1H0AA

Epsin enth bound to ins(1,4,5)p3
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
158
structure length
158
Chain Sequence
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPSIN
publication title Curvature of Clathrin-Coated Pits Driven by Epsin
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis
total genus 68
structure length 158
sequence length 158
ec nomenclature
pdb deposition date 2002-06-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1h0aA00
3G2TA 4AVXA 3ZYLA 1HF8A 3D9NA 3G2UA 3G2VA 4FU3A 5CMWA 2QY7A 1EDUA 1HG2A 1X5BA 2KM4A 2L0IA 2MOWA 4HFGA 1EYHA 1DVPA 1HX8A 1UJKA 3D9PA 4Q96A 5LP0A 1JWGA 1VDYA 2DIWA 4JXTA 3ONLA 1HFAA 3D9KA 1JWFA 3ZYMA 3D9LA 1SZAA 3G2WA 2LO6A 3CLJA 1HG5A 1JPLA 1JUQA 2V8SE 3LDZA 3ONKA 4GZDA 4GZCA 4Q94A 5CMYA 2L0TB 1XGWA 2BF0X 1H0AA 1LF8A 1PY1A 3G2SA 3D9JA 3ZYQA 1UJJA 5LOZA 2DCPA 3ZYKA 5J08A 1MHQA 3D9MA 1INZA 1ELKA 4FLBA 3D9OA 1SZ9A 3D9IA 4NACA 3RRUA
chains in the Genus database with same CATH superfamily
5G2NA 1QZ2A 2VJ8A 3JXJA 1IKND 1VDYA 1L5JA 4HXIA 4GPMA 4WNEA 3ISMC 4I6JA 5HS0A 3O48A 4U04A 3ASFA 2YHEA 3IXEA 4JC8A 4U0UA 3FTVA 3HIZA 3FEXA 2J4DA 1ZBPA 3TWTA 1IXVA 1MYOA 3ZN3A 4L23A 3MKRA 5HI7A 2WVIA 4YDEA 2EILE 5JA4D 1LF8A 2XEVA 4I1OB 2WPVA 2VSNA 4RG9A 4PS3A 3T8KA 1BI7B 2XENA 3AG3E 5C1DA 4E85A 2OEWA 4XEIG 2ETCA 3QWVA 1NL4A 2LAHA 4JEHA 5ENSD 1ZB1A 3IHVA 3LY8A 5D66A 3PREA 2F8XK 4GTOA 3C3QA 4C9BB 3KSLA 5CRVA 1H2TC 4YDOA 1U2VG 2UWJG 3BG0B 3KSQA 2OEVA 4BX8A 3TGOA 3CVYA 4GA0A 3R7QA 4TUMA 5BUZA 3TWSA 1IHBA 5EX3A 4KMOA 4BTAA 5LX8A 2ILRA 3RU0A 3T5VA 1H2UA 4EZJA 2F37A 3AJIA 2GRPB 1H2VC 4GMRA 1X81A 2RKKA 4HVBA 4J8YA 3Q9UC 2UY1B 3B95A 2Y1LE 4D10C 3PVLA 1RZ4A 4ZFHA 1HH8A 3CGHA 3PUKA 3ZYLA 3EU5A 5BXOA 1HE8A 3I4GA 4JXTA 2UY1A 4DX1A 1NFIE 1N4RA 3ZYMA 3D9HA 2XHEA 3FFLA 3FH8A 2CG3A 4GA2A 3JXIA 4HQDA 2VSYA 1FVFA 3CKCA 2MOWA 3FULA 4QFVA 5DIZA 3L54A 3FH7A 1WDYA 3DBSA 3CVNA 2CHXA 1N9AA 4EZKA 1EF1C 3FTWA 4AY5A 1HF8A 3Q75A 4W9RA 3NOGD 4EPZA 1SA4A 3IV0A 4LNBA 1NP7A 3CKBA 3ULYA 2ZXWE 3FTSA 2P9PG 4KZ0A 3SFZA 3EDTB 3ZXSA 2XPIA 4L2YA 2WXGA 1TN8A 3ABKE 3ZXPA 1LTXA 3UIPC 4CZ2D 2P9NG 4BFRA 4DX7D 4DPRA 4N2QA 4BETA 1NI1A 4L7TA 4J6IA 4N5CA 4WWPA 2LSVA 4N2SA 3UTMA 5E75A 3UIOC 5KJNA 3CVXA 2DVWA 3S7DA 4AXHA 2JEKA 2XS8A 5FTPA 1N52A 4ATZD 1OUVA 3JUIA 1OWLA 4G8KA 1BPOA 4KVMA 2X6IA 5H7PA 3T8MA 4Y6WA 1HFAA 2YQ8A 4L1BA 2XPYA 2OOEA 1IQRA 1HS6A 5BW8C 4DUIA 1ELKA 5FZRA 3RRUA 4EQFA 2NC9A 1E8WA 3QOUA 4F1PA 3LY9A 2B0OE 2HM8A 2HE0A 4BT9A 3KS2A 1OWNA 5FQ8A 5FQ6A 3JUEA 2J9QA 3B13A 4GTMA 1K1AA 2M63A 4C0EA 4JHRA 4L2LA 4CGVA 4MBGA 4U63A 3PUJA 4JHKA 2EINE 3CLJA 2VGEA 3FY4A 2IFUA 2J08A 2AJAA 3SGHA 3TWRA 4N3CA 1KT0A 3UMVA 4G24A 4HB5A 1YYHA 2Y3AA 3PEVB 2ZIRA 3SO8A 5LP0A 2IO3C 3Q78A 3SBTB 3UM2A 2IONA 3FTZA 1QQEA 5ENOD 3ZRHA 3QAQA 3UINC 3GZ2A 4OAUC 2XGMA 4U7EB 3I4RB 3AS8A 3Q47B 3PZ1A 5AJDA 3C98A 1OCOE 2ZISA 3OAWA 2LAIA 5AQAA 4XI9A 5AIJA 3TWXA 3HYMB 5CCMA 1EPUA 4A1GA 2WXOA 2ZGDA 4LERA 1WM5A 4JA7A 4C0MA 2XS1A 3PZ2A 1PAQA 3J5QB 4UQZA 4JD2G 3EHMA 3OXFA 2J09A 3DPDA 4X8QA 3LCAA 3FUMA 3ML8A 1TNBA 2IOLA 4RLYA 3D9MA 2LNIA 4J8EA 3TAXA 4FU3A 1V54E 3CR3A 3APDA 2MRIA 3U4TA 1D8DA 3L13A 4NIKA 3PNLB 4UWGA 2RFAA 2DYRE 2XZTG 5ITZF 5FJYA 1TNYA 4NRHB 5J90A 1AP7A 3G2UA 1OXJA 2R59A 1N54A 3U9WA 5LFAA 3FUFA 4N3BA 3AG1E 2PM6A 3ZVVA 3FU0A 3LVRE 4WUYA 4APFA 2J4BA 4GTRA 3ASDA 4K5BA 4B8AA 1BD8A 2KXPC 2C0LA 4UQXA 2HYZA 2HO1A 5FQ4A 4GTQA 1G3NB 3R9MA 1HU3A 2IQCA 4NURA 4JEUA 4GMJA 4KYOB 3LXUX 4GTTA 4JL0A 4HS2A 4EBAA 2XPZA 2OVFA 3AAAC 4BERA 4LSZE 2EIKE 3MYVA 5CEDB 3RAUA 2BTDA 2WMNA 4JA9A 1ZU2A 2AW6A 1DVPA 4Q96A 1FVHA 3OTNA 1MZCA 5G04C 3DXKG 3HDXA 3UUXA 1JCSA 3SD5A 4AP2A 1PY1A 1IYGA 1YCSB 2FULA 3RRNB 4A3VA 5EX0A 3CHSA 1OWOA 3CVUA 3ABLE 2YHCA 3E30A 4I9CA 4R7LA 5JHAA 2Y4TA 5FZSA 3Q7FA 4JVSA 4UUCA 2Y0BG 4ME2A 1XNFA 4GA1A 3U66A 2GRLA 2GGFA 3T9KA 3EHQA 2CFZA 1LD8A 2BF0X 3B7SA 3VTYA 5FQ7A 2LXLA 4I6EA 3V31A 2PZIA 2I2OA 3E33A 3JQ1A 5ANRA 1O1RA 2RG8A 3GZ1A 4DI4A 2A4ZA 1Z6TA 3CVPA 3RK6A 4U0SA 4OVVA 4G1TA 2IOSA 2VTBB 4URKA 3SFYA 1MX6A 5G05J 3QARA 3LEWA 3D9NA 3B7BA 1EDUA 4J0UA 4HRLA 4XX5A 3CHMA 3PEUB 2OCCE 2VTBA 1SW6A 1NZNA 2IU1A 3QNKA 3CVVA 3D9JA 3DSSA 1V55E 1OY3D 1SZ9A 3E32A 2I1JA 5B1BE 4XZ4A 3G2VA 1NA3A 3DSTA 4UI9K 4L9PA 1MX4A 2P9UG 4HBDA 2FBNA 1O1TA 2FI7A 3L08A 4A55A 5ENNA 1D9SA 4OAVB 3FU5A 3LVQE 5LCWJ 3PZDA 2LSUA 5IY5E 2A5UA 2KM4A 4IRUA 3UKRG 2X38A 3UPVA 2WXFA 3L16A 3KEAA 4GCOA 3FEYA 2PL2A 3BG1B 5KNGA 3ZPJA 3VLEA 4A3TA 5ENPD 3TWUA 3D9IA 4I2ZA 4GYOA 4N3AA 4WNFA 4JZYA 2J07A 3I3NA 1N11A 4UQYA 3JCKC 1YMPA 1TEZA 4BTBA 3UM3A 2P9LG 2XCCA 3UKUG 4AIFA 3TG4A 2XRYA 3EIQC 4TXQA 3FUNA 3V2OA 3LY7A 4ZHBA 4ACKA 3UQ3A 5T3RA 5HRYA 4CCAA 4O6FA 4U8VD 3HXDA 4CDRA 3EHNA 2I1KA 3UM0A 3L17A 3QB2A 4ANVA 2XRZA 3CHQA 3PZ4A 2EQXA 2H6FA 4E6HA 3ZKJA 3Q79A 4H7XA 1MQSA 4YVOA 4F7AA 4KZCA 5T8IA 1DCQA 5D0OD 4ILHB 4APOA 3EJNA 4WWOA 2Y69E 4GPKA 3ASOE 3PRZA 1Z3YA 2LXMA 4TRQA 1HX8A 3N71A 4N5QA 3CQGB 2I9CA 3JYSA 4FLHA 4PS8A 4GZCA 4HORA 4I9EA 4HRMB 3CVWA 2F0YA 2P9SG 4G8LA 4GZ6A 3D3MA 1W3BA 4KT6B 1X5BA 3FU3A 1GW6A 4HLEA 3LPZA 1SA5A 3ASNE 4LUNU 4EHMA 1FT1A 5BV1A 5EYLA 3D9LA 1JPLA 1KZOA 4LRZA 1XGWA 2A5EA 1YA0A 2GRMA 3S7BA 3CEQA 1KT1A 4DX5D 1BI8B 1H6KA 2XQ0A 2X6KA 3TWQA 5CMWA 4U95D 4N39A 4BSZB 4B94A 4XKCA 3FUKA 1KZPA 2BUGA 4XIFA 4ABNA 4FADA 2XGSA 4Y6CA 3OXLA 4FULA 1HG2A 2F8YA 1EYHA 2XZDG 3ONLA 2R17C 2JABA 4UI9J 2DZOA 3LJNA 3PNTB 2WQ7A 1TN6A 2AXVA 1ELWA 4O1OA 2R5SA 2PM7A 2QY7A 4U8YD 4QQIA 3NAWA 3L6AA 4DX6D 4PH4B 2C0MA 3PE3A 2E0IA 2VGXB 3ENEA 1E96B 2DBAA 4O60A 5M72A 1WAO1 4G26A 1UOHA 2C2LA 4I43A 4GMLA 1O1SA 3U3WA 3MEKA 1HXIA 2R05A 1WY6A 4DLOA 2H6GA 2PQNA 3PDNA 4HFGA 2VGXA 3FU6A 5CERB 1KPSB 3NF1A 3G2WA 4CGWA 1K1BA 2AWIA 4JB8P 1OWPA 3UI2A 1Z5SC 1N4QA 1O5MA 4MRUA 5A6CA 3GW4A 2H6HA 4LEUA 4J7WA 4EZLA 2WM9A 3FWVA 5ARFA 2WXPA 1JUQA 2P58C 3L82A 2GRNB 3ZHEB 4DK5A 4H7YA 4CDMA 5FINA 4HOTA 4CT4A 4GAAA 4C48B 3ZHEA 3ASHA 3DPYA 5KJKA 3ZFWA 3HG0D 1MHQA 1UG3A 3SF4A 3Q15A 3FUIA 4UWHA 4Z68A 1UN9A 3ZIMA 1DC2A 2WXKA 5AN8A 4DLQA 5G04J 4HRNA 3KAEA 4TXPA 3ESKA 4BESA 2V4HC 5AQBA 4CEMA 5CMYA 3Q5MA 5CECB 4B93B 2R03A 3HHMA 3X2QE 5JJTA 1NA0A 2B6CA 2QZAA 5FT9A 2FO7A 5JJ6A 3ZNGA 4BEPA 2PNNA 3C72A 1N0QA 5DBKA 2RD0A 4PS7A 3APFA 2H6IA 4BSXA 4IYPA 4EBAG 3IEGA 1LD7A 1INZA 3UT8A 1IHGA 3L9TA 2PQRA 3RO2A 4AEZC 4LG6A 1QYMA 4HOUA 2AXZA 2E2EA 1H6OA 3QDNA 5A23A 3QK0A 4CT0A 3UT4A 3EHRA 3CQCB 2CHZA 3I5PA 4KXKB 3BQOA 4NQ0A 1E8XA 1JWGA 4CRWA 5LOZA 1HG5A 3C3OA 4CYMD 2V0PA 3EUVA 4K03A 3MV2B 2VGYA 2DCPA 1ELRA 4TV3A 1BU9A 4GYYA 4U07A 3AS5A 5T4YA 3Q9NC 1IQUA 3E4BA 1N4SA 4I1AA 1K3ZD 4BT8A 3FUJA 3SNXA 3HXBA 3UX4A 1N95A 3AU4A 2XEHA 3HXCA 4K5CA 4O1PA 3DSUA 2WXLA 4G25A 4J8SA 3QC1A 3FUHA 3P2BA 2IY0C 2KCLA 4FJZA 2WXJA 4YVQC 4HI9A 4WAFA 3HXEA 3TL5A 4J8DA 1A5EA 4GTSA 2ONDA 3CVQA 3HXFA 3T5XA 3MCXA 3IKOB 3ASGA 4RSYA 2V8SE 4K0RA 4GYWA 3ZW3A 3B7UX 3FTYA 2X6HA 2IJGX 1K8KG 2V4LA 3CV0A 3LKUA 4ILGA 5BPPA 5KBAA 2LO6A 4EECA 1A17A 4FA6A 1TJCA 3PH0C 4RQIA 3VTXA 5ANLA 3QJZA 1P5QA 2GRQB 1WG0A 5FIOA 3TXNA 3P1UA 2WQ6A 3MX3A 3DEOA 4F6RD 3WG7E 1DNPA 2WXNA 1PC2A 4GB9A 5ENTD 2KC7A 4XE0A 3VLFA 3ZEFA 4K5AB 1E7UA 2VSXE 5A7DB 3NOCD 2VYIA 4V3IA 3BUAA 2RFMA 4CDNA 4I6GA 5B3SE 3RIBA 3F6QA 4AY6A 4ATGA 1D8EA 5EYPF 1TR4A 4HI8A 5AAOA 3WXXA 5EDSA 3SI5A 4GCNA 4GZDA 4BWRA 2Y4UA 3CIAA 3ZYQA 2FO1E 3V30A 2KATA 4UWFA 5B1AE 2OVBA 5EILA 4HNAD 1N4PA 4NACA 4AM9A 5G05C 3LYAA 1B89A 3FH5A 4U0ZA 2WMOA 1Y8MA 2FEZA 1JWFA 4DI3A 1OT8A 2P9IG 3L22A 1E90A 3R7RA 3MKQB 3OXGA 5CRUA 4AOFA 3JQ0A 2OV8A 1FCHA 2WXRA 2I6HA 1MJ0A 5KNHD 1TNOA 2QYUA 3UT7A 1DCEA 4BY6A 3HVEB 4JPSA 2GW1A 3MKQA 4KVOA 2NSZA 3QWWA 2ETAA 2WXQA 2EIME 5BNWA 4ANXA 1TYQG 3EU9A 3HVEA 2JLBA 5LCWC 1RW2A 3VLDA 3EIJA 1U3CA 4GZ5A 3D9PA 2QYJA 4B8CB 4PUCA 3APCA 2ETBA 3DSVA 3TG5A 2IO2C 1H0AA 3NQPA 5FZQA 5E76A 3QWPA 2BKGA 3QKYA 5CCLA 1MX2A 2KCKA 3MJWA 2V5FA 5EKQD 2XCBA 1S0PA 4LNUD 3CSFA 3RRMB 3SQVA 3URZA 3AS4A 3ZUVB 2X6JA 3BU8A 3W9FA 1OCCE 4AJWA 3RJVA 1E8ZA 4AV7A 2FF4A 4FHJA 2YINA 3ABME 4LCTA 4U8HA 4XI0A 1H6PA 3FP3A 5ENQD 4FHKA 5CBNA 5ARGA 3MV3B 2QFCA 2VSOE 3J5PA 3SBSA 2L6JA 5BXUA 1N94A 4WNDA 3CSTA 4M7CA 4A1SA 2J8SD 4MS6A 4F3VA 3V2XA 1HO8A 3AG4E 1Y6IA 3S2AA 4MLPA 3NZSA 3S7JA 3PE4A 3IHYA 3BEEA 1Q2ZA 1N0RA 3G2TA 3RKVA 5C2YA 5AJLA 3DRAA 2Q7FA 4G11A 3B7RL 4RVBA 2EIJE 3GYZA 4PDXA 3Q73A 2IF4A 5JMND 1KLXA 4UWKA 3SY2A 3FTXA 5AYWD 1UW4B 1OCZE 4GZ3A 4ANWA 4BX9A 2DWZA 3LS8A 2L0IA 3FDHA 2GROB 3RO3A 3CHOA 3UXGA 3CVLA 3FUDA 5JJ7A 5BT1A 1UN8A 3ULQA 5AARA 3E34A 3Q4AB 2HR2A 4AVXA 1QNFA 2WXMA 3C5RA 5EIDA 4IN3B 4HLLA 3NZUA 2P2CP 4A63B 3NB2A 1S64A 2J49A 1OWMA 4KBQA 3ONKA 2XGOA 1OCRE 2QC9A 1SQMA 3FUEA 3V79K 4GTPA 4M3OA 2WXHA 4B0ZA 4G2VA 1AWCB 3TWVA 3B7TA 3ULEG 3LJ3A 4DX2A 3SZ7A 3ESLA 3HRAA 4I2WA 1UJKA 1BLXB 3SFXA 1E8YA 2CHWA 5KCMA 2BKKB 4Q94A 2NXPA 2CG2A 4FC8A 4TUUA 4B89A 4WWNA 3CK8A 3Q7AA 3TWWA 4F53A 4UI9C 2WXIA 2AVPA 2KZTB 4F1SA 5AQ9A 3Q49B 2WB2A 2DYSE 1TN7A 5KJMA 4J8FA 2IEJA 3DWLG 3CHRA 2GRRB 3U64A 2AXUA 5CBOA 3MZLB 2KZTA 5AENA 3UM1A 3ZYKA 5ENRD 3DEPA 4XKBA 2VQ2A 1FT2A 4FP7A 4MKTA 3AU5A 3S7FA 4WNGA 3GZSA 3R9AB 3D9KA 1TNUA 2MHKA 3K9IA 3SHFA 2XEEA 2LUHA 1Z3XA 1TJFA 2BEDA 3PZ3A 4ILIA 4LNGA 3ZGQA 1H19A 2R02A 5EN5D 1FPPA 2CFUA 5HKPA 2MYOA 2DIWA 3DSXA 2DZNA 3CHPA 3O4ZA 3LDZA 1SVXA 3C3RA 3PS6A 5D2MC 3ZU7B 2X3MA 2WQHA 4U96D 4GU5A 4OVUA 2P9KG 3E37A 3ML9A 3FTUA 4DRXE 1S63A 5AQ7A 2YNQA 3TJPA 4Q69A 4RG6A 4JHJA 2L6BA 2R2LA 2KBXA 5KWDA 4UWLA 1S70B 2L9BA 3DSWA 3CK9A 4IULA 4TXRA 3KD7A 5EIBE 1U3DA 3TXMA 5CHEE 5D0QD 4I1MA 5CEAA 3NBNB 3W9GA 5HQ8A 4G23A 2KCVA 2X6FA 4DJAA 1JCRA 4YDWA 3RSEG 2ZU6B 3MA5A 4I17A 1TNZA 3CK7A 5BV0A 4HOQA 4GTVA 4OYSA 2ZGGA 3MGBA 5J08A 3IBEA 4P29A 5JHBA 1JCQA 2NYJA 5FWQA 1E7VA 3FHEA 2V5QC 4HOSA 3DXMG 4FJYA 4JW1A 4YNDA 4ANUA 1SZAA 3AG2E 5G55A 1QBQA 2L0TB 3KEZA 3G2SA 1UJJA 1HZ4A 4YDYA 4FLBA 3D9OA 5KJLA 4ACLA
chains in the Genus database with same CATH topology
5G2NA 1QZ2A 2VJ8A 3TAXA 3OXLA 4FULA 4FU3A 1HG2A 4AM9A 5G05C 3CR3A 1EYHA 3APDA 3LYAA 1B89A 3FH5A 4U0ZA 1VDYA 2WMOA 1L5JA 3ONLA 1Y8MA 2FEZA 1JWFA 4DI3A 4HXIA 2MRIA 4WNEA 2R17C 3L22A 3U4TA 3L13A 1E90A 4I6JA 3PNLB 3R7RA 4UWGA 4UI9J 3PNTB 2WQ7A 3O48A 5FJYA 4U04A 3ASFA 2YHEA 2AXVA 3MKQB 4JC8A 3OXGA 4NRHB 4U0UA 1ELWA 3FTVA 5J90A 4AOFA 3JQ0A 2OV8A 3G2UA 2R5SA 1FCHA 2WXRA 2I6HA 2PM7A 2QY7A 3HIZA 2R59A 1N54A 3FEXA 3U9WA 3UT7A 5LFAA 3FUFA 3L6AA 4BY6A 4N3BA 4PH4B 2J4DA 1ZBPA 2PM6A 2C0MA 3HVEB 2E0IA 3PE3A 4JPSA 3ZVVA 3ZN3A 3FU0A 2GW1A 4L23A 3MKRA 3MKQA 3LVRE 5HI7A 4KVOA 2NSZA 2VGXB 2WVIA 3ENEA 1E96B 2DBAA 1LF8A 3QWWA 4WUYA 2XEVA 1WAO1 2WXQA 4I1OB 5M72A 2WPVA 2VSNA 4G26A 2J4BA 4RG9A 2C2LA 4I43A 4APFA 4GMLA 4PS3A 3U3WA 3ASDA 3MEKA 4B8AA 5BNWA 1HXIA 4ANXA 2C0LA 3HVEA 4UQXA 2JLBA 5LCWC 2HYZA 2HO1A 5FQ4A 1WY6A 4DLOA 3VLDA 2PQNA 3EIJA 3PDNA 4HFGA 5C1DA 1U3CA 2VGXA 3FU6A 3D9PA 1HU3A 2IQCA 4GZ5A 4NURA 4JEUA 4E85A 4GMJA 4KYOB 3LXUX 3NF1A 4B8CB 3QWVA 4PUCA 3APCA 3G2WA 4CGWA 2LAHA 4JL0A 3TG5A 2AWIA 4JEHA 1H0AA 4HS2A 4EBAA 3NQPA 1OWPA 5FZQA 5E76A 3IHVA 2XPZA 2OVFA 3QWPA 3LY8A 3QKYA 3MYVA 3PREA 5CCLA 2KCKA 4MRUA 2BTDA 3MJWA 2WMNA 2V5FA 5EKQD 4JA9A 1ZU2A 5A6CA 3GW4A 2AW6A 4C9BB 1DVPA 4LEUA 2XCBA 4Q96A 4EZLA 1H2TC 1FVHA 1S0PA 3OTNA 3CSFA 2WM9A 3FWVA 2UWJG 5ARFA 3RRMB 3BG0B 2WXPA 4BX8A 3TGOA 3CVYA 3URZA 5G04C 1JUQA 4GA0A 3HDXA 2P58C 3UUXA 3R7QA 3SD5A 4AP2A 1PY1A 3AS4A 5BUZA 1IYGA 2X6JA 4AJWA 2FULA 5EX3A 4KMOA 4BTAA 3RRNB 4A3VA 3ZHEB 4DK5A 3RJVA 5EX0A 4H7YA 2ILRA 1E8ZA 3RU0A 4CDMA 1H2UA 3CHSA 5LX8A 1OWOA 3T5VA 4EZJA 3CVUA 4AV7A 1H2VC 4HOTA 4CT4A 2FF4A 4FHJA 2YINA 4LCTA 2YHCA 4U8HA 4XI0A 4GAAA 3FP3A 3ZHEA 4I9CA 3ASHA 4FHKA 4HVBA 4R7LA 5KJKA 3ZFWA 5JHAA 5ARGA 2UY1B 1MHQA 1UG3A 4D10C 3PVLA 2Y4TA 5FZSA 3SF4A 3Q15A 3FUIA 3MV3B 4UWHA 1UN9A 1HH8A 2QFCA 3CGHA 4JVSA 3ZIMA 2WXKA 3PUKA 3ZYLA 2VSOE 4DLQA 3SBSA 2L6JA 1HE8A 4ME2A 4WNDA 3CSTA 3I4GA 5G04J 1XNFA 4GA1A 4JXTA 2UY1A 3U66A 2GRLA 3KAEA 3ZYMA 2GGFA 4A1SA 4MS6A 4F3VA 3ESKA 2XHEA 4CEMA 5CMYA 3FFLA 3FH8A 3Q5MA 2CFZA 2BF0X 1HO8A 3B7SA 2CG3A 3VTYA 1Y6IA 3HHMA 3S2AA 4GA2A 5FQ7A 4I6EA 5JJTA 4MLPA 2VSYA 3NZSA 2PZIA 2I2OA 3PE4A 3IHYA 3BEEA 3S7JA 3JQ1A 1FVFA 3G2TA 3RKVA 3CKCA 1NA0A 5C2YA 5AJLA 5FT9A 2Q7FA 4G11A 2MOWA 3FULA 3B7RL 2FO7A 4RVBA 5ANRA 2RG8A 3GZ1A 5JJ6A 4QFVA 3GYZA 4PDXA 5DIZA 3L54A 4DI4A 2A4ZA 2IF4A 5DBKA 1KLXA 1Z6TA 3FH7A 2RD0A 3DBSA 3CVPA 4PS7A 3APFA 3RK6A 4U0SA 4UWKA 4BSXA 4OVVA 3CVNA 2CHXA 4EZKA 4G1TA 2IOSA 4IYPA 4EBAG 2VTBB 3IEGA 1INZA 3FTXA 3UT8A 4URKA 5AYWD 1UW4B 1IHGA 4GZ3A 2PQRA 4ANWA 5G05J 1EF1C 3QARA 3FTWA 3LEWA 3RO2A 1HF8A 3D9NA 4W9RA 4AEZC 3LS8A 4AY5A 4BX9A 1EDUA 4EPZA 4J0UA 2L0IA 3FDHA 4XX5A 3RO3A 3CHMA 3CHOA 3CVLA 3FUDA 3IV0A 3PEUB 5JJ7A 1NP7A 2VTBA 4HOUA 2AXZA 2IU1A 1NZNA 3CKBA 5BT1A 2E2EA 3QNKA 3CVVA 3QDNA 5A23A 3FTSA 1UN8A 3QK0A 4KZ0A 3D9JA 3SFZA 4CT0A 3EDTB 3UT4A 3ZXSA 2XPIA 4L2YA 2WXGA 3ULQA 1SZ9A 3CQCB 3Q4AB 2CHZA 2I1JA 3I5PA 2HR2A 4AVXA 4KXKB 4XZ4A 1QNFA 3G2VA 2WXMA 1NA3A 4BFRA 4IN3B 4DPRA 4N2QA 3NZUA 4UI9K 4NQ0A 1E8XA 1JWGA 2FBNA 4L7TA 2J49A 4CRWA 4J6IA 4N5CA 1OWMA 4WWPA 2FI7A 2LSVA 4N2SA 4KBQA 3ONKA 1HG5A 3L08A 5E75A 5LOZA 4A55A 5ENNA 5KJNA 2XGOA 2V0PA 1SQMA 4K03A 3CVXA 3S7DA 3FUEA 3MV2B 4M3OA 2WXHA 4B0ZA 2VGYA 4AXHA 3FU5A 2DCPA 4G2VA 3LVQE 2JEKA 3B7TA 1ELRA 1N52A 4TV3A 3PZDA 5FTPA 5LCWJ 3LJ3A 1OUVA 2LSUA 2A5UA 3JUIA 4GYYA 3SZ7A 3ESLA 1OWLA 2KM4A 4U07A 1BPOA 4IRUA 3AS5A 4I2WA 4KVMA 5T4YA 1UJKA 2X6IA 3T8MA 1IQUA 4Y6WA 2X38A 3UPVA 2WXFA 3L16A 1E8YA 1HFAA 2YQ8A 2CHWA 3E4BA 4GCOA 4I1AA 5KCMA 3FEYA 4L1BA 2PL2A 4BT8A 4Q94A 3FUJA 2XPYA 3BG1B 3ZPJA 2OOEA 2NXPA 2CG2A 4FC8A 4TUUA 3SNXA 3VLEA 4WWNA 4A3TA 4B89A 1IQRA 3CK8A 1HS6A 5BW8C 3UX4A 4F53A 1ELKA 3AU4A 4UI9C 2WXIA 5FZRA 3D9IA 3RRUA 4I2ZA 2AVPA 2KZTB 4F1SA 4GYOA 3Q49B 4N3AA 4EQFA 2NC9A 4WNFA 1E8WA 2WXLA 3QOUA 4G25A 2WB2A 4J8SA 3QC1A 4JZYA 5KJMA 3FUHA 2J07A 3I3NA 3LY9A 3P2BA 4J8FA 3CHRA 2HM8A 3U64A 2AXUA 4BT9A 2KCLA 4FJZA 2WXJA 3KS2A 4YVQC 4UQYA 1OWNA 3JCKC 2KZTA 3MZLB 5FQ8A 5AENA 1TEZA 4BTBA 5FQ6A 3ZYKA 2J9QA 3B13A 2XCCA 4WAFA 4AIFA 4XKBA 3TG4A 2VQ2A 4FP7A 4MKTA 2XRYA 2M63A 4C0EA 3EIQC 4JHRA 3TL5A 4J8DA 3AU5A 4L2LA 3FUNA 3S7FA 2ONDA 4CGVA 3CVQA 3LY7A 4U63A 3MCXA 4WNGA 3GZSA 3T5XA 4ACKA 3PUJA 4JHKA 3R9AB 3D9KA 3IKOB 3ASGA 5T3RA 3UQ3A 3K9IA 2MHKA 3CLJA 2V8SE 4RSYA 3SHFA 4K0RA 4GYWA 4CCAA 3FY4A 3ZW3A 4O6FA 2IFUA 2J08A 1Z3XA 3B7UX 1TJFA 3SGHA 4ILIA 3FTYA 3ZGQA 4N3CA 4CDRA 2X6HA 2I1KA 3EHNA 1H19A 1KT0A 3UMVA 3L17A 3QB2A 4G24A 2CFUA 4ANVA 2XRZA 2IJGX 2Y3AA 3CHQA 3PEVB 2EQXA 2V4LA 5LP0A 2DIWA 3CHPA 3CV0A 4E6HA 3LKUA 3O4ZA 4ILGA 5BPPA 3LDZA 2LO6A 3PS6A 4H7XA 2X3MA 3SBTB 4EECA 1MQSA 2WQHA 4YVOA 1A17A 4KZCA 4F7AA 4GU5A 1TJCA 2IONA 3PH0C 4OVUA 4FA6A 3FTZA 5T8IA 3VTXA 5ANLA 3ML9A 1QQEA 3FTUA 3ZRHA 3QAQA 3QJZA 5D0OD 4ILHB 4APOA 3EJNA 1P5QA 3GZ2A 2XGMA 4WWOA 2YNQA 3I4RB 4GPKA 3AS8A 3TJPA 4Q69A 3PRZA 4JHJA 1Z3YA 4RG6A 4TRQA 1HX8A 3Q47B 3N71A 4UWLA 2L9BA 3CQGB 3TXNA 3P1UA 2WQ6A 5AJDA 2I9CA 3JYSA 4FLHA 3C98A 3CK9A 4PS8A 4IULA 4GZCA 3KD7A 1U3DA 3MX3A 3TXMA 5CHEE 5D0QD 4HORA 4I1MA 4I9EA 3OAWA 3CVWA 2LAIA 1DNPA 4XI9A 4GZ6A 5AIJA 5HQ8A 3D3MA 2WXNA 1PC2A 4G23A 4GB9A 1W3BA 2KCVA 4KT6B 2KC7A 4XE0A 1X5BA 3FU3A 1GW6A 2X6FA 4HLEA 3VLFA 3HYMB 3LPZA 4DJAA 3ZEFA 5CCMA 1EPUA 4A1GA 4LUNU 2ZU6B 3MA5A 4I17A 5BV1A 1E7UA 2WXOA 2VSXE 3D9LA 3CK7A 5A7DB 1JPLA 4LERA 5BV0A 2VYIA 4HOQA 4LRZA 4V3IA 1WM5A 1XGWA 4JA7A 4C0MA 4OYSA 1YA0A 4CDNA 2GRMA 3MGBA 1PAQA 5J08A 4I6GA 3S7BA 3CEQA 3IBEA 1KT1A 4P29A 4UQZA 5JHBA 1H6KA 2XQ0A 2X6KA 5FWQA 3RIBA 4AY6A 1E7VA 3EHMA 3OXFA 4ATGA 2J09A 5CMWA 3FHEA 3DPDA 4HOSA 4N39A 3LCAA 4FJYA 4JW1A 4YNDA 3WXXA 3FUMA 3ML8A 3SI5A 5EDSA 4B94A 4XKCA 4ANUA 4GCNA 3FUKA 1SZAA 4GZDA 4BWRA 2Y4UA 2BUGA 5G55A 3CIAA 2L0TB 3KEZA 4XIFA 4ABNA 3ZYQA 3G2SA 2IOLA 4FADA 1UJJA 2XGSA 1HZ4A 2KATA 3D9MA 2LNIA 4UWFA 2OVBA 4FLBA 3D9OA 5KJLA 4Y6CA 4NACA 4ACLA 4J8EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2T A;  4AVX A;  3ZYL A;  1HF8 A;  3D9N A;  3G2U A;  3G2V A;  4FU3 A;  5CMW A;  2QY7 A;  1EDU A;  1HG2 A;  1X5B A;  2KM4 A;  2L0I A;  2MOW A;  4HFG A;  1EYH A;  1DVP A;  1HX8 A;  1UJK A;  3D9P A;  4Q96 A;  5LP0 A;  1JWG A;  1VDY A;  2DIW A;  4JXT A;  3ONL A;  1HFA A;  3D9K A;  1JWF A;  3ZYM A;  3D9L A;  1SZA A;  3G2W A;  2LO6 A;  3CLJ A;  1HG5 A;  1JPL A;  1JUQ A;  2V8S E;  3LDZ A;  3ONK A;  4GZD A;  4GZC A;  4Q94 A;  5CMY A;  2L0T B;  1XGW A;  2BF0 X;  1H0A A;  1LF8 A;  1PY1 A;  3G2S A;  3D9J A;  3ZYQ A;  1UJJ A;  5LOZ A;  2DCP A;  3ZYK A;  5J08 A;  1MHQ A;  3D9M A;  1INZ A;  1ELK A;  4FLB A;  3D9O A;  1SZ9 A;  3D9I A;  4NAC A;  3RRU A; 
#chains in the Genus database with same CATH topology
 5G2N A;  1QZ2 A;  2VJ8 A;  3JXJ A;  1IKN D;  1VDY A;  1L5J A;  4HXI A;  4GPM A;  4WNE A;  3ISM C;  4I6J A;  5HS0 A;  3O48 A;  4U04 A;  3ASF A;  2YHE A;  3IXE A;  4JC8 A;  4U0U A;  3FTV A;  3HIZ A;  3FEX A;  2J4D A;  1ZBP A;  3TWT A;  1IXV A;  1MYO A;  3ZN3 A;  4L23 A;  3MKR A;  5HI7 A;  2WVI A;  4YDE A;  2EIL E;  5JA4 D;  1LF8 A;  2XEV A;  4I1O B;  2WPV A;  2VSN A;  4RG9 A;  4PS3 A;  3T8K A;  1BI7 B;  2XEN A;  3AG3 E;  5C1D A;  4E85 A;  2OEW A;  4XEI G;  2ETC A;  3QWV A;  1NL4 A;  2LAH A;  4JEH A;  5ENS D;  1ZB1 A;  3IHV A;  3LY8 A;  5D66 A;  3PRE A;  2F8X K;  4GTO A;  3C3Q A;  4C9B B;  3KSL A;  5CRV A;  1H2T C;  4YDO A;  1U2V G;  2UWJ G;  3BG0 B;  3KSQ A;  2OEV A;  4BX8 A;  3TGO A;  3CVY A;  4GA0 A;  3R7Q A;  4TUM A;  5BUZ A;  3TWS A;  1IHB A;  5EX3 A;  4KMO A;  4BTA A;  5LX8 A;  2ILR A;  3RU0 A;  3T5V A;  1H2U A;  4EZJ A;  2F37 A;  3AJI A;  2GRP B;  1H2V C;  4GMR A;  1X81 A;  2RKK A;  4HVB A;  4J8Y A;  3Q9U C;  2UY1 B;  3B95 A;  2Y1L E;  4D10 C;  3PVL A;  1RZ4 A;  4ZFH A;  1HH8 A;  3CGH A;  3PUK A;  3ZYL A;  3EU5 A;  5BXO A;  1HE8 A;  3I4G A;  4JXT A;  2UY1 A;  4DX1 A;  1NFI E;  1N4R A;  3ZYM A;  3D9H A;  2XHE A;  3FFL A;  3FH8 A;  2CG3 A;  4GA2 A;  3JXI A;  4HQD A;  2VSY A;  1FVF A;  3CKC A;  2MOW A;  3FUL A;  4QFV A;  5DIZ A;  3L54 A;  3FH7 A;  1WDY A;  3DBS A;  3CVN A;  2CHX A;  1N9A A;  4EZK A;  1EF1 C;  3FTW A;  4AY5 A;  1HF8 A;  3Q75 A;  4W9R A;  3NOG D;  4EPZ A;  1SA4 A;  3IV0 A;  4LNB A;  1NP7 A;  3CKB A;  3ULY A;  2ZXW E;  3FTS A;  2P9P G;  4KZ0 A;  3SFZ A;  3EDT B;  3ZXS A;  2XPI A;  4L2Y A;  2WXG A;  1TN8 A;  3ABK E;  3ZXP A;  1LTX A;  3UIP C;  4CZ2 D;  2P9N G;  4BFR A;  4DX7 D;  4DPR A;  4N2Q A;  4BET A;  1NI1 A;  4L7T A;  4J6I A;  4N5C A;  4WWP A;  2LSV A;  4N2S A;  3UTM A;  5E75 A;  3UIO C;  5KJN A;  3CVX A;  2DVW A;  3S7D A;  4AXH A;  2JEK A;  2XS8 A;  5FTP A;  1N52 A;  4ATZ D;  1OUV A;  3JUI A;  1OWL A;  4G8K A;  1BPO A;  4KVM A;  2X6I A;  5H7P A;  3T8M A;  4Y6W A;  1HFA A;  2YQ8 A;  4L1B A;  2XPY A;  2OOE A;  1IQR A;  1HS6 A;  5BW8 C;  4DUI A;  1ELK A;  5FZR A;  3RRU A;  4EQF A;  2NC9 A;  1E8W A;  3QOU A;  4F1P A;  3LY9 A;  2B0O E;  2HM8 A;  2HE0 A;  4BT9 A;  3KS2 A;  1OWN A;  5FQ8 A;  5FQ6 A;  3JUE A;  2J9Q A;  3B13 A;  4GTM A;  1K1A A;  2M63 A;  4C0E A;  4JHR A;  4L2L A;  4CGV A;  4MBG A;  4U63 A;  3PUJ A;  4JHK A;  2EIN E;  3CLJ A;  2VGE A;  3FY4 A;  2IFU A;  2J08 A;  2AJA A;  3SGH A;  3TWR A;  4N3C A;  1KT0 A;  3UMV A;  4G24 A;  4HB5 A;  1YYH A;  2Y3A A;  3PEV B;  2ZIR A;  3SO8 A;  5LP0 A;  2IO3 C;  3Q78 A;  3SBT B;  3UM2 A;  2ION A;  3FTZ A;  1QQE A;  5ENO D;  3ZRH A;  3QAQ A;  3UIN C;  3GZ2 A;  4OAU C;  2XGM A;  4U7E B;  3I4R B;  3AS8 A;  3Q47 B;  3PZ1 A;  5AJD A;  3C98 A;  1OCO E;  2ZIS A;  3OAW A;  2LAI A;  5AQA A;  4XI9 A;  5AIJ A;  3TWX A;  3HYM B;  5CCM A;  1EPU A;  4A1G A;  2WXO A;  2ZGD A;  4LER A;  1WM5 A;  4JA7 A;  4C0M A;  2XS1 A;  3PZ2 A;  1PAQ A;  3J5Q B;  4UQZ A;  4JD2 G;  3EHM A;  3OXF A;  2J09 A;  3DPD A;  4X8Q A;  3LCA A;  3FUM A;  3ML8 A;  1TNB A;  2IOL A;  4RLY A;  3D9M A;  2LNI A;  4J8E A;  3TAX A;  4FU3 A;  1V54 E;  3CR3 A;  3APD A;  2MRI A;  3U4T A;  1D8D A;  3L13 A;  4NIK A;  3PNL B;  4UWG A;  2RFA A;  2DYR E;  2XZT G;  5ITZ F;  5FJY A;  1TNY A;  4NRH B;  5J90 A;  1AP7 A;  3G2U A;  1OXJ A;  2R59 A;  1N54 A;  3U9W A;  5LFA A;  3FUF A;  4N3B A;  3AG1 E;  2PM6 A;  3ZVV A;  3FU0 A;  3LVR E;  4WUY A;  4APF A;  2J4B A;  4GTR A;  3ASD A;  4K5B A;  4B8A A;  1BD8 A;  2KXP C;  2C0L A;  4UQX A;  2HYZ A;  2HO1 A;  5FQ4 A;  4GTQ A;  1G3N B;  3R9M A;  1HU3 A;  2IQC A;  4NUR A;  4JEU A;  4GMJ A;  4KYO B;  3LXU X;  4GTT A;  4JL0 A;  4HS2 A;  4EBA A;  2XPZ A;  2OVF A;  3AAA C;  4BER A;  4LSZ E;  2EIK E;  3MYV A;  5CED B;  3RAU A;  2BTD A;  2WMN A;  4JA9 A;  1ZU2 A;  2AW6 A;  1DVP A;  4Q96 A;  1FVH A;  3OTN A;  1MZC A;  5G04 C;  3DXK G;  3HDX A;  3UUX A;  1JCS A;  3SD5 A;  4AP2 A;  1PY1 A;  1IYG A;  1YCS B;  2FUL A;  3RRN B;  4A3V A;  5EX0 A;  3CHS A;  1OWO A;  3CVU A;  3ABL E;  2YHC A;  3E30 A;  4I9C A;  4R7L A;  5JHA A;  2Y4T A;  5FZS A;  3Q7F A;  4JVS A;  4UUC A;  2Y0B G;  4ME2 A;  1XNF A;  4GA1 A;  3U66 A;  2GRL A;  2GGF A;  3T9K A;  3EHQ A;  2CFZ A;  1LD8 A;  2BF0 X;  3B7S A;  3VTY A;  5FQ7 A;  2LXL A;  4I6E A;  3V31 A;  2PZI A;  2I2O A;  3E33 A;  3JQ1 A;  5ANR A;  1O1R A;  2RG8 A;  3GZ1 A;  4DI4 A;  2A4Z A;  1Z6T A;  3CVP A;  3RK6 A;  4U0S A;  4OVV A;  4G1T A;  2IOS A;  2VTB B;  4URK A;  3SFY A;  1MX6 A;  5G05 J;  3QAR A;  3LEW A;  3D9N A;  3B7B A;  1EDU A;  4J0U A;  4HRL A;  4XX5 A;  3CHM A;  3PEU B;  2OCC E;  2VTB A;  1SW6 A;  1NZN A;  2IU1 A;  3QNK A;  3CVV A;  3D9J A;  3DSS A;  1V55 E;  1OY3 D;  1SZ9 A;  3E32 A;  2I1J A;  5B1B E;  4XZ4 A;  3G2V A;  1NA3 A;  3DST A;  4UI9 K;  4L9P A;  1MX4 A;  2P9U G;  4HBD A;  2FBN A;  1O1T A;  2FI7 A;  3L08 A;  4A55 A;  5ENN A;  1D9S A;  4OAV B;  3FU5 A;  3LVQ E;  5LCW J;  3PZD A;  2LSU A;  5IY5 E;  2A5U A;  2KM4 A;  4IRU A;  3UKR G;  2X38 A;  3UPV A;  2WXF A;  3L16 A;  3KEA A;  4GCO A;  3FEY A;  2PL2 A;  3BG1 B;  5KNG A;  3ZPJ A;  3VLE A;  4A3T A;  5ENP D;  3TWU A;  3D9I A;  4I2Z A;  4GYO A;  4N3A A;  4WNF A;  4JZY A;  2J07 A;  3I3N A;  1N11 A;  4UQY A;  3JCK C;  1YMP A;  1TEZ A;  4BTB A;  3UM3 A;  2P9L G;  2XCC A;  3UKU G;  4AIF A;  3TG4 A;  2XRY A;  3EIQ C;  4TXQ A;  3FUN A;  3V2O A;  3LY7 A;  4ZHB A;  4ACK A;  3UQ3 A;  5T3R A;  5HRY A;  4CCA A;  4O6F A;  4U8V D;  3HXD A;  4CDR A;  3EHN A;  2I1K A;  3UM0 A;  3L17 A;  3QB2 A;  4ANV A;  2XRZ A;  3CHQ A;  3PZ4 A;  2EQX A;  2H6F A;  4E6H A;  3ZKJ A;  3Q79 A;  4H7X A;  1MQS A;  4YVO A;  4F7A A;  4KZC A;  5T8I A;  1DCQ A;  5D0O D;  4ILH B;  4APO A;  3EJN A;  4WWO A;  2Y69 E;  4GPK A;  3ASO E;  3PRZ A;  1Z3Y A;  2LXM A;  4TRQ A;  1HX8 A;  3N71 A;  4N5Q A;  3CQG B;  2I9C A;  3JYS A;  4FLH A;  4PS8 A;  4GZC A;  4HOR A;  4I9E A;  4HRM B;  3CVW A;  2F0Y A;  2P9S G;  4G8L A;  4GZ6 A;  3D3M A;  1W3B A;  4KT6 B;  1X5B A;  3FU3 A;  1GW6 A;  4HLE A;  3LPZ A;  1SA5 A;  3ASN E;  4LUN U;  4EHM A;  1FT1 A;  5BV1 A;  5EYL A;  3D9L A;  1JPL A;  1KZO A;  4LRZ A;  1XGW A;  2A5E A;  1YA0 A;  2GRM A;  3S7B A;  3CEQ A;  1KT1 A;  4DX5 D;  1BI8 B;  1H6K A;  2XQ0 A;  2X6K A;  3TWQ A;  5CMW A;  4U95 D;  4N39 A;  4BSZ B;  4B94 A;  4XKC A;  3FUK A;  1KZP A;  2BUG A;  4XIF A;  4ABN A;  4FAD A;  2XGS A;  4Y6C A;  3OXL A;  4FUL A;  1HG2 A;  2F8Y A;  1EYH A;  2XZD G;  3ONL A;  2R17 C;  2JAB A;  4UI9 J;  2DZO A;  3LJN A;  3PNT B;  2WQ7 A;  1TN6 A;  2AXV A;  1ELW A;  4O1O A;  2R5S A;  2PM7 A;  2QY7 A;  4U8Y D;  4QQI A;  3NAW A;  3L6A A;  4DX6 D;  4PH4 B;  2C0M A;  3PE3 A;  2E0I A;  2VGX B;  3ENE A;  1E96 B;  2DBA A;  4O60 A;  5M72 A;  1WAO 1;  4G26 A;  1UOH A;  2C2L A;  4I43 A;  4GML A;  1O1S A;  3U3W A;  3MEK A;  1HXI A;  2R05 A;  1WY6 A;  4DLO A;  2H6G A;  2PQN A;  3PDN A;  4HFG A;  2VGX A;  3FU6 A;  5CER B;  1KPS B;  3NF1 A;  3G2W A;  4CGW A;  1K1B A;  2AWI A;  4JB8 P;  1OWP A;  3UI2 A;  1Z5S C;  1N4Q A;  1O5M A;  4MRU A;  5A6C A;  3GW4 A;  2H6H A;  4LEU A;  4J7W A;  4EZL A;  2WM9 A;  3FWV A;  5ARF A;  2WXP A;  1JUQ A;  2P58 C;  3L82 A;  2GRN B;  3ZHE B;  4DK5 A;  4H7Y A;  4CDM A;  5FIN A;  4HOT A;  4CT4 A;  4GAA A;  4C48 B;  3ZHE A;  3ASH A;  3DPY A;  5KJK A;  3ZFW A;  3HG0 D;  1MHQ A;  1UG3 A;  3SF4 A;  3Q15 A;  3FUI A;  4UWH A;  4Z68 A;  1UN9 A;  3ZIM A;  1DC2 A;  2WXK A;  5AN8 A;  4DLQ A;  5G04 J;  4HRN A;  3KAE A;  4TXP A;  3ESK A;  4BES A;  2V4H C;  5AQB A;  4CEM A;  5CMY A;  3Q5M A;  5CEC B;  4B93 B;  2R03 A;  3HHM A;  3X2Q E;  5JJT A;  1NA0 A;  2B6C A;  2QZA A;  5FT9 A;  2FO7 A;  5JJ6 A;  3ZNG A;  4BEP A;  2PNN A;  3C72 A;  1N0Q A;  5DBK A;  2RD0 A;  4PS7 A;  3APF A;  2H6I A;  4BSX A;  4IYP A;  4EBA G;  3IEG A;  1LD7 A;  1INZ A;  3UT8 A;  1IHG A;  3L9T A;  2PQR A;  3RO2 A;  4AEZ C;  4LG6 A;  1QYM A;  4HOU A;  2AXZ A;  2E2E A;  1H6O A;  3QDN A;  5A23 A;  3QK0 A;  4CT0 A;  3UT4 A;  3EHR A;  3CQC B;  2CHZ A;  3I5P A;  4KXK B;  3BQO A;  4NQ0 A;  1E8X A;  1JWG A;  4CRW A;  5LOZ A;  1HG5 A;  3C3O A;  4CYM D;  2V0P A;  3EUV A;  4K03 A;  3MV2 B;  2VGY A;  2DCP A;  1ELR A;  4TV3 A;  1BU9 A;  4GYY A;  4U07 A;  3AS5 A;  5T4Y A;  3Q9N C;  1IQU A;  3E4B A;  1N4S A;  4I1A A;  1K3Z D;  4BT8 A;  3FUJ A;  3SNX A;  3HXB A;  3UX4 A;  1N95 A;  3AU4 A;  2XEH A;  3HXC A;  4K5C A;  4O1P A;  3DSU A;  2WXL A;  4G25 A;  4J8S A;  3QC1 A;  3FUH A;  3P2B A;  2IY0 C;  2KCL A;  4FJZ A;  2WXJ A;  4YVQ C;  4HI9 A;  4WAF A;  3HXE A;  3TL5 A;  4J8D A;  1A5E A;  4GTS A;  2OND A;  3CVQ A;  3HXF A;  3T5X A;  3MCX A;  3IKO B;  3ASG A;  4RSY A;  2V8S E;  4K0R A;  4GYW A;  3ZW3 A;  3B7U X;  3FTY A;  2X6H A;  2IJG X;  1K8K G;  2V4L A;  3CV0 A;  3LKU A;  4ILG A;  5BPP A;  5KBA A;  2LO6 A;  4EEC A;  1A17 A;  4FA6 A;  1TJC A;  3PH0 C;  4RQI A;  3VTX A;  5ANL A;  3QJZ A;  1P5Q A;  2GRQ B;  1WG0 A;  5FIO A;  3TXN A;  3P1U A;  2WQ6 A;  3MX3 A;  3DEO A;  4F6R D;  3WG7 E;  1DNP A;  2WXN A;  1PC2 A;  4GB9 A;  5ENT D;  2KC7 A;  4XE0 A;  3VLF A;  3ZEF A;  4K5A B;  1E7U A;  2VSX E;  5A7D B;  3NOC D;  2VYI A;  4V3I A;  3BUA A;  2RFM A;  4CDN A;  4I6G A;  5B3S E;  3RIB A;  3F6Q A;  4AY6 A;  4ATG A;  1D8E A;  5EYP F;  1TR4 A;  4HI8 A;  5AAO A;  3WXX A;  5EDS A;  3SI5 A;  4GCN A;  4GZD A;  4BWR A;  2Y4U A;  3CIA A;  3ZYQ A;  2FO1 E;  3V30 A;  2KAT A;  4UWF A;  5B1A E;  2OVB A;  5EIL A;  4HNA D;  1N4P A;  4NAC A;  4AM9 A;  5G05 C;  3LYA A;  1B89 A;  3FH5 A;  4U0Z A;  2WMO A;  1Y8M A;  2FEZ A;  1JWF A;  4DI3 A;  1OT8 A;  2P9I G;  3L22 A;  1E90 A;  3R7R A;  3MKQ B;  3OXG A;  5CRU A;  4AOF A;  3JQ0 A;  2OV8 A;  1FCH A;  2WXR A;  2I6H A;  1MJ0 A;  5KNH D;  1TNO A;  2QYU A;  3UT7 A;  1DCE A;  4BY6 A;  3HVE B;  4JPS A;  2GW1 A;  3MKQ A;  4KVO A;  2NSZ A;  3QWW A;  2ETA A;  2WXQ A;  2EIM E;  5BNW A;  4ANX A;  1TYQ G;  3EU9 A;  3HVE A;  2JLB A;  5LCW C;  1RW2 A;  3VLD A;  3EIJ A;  1U3C A;  4GZ5 A;  3D9P A;  2QYJ A;  4B8C B;  4PUC A;  3APC A;  2ETB A;  3DSV A;  3TG5 A;  2IO2 C;  1H0A A;  3NQP A;  5FZQ A;  5E76 A;  3QWP A;  2BKG A;  3QKY A;  5CCL A;  1MX2 A;  2KCK A;  3MJW A;  2V5F A;  5EKQ D;  2XCB A;  1S0P A;  4LNU D;  3CSF A;  3RRM B;  3SQV A;  3URZ A;  3AS4 A;  3ZUV B;  2X6J A;  3BU8 A;  3W9F A;  1OCC E;  4AJW A;  3RJV A;  1E8Z A;  4AV7 A;  2FF4 A;  4FHJ A;  2YIN A;  3ABM E;  4LCT A;  4U8H A;  4XI0 A;  1H6P A;  3FP3 A;  5ENQ D;  4FHK A;  5CBN A;  5ARG A;  3MV3 B;  2QFC A;  2VSO E;  3J5P A;  3SBS A;  2L6J A;  5BXU A;  1N94 A;  4WND A;  3CST A;  4M7C A;  4A1S A;  2J8S D;  4MS6 A;  4F3V A;  3V2X A;  1HO8 A;  3AG4 E;  1Y6I A;  3S2A A;  4MLP A;  3NZS A;  3S7J A;  3PE4 A;  3IHY A;  3BEE A;  1Q2Z A;  1N0R A;  3G2T A;  3RKV A;  5C2Y A;  5AJL A;  3DRA A;  2Q7F A;  4G11 A;  3B7R L;  4RVB A;  2EIJ E;  3GYZ A;  4PDX A;  3Q73 A;  2IF4 A;  5JMN D;  1KLX A;  4UWK A;  3SY2 A;  3FTX A;  5AYW D;  1UW4 B;  1OCZ E;  4GZ3 A;  4ANW A;  4BX9 A;  2DWZ A;  3LS8 A;  2L0I A;  3FDH A;  2GRO B;  3RO3 A;  3CHO A;  3UXG A;  3CVL A;  3FUD A;  5JJ7 A;  5BT1 A;  1UN8 A;  3ULQ A;  5AAR A;  3E34 A;  3Q4A B;  2HR2 A;  4AVX A;  1QNF A;  2WXM A;  3C5R A;  5EID A;  4IN3 B;  4HLL A;  3NZU A;  2P2C P;  4A63 B;  3NB2 A;  1S64 A;  2J49 A;  1OWM A;  4KBQ A;  3ONK A;  2XGO A;  1OCR E;  2QC9 A;  1SQM A;  3FUE A;  3V79 K;  4GTP A;  4M3O A;  2WXH A;  4B0Z A;  4G2V A;  1AWC B;  3TWV A;  3B7T A;  3ULE G;  3LJ3 A;  4DX2 A;  3SZ7 A;  3ESL A;  3HRA A;  4I2W A;  1UJK A;  1BLX B;  3SFX A;  1E8Y A;  2CHW A;  5KCM A;  2BKK B;  4Q94 A;  2NXP A;  2CG2 A;  4FC8 A;  4TUU A;  4B89 A;  4WWN A;  3CK8 A;  3Q7A A;  3TWW A;  4F53 A;  4UI9 C;  2WXI A;  2AVP A;  2KZT B;  4F1S A;  5AQ9 A;  3Q49 B;  2WB2 A;  2DYS E;  1TN7 A;  5KJM A;  4J8F A;  2IEJ A;  3DWL G;  3CHR A;  2GRR B;  3U64 A;  2AXU A;  5CBO A;  3MZL B;  2KZT A;  5AEN A;  3UM1 A;  3ZYK A;  5ENR D;  3DEP A;  4XKB A;  2VQ2 A;  1FT2 A;  4FP7 A;  4MKT A;  3AU5 A;  3S7F A;  4WNG A;  3GZS A;  3R9A B;  3D9K A;  1TNU A;  2MHK A;  3K9I A;  3SHF A;  2XEE A;  2LUH A;  1Z3X A;  1TJF A;  2BED A;  3PZ3 A;  4ILI A;  4LNG A;  3ZGQ A;  1H19 A;  2R02 A;  5EN5 D;  1FPP A;  2CFU A;  5HKP A;  2MYO A;  2DIW A;  3DSX A;  2DZN A;  3CHP A;  3O4Z A;  3LDZ A;  1SVX A;  3C3R A;  3PS6 A;  5D2M C;  3ZU7 B;  2X3M A;  2WQH A;  4U96 D;  4GU5 A;  4OVU A;  2P9K G;  3E37 A;  3ML9 A;  3FTU A;  4DRX E;  1S63 A;  5AQ7 A;  2YNQ A;  3TJP A;  4Q69 A;  4RG6 A;  4JHJ A;  2L6B A;  2R2L A;  2KBX A;  5KWD A;  4UWL A;  1S70 B;  2L9B A;  3DSW A;  3CK9 A;  4IUL A;  4TXR A;  3KD7 A;  5EIB E;  1U3D A;  3TXM A;  5CHE E;  5D0Q D;  4I1M A;  5CEA A;  3NBN B;  3W9G A;  5HQ8 A;  4G23 A;  2KCV A;  2X6F A;  4DJA A;  1JCR A;  4YDW A;  3RSE G;  2ZU6 B;  3MA5 A;  4I17 A;  1TNZ A;  3CK7 A;  5BV0 A;  4HOQ A;  4GTV A;  4OYS A;  2ZGG A;  3MGB A;  5J08 A;  3IBE A;  4P29 A;  5JHB A;  1JCQ A;  2NYJ A;  5FWQ A;  1E7V A;  3FHE A;  2V5Q C;  4HOS A;  3DXM G;  4FJY A;  4JW1 A;  4YND A;  4ANU A;  1SZA A;  3AG2 E;  5G55 A;  1QBQ A;  2L0T B;  3KEZ A;  3G2S A;  1UJJ A;  1HZ4 A;  4YDY A;  4FLB A;  3D9O A;  5KJL A;  4ACL A; 
#chains in the Genus database with same CATH homology
 5G2N A;  1QZ2 A;  2VJ8 A;  3TAX A;  3OXL A;  4FUL A;  4FU3 A;  1HG2 A;  4AM9 A;  5G05 C;  3CR3 A;  1EYH A;  3APD A;  3LYA A;  1B89 A;  3FH5 A;  4U0Z A;  1VDY A;  2WMO A;  1L5J A;  3ONL A;  1Y8M A;  2FEZ A;  1JWF A;  4DI3 A;  4HXI A;  2MRI A;  4WNE A;  2R17 C;  3L22 A;  3U4T A;  3L13 A;  1E90 A;  4I6J A;  3PNL B;  3R7R A;  4UWG A;  4UI9 J;  3PNT B;  2WQ7 A;  3O48 A;  5FJY A;  4U04 A;  3ASF A;  2YHE A;  2AXV A;  3MKQ B;  4JC8 A;  3OXG A;  4NRH B;  4U0U A;  1ELW A;  3FTV A;  5J90 A;  4AOF A;  3JQ0 A;  2OV8 A;  3G2U A;  2R5S A;  1FCH A;  2WXR A;  2I6H A;  2PM7 A;  2QY7 A;  3HIZ A;  2R59 A;  1N54 A;  3FEX A;  3U9W A;  3UT7 A;  5LFA A;  3FUF A;  3L6A A;  4BY6 A;  4N3B A;  4PH4 B;  2J4D A;  1ZBP A;  2PM6 A;  2C0M A;  3HVE B;  2E0I A;  3PE3 A;  4JPS A;  3ZVV A;  3ZN3 A;  3FU0 A;  2GW1 A;  4L23 A;  3MKR A;  3MKQ A;  3LVR E;  5HI7 A;  4KVO A;  2NSZ A;  2VGX B;  2WVI A;  3ENE A;  1E96 B;  2DBA A;  1LF8 A;  3QWW A;  4WUY A;  2XEV A;  1WAO 1;  2WXQ A;  4I1O B;  5M72 A;  2WPV A;  2VSN A;  4G26 A;  2J4B A;  4RG9 A;  2C2L A;  4I43 A;  4APF A;  4GML A;  4PS3 A;  3U3W A;  3ASD A;  3MEK A;  4B8A A;  5BNW A;  1HXI A;  4ANX A;  2C0L A;  3HVE A;  4UQX A;  2JLB A;  5LCW C;  2HYZ A;  2HO1 A;  5FQ4 A;  1WY6 A;  4DLO A;  3VLD A;  2PQN A;  3EIJ A;  3PDN A;  4HFG A;  5C1D A;  1U3C A;  2VGX A;  3FU6 A;  3D9P A;  1HU3 A;  2IQC A;  4GZ5 A;  4NUR A;  4JEU A;  4E85 A;  4GMJ A;  4KYO B;  3LXU X;  3NF1 A;  4B8C B;  3QWV A;  4PUC A;  3APC A;  3G2W A;  4CGW A;  2LAH A;  4JL0 A;  3TG5 A;  2AWI A;  4JEH A;  1H0A A;  4HS2 A;  4EBA A;  3NQP A;  1OWP A;  5FZQ A;  5E76 A;  3IHV A;  2XPZ A;  2OVF A;  3QWP A;  3LY8 A;  3QKY A;  3MYV A;  3PRE A;  5CCL A;  2KCK A;  4MRU A;  2BTD A;  3MJW A;  2WMN A;  2V5F A;  5EKQ D;  4JA9 A;  1ZU2 A;  5A6C A;  3GW4 A;  2AW6 A;  4C9B B;  1DVP A;  4LEU A;  2XCB A;  4Q96 A;  4EZL A;  1H2T C;  1FVH A;  1S0P A;  3OTN A;  3CSF A;  2WM9 A;  3FWV A;  2UWJ G;  5ARF A;  3RRM B;  3BG0 B;  2WXP A;  4BX8 A;  3TGO A;  3CVY A;  3URZ A;  5G04 C;  1JUQ A;  4GA0 A;  3HDX A;  2P58 C;  3UUX A;  3R7Q A;  3SD5 A;  4AP2 A;  1PY1 A;  3AS4 A;  5BUZ A;  1IYG A;  2X6J A;  4AJW A;  2FUL A;  5EX3 A;  4KMO A;  4BTA A;  3RRN B;  4A3V A;  3ZHE B;  4DK5 A;  3RJV A;  5EX0 A;  4H7Y A;  2ILR A;  1E8Z A;  3RU0 A;  4CDM A;  1H2U A;  3CHS A;  5LX8 A;  1OWO A;  3T5V A;  4EZJ A;  3CVU A;  4AV7 A;  1H2V C;  4HOT A;  4CT4 A;  2FF4 A;  4FHJ A;  2YIN A;  4LCT A;  2YHC A;  4U8H A;  4XI0 A;  4GAA A;  3FP3 A;  3ZHE A;  4I9C A;  3ASH A;  4FHK A;  4HVB A;  4R7L A;  5KJK A;  3ZFW A;  5JHA A;  5ARG A;  2UY1 B;  1MHQ A;  1UG3 A;  4D10 C;  3PVL A;  2Y4T A;  5FZS A;  3SF4 A;  3Q15 A;  3FUI A;  3MV3 B;  4UWH A;  1UN9 A;  1HH8 A;  2QFC A;  3CGH A;  4JVS A;  3ZIM A;  2WXK A;  3PUK A;  3ZYL A;  2VSO E;  4DLQ A;  3SBS A;  2L6J A;  1HE8 A;  4ME2 A;  4WND A;  3CST A;  3I4G A;  5G04 J;  1XNF A;  4GA1 A;  4JXT A;  2UY1 A;  3U66 A;  2GRL A;  3KAE A;  3ZYM A;  2GGF A;  4A1S A;  4MS6 A;  4F3V A;  3ESK A;  2XHE A;  4CEM A;  5CMY A;  3FFL A;  3FH8 A;  3Q5M A;  2CFZ A;  2BF0 X;  1HO8 A;  3B7S A;  2CG3 A;  3VTY A;  1Y6I A;  3HHM A;  3S2A A;  4GA2 A;  5FQ7 A;  4I6E A;  5JJT A;  4MLP A;  2VSY A;  3NZS A;  2PZI A;  2I2O A;  3PE4 A;  3IHY A;  3BEE A;  3S7J A;  3JQ1 A;  1FVF A;  3G2T A;  3RKV A;  3CKC A;  1NA0 A;  5C2Y A;  5AJL A;  5FT9 A;  2Q7F A;  4G11 A;  2MOW A;  3FUL A;  3B7R L;  2FO7 A;  4RVB A;  5ANR A;  2RG8 A;  3GZ1 A;  5JJ6 A;  4QFV A;  3GYZ A;  4PDX A;  5DIZ A;  3L54 A;  4DI4 A;  2A4Z A;  2IF4 A;  5DBK A;  1KLX A;  1Z6T A;  3FH7 A;  2RD0 A;  3DBS A;  3CVP A;  4PS7 A;  3APF A;  3RK6 A;  4U0S A;  4UWK A;  4BSX A;  4OVV A;  3CVN A;  2CHX A;  4EZK A;  4G1T A;  2IOS A;  4IYP A;  4EBA G;  2VTB B;  3IEG A;  1INZ A;  3FTX A;  3UT8 A;  4URK A;  5AYW D;  1UW4 B;  1IHG A;  4GZ3 A;  2PQR A;  4ANW A;  5G05 J;  1EF1 C;  3QAR A;  3FTW A;  3LEW A;  3RO2 A;  1HF8 A;  3D9N A;  4W9R A;  4AEZ C;  3LS8 A;  4AY5 A;  4BX9 A;  1EDU A;  4EPZ A;  4J0U A;  2L0I A;  3FDH A;  4XX5 A;  3RO3 A;  3CHM A;  3CHO A;  3CVL A;  3FUD A;  3IV0 A;  3PEU B;  5JJ7 A;  1NP7 A;  2VTB A;  4HOU A;  2AXZ A;  2IU1 A;  1NZN A;  3CKB A;  5BT1 A;  2E2E A;  3QNK A;  3CVV A;  3QDN A;  5A23 A;  3FTS A;  1UN8 A;  3QK0 A;  4KZ0 A;  3D9J A;  3SFZ A;  4CT0 A;  3EDT B;  3UT4 A;  3ZXS A;  2XPI A;  4L2Y A;  2WXG A;  3ULQ A;  1SZ9 A;  3CQC B;  3Q4A B;  2CHZ A;  2I1J A;  3I5P A;  2HR2 A;  4AVX A;  4KXK B;  4XZ4 A;  1QNF A;  3G2V A;  2WXM A;  1NA3 A;  4BFR A;  4IN3 B;  4DPR A;  4N2Q A;  3NZU A;  4UI9 K;  4NQ0 A;  1E8X A;  1JWG A;  2FBN A;  4L7T A;  2J49 A;  4CRW A;  4J6I A;  4N5C A;  1OWM A;  4WWP A;  2FI7 A;  2LSV A;  4N2S A;  4KBQ A;  3ONK A;  1HG5 A;  3L08 A;  5E75 A;  5LOZ A;  4A55 A;  5ENN A;  5KJN A;  2XGO A;  2V0P A;  1SQM A;  4K03 A;  3CVX A;  3S7D A;  3FUE A;  3MV2 B;  4M3O A;  2WXH A;  4B0Z A;  2VGY A;  4AXH A;  3FU5 A;  2DCP A;  4G2V A;  3LVQ E;  2JEK A;  3B7T A;  1ELR A;  1N52 A;  4TV3 A;  3PZD A;  5FTP A;  5LCW J;  3LJ3 A;  1OUV A;  2LSU A;  2A5U A;  3JUI A;  4GYY A;  3SZ7 A;  3ESL A;  1OWL A;  2KM4 A;  4U07 A;  1BPO A;  4IRU A;  3AS5 A;  4I2W A;  4KVM A;  5T4Y A;  1UJK A;  2X6I A;  3T8M A;  1IQU A;  4Y6W A;  2X38 A;  3UPV A;  2WXF A;  3L16 A;  1E8Y A;  1HFA A;  2YQ8 A;  2CHW A;  3E4B A;  4GCO A;  4I1A A;  5KCM A;  3FEY A;  4L1B A;  2PL2 A;  4BT8 A;  4Q94 A;  3FUJ A;  2XPY A;  3BG1 B;  3ZPJ A;  2OOE A;  2NXP A;  2CG2 A;  4FC8 A;  4TUU A;  3SNX A;  3VLE A;  4WWN A;  4A3T A;  4B89 A;  1IQR A;  3CK8 A;  1HS6 A;  5BW8 C;  3UX4 A;  4F53 A;  1ELK A;  3AU4 A;  4UI9 C;  2WXI A;  5FZR A;  3D9I A;  3RRU A;  4I2Z A;  2AVP A;  2KZT B;  4F1S A;  4GYO A;  3Q49 B;  4N3A A;  4EQF A;  2NC9 A;  4WNF A;  1E8W A;  2WXL A;  3QOU A;  4G25 A;  2WB2 A;  4J8S A;  3QC1 A;  4JZY A;  5KJM A;  3FUH A;  2J07 A;  3I3N A;  3LY9 A;  3P2B A;  4J8F A;  3CHR A;  2HM8 A;  3U64 A;  2AXU A;  4BT9 A;  2KCL A;  4FJZ A;  2WXJ A;  3KS2 A;  4YVQ C;  4UQY A;  1OWN A;  3JCK C;  2KZT A;  3MZL B;  5FQ8 A;  5AEN A;  1TEZ A;  4BTB A;  5FQ6 A;  3ZYK A;  2J9Q A;  3B13 A;  2XCC A;  4WAF A;  4AIF A;  4XKB A;  3TG4 A;  2VQ2 A;  4FP7 A;  4MKT A;  2XRY A;  2M63 A;  4C0E A;  3EIQ C;  4JHR A;  3TL5 A;  4J8D A;  3AU5 A;  4L2L A;  3FUN A;  3S7F A;  2OND A;  4CGV A;  3CVQ A;  3LY7 A;  4U63 A;  3MCX A;  4WNG A;  3GZS A;  3T5X A;  4ACK A;  3PUJ A;  4JHK A;  3R9A B;  3D9K A;  3IKO B;  3ASG A;  5T3R A;  3UQ3 A;  3K9I A;  2MHK A;  3CLJ A;  2V8S E;  4RSY A;  3SHF A;  4K0R A;  4GYW A;  4CCA A;  3FY4 A;  3ZW3 A;  4O6F A;  2IFU A;  2J08 A;  1Z3X A;  3B7U X;  1TJF A;  3SGH A;  4ILI A;  3FTY A;  3ZGQ A;  4N3C A;  4CDR A;  2X6H A;  2I1K A;  3EHN A;  1H19 A;  1KT0 A;  3UMV A;  3L17 A;  3QB2 A;  4G24 A;  2CFU A;  4ANV A;  2XRZ A;  2IJG X;  2Y3A A;  3CHQ A;  3PEV B;  2EQX A;  2V4L A;  5LP0 A;  2DIW A;  3CHP A;  3CV0 A;  4E6H A;  3LKU A;  3O4Z A;  4ILG A;  5BPP A;  3LDZ A;  2LO6 A;  3PS6 A;  4H7X A;  2X3M A;  3SBT B;  4EEC A;  1MQS A;  2WQH A;  4YVO A;  1A17 A;  4KZC A;  4F7A A;  4GU5 A;  1TJC A;  2ION A;  3PH0 C;  4OVU A;  4FA6 A;  3FTZ A;  5T8I A;  3VTX A;  5ANL A;  3ML9 A;  1QQE A;  3FTU A;  3ZRH A;  3QAQ A;  3QJZ A;  5D0O D;  4ILH B;  4APO A;  3EJN A;  1P5Q A;  3GZ2 A;  2XGM A;  4WWO A;  2YNQ A;  3I4R B;  4GPK A;  3AS8 A;  3TJP A;  4Q69 A;  3PRZ A;  4JHJ A;  1Z3Y A;  4RG6 A;  4TRQ A;  1HX8 A;  3Q47 B;  3N71 A;  4UWL A;  2L9B A;  3CQG B;  3TXN A;  3P1U A;  2WQ6 A;  5AJD A;  2I9C A;  3JYS A;  4FLH A;  3C98 A;  3CK9 A;  4PS8 A;  4IUL A;  4GZC A;  3KD7 A;  1U3D A;  3MX3 A;  3TXM A;  5CHE E;  5D0Q D;  4HOR A;  4I1M A;  4I9E A;  3OAW A;  3CVW A;  2LAI A;  1DNP A;  4XI9 A;  4GZ6 A;  5AIJ A;  5HQ8 A;  3D3M A;  2WXN A;  1PC2 A;  4G23 A;  4GB9 A;  1W3B A;  2KCV A;  4KT6 B;  2KC7 A;  4XE0 A;  1X5B A;  3FU3 A;  1GW6 A;  2X6F A;  4HLE A;  3VLF A;  3HYM B;  3LPZ A;  4DJA A;  3ZEF A;  5CCM A;  1EPU A;  4A1G A;  4LUN U;  2ZU6 B;  3MA5 A;  4I17 A;  5BV1 A;  1E7U A;  2WXO A;  2VSX E;  3D9L A;  3CK7 A;  5A7D B;  1JPL A;  4LER A;  5BV0 A;  2VYI A;  4HOQ A;  4LRZ A;  4V3I A;  1WM5 A;  1XGW A;  4JA7 A;  4C0M A;  4OYS A;  1YA0 A;  4CDN A;  2GRM A;  3MGB A;  1PAQ A;  5J08 A;  4I6G A;  3S7B A;  3CEQ A;  3IBE A;  1KT1 A;  4P29 A;  4UQZ A;  5JHB A;  1H6K A;  2XQ0 A;  2X6K A;  5FWQ A;  3RIB A;  4AY6 A;  1E7V A;  3EHM A;  3OXF A;  4ATG A;  2J09 A;  5CMW A;  3FHE A;  3DPD A;  4HOS A;  4N39 A;  3LCA A;  4FJY A;  4JW1 A;  4YND A;  3WXX A;  3FUM A;  3ML8 A;  3SI5 A;  5EDS A;  4B94 A;  4XKC A;  4ANU A;  4GCN A;  3FUK A;  1SZA A;  4GZD A;  4BWR A;  2Y4U A;  2BUG A;  5G55 A;  3CIA A;  2L0T B;  3KEZ A;  4XIF A;  4ABN A;  3ZYQ A;  3G2S A;  2IOL A;  4FAD A;  1UJJ A;  2XGS A;  1HZ4 A;  2KAT A;  3D9M A;  2LNI A;  4UWF A;  2OVB A;  4FLB A;  3D9O A;  5KJL A;  4Y6C A;  4NAC A;  4ACL A;  4J8E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...