  4JW1 A;  4IN3 B;  3MA5 A;  1OT8 A;  4ZFH A;  2X6I A;  3SFZ A;  4DX2 A;  3VLF A;  5EDS A;  2CHZ A;  1QYM A;  4JPS A;  3S7B A;  1N4Q A;  1EYH A;  2EIN E;  2AJA A;  5ANR A;  3FUK A;  2CFZ A;  1MJ0 A;  3DEP A;  3DSS A;  1Z3Y A;  5CCM A;  5BV0 A;  3C98 A;  5HQ8 A;  2XS1 A;  1FT2 A;  4DLO A;  2GRR B;  4HRL A;  3OXF A;  3CHM A;  4U04 A;  3QC1 A;  3FUF A;  3QNK A;  4J6I A;  3P2B A;  1E7U A;  3PUK A;  3CLJ A;  2R59 A;  2WXL A;  3Q73 A;  3MV3 B;  4HVB A;  1E96 B;  3ZRH A;  2IO2 C;  2P9S G;  3RRU A;  5J08 A;  1BU9 A;  4HOQ A;  4KZ0 A;  3ZIM A;  5KWD A;  3C5R A;  3DRA A;  2P9I G;  3EIJ A;  4DUI A;  5JA4 D;  3G2U A;  3PNT B;  5ENT D;  3SFY A;  5KCM A;  2VTB B;  4GZD A;  2VJ8 A;  2Y3A A;  1Z3X A;  3SGH A;  1QBQ A;  4HS2 A;  4HBD A;  5JMN D;  3L08 A;  2AXV A;  2GRM A;  4NRH B;  3DXM G;  1H19 A;  4C0E A;  2X6J A;  3ZN3 A;  4GCO A;  2NYJ A;  4KZC A;  4F1P A;  2I9C A;  3D9J A;  4AJW A;  2BKG A;  1O5M A;  4JA9 A;  2RD0 A;  3TWU A;  2J4D A;  1N95 A;  4PDX A;  4BFR A;  3FUN A;  2XRZ A;  3FU6 A;  2ZXW E;  3FWV A;  5BXO A;  3VLD A;  4XZ4 A;  3UM2 A;  3ZNG A;  3JCK C;  5ENR D;  4U0S A;  5LOZ A;  1TN7 A;  3P1U A;  1D8E A;  1HX8 A;  4AVX A;  2XCC A;  2DWZ A;  5AJD A;  3TG4 A;  1IHG A;  4JB8 P;  3SFX A;  3J5Q B;  5CMW A;  2FF4 A;  4R7L A;  4XE0 A;  1DNP A;  4FJZ A;  3MKR A;  4I1O B;  3UM1 A;  4J8S A;  1O1T A;  4J0U A;  3PE4 A;  3U4T A;  1OCR E;  5AIJ A;  3KSQ A;  4GZ6 A;  3ML8 A;  3TXN A;  3QK0 A;  3GYZ A;  1NL4 A;  3D9P A;  3UMV A;  4DX7 D;  4UWF A;  1H6O A;  2KZT B;  1B89 A;  4B89 A;  2XEE A;  3FUH A;  3CK8 A;  3NAW A;  5BV1 A;  4HOS A;  3ABM E;  2WXF A;  3BG0 B;  2VTB A;  3PVL A;  2J4B A;  4APF A;  4AV7 A;  1HO8 A;  1IQR A;  4UQY A;  2WXJ A;  3ASF A;  3NOG D;  4MBG A;  2HO1 A;  3RSE G;  4A1G A;  5E76 A;  4GCN A;  5BXU A;  3GZ1 A;  2ZIS A;  3O48 A;  4HQD A;  1E8Y A;  3LEW A;  4FP7 A;  3S2A A;  2EIL E;  4XKB A;  2CG2 A;  2KCK A;  3JUE A;  3B7U X;  3U9W A;  5LX8 A;  4M3O A;  2LXL A;  5FQ7 A;  2PM6 A;  1NP7 A;  2WXH A;  3Q9N C;  1BD8 A;  1LD7 A;  3LVR E;  3J5P A;  2ION A;  4KBQ A;  2PQN A;  3GW4 A;  2P9P G;  3V2X A;  1H2U A;  2XCB A;  2P9K G;  3Q5M A;  4JZY A;  2P2C P;  5FQ6 A;  3NZS A;  4FA6 A;  1TR4 A;  3EU9 A;  1H2T C;  4F7A A;  5KNG A;  2XPY A;  1V55 E;  3CVX A;  2GW1 A; 
#chains in the Genus database with same CATH homology
 4WWP A;  3CIA A;  5FZS A;  5G04 J;  2WXR A;  3KS2 A;  1HZ4 A;  4OVV A;  4JEH A;  4FJY A;  4CCA A;  4WWN A;  2IU1 A;  3D9K A;  3PE3 A;  3GZ2 A;  2HM8 A;  3ESK A;  4EEC A;  3N71 A;  5KJM A;  2WXN A;  2J07 A;  4UWG A;  3B7R L;  1SZA A;  3E4B A;  4ACL A;  4I6J A;  2AVP A;  3CVW A;  3SBS A;  3OAW A;  4LER A;  3U66 A;  2KAT A;  4KVM A;  1P5Q A;  5G2N A;  4PS3 A;  3AS5 A;  3ZHE A;  2E2E A;  3ZHE B;  3CVY A;  4YND A;  1WAO 1;  2OOE A;  3UUX A;  2PZI A;  5M72 A;  2E0I A;  5ARG A;  5JJ7 A;  1UW4 B;  3LCA A;  3LY8 A;  4GAA A;  4J8D A;  3IV0 A;  4NAC A;  1S0P A;  2LSU A;  3MGB A;  2WXG A;  1MQS A;  4XI0 A;  4OYS A;  3QOU A;  4L2Y A;  2GRL A;  1H6K A;  3LVQ E;  1JWF A;  5T4Y A;  4RVB A;  4H7X A;  3I5P A;  3QB2 A;  3SHF A;  3IKO B;  3FTV A;  4O6F A;  4PS8 A;  3MKQ A;  2V4L A;  2WXO A;  3Q15 A;  3CHQ A;  3BG1 B;  3MKQ B;  2VGX A;  4I1A A;  1UN8 A;  2I1J A;  1E8Z A;  4WAF A;  4BTB A;  3D9I A;  1OWL A;  4WUY A;  3UQ3 A;  4OVU A;  4WND A;  3CVV A;  1WM5 A;  3B13 A;  3LDZ A;  3LKU A;  3B7S A;  4IUL A;  3PRZ A;  3PNL B;  4U8H A;  4GYO A;  4N39 A;  3UT7 A;  1NA0 A;  3FTX A;  2PL2 A;  3I4G A;  2OVF A;  2KCL A;  3FUJ A;  2NC9 A;  3KD7 A;  3SI5 A;  3G2S A;  3CVQ A;  3DBS A;  4ANW A;  4URK A;  4GYY A;  4F3V A;  3CGH A;  4NUR A;  2BF0 X;  2FBN A;  3CHR A;  2CFU A;  2XHE A;  2VQ2 A;  2YHE A;  2LSV A;  4WNG A;  4DJA A;  1VDY A;  4CGV A;  4KXK B;  1BPO A;  4DK5 A;  4I1M A;  5JHB A;  2BTD A;  1NA3 A;  5AJL A;  4F53 A;  5ARF A;  4G25 A;  3CVP A;  4AEZ C;  2WXK A;  2X6F A;  3ENE A;  3FU3 A;  2IOS A;  1UJJ A;  4G26 A;  4RG9 A;  2PQR A;  4DI4 A;  4PH4 B;  1OWO A;  3CVN A;  2P58 C;  3FUL A;  5CMY A;  2FO7 A;  3QKY A;  4BT9 A;  3RU0 A;  2WQ6 A;  3VTY A;  1Z6T A;  4NQ0 A;  4F1S A;  5C1D A;  3S7J A;  1QNF A;  2V5F A;  3SF4 A;  4EZK A;  1N54 A;  1A17 A;  3PS6 A;  2J9Q A;  3HYM B;  2IF4 A;  2YHC A;  4N3C A;  4UQX A;  5J90 A;  4JL0 A;  1ELK A;  3ZXS A;  2FUL A;  3FU5 A;  1Y8M A;  1OWP A;  3ONL A;  4N5C A;  1XNF A;  4Y6W A;  4ATG A;  3FTU A;  3FTY A;  3RRN B;  4APO A;  4U0Z A;  3MX3 A;  1EF1 C;  5A23 A;  1LF8 A;  5ANL A;  4I6G A;  4ILH B;  3IHY A;  1JWG A;  2IOL A;  2EQX A;  3TG5 A;  3NZU A;  2WQ7 A;  3ZYQ A;  4EBA A;  4GZ5 A;  5A6C A;  4EZJ A;  4N3A A;  1ELW A;  2XQ0 A;  5DBK A;  4EZL A;  3L6A A;  3G2W A;  2IQC A;  1E8W A;  3ZEF A;  3PUJ A;  2UY1 A;  2OV8 A;  1SQM A;  3CK7 A;  4P29 A;  3T8M A;  4LCT A;  4N2Q A;  1L5J A;  3LJ3 A;  3JUI A;  2QY7 A;  1ZU2 A;  1HH8 A;  4CT4 A;  2OND A;  3LS8 A;  3FP3 A;  2XEV A;  5KJK A;  2HR2 A;  4ME2 A;  2IJG X;  4N3B A;  1PAQ A;  2BUG A;  2R17 C;  4GB9 A;  3UT4 A;  4HOT A;  2XGO A;  1INZ A;  3QAR A;  2WM9 A;  3TJP A;  3ZYK A;  4BY6 A;  2A5U A;  4QFV A;  3BEE A;  4U07 A;  4GA0 A;  3T5X A;  4IYP A;  4JW1 A;  4IN3 B;  2C0M A;  3MA5 A;  3MZL B;  1UN9 A;  3TXM A;  2X6I A;  5EKQ D;  1X5B A;  2LO6 A;  3SFZ A;  3D9L A;  2KCV A;  2J08 A;  3OXL A;  3AS8 A;  2CG3 A;  4G11 A;  3VLF A;  5C2Y A;  2KM4 A;  3CVU A;  3URZ A;  4I9E A;  4GA1 A;  4CRW A;  3O4Z A;  4LRZ A;  5EDS A;  5G05 C;  3FUE A;  2CHZ A;  4JC8 A;  3CV0 A;  4BT8 A;  4JPS A;  4L23 A;  3HVE A;  3S7B A;  2WXM A;  5A7D B;  2WXI A;  4A55 A;  3ASH A;  1EYH A;  2V8S E;  4JHJ A;  3SNX A;  5AEN A;  5ANR A;  1ZBP A;  3FUK A;  3KEZ A;  3QDN A;  2CFZ A;  2AXU A;  2NSZ A;  3OXG A;  3IEG A;  1HG5 A;  2NXP A;  1Z3Y A;  5JJT A;  5CCM A;  4ABN A;  5BV0 A;  3C98 A;  2CHX A;  3CK9 A;  3FY4 A;  5HQ8 A;  5FWQ A;  4I6E A;  2WXP A;  4DLO A;  2RG8 A;  4AIF A;  4HXI A;  3OXF A;  2I6H A;  3L13 A;  2WMN A;  3CHM A;  4U04 A;  5G04 C;  3CQG B;  1H0A A;  3ONK A;  4HFG A;  3QC1 A;  3FUF A;  3QNK A;  4DLQ A;  4J6I A;  3P2B A;  1HE8 A;  1E7U A;  5FQ8 A;  1HS6 A;  3PUK A;  3CLJ A;  4GU5 A;  1IQU A;  2LAI A;  4ACK A;  2R59 A;  2GGF A;  2WXL A;  3UPV A;  4UWH A;  2LNI A;  4TUU A;  5EX3 A;  3MV3 B;  1H2V C;  4DPR A;  4UWL A;  3LY9 A;  4HVB A;  1E96 B;  3ZRH A;  3RK6 A;  3ASG A;  5BW8 C;  2YNQ A;  3PDN A;  3RRU A;  4CEM A;  5J08 A;  3AS4 A;  2IFU A;  4YVO A;  2ILR A;  4HOQ A;  5FZR A;  4FU3 A;  5D0Q D;  3FTS A;  5AYW D;  1KT1 A;  5G55 A;  4ILI A;  3UX4 A;  3CVL A;  4KZ0 A;  3HVE B;  2Y4T A;  3ZIM A;  5FTP A;  2HYZ A;  2I2O A;  4RSY A;  2X6K A;  2VGX B;  4L7T A;  2Q7F A;  4AM9 A;  5JHA A;  1HG2 A;  4XKC A;  4K0R A;  2XGS A;  3K9I A;  3ZGQ A;  3MJW A;  2JEK A;  4UI9 C;  3FUI A;  4E85 A;  3U3W A;  3EIJ A;  5FZQ A;  3ZYL A;  4I17 A;  2R5S A;  3G2U A;  3PNT B;  4LUN U;  4BWR A;  3ZVV A;  4AXH A;  3B7T A;  3PEU B;  3CEQ A;  5KCM A;  4WNE A;  4GMJ A;  4L2L A;  3RJV A;  4B94 A;  4GZD A;  3FHE A;  2VTB B;  2VJ8 A;  1PC2 A;  2L6J A;  2KZT A;  3SZ7 A;  2Y3A A;  3I3N A;  3RO3 A;  3RO2 A;  3JQ1 A;  1Z3X A;  4HLE A;  3FFL A;  2WXQ A;  4CDR A;  3SGH A;  5BT1 A;  1OUV A;  4HS2 A;  3FTZ A;  3L16 A;  3R7R A;  3ML9 A;  3JQ0 A;  1N52 A;  3Q4A B;  4GML A;  2A4Z A;  4JA7 A;  2I1K A;  4UWK A;  3VLE A;  2QFC A;  3L08 A;  2AXV A;  2GRM A;  4NRH B;  4WNF A;  3CR3 A;  3UT8 A;  3T5V A;  1H19 A;  3EDT B;  4C0M A;  2OVB A;  4C0E A;  3EHN A;  4LEU A;  3Q49 B;  1QQE A;  2X6J A;  3MEK A;  3ZN3 A;  4GCO A;  4Q94 A;  3SBT B;  4KZC A;  4FC8 A;  2I9C A;  3PZD A;  3D9J A;  4AJW A;  2UWJ G;  4FAD A;  3HIZ A;  4JA9 A;  3ZFW A;  5JJ6 A;  2RD0 A;  3APF A;  2AXZ A;  3FU0 A;  2XPZ A;  2XPI A;  4V3I A;  1E90 A;  2J4D A;  4FHK A;  4KYO B;  5BPP A;  4PDX A;  4RG6 A;  3CHS A;  3QWV A;  3FH5 A;  3L17 A;  3QJZ A;  3FUN A;  4YVQ C;  1U3C A;  4BFR A;  4JEU A;  4KVO A;  4EBA G;  3D9N A;  1HF8 A;  5FQ4 A;  3FU6 A;  2XRZ A;  1QZ2 A;  2X38 A;  3RRM B;  3ZYM A;  3FWV A;  2V0P A;  5LFA A;  2L0I A;  2VSX E;  3TGO A;  3VLD A;  3LXU X;  3LPZ A;  4XZ4 A;  3ZPJ A;  3AU5 A;  1E8X A;  3JCK C;  4AY5 A;  4ILG A;  2UY1 B;  4HOU A;  4U0S A;  2PM7 A;  5LOZ A;  4B8A A;  3P1U A;  1KT0 A;  5BNW A;  4H7Y A;  1HX8 A;  4IRU A;  4AVX A;  3CSF A;  2XCC A;  1XGW A;  4A1S A;  1FVH A;  3APC A;  5AJD A;  5HI7 A;  3TG4 A;  1IHG A;  2DBA A;  4EQF A;  5CMW A;  2L0T B;  4GZC A;  4MLP A;  2J09 A;  4I2W A;  4Q96 A;  2LAH A;  3JYS A;  3NQP A;  4BX9 A;  4GZ3 A;  4DI3 A;  2FF4 A;  4R7L A;  4XE0 A;  1DNP A;  4FJZ A;  3MKR A;  4J8E A;  4C9B B;  4AY6 A;  2XRY A;  3QWP A;  4I1O B;  3R9A B;  3NF1 A;  3ASD A;  4J8S A;  3L22 A;  4JHK A;  4KMO A;  5CHE E;  5T3R A;  4TRQ A;  3CKC A;  3WXX A;  3CHO A;  4I9C A;  1TEZ A;  4J0U A;  3PE4 A;  4EPZ A;  3U4T A;  1IYG A;  4FHJ A;  2AWI A;  1EPU A;  3FUM A;  4AP2 A;  1UJK A;  2J49 A;  5AIJ A;  2MRI A;  2XGM A;  5E75 A;  3ULQ A;  2ZU6 B;  3ML8 A;  2CHW A;  4GZ6 A;  4CGW A;  3TXN A;  3CVX A;  3QK0 A;  1Y6I A;  5LP0 A;  3D3M A;  3GZS A;  4BTA A;  3LYA A;  1WY6 A;  2MOW A;  4L1B A;  3MV2 B;  3GYZ A;  1JPL A;  3D9P A;  2VSN A;  4UQZ A;  1YA0 A;  3UMV A;  3EIQ C;  5FT9 A;  4PS7 A;  1EDU A;  1MHQ A;  2WMO A;  4UWF A;  2KZT B;  2YQ8 A;  3PEV B;  1JUQ A;  4PUC A;  5EX0 A;  2M63 A;  1B89 A;  5LCW J;  3CKB A;  4XI9 A;  3SD5 A;  4B89 A;  2JLB A;  2WQH A;  3FUH A;  5T8I A;  3CK8 A;  4W9R A;  4FUL A;  1TJF A;  2WB2 A;  4GA2 A;  3S7F A;  3FH8 A;  4UI9 J;  1NZN A;  5BV1 A;  5CCL A;  4XX5 A;  4HOR A;  4HOS A;  4UI9 K;  1GW6 A;  2WXF A;  3BG0 B;  5DIZ A;  2VTB A;  2FEZ A;  3PVL A;  2J4B A;  4APF A;  4AV7 A;  4J8F A;  4D10 C;  1HO8 A;  1IQR A;  4JXT A;  4UQY A;  2WXJ A;  3ASF A;  5D0O D;  2HO1 A;  4ANX A;  1DVP A;  4B0Z A;  3FEY A;  3G2T A;  3PRE A;  4A1G A;  2Y4U A;  5E76 A;  4AOF A;  3QAQ A;  4GCN A;  1TJC A;  4N2S A;  3U64 A;  2VSO E;  3GZ1 A;  3MYV A;  3S7D A;  1E7V A;  4G23 A;  4WWO A;  2C0L A;  4CDN A;  4U63 A;  1FCH A;  3KAE A;  3TL5 A;  3O48 A;  1E8Y A;  3LEW A;  3MCX A;  3CST A;  4G1T A;  4FP7 A;  1HU3 A;  3S2A A;  4MS6 A;  2VGY A;  3FH7 A;  4Q69 A;  2DCP A;  5FJY A;  4XKB A;  2CG2 A;  3FTW A;  2KCK A;  1PY1 A;  3B7U X;  5KJL A;  3D9M A;  2L9B A;  3I4R B;  3RKV A;  3IBE A;  3U9W A;  1HFA A;  2DIW A;  4FLB A;  2KC7 A;  4FLH A;  5LX8 A;  2C2L A;  3DPD A;  4XIF A;  4M3O A;  4TV3 A;  5FQ7 A;  3OTN A;  3APD A;  3D9O A;  2WVI A;  4K03 A;  4MKT A;  3CQC B;  2PM6 A;  1NP7 A;  2VYI A;  3FDH A;  4MRU A;  1FVF A;  3Q47 B;  5BUZ A;  2WXH A;  5LCW C;  1U3D A;  2MHK A;  3HDX A;  3LVR E;  4G24 A;  4I2Z A;  3PH0 C;  4A3T A;  3TAX A;  4BX8 A;  1OWM A;  4JHR A;  2ION A;  3HHM A;  4KBQ A;  2PQN A;  3FUD A;  3ZW3 A;  1SZ9 A;  3ESL A;  1W3B A;  4G2V A;  3R7Q A;  3FEX A;  5G05 J;  4U0U A;  2FI7 A;  3GW4 A;  4BSX A;  1ELR A;  3QWW A;  1HXI A;  4E6H A;  5ENN A;  3EJN A;  3LY7 A;  1H2U A;  4ANV A;  1OWN A;  3VTX A;  4A3V A;  3RIB A;  2XCB A;  4CT0 A;  1KLX A;  4ANU A;  3Q5M A;  4JZY A;  4GPK A;  3G2V A;  3L54 A;  3AU4 A;  5FQ6 A;  3IHV A;  3NZS A;  4I43 A;  4KT6 B;  4FA6 A;  1H2T C;  5KJN A;  4F7A A;  4Y6C A;  2VSY A;  4GYW A;  3CHP A;  2XPY A;  4JVS A;  2YIN A;  2X6H A;  3EHM A;  2X3M A;  2WPV A;  1UG3 A;  4B8C B;  2AW6 A;  4CDM A;  2GW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...