4MLPA

Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
492
structure length
492
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Cryptochrome-2
total genus 179
structure length 492
sequence length 492
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4mlpA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4mlpA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mlpA01
4L2IA 1PFVA 4AQ7A 1H3NA 4U63A 1HYBA 3P0IA 3UK2A 4QRDA 4J76A 1XNHA 4MAFA 1PFYA 3IVXA 1EJ2A 2Z08A 2E89A 4UZEA 4DNXA 4FZJA 1PG2A 2O5RA 4MVXA 5DASA 1EFPB 3H97A 3M5WA 4MWCA 4PBRA 1V47A 5TEWA 3RK1A 3ZUGA 1N77A 1K97A 1T6ZA 2V0CA 3H9CA 3QE4A 3RFFA 4NAUA 1NSYA 4P2BA 3SZ3A 1KR2A 1J20A 1QRSA 1IQRA 4EG4A 1T9GS 1XNGA 4XFJA 4KPUB 1I6KA 1JIKA 4ZCRA 1IFXA 4OUDA 3NBAA 4DDMA 1YIAA 1JHDA 1WXHA 2A84A 1XNJA 3HGMA 4XFDA 1JEDA 3NBKA 1N2EA 4ARIA 1A8HA 3G5AA 1JIJA 2PIDA 3AG5A 1MOPA 1H3EA 1O97C 3RBAA 1M83A 1MAUA 3Q12A 4XSVA 2JA2A 3CLSD 2DUMA 4ZCTA 3CVXA 2X1MA 1WQ3A 2AKEA 1N2OA 4MW6A 1KQOA 3IOBA 3H9BA 4UZFA 1Q19A 1XJQA 2PFSA 4MW1A 1QJCA 1R6UA 3X1MA 3IMCA 4MW5A 4TS1A 2BYTA 1KP2A 1I6LA 4HJRA 4F3RA 1JGTA 1GN8A 2E0IA 1KH2A 1MAWA 3N2YA 4HK4A 4YP7A 3ZXIA 4ZCPA 1OWPA 3ND7A 2PZAA 4MW9A 4CDMA 3CLTC 4MUEA 1KP3A 1PFUA 1MB9A 1OWMA 3CLSC 5H7XA 4MVCA 1ZH6A 3AFHA 4DLPA 5FO0A 1O96A 4RPIA 4NAHA 4DDKA 5IHXA 5F23A 3Q4GA 2HMAA 1G59A 4K0RA 3IMGA 1WXIA 4HJXA 1KQNA 4GU5A 3IUBA 3LE8A 3G6KA 4F4HA 1D2RA 1ZH0A 4I6JA 3IOEA 3MLBA 1WKBA 1WY5A 3SEZA 2G36A 2OV4A 2QJTA 2YWBA 3DLAA 1J70A 3KT6A 4MLPA 1F9AA 1OWOA 4GRIA 4MW0A 2DETA 2C5SA 3ZIUA 4MUIA 1OBCA 1N2IA 1IRXA 2VTBA 4YMIA 2A1UB 3ND5A 2IP1A 1J09A 1O95C 1COZA 1J1UA 2PXHA 3CLUC 4JXZA 3MXTA 1GLNA 4DDHA 3RK0A 1U0BB 4MWBA 4HPWA 3CLRC 1B6TA 1NUSA 4MW7A 1NI5A 4MULA 1IQUA 4DE5A 1M8JA 1WXFA 1U7XA 1G8GA 2O8VA 1JEEA 3X1KA 1JZSA 3COWA 5KWVA 1N2JA 1Q77A 1ZUNA 1QNFA 1NZJA 4EF6A 1T9GR 3VU8A 3A2KA 4MUGA 4MWEA 4AS1A 2TS1A 3AL0C 4L2IB 3PRHA 4YBRA 2X1LA 2QJFA 3G59A 3IVCA 3PNBA 3LOQA 5LFAA 4ND7A 2CUZA 3FETA 1ZJWA 4JFAA 3INNA 1O5TA 1TFUA 3CLRD 4KKVA 3UMVA 3IODA 2D13A 1RQGA 5DB4A 3HFJA 1SURA 1P7PA 2ZUEA 1K92A 2WSIA 4R0NA 1G8HA 4YP5A 1NYLA 1QRUA 3HV0A 1U3CA 2QTRA 2ZP1A 2J08A 2GKSA 2DPLA 3KT3A 1N2GA 3CA8A 2BTEA 4OUDB 4CDNA 3A04A 1VL2A 3ZXSA 4ZCQA 3SEQA 2PG3A 1OD6A 3VRHA 4NX2A 3BL5A 1U7DA 1WJGA 1VBKA 3HMQA 3IVGA 2DXIA 1LI5A 3PXUA 2DEUA 3U1VA 2QUJA 3QTTA 1Q11A 4ZT6A 3SZGA 2AG6A 2CYCA 1O0CA 5TGTA 3KT8A 2J09A 1I2DA 2RD2A 5BNZA 3ZGZA 1MRZA 3KT0A 5LLTA 4QBTA 1IVSA 1NUPA 3UY4A 1M1ZA 3UOWA 1T6XA 5K0TA 2WQ6A 1QQTA 4E1AA 1NUQA 1N78A 3H99A 4YP6A 4MUFA 3D6UA 4Q93A 4RUKA 3COYA 3FH0A 4EG8A 3AKZA 1WXGA 2WQ7A 3CLTD 1N2HA 5J5AA 5HG0A 1O97D 2CV2A 2HGZA 3CVVA 4K03A 2VXOA 4KR6A 1IQ0A 3H05A 3ZJTA 1N3LA 2PZBA 1FFYA 1WOYA 2I1LA 1F7UA 1S4MA 4MW4A 3ISJA 2NSYA 2OQ2A 1EFVA 2A7XA 5AHWA 2QUHA 4DJAA 2E18A 1YULA 4CQNA 1N1DA 1JILA 2DLCX 3FHJA 2NZ2A 1KAQA 1MB2A 1Q15A 3K32A 1M8GA 3MMXA 4MVWA 1TYDE 3MUEA 3A05A 5J58A 3OTWA 4JYZA 1YIDA 3JXEA 4S1OA 3MLAA 3TQIA 3FNRA 1N2BA 4EG7A 1VBMA 5LM3A 3CR8A 5JBNA 2D54A 1VLHA 4JZYA 1ILEA 3PNVA 1JIIA 3ND6A 4KR7A 3FI0A 3DV2A 3F3MA 1NUTA 2VTBB 3A4IA 1TYBE 4J75A 1QRTA 3P52A 2H29A 3CVUA 1CT9A 1BS2A 3IH5A 5K0SA 2EJCA 2QUIA 3LCJA 3I05A 3TZLA 5KCMA 2EL7A 5EKDA 1KQPA 4U7JA 3IUEA 2A4MA 3IMEA 1QU2A 2R5WA 4KR9A 2H2AA 5DEOA 5FNZA 3RJZA 2CV0A 5J59A 1NURA 4EGAA 4PBTA 3GUZA 2J4DA 1M8FA 4QREA 5TEVA 2CFOA 3TS1A 2B7LA 2E21A 3KFLA 1VBNA 4G6ZA 3FDXA 4ZT5A 1IHOA 3CLUD 3Q10A 4ARCA 1EFPA 1YI8A 3COVA 3FWKA 1I6MA 2YWCA 2XRYA 1F7VA 2RE8A 3PNYA 1OWNA 4EFKA 2YY5A 3FY4A 1PFWA 3GMIA 3VGJA 3AIIA 4KPUA 4X0EA 3FIUA 4MUKA 3AG6A 3QTBA 3RHSA 2DERA 3X1JA 1K4KA 2QTNA 1JZQA 1OWLA 4I6GA 3SDBA 1OBHA 3P0JA 1J1ZA 2YXNA 4OJMX 3N9IA 4MQ6A 1M8KA 4MVYA 4WNYA 3CVWA 4WSOA 5KHAA 1MJHA 3FOCA 4ZT3A 4ZCSA 2J07A 4PY2A 5HUJA 1R6TA 1TEZA 4JXXA 1EXDA 2JAXA 3HZRA 1GPMA 3ZJVA 2CSXA 1ULHA 3L93A 3SYTA 1MBZA 3S3TA 2X0KA 3C8ZA 4ND6A 3GLVA 2A88A 2HZ7A 1KAMA 4NZPA 3ELBA 3CVYA 2CT8A 3K9WA 1PG0A 4MUHA 4Q16A 4R2LA 4ZT2A 5TS2A 1H1TA 1G8FA 2QTMA 2J5BA 4CT0A 1IH8A 1T6YA 1J21A 1GTRA 4G5FA 2Z09A 4ZT4A 3N8HA 4BWVA 1V8FA 1LW7A 1GZUA 1TYAE 1JMVA 2WB2A 3NV7A 4NDAA 3COZA 5FO1A 4G5YA 3IDFA 4R2MA 3HL4A 1U3DA 3IOCA 2A1TR 3ILVA 4EG1A 4U8HA 3UC5A 5HUHA 3ZJUA 2IJGX 1WQ4A 2GOYA 3DO8A 1WZ2A 1GAXA 2V0GA 1QU3A 3DPIA 3N05A 1O95D 1O96B 3D6VA 1KORA 1YUMA 4PBSA 1WXEA 3P0HA 2A86A 2PZ8A 5IJXA 1DNPA 4A91A 1FYDA 2CYAA 2XRZA 1EFVB 3OP1A 2IELA 4I6EA 2X3FA 2DR2A 2CYBA 3TNJA 1O94C 1EUQA 1K4MA 3TQOA 2D5BA 3E27A 4EG5A 1O0BA 4ZT7A 2ZUFA 1Y42X 2QUKA 1NUUA 2A1UA 1R6XA 4EG6A 1X8XA 1JECA 5H16A 1NP7A 4EG3A 1KH3A 3TZEA 2JANA 1O6BA 4H3SA 1MC1A 1EE1A 1GTSA 3L92A 2CV1A 1TYCA 4MUNA 2Z3VA 1H3FA 1M8PA 1QTQA 4MWDA 2GM3A 3SP1A 4MW2A 1LI7A 1F4LA 1KH1A 3FG9A 1KKUA 2AZXA 2QJOA 1UFVA 1TQ8A 2A1TS 1X6VA 1N75A 4NATA 1YUNA 1EUYA 1O94D 4MUJA 5DK4A
chains in the Genus database with same CATH superfamily
3ETEA 2NXJA 4LFBB 2GJ9A 2VBIA 2DPHA 4MWOA 5G2OA 1L5QA 2O1EA 2BH2A 1REQA 2C78A 1XHLA 3X44A 2BRUA 2Y1LE 3MD0A 2YC2C 4J76A 1D8TA 1EUDA 2R1VA 1MC5A 2YHAA 1JTEA 4MAFA 2VYQA 3RSCA 4DC9A 3VTXA 2OC9A 2G5CA 4KU4A 1XPOA 5DOVA 5GGXA 3AWDA 4WWNA 4NIKA 3BCRA 1T4BA 3DKKA 1L8QA 1U8CB 5EUMA 4E32A 2DHQA 5T7BA 3DCJA 3ULEG 1U6JA 1B0PA 3BFKA 1ORIA 1BCRB 2WM2A 2YJ3A 4MKZA 1BOOA 1K27A 4OLBA 1CUWA 3A3YA 4ATGA 4F7DA 2GXQA 3HU2A 4JB8P 1QZZA 2VDOB 4FDUA 2QE6A 1Z4KA 1JR3A 4KUEA 4QATA 3G2QA 2JLRA 3H9CA 3QE4A 1Z4MA 2LBPA 4YDSA 1MO2A 3K1YA 1XRLA 3LKDA 4P3YA 3SZ3A 3TCXB 2I2CA 1P1CA 4KQHA 3VR6H 4RY0A 2EZ8A 1I6KA 4LOHA 4TUYF 1WF3A 2CJWA 5FBWB 4OQQA 3EF0A 3HI4A 5ELXA 4PLWA 4GUDA 3QOUA 1C1DA 1C4KA 2CKDA 1U8UA 3ZCXA 1I8TA 3CCFA 3CXUA 1A7JA 3HGMA 2C4MA 4C2AA 2W6IA 2GYUA 4IRUA 3M4YA 4KQ1A 2VHTA 3R23A 4J16A 3AU5A 2EX1A 3LH5A 3LOPA 1PJBA 3N70A 3PQFA 3O7WA 4D9MA 1SCDA 1Q5PA 1HK7A 2GN0A 4XSVA 2HLDD 4X62B 1YA4A 5FA5A 1TO6A 4IJ6A 3V8BA 4F2GA 3G5LA 4FFLA 1CF4A 3J7AC 1ZIOA 5ENZA 3B1VA 3ZIAD 4DIUA 4F21A 2JVJA 4MDFA 3EQ6A 1YQXA 2VLIA 4BWYA 3KQKA 1N54A 2F3QA 1PSWA 1JNXX 4KLCA 4OHXA 2NUPA 1XJQA 1SUPA 2SHKA 1XZAA 5IKXA 4CF6A 1QJCA 3G88A 1JBKA 1AHHA 3QH4A 5CXUA 3D6TB 4TV8B 3TVDA 2B69A 1XVTA 1GCOA 1I4DD 3P27A 2I54A 3H0EA 4PLVA 5EFOA 2IYOA 3HKCA 4URVR 1LDNA 2BIFA 3RU0A 1IQPA 1PT7A 2DKOA 4ER6A 3MV3B 3S7DA 2IUEA 3AH8A 3CN9A 4HLQB 4AZWA 2C57A 4OIFA 4YIHA 1AKYA 1CYDA 1Z7WA 1YBAA 4BBJA 3VO2A 3MTGA 4NECA 5AQBA 4CDMA 2LVBA 3CO0S 2AKEA 1NPYA 1KDOA 4GW3A 4QOJA 2KLBA 1FXWF 4RFLA 2W0MA 3SR3A 4F04A 1ULTA 5BORA 1C29B 1MB9A 4OV6B 4MI1A 2ODAA 1Z4NA 4JN6B 3CHQA 4AQDA 3AFHA 2YWHA 3M2PA 1GTZA 4EB8A 1EWTA 5IH7A 1Y5MA 2CDNA 3UMSA 4RVSA 5EHGA 3FVTA 3HN6A 4FGKA 3RYFA 1HI9A 1M72A 1VYHA 1LY1A 4IFIA 4HVCA 1KRXA 5KZMB 5JNSA 3JZMA 3LDGA 2NPIA 3H2YA 4GU5A 1US8A 3DHEA 3IBTA 3IUBA 3VSEA 4CXMA 4CL3A 1FU8A 2D2VA 1NHWA 2CC2A 3C2QA 2JIZD 4Q7QA 4I6JA 1TR4A 1NN0A 1VI5A 1ODSA 3D7SA 1L4GA 2PS3A 1UMCA 4XB1A 1BE8A 3F67A 4CMBA 2XDWA 3KQOA 1Z06A 5BUCA 4L1BA 2YWBA 5TPWB 4JSTA 4QEKA 3S8MA 1CS0A 1JQEA 2PQ2A 4KE8A 4U95D 4Q82A 3LL7A 5A5FA 1OLXB 1F0NA 2XD9A 4B6OA 3HO1A 3H65A 3UPTA 1IRXA 3IIMA 3F46A 4B4UA 3EGOA 1CUYA 2A9OA 2HRDA 3K31A 4QUBA 4IIEA 4KN9S 5IDQA 4EB6B 2KBFA 1HYHA 3QPVA 3S8YA 2H11A 3ZE7A 1KIAA 3L7AA 3N0WA 1Y1SA 3BM5A 4INZA 1F5SA 1OV6A 2XB6A 2XGOA 1V1MA 2FP4A 3A1TA 3KZKA 3RREA 1B3BA 5ALDA 3LYAA 1LC3A 2HHCA 4F93B 1GUAA 2OCPA 1OJ7A 3DHYA 1E1LA 1GFSA 4NENA 4WLVA 5GP1A 1FW8A 1BYUA 3ANMA 5KKAA 4MWTA 4OXRA 1ZJ6A 1PTJA 2PLAA 3EEIA 2JVIA 2XB9A 1V11A 4P86A 2JFBA 5KWVA 1YMVA 5F7ZA 2WT9A 3U1TA 4AMBA 3IURA 3HVKA 3T99A 4OLAA 4WBSA 4D46A 2ZZMA 1LNQA 3W78A 3FH5A 4RA9B 4AICA 4GTTA 4QYXA 3V9PA 4ZYUA 2WXNA 4Y8VA 3WSWA 2ARKA 3D54D 4KWTA 3IBCA 1YS2X 1ZK3A 2HUPA 3IHYA 4IIXA 4TKLA 4UDOA 5K7SA 2KCKA 2QR2A 3DMTC 5GZ3A 3N6RA 1BQ4A 4YN3A 1JVSA 2FBNA 1C80A 4R7TA 2XXBA 4JT2A 2CLIB 3BHJA 2V6FA 4GTSA 1W88B 2Y2VA 2ZRMA 5TQ0B 3L0CA 3EUVA 2O0KA 1XTVA 2D5AA 4AECA 4MPPA 1OOEA 2BKUA 3BWCA 4H31A 4E4RA 1PEDA 2WPVA 4US2R 5CD1A 4QDUA 3SZUA 1BMDA 2RC6A 3EZ7A 4N7JA 5L95A 1SCBA 1Y8ZA 3ND8A 3TMYA 3IXQA 3O94A 3UM3A 1BVHA 2JCYA 1UM9A 1JFRA 4B8ZA 1DL5A 3F5MA 4FQ8A 4CLRB 1WCV1 3GLIE 4DR4B 3A36A 3K1AA 5JCOA 5FDFA 2I3ZA 1XTUA 1R10A 4PS1A 1VLLA 3RK4A 5KJMA 2Z6QA 2GKSA 1X8KA 1A9PA 3H5NA 3CQ9A 2BTEA 1WW8A 5AM3A 1PGJA 3JVDA 4UM9D 3NM6B 5IZCA 4AMVA 5CX1A 1QYCA 3JQ1A 4FINA 2CHXA 2O2IA 5JIBA 2HKIA 1FUYB 3E82A 4IWYA 3ONDA 1RWVA 4BV8A 5CXSA 3EIHA 1SOUA 5B4UA 5BWLA 2YJ4A 2D0OB 3C3EA 3EGDA 4B2IA 1GD1O 3TL5A 1P4HA 1XXHB 3H6HA 4OXQA 3FMOB 3O83A 3OMXA 4RK1A 3CKCA 2SKEA 1QJ4A 3I6IA 1E58A 2J09A 1ZJZA 2AXZA 2FRVA 3EIEA 4ZMRA 4BSZB 5BRJA 1GCAA 2JBHA 2C8LA 2NTYC 3E1SA 1UBFA 1M1ZA 3LU1A 2XMGA 2QLNA 4Y6SA 3UOWA 3UY4A 4D10C 4HQ6A 1Y7HA 2NZVG 1N78A 3DXMG 2GBFA 5AK0A 3JQ9C 1KDZA 3W2IA 2YZ7A 1GPUA 4W5WA 4MRAA 3DL7A 3EZ2A 1Q1GA 2DFVA 4LJ8A 3EU5A 3T7DA 3UWKA 4Y67A 4DMCA 3DKPA 2H08A 1KMCA 2OEWA 1WKVA 3NOGD 3IDQA 3T12A 4LHVA 3T0GA 3UIPC 3CBQA 1TM2A 2XS8A 2D8MA 4WDRA 3DVSX 2V5FA 3HUTA 5KPJA 1E2BA 1WMAA 2IOHA 4JENA 1DG3A 2GW1A 2YHSA 3MW8A 3AXTA 1JDPA 3FEYA 1SC1A 1XRQA 4FGWA 4H18A 4HQFA 4JC0A 4KWEA 1F9EA 2BBWA 4JKIA 3WADA 3WK4A 4DCGA 2YY7A 1I3MA 3AG3E 3VKVA 1UC9A 4M8NE 3IV6A 4S05A 3C8HA 3OIGA 4ENWA 1HG5A 2J4BA 3CHYA 4IDQA 5JALA 1N1DA 1S4QA 1E2FA 1NN3A 3UPUA 5FBRB 2X7HA 2F9LA 2QM0A 4IR7A 2NSDA 2VGXA 1DRVA 1X7HA 5K6AC 3PZBA 1YQGA 3K9NA 2RAVA 4NH4A 1K8QA 1V16A 1WDKA 4PC6A 4X7RA 1X0XA 2C54A 3AS4A 4K8RB 5FI1B 1USWA 3BZWA 2FPRA 4OQMA 3T5BA 1S89A 4O8ZA 3UJNA 1K9SA 1YIDA 4IXTA 1J8DA 5TV2A 1V9CA 3RHFA 4W4TA 3NUGA 1G19A 2L19A 5AENA 3DEJA 5ALKA 5B2EA 3IVMA 4BN4A 2PAAA 5GPBA 2V7UA 3NZSA 1HQCA 4KVMA 2HU5A 5DWDA 1OFIA 1TN7A 3SDSA 1I13A 3DQQA 1SVWA 3AY7A 1JIIA 2ZYUX 2AOUB 3BFXA 3PFCA 4JJ4A 3WMGA 4P54A 4ATNA 3G9UA 3G2UA 4HV4A 4DLQA 3KSMA 2B8TA 1DQNA 2UYYA 3VPSA 5KTTA 1TNDA 5ENNA 1RRPA 3OU2A 3EMKA 3SX2A 3WYEA 4M1QA 3CHPA 1W8DA 1EP9A 5EIHA 1ZIYA 5I9BA 4QPJC 3UAVA 4DV2B 3OJWA 1BEUB 4WWHA 3O2QB 1DHRA 4O4HF 3W34A 4D8XA 4EZBA 4FC8A 1C0IA 1SBHA 2DFNA 2LO6A 1W4BA 4BKQA 1FFGA 4EM6A 5LJIA 1T36A 1RKQA 4DCPA 1UOQA 1J33A 2C3OA 4QRHA 5TR9A 2VOJA 1J7JA 4QPZA 3OEED 2YV4A 2JDIA 4EMSA 2OAP1 2VP2A 4Z0TA 3QFCA 2MOKA 2P75A 1JF8A 4IXMA 1M8FA 3GJQA 1GNLA 1GDTA 2FMHA 4QRIA 4W1QA 1VBNA 4YMVA 1VHTA 1YASA 2FWPA 3S8EA 3LX6A 3UV3A 3K2BA 2ZB8A 1YRWA 3K9CA 5JHGB 5I7RA 2P9GA 1EFPA 4DXDA 4ER5A 2IEGA 3LX5A 3P2EA 4MCIA 4WOPA 4DILA 5KSYA 2I99A 3CG4A 1BWRA 1QZXA 1XL1A 2O3TA 4WXHA 5JISA 3AR4A 4HGPA 1IXZA 3FY4A 1CHNA 4XFKA 3SIXA 1X92A 4CM4B 3IKTA 4LBZA 2TMDA 1PLJA 4YB8A 3W5UA 4AI6A 2XOEA 3GNTA 2IZ5A 1HLFA 3T94A 1P7YA 3I1IA 3JYNA 5C7LO 4F2HA 2MRIA 3QTBA 3N1UA 3RYIB 4CFSA 4JLPA 2H7VA 5AVTA 1L5GB 2GESA 3UJPA 2GBCA 4D9CA 4CLRA 2D7JA 2JFOA 2B1GA 2EFEB 3R0IA 3HXDA 5JVDF 4B31A 4IMJB 2KS6A 1O1SA 1RHQA 4WNYA 1U28C 5HDQA 5L3RA 3OSUA 4BCDA 3FOCA 4LNUD 4BB9A 1BD3A 1HXHA 4DLBA 1HWYA 1KI7A 1KMHA 3PLRA 2JAXA 2QW0X 5F12A 2JGDA 5FFFA 5U4QA 5DFAA 4LRYA 4B8YA 3SYTA 1M7BA 2AQIA 3EA0A 4X7MA 4ZVNA 4A0GA 2ZBDA 2CLKB 1Z17A 4AJEA 4TV3A 2PFGA 4IWNA 1VQ1A 5I47A 4EZLA 3UGJA 2EBFX 2JATA 3QDNA 3F2IA 4Q16A 4LE1A 4XVRA 3RGWS 4G41A 3VDXA 2VUUA 4IM7A 2RBKA 4GA1A 4EW1A 5CERB 4BMNA 2MYOA 4FKZA 1OUVA 1IK4A 1GTRA 2ZVDA 3LYUA 4ZT4A 1KO8A 1ZIDA 2F43B 2AXEA 2HMVA 2PJUA 3BK1A 4CMKA 5BWMA 3GMTA 3HVUA 3P32A 1DX6A 1P2TA 4FFBA 1CIVA 4II2A 4PR3A 2IXTA 2IYSA 3CH4B 4MVJE 3G2SA 1YWGO 1RYMA 2J85A 4PX9A 1V2HE 4OB8A 2XWJI 5FL3A 1VA4A 2QRVA 1ACMA 4HGQA 4LE0A 2UZ0A 1UFRA 2GF9A 3TIIA 4M9CA 3HBAA 3AUKA 3AUTA 4URXR 5BV1A 3LYLA 3DO8A 5GJCA 4DIFA 1GUBA 5I9NA 3V1UA 3TXYA 2PNFA 1HT2E 2JIPA 2P2YA 3OPQA 5F52A 3FZGA 1SXPA 1L7DA 1RWKA 3IRVA 3QWVA 1PQYA 4DA8A 5J90A 4E13A 1UWVA 4QBKA 1WMFA 1GG9A 3X1WA 1XTQA 1ISFA 1FS6A 2ONJA 3W5CA 4GR4A 5JSHA 3FGOA 2M98A 1C4WA 1G4HA 2WF9A 4LRZA 2DTEA 5IJXA 4A91A 2WM3A 2Z2ZA 3ZYZA 4UWGA 3CEAA 3TFQA 2YQ5A 2P6RA 2FE1A 1GCGA 2Y0BA 1SXJE 2BR5A 1X7XB 3DDNA 1JNYA 4W82A 5EYPB 4ZI3A 3LPMA 5IHPA 4IZHA 4CM5A 5IMSA 1O94C 1UJMA 3DB2A 5K6RA 1IEVA 2O8EB 2JFUA 3TPCA 1KPIA 2IXDA 1J0XO 3AFOA 5REQB 4P81A 3OQNA 2V7QD 4P7GA 2PEYA 1YL6A 3NTXA 5E9WA 1V25A 2I9KA 1DSSG 1IG0A 1PR0A 2GAAA 2RGNA 4WFIA 2F90A 2YV1A 3N3BC 1WABA 5CLQA 1PVDA 2M6SA 5AW9A 4D1YA 3TFOA 3RE1A 3HHMA 4CTNA 3DOCA 4PXAA 3MIIA 1Q0LA 3IOYA 3S2UA 1AKUA 1X9GA 4V03A 2RK4A 4QU8A 2CJXA 5BPPA 3LVRE 3FMGA 4FKMA 2J46A 4LI3X 2Z6UA 1D7OA 1P33A 4FYKA 5IK2A 5F3DA 2Z8ZA 1W9HA 2NV0A 3KYCB 3QVUA 2XZTG 1ZI6A 2B7CA 4C78A 4F6RB 3KSUA 1STOA 3GBVA 4F6CA 4R6XA 2DPYA 1Q44A 4PZ0A 3FTVA 3A58B 3MLEA 4ZQFA 5IF9A 4E5VA 3JWEA 5K1ZA 2IZZA 2C2BA 1MTOA 2ZSUA 3GEIA 3L6BA 3EQZA 3PIRA 1AGPA 1EBUA 1ECBA 1U9IC 2FRXA 1EX7A 3BJZA 3NT5A 3R44A 5C8YB 5IANA 2YYAA 3THYA 3UTCA 3C3OA 3ENVA 1AUVA 4PSVA 3G0CA 1JQKA 4LQLA 2YHUA 1ONOA 1ESZA 1U8ZA 1ZN9A 3OBBA 2NGRA 1UXOA 4MQEA 4TLMB 3JAKA 4Y1RA 3IA7A 3APCA 1UP4A 1YQUA 4PANA 4Z4CA 4LHYA 1PFVA 2BI4A 2ZE5A 4MRMB 4C5AA 4IH4A 5JATA 5LA6A 3LC2O 2B37A 2QLBA 4ZMBA 3R77A 1WD5A 3OQ6A 3PQ8A 2QP9X 2VWHA 1AF7A 1XMOB 1JG4A 2X0RA 1Z5OA 3TSOA 5LUBA 4M3OA 4B8WA 3R7RA 1PBNA 1WM1A 2J9FA 2ZIUB 1DCQA 1P44A 3WKCA 3E9EA 3ZIDA 4NNOA 3AUAA 3B7PA 1D2MA 2XA1A 4OP3A 5HWSA 4XPIA 4F4JA 4IJKA 3PQCA 3WX0A 1KP9A 1LNZA 2EKDA 1QH1B 1NR5A 1ZICA 2I2OA 4HRXA 2X0DA 2DF8A 3AUJB 3WG9A 1YSCA 4CRWB 4TUUA 1H94A 2FW7A 1H2YA 3B52X 4KZKA 1KSGA 4UI9K 1Y3AA 5DM1A 1EUZA 3SIWA 1HDRA 2C42A 4BKMA 4YUXA 1SG0A 3K15A 3KUXA 1GDHA 3T3OA 1ABEA 1CUXA 1N5KA 5D5QA 1KYWA 1LF8A 4DI4A 1DXOA 3G2JA 3I04M 4ARZB 4D97A 1D9XA 2C96A 4HBGA 5CW1A 3R7LA 5AVQA 2PZIA 1H2EA 1FK8A 1JMKC 3D0QA 3GCDA 4NBKA 5E9AA 3EGIA 3G7UA 4H7YA 4GVXA 1T3GA 3HPQA 1WXHA 3W7VA 1XA0A 1Z2CA 3BQNB 4B82A 3CV3A 4U07A 3LTEA 3U6KA 1Q12A 3PC4A 3CKKA 1V54E 3L46A 2XITA 3OEHD 1B8NA 2H85A 5HRCA 1QYMA 1ZINA 2DBVO 3FFBA 3KVOA 3AETB 5IDVA 1D1PA 3KM0A 3QW2A 4BNDB 1LZLA 5G3ZA 3E9YA 3TFWA 1M9NA 2AL7A 3T15A 2A3NA 1SCKA 1YXMA 2YFHA 3UF0A 3GPLA 2G1UA 2GKGA 3M4ZA 2ZIAA 3EDOA 3HDGA 3QEMB 4DLUA 2YFYA 4GBMA 4V0QA 5U1PA 2YIVX 2VJPA 4YJ3B 3UMJA 4NARA 3ZQUA 4ARAA 4WESB 2V96A 2JKZA 3KWLA 4J1TC 4JR0A 4UVGA 1E9VA 1Y4AE 2XODA 3GUUA 3HKEA 3ZH2A 5A02A 5JXIA 2BUBA 1J24A 1FFXA 3HYLA 4ECEA 3PE4A 3DSTA 1EVEA 4MW5A 2NUBA 1N6KA 2DFKB 2ZU6A 2BYTA 3EG9B 1N1GA 1UT5A 3RSGA 1D1SA 2G4VA 3NYRA 3ZNGA 3W2GA 3VLEA 3GF4A 2GA9A 4Z4GA 5ARCA 3B53X 5J43A 2XKAA 3IV9A 1ZXBA 2M2IA 1IZ8A 4LDJA 5D1HA 2WHYA 1QONA 2Q4OA 1N34B 3NM5A 1X9IA 3GWGA 2GFQA 3B1ZA 1KZOA 3TNFA 2PV0A 4J8EA 4UMEA 1ZNXA 3CLTC 3AQIA 1S2GA 2DH6A 1CUGA 1E2UA 5P8WA 3B7WA 5FV4A 1T8UA 4L0CA 2MOWA 2IHNA 4XUDA 1G21A 4U2KA 1HU3A 1IBKB 4EYKA 1Z4OA 1BHQ1 1BROA 1ZH6A 2L69A 5GAJA 3AHGA 5H3HA 4YRQA 5J2TF 3ZHOA 3UUGA 4FS3A 3MWDA 2CEKA 3V4VB 3ZLVA 1VSBA 4G67A 4Q4LA 1EK1A 3GN2A 3DDOA 1AC5A 3OFND 1G42A 4IDBA 3BXPA 4RKQA 1OH5A 5HFAA 2D5LA 1EDDA 2GVDC 2BGWA 3PIIA 3LQFA 3Q5MA 4RVUA 4ZC1A 1OY1A 3PGVA 1GAEO 2XUJA 1Q92A 2Y0CA 2IC5A 3PZDA 3A4VA 2XUAA 4R3NA 2I5PO 2X6HA 2WA2A 1HNXB 1A7UA 2WJ6A 3PSHA 5JAMA 5B5SA 3I4LA 3NLLA 2P1DA 1MN6A 4WERA 4CI9A 4GRIA 2AV6A 3OQ1A 3EXIB 3ZHXA 3I4RB 3IPXA 4XSGA 4BFTA 4D82A 4E51A 2FMFA 8OHMA 4KG7A 1H65A 4I17A 3P9ZA 2EX0A 2WJYA 3E1KA 4NG5A 3V7NA 1ZS9A 3OUUA 4DXHA 4E5SA 5IX8A 1J09A 1P6XA 2TECE 3KLBA 1QG0A 2CL6X 4LG6A 3BD6A 3CLUC 4JLMA 3ZRHA 4OBXA 4E2FA 4CZ2D 2Z8YA 5AW5A 3LJ3A 3ZYLA 4P3OA 3SFVA 4F4CA 1NQOA 4LJSA 1SUEA 1E8WA 4HPWA 2WMOA 1EE2A 4JLVA 1NBWB 3OPVA 4A16A 4R1QA 5A5VA 4A6DA 4GMLA 3OLYA 4MS4B 4OI2A 5B3SE 2CY0A 5D51S 5DHRA 2YN0A 1HTWA 4WXMA 4FQ5A 1E3MA 1BMFA 4ZANA 3A9WA 3UW1A 1OCCE 5FQOA 4G0MA 3I34X 4Q24A 2CN1A 2HIMA 2PJZA 4OHMA 3VYUB 3H16A 4FCTA 3WYAA 4JHXA 3KPUA 3OOHA 2O8DB 1SOMA 4ZGBA 3LT1A 3L7LA 4FMPA 5K9ZA 1VI2A 3RVKA 1UJ6A 4JOCA 1J42A 2A0XA 5C5CA 1L4YA 3E84A 2FP3A 3HA2A 2R47A 5FJJA 3ZWYA 3BRQA 2QBYB 1QAQA 2WZDA 1L4NA 1XZEA 2ES4A 2WG1A 2PKYX 2QJFA 3FMVA 4MA0A 4O5OA 1RI3A 5DPMA 3H8JA 1UWKA 4ATZD 1L9XA 1JDBC 2K2WA 4R2JA 4IPTA 2R4QA 1GZHB 1FVXA 2ATVA 3LKVA 3WHPA 1WO8A 1I4TD 1PLLA 1Q0SA 1T24A 2PRIA 2V3WA 4YYZA 1NKTA 1ZONA 2FX3A 2IYVA 5KDOA 1ZMBA 3NTRA 4QXOA 3GAMA 2WB4A 3IHTA 3C5VA 4OPMA 1GQSA 2OO7A 3C41J 1VM6A 3I4CA 3A1SA 3KEFA 4M83A 1GAWA 1JWFA 1PP4A 4DWJA 5HYVA 4N0QA 5ED4A 1A82A 1T5TA 1NP3A 4TT3A 4NCHA 3R9IA 3S7ZA 4G0WA 1SCUA 3I9OA 3KIPA 1CQIA 1IZYA 3TBKA 2P58C 2OXEA 3H9EO 3MGKA 1AKTA 3O93A 1IJBA 1VB3A 2GNPA 3SZLA 1F14A 1ZNYA 3EQ8A 5BQPA 3ZBUA 1FFDA 4P5EA 3FUUA 4YRFA 1CUCA 2PG3A 3U2QA 1WEKA 1NBME 3AAAC 1ISMA 1WUYA 1BI8B 2HN9A 2VJLA 3I4FA 4QYTA 1ISRA 2AG5A 1VJCA 2APJA 3I8SA 4IMPA 1QGYA 4LDPA 3WKDA 5EZYA 3FDFA 2P27A 3C1OA 2V4MA 3GJ5A 3W9GA 2ZIWB 3O47A 5G0VA 5CPFA 4BT8A 3ZX4A 4WCDA 4WLUA 1DARA 1TM3E 2WWTA 1GL3A 4I08A 3TYXA 2HHHB 2N75A 4RMIA 3IXLA 3I2FA 2LIPA 1R8QA 4INJA 1UFOA 3D4OA 4ZVRA 3IAEA 4XVHA 1QCDA 1SXJB 2A7QA 4YJKA 4N47A 1MRZA 3UT5B 4O0MA 3I2HA 3AB8A 3OJXA 3MKQA 4RIEA 3WDLA 5LLTA 4PX3A 1IVSA 1L5SA 4TM7A 2IV2X 2QAJA 4I1AA 2O7VA 3PNSA 2HJGA 1ECFA 4ITVA 3AHIA 2HQ1A 5AI4A 1T2AA 4Q1EA 2X6KA 3SE7A 5JXHA 1PYGA 2WG2A 4OHCA 5HIMA 3IESA 3PFHA 1U7WA 1QF7A 3P9QA 1BS1A 5J23A 2NXEA 1VECA 4BJ6A 1A8SA 2C0CA 2IPAB 3R0XA 3TLEA 4D4LA 4N9WA 4UD2A 1PNRA 3IT3A 3TMKA 2NVWA 4K6OA 5I01A 1LD7A 5EJIA 4NI5A 3NGXA 3ZNPA 3G9TA 1ATZA 1BDHA 4G4SP 3K4HA 1PIWA 1JJIA 4I1SA 5DBIA 4ABNA 4X20B 1RI4A 2PX6A 3FZQA 4FFDA 3MOSA 5HM8A 1GSHA 3TRIA 3JCZA 5E2BA 1EF1C 5FOUA 3N2GB 4W9MC 5EWJB 3LI2A 5ITVA 1A0OA 1RLMA 2GD2A 1JDUA 3CF4A 1FMJA 3WLIA 4D9IA 3HBJA 4EARA 4C6TA 1MQ9A 2NZ2A 5ANRA 4HNVA 2WE7A 4R8SA 3KCQA 1PS9A 2D4AA 3M1AA 4UQYA 3QK0A 1EI9A 3MMXA 1E9EA 4MVWA 4F1SA 2V7TA 4JKYA 3AVTA 4TUYA 3BHMA 5BUZA 4B3CA 3VOSA 1C3OA 1K8XB 3ESRA 2BN4A 3MLAA 1LLDA 2AD5A 3ELDA 4NULA 4P22A 3THWB 4G0UA 1QX4A 4L6IA 1Q74A 4W5HA 3A0RB 2ODPA 2KJQA 3HVEB 4EG7A 4YBZA 4PLCA 1QK3A 1VP9A 3LUCA 3RC1A 1U0TA 3UN1A 2QTWB 2ZRAA 2DBAA 4LUNU 1L5FA 3BG5A 5E9QA 1AU9A 1M6VB 4KR7A 1FBTA 2ZRIA 1LD8A 4MYCA 5AW4A 4DVGA 3OPYI 5HRUA 4Z7JA 3EIQC 4P35A 4AIIA 4WBNB 2OFPA 3C1TA 1Z5SC 2WJHA 4EJ0A 4WUVA 1NGSA 1BS2A 2JEZA 2H92A 3E9RA 4WGGA 1YL5A 5D7NA 5K0SA 4DL9A 3FH8A 1CRQA 3ENZA 2WM9B 3PREA 1N9GA 2CCKA 4TMFA 3O73A 5AVSA 4R7ZA 4BZWA 2AFIE 2GN4A 2W2XA 4AS2A 4D3XA 5KCMA 1JLRA 3GYZA 1C41A 1UBKS 4MQUA 5HPYB 5CP8A 3EBLA 3M9WA 3L1VA 1VLJA 2J41A 2FZCA 3CPJB 3K30A 5KQRA 2JCVA 4R68A 5TT0A 2E4ZA 2BP7A 1CJTC 2V8OA 1SY7A 1NBMA 1LCIA 3MWGA 1AA9A 2XE7A 4UREA 3U1BA 2GRJA 4KXNA 4BPBA 3GEPA 4H1TA 1PNOA 2C03A 1VKOA 3BL6A 4PCVA 4KVZA 1GTMA 3FSJX 1NR7A 3BD7A 5CCBA 3DUWA 3LRPA 1XWFA 3A3OA 3LY9A 1Y7PA 1CLEA 3GA7A 3CHRA 2A5DA 2C8KA 1Q17A 2NSZA 3AEUB 4FJ2A 2C7PA 3E5HA 4IJQA 1CR4A 2QBYA 3AR7A 3KPVA 3LP6A 4WJKB 3I92A 1BCSA 1EIZA 1N0RA 1C3LA 2W90A 1ZH4A 3K1TA 2OYRA 5FPHA 5EJEA 2BEUA 4D4MA 1IRIA 1EP3B 1T1GA 5JNTA 4P4GA 5CDGA 4OSPA 5CECB 4GUAA 4ESEA 3JALB 1GQ2A 4HVBA 1TVMA 2ODBA 3Q85A 1UK7A 2W6ID 4PX2A 3T1VA 4BFXA 1IULA 4ZAFA 5LQMA 1T9DA 1P2SA 4XYEA 3AILA 5FWYA 5F5XA 4Q12A 2ZAIA 1KARA 5HBGA 2J4FA 2OCKA 2BRUC 2ZJYA 3H04A 3NHKA 2BEKA 5F76A 1UKAA 2WMYA 1JH8A 2VCEA 4JQYA 4LN1A 5IDXA 1G5HA 5K3EA 2BKVA 3UXHA 1G6KA 3HLKA 4FWBA 3UG7A 5JSFA 3FCCA 3PGA1 4GI3A 3Q9UA 1DWQA 4DX5D 5BNTA 4PY2A 1BX0A 4KVAA 1R6TA 3QI7A 5AP9A 3ZE1B 5D2MC 4PZZA 4BSXA 3KCNA 1Q1ZA 2HHJA 1KOJA 2Z4TA 2X0JA 4KZCA 5HKKD 5CA0A 3RSHA 3BJIC 2W22A 4Q3LA 1GPDG 4Q47A 3EJ6A 2XB4A 4N7BA 3UK6A 3X1YA 3KE9A 4EYGA 2Q0SA 4Y2TA 5EZYB 4NMMA 1HLGA 3DAPA 4KC0A 5JVDB 1VXRA 3UUWA 2H4HA 4ZT2A 3IEVA 3RVJA 1G63A 2EILE 1G8FA 1SKYB 1G5TA 5GOZA 2PPVA 1LQTA 2PY6A 2EG5A 2JAOA 4H6VA 5CFNA 4CBVA 3HJBA 3H8SA 4NG4A 3HBFA 2R84A 2BONA 3COZA 4PRZA 1APBA 2IH4A 3JWIA 1C4XA 3BSYA 3HI6A 3L4KA 4HAUA 4D26A 3AX6A 4K1XA 2HLDA 1BGWA 1PF7E 5J1TB 2VIIA 1GDDA 1Z34A 1C9EA 1PN3A 4PONA 3G7NA 3MJSA 3HYSA 4QXMA 1TM4E 2EP5A 3QX8A 4DIKA 1MDFA 4DM3A 4KSYA 2VTDA 4HQKA 3ZJUA 1XTPA 1CUVA 4UHJA 3GRVA 1FFHA 5EWMB 3B6KA 4BL5A 1P29A 4OLJA 3CSDA 5EERA 2V0GA 4JYAB 4LZLA 4RH3A 1PL7A 2AMVA 3L79A 5HKAA 1X81A 3TRKA 1NTOA 3PL1A 3PX3A 1PR5A 1NVUQ 3UM1A 4LBYA 3SSOA 4ZHQF 2PJRA 3A9TA 4ITRC 1UKCA 1P61B 3IBGA 4DMGA 1XMSA 2XWBF 1HORA 3WRYA 2XRZA 3LIPA 4UPVA 3L7IA 4Y6QA 3U4CA 3DG9A 1L3IA 4PBSA 3FMIA 3WA6A 4P08A 5JQGB 4ZOLF 3LTNC 4C29A 3A10A 1DKUA 2WVGA 4EG5A 1TLTA 1RCFA 2MSCB 1WV1A 3BJEA 3FNEA 4RTQA 2ZZKA 5BW8A 5KUTA 4TUYB 1Y42X 4GQIA 2ZUFA 5MN6A 1QB7A 2C95A 3L8YA 3MSXA 4HLLA 1QTIA 1YI1A 1KI9A 2BH9A 4IDPA 3THWA 1D8AA 1JECA 2UAGA 1GV0A 5EMHA 3SC3A 1T1RA 1NBOA 1XZ8A 2Z4RA 1KZ6A 1Y0BA 3U17A 3FYTA 1E61A 3DONA 3WB2A 1DMRA 1JR3D 3UJAA 5L53A 1QIIA 4NEGA 4RVGA 3DE6X 5ED0A 3ET4A 1L6RA 4UJ5A 4ZYWA 1QDEA 4MS3B 4QBFA 2WUFA 4TQGA 4YRZA 1V1RB 3UX4A 5F33A 4JI8B 1DU4A 3CWQA 3DWEX 2OP0A 2RHBA 2Z8YM 3UKRG 3KOXA 3DSVA 1OQAA 4HL6A 4HWOA 3RV3A 3OKAA 1FJ2A 3QFTA 4KBFA 2NUTA 4D92A 2RI1A 4TKVB 5ALYA 2AG0A 4IQGA 3EARA 3TSAA 1EXMA 2G1AA 1DKOA 1N2XA 1PJSA 2CXOA 2J3JA 4QOSA 2RH8A 2VYVA 4Y2SA 4B5LA 1TQ8A 5TX7A 3L6UA 3RG2A 3RR2A 1FJHA 3FNQA 3TQCA 3VHXB 3MAJA 4M8SA 4E2YA 1QDLB 2PVPA 5DXJA 2OCGA 4NFLA 4DK5A 3QY0A 3VAYA 4YRRA 5CBOA 2AR0A 4LY6A 5MGBA 3NCHA 1R15A 2R751 1WMSA 3D6FA 1FS5A 3IEKA 3R6DA 5AIAA 3QVXA 1Z0KA 3V1TC 5KWEA 4J0UA 2UXCB 2P2CP 2UY1B 4TUMA 2YOFA 3B5EA 2Q9BA 4LERA 2H2WA 4J8YA 2Z95A 1BGVA 2OD2A 1PFYA 2OMEA 1RADA 5MFZA 1P19A 4KX3A 2F1OA 5AKLA 2H3HA 4HBZA 4ZHSA 3KYDA 4TYYA 3K9LA 2J48A 2Y99A 4FZJA 3EX7C 3H4MA 4F4IA 3M5PA 2ZIVB 2PUAA 2J0QA 1ZUD1 1RKUA 2AG1A 3ORRA 1B73A 3UBMA 2XF2A 1L7RA 1NT4A 2V98A 2VZ8A 4FEEA 4FR2A 4KXXA 5CDYA 2KQUA 2PRZA 4DDVA 2IOFK 3O8RA 1YVUA 3LV8A 4MPRA 2HMSA 3JD0A 3QI2A 2HA7A 1VPWA 2DECA 3M6MD 1T6ZA 5F9HA 2G76A 2HBRA 2ZT8A 1AUQA 3AERB 4P2BA 3THXA 1CX9B 4U00A 1YTLA 3FD8A 1J20A 4ZO6A 3WL3A 3RHZA 3IAM6 4LCJA 4P8RA 4JC8A 4KPUB 2F55A 3KBOA 2PS1A 1P2VA 4GTMA 3EZ6A 4FC6A 4IYPA 3WWPA 2HEIA 3D3EA 2JFZA 2L17A 4I1IA 3MAGA 4ZP1A 3AG2E 3EF1A 1G6HA 4MJXA 1WD7A 3UO8B 4YV2A 3RK6A 2GNOA 3ML1A 4PSKA 4XFDA 4QOIA 3WQHA 5B1YA 5J2TA 4JUIA 5H02A 4B6EA 2WHRA 3K53A 2QYHA 3HB1A 5A1JA 4RSYA 1NVWQ 3CFYA 1P0CA 3N7TA 3FJOA 4Q39A 5A2QA 1T4CA 2E82A 2P9SG 2MT9A 4K6FA 1JFFA 1T3SA 4TT8A 4ZVQA 3EH2A 4PZ9A 1K98A 2XEHA 4ZFHA 1NSFA 3D6JA 4WXYB 1BH6A 1A9ZA 1MH9A 2QX7A 2CFUA 1SXHA 2H1CA 2C3YA 3FYUC 2PCLA 4FYPA 4BO5A 4B2LA 3M83A 2R25B 3NKVA 3OF2A 3BXZA 4ZYXA 4DWWA 1E0JA 4S3MA 1CY8A 1ENYA 3MKRA 1VG0B 4A3VA 5D5HA 5BQ3A 3LX8A 5BR7A 2FDCA 2W00A 2XUIA 2KXPC 1H6AA 2V9ZA 3LQQA 5D86A 5FBLB 2E4WA 5EE1A 3X1MA 2Q29A 2GPNA 1B89A 2YMPA 4H7HA 4IINA 4KIUA 3LFTA 3T3GA 1UAYA 5E6UB 4DAOA 5GV8A 2A9QA 3EGVA 3H4TA 1DTWB 4DIBA 4J8FA 2QUBA 3EGWA 2QENA 4IMRA 4K5AB 4LX0A 5DCWA 5EIOA 1QHFA 5H80A 5EZ6B 3IJRA 3EXEB 4K2HA 1ANKA 1GN8A 3DKIA 4M8KA 4Z1MA 2J0VA 3DMDA 5EHIA 1JEQB 3MJVA 4J7XA 4JR2A 3NAZA 4RTPA 1KC3A 1CDDA 4O2LA 2QA5A 3UA3A 4YR9A 1NVTA 2ID8A 3PJGA 2BGRA 4XCQA 3D1JA 1RAGA 2VNIA 3KSRA 2EGUA 2B78A 4ER3A 2IPLA 1X87A 4NY1A 5TSDA 3TZKA 5BXUA 4AUKA 2YHCA 1J8MF 2GHRA 4B8AA 4ODIA 1WS6A 4HNAD 4PPNA 3EHNA 1XDBA 3KK0A 3KJIA 3FPAA 4L6AA 4EDFA 1Q0TA 2VZLA 5ESWA 2AFIB 5JYCA 3NDPA 5L7YA 4LNAA 2P4UA 1N11A 5B1BE 2VP0A 3G2NA 2GN1A 4I55F 2B6CA 3RKSA 4BX2A 1HEYA 1G59A 2XZLA 4WUTA 5DRTA 1KQNA 4CL0A 2I03A 3B7BA 1XZBA 2DQZA 2F8LA 1D2RA 5LMNB 3KTOA 2AR9A 1U2TA 4EMTA 5FQ8A 4EK9A 2CEAA 1OE0A 1OHHD 2B4RO 4JBYA 3MMPA 1CZKA 4DA7A 1T1EA 2ZAYA 4IIJA 1SKMA 821PA 4DV7B 3F7NA 2ZB2A 3U40A 3CWCA 4EFLA 2DETA 2XZPA 3P2MA 3DFUA 5FIOA 3PC6A 4HEHA 3U4QA 1HLDA 1K7XB 4YMIA 2WTAA 3ZJYA 3PV0A 5FUMA 2BKLA 4JJGA 4C0HA 3GAFA 2NTVA 1UP6A 4GGMX 4OLFA 5F77A 2ZZNA 3BMOA 4J6IA 1ELWA 3Q47B 4ONEA 3GXBA 2X23A 2C4NA 5JI3E 3M6AA 4G63A 2J30A 2VQDA 1GLNA 4TQ9A 4A8TA 3D6NB 1WLSA 4M21A 4TLBA 2GUGA 3OLZA 1DJNA 3MTDA 3DPUA 3HCOA 5EPUA 3UATA 4ZGGA 1QNLA 2NUAB 2WWVD 3VI3B 1IBMB 5KJLA 3A6LA 3BE6A 4M6WA 4L74A 2PUGA 1SVOA 2HMTA 5HCIA 1UMBA 3NT4A 4U4AA 3RAUA 4OVUA 1UMDB 2HIGA 3KAKA 3L8FA 1FU7A 3GLFA 4JKOA 4C7MA 1GT6A 3PT5A 2B8EA 1ZKMA 4CL8A 5AMXA 1KMMA 2DWCA 2REOA 5GZ6A 3AEKA 4EUEA 1P1HA 1CTQA 2DWPA 2X1VA 3H75A 3JTMA 4RCYA 1JAIA 4RY9A 1H0KA 1NXXA 4O4IB 4N3GA 1NSTA 4CV0A 3JQGA 1UPTA 3WGGA 2IZ1A 1J2RA 4IF6A 3F6PA 3O26A 3N28A 1LDBA 1GGKA 1SWVA 4I1UA 4MR7A 1DOZA 4G8BA 3SQOA 3WDKA 5A4KA 5H9WA 1ICEA 4HS9A 1RKXA 1ZVQA 3BSSA 2EATA 2REBA 4LNBA 3G59A 1U4OA 4R2HA 4JVNA 2B8JA 2XOKD 5DN6A 1H4QA 1RMTA 2A9KA 4L50A 1SEPA 3DMGA 1XC7A 1SB8A 1XSEA 3P2IA 2XYVA 5IYZF 4B3XA 2BFAA 1Q0RA 1KI6A 1SKYE 2A59A 1TFUA 1YCGA 3R76A 3B2EA 3RVMA 2RHHA 1LPBB 1N92A 1OAOC 3AUUA 4UMDA 5HFNA 5HQTA 1DHTA 4FWTA 1Z6YA 2ACEA 4JP1A 4DR5B 1DRWA 5ICEA 1H42A 1P8AA 5GADl 4XGIA 3NOVA 3I53A 4JLJA 1ID1A 5JCOC 1C9JA 1HDCA 3TWTA 2GS9A 2VUSA 3BCSA 4IUDS 1X15A 4OQ4A 4C6HA 4RORA 1RACA 2I2WA 4LGVA 3EDRA 1F12A 3I8OA 1Z38A 3CW9A 3U9SA 3KPWA 3EEYA 5L3QB 4G81A 1HDEA 3EF3A 1SHKA 1DKRA 2AVDA 3QV2A 5AICA 1OT5A 1Z2EA 3M8KA 4FHJA 4G4GA 2VXCA 4RDHA 3R7BA 1XRSB 2CMGA 5A6VA 5B30A 3VLFA 1U7DA 1VL8A 2GERA 2DQKA 4XIGS 4HI8A 1CCWA 2DYKA 5TT1A 2E7ZA 1WDLA 1ZUIA 1NMEA 2DEUA 2JLYA 3GRPA 5DDIP 1J07A 1V4NA 2RB4A 2XA9A 4Q9HA 5K3CA 2QD1A 2IS2A 3NAMA 3IEPA 3JYLA 4NCKA 4P84A 3A4TA 4ENTA 2FFBA 1RM3A 2J3KA 4CIVA 3JATA 4HRMB 4U7EB 2W2MA 3ROZA 1I3LA 2VAWA 1S1MA 3E7FA 2P8JA 3GLIA 1T6XA 4DV3B 5FPQA 4LJAA 3WKEA 3VLDA 1CHDA 1YE8A 1YAHA 3LUAA 1DC4A 3TXXA 4F97A 4B6JA 3FX2A 2V0PA 2MYNA 2DJ5A 1H2XA 3DHVA 1GP2A 3II6X 1XLVA 2P40A 5ALMA 2O19A 3W2HA 5IVHA 1ZAKA 4I50A 4NJEB 3FFTA 4J7UA 3SYKA 2F3SA 3LHIA 1DTWA 1A72A 4D0LB 3LQ2A 1RYFA 5I9SA 4C08A 2HFJA 1GGFA 1Q14A 4L2LA 2WUWE 5B1SA 2J5QA 4MZXA 3ZCPA 3R8FA 3TAUA 1FFYA 1WOYA 2WWWA 4O4LB 4OBWA 3NM4A 2HJ9A 1DXHA 2G0TA 2QMUA 2Y1CA 1QFJA 2ZTUA 3K0AA 4NNJA 1O8CA 3L05A 4ZVLA 5IBRA 3ZCUA 5TGZA 2CF5A 2JAUA 2R6GA 3VR5D 1Q7BA 3NQ41 3RW9A 3CF6R 3ICCA 2P6PA 1C8BA 1UK8A 2CNOA 2WKWA 1YR9A 3JYPA 2WC1A 1A3CA 4KAAA 4R9SA 4CKEA 3A9RA 3GVHA 1EAYA 2IDJA 3VUEA 3O3CA 5D3MB 5CFQA 2X6IA 1NWCA 4UUCA 4DX6D 1WPXA 2FPLA 3CF0A 3W0LB 2W5UA 4JELA 2SKDA 5LOVF 3QOFA 1EPUA 1JXOA 3ASFA 2XB8A 1H19A 4WZBE 4FYVA 2ZITA 4YGYA 5L4LA 2B4AA 1U98A 1OI2A 2Q5JA 5LXTA 1PC2A 3N2LA 2HLPA 2PU7A 1TA0A 1XMXA 1R1DA 4MROA 1VSTA 1KETA 4HXFB 4J3JA 2ZRJA 3L0DA 2VJAA 2KZTA 3I5AA 4IIJB 3PGKA 2AEJA 2I7VA 3X43A 1GNVA 3UMGA 2WTXA 2OHGA 5EPOA 5FORA 4CKCB 3B9QA 4D79A 4MIKA 5G4KB 4A36A 2D1QA 4RHXA 2PAFA 3OBIA 2ZBRA 4J75A 4G2TA 4RQUA 5AKJA 4GKVA 4ZOLB 1QRDA 1UEXC 2RIPA 2AXPA 4W1SA 4D3YA 3GZ1A 5CB4B 2A5YB 4Q1VA 1QKIA 1EVIA 3CRMA 4B71A 4ZIRB 2EFDB 3GUCA 4IZIA 4H7XA 5EE5B 1SVLA 2P9TA 2QL5A 3TCKA 5LR6A 3LCJA 3CIOA 3GC6A 4WN9A 1JHUA 2D1TA 2ECKA 4HMPA 2R8ZA 2XYQA 5K4HA 4YDEA 1QS0A 4H7FA 1XZNA 1LLQA 3CONA 4HYTA 4QXQA 1QQAA 4LZPA 2YWEA 1YBHA 3GLGE 1WTCA 2OSVA 5FPSA 3GLFB 2J4CA 3JWJA 1GRCA 1QG2A 3V2XA 1T9CA 4IOLA 4JLAA 4J2TA 3U3RA 4BMVA 1BKDR 1LSOA 4F2DA 1ZM7A 3ZYMA 2CV0A 4DEVA 2GBLC 1NURA 4FFOA 4NMLA 4X1KA 2WWXA 4ZC8A 3ASDA 1MX5A 3R3HA 2CFOA 3R7SA 4E5UA 4NAVA 4M1MA 4U9UA 1RHMA 4AL4A 1ODLA 3ACCA 2A0YA 1E2IA 1ZH2A 3ELWA 2CJYA 3G0GA 2M9MA 1NF2A 5THKA 2EKQA 3F5QA 3UPVA 3GDFA 1R8YA 2C0PA 1I6MA 1X3LA 4LF6B 1QIGA 3KLPX 1YR2A 3QJ5A 3D8UA 5DLYA 1WDWB 1KY2A 3LCCA 3UXEA 2JKVA 3RVLA 4RGVA 2Z5FA 3IT0A 3ER9A 4WCFC 3BQMB 4J2HA 1P2DA 1GZDA 3AIIA 4H27A 1Y1TA 2ZSKA 2ZXEA 4YMWA 4JI1B 5C32A 1KHHA 2BEVA 1BIFA 1PK9A 2JK0A 4FZ3A 4TQUS 2HTFA 4IKPA 1JH9A 3BJRA 3VTKA 3FTYA 2QYUA 1YI0A 2YJ6A 3BX1A 1NJSA 3ZTTA 3WBJA 1K8KG 1GADO 1ULZA 2BFNA 3Q7PA 3I9JA 3KUKA 4GPKA 5DEIA 1U4NA 3ZBQA 1BA3A 4KYVA 5EEHA 2XKJE 1N0WA 1UKZA 4D99A 2PUVA 2QJRA 4LOLA 1V9SA 3WMEA 4I1MA 2ZB7A 2H2GA 1SEVA 4Z3KA 4A5SA 3CVNA 4N7RA 3HB7A 3V8VA 4CM6A 4GZLA 4ER7A 5EIBE 1R0WA 1J6UA 1Q84A 3EDMA 5FHRA 2V58A 2D4HA 3IMFA 3KOMA 3STVA 2QZ4A 5ADWA 1OZFA 2A57A 1EDUA 1TMOA 3PCRB 1PQ4A 2ZI3A 1E1KA 1GKYA 2WP0A 3ENEA 1R6AA 3L41A 2FF4A 1JHVA 1NI1A 1YZVA 3V42A 1M7HA 2OBLA 3RM3A 1P7CA 4IX1A 4KTVE 3SQMA 4EPXA 2EBUA 3BTVA 3CKYA 4JEMA 4WXPA 4M1KA 4EL5A 4JODA 4RIFA 4G5FA 4M4SA 2ZYVX 4DFDA 2JRCA 5K8JB 3GCGA 3PZ4A 1FRFS 3PZRA 3RIHA 3K73O 3K6KA 2EZTA 3ND9A 4GR5A 1JXAA 1UC5B 4EHLA 4R1UA 5FUYA 3Q9NC 3DR3A 3RNLA 4E88A 4EY7A 3PNPA 2FWBA 4I9NA 5B6JA 1QQ7A 3W2TA 1MC8A 3D3WA 2PLRA 2ZUCA 2ZVQX 4PFJA 5AHKA 2FYTA 3C5RA 2L82A 3WXMA 3RKUA 4E70A 5L3SA 4DR6B 2WXOA 2ZFUA 3FKSD 4GYWA 1YFZA 4ENPA 5FUQA 3CEQA 3CINA 1GAXA 3MQFA 3O8OA 3RFVA 3MM4A 4PCUA 5CRIA 5EIBC 1DIOB 2REXB 4Z3DA 3DOUA 3I9KA 3K72B 1KFEB 3L7MA 4EGQA 1FPPA 1E20A 1KORA 1TM5E 5KYVA 5K99A 2QUAA 1MKYA 2ACVA 1WXEA 4S2UA 2BR3A 1GNQA 1Y8QA 3LWNA 4TYQA 2JD1A 3W2FA 5B58C 2FWMX 4GL2A 4ZQBA 1LF0A 5A5GA 4ZEXA 1BN6A 1OB2A 5A06A 1UW4B 1QXSA 4DSUA 4RPGA 1RJWA 4HXGA 1JRLA 3O1IC 4ARUA 3CPSA 2I7CA 3E27A 4L4RA 4DCJA 4ZJUA 5LWHA 3GFTA 2CVQA 2DWUA 5BSVA 2GMWA 4KN6A 3RC7A 3ORFA 1QHNA 4CODB 1NF3A 4WLEA 7REQA 5EA2A 1KQFA 3EZFA 2IOSA 3GJRA 5GONF 1DQPA 3AGQA 3Q8WA 2VF2A 4MR8B 3WGKA 3ZDRA 1BFUA 1KEZA 1OROA 2PO5A 4EG6A 3HKDB 1RIFA 3E7XA 3RVDA 4PYJA 3CR3C 3E23A 1OH7A 1FYXA 4NBSA 5AUOB 3MGGA 2BJVA 4DGQA 4EPWA 1Q1NA 1BW9A 1N4DA 2KZTB 3V7YA 2QK4A 3D7KA 3RS3A 3IBEA 1R0YA 2Q49A 4OG2A 1LPOA 3EW9A 3CNLA 1KERA 2J33A 3IDSA 2EKPA 3ILHA 2PH3A 3BFJA 5EDSA 3AM3A 5TQVA 3ZZNA 1XKTA 2LCFA 4MWDA 1L4LA 2TMGA 2VHJA 4BWFB 3L54A 2ZYAA 1V37A 1P9LA 2IU4A 3C3YA 4GRAA 3V32A 6CHYA 1UBHS 3GOQA 1AK9A 3LLCA 1ZUNB 3S2SA 4IVQA 2O2HA 2Z56A 3BIXA 3LSYA 3OT1A 3TOZA 3GFFA 4KZ0A 2FPMA 1BEEA 1DAFA 3FTPA 4HQ0A 4XR9A 2ONKA 1JKJB 3FYCA 1P9WA 3NTOA 1Z6GA 4WY2A 3PHHA 2QY7A 3PF9A 3VGPA 1HYBA 3ETHA 3RYHA 1NU6A 5F73A 4UPEA 3WI7A 1FFEA 3V2OA 4ZWNA 3HR8A 5GOTA 4WXRA 5IH3A 4CG1A 1DTEA 1SH7A 2ZRLA 3HZOA 2C82A 3ANNA 2AJAA 1EFRA 1KZ4A 4RDCA 4JLNA 4EY6A 2PT6A 5DVZA 2ZREA 3GELA 3BIFA 1MQAA 2Q41A 1TTHA 2ZROA 4HCJA 1F2UA 5JRDS 2X8BA 5JDIA 1W3BA 2RGCA 2Q07A 4LXIA 4F9TA 4HH4A 3L8MA 4LRUA 4FX5A 4I9GA 1QLWA 1BRMA 1UBUS 3E05A 4MWCA 2HCTA 3U4HA 4E5YA 2NC9A 1JAZA 2PMWB 3AR2A 1CS4C 3OZ7A 4TMZA 1L5NA 5ENQD 4QICA 1V47A 5JZVA 3QBVA 4JBGA 3G2MA 3ZUGA 1MEEA 2PKQP 4JROA 5KVSA 1N77A 2JLWA 2DYRE 4Q4HB 2GRRB 3GT4A 3NIDB 4YH1A 1QUEA 1LK7A 1WE2A 3DZFA 3KZCA 3JQ8B 3TB4A 4BYGA 4EY4A 1FTGA 3IERA 4EG4A 5C52B 4ZI5A 3IPRA 4O3MA 1WRBA 4GGOA 5HNKA 5A4MS 3W9SA 1YU9A 1P5ZB 1N3BA 2PCJA 1D0IA 1JHDA 2AN9A 2GX6A 2WT8A 3V8MA 1UDCA 3R0QA 4CI0B 2BFBA 3IP6A 4IDOA 3TJMA 1K6EA 4AFNA 4AJKA 3GZNA 1HFAA 2PN1A 4U1RA 4QQKA 2VEDA 5EKUA 7AT1A 2M1ZA 1GO2A 2IS6A 2BCGY 1CEEA 2D7CA 4IVRA 4R83A 1N2CA 2IGBA 3D9PA 3LHDA 3O92A 1EVJA 4NBRA 4JT9A 3IB3A 1QGUB 3U49A 1POXA 4JQCA 2QLJA 1IXKA 2JFVA 1CQPA 1KK1A 1DQRA 2XUDA 3IUPA 1P39A 4E6HA 3FTUA 5KAPA 2VG8A 3V55A 1MHTA 1TAHA 2PL9A 1KBOA 1A9TA 4HFGA 2BHLA 3OCCA 3I3NA 3WLQA 4EA9A 3G2OA 1THTA 1FDVA 1B26A 1UBSB 3DUFB 3EC7A 4HHEA 4HWRA 4N5LA 4QUAA 1M2VA 4ILHB 1ZGJA 4R9RA 1YS7A 4WZBB 3UQYS 1MD9A 3RAGA 2GPYA 2J6BA 3GG9A 4JDUA 3KV3O 1Z88A 4DDTA 1EK5A 5LDGA 1I7PA 4H0CA 5CDHA 3OOEA 4JBNA 1J5PA 2E0IA 4IILA 2WIBA 4M0DA 4N8DA 4NV3A 3OIUA 4KO1S 2C9YA 5JEEA 3FPLA 5LQJA 1PZNA 3AF4A 4ABTA 3AUXA 3S81A 2Q62A 1YTUA 2I91A 4C43A 1LEHA 3LLSA 5LLSA 4JLDA 4KIGA 4DKJA 1XTKA 4KVGA 3WGOA 5L3SB 4L7QA 3VBCA 1PD1A 1U2DC 3D4IA 1JHMA 4QVGA 2IYYA 1XZIA 4URFA 4Z6KA 2GPBA 2ZJ1A 1ODIA 3NBUA 1DX9A 2JASA 4ML3A 2EIHA 1Z5PA 3IE2A 2C83A 2W2QA 3LDZA 3JR3A 5IW8A 4AN0A 1E96A 3NUZA 1V16B 3F6EX 3GGOA 4QGFA 4RJKA 2IEYA 4CU2A 2WVAA 1NRIA 5SZIA 3HY3A 4DR7B 2CVOA 4FYHA 4HJXA 1NVMB 3F7MA 5T8IA 2IQCA 1G5PA 3GLFE 2R6AA 2JLSA 2NSHA 1KL7A 2PUHA 4Q7KA 2MHKA 1TZJA 3ZXPA 2QJTA 4E07A 3WO0A 5KYKA 4YJ2A 3GNQA 3ZXUB 2H16A 3GCXA 5DP1A 3IQEA 4ESOA 2PUTA 2R62A 2CZQA 2ISCA 3GJXC 3K0CA 4MUIA 3CEJA 3EHDA 3ON5A 1E8XA 4DBLE 3E4BA 1MX4A 1G5RA 4OGWA 4TL8A 1AGYA 1GGVA 4RVBA 3MCAA 2P2NA 1FUUA 4O2AF 4RANA 4CIYA 3O9VA 4JXZA 1MOQA 4J49A 4DLNA 5AKZA 1F51E 3Q15C 5J2UF 2LAIA 2D6FA 1AE1A 4E15A 2GVZC 1JYSA 2CDBA 2V55B 3SMVA 5BXYA 1PZXA 4FIDA 4MARA 1DDGA 3PI7A 4B0OA 1VYUA 3KUDA 5SYAA 3K9BA 1IQUA 2QPTA 5KIAA 1ZCJA 2PLWA 2P9YA 4G07A 2YINA 3M70A 4Q9DA 2H1HA 5F7OA 1N7IA 2JB9A 3S2IA 3B7GA 4WD3A 2C31A 3RLIA 5JLJA 1E69A 1XMJA 2VWQA 1DFHA 1HOXA 4N12A 1DOAA 3UOAB 3OOWA 1U2GA 2QMQA 3HJUA 5IY5E 3OT1B 4TZ6A 4E31A 3FOAA 3BH0A 2GCPA 3QTLA 3FWZA 4TZTA 3STYA 1JQ3A 3VX4A 2ZSFA 4UHCA 2I33A 3PB3A 3I1JA 5JCJD 2FZ4A 4E08A 1CF9A 3H2BA 3KUCA 3O1JC 4I36A 4IV0A 2DCPA 1XAGA 3EVTA 3TLJA 4AF8A 3GPIA 3RBVA 1ODKA 1DV2A 2ZS7A 3ADKA 2CD9A 1JWAB 1JEOA 1YL7A 2VZ9A 4LNUA 4J8PA 1Y34E 1DWUA 3PNBA 3U4AA 2BUAA 2I8AA 5LFAA 3PEVA 4FI3F 1RDFA 2EWMA 4RZUA 2Z6AA 3SO8A 1YUBA 4GZCA 5DHAA 2VHYA 2QZPA 1MFPA 1X1RA 4FP9A 1Y1LA 4CM4A 5C5DA 4RFSB 2HLNA 3KS2A 5ALLA 1P72A 2PNNA 1S8AA 4PCLA 2SKCA 3MFQA 4RK4A 3W3AA 1FNSA 3LCAA 4HNGA 2O54A 1ZNWA 2FQXA 2GHIA 4E4TA 1XK7A 1RAHA 3PFFA 4U2BA 3SYNA 5EVCA 5KOJB 3MJDA 1IZZA 4TXMA 2B98A 1U7PA 4YP5A 1NYLA 5LQAA 5E6SA 2HA6A 5ER9A 2IUUA 4D41A 4L57A 1C81A 2ILRA 1N94A 4LDRA 3KKKA 3A1CA 2H4JA 2ZP1A 2J08A 5K2OA 2AFHB 2QDXA 3ANSA 3FZYA 1S63A 3QXHA 4KUGA 3WYDA 3L0IB 3ZW9A 4CKZA 1M7GA 3RJ9A 3BL8A 4DWVA 4CEIA 5EXTA 1C1DB 3ZK7A 2RIRA 3TRFA 5BUSA 3NNNA 2ZJ7A 4DMRA 3F74A 3A6PC 3W77A 4NS4A 4HNRA 1NLMA 3IPCA 4NK4A 3RHSA 3WLLA 4AY6A 3AHHA 1XZLA 1NM5A 3IS3A 3PHBE 3PVSA 2EP7A 1J9GA 4AJWA 1OUMA 1WW3A 2RGDA 4PXSA 3RRJA 1GIAA 1ORHA 1X7WB 4KT6B 1K68A 2PWAA 3UEOA 1KEEB 3L6AA 3AONB 3ESQA 2I1KA 3W5SA 3X2EA 4EUKA 1Q11A 1P81A 1XRRA 1FCHA 4OA8A 1VE5A 3BFVA 3FDZA 1ZL2A 1L5ZA 1H2FA 2GXAA 2W98A 4BS9A 5ILOA 1C0LA 3NANA 4R05A 2OXTA 2A0KA 1HG2A 1IXSB 3BHIA 3PIDA 4FEAA 1MH1A 3OCZA 4LPKA 5FNVA 1LPPA 1R27A 3DL4A 3HB5X 2I4IA 3MT8A 4KI0A 2NUPB 3R7AA 4UNRA 4Q6BA 1YB6A 2A9PA 4O4LF 1YOBA 2XRMA 3IHKA 3PTZA 5D84A 5KX5F 2V3CC 1MG0A 1F06A 3DUFA 1X1EA 2IEBA 3PR1A 4TV8A 5EJFA 1DC6A 3L4BC 3JU3A 5EN4A 3JARB 3MOGA 1E1CA 1MW9X 1E6KA 3DEZA 4V38A 5AOBA 4AWAA 5HILA 3BTOA 1L7PA 2ZWAA 4FJ0A 3F78A 4Q48A 4HQLA 1KYIA 3AS8A 1N2HA 2GD6A 1LBEA 3E34A 4FJZA 4PX5A 4WOKA 4D6YA 2JHCA 2ET6A 1TF2A 4WACA 1YA8A 3TK1A 3DDUA 2JHPA 3VPGA 3TZHA 3WRWA 3Q15A 1AXGA 2QX6A 1HEIA 1RWBA 4G2VA 1QGAA 1Z7GA 2X5KO 2W6PA 3TTTA 1N3LA 3ZQ4A 3VV3A 4N03A 3N3AC 4ND8B 4AG5A 1R8SA 1S4MA 1I5EA 3NTQA 1D0VA 2UKDA 2B4QA 2CFTA 1U0RA 4MUYA 4DZTA 2IFTA 1B8PA 2Q5CA 2O57A 2XUHA 3LGXA 4QOEA 3G9QA 2QUHA 3HB4X 3N8KA 4RZSA 4EUFA 1X7XA 2FPKA 4URHA 1V8PA 3CZPA 5CR9A 4MRPA 2VPZA 4HYEA 3V48A 3TLGA 2C8JA 1XJ5A 3WWDA 3GCWA 1I7LA 1IJFA 2GXSA 2P3LA 3GXOA 1TQHA 3MJ4A 4K9SA 4OGKA 3TM5A 4YCMA 3IAS1 1WNTA 1Z0FA 3M6LA 3MUEA 4MTLA 2H8KA 1NVBA 5TQ2A 3GZSA 1YZUA 2HEGA 2IYLD 3EDYA 4MV8A 1U3FA 4WK2B 4HG2A 3L22A 1L1EA 3GLUA 2WMNB 2Y66A 4NE7A 3QAQA 2W2NA 3GJ7A 3PDIB 5KJEA 4ZOQI 1N6OA 2OORC 4YXWD 2XZDA 3UJ7A 4X84A 2PTHA 4UNQA 1TZCA 2HWKA 3QHQA 1CS0B 3P9XA 4AKHA 4PGHA 4B3SB 5GM1A 1IN7A 2C7OA 2PUDA 1EWVA 3BUAA 2WNIA 3CB4A 3LJKA 3EUAA 3EMVA 1L5HA 2ZE6A 2IT1A 3CZRA 3N0XA 2H29A 3BULA 2OUKA 3CVUA 4LNGA 4EB6A 4BGIA 3RSSA 2IY7A 2I87A 4EQ6B 2EJCA 1EP1B 5IZCC 4I2ZA 1UKVY 3O48A 5J2UA 1TQDA 2WJWA 2MYPA 4JVSB 5CFLA 1K9VF 3LHFA 5FOWA 2IHTA 1MABB 2YFKA 5IXJA 1UEIA 4N5DA 4NU8X 1AB6A 2EL7A 4Q05A 1YNSA 5EKDA 3VISA 4XIFA 4YFYA 2N0SA 4OY3A 4JP8A 1Z75A 3IUEA 4G97A 1TVKA 3U4GA 2CBXA 1T35A 1NNSA 4D4KA 5DNCA 6REQA 5A6SB 2R5WA 4QQRA 3ZU5A 3AOEC 1E6CA 1G3QA 2JIBA 2HJRA 3AEQB 3WDMA 1LDGA 1NQWA 3TTWA 3T3PB 2H2FA 2OO5C 5BNWA 1QTRA 2VSQA 3HDHA 4RADA 5AHXA 5BN4B 3EVZA 2DQ4A 4IGAA 2V8BA 4H7EA 1PR9A 5JMND 2IXBA 4M60A 4ECAA 2NZYA 1TW3A 4I3FA 1IHOA 4MCAA 3CT6A 4JA0A 2EU8A 1EG2A 2JZOA 3PDHA 3DE2X 1GZSA 2C4WA 3BH7A 1Z6ZA 5CB8A 2QTLA 3DFMA 2IVFA 2ILTA 3LY5A 3RI3A 4UM8B 4RTJA 5KC8A 1A95A 4MR9A 4PZDA 1F1BA 3SSNA 3VYVA 3EIUA 3T8YA 2YIMA 3VGJA 1BGXT 4QHYA 2NSJA 2PZMA 3QWHA 3LPAA 4DC0A 2I1WA 2FI7A 1HYQA 1M2OB 2RBEA 3GEHA 2JJMA 2OV8A 2YNQA 3T6KA 1M1NB 2X9VA 3WSTA 2FE4A 3U37A 2DERA 4BETA 2QN1A 3AKYA 1SC6A 2BMWA 1U7TA 1A9SA 1OBHA 1TUGA 4UHFA 3JAMA 3HJGA 3OFKA 5JS8A 4APOA 4MQ6A 1T2CA 4S35A 1T9ZA 4UDNA 4XB6B 3OX4A 4XQGA 4WEOA 1LA2A 2AHRA 1RRKA 1P73A 3HJRA 3A6ZA 2ACKA 4NKRA 3ZN2A 5B55A 3UBTA 3V2GA 5I7EA 2DKNA 3ZJVA 4X66B 2XE6A 1USUA 3ASOE 1A5SB 2QP4A 4XI9A 3L93A 1KVUA 1PWYE 2BL4A 2PSHA 5ENVA 3RABA 3S3TA 4C5CA 3H11B 3HS3A 3U3DA 3FJ1A 3WR5A 3JVEA 2GXUA 3MJCA 2REQB 4OQFA 5SZKB 1SC4A 3GFSA 3GVCA 3ZEIA 3L8ZA 1SB9A 1SZDA 1QVAA 2HJHA 1HETA 1PZEA 1WBDA 5CDFA 3AHJA 1RWXA 3V7UA 3AL2A 1ZQ1A 3ENKA 4G1TA 1C30B 1H1TA 1LTHR 2ZU6B 2QL9A 3WOHA 5IC4A 2JBAA 3VVCA 2FQWA 4JA7A 3KR1A 3VR4A 4BWVA 2EVWX 1EINA 3KQVA 4TTRA 2YZKA 2WTMA 2OV3A 3W1WA 4WKNA 3C24A 2DVMA 4FZ5A 2NT4A 5AXCA 3FHOA 3P2JA 4IZOA 4EX6A 2YHBA 3L6RA 2R5NA 1ZRHA 2EIXA 4IFTA 4YRLA 3AESB 3CUUA 5T4FA 3R9WA 3ILVA 1HL7A 2X58A 1XUOA 1YS1X 2V5VA 4K88A 1SXIA 5IABA 4JYMA 4BMZA 2FR8C 4HH3C 3IHVA 1C0PA 4IVNA 5BVGA 1SUCA 1NY6A 1UK6A 3A1EA 3ECCA 4O33A 4OXKA 4EA8A 4EKIA 5KJ1A 1Z35A 4QLAA 4BLTA 5KKCA 3LC7O 4LWZA 1U3VA 5B3KA 2QT9A 2ZWMA 3CZ9A 4NMXB 3H42B 5HZKA 1DI0A 1NLUA 2J3MA 1EDZA 1Y9JA 4G65A 5AKGA 1TAQA 4RTRA 3JD2A 1TGYA 3J81A 2CMFA 5D3ZA 3KKQA 4HPXB 5KTOA 1WDYA 5CNJA 2G67A 1R9MA 3VR6D 1FX0B 4PYOA 1BX1A 2WJPA 3FI9A 5BRAA 5LPNA 1PWZA 4HNUA 4WZAB 3OQMA 3ONEA 1EUQA 4FYYA 4W1PA 3QKRB 4M8IA 4JJ8A 4M0EA 3AJ9A 1W4LA 1S2LA 3H5RA 5T8KA 4ZFNA 3FPKA 2OOEA 2IZ6A 2O0MA 3N2ZB 4QYIA 1MLDA 5CH8A 3EXIA 3HXQA 1WUTA 3NTUA 4EVSA 2MSWA 4AJIA 1CUIA 1AUOA 4KH0A 2Y1GA 5D7BA 2Q7FA 1V7CA 1ZSVA 2JFWA 3NBXX 5TARA 2ZJZA 3GG2A 2GF2A 1OXUA 2AC7A 2EW1A 3MWEA 4HS4A 4OREX 4UEJA 5ALUA 5EEGA 3LFUA 5FIUA 1KJ9A 2YWGA 5H16A 3S2FA 4UUQA 4WKCA 5AI6A 5FTLA 3LLMA 1N8KA 2ASVA 3EOBI 1M5RA 3GLTA 2O3QA 2WTNA 1PU2A 2WU8A 3PWZA 4H3SA 4LQ4A 2VDWB 4UFOA 4V02A 2B0OE 1JPVA 1EE1A 2V6JA 2WMOB 3HYRA 3DRAA 1ZVKA 4FT2A 4PPFA 4UOQA 3ZY6A 2PGOA 4V3BA 3WLSA 5FPPA 4Y6RA 1UBNA 3NYIA 3Q7RA 3DNMA 1P18A 1BJKA 1TTPB 3C3AA 4U2FA 4WT7A 4F11A 5CIYA 3E9DA 1DKMA 3EIXA 5TB5A 1JV2B 3DLCA 4LV8B 3UXMA 1KOGA 5JHBA 1LS6A 2G40A 4TL7A 5LJLA 3U44B 2VK2A 2CDAA 5CEAA 2DIWA 4FN5A 2DGDA 4RZXA 5J2UB 4CMIB 4N3CA 1P5FA 1X6VA 3OPYA 1QYVA 1RE0A 1UG3A 1MABA 1Z22A 2XMSA 3SD7A 3PPXA 5FA6A 1S8FA 3REQB 1R4AA 2AFHE 1YO6A 4LDAA 4BEPA 4LJLA 5DK4A 3V7FA 4F85A 4CCYB 5EJ7A 3T9CA 5KOHB 4DREA 1K6JA 3NHAA 3TLYA 5KOYA 1SVIA 1DO8A 2OHHA 3B7SA 3KEOA 1A5ZA 4QRDA 4V2IA 3IJPA 4W5QA 3A6HA 1SXQA 3CX8A 1X7YA 3JY6A 3LUBA 4PGMA 4V0SA 2JGAA 3HE3A 4LXQA 1E5VA 4MLZA 1OLSB 1TPZA 4FB5A 4YUZA 3FHEA 2NX2A 1FEZA 2YOHA 3GB9A 5DLPA 1XZHA 2NW6A 2VI5A 4MNTA 5BSFA 4CEHB 5ARBA 4HX5A 2VSNA 1OX4B 1KDYA 3OO1A 2GEDA 2X9NA 4E12A 4R0VA 2CXQA 16PKA 3ZYKA 2SBTA 2V6MA 3ZS9A 4HNQA 3QWWA 1EFPB 1TNUA 1GRRA 3H97A 1P4AA 3FTXA 3IAXA 1GCIA 1YZGA 3V8RA 4XJSA 3W7BA 2AOTB 2GTPA 2UZ3A 3HDQA 1NMYA 4QNNA 5EN5D 3QE3A 4C88A 3BZBA 3OY2A 2V0CA 4L4ZA 1XCGB 5EE9A 2J7PD 3BMQB 2GFIA 2FJPA 1V2GA 2WF7A 2ZRBA 2YWRA 3MBKA 2OLEA 4X6YA 5AJXA 1IQRA 1GZ6A 3GP5A 5EINA 2R03A 1QH8A 1ZESA 1Z82A 1UR5A 2HI0A 3BORA 3WK6A 2DRIA 4LYGA 4PFKA 5CFPA 1YB7A 3UI2A 1Y4SA 2I9PA 2ZSHA 1YIAA 1CJVC 1N0VC 2AJDA 2MSDB 3QPAA 3COPA 4K7JA 5HF6A 3B51X 1VSQA 4ARIA 1KAEA 4UAUA 5DW3A 5CA1F 1QTNA 3C16C 3TEMA 1IONA 3NATA 4OHUA 3UGKA 1JQDA 1SU7A 4ZPXA 3DLHA 1F8YA 4DABA 1GZVA 4Q7MB 5KVCA 1DFIA 1Z29A 2XVAA 2DUMA 4JYCA 2A5FA 2CCGA 1HQDA 2GTIA 4OQLA 2ZKLA 4Y6PA 3WHIA 4C2TA 2VKTA 4EJFA 1X7ZB 2ZISA 2G9UA 4DHWA 2G4CA 3FEXA 4YV0A 4QYWA 3ZGNA 4OSEA 4CN8A 2PMCA 1OHHA 4YAKA 4PRKA 4KQJA 2REQA 3QGMA 2ORIA 1EHYA 2JCSA 3INYA 5GVRA 3RIEA 3R7FA 3RS9A 1HEUA 5DM60 2PFSA 4DSTA 1BO6A 3D9OA 1HE5A 1BC5A 3W9FA 2FPIB 4XLLA 2Q9CA 4OD0A 4XH9B 4TWRA 1G5QA 1QKKA 3VYTB 2WNSA 1YJ8A 4PLYA 4PS7A 2B0CA 1I6LA 4ME6A 3CNQS 5IXYA 1WMEA 4YRDA 2Q2OA 1IHXA 3OC6A 5ELMA 4EQFA 2CG2A 1PGNA 1XF9A 1KPSB 1G7SA 4JW1A 1RIIA 4TSFD 4Y9DA 1U2GC 5FBKA 7ADHA 3HCPA 1KDRA 4UHDA 5A3JA 4XE0A 1T3TA 1P1JA 1QIMA 2QN2A 3NO4A 4D3ZA 1Z6XA 4H1UA 3QVTA 3NBZC 4MGHA 1HC7A 1W59A 2FSGA 4EGSA 1W76A 1RM0A 4YJ3F 3TVYA 2ZJ5A 1FVHA 2G8NA 4BNMA 4ISCA 4LXYA 4XZ3A 4Y98A 2BUGA 1W44A 3D64A 4KXWA 4DIMA 3PC3A 3QK7A 1BYIA 5IVKA 1H6KA 4DLPA 3TM4A 1NRWA 3KEZA 2WF5A 4QXAA 4X65B 3HBMA 4OBBA 2PBLA 3GFQA 1AZWA 4NIMA 4CEMA 3WLAA 3RBXA 4C7XA 4E46A 1ES9A 2MINA 1JJAA 5LBUA 4IS2A 1Q7TA 5GM2A 3ZIMA 1QR2A 4X1IB 4EHAA 3CLVA 3T61A 1AOXA 4O63O 1BVUA 1LQ2A 3HVEA 1L4KA 2NACA 1RE1A 5D8DA 4TWBA 5EZ5A 4DRXA 1RBMA 1OC4A 5JJIA 5HE9A 4K40A 3MV2B 4GZDA 1OWOA 1GRQA 1P4SA 1QDUA 2DHDA 1RJEA 4UEQA 3WJ2A 3EXG1 3WOVA 5KNDD 2P9ZA 2WF6A 1KY5A 4R9NA 1V6CA 4B43A 3OWOA 3KLNA 1MR3F 1E77A 1W47A 2PKEA 3K8OE 1J8YF 1CIPA 1UKBA 3C6MA 3D8SA 4QGHA 3S2EA 3TW8B 3SLKA 1M5UA 1XEXB 2FNAA 2J45A 2R85A 3WV4A 4QM6A 4JB0A 2WI8A 1S7CA 1H1DA 1LZKA 1QG6A 4YDRA 1U0BB 4CT4A 2XXAA 3GEDA 2ZYIA 5IAJA 2WVHA 2H1RA 4BVFA 2CHGA 5JS1A 2W2KA 5TMPA 1BS9A 3OZCA 1OZAA 4O6FA 1V8DA 2WYVA 4NMHA 1G2PA 2OZKA 3P2OA 4AXXA 2FVXA 1O4WA 4FS8A 5K0FA 1H69A 1DG1G 3MIZA 4Q3DA 3SZMA 4I8DA 4N54A 2BP7B 5JS7A 3BFPA 4OP1A 4Z99A 2O8FA 5AI9A 4ZAZA 2MMGA 1G4UR 2QSZA 2QN9A 2ZI4A 3Q75A 4INAA 2ONDA 4GAAA 2XT0A 3LG2A 4GM0A 5FEMA 1C3XA 5T6MA 2HCJB 3U26A 4HGZA 4UOEA 2ALJA 1WU7A 4H7KA 4UU7A 1OJLA 4MUGA 3STUA 1YDHA 2HNAA 3DWGA 4D81A 2IPOA 3O8QA 2MSNA 3OCVA 2R6ZA 3Q5GA 1F1JA 1P8JA 2C97A 1A5EA 2DFDA 2RGEA 2WUGA 4L2IB 4OFWA 4QT0A 4CCYA 3PC7A 4O4HB 3PXEA 4EZKA 5AK5A 4K5BA 4QDZA 3IXMA 2QXYA 4W9NC 1U1EA 4BMXA 3FF4A 3NOXA 4DMUB 1DQSA 1EUDB 1Y89A 1HFEL 2BW0A 1RAIA 2D00A 2R1VB 3L8CA