4MLPA

Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
492
structure length
492
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
publication title Crystal structure of mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 179
structure length 492
sequence length 492
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4mlpA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4mlpA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mlpA01
3COYA 3FH0A 4OUDB 1TYBE 4F3RA 4MUKA 1MAWA 1JGTA 3HV0A 5TS2A 3COWA 2D54A 3AFHA 3SP1A 3MXTA 4NAHA 2WQ6A 1EFVA 1N77A 3X1JA 3OP1A 3ILVA 4MW6A 3PNVA 4MUNA 1GN8A 4G5FA 1P7PA 4MW7A 4R0NA 2X0KA 2PFSA 4PBSA 4L2IA 4S1OA 4CDNA 2XRZA 4XFDA 1VBMA 1KH2A 3ZJUA 1H3EA 1OWMA 3E27A 1MOPA 4L2IB 2HGZA 3N9IA 3S3TA 3H05A 3TQOA 2YWCA 4U7JA 3AIIA 2DLCX 3M5WA 3KFLA 1OBHA 2DETA 4DNXA 1GZUA 3FHJA 1G8FA 4MWDA 1OD6A 1U7DA 4YMIA 3IOEA 4MW1A 5H7XA 3RHSA 1J20A 4MUJA 1T9GS 1XJQA 1G8HA 3KT3A 1KAMA 1JIJA 1O94D 4J76A 2CV0A 1JEEA 2A1TS 3Q10A 1O94C 4HJRA 2I1LA 1I6LA 1R6UA 5H16A 4YP5A 4ARCA 1MC1A 3A2KA 2J09A 3CLRD 1OWNA 1WXHA 1YULA 3CLRC 4PBTA 4PY2A 4X0EA 3IODA 3RK1A 1NSYA 1K92A 1QU3A 3AL0C 4KR9A 2DERA 1WQ4A 1H3FA 1KQOA 3GLVA 4MW5A 1KP3A 4DLPA 2YWBA 1M8PA 2CFOA 1GLNA 1EFPB 1O6BA 1NUSA 1Y42X 3Q12A 4EF6A 3LE8A 4KR7A 1RQGA 2A88A 2CT8A 1YUMA 1PFYA 3FY4A 3K32A 4U8HA 1FFYA 3IMEA 1G59A 2E89A 5FO0A 1IFXA 2GOYA 1GTSA 5HG0A 1I6KA 2YXNA 3MLAA 4KPUA 1KKUA 2RE8A 4ZT7A 4DDMA 1GPMA 2EJCA 1B6TA 3CA8A 2DPLA 2QTNA 4KPUB 1K97A 3H99A 4MUIA 1VLHA 3TQIA 1F7UA 3CVXA 1WKBA 2PZ8A 1V8FA 3UC5A 1GTRA 1IQRA 3CVWA 1M83A 5HUJA 2IELA 2E0IA 2QUKA 3SEQA 3ZXIA 3ZIUA 5DK4A 3C8ZA 1PFVA 3PNYA 2QUJA 2VXOA 3ZJTA 4JZYA 1WXEA 3DO8A 4MUHA 5IJXA 1FYDA 1SURA 2V0GA 2QJOA 4MW4A 1K4KA 3NV7A 3LCJA 1U3CA 2A84A 2PXHA 2E18A 3SEZA 1IQUA 3HZRA 3U1VA 1S4MA 4ZCPA 1BS2A 4JXXA 4BWVA 1NZJA 3DV2A 1M8KA 4EG7A 3QE4A 1N3LA 3RK0A 2V0CA 3IVCA 2A1UA 1N2IA 5K0TA 4K03A 4RUKA 1N2EA 2IP1A 1OBCA 1QRSA 4MUGA 1TEZA 1U0BB 2AKEA 3CLSD 2A1UB 3ZGZA 1X6VA 1ILEA 1JMVA 4MW0A 1CT9A 1QJCA 1YUNA 1N2OA 1QQTA 4I6JA 4NZPA 3FG9A 1G8GA 1EFVB 3IVXA 4MWBA 1QRTA 1N2HA 4HK4A 4XSVA 2HMAA 3AG5A 1VBKA 1LW7A 5AHWA 5JBNA 2QJTA 1T9GR 3H9BA 4CT0A 1KORA 3SYTA 2A1TR 1N2JA 4PBRA 1JHDA 3CVUA 3JXEA 5FO1A 4H3SA 3OTWA 1EUYA 1TQ8A 1T6XA 2A4MA 3COZA 3KT0A 5LM3A 5KCMA 2DR2A 3D6UA 4MVYA 4QBTA 2H2AA 4MVCA 2CYCA 4U63A 1QU2A 3SZ3A 2WQ7A 3H9CA 3A4IA 2JA2A 4P2BA 4ZT6A 4DJAA 1Q15A 3FWKA 4K0RA 2DEUA 4MAFA 2D5BA 4MWEA 1YI8A 4NDAA 3HGMA 2BTEA 1F4LA 3IMGA 1NYLA 5FNZA 1WOYA 5DB4A 1JZSA 3CLTD 3COVA 1PG2A 2J08A 1H1TA 4EFKA 5LFAA 3CLTC 3GMIA 3FDXA 3FIUA 2H29A 4NAUA 2Z3VA 4QRDA 4WSOA 4MW2A 1PFUA 3P0HA 1ULHA 4ZCRA 4HJXA 1A8HA 1ZJWA 3PNBA 2A7XA 1N75A 3MUEA 3Q4GA 1O97D 4Q16A 4I6GA 2PZAA 3INNA 3HFJA 1O97C 1R6XA 4KR6A 2DUMA 2X3FA 3UY4A 1WXFA 1U3DA 2XRYA 1J21A 5J5AA 3KT6A 1JZQA 4DE5A 4GRIA 3UOWA 2PIDA 3FNRA 3MLBA 3FOCA 1M1ZA 1XNHA 4FZJA 1Q19A 2QUIA 4MUEA 2X1MA 1U7XA 1NI5A 2E21A 4NATA 2CYAA 2ZUEA 3H97A 4YP6A 3DPIA 1M8JA 2Z08A 4JFAA 1IHOA 3L92A 1O96A 1JEDA 2EL7A 2X1LA 3UK2A 1Q11A 2AG6A 3F3MA 1DNPA 1KAQA 3G59A 1O96B 1NP7A 2GKSA 1OWOA 4ZT3A 1F7VA 2YY5A 2CUZA 4MULA 4EG8A 2R5WA 4ND6A 5KHAA 4CDMA 1JECA 1KQPA 1WXGA 3P0JA 3K9WA 3PXUA 3NBAA 1KR2A 2B7LA 3ND5A 2AZXA 3IMCA 1I2DA 1NUQA 1I6MA 1MAUA 1TFUA 3N8HA 3VGJA 5F23A 5KWVA 1EJ2A 1O0BA 1IH8A 3ZJVA 1MB9A 1O5TA 1NUPA 4HPWA 3SDBA 4F4HA 3CVVA 2GM3A 4MVWA 4ARIA 3KT8A 1IVSA 3L93A 3CLSC 3P52A 4EG1A 5K0SA 3P0IA 4DDHA 1XNGA 2DXIA 1N2GA 1TYCA 3A05A 3ND6A 4OUDA 2PG3A 3LOQA 4QREA 1OWPA 3X1MA 5J58A 2A86A 1IRXA 2WB2A 5HUHA 5TEVA 5IHXA 3N05A 2J4DA 2QTRA 1QRUA 2WSIA 3IVGA 1LI7A 1UFVA 2CYBA 5TGTA 2CV1A 4ZT2A 2NSYA 4UZFA 3FI0A 1YIDA 1O0CA 2IJGX 1V47A 4EG5A 3QTTA 1N2BA 3AKZA 4EG4A 3CLUD 4A91A 3TZLA 3VRHA 1WY5A 2O5RA 2J5BA 1O95D 3CLUC 3G6KA 2RD2A 1QTQA 1O95C 2OV4A 5LLTA 3A04A 4EGAA 2VTBA 3ZXSA 3QTBA 2CSXA 3HL4A 4KKVA 3RFFA 1J09A 1MRZA 5DEOA 2VTBB 3D6VA 1JILA 3VU8A 4MLPA 1QNFA 1T6ZA 3I05A 5DASA 4YP7A 3RJZA 3IOBA 2C5SA 1YIAA 3RBAA 4EG3A 4UZEA 5BNZA 5EKDA 1COZA 1N78A 2TS1A 3PRHA 4G6ZA 4OJMX 1KH3A 5J59A 3MMXA 3IUBA 4MVXA 4YBRA 3ND7A 4R2LA 4ZT4A 4ZCTA 1D2RA 4Q93A 1K4MA 2Z09A 3ZUGA 1EUQA 4AS1A 2NZ2A 4I6EA 3GUZA 2QTMA 3HMQA 4JYZA 3CR8A 4EG6A 1Q77A 1WZ2A 1WXIA 3ELBA 5TEWA 1LI5A 1ZH6A 1OWLA 1VBNA 1TYAE 2PZBA 3SZGA 4NX2A 2ZUFA 1EFPA 1MJHA 3UMVA 4MQ6A 1JIIA 1EXDA 1XNJA 2OQ2A 3IOCA 4WNYA 1VL2A 2BYTA 3IDFA 3IUEA 4TS1A 2HZ7A 3N2YA 1HYBA 1WJGA 1GAXA 2ZP1A 3TNJA 4CQNA 1EE1A 4ND7A 4XFJA 2QUHA 3FETA 1NUTA 1ZUNA 1R6TA 4AQ7A 1MBZA 4E1AA 2JAXA 3ISJA 3X1KA 1J1ZA 4GU5A 1MB2A 2D13A 3NBKA 1TYDE 3AG6A 1ZH0A 1KP2A 4G5YA 1T6YA 4MWCA 2J07A 1F9AA 3TS1A 3CVYA 2QJFA 4MW9A 1N1DA 1WQ3A 4ZCQA 4JXZA 3DLAA 1M8GA 2CV2A 4RPIA 1X8XA 3BL5A 3TZEA 1PFWA 1NURA 3IH5A 4R2MA 2O8VA 4ZCSA 3G5AA 1J1UA 1JIKA 1KQNA 1IQ0A 1M8FA 1J70A 2JANA 4ZT5A 4MUFA 1H3NA 4DDKA 1KH1A 1PG0A 2G36A 4J75A 1NUUA
chains in the Genus database with same CATH superfamily
4KR0A 4AK9A 1HQKA 2R86A 2QQ5A 1JR2A 1UN8A 3PHCA 4KLAA 2BKVA 3FCEA 1E2BA 4B3XA 5KAPA 4J91A 1ADFA 5CCLA 4C21A 3TXMA 1FT2A 5TMDA 4FQ8A 4LGMA 1IUKA 4LCJA 2Q6VA 4MP8A 1XAHA 4OB8A 5EZ6B 2B1IA 2B9EA 2GJSA 4AM8A 4N7JA 3THRA 3GLHE 5AKZA 1TU0A 1SIWA 5ITVA 3DMHA 1SC1A 3C48A 4GI1A 3TQFA 3USCS 1KAOA 4ODIA 2FW7A 3HCFA 3EC7A 5ELLA 2WJIA 3GJ5A 3PS9A 1A8UA 3FNQA 3I5UA 4Q1FA 4MRPA 4RPGA 2PL2A 3G85A 1UPUA 5BP7A 3VKUA 2QE6A 3C98A 1XTVA 3TKLA 2WYIA 2DTEA 4EBAG 1GA1A 2I4IA 4QYWA 5A4MS 4MK4A 2OD2A 4GCOA 1J8FA 4XDHA 4IOJA 1JR3A 4OYRA 1BJTA 4MA0A 2GCIA 3HZRA 2CNBA 5JECA 5HIJA 3WLRA 4QPNA 2GWRA 1JX6A 4V0ME 3WQHA 2LIPA 4K03A 3C3QA 1UDWA 2J7PA 2Q5EA 3PX7A 1CT9A 4XQCA 1EFVB 4MWBA 4IY1A 3DG9A 1KFEB 1WDKA 2GCPA 1V8BA 3E5HA 4Q1EA 2I55A 4MYUA 3NV9A 3VX4A 2PQMA 4TMWA 4J2HA 1B3BA 1I4OA 3C3EA 4FCTA 4DSOA 3EB9A 5C8ZA 1SU4A 5A9TA 4OHUA 1Q15A 2V4MA 1GWNA 1JIVA 4BTBA 3TLEA 3RV3A 4QAQA 3C85A 2TMDA 5D3MB 5HM8A 1FFDA 3RSQA 2VHUA 3IP7A 5ICCA 3GBPA 4B6RA 2DQSA 1F20A 2J67A 2HA7A 4G5OA 3AJRA 3L7CA 1EHCA 5F77A 2GQ0A 2OWDA 1VJCA 1MHTA 2FFJA 4LC9A 4YRZA 1E3LA 2XGGA 1TMOA 1E0JA 2E21A 3Q5EA 5J08A 1ENYA 4Z4CA 4EELA 1PKXA 3B20A 3TVTA 3LYLA 2BT4A 4JJGA 3PEVB 1Z56C 2EIHA 3F4KA 2VQEB 2D1RA 2ES4A 1WSWA 2G7ZA 2A78A 3FLBA 1ND5A 1V16B 4C22A 4ZJPA 2Y6VA 3UA4A 1V11A 1S2MA 3KNZA 2XPYA 5ESDA 1IEQA 3QJYA 1GSOA 3WGKA 4RLHA 1PZNA 4K9RA 3HACA 4AJNA 3QOFA 2W6CX 2I71A 4RVUA 1KO5A 5FZRA 4DC0A 3OCCA 2EIJE 4M86A 6REQB 2QTHA 5KVQA 4LVUA 5FPQA 4LVCA 5JO0A 1YL6A 1X1TA 4ISCA 4OVVA 3FSRA 4J3JA 4C5CA 4DUZB 4A16A 4NCKA 4TLMB 4FMPA 2LUHA 1M66A 5MGBA 3EVGA 4XUDA 4A6XA 1S0PA 4YAFA 2JFFA 1C1HA 2WWRA 2P2ZA 5JMWA 4CNBA 3I05A 1LPMA 5B30A 1ECLA 3CTMA 1OX6A 4AMGA 4YCCA 3DTNA 1XYVA 1CPYA 4GLBA 1ZGGA 2FEKA 1R0WA 4I9UA 3T1YB 4XPIA 3VBCA 3D9OA 1TN6A 1VCOA 1NXXA 3E81A 1E6WA 2YUIA 3AY6A 4URVR 5G05J 1ODSA 4ENSA 4YDYA 4IH9A 2ZP1A 3JQ7B 5F7OA 1U6IA 3WLQA 3QWPA 4I5FA 4RK6A 3ASVA 2IYUA 3OVMA 4ZJYA 2GZHA 1WPGA 3WNVA 4OU5A 2QXYA 4POOA 2WPDD 3CF6R 2EC5A 2P67A 4Q7LA 4YVQC 2M1ZA 3VC2A 1T0BA 4MR9A 4QHYA 3G5AA 3W4KA 1WXQA 5ENDA 4DANA 2Q1WA 1C7RA 1WB4A 4J1QA 1M5RA 2FFQA 2MSNA 3WYNA 5G2NA 3K3PA 3RWOA 5IH3A 3UV7A 1PGOA 5A03A 4RLFA 2H6EA 4HFNA 4L15A 3N74A 3R3UA 3G2VA 1Z2DA 3AJEA 5DYWA 3FNGA 1WP9A 4JEUA 3K4PA 2ZSEA 2ONZA 2O0JA 2J0EA 1ILWA 1TUIA 5DGCA 1CBUA 1LD8A 1VMDA 2O50A 3GJQA 1YI1A 2IOFK 4WFKA 1NJSA 2R8PA 1EP2B 4IEFB 4PQFA 1EWKA 2QYJA 2PRSA 4N5DA 3ZIMA 4GGOA 2HWWA 4GHWA 1M2VA 1RU3A 5ECWA 4US2R 3ZDBA 3UMRA 1QR6A 4Y2GA 1I33A 4B31A 1FRNA 3IIMA 2HPAA 3T4XA 3IP9A 2FSUA 5IJAA 3OKAA 4LCEA 1M6WA 3GFSA 3LCAA 4GUDA 3AR6A 1QTRA 4DDUA 2XQ0A 5H5JA 1ZR4A 1R9NA 2XE6A 4M0MA 1AZTA 1V48A 1ZK4A 3MUNA 1ZVJA 4NOKA 1Y6ZA 2PX6A 1PEAA 2VHXA 3KQOA 5J2TF 2O52A 2XT9A 3CLKA 1ZOPA 1CY8A 1NMZA 1VKJA 3USES 3V1MA 1ZJ4A 4TQGA 2WD7B 4FEGA 1YJ5A 4ZO4A 3OJWA 4UM8B 1JTVA 4GD3Q 5LXTA 4UHHA 1U9IA 3FCCA 2BGWA 3MWEA 4AJ4A 1OFGA 1LSUA 1FMTA 2YY7A 3BD8A 3NHAA 2MT9A 1TYZA 4P82A 3UCEA 3W7VA 4M0CA 1NZFA 4M76B 1KYYA 3SZ3A 3FBTA 1TN7A 1KJZA 2A5JA 2O3QA 3H5VA 2Y9MB 1FFCA 4ZHQF 3FVQA 5KWJA 2AC2A 1T26A 4MV5A 4RTMA 3NT2A 4Q18A 4BLQA 4G4GA 3SBDA 4BJ1A 4JLWA 1KE1A 4IL5A 2B20A 4RY8A 4D9NA 4KR6A 2DUMA 4AC9A 4FWTA 3C4QA 4XJTA 1CLUA 2GRNB 1KNQA 3REQA 3ZV4A 1UWCA 1C9JA 3U9WA 2BFFA 1XMXA 4EDFA 4F56A 4J0CA 3ZJ4A 3RO7A 1OXMA 8OHMA 3U44A 3NHPA 4ZCIA 2GZMA 5E7JA 1DLJA 3KSRA 3N70A 3TM5A 3EWIA 3WKCA 3IKJA 1WS6A 1BE0A 4WW0A 1O0BA 4CMAA 1FNNA 3CIAA 4BMOB 3GK3A 3E5RA 3PQFA 2KYRA 5J4LA 1H5QA 1P0PA 5KJEA 4BJ6A 4B45A 5KVVA 3PGJA 4TTRA 2PYDA 2FX2A 4GYOA 1UOEA 2CFCA 1E9BA 4PICA 5ADVA 4MA5A 5LA6A 2CYBA 3LW7A 1ZH8A 4XX1A 4QOJA 1HNXB 3KEFA 3OLCX 4AJ9A 4G0OA 4OGLA 4QAJA 3PIRA 4JJFA 3PV0A 4JLJA 2WMNB 1CNMA 5HIIA 1UJNA 3Q9NA 1HI9A 1HZJA 1TDJA 1F60A 4UTPA 5LYJB 1OASA 3RFFA 3ZZMA 1F06A 2BFAA 2Y99A 2YX1A 4WKBA 4OL9A 1ZQ1A 4TN1A 1DO8A 1ZUWA 4XVCA 4BJ3A 2MSKA 2AOTA 3ZNGA 2P1RA 4KFRA 1SHZA 4I6EA 4FUTA 1L7EA 3RYHB 5GZ6A 2VHJA 2NUTB 2EFCB 4I2WA 4PAGA 5IAAA 2XYPA 3AETA 4HQ0A 5EXXA 1TEHA 2KLHA 4J8FA 1GHTA 3COJA 2C2ZA 4AF6A 2HY7A 1TTTA 2QU7A 3A25A 3DVSX 4L3OA 1DKMA 2XX3A 2JL1A 5LUBA 3NBKA 3OZXA 3W9BA 3GA0A 2J4FA 1FTSA 2ZE7A 3GZSA 4OXQA 1KDOA 2YASA 1KZPA 2CBGA 3GUYA 3V2OA 5JXIA 4Y9SA 2ZRPA 1N0HA 1XZBA 1BTOA 1FNBA 1FZQA 1L9KA 1Y3CE 3DE5X 4DK5A 4M0LA 2TMKA 2XWSA 2HR2A 1W30A 1UK8A 2Z1DA 3K2BA 2Q1TA 4NEGA 1WDWB 1IB6A 2YYZA 3WB9A 4CUZA 3ONWA 1ADJA 1ZNQO 4AUMA 3GO4A 2JEKA 4PRYA 4NIMA 1SC3A 4PYJA 1ZCJA 3OTIA 3PXBA 4XFKA 2A1TS 1H4QA 4C7JA 1XZAA 4LNUB 4HDCA 1J2UA 3AP2A 3LQKA 1MVNA 1VBFA 2DZDA 3JZMA 4CM8B 3IS3A 1RADA 2FSGA 4W5RA 3FUFA 3TLMA 1Z7BA 2Q4RA 5HRUA 3IQWA 3SNKA 3I4FA 5AO9A 1KRXA 1Y81A 4L9AA 1IOLA 3IFSA 5F4ZA 5BWBA 2OORA 3AEQB 4AY4A 2CXNA 4DG9A 2H8GA 3GARA 3NU1A 2AXUA 5TMPA 3IHVA 4L9SA 4WLNA 2C7PA 2VF2A 4WGGA 1E3QA 3VUEA 1TL7C 1SVIA 1JDVA 4LNHA 2HLDD 3S2FA 4KQ9A 2L18A 2Q41A 3IP1A 4FJ1A 3C5HA 3AF4A 4GKVA 4LDZA 4MGEA 3ZRHA 3SF8B 2P5YA 4JEHA 4BU0A 2BFDA 2JH3A 1EU1A 1GZ4A 2F8MA 4EY5A 1BX1A 2AA3A 1ZCZA 1QCZA 4XOUA 3CVNA 3SR0A 1J5PA 4CLXA 2F00A 2DR2A 4OK3A 2F64A 1Q7EA 1NASA 3GD5A 4JMLA 4IH4A 2H51A 2YWFA 2IKSA 3QWAA 3K09C 4DJAA 4D10C 4ETMA 3UMGA 3MJSA 4DCTA 1G5HA 3LPMA 3L3BA 2QPOA 3IAAA 3BB1A 5JC1A 2J08A 4TZ6A 4AJ2A 1I4DD 3A1VA 3DEYX 4M46A 2V54A 2Q49A 4K9NA 1ZN7A 4XI0A 1NOIA 2B30A 1CUUA 4Q3LA 5SYMA 4Y9DA 3TG2A 4FI3C 3QJZA 2BGRA 3T0IA 1MRSA 2NO5A 4K1XA 4E4TA 2Q2VA 3EUEA 4AUKA 3YASA 5IK2D 1P5RA 4OBWA 1U3UA 4CL8A 2I67A 1XPRA 4RD1A 1T2FA 3BCHA 4PO8A 1YJXA 4EB8A 4NC9A 3ZXYA 3FTXA 2BW0A 3O1LA 4ZV7A 1T5BA 4DYVA 4O0MA 2MINB 3HCNA 1E8DA 4EPZA 4NYMR 3N05A 2AV6A 3I42A 2WTEA 4HUTA 4JDPA 3RAGA 3RT9A 1U8AA 2P9GA 4O25A 1M67A 1R64A 1EJBA 4F5EA 3F6PA 4RE5A 2WPDA 3QTBA 4WKGA 3AG2E 2FE4A 4WBSA 5L3QA 2J4BA 1V5FA 3DDUA 2FPKA 1SXQA 2V5UA 4EA9A 1Y3IA 5IHPA 1R6DA 1SN7A 2A5YB 3OQJA 4YBRA 3N5CA 4M9ZA 3TWTA 1MQSA 3GZ4A 1Q95A 3KYCA 1KIMA 3HN6A 4FE3A 4GWKA 1HTBA 3PUYA 2XADA 1NYQA 5B1AE 3ENNA 3RC1A 4L5IA 3Q1LA 4CBVA 2V6BA 3OM0A 2FFHA 4OMUA 2VSOA 3EAQA 5LQCA 1SHJA 1U31A 5JXJA 3EA0A 2HUPA 4CMKA 4FZ5A 2A33A 4KOEC 3PPWA 1GRRA 4YJ3F 4AL4A 2FGKA 2RGYA 2ID4A 1GPBA 1I4TD 3EJWA 3AKCA 2AT1A 4Z4GA 2O3UA 3O8OB 2B21A 5H3HA 5IKOA 4LMAA 1KU6A 1KK1A 3MTAA 3IEMA 4BCDA 5H7XA 2Q0HA 4PN3A 2AFHA 4INZA 3UK1A 3AB8A 3CEMA 5KTRA 1DTWA 2H85A 2NADA 5EUCA 1QFYA 4TTJA 5EIEA 5KQLA 1YVRA 3NVDA 3DW1X 4HOUA 3EIJA 2WNHA 3W3ZB 4MW7A 2FPLA 1Q1EA 3GGJA 1UMCA 2IP4A 3U3KA 4QA9A 1DINA 2PL9A 2NYJA 2E5LB 4IHJA 5F9FA 2ZW9A 4Z99A 2WHPA 2BGTA 3N07A 1FT1A 1O94C 1I6LA 4K05A 3APCA 3SBSA 4ZVKA 3C3AA 3MD0A 1RC1A 1YRYE 3LPNA 5CGZA 3THWB 2PT6A 5ITWA 5HVNA 5AN8A 3ECAA 2ROQA 2IXBA 2I7XA 1INZA 1E9DA 4M9UA 5FBKA 1SQ6A 2FO7A 4ZVVA 1AHNA 3C6YA 1ML4A 3UOGA 1QP4A 2ZWMA 3GZNB 4EAAA 1M1YE 3X2FA 3GLSA 1JFSA 3O95A 5KYUB 1HFJA 3R3HA 1QG2A 3HBJA 3VU3A 1UBCA 3HY6A 1RQNA 4K9DA 3PNLB 1RJGA 4RWEA 2R84A 1C9NA 3SXJA 2GRJA 1Z7EA 2XXAA 4GTPA 4DV6B 4WIAA 3AFIA 2GM9A 3JASA 2HB6A 5EMJA 1F2UA 2ZYTX 1FMCA 4BESA 1GFSA 3BZWA 1T1SA 1C4KA 2BHSA 3DAOA 3A3NA 1IQUA 1SK9A 4OMCA 1VHLA 1AG9A 3IVCA 2IUSA 1W3BA 1AX9A 4RU1A 5K3AA 3ZKWA 3QG5A 3R5FA 3OMWA 3PDIA 4BL5A 4IZOA 3IVXA 2V74B 4YMLA 1ZG3A 1P75A 1Y4AE 3ZKJA 3CZPA 1VG8A 2C03A 1FXUA 3LX4A 4O5OA 3RAJA 4DPKA 4NNJA 1KMNA 3PQ5A 4YRBA 1NONA 5KCMA 3MINA 1U9ZA 5EJ2A 1GIAA 4N3GA 2BIFA 5JNSA 3TZ6A 1W36C 2QD1A 3BDVA 5J1SB 4HRXA 5DTIA 1HDGO 4MZDA 2XPIA 1W29A 2ZISA 4BEBA 2HOQA 5KQSA 1AVTA 4ZCLA 2ACWA 5TQ2B 3GN1A 2CC2A 2VBCA 3HDJA 2FQ1A 4NU8X 1CR0A 2QN3A 1PR9A 4GRIA 2ECQA 1SBQA 1SULA 2Y1LA 1A5BB 4H1VA 4GP9A 1ZH2A 2BOVA 5LMCA 4PHTA 3F7MA 4JJ8A 2O6HA 2XNSA 3WKAA 2CUZA 2X15A 3BFPA 3EK2A 1D07A 2HIGA 1GD1O 1N9GA 2UZ1A 5KNHD 4BFLA 3EIOA 1P5FA 1PR2A 4UVEA 2I9KA 2XXJA 1T15A 4JHJA 3P0IA 5AVTA 4FN5A 1R5OA 1HRDA 2SKCA 2Z6VA 4MR7A 4NV0A 3PL5A 1EFTA 1IK6A 2RHOA 4ZI5A 2QX4A 1WTCA 3IUNA 2HV8A 1M2NA 4KWEA 5DHPA 4DMMA 3A1FA 4U7WA 1T8RA 3KAKA 4UI9C 3GHHA 5ALWA 4ZYVA 1PT7A 2LCFA 4KTVE 2WI8A 4Z4QA 3O48A 5CVCA 4L02A 4RX1A 5ARCA 5HOEA 4F8EA 2CGEA 1QRAA 2OZLB 3VPCA 3FWPA 4PO9A 5K8VA 3S28A 4EJFA 2H6GA 2ERYA 1L5GB 1Z28A 3OSUA 1QHYA 2BYTA 3FYSA 3QVXA 4UM7A 3UZUA 3ZN3A 5JAHA 3CISA 3M6AA 5CDTA 3ZGYA 5JCPA 4WHMA 3P4YA 3BJZA 4MLZA 1OI7A 1E9SA 1G0OA 3F46A 3R5JA 4EGFA 4NOMA 5JCOA 1XZPA 1UJ4A 4TTTS 4UU0A 1GPJA 2GMWA 4RKFA 4EKEA 4RA6B 1EJ0A 1VM6A 2Q6LA 2FUKA 4YRKA 4QU5A 2O2CA 2PUGA 1Q84A 4TL7A 4F6CA 2BFBA 2X86A 4R5HA 5B64A 3SQXA 2EP7A 1Y1LA 2OGUA 3NF1A 2PZKA 3WB0A 1V4NA 2ZJ2A 1C0IA 2GCNA 2BBOA 3QV2A 4MP6A 3KG2A 3B7SA 1SCUB 2IGBA 2PX8A 3ROMA 2HLDA 1CB0A 3TQOA 1XZGA 5L8VA 2X6RA 1OBHA 3FPJA 5P8WA 5HW0A 5JCXA 4DBLC 4Y2UA 1ZBDA 4Q4HB 1QSGA 4MJXA 5C35A 1OBVA 3R7BA 4NARA 4N3BA 1Z3CA 2VJMB 4G8LA 3CLRD 4PTLA 4HVCA 1RHKA 2OYCA 3KV1A 3ZEIA 1QGED 4B0PA 2YHIA 4LF9B 1JPVA 3D6AA 1HF3A 4OA8A 4WKNA 4ZAYA 1K5PA 2B36A 3JALA 3F6RA 3UW1A 1H2EA 1U0SY 5IAKA 4F53A 3MCUA 3HVEA 2J41A 4EY3A 5KYWB 4B4VA 1Y5MA 3BTSA 4DRYA 4CQMB 5TQJA 1TQ4A 2FZCA 4UKDA 3AUFA 5L7WA 3O83A 1GZDA 3KQMA 1QH0A 4J3NA 3CKBA 5JJCA 2I5PO 3SE0A 1TNOA 1RRFA 2QLMA 4N6GA 3KX2A 2I8CA 5AKIA 3ZWOA 5BV0A 2R6HA 4B81A 3DC7A 4TN5A 4DVGA 2V0CA 1OFUX 1VKZA 2HYIC 4QG7A 5FOTA 3FJYA 4PPGA 5J40A 2QDKA 1EXWA 5KWSA 1JHYA 1GO2A 1YUNA 3K0FA 4MRVA 6GPBA 2QTLA 3ZXPA 2Q9BA 1M72A 1NF8A 2L0IA 5ALOA 4R8LA 2XF2A 3RC9A 4IQ8A 1KZHA 2I9CA 1EBUA 1NR1A 4PAWA 2ONJA 5IK2A 1DEXA 3EGVA 4UNPA 5EX0A 1QDUA 2AFIB 2WUEA 1OXSC 4GZLA 5H83A 3L54A 5ALPA 2FZWA 2XH8A 2H9AA 3TBHA 3O1HB 2WP0A 1K7YA 4G0QA 1SBZA 4WSOA 4MW2A 4XLTA 4HDQB 1G2PA 1N4QA 3GA5A 5JS6A 1L2TA 1QC5A 1Z47A 2D0OB 3IR6A 3SZLA 2WNIA 4OXNA 2VJPA 1V7PC 1Q19A 3GI1A 4IKEA 4KRYA 3WQRA 2CYAA 4ENTA 4ED9A 1TLFA 4YASA 3SBXA 3QSGA 3UWPA 4WZZA 5D0OD 1HTWA 1E2QA 1Q6YA 1K3TA 1ZBPA 3IV9A 4G09A 3OCUA 4BQIA 5KJ6A 2A58A 1T8YA 4BO8A 4U2DA 1T9HA 3KWFA 1J97A 2PSSA 3DOOA 1U0NA 1N32B 5EMNA 1L7PA 1TA0A 5FBWB 4DABA 2A4KA 3IJPA 4ICIA 3CHSA 1L4EA 1KK3A 4DEXA 4NEQA 3NOGD 2A5GA 3AZQA 1WZNA 1YXMA 2CB9A 4ZVUA 2D74A 4YAGA 2C2GA 3BSYA 3OFKA 3ZCUA 1WG0A 2X5KO 5IM4A 1O0CA 1YASA 2WD9A 4MR8A 1CQJB 3HZOA 4TWBA 4N41A 1V35A 4GMKA 2J6CA 1J23A 2XMRA 4HD8A 5M3BA 2G9VA 1ZWLA 2EBUA 4BCCA 5ALKA 2PCJA 1YRWA 2FG5A 4GZDA 2BJVA 2LBPA 2HSZA 3HA7A 5ICEA 2CEAA 4P4GA 2IONA 4Q48A 5C7YA 4K26A 4D0GA 1FUKA 2BCEA 1LD7A 4XD7D 4DNQA 6ADHA 4X3PA 2V58A 1XMIA 3OUZA 2BELA 1G21B 1VE7A 1R4NA 2V7XA 2G71A 2D2IA 1X7ZA 3ORFA 4PIPA 1EM8B 5JXHA 3NAGA 1TYDE 1ZH0A 4X1OA 3SHFA 1QZTA 4KLZA 4NBVA 2VUTA 2ZTLA 2I34A 3EPHA 1RWPA 2WKWA 1C81A 1E2GA 2VJCA 1RTKA 4YDWA 4WFQA 4CFZA 3COSA 4J3FA 4KBQA 2G36A 2O6LA 3KQPA 1AQNA 3QX3A 2IS6A 3O6VA 1E2PA 4GOJA 4AG3A 4CN9A 2IIBA 1DELA 5DXJA 1SH7A 2CFIA 4E32A 4BGVA 2R6CA 3HBAA 2X9VA 1Y7HA 2IYVA 2XRZA 3HP7A 4FFMA 1LLDA 3RVKA 4OO3A 3RU3A 5J5CA 2WV9A 3KPWA 2VQDA 4L51A 4B6EA 3LQ2A 5JYCA 2Z9DA 3RHSA 1RYHA 5GM1A 2PSJA 1QH8A 4JROA 2HJ9A 3QF4B 1PL8A 2ZR7A 1JSCA 4YCJA 2VZLA 1LJLA 4GG1A 3PTAA 3C7TA 4HAZA 3VR0A 4KZ0A 3V8EA 4LHZA 2FZEA 2CZQA 1P7CA 1VSTA 3PUKA 4ARZA 3BWYA 2I1VB 5EMMA 3ELYA 1Z34A 1CS0B 3KLPX 4QTTB 2RARA 4B89A 1ECFA 1HEIA 3V7YA 4BVHA 2YOHA 4FCVA 4MS3A 4E7PA 4YT2A 4UCXA 3OQHA 3SGHA 3MLEA 3DSSA 3H5OA 2IYLD 3C6ZA 3IRVA 4AVXA 3U3OA 4MYTA 4LGCA 3H19A 4RUKA 1D09A 3APFA 3V2XA 5ILGA 1XF9A 5DBFA 3VSBA 2B7CA 5JPIA 1L1FA 2XODA 4DM7A 3VZRA 3GH3A 1JQAA 4F97A 2JFVA 4DJFC 5FL3A 4X8LA 4PR3A 4ZAZA 2FJUA 3DFMA 2X5JO 2FSVC 4NYMQ 4JP2A 5JD3A 4MWEA 3H83A 2Y0CA 5JJ6A 1AUVA 2WFLB 1C1XA 3MW8A 4DIDA 4R1LA 3QU9A 4U3JA 1GKIA 2FPGB 5JBIA 3RRNA 4POAA 3ULQA 2ZQYA 1N75A 3JAKA 4Q16A 3NHKA 3D4IA 1CZHA 1MX9A 4EUSA 5HF6A 4BXOA 2F90A 3D1LA 1HKUA 3OJFA 5AM2A 3PGLA 3KB6A 1KVTA 3EWSA 2ZIUB 3ZPJA 5ISMA 5IUJC 3RODA 5T4EA 3OPXA 2DB3A 1HV8A 5A4FS 3UXGA 4EI9A 1KAQA 1O96B 4M87A 3IVMA 1Y7LA 1H2RS 3ASYA 5BYBA 1DC4A 3QBJA 1H05A 1UFKA 1FSGA 4K6KA 2Z95A 2QQFA 4QDXA 2GD2A 3RFVA 2VO1A 3U3JA 2N9UA 1ZMBA 1KEWA 1L8QA 1RXIA 1A9QA 3IVGA 4FSHA 1TCVA 3QIVA 5FWDA 2PZFA 3OWHA 2ZTHA 1M3SA 3MT8A 2QR5A 1ZXLA 4EUKA 2I6FA 2YWJA 2HHHB 5FXMA 3ZV3A 1EG2A 1SU7A 2PNNA 3ZHZA 1I80A 4KRGA 4M8LA 4AY5A 4HB5A 5EIWA 2YFYA 3ZFWA 2WOOA 5TARA 1U7ZA 2GBLC 1CUGA 1EG7A 3UJ3X 2ODNA 4PZDA 2RGRA 2B4TO 4QSMA 1YRAA 5KOJA 4Q93A 4JJKA 1WPRA 3LPAA 5DTMA 3HMQA 2WYVA 3NHUA 5EDSA 4DVJA 3WLEA 4J4HA 4GQAA 3IQIX 1OVMA 5FIUA 1OCEA 1Z33A 4NE7A 4O1OA 4RTOA 3TG4A 1CC1S 3JRXA 3MXOA 2WVGA 1VG0B 2VYVD 5JYEA 3LPCA 3WOVA 2FX3A 2ONKA 1TF2A 1T8SA 4IQGA 3WGMA 3SI5A 2EFHB 2D1SA 2R48A 4RORA 1L8AA 1I5RA 4ETNA 3S0JA 4FLMA 5EHQA 4ZEVA 3P2IA 1QQAA 2V7BA 4IZIA 1R10A 3DLAA 3D6JA 5BSFA 3EHQA 3VJMA 1ZL0A 3ISVA 4DMFA 1U4SA 3WIUA 3O0DA 5T4BA 4KWIA 4DLYA 4GS5A 4DM4A 1NA5A 1WBDA 1SD5A 1PJZA 3LCVB 5JJ5A 4AWBA 3QA3E 5GY7A 1N54A 3SZUA 3MJHA 2X0KA 4TYNA 5DBEX 3M2TA 5BN5A 3WK6A 3ZN2A 3VQTA 1KIAA 2C5GA 4DHEA 4TV3A 4RK1A 4Y6OA 4F85A 2HA6A 1VJGA 1P0FA 1TAGA 3VGPA 3OHPA 2JIZD 4FYVA 2VXCA 1ESZA 1K7SN 4E7OA 4WXYB 3G5MA 4UOZA 3GGSA 1GTL1 1ODTC 2DQYA 1MUUA 3PREA 3WZMA 1HA3A 4EPVA 1NSYA 4H6PA 3FJOA 1CUZA 5IW8A 4JX9A 4OB6A 2H1HA 3IKMB 5WRFA 3QNWA 3ZLBA 2I1QA 4DC9A 1KMCA 3DS8A 4MPPA 1S3SA 4RV4A 3TTTA 3ENVA 1W6RA 4NVRA 4EHHA 3OWOA 4G1MB 4NG5A 2YINA 1WKBA 2HA2A 3F7TA 3PEYA 3VI4B 4N5IX 2ONCA 3A32A 4WD3A 5AKYA 2YW9A 4E2XA 2C4TA 3MKQB 3RS5A 4L7QA 5DLEA 4LNBA 4EA6A 3NV7A 1ZDMA 1E3WA 4WTOA 1R6VA 1Y0BA 4X62B 2YWDA 3ORSA 2NW6A 2B83A 1SQMA 2XXBA 1Q50A 1QQTA 4XR4A 1T2DA 5LCWC 2VPTA 2QRQA 1QRTA 2A2ZA 2R751 1DSSG 5JBNA 1U8TA 3FTZA 4JLPA 4DQ0A 3DPDA 3FH5A 2QRKA 2XMGA 1QIGA 2ASVA 1W7AA 2ZSIA 2J48A 2ZPAA 4GSKA 4U9UA 4U7HA 1RRPA 3JQAB 3IAM1 5HI7A 1JHOA 5EJ8A 2B1GA 2ZJ6A 3U9SA 4UQLA 3OQNA 3UIOC 2OCPA 2KZTA 1VPDA 2Z6AA 2FQWA 3BXHA 2WJGA 4MVJE 1BAPA 1MQ9A 1LDYA 3E9YA 1H1DA 1WY7A 4BMPB 5CM9C 1MTOA 5DX1A 2DUUA 2ZDQA 5TPWA 4C5AA 3DKIA 1N4AA 4C0LA 2DF8A 1DC3A 4I6GA 1KJ9A 4A0HA 2WM9B 4KVAA 2DWUA 1X74A 2GPAA 1DQSA 1LJ8A 4N40A 5LMNB 1H19A 1EGAA 1JQ3A 1K06A 2DHDA 1WSDA 3F3YA 4L75A 3ZDFA 2Q2QA 2QTVB 1KJJA 1XYGA 1AKTA 3SDZA 3CLJA 1NJ8A 4BNNA 4IGEA 1JFLA 1AQLA 4F7DA 3ICPA 2F6RA 1L3BA 4EG0A 4DCSA 2DM6A 2AOWA 4IJKA 3E7PA 4GGMX 2IV3A 3UXYA 1IH8A 4PZ0A 1Z6GA 3IBGA 2YN0A 4KN9S 4GYYA 5FUWA 4LCTA 3M33A 1OFUA 2X3MA 3L8YA 4XYEA 1VLJA 3PVLA 3DBLA 3DP7A 2LDXA 1I3LA 2E2WA 2H8KA 1A76A 3RRBA 3SK0A 4L0CA 3F98A 1P0IA 4PLFA 4XUEA 4OBBA 1CY0A 2HA5A 3DH0A 5K5EA 3TCNA 2GZ2A 1EINA 2W8ZA 3X2SA 2EAUA 5P21A 1E3JA 4CYMD 1WWKA 4PX3A 5IVPA 5D84A 4X9XA 4TXNA 3U17A 4DCUA 1LSJA 4C0JA 1I5OA 5HM6A 1T9KA 3A0RB 2ZYRA 1EQUA 4KKXB 1YB5A 4HAOA 4FC8A 4O6FA 3UGJA 2Z83A 3JQBC 5LWQA 3FR7A 5CERB 3FPKA 2WXMA 1M10A 4RHYA 2HZ7A 1GCUA 3CNQS 4R9NA 3Q15A 3B89A 3PUIA 3AYZB 1I7NA 4B7AA 1TI7A 3RG2A 1H85A 4DUPA 1KYZA 5AJHA 2YS6A 3PSAA 3BWVA 1T3TA 2CB0A 2X2FA 4XRGA 1CY6A 1PT8A 4HWTA 3AQ4A 3N2ZB 1V41E 3H9UA 1QV7A 2FPIB 3CSSA 1J0DA 1U7UA 3V1YA 4ZOQI 3UM0A 2J5XA 3A9VA 2IF0A 4V0QA 1MIHA 5CX4A 2YV1A 3MEKA 4V0LA 1UC4B 2C00A 5IT4A 3H6HA 4HXIA 2QFCA 3I5PA 1XXHE 3LW8A 3DLHA 5ENVA 1RWMA 1F6BA 1FS4A 1KC3A 5H3LA 3HCEA 1F9EA 2IVZA 2P5UA 1N6NA 5IKXA 4MWGA 4PW0A 3TWUA 4D56A 2H1WA 5IVHA 1I1OA 4XDGA 1LPSA 1XAGA 4S1TA 5KO2A 4BASA 3ENZA 1XLTC 3R3VA 3C7KA 2I1LA 3FEYA 3T3PB 3L9TA 1L4HA 2FEOA 1E2DA 4RGVA 5F78A 3LXMA 5AIBA 2LV8A 1Z08A 4XCXA 2JJ2D 2Q3MA 3GLTA 4A5SA 1MLDA 4IDGA 4OREX 2Z4TA 1YVDA 4K9LA 3P45A 1T1GA 3R3JA 1G59A 5DNCA 1T4DA 1WVGA 4HLQB 4BV2A 4OK5A 3NC4A 3KHSA 5CA0A 4CKEA 4JUDX 2E0IA 3AFMA 1ZD1A 3SFTA 3DMTA 4LECA 1O4VA 3OZWA 3FN4A 2AR0A 3V8VA 5FYQA 5ERYA 3LCJA 1TM3E 1D2MA 3U1VA 2DHCA 3BRSA 3UKUG 4KMOA 5AWFC 3H42B 1JHMA 5DSTA 1JAYA 4ZXFA 4ZFHA 3CLSD 4FPXA 4KXXA 1E7QA 4H08A 5M04A 1N92A 3QKSA 3KTFA 4FLFA 5FF9A 2QOEA 2MTBA 4CIXA 2PMFA 3KALA 1AKWA 1WQ1R 3NO4A 1VJ0A 3PJEA 1WAO1 4P3PA 4C4AA 3DW3X 1QE0A 1D7AA 4L5YA 4MAFA 5SY6A 3ZTWA 5D3KA 4Y2HA 2HYDA 1GEGA 1RAEA 2DHRA 5LFAA 1SUEA 4HORA 2Q2OA 4GYKA 1A8PA 3KDAA 4GBJA 3LS2A 4OSOA 1ULHA 3WC4A 2VBFA 4CGZA 3GFTA 4LX8A 4RMNA 3IT2A 1I0LA 3KXKA 5TR9A 2MYPA 1GTVA 4E5UA 1HUQA 2Q99A 5DM4A 1RAGA 2W4QA 1T29A 3ND9A 1UC8A 2UXDB 4PQEA 1XHLA 1JEYB 3SOZA 4ECAA 1T6NA 2AG6A 4CKCA 3RABA 1VHWA 3ZV7A 5CCXA 2GFIA 3BXZA 2C57A 1WXGA 4UU8A 3AO0B 2VT2A 4G8BA 1RHQA 1SXJB 3M1IA 5F9HA 1IWOA 3TGLA 2UU9B 2GSWA 2AMVA 3S1AA 3DV0A 4NXNB 2QNIA 4HUQB 2GK6A 5JZVA 2VYVA 2H4JA 4WXMA 4L27A 2H1RA 1FCHA 2XQJA 3CKCA 2QRUA 3LA6A 4I9CA 3E35A 5KKAA 3EDOA 5C9ZA 3ICCA 4DR7B 1UPTA 4K87A 1KBZA 5EWJA 1RLUA 2ZWOA 3R7QA 2EKLA 3O5AA 2IPAB 4CKBA 2VTBB 3KXIA 1CZNA 4HH0A 4IXMA 1ZIYA 1XZEA 1HDZA 1COZA 5B3AA 1RDFA 4OP2A 1FUEA 1FL9A 4ZCTA 5I7OA 1U8YA 4UTNA 3N3BC 3UT5A 4YO7A 4AS1A 2C0QA 1X7YB 4HDRA 1YK0A 1PSZA 4GB9A 2V5FA 1P0MA 1GSAA 3ZW8A 1NR7A 2VQ6A 2YCLA 4YMGA 5DU2A 4KDCA 2Q3BA 3IHWA 2HMVA 3IT3A 4I8DA 4A2PA 4A8JA 2R17C 2CK3D 2FW8A 2JIZA 4HQDA 1L3CA 1GL9B 4G1CA 3BB3A 3M49A 1TZMA 4F60A 1NMSA 4OXYA 1OCRE 4QYIB 3SQMA 3LZ6A 3IYLW 2IYRA 4Q4AB 2JCGA 2AMFA 1Y7IA 4FEAA 1AHIA 4ARAA 5A2GA 2OD7A 1WE2A 3CY6A 3TWQA 2P9EA 3OZAA 4O02B 4NU5A 4AIIA 1Y3AA 1QE3A 2VNIA 4UNNA 2F1KA 2IXTA 2IP2A 4S2EA 4OCZA 2H07A 2CL6X 2VNJA 2X5OA 3KKOA 3H6GA 5B7QA 5JQWA 5ESXA 4ES6A 3SJUA 3Q8WA 4AYTA 5DX0A 1JHRA 4F2GA 4MUYA 2OQRA 9LDTA 3EGOA 1CDOA 2YZKA 2PA0A 1JFFB 1MC1A 5L3ZA 2RB5A 4GMLA 1WD7A 3T5BA 3GLIE 3HNPA 3JD3A 2EZ9A 3KAPA 1WPQA 4FKBA 1XMOB 3OHMA 4H9GA 1POWA 2XT0A 4MUXA 4PS3A 4OYLA 2QRGA 5KSOA 1YS4A 2E4WA 5TMEA 1C29B 1GTG1 3LQ1A 2GOYA 3S40A 3ZD7A 3K31A 2PZEA 2PPLA 2DFPA 3A10A 4Z51A 3NLLA 2FOXA 4UBJA 1KAGA 2O1XA 4GPZA 1D6MA 2V59A 4EAQA 3B7UX 1D8TA 1SZAA 2CLKB 3L06A 1R3DA 3V4FA 1FYDA 4DS3A 3GEHA 721PA 1DQYA 3DFKA 1G64A 3U9TA 2ZJZA 2V6JA 2JIMA 4URZR 5BW4A 5EE0A 4TKLA 5HKKD 3IEUA 4EA8A 1DQNA 3OZDA 3GNLA 4CM4A 2CDBA 4HB2A 2CLIB 4D5EA 2OBXA 1LW7A 2CJXA 4ZGGA 5H7PA 5L6LB 4LY6A 5JJTA 1LFAA 5H4HA 2ZRBA 3PEWA 1V9CA 3FROA 4PS8A 1URPA 2QG9A 1OQAA 4RELA 3F4BA 3KK0A 1FRQA 4HB0A 4RFSB 3IOYA 1ELRA 4NCAA 4YMTA 4H6WA 3WL5A 3EXG2 2WAYA 2NU7A 3FIUA 1BN6A 2H29A 2XCQA 3HLYA 2RHTA 2VP3A 5C7LO 4LK2A 5HHTA 4CMEA 5T4HA 2PWAA 5G0WA 4BZPA 1H5UA 4Y7DA 4B93B 2XMSA 1MZVA 1JEQB 4MUEA 4ERXA 4LGVA 5LX8A 2VDOB 4OL0A 3WXMA 3EOAI 3EIEA 4O8CA 4P5PA 4DSZA 2WIBA 1ONOA 1N25A 2AEMA 2WABA 3O4GA 2HXSA 2AF4C 4CYMA 3NTQA 4BKRA 1SHUX 2VH1A 4LJLA 4ZVPA 1SUDA 2OA0A 4CCAA 3ZGOA 1KQFA 3S70A 2XHZA 1AMOA 3R9WA 2ZBEA 3DCYA 2IYZA 4GTSA 2DT5A 1N1MA 1RD4A 3UK7A 1QO7A 3GW8A 3A05A 5A7FA 1UAYA 4HWKA 4MKHA 1XTTA 3A27A 5EYPF 1G4UR 1V37A 2NUBA 4CR6A 2IJGX 1U11A 3K94A 4G1FA 2KI5A 2VDJA 1PNRA 3SG0A 3G7NA 2FAXA 3STXA 2P41A 3G2TA 3ZWNA 3UBTA 3SKXA 1B26A 3SYLA 3KYDA 3FZNA 4ZV9A 2M6RA 1SCIA 1KYQA 1ZMTA 2ZPUA 3WFZA 3HI6A 1YDGA 5H70A 2JGLA 3N86A 2EW8A 5J2TB 1SIOA 4CT4A 4JI1B 1HFWA 3A2MA 4TS9A 3X2QE 3ETNA 2A5UA 7GPBA 1UBSB 2D2EA 5SZIA 2GO1A 4Y6PA 2Q29A 2Z8ZA 5BXYA 4FE4A 5K0FA 4XFJA 5AQBA 3EC2A 4LJ4A 4L8GA 4UQXA 1HQCA 3T8MA 3TDNA 1UP6A 4IVPA 3T4UA 1QORA 4P54A 1ZKDA 5F5NA 3CHPA 1RACA 3VKFA 2GRPB 3EQ7A 3HG0D 4ZHQB 3FNFA 5KWDA 2YC4C 1W93A 3CW8X 2GH1A 4U8YD 1A7AA 2VSQA 3VU9B 1MGPA 2JJ2A 3K1YA 1Y6IA 1U3FA 3RROA 2C9YA 4K9SA 3GQBA 1VE1A 5GONF 2J3IA 3LXUX 2BCJQ 2FQXA 1ZX1A 3LRPA 2P68A 3H4IA 1SQSA 4CV2A 4PYKA 1U3TA 1T0HB 2PBLA 4D6PA 1G4HA 2KB0A 5LBIA 2BHTA 4HOSA 4IXTA 1RRVA 4U7JA 4P7KA 3TQQA 2NVOA 3T4EA 4GC5A 1MO6A 2EQXA 2H3EA 4TVOA 4BHTA 2G25A 3AI3A 3LUAA 1YONA 4FX5A 2O3RA 2FULA 3EGXB 4EHAA 2VCHA 2YOFA 3W1EA 2NZJA 2BFCA 2W0SA 4KR9A 3M6WA 1CFJA 3Q4AB 4N8EA 4ZTUB 2J0UA 1D2HA 4MYSA 3TF5A 4GH5A 4JVSB 2PAFA 3H2YA 2QW0X 2AZDA 1SVLA 5CCMA 3QTLA 2Q8PA 5EQJB 5LOVA 3GLRA 4ZPJA 3E3NA 3W3AD 2XQFA 2H11A 4BUZA 1K97A 2X22A 2Y27A 4K9MA 1BXGA 5GZ1A 1GTRA 1S01A 4UTZA 4M7PA 1TM7E 2RHCA 5LCWJ 1EQ2A 2QD2A 1YDFA 5IKMA 5DTEA 1RI1A 4J0GA 4IIXA 2PLNA 4TKUA 2R00A 3QE3A 1ULAA 2VUIB 3KSUA 1OJ7A 4FJYA 2A94A 1J99A 3ZLTA 1ACLA 5EY5B 2A1UA 4CHGA 2Q5FA 3UAGA 4CGYA 2R7MA 3CV3A 3O4RA 1J0AA 1QJCA 4EFMA 2IO2C 1KS2A 3ZNPA 1ATIA 3V4RA 2C5AA 3NGMA 3P2OA 4M8IA 3O4HA 1JWFA 1L1RA 3D9IA 4UOEA 2CCKA 4DLQA 1KTIA 1FDUA 4E2YA 4D6YA 1ZMXA 1F0KA 5BQ3A 1E3IA 1T5HX 3R8CA 5K20A 4ZCRA 5C4IA 4MS1A 2I6HA 4LOLA 4ALLA 1ZHOA 121PA 3KSLA 3JQGA 3OCZA 3ZBTA 5DSXA 1V7ZA 5JRJA 3HFSA 1P74A 2YWEA 5COBA 3CUTA 2FRXA 5KKCA 2HEIA 3W9YA 3DB1A 3KPUA 5FTWA 4EVQA 2FGJA 3JD4A 5A4IS 1KMHA 1X7WA 3A70A 1AUXA 1A9XB 5EIHA 1E99A 5AJUA 4WXPA 5BV2P 1ZI9A 2PZLA 3DVAA 5D6OA 4IXDA 3EVAA 1U2PA 5CFRA 2JD1A 2HF7A 3I4RB 1X70A 2B5OA 1W59A 4ESOA 4TPKA 1T2AA 2O9JA 1UFVA 4ZAVA 3FM9A 4D0SA 3EF1A 2QGFA 4AP9A 2L19A 2I91A 1O95D 1J8QA 3WL7A 4MYDA 2NXJA 4HDSA 3NRBA 1R8JA 2BMJA 3BOSA 1U1FA 2Y1GA 1PV2A 1E1CB 1UM9A 2WNSA 4OXXA 3MB5A 2OBYA 1NDHA 3UEOA 4OA5A 4IHKA 1QTNA 4AS3A 4PFQA 2VT7A 3U4QB 1D2RA 3M3DA 3FUJA 2QTMA 2G9QA 3HCCA 2G67A 2O0HA 3B51X 5GJVC 1XNJA 5KINB 3I0MA 1UBOS 3IDFA 1DTEA 3ICVA 4X1KB 4IMJB 3WIOA 1TQ2A 4RZ2A 2AZ4A 3AMVA 2BE7A 4H1TA 4Z4FA 2PSDA 1RRCA 3QX9A 4Y2PA 4BV9A 3HGQA 4MMZB 1K3ZD 2I4TA 4Q9NA 4YMUA 1XP8A 1KVSA 3HNRA 1YA8A 1NUAA 1QP7A 1NW4A 2VGEA 1LD3A 3CW2A 2ZB8A 2J3LA 5LZ5A 2ZREA 3GPLA 4C5BA 1QF7A 1BA3A 4JJIA 2P7HA 1E5TA 4TXQA 4GPMA 4C6TB 1UM8A 4D26A 2HQSA 5AVZA 3ZQ6A 5C1OA 1JBQA 1ST2A 1JJBA 5ER9A 2XS1A 2I03A 1E60A 4NAHA 1O6ZA 1YBAA 4JBLA 4PIVA 2DPGA 3OCVA 4LRQA 4F96A 2J6IA 4ESHA 1GXSA 3BE4A 3ZE1B 1ETUA 2I2WA 4F71A 2Q6OA 1IUNA 3KQKA 1CR1A 1ZGHA 1A5ZA 4BNXA 4FILA 4L0MA 1XTIA 2YHBA 4GI2A 2ZEJA 4BVLA 2VGYA 5HKKA 1WTAA 5DBOA 1RVDA 2YV5A 4FWBA 3U61B 4FADA 1R50A 4MZXA 5DTQA 2Q7OE 4TZTA 1JA9A 1VJ5A 1TM1E 5KAMA 3KXDA 3WBFA 2GDZA 3SSMA 3A3PA 1T9DA 1ISGA 3E8XA 3OPYB 4U8HA 3RS7A 4OV6B 4PG8A 4KDFA 5G04J 1XVIA 2FSIA 3P1JA 3OKFA 4ZTZB 2P4SA 3V3KA 1C3LA 3MAJA 3WHLA 5CB4F 1GEEA 2B69A 4B6GA 1QKKA 2O07A 2GF2A 5HF9A 3OZTA 3DF9A 1XEXA 4NQ0A 3Q3EA 5K05A 3EODA 1TK9A 5IJXA 4E2ZA 2OHOA 1MXFA 4JKOA 1S4MA 4LWQA 1U3WA 3OIGA 1OA1A 4H0FA 4JLUA 2YIDA 1JLHA 1Z16A 1PZMA 1T4CA 4N9QA 1XRJA 4DQDA 1T4GA 4HWPA 3OX3A 1M75A 4JYCA 1G1MA 2WJYA 1E8WA 2A1TR 2AW6A 2JAOA 4HKTA 5BYJA 1U2DC 5IU6A 3M6XA 4WN3A 3OIDA 4TLBA 4EY4A 3I4GA 1BLXB 1RZRD 2PUEA 1LS1A 4K0RA 4YJ3B 5AOVA 1IK4A 2ZBPA 1IULA 3CLTD 1H1TA 1NRXA 1FJXA 4OXIA 3KJXA 5CJJA 3NIWA 3FNIA 1REQB 2IOLA 2I3BA 3HK2A 3AHIA 2WLSA 2X3FA 2POQX 3CCFA 1XZCA 1TECE 2OILA 1JHAA 4MI9A 4D4JA 3GMDA 4F72A 2Q8QA 2Y92A 1WY6A 1UN9A 4Z8YA 1LWNA 1M2OA 1ODIA 4JITA 5ICSA 5A62A 1BXZA 1SRRA 4QD3A 1VMAA 3NATA 3U40A 2X1HA 2RFAA 5K0JA 1JECA 2VZ8A 1ULSA 4YROA 1TKBA 2ZR8A 1HG0A 4YMSA 1KT0A 4AICA 4X6LA 3AUXA 5JPCA 4JU9A 2QROA 2I4NA 3KT8A 1XN4A 1VPWA 5CT8A 3P52A 3BAZA 2CXXA 2G28A 4O29A 3Q7RA 1W85B 3TQHA 2ZAYA 3R23A 5KHLB 2UUOA 2PT5A 2BUGA 3ZWYA 4JGBA 1VRCA 3M6FA 4MQLA 2O5RA 2XPZA 1QFJA 4WA8A 3RTCA 3AVWA 2ECFA 2Q1YA 4EKNB 2A9RA 2C98A 3QMWA 1IQPA 3L0BA 4KIWA 3MKRA 3B2NA 1YSCA 1GQQA 5I7AA 1ZYUA 3U60B 4D96A 5LB2A 4RCYA 2F1HA 4LUNU 4IDAA 2XGMA 3HYSA 1FTQA 2O8CA 5B3KA 1FJHA 1H6PA 4TRMA 4E4YA 4YHBA 5AFSA 1ENZA 1KYWA 4I14A 2A5LA 3E22A 1MNQA 1VSBA 4EI7A 1U9IC 1UKCA 2E1RA 1RM4A 4AZWA 4AQ7A 5ENRD 1MBZA 3ZU7B 4I2ZA 3AG6A 4MGYR 2YBEA 4N0MA 3P9YA 3MS2A 2OHHA 4OLBA 3L7LA 2C9MA 4TV9F 4P7FA 10MHA 2XVXA 2BFNA 4GI3A 1SC4A 1DDGA 1WX1A 2WJHA 4BKPA 2IWHA 2QG4A 4XQEA 1QZZA 3I1JA 5K0EA 3PCRB 3W3AA 3TI7A 4YJHB 3E2IA 2CN1A 3FHEA 2CD7A 4U95D 2VHQA 1WCV1 2WXFA 3QARA 2W6ZA 4YA6A 1LPOA 3TSAA 1KZ4A 3OIUA 4N48A 1G8FA 2ETAA 4UWLA 1OD6A 4OATA 1C0PA 4D9IA 2JGMA 3OC6A 4L6AA 3VSDA 3AEKA 4PEVA 3ICQB 1SZ9A 4MQFB 3TJZA 5CHEA 4ZEOA 1UKBA 4E21A 5HQ8A 3QP9A 1B6GA 3JWGA 4N8DA 3N58A 4QTXA 3BRQA 5EUQB 4NNOA 4H7FA 4FHZA 4MQMA 4WVFA 1GG8A 3OQIA 4YK7A 5CAEA 4MUMA 3L82A 5C18A 4MLCA 4MRAA 5K8JB 3BXPA 4Q37A 2WQZA 5DHSA 2WVHA 3CMCO 3EXFB 2G80A 2ZRAA 3PPIA 4Y3UA 1BFKA 5K0GA 4EVRA 2POCA 3P0RA 2PMWB 3ZJYA 2NUPA 1QBQA 3H7AA 1NT4A 5AJWA 3PHBE 2W37A 1QGUB 3QFCA 1E6UA 1JWGA 3WR5A 4XD2A 3I5AA 4D74A 1CB7A 1AUOA 5B7GA 1VLLA 1XZJA 5ES4B 2OV6A 2WJZB 3EW9A 3ZU2A 4KFCA 4ZD6A 1MX6A 2JAHA 4ZXPA 2CBZA 2P9CA 3BKXA 3O9VA 2HMAA 4D0RA 3AX6A 3PC4A 2JZNA 1XD8A 2NU8A 1NYTA 3M9WA 2QAIA 2PT9A 2B1QA 3UGKA 5CXQA 2GRRB 3H9GA 5CB8A 1YO6A 3L0PA 4E88A 2VKQA 3SS9X 3QUQA 4QZVA 4Q6WA 3HKEB 3CS3A 5LKAA 3JWIA 4HMQA 2G63A 3S44A 3A9SA 3U7QA 5KTPA 4W5JA 5I9MA 2YJ5A 3MPUA 3EARA 4CU2A 1Z5OA 2C8KA 2WE8A 2C5FA 1IPHA 1T3HA 4ZALA 1MYOA 4LXUA 1QV6A 2FR1A 4OTZA 4GLJA 5GV8A 3QELA 1O95A 4V1CB 2IW1A 5EYLA 2F62A 4YRCA 4P32A 2IQ5A 2X1LA 4ZMBA 5G1OA 1DOAA 3RYIA 1USIA 2PEZA 1FQKA 5C2YA 1PGQA 5FBZA 1WU7A 4KPYA 3QVKA 3PTZA 1Y6QA 4DZTA 5B1IA 3E7DA 2BKAA 1Z2NX 2EL9A 1S3GA 5KNLA 2YW2A 3C7CB 2IIPA 1K66A 4G4IA 1TYCA 1OT5A 1KJWA 5JZMA 3TW4A 2FG7C 4LV6A 2O8FA 2J5QA 4UFOA 1GDTA 5C1IA 1L5VA 3NIDB 4O4IF 2C2KA 3UCXA 2B4KA 4RTQA 4IZ6A 4A91A 5L9AA 2AJTA 2ODTX 4HVBA 3RS4A 1LK5A 1XXLA 4JI5B 2CWDA 1EVKA 5I7SA 4YP7A 1RQ2A 1V7QA 2G77B 1VCMA 1GUAA 3X43A 3D2CA 3CLHA 4JHXA 1TCUA 3QQPA 3CR8A 3JYOA 1EIWA 2ADMA 5E7QA 1KHTA 2VIIA 5CDFE 2PKEA 4BNIA 4B76A 4C2BA 1G41A 1NHWA 2P8JA 3UT8A 3ESCA 3T1VA 5IH7A 4ZVLA 4U1RA 1A9ZA 4Q24A 3LZDA 3RAUA 1L5MA 4MOWA 2NTNA 2GJ9A 4F84A 5F2NA 3TS1A 1EYZA 1DCQA 3WNZA 4DZRA 3Q8LA 4UHJA 1RP1A 1UXKA 1X8XA 4YPOA 2P9SG 4WXHA 3D1VA 4NJOA 5CIWA 3RKUA 3OZFA 1OH7A 4YV0A 1M34B 2VA9A 4PS0A 2EX1A 1EX7A 4HDNB 1NPYA 4OQXA 3EDTB 2Y0EA 4QUHA 4DBZA 3M4NA 3PC8A 4XEUA 3HL0A 3IAS6 1RKBA 1VIDA 3R77A 4K6FA 4C7XA 1Z6AA 2PKQP 1JQ5A 4IIYA 3R9IA 1U0JA 1P1JA 5TJ9A 3HJBA 4NG4A 1UBLS 1NC3A 3IQDB 3A2KA 3TEJA 2PQ0A 3T3OA 2X6FA 1MN6A 1BC5A 2I0FA 2AOVA 2CUKA 5J4KA 1XHFA 2JG3A 1TT7A 4C01A 2C1EA 3C43A 1A5AB 2A88A 3ZCQA 3SXUA 2AJAA 2GJ4A 2JBWA 1MF7A 3KELA 3WFJA 3ELUA 1RZRA 3IEKA 1UAAA 5CT6A 1FMFA 1DAGA 1W94A 1UDXA 4NRHB 1DRKA 5KNDH 2RAFA 3WMEA 1U99A 2QX8A 3PXXA 3WGQA 4CEJA 2R1VB 3GPCA 3C3BA 2DH6A 4K3UA 2PHZA 1QMGA 2BLLA 4HP8A 4WZBE 3BXEA 2X7JA 4EKGA 1NM5A 4RGYA 3GCZA 1ZSVA 5IDXA 2X58A 3WOHA 2FZ4A 5HGXA 2XDYA 1L1QA 2PX2A 1W9MA 4C6HA 1G8KA 1SA0B 1U28C 3E23A 2QM0A 2JH9A 4G2NA 5LQKA 3SX2A 4DLLA 1XLUA 1Q1BA 2WTUA 3IUPA 3FPAA 4Q7QA 3H04A 2IY9A 3HGMA 1L4GA 2O2IA 1JDSA 2P6OA 3L0DA 2Z3VA 1JYSA 1PFUA 3GJYA 2HT6A 1E7RA 5CCDA 2AXPA 4DV0B 4W1QA 3E34A 3SU8A 2D2FA 3H1EA 1JZQA 1WV0A 4LV8B 2SCUA 2D62A 3KZ1E 4XA8A 4WAUA 1ESCA 1AO0A 4YONB 3UPTA 1IY9A 3FDZB 2YDYA 2NYRA 2HEGA 3F3MA 1TZBA 4FLEA 2CNWD 1A71A 4RTNA 4PYQA 1F2DA 5IAJA 1NV8A 4JNCA 1VLVA 1H93A 1R0BA 3W04A 3C70A 5HFAA 2WTBA 1XNRB 2OQIA 4JL6A 2DXIA 1UCFA 3NTUA 4D82A 4U7TB 4HMOA 4ER0A 4BNKA 1OBFO 1XFAA 2ZR9A 4MKGA 3TFOA 3ZD6A 4QXPA 3AY0A 4X1IB 3R3SA 3ZWKA 2R6FA 2ZB3A 4FFSA 4TUYF 3L4BA 3DKKA 3OFSA 3ETDA 4M6WB 3GLHB 2IO3C 3DB2A 5LLTA 3OP4A 5FBLB 5EWLA 2PSEA 3GGOA 3IQHX 3SHQA 4GX0A 2C5SA 2VCEA 1IBLB 3ZWMA 3F2IA 1V3TA 3TJRA 1I1HA 4KUGA 3P9NA 2JFPA 4MVXA 4EDHA 2P9HA 1NR5A 1JLRA 3T99A 4IGIA 1AJEA 3BL6A 4QU0A 4FMBB 4RM3A 4LYFA 5DGIA 1QHSA 4TLLB 1SKUA 1N52A 2OC4A 4IIJA 4FX2A 4RYLA 2AKAB 2EBWA 5KZMB 3SX4A 5HJ5A 1NBME 3CFYA 1XEFA 4EBFA 2UUBB 1WCIB 1J1ZA 5TNXA 1XDUA 1HT0A 4Q7MB 3N0TA 3BHMA 3N2KA 1Z0ZA 2JFWA 2M6LA 3KR9A 3GIWA 1FW6A 1RAFA 2LNIA 5BMVF 1YJCA 1SOVA 2PIAA 5ALJA 5FLEX 4DMCA 2AVPA 1KEKA 4ID9A 3SO8A 1PG0A 3A2LA 5AVRA 5C5CA 4NJMB 4E2WA 6ABPA 1EUDA 4UD2A 3GUCA 4RBNA 4OMFG 4B82A 1E63A 4LGYA 4URXR 3JD1A 2VHWA 4D80A 5C7OO 3PZBA 2IDMA 2AD5A 4NJEA 1O2DA 3TFWA 3G0IA 3R7NA 5ITZA 4ZQGA 5LQJA 2XYVA 1TGVA 3JUEA 5GOTA 1UZUA 3AFGA 4PZPA 4C9BA 4S2UA 4LOKA 2QXUA 1O6CA 4F4JA 5FR1A 2R8BA 2GTPA 5JS2A 3D6NB 4QQNA 2Q5JA 3AU9A 2OL4A 5H4GA 1JZTA 2PTGA 4PN7A 3BWMA 2OPHA 1GPDG 4URKA 1G2QA 1IN5A 1L5YA 1K9SA 4DLKA 3AESA 1VLHA 4GZ3A 2D4AA 3R7FA 4ZN6A 3EXIA 4LRZA 1NQXA 1SCAA 4TRJA 2HK6A 3OSZA 3BFXA 4H4DA 1SW6A 3IAFA 3P2YA 4QODA 3TWOA 2PT7A 1LBHA 4M3NA 1MP0A 2BR4A 4YJGA 4RJIA 2QDXA 3ACCA 3ITNA 4ENUA 5AVXA 3B13B 1EVLA 1AE1A 2XUQA 2QRVA 1KJ8A 5SYNA 4OQLA 4XD7A 2PUFA 4KXUA 4CF4A 1UBMS 3CF2A 3M5PA 4BFTA 2V8BA 4C4RA 4C6SA 4IQFA 1BCRB 2FR0A 1ZK3A 3FTNA 1OYYA 4DR5B 3L7DA 1IL0A 3UWSA 1GRVA 1H4VB 2Y66A 2BTOA 4CJXA 3KOWA 2J1LA 4Q96A 1M6EX 4C4YA 3L0ZA 1P62B 1S4QA 4BNGA 4BT8A 2XMDA 4M36A 1RWOA 3UWOA 4EJSC 2V6FA 4AZTA 1E4EB 3HJHA 4IKOA 2BZ0A 3PE4A 4TUYB 4AI6A 1JXMA 5A5DA 4GA2A 4RD6A 4O1HA 2JCBA 3LKBA 1PW5A 1J8DA 3Q7FA 2FWPA 1RI3A 4PNHA 3TTVA 3TXNA 5KTMA 3ANNA 1YCFA 1OH8A 2BISA 2OCCE 3DUFA 5BPFA 5JFTA 1OLXA 1JTEA 4O2LA 1MB9A 3Q3GE 4R01A 3GG2A 5ICFA 2NU9B 3W5SA 5A71A 5JQGF 5JS1A 2N47A 3OAWA 5AK0A 1YZLA 4G63A 3A31A 2WQHA 5A2QA 4YR7A 3B7TA 1U0HC 3VJLA 1I9GA 3HCAA 4BWGA 4RKYA 4DLRA 3I34X 3RADC 1LXCA 4U5XA 4J0EA 2BMAA 3N6RA 4P3OA 3ZEFA 2NVWA 4JT4A 2I76A 1QYRA 4B84A 1X39A 4BY9E 4KB5A 3HL4A 2GCOB 1PN3A 3FOAA 3D6VA 1TNZA 3AHJA 3VBEA 1JXAA 3ED5A 3G49A 3V8BA 5KYYA 3KVOA 4DSTA 1H8ED 1BHO1 2HAEA 2J9FB 3JYQA 1ZZEA 4GSLA 3T9KA 2UV8A 4PG7A 2B8WA 4JYZA 3PL1A 2IY0C 3CH6A 3GJZA 3H16A 1H6KA 2HXYA 5E7IA 1GQSA 3KXPA 3GDWA 2X3UA 2VDQB 1G5RA 4L73A 2VNSA 3PNOA 4Q3DA 3T95A 1JJIA 3O75A 4LNGA 5FULA 1MQ8B 4B4KA 2X6TA 4KMSA 3LL7A 3NMUF 2BF7A 3HUTA 2ZG6A 1ZINA 3B8HA 3S2SA 3IUJA 1K5GA 2WT9A 3OF5A 3ZY5A 3PLAE 1AF7A 3ZE6A 4PONA 1L5LA 4J2OA 3U66A 4RQBA 4ZVRA 4YT4A 2ZWAA 1DXOA 4OHBA 1IY0A 4C1NA 5G04C 3EEYA 2EHJA 4DR3B 1TYBE 2O5EA 2ZRIA 3OLQA 4U2GA 4HNHA 1O1YA 1U3VA 2Z0MA 4WNAB 4MB2A 1UMBA 2M1XA 4HS4A 1G3QA 1O03A 1ICIA 4XFDA 1KH2A 1OX4B 4KACA 2A7QA 3QVGB 3AVPA 1A2OA 4HDKB 4CNQA 1U9CA 3FMIA 3MEQA 4ZMRA 5BN3B 4Q3KA 2IFTA 4PX5A 1QMPA 4DJJA 4ZZ0A 3OD1A 1NVGA 4UHBA 3BEOA 4NMMA 5AI9A 2YWBA 4WINA 1O6FA 5C51B 1XU7A 3DDCA 3DM5A 7MDHA 2JFQA 2HADA 3TDMA 5EIOA 2ZLBA 2A5DA 5JLJA 1RQXA 2F37A 1PUIA 2FW1A 4M2LA 1E4YA 3OI7A 5I45A 5JVDF 4RV9A 1P8AA 3CH7A 4BNLA 2BAGA 2BEVB 3DL4A 5HRCA 1H9BA 4OG2A 3ASGA 3NKVA 3NWOA 2HQOA 4QUGA 4C78A 1CE8A 1ONNA 3DEIA 1Z4JA 4OHRA 2VJKA 1ZGAA 3B1VA 3RVBA 5K45A 3UIEA 1HZZA 4JW1A 2RONA 3MMSA 4GX2A 4AKEA 1L4UA 5ALQA 1LLQA 3KQLA 2QBYB 2FF4A 3A3YA 1ICEA 4G0MA 4EQ6A 3NWBA 4YI5A 3G2LA 3PD0A 1TJCA 2JGEA 1ZH4A 5E9WA 1ONPA 1NI3A 3WLFA 3DT8A 4ZT6A 1PJ3A 2OLJA 1MOQA 3AWIA 1CJKC 4DQVA 1Q7CA 3RG8A 3FGNA 1DMRA 4LDNA 5EG5A 2C4MA 4CEIB 1XZMA 1YRHA 3ZUVB 2XMCA 3RRXA 3O31A 1PF7E 2J9GA 2JGJA 4C1BA 2P11A 3CJRA 2EWVA 5TSDA 2ZSJA 2QLJA 4AEZC 3QVTA 3PXGA 5IUKC 2BCGY 3NBQA 2OTCA 1LS6A 4B6OA 2Z08A 3UA3A 1YFLA 1GVNB 1MIOB 2JJQA 2B8EA 3LX6A 4F8YA 2W8BA 1ULTA 3CK7A 3OIVA 2QMUA 3V97A 4OQEA 1CW2B 1SM4A 2H7VA 2PUCA 2OO7A 1JG1A 3FUTA 3H1PA 1B2RA 3HJUA 1U8XX 3GMTA 3TQTA 3L1JA 3M2PA 3MJEA 1KWKA 3SD7A 3A1WA 3B6EA 3CMMA 1OWPA 2AG0A 5LP1A 3H1TA 1TNUA 4ZYLA 3B60A 1P5ZB 2AW5A 3DBHA 3RTBA 4C3ZA 1R2QA 2MMGA 1JXOA 2NZUG 2RHWA 4ENPA 3CLUD 4CMIB 2M9MA 3CQCB 4DG8A 1VA5A 3FPLA 4QDJA 1GVHA 3INTA 4KNVA 4BKOA 1AT1A 2X8LA 3BF8A 5IJWA 4JHKA 1RYFA 1VC2A 3VSCA 3D4OA 4YYEA 1X1SA 2FZVA 2OFWA 2ILTA 4MDYA 3QKIA 2ARKA 2YZGA 3VPFA 4A4DA 4PLWA 4I50A 5F52A 4DLBA 3IMFA 4QT0A 3MJRA 2EX4A 1N0RA 2C92A 3PDNA 4GTVA 1BDIA 2AN5A 3RKRA 3VR6D 3S8EA 4ZEXA 3WLPA 2JFUA 1E59A 1RRMA 1WUHS 3LV8A 3DXYA 1VYVA 1C2TA 1U2TA 3C5VA 5F2KA 1EE1A 1M2HA 1V6CA 5DHQA 4TROA 4PSDA 3MCAA 2V6MA 4KE8A 3I9FA 1UJMA 1LV8A 3EMVA 3CIFA 1I2CA 3AVQA 3A28A 1MB3A 2EZ8A 2XTMA 5B5SA 3C1OA 2OP0A 4Y98A 3PQ7A 4B3JA 2Q1SA 3AINA 1T5LA 2H63A 2IEAA 1SWVA 1S0UA 3LUDA 1A4XA 1T8TA 4B3SB 3ECCA 4B4UA 2RKBA 4ND8B 3AR4A 5LL6P 2W6ID 1R0ZA 1DCTA 3PENA 2I1KA 1PWEA 3I52A 1FTNA 4M7OA 3OX4A 4EJ2A 4B9AA 3EVNA 4G5FA 2XA9A 1XD9A 5JVDB 4C0AC 2XWPA 4XWYA 3HA2A 5KYTA 1H9AA 3EFEA 3HXPA 4URHA 4CTOA 3E7FA 5LD2B 4G0ZA 2R65A 2JBHA 4H1HA 5DTJA 2DULA 3KT3A 2OXRA 1EVYA 4YCNA 2WXLA 5DHTA 3QLUA 2V7TA 1V1MA 2ZJ4A 4X54A 1YULA 1HFAA 3L05A 4RGQA 2VN8A 4XTRA 3EGIA 3CGWA 1H3FA 2WAOA 2YTZA 3G9UA 4HWRA 1B8UA 2C4WA 1TZJA 3KD7A 2VYFA 3ZHSA 3TLXA 2IF2A 1PWYE 4RIHA 4OVKA 1T13A 1ZUNB 5CTJA 4YQEA 2P3QA 4AG6A 4UMEA 5K8CA 3UC5A 5T41A 4BE9A 5KDLA 2IE0A 3RSSA 4X91A 2QUKA 1YFJA 4HRLA 4RPKA 1NJ1A 1GZ5A 1A9YA 4F5WA 3RAEC 1GPNA 3TYXA 5FTKA 2B8NA 3IUMA 3ZZ1A 1YL7A 4RKWA 5CDYA 3OO0A 3DFZA 1LWOA 1P5HA 2RH9B 2AXEA 2Q6TA 2J3HA 4GA1A 2ZJAA 1NXOA 3SHVA 1UIMA 3Q2IA 2Z9BA 3ETLA 1UPXA 4DOMA 5DBIA 1ZCBA 2R96A 2WYHA 3TTXA 2JHPA 2NZWA 3TCXB 5IAGA 2NLOA 2PLAA 4P4NA 3OZSA 4EZJA 1BDJA 4J0HA 5H1YA 2QAGC 2W2KB 2H92A 2P27A 2PH5A 3LK7A 3ET4A 4PXAA 1W0KD 2ZB2A 2QMOA 4W7HA 1B8OA 4IIUA 3MA5A 1CVRA 3OT1B 3ISMC 3JRNA 4Y7CA 4WWNA 4H6XA 2EEPA 2MWMA 3UHFA 1H2BA 1OLUB 2GZ3A 4NCHA 5AW6A 3Q4GA 3PF8A 2VH5R 2RJ3A 4OGFA 3WK9A 2DQKA 2H4HA 2R7AA 4HQFA 4BLPA 3ZG6A 1QX4A 3JYSA 4JLDA 3EXHA 2H1SA 3IHTA 1H8EA 1NVFA 2Y3AA 1M0TA 1C3OB 4CDMA 2P0AA 3D5EA 1VE3A 4CTMA 3DSRA 4FIDA 1VKOA 3WGLA 3ROGA 4DMRA 3SD5A 1DJMA 2QX9A 1YFZA 5K51A 3QE2A 2QR2A 4ZOAA 2BTDA 1PQPA 1J39A 3SY2A 5IBQA 5HF8A 4DT1B 1FSZA 4FBLA 4RV5A 3TXYA 3EGDB 5J58A 1TOAA 4LYGA 4GEGA 2Q4DA 5FINA 4QOIA 1L5WA 1LGYA 4TL8A 2BM9A 2ZRDA 3RHZA 3K9BA 1QGAA 4C06A 5AM3A 3ZYKA 3EJ6A 4GKJB 2PGXA 2YINC 4WASA 3LUBA 1SG9A 2XNKA 1M1YB 1Y7TA 3H2GA 3ZVNA 3L0OA 4B4DA 4AYWA 1U0GA 4QUDA 2OWEA 1S5PA 2HBRA 4XDYA 1XVUA 1KJIA 3I76A 1O1RA 3ZK9A 1UMDA 2PZBA 3D9QX 4ABTA 4OSEA 4L8WB 4OQFA 3ABQB 3G5TA 3M1YA 3L4JA 1L3IA 2E82A 1IOVA 1N5MA 4JI6B 1OAKA 4YDEA 2X6KA 5C8YA 3NCHA 5AXCA 1P0QA 4OAUC 1FPPA 1NG1A 3W4IA 3PQ4A 2YWXA 4WK2B 1G7TA 1V6AA 1SBTA 2FMHA 1DBWA 5FA6A 4C7OB 3RB8A 4G5RA 1GRNA 3AW8A 2HU2A 1VG1A 2BMFA 1UT8A 1JVNA 2PRJA 3RVMA 1R9GA 2JRCA 3GLGE 4U00A 3PEFA 3PE6A 2UUCB 3N8IA 1TJ3A 3FYUC 3BERA 4DR1B 4PDXA 4S1OA 3V2IA 3R24A 1WP4A 2OHXA 3O8QB 5KVAA 1QP0A 3REGA 4G41A 4CVNA 3TB4A 2YNMD 4G8KA 3T61A 1PLLA 5JARA 1QQ6A 3GD7A 4OBEA 3LDGA 1WZEA 4AX4A 5FI1B 3RS9A 1PJ4A 3KR2A 3PGA1 3ABOB 4MQ5A 1WW3A 3NT5A 2I6GA 3DNMA 4BBAA 2O2ZA 5DISB 4B3CA 4LV5B 9MHTA 2OV1A 3HYLA 1H4TA 3KC2A 2CFOA 1QCYA 1VB5A 1ZB1A 4KQIA 4QJ4A 3UQYS 5ENPD 5T3RA 4ZO6A 1KA9H 4XKBA 3IMEA 5DHAA 5EYPB 3VR4H 4XVHA 2QR3A 1UW4B 4LRWA 4KPUA 3NTRA 1M7BA 3FSEA 4DLTA 4C76A 1I2BA 4UCWA 5SICE 2NUAB 5CFNA 3U3ZA 5JH7A 4P4UA 4GE0A 3UK6A 5AVYA 2PUWA 4JYBA 4JB0A 4UBLA 1MU0A 1R0YA 4E5NA 1A69A 4W1SA 1QCCA 1H9CA 1AKRA 1E32A 1A96A 3CRQA 3GUVA 4F86A 5D1NA 4P93A 3TMYA 2LNDA 3QEAZ 2ATCA 3JQ8A 1DFIA 1OBCA 2IYPA 3F67A 2HO1A 3THXA 5EXPA 5AVVA 2VJQA 3DE6X 1XQ1A 3LUKA 1AV6A 3UM3A 4ZQBA 4BX3A 1HNWB 2CK3A 2WXOA 5K3BA 3D9NA 5EGSA 4ZI7A 1IWPB 3GNQA 4HEA1 2H9YA 3Q15C 4OP1A 3AUSA 2GA8A 3JXEA 3GRZA 3C3WA 2OAQ1 3R7WB 1Y3HA 2W6MA 4BAUA 3B5JA 3MWYW 4EABA 4A10A 3A4IA 3CEAA 4QXRA 3OFND 2OR3A 4HH1A 4JLMA 4O2BF 1P61B 3IMGA 4KRXA 4O5AA 5LNK1 4FGWA 4QGHA 1RIFA 3VDRA 1GTJ1 2NVUB 4MDHA 5GONB 1QIHA 2EF1A 5HDQA 4QX6A 2PM8A 2ZQZA 4OI1A 3FHTA 4MHSA 2IOFA 3H4VA 1UJCA 1EESA 3UKDA 4R1NA 4QWWA 1J6UA 4C6RA 1H6AA 2UY1A 4XUGB 3MT7A 2MRIA 4ZANA 2XJ9A 3AUYA 3B9PA 3HCPA 3AG3E 1J1IA 3OF2A 1RHRA 3NBAA 3I6BA 3K6RA 3D2LA 1QLJA 4FK8A 3ZHQA 4AQDA 4ZPXA 3SAJA 2BPOA 3CT4A 2NO0A 2B37A 3VR6A 2R7LA 2EU8A 1D8AA 4K9KA 5FTLA 4DHWA 4W5HA 2PL3A 3O21A 4JQZA 1Q83A 1AHHA 3NOCD 3D7NA 1VHJA 2I3DA 1X94A 1X3LA 3VO2A 4WESA 5CITA 2F8SA 1NXTA 3WQSB 3OUTA 1Y4SA 1DCKA 4JBHA 1V47A 1MABB 1MCZA 2QZSA 1QB7A 1N8KA 2QTTA 3H9QA 1UG3A 5FUMA 4WY2A 1KFBB 2PKQO 3DFFA 3EGWA 3HYCA 1ZISA 3DDOA 3ZWXA 1SEVA 3DMTC 4R7GA 2ZUUA 4WN9B 1L7MA 4E15A 3ELWA 1GUZA 3SIRA 1HG1A 3GT4A 2W6IA 2Z09A 4RJJA 8GPBA 3H2KA 4F4DA 1Z5VA 4YJFB 5KTNA 1DWPA 2V7UA 4BZQA 4F2DA 3WGHA 2DSTA 5CDUA 1YL5A 1A72A 3DXFA 1E1QD 4BQPA 1WUIS 5PNTA 4Y6QA 1QYCA 4Y30A 3P2KA 4EZEA 2D5CA 1Y9ZA 3VI3B 2O3TA 3MTJA 1SD2A 2BMEA 1CIJA 3OX1A 3LXRA 1H0SA 1RXWA 3FU6A 1Q0SA 3F7OA 1TA9A 3WP1B 5F98A 2NT4A 4BBJA 2IHBA 3U0VA 3DDHA 1Y37A 5C0OE 1YF3A 3F5FA 4WNDA 1J70A 3WJ7A 4P98A 1T1EA 3K70C 4MS4A 1GKUB 1IMOA 1KKMA 3TO5A 1I3OA 1R8XA 1FVXA 1EPUA 2B5WA 2AWNA 3CN9A 3W2IA 3F6EX 4TOIA 1QHEA 2AQIA 3LX5A 2MHKA 3PB3A 4PU0A 5B1YA 3MS7A 4DMUB 4AM9A 3IURA 1WSBA 3BQNB 3VNUA 4CLOA 3OOSA 2V5QC 3KVNA 4FONA 2ZROA 1J20A 1GNVA 1WW8A 1NZNA 1VMIA 1Y9DA 4PTYA 1TXGA 3UN1A 6PFKA 3RE1A 1IIBA 3AILA 4UWHA 1AF4A 2LW7A 3BVPA 3VXKA 1Y8QB 3G7SA 1S89A 1KQOA 5DE3A 3E32A 1Z4QA 2NV0A 2OKCA 3UAOA 1V26A 3N0RA 1T5SA 4MKTA 1KZYC 2CT8A 2CBXA 3R0JA 2UWJG 1WMDA 4FKZA 3SVZA 1BYUA 1VI2A 3WYEA 4G5GA 4TTQA 3TUIC 2R2GA 1WM5A 4FUQA 1B6TA 1NYRA 3TW8B 4S04A 2O8BB 1W0KA 3H8SA 4BFUA 2G1JA 1OGYA 5T3YA 3BUSA 2Q62A 3U7FB 3RT1A 4U9IS 2WKQA 2BEWA 4Q34A 4R7TA 1JDZA 2VGXB 3T34A 1IPEA 3I5MA 1H94A 4YR9A 4MTCA 2F8LA 1CUHA 5D86A 1E6CA 4HYQA 1JMVA 4PPNA 4FYJA 3T7DA 1SZPA 3TQRA 5GOZA 1DEAA 1SHKA 2ATEA 4Z3KA 4AX8A 1UJ5A 1AGNA 4B0OA 4PBRA