4MLPA

Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
492
structure length
492
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Cryptochrome-2
total genus 179
structure length 492
sequence length 492
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4mlpA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4mlpA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mlpA01
3RFFA 2V0GA 4H3SA 1M8KA 4PBTA 2QTRA 1VBMA 1TQ8A 2A88A 2CFOA 4BWVA 1NI5A 2HZ7A 3FIUA 3RK1A 3HFJA 4XFDA 2QUJA 1KQNA 3FNRA 1FYDA 1N2IA 4DNXA 5HUHA 3CLSC 1EFPA 3CLSD 3VU8A 1J1ZA 3UK2A 1QNFA 5EKDA 5LLTA 2PIDA 3LCJA 1DNPA 1J21A 4MW5A 3N8HA 2IELA 1LI7A 3SZ3A 1J09A 2A7XA 1WXEA 1CT9A 3RK0A 3FDXA 3HV0A 3QTTA 2R5WA 4ARIA 4ZT2A 4YMIA 2NSYA 4OUDB 5K0SA 4J75A 3UY4A 2XRZA 4K03A 2H2AA 1ZUNA 4RUKA 1MJHA 1ZH6A 3FOCA 1QTQA 1WQ3A 3H97A 4JYZA 2E0IA 1PFWA 3CA8A 4NAHA 2YXNA 2B7LA 4U7JA 2DXIA 1KP2A 1G59A 3S3TA 3G6KA 1NUPA 1WQ4A 3CVXA 1NURA 1OWPA 4MVCA 2DUMA 4MUFA 4ZCTA 3COZA 1H3FA 1VBNA 2X3FA 4MUHA 4ZT4A 5H16A 4EG4A 5JBNA 4JXZA 3PRHA 1WZ2A 1MOPA 2X1LA 3LE8A 3NBKA 2QUHA 4HPWA 5K0TA 4HJXA 3CLRD 2XRYA 2I1LA 1EFPB 1KH1A 2BTEA 2QJFA 4R2MA 1N2EA 1K92A 1MBZA 2AZXA 3IVXA 4JZYA 1I6MA 2PG3A 2DETA 4MWDA 2QUIA 4MLPA 4ZT7A 5FNZA 4F3RA 1G8HA 3HZRA 1MRZA 3C8ZA 3DV2A 2WB2A 2CT8A 1U3CA 3LOQA 1QJCA 2JAXA 4CT0A 4YP5A 1JIJA 4EG5A 4DDMA 4J76A 4EG8A 3KT8A 4E1AA 3FI0A 1U7XA 1R6UA 1VL2A 4I6EA 3SZGA 2D5BA 1WKBA 2GKSA 3SEQA 3F3MA 1OWNA 2H29A 4NZPA 3AL0C 2ZUFA 2QJTA 4MVXA 5IHXA 5TS2A 3D6UA 4ND7A 1MB2A 1WXHA 2TS1A 2CUZA 1WXFA 2HGZA 3IOEA 1GZUA 2A86A 5J59A 1WJGA 1O96A 4YP7A 1QU3A 3CVYA 1K4KA 2YWBA 3IUEA 1WY5A 3AKZA 1N2GA 3UC5A 1Q11A 1JZSA 3MUEA 3FHJA 3IUBA 2AKEA 4I6JA 3GMIA 3IODA 1IRXA 3JXEA 2A1UA 3IOBA 4AS1A 2Z3VA 1Q15A 1UFVA 1I2DA 2WSIA 3AG6A 1IVSA 3ZGZA 1J70A 3QE4A 1F7UA 1TYDE 2X0KA 3ZUGA 2NZ2A 4MW7A 1EFVB 4MUGA 2QTNA 4MUIA 3ZIUA 3KFLA 4EG1A 1A8HA 2ZP1A 3L92A 1N77A 4MW2A 2RE8A 3N05A 4WNYA 1ILEA 1QQTA 2A84A 4KKVA 3KT0A 1GAXA 4EFKA 5F23A 4PBSA 3Q12A 4XFJA 1COZA 3IMGA 2A1UB 3ZXSA 2GOYA 3CLUD 1V47A 4ND6A 4KPUB 5DEOA 3HL4A 4MW6A 4NATA 3OP1A 1IQUA 1O97C 1LI5A 3CVWA 1JECA 4A91A 1F9AA 2QJOA 3DPIA 2X1MA 5HG0A 3AFHA 3K9WA 3RJZA 3TQOA 1NUQA 1IQRA 4R2LA 1F4LA 1B6TA 4ZT3A 1NZJA 2D54A 3A05A 1JEEA 3DO8A 3KT3A 2J4DA 4QBTA 1J1UA 3H9CA 2PFSA 3CLRC 4G6ZA 1OWMA 2J5BA 2O5RA 1JIIA 3NBAA 1O0BA 1OWOA 3IH5A 3QTBA 1GTRA 1WXIA 1M1ZA 1N2HA 1KORA 2OQ2A 4MW1A 1GN8A 3IDFA 5LM3A 2IJGX 3TS1A 4UZEA 2GM3A 1N1DA 3IVCA 1M8JA 3CLUC 1H3NA 3P0JA 2EL7A 4EF6A 4TS1A 1Y42X 2CYBA 3ILVA 4OJMX 4R0NA 1NSYA 1O0CA 1N2BA 1OBCA 1O94D 4RPIA 1MB9A 4G5FA 1LW7A 5KHAA 3H05A 1PFYA 4DLPA 4ZCRA 4MW0A 3ND5A 2EJCA 4WSOA 1N2JA 4DE5A 5DB4A 3P0IA 4MW9A 4ZT6A 4ARCA 4MVWA 2WQ6A 4G5YA 1U0BB 3CVVA 1JMVA 1QRTA 1QRUA 1N78A 4S1OA 1QU2A 1X6VA 1J20A 1K4MA 2O8VA 4UZFA 3FETA 4GRIA 2BYTA 1PG0A 1YULA 1IH8A 2CV0A 3IVGA 3X1KA 1NP7A 2PXHA 1TEZA 2PZBA 3I05A 3SP1A 3TNJA 3ZJVA 3G5AA 3AG5A 1YI8A 4HJRA 1T9GR 3U1VA 1Q77A 1O95D 1O95C 1XNJA 3INNA 5FO0A 3N9IA 1JILA 1KR2A 1T6YA 1M8PA 4YP6A 4KR9A 1O5TA 1YUMA 1JGTA 3COVA 3P52A 1M83A 1EE1A 1JZQA 3GLVA 3IMEA 5TGTA 1V8FA 4NDAA 5KCMA 3UMVA 1KH2A 3DLAA 3SDBA 1IQ0A 4DDHA 2PZAA 1PG2A 1KH3A 1MAWA 1WXGA 1IFXA 3TQIA 1GLNA 3ISJA 3KT6A 4DJAA 1K97A 2VXOA 3PXUA 5BNZA 1NYLA 1YUNA 1ZJWA 4KR6A 4Q16A 1RQGA 2JA2A 2YY5A 5TEVA 4ZCQA 4FZJA 1H3EA 1GPMA 4L2IB 1ZH0A 3RBAA 5FO1A 2Z09A 1T9GS 1S4MA 1ULHA 2E21A 2J09A 4U63A 3COWA 4JXXA 1O97D 3CVUA 2ZUEA 3TZEA 2D13A 5HUJA 4HK4A 3ZJTA 1NUSA 4AQ7A 1I6LA 1N3LA 5AHWA 1PFUA 1TYBE 4MWEA 5H7XA 1TYCA 2CV2A 4NAUA 1O94C 1PFVA 4EG6A 1FFYA 2C5SA 3MLAA 3X1JA 3X1MA 1YIAA 4MUJA 1EJ2A 1VBKA 2CYAA 3ELBA 5DK4A 1KQOA 1F7VA 3FY4A 4EGAA 3H99A 3IOCA 4QRDA 1I6KA 3E27A 3HMQA 3H9BA 3FWKA 2PZ8A 2G36A 3L93A 1TFUA 1M8GA 1VLHA 1G8GA 2A1TS 1M8FA 1EXDA 3CR8A 4F4HA 1JEDA 1GTSA 4ZCSA 2A4MA 4MWCA 3TZLA 4ZCPA 4KR7A 1XNHA 2DR2A 4KPUA 2IP1A 1EUYA 5DASA 1EUQA 1U3DA 4L2IA 5IJXA 4JFAA 4MUKA 1KAQA 3P0HA 3Q4GA 4PBRA 2JANA 1X8XA 4MWBA 1G8FA 4EG3A 3CLTD 3MLBA 3AIIA 3A2KA 1JIKA 3NV7A 3M5WA 4QREA 4P2BA 4I6GA 2Z08A 1KAMA 2CSXA 2DEUA 1BS2A 1R6TA 1SURA 4CDNA 1JHDA 3IMCA 4MVYA 1H1TA 4NX2A 2RD2A 2DERA 5J58A 3ZJUA 1KKUA 1D2RA 3BL5A 4MQ6A 4U8HA 4YBRA 1NUUA 2OV4A 1OBHA 1T6XA 2E89A 3MXTA 4GU5A 2AG6A 1MC1A 1MAUA 1U7DA 3GUZA 1KP3A 3A04A 1Q19A 1WOYA 1N75A 2VTBA 5TEWA 1IHOA 1T6ZA 3G59A 1KQPA 4CDMA 3VRHA 2QTMA 2E18A 5J5AA 1N2OA 4Q93A 3Q10A 1EFVA 3PNBA 1O6BA 3CLTC 3D6VA 2WQ7A 4DDKA 4OUDA 4X0EA 2DLCX 3COYA 4EG7A 1QRSA 2YWCA 5KWVA 3HGMA 3RHSA 3K32A 3PNVA 3SYTA 3SEZA 3OTWA 4XSVA 2A1TR 4MW4A 1OWLA 2HMAA 3VGJA 1TYAE 3MMXA 5LFAA 3ZXIA 4MULA 3UOWA 3N2YA 2CV1A 1HYBA 3A4IA 1O96B 1YIDA 2DPLA 3ND7A 2CYCA 4ZT5A 1OD6A 1R6XA 1XNGA 1XJQA 3ND6A 1P7PA 2QUKA 4MUEA 4PY2A 4MUNA 3FG9A 2J07A 2VTBB 3FH0A 4MAFA 3PNYA 1NUTA 4CQNA 4K0RA 2J08A 2V0CA
chains in the Genus database with same CATH superfamily
3UTDA 2B8TA 4XAQA 4ZTBA 4QEKA 5JS2A 4E46A 4RHYA 1CUAA 5CDGA 3O3OB 2ILRA 3TAXA 1CF2O 2BY4A 5FUVA 2BVNA 2RARA 3P71T 2X22A 1OKKD 3QK0A 4CMEC 4B3IA 2Z30A 3SQDA 2QUJA 2QVCA 3L1VA 4JCOA 1X38A 3OTHA 2DWUA 1V1MA 4RVGA 4A36A 1P3Y1 4DLRA 3N0TA 1YOBA 3CLSD 4ILIA 3ACDA 1DELA 4YBZA 4KDFA 2GPAA 2WXGA 2R7AA 3LOPA 1F14A 2OUIA 4YAWA 1ZGHA 4JP2A 3J7AC 2Q4TA 1E3JA 3I1JA 3ZI0A 4S0ZA 1EFRA 4PTZA 2WVIA 1CZHA 2EKBA 5LMCA 1P62B 1MX1A 2RHCA 4Q37A 3REGA 3PCRB 2XGSA 1H0SA 2X6IA 1XTJA 4TWRA 3L82A 3TG8A 3G79A 3RODA 4W6QA 5JZVA 5C81A 2HU5A 1Y48E 3RUFA 3PGKA 2AE2A 3B85A 3L16A 3FKQA 2Y1FA 3GLKA 3C45A 4K40A 5TVGA 1RRMA 3FOCA 4CFYA 1KI7A 3O8NA 2OYRA 1I7DA 3VNVA 3EFBA 1PO7A 2C07A 1A8PA 1ZLXA 2PANA 1SPBS 3CH6A 3E5MA 3OSUA 3QF7A 3E3NA 3D4NA 3GAMA 5AI9A 2C96A 2AGVA 3CE6A 1F8FA 3RVDA 4YQYA 3HYRA 4C22A 3KQUA 2GZ1A 4FWBA 2FAXA 2DQ4A 1E60A 1TO2E 1Y34E 1WNTA 3SCZA 4QAQA 1E6EA 3TBHA 1Z63A 4QUDA 1PEAA 1V6CA 2X5KO 3U44B 2L18A 3UYLA 2AXUA 2C2OA 1AS3A 5DHFA 1I0LA 4JK3A 3FEYA 3CW8X 4EDFA 1N57A 2EGHA 2BF4A 4MYTA 1AXEA 3LQ2A 3RV3A 1NG1A 1UKYA 2DUMA 2X9VA 1Z0IA 3MBOA 3PGVA 3SIRA 2N47A 3TLYA 3KLOA 3LLSA 3WQBA 4XWAA 3AJAA 2FNAA 4DX2A 4M1SA 3FSGA 2BFFB 2HRCA 3CUSA 3RO7A 5JBNA 1V3VA 2ZJAA 4YDWA 1DP4A 1S7CA 5JAUA 2H1OA 3ZWCA 4S3MA 5GV7A 2DBVO 2ZBVA 2MSLA 2PXXA 3VVLA 3FTNA 3ROEA 4YHHB 2I1LA 2PX8A 4I5IA 4BY9E 3QLVA 4DQLA 4NBUA 5H7PA 1YVRA 4P33A 4R2MA 1RXWA 2XXAA 5JAHA 2CNNA 1G6HA 4QXOA 2J9FA 3N2GB 1M5UA 2PRKA 3ER6A 5JHBA 1DEOA 3IPAA 4ZC8A 3ZWDA 3UW3A 2YTZA 2Q45A 3NRBA 2M2IA 3LNCA 4ZPJA 1Z88A 2Q1XA 1F2VA 3IR6A 4BGEA 3HZRA 5JS7A 2C77A 5MGNA 5K09A 1CIJA 1K6JA 2YFYA 1GLVA 4HD8A 1DMRA 3M6FA 1QF7A 2GHQA 2VCHA 3PRYA 4B3CA 4RH0A 4BFYA 4BMXA 4O25A 4U0KA 4YP5A 5BMVB 4HXYA 5BPFA 2GCPA 3FCOA 4AYXA 2IS6A 5BSKA 2ZKIA 5LWHA 2PS3A 3J7TA 3TWVA 1XCBA 4FJZA 4KMRA 2GK6A 2UV8A 3KFXA 1Y3DE 1MG0A 2XNDD 3MSCA 4LHEA 4BEJA 4DG8A 4RWZA 2GKSA 4G5XA 3NTXA 3SEQA 1GM5A 4HWSA 1V39A 3BTVA 1E3WB 2D0DA 3CX6A 2MMCA 4KQGA 1LGYA 5IEJA 3ZDAA 2D3TA 3UAOA 2J59A 3O8OB 3PQ5A 5TS2A 4RSMA 1I1NA 1PD0A 1TZCA 2WFMA 3QA3E 4QJ4A 4N12A 5K6TA 4KBGA 1FP1D 2A30A 3KJGA 2A78A 5AJWA 3K70B 3D0KA 3CW2A 1AQYA 4Q47A 3EC2A 1LDYA 3RS9A 1S63A 1NPDA 1T2NA 4D96A 2XLBA 4XB6B 1SUEA 3TNYA 4KGZA 3H1EA 2VDWA 4XIGS 3K0EA 3L2OB 3QKSA 2QX8A 4ETWA 2WNHA 4QYXA 3HP4A 3IE2A 2Q5CA 4C0QC 1L1RA 3UM0A 2JC3A 4DYDA 4HB5A 1Q11A 4K8RB 3RSLA 1WXDA 2VRCA 3PHLA 1QYVA 3KEMA 4QDJA 4UVDA 2X23A 1GARA 2Z4TA 2AKEA 1SUCA 3DSRA 3GFSA 3M4ZA 1F0YA 1GVHA 3NIWA 1BS1A 3A32A 4PLGA 4CIXA 4E15A 1UDRA 3RC9A 4GW3A 2QEQA 3NB0A 2W00A 3L7OA 2G5GX 3LW7A 4IXNA 3P2KA 5EP4A 4OPMA 1HORA 1VFNA 4D9IA 4X00A 5CMLA 1UC9A 2M63A 2GVDC 4LWOA 1R0KA 4B43A 4AROA 4YRTA 2P2GA 2F43A 3C39A 1FYEA 1T5IA 1Y9DA 4Y9TA 1A1SA 3UH0A 5KREA 3LC0A 3H0CA 5EKTA 1L4EA 2ZP1A 3SQMA 1N5DA 3HUUA 1R74A 4F45A 2R6AA 4GYJA 6PFKA 1RYEA 4O08A 1J2YA 4WNYA 4XVRA 4CYMA 4P38A 4G89A 2ZE7A 5HIMA 5CEAA 1Z73A 5KKNB 1PJZA 4U9UA 4XFJA 1DS6A 4UQXA 3VHXA 3AGQA 3B3GA 3OZ7A 5I7VA 1G8AA 1G7TA 2VSQA 2HQBA 4C9BA 3HL4A 4JHKA 1ETUA 1JXOA 3H1BA 4A27A 2PWPA 3QC1A 1EFLA 2JGKA 3LT2A 4Z8YA 3BJEA 2PL3A 5BW8A 4HO1X 3DPIA 1AKWA 1WD7A 2Q5LA 3N5KA 3IQEA 1VSTA 2XRFA 3CF0A 3DYVA 3KZKA 1QFSA 5ADUS 1P72A 2D54A 1VKNA 4DSTA 2FXIA 2MSKA 1TAHA 2GVNA 3QFRA 3DEFA 3HP1A 1CYDA 1TNOA 2FX3A 3AVPA 4GTQA 3M1IA 1U4OA 3EIFA 4V24A 4DV6B 2I4IA 3HI4A 2J5BA 1Q84A 1ECBA 3DAHA 1ZBDA 3ZKJA 2F48A 3JQGB 5KNCD 4MEAA 1M1ZA 2GPTA 3GEBA 3CKBA 3E23A 2VJOA 3AR9A 1ID8A 3DVSX 1OILA 4I55A 3K4QA 1IN4A 1ABBA 3TLEA 2NPOA 1IUOA 1KS9A 2WZCA 5AJZA 3UKDA 1NMYA 1E9CA 1N9ZA 2AH5A 3BZUA 3AUFA 3IVCA 4OHWA 3T5VA 3TLGA 4QEDA 3IEUA 1V5GA 1Z22A 4KRXA 3VHLB 1PGOA 3D9HA 4LY6A 4XUEA 1HEIA 2Q6IA 5ER6A 3UOGA 2RHRA 1Q7RA 3T61A 3V7FA 3VR3A 5JNWA 3TTVA 4Q3AA 5L53A 3MELA 4R0NA 3QXJA 2W4IA 3AR2A 1P31A 1QH8A 3K9CA 4MDYA 1D4ZA 4PLYA 3WKDA 4BVAA 2L6JA 3JD4A 4R69A 3RQIA 5EJEA 2JLWA 1K0FA 1RDFA 3E58A 5K3AA 1QIEA 2YFHA 4JBGA 4P58A 2ACEA 3WNQA 2WFZA 2ZSHA 4QHTA 3KZOA 3FUDA 2EJCA 4JGGA 4EMTA 4J90A 5DB4A 1SCDA 4ZT6A 4LBVA 3FDFA 3TOVA 1FRFS 3K9IA 4WQMA 4L75A 5EP1A 5FLYA 3CLHA 4N0EA 3RFVA 3CRRA 3MJHA 3DSTA 2F8MA 3K1ZA 2QVYX 2ZSBA 2VF4X 3AZQA 4UVHA 3EQ7A 2PBZA 3LYUA 4ZMRA 4NONA 2XMPA 1XJWA 4S1OA 3IVMA 1MB3A 4IHKA 3LGAA 4DOMA 4CM3A 3FPEA 5K8TA 5DBIA 4D81A 1Q17A 4WGGA 4LHWA 2WJWA 4Y6CA 2RAFA 2CFUA 5AW5A 1GNPA 1K5HA 1SZJG 2C83A 2P9FA 2W2KB 2RCNA 1FDOA 2FZEA 4FNGA 1NP7A 2JFYA 4OH1A 3I05A 3B1JA 1KYIA 4NHOA 1XLTC 4A0SA 4BB0A 3H3JA 4DV4B 2XR1A 2AZDA 2ECQA 3GRYA 4C3OB 3PJGA 3BH7A 5LQUA 3TL6A 2NUAB 5ANRA 4OXRA 1NU6A 4MX8A 1MHTA 1SCIA 3T5BA 1ZNYA 2JHFA 4WADA 4IMRA 3IA7A 4UBJA 5HCIA 1NT4A 2IU4A 4D3YA 5GM1A 1ZD1A 1CCWA 3UJBA 4C03A 1YB1A 5TIIA 1LNSA 3BSSA 2GRRB 1FUKA 1JZQA 2H00A 2RGDA 4NOLA 2O9JA 1Q7BA 4Q9DA 4TV9F 5EHQA 2RBGA 2VPTA 5TXGA 4AF7A 4B46A 1YR1A 1ZJYA 1W4AA 2QAJA 4ER3A 4LXHA 3RTGA 4Q3EA 2X6JA 1G0OA 1N2CE 2ZUWA 3BTOA 1MAVA 4GSKA 2EWMA 1BX1A 2XDQB 3SQLA 2IWHA 3OTOB 4IMPA 3OICA 1M9NA 3MKRA 3E9MA 4MVJM 3S8MA 2O8BB 4HDRA 2O8NA 5LDGA 1IB0A 2REQB 1JHQA 1SHJA 4GQAA 1OTXA 1V16A 4QQIA 2IYSA 5K0NA 2R84A 4EA6A 3RUDA 1A9PA 1AUVA 1FU7A 1M1YB 4FQ7A 2EIJE 4TMVA 3AESB 3IP6A 4PZYA 4RJJA 5HIAA 5IZCA 2ZIWB 1K97A 1T43A 2PUJA 1EGQA 2AR9A 1CP3A 5BNZA 1ES9A 2VYFA 3S8EA 1RZRA 3JUIA 3UMCA 4IQGA 1D6MA 1NRWA 2FPXA 4KGDA 4M7WA 3X2EA 2AB0A 4Q16A 5AK3A 1UXKA 5TY0A 1M76A 4DRXA 4JA7A 4NU8X 1PYGA 3FCYA 1GPMA 3IUYA 5LC1A 4M0DA 3ZCRA 3LP6A 4Q39A 3WMWA 4HH1A 3WHLA 4R8SA 4GTTA 3OZBA 2WJPA 4NEHB 4XGNA 3RVJA 1TU0A 3QUBA 1S2NA 1MO5A 2DFLA 3K1JA 4ZO4A 3UICA 5B6JA 4WXHA 4EZJA 2W42A 1TEHA 2NXJA 4Z9YA 1UN9A 4ARZA 4M0FA 1KEZA 4Y6GB 3OFSA 4X1YA 4DX1A 3IKVA 1PDOA 1Z0UA 4MR7B 4DCMA 2ZM5A 2JKVA 1GG2A 1FFGA 1PGQA 2D1RA 3DWIA 1GZHB 4FQ8A 1BA2A 3T1TA 3M82A 3PC2A 1NUSA 1GQYA 2GM9A 4JR1A 3LHFA 1I6LA 2I67A 1PZGA 4A3TA 1YI0A 3A36A 2EX4A 3ZD8A 4ZZIA 1M2HA 1KY4A 1ZMXA 2WXFA 2ONYA 3BFJA 4XIYA 4KQKA 1YIAA 3OLQA 2RK6A 1YKSA 2XMRA 4LYDA 2JATA 4RVHA 2QD2A 3ZU7B 4DG5A 5ILQA 5LPNA 5FUWA 2WSYB 4RDXA 4FE7A 3EA4A 3ETGA 2JEKA 3I9LA 5IX8A 2L69A 4J7CA 2NW6A 4R1TA 1BC5A 2B4YA 2DM6A 1IZ7A 1PJCA 4RV9A 5B12A 1HTBA 4KO2S 4EMUA 1RC1A 1NNUA 2GZDA 1PNQA 2XMCA 1EZZA 2WLTA 1NXOA 1XZJA 2A5FA 2FXVA 4FJ0A 2IIVA 3AJDA 5EUCA 3UO8B 4DM7A 5ARBA 4CM7A 4DUZB 4N39A 4NE9A 2X3YA 4LHYA 2PMBA 1BKYA 4AJNA 4J0CA 2QRMA 1TGYA 2Q3LA 4ZCPA 4A3VA 3NH6A 3WRXC 1EWVA 1VMKA 1Z5SC 4MQEB 4J8YA 3L4SO 4W8HA 3WDSA 4PZLA 3T06B 2J6IA 5HXAA 1K88A 1WU8A 3MTBA 4B34A 5G1OA 3GOHA 4MV7A 4REOA 4MUKA 2XOKA 3NBQA 2IW3A 3A37A 5H3LA 4BWGA 1Z6ZA 3PC6A 4DM3A 5FXMA 5BYAA 3DLHA 1NFIE 1I80A 4O1PA 2NOAA 1PR3A 2HMUA 3EVDA 3IQFA 1IN1A 4ANXA 1Y3FE 4Z1MD 4KL8S 3V1YA 2WYUA 2WJHA 3SZ7A 4TYWA 2PM7A 4HQ6A 2Q41A 3HACA 3NHRA 1S64A 5D2MC 2VJYA 3JWPA 5B1DA 2IZ6A 1X8LA 2YIJA 4GLBA 2FGKA 2PFKA 4Y1GA 1MKYA 1PSZA 4NPCA 3VOSA 2D0IA 2W8BB 4BLOA 1OBFO 4WNAA 3KOYA 4FOSA 4QPNA 2Y1GA 3L46A 5IDYA 1NDQA 3W1VA 3AR3A 1Z7YA 5EDSA 1MVLA 1EPUA 1GVNB 3PPXA 2VK2A 4HS9A 2L0TB 1USUA 4O2LA 2MRIA 4YAUA 1DGQA 2WAAA 3VYRB 1Z9BA 5GY7A 4H16A 4ZA2A 3V1MA 3VNUA 1D0VA 3I4LA 4DL9A 5CDTA 3SQXA 1JSRA 5ARDA 1Q19A 1Q0PA 3ANTA 3QK7A 3S6JA 2OV1A 1BZYA 4XWWA 1N6LA 3NVDA 1O8BA 1X1QA 2IZZA 2CMFA 4CDMA 4PGFA 1E3QA 2X0EA 5J5AA 3OU6A 4OU4A 5AM0A 1ZINA 4XWOA 2QLBA 3E18A 1TUIA 3LKBA 5HKKA 1F6WA 3GLIB 1TIBA 3RIYA 3FZEA 1GL7A 3A6KA 2H4FA 5DKFA 4INAA 4P2GA 4TTRA 4AJ9A 4CODB 4RIFA 4CW7A 1D09A 1U3WA 3VKFA 4FJYA 4JXTA 2FY8A 3SXPA 3RSZA 2GSDA 3ZZ0A 1G9XA 2ONZA 5F7ZA 3KB8A 4IVRA 3DH0A 1G18A 5IBRA 1TMKA 2A5JA 1FFXB 2ECFA 1XU4A 1PL7A 2WT9A 2WKRA 4LUNU 4OU5A 5GONF 2G88A 4PLZA 2HMAA 4LI0A 3VGJA 1EX7A 4W1QA 1DHTA 1GFIA 4MMZB 3LC2O 3ERCA 2Y92A 4F3NA 9ATCA 5BN3A 2CNDA 5FH9A 2P2ZA 2XE8A 2D5LA 3MQFA 1HYBA 1PSWA 2D5IA 2WSLA 3CR7A 3K8QA 4FEAA 3HXLA 4RQUA 2YHUA 3IT3A 4TYPA 2X2PA 2ZUBA 1II9A 2YIDA 2N42A 4CM1A 721PA 1TKRA 1RJFA 4HXEB 1DXQA 3MTDA 1MV5A 4IFEA 4HRLA 1NP3A 3NPAA 2DGDA 4V1CI 1J9GA 1R6XA 2YCBA 3M9LA 3UBMA 3DDOA 3DVLA 3WWYA 1ZK3A 2JCXA 1U98A 2X41A 3P9KA 4MUEA 1ZXLA 3RF6A 4FFBB 3TSOA 2GW1A 1CJKC 1DXOA 1WM1A 2JAHA 1OY3D 2RAUA 3O31A 4Z0PA 3ZCUA 1I51A 4LCBA 4AJPA 1WW2A 3QVGB 4Q3KA 3JQDA 2NXCA 1SG6A 4RQIA 5IHPA 1S6YA 1UBMS 2ZUVA 1KAGA 3K73O 3KSRA 4JHXA 1VECA 2MTBA 4HDMB 4K9LA 3U44A 4D0NA 1FE8A 4EKEA 2HPVA 2VNAA 1VBMA 4ZCTA 2OG1A 3H1PA 1CY0A 3V33A 3FTZA 3GDGA 3AHDA 4PNEA 5AM5A 4GBJA 5T4HA 4TTJA 4JI4B 3RK1A 1UK9A 1CK4A 4F12A 3NKVA 3GVHA 3M5DA 4L6CA 4B76A 4ANUA 3DZBA 2C3OA 2YJ3A 5AVXA 2NXNA 2GAIA 1XI2A 2ZUCA 2AN5A 3NASA 1VXOA 3OZCA 5DRYA 5A5GA 1CUIA 1A7AA 2XMQA 1KGSA 3MWKA 3PUIA 1H8HD 4FFSA 4P9NA 4DWJA 1OI7A 4V2IA 5DLPA 6ADHA 3KPWA 3E5NA 4QYIB 2CHXA 4B85A 3TMYA 3PA6A 2HYDA 3FCUB 1B7GO 4JI1B 1QNLA 2JS7A 4OA8A 1DXYA 3C4VA 3KNZA 1RMTA 1TA0A 4GH5A 4KGXA 4WA8A 2QBYA 2HSEA 3B9BA 1F1JA 2HK6A 2IELA 2ISQA 2KW5A 1A7KA 3DEHA 4DV3B 1FL9A 1THMA 2ZJ6A 1YR7A 2VUSA 3L4EA 2JF0A 3IKJA 3RKVA 2P2CA 4M8LA 1D4FA 1WTAA 1RU3A 3DC2A 3K9LA 3N86A 4CKCA 2ENWA 3HCWA 4RUKA 1EVEA 2XTNA 4BRWA 4YK7A 3CE9A 3OY2A 4XQEA 1ITZA 3F5SA 1HG0A 3AR7A 4JYZA 4JHLA 3FLMA 3ZOZA 3QVGA 1PFWA 1RHMA 4MUMA 4OSPA 5M34A 3ZK9A 5EJ2A 2GZHA 3WXMA 1JQJC 1KVQA 2P9CA 1XALA 4BO6A 2H3EA 2O4CA 1YZNA 4QU8A 5CD9A 2IONA 1M10A 5DHQA 4M9RA 1PVOA 3S3TA 4XUCA 2CXOA 2AVNA 3IE1A 3KB6A 3OZWA 5G05J 4JP8A 3H1GA 2HWKA 1SOMA 4N3GA 3EQ8A 4GEKA 3KC2A 3T4XA 2G9VA 2PX0A 3TM4A 4E12A 2VTEA 3BFKA 4MUFA 1TDJA 3AHHA 2J1LA 5BN4A 1K3UB 1IULA 3COZA 1H3FA 1VBNA 2O1SA 1ZXXA 1KAHA 2FWRA 3PUHA 3APCA 1VP3A 2BFDB 2IY7A 1LX6A 2RHBA 3A0RB 4IKPA 1PZNA 3N8NA 4XGQA 1JA9A 2C8LA 3G7NA 3OC0A 3P0RA 5BV2P 2ID8A 4B75A 3VTXA 3E37A 3LS8A 5CIYA 3ZHUA 1ZCBA 3BREA 5KYXB 1KAEA 1VLLA 2P67A 2SECE 4U0UA 1DZ3A 3R9MA 5HS6A 3VR4A 4U7TB 4NH4A 2DKNA 4HOSA 1XEAA 4UU1A 5H9VA 3DT8A 1C9MA 4B4OA 1FP4A 1IQPA 1E2IA 1Q7EA 2QRNA 3A9WA 1MU0A 2DBAA 1URPA 1V2GA 2A5LA 4ZHQF 1T0JB 2GHTA 2JFZA 1XPUA 3ULEG 1BD4A 3C3RA 4I1OB 1MRZA 3RYFB 3G49A 2ENUA 4H1UA 1DJOA 1U3CA 2Y1WA 1JPJA 2PPLA 2QTFA 3U9TA 3ON5A 3P0EA 4FONA 1KPSB 1R9NA 4YRMA 3EIHA 3GJYA 3ODPA 2WUFA 5FLXA 4E08A 1B3BA 4I6EA 3SZGA 2EWVA 2R9VA 3EBOA 1E2EA 1CJSA 1CU1A 3I61A 2H1FA 2JH9A 4A0GA 1IRIA 3C3CA 4NNOA 1YK1A 4C2AA 5DM0A 1ICIA 3IERA 1EA5A 2PQ2A 1UKAA 2RGGA 5LXTB 1GUFA 1L7XA 3ACCA 5F52A 1STOA 3TKYA 2AMJA 3B7RL 1TTHA 5L6MB 2ZAGA 2LXLA 1GEEA 3DE2X 4HAYA 3S7TA 3V2UA 1WXHA 3PQ4A 4ETMA 2GUGA 2KM1A 3FCAA 2ZRAA 3NO4A 2JGDA 4FMCF 3UJPA 4E3WA 1LLCA 2GEFA 2ZYGA 2JABA 5P8WA 1R8QA 2Z43A 1ZKDA 4KX5A 1KOFA 2QAIA 3S27A 2B3DA 3MPUA 2O8EB 5C5CA 3OBIA 3GF4A 5BUZA 1I0ZA 3BGOS 3A6JA 1G98A 4JOQA 3WK5A 5BW5A 1JEOA 1DEHA 3AEKA 1N1MA 1RKBA 1M54A 1ACJA 1N2GA 1JSLA 1CUXA 1YZUA 2FOIA 2NZVG 2QK4A 4FEGA 4UXJA 4Y98A 5AICA 5GP1A 2CHFA 4LRSB 4UQYA 1P9WA 3KTAB 5AP9A 4DMCA 4KUHA 4LHVA 1HF3A 1EKXA 1T8WA 1W88B 3HDHA 5K0FA 3QE3A 3LIPA 2O2SA 4Q4JA 5AKIA 3RNLA 3E48A 2PUWA 4B5KA 1WF3A 5IF9A 1RZRD 2QWXA 4NICA 3WWCA 4G0PA 3DL0A 4WWNA 3HU2A 5DNEA 1U0LA 3ZWQA 2Y3AA 1RQNA 1SXJA 1D9SA 4BKOA 4LYGA 2C7QA 3DR3A 4XEUA 1KF0A 4OUKX 2IW1A 1FX0A 2VDLB 1RZ4A 1A8HA 3CURA 4KDEA 3AWIA 1OTYA 4GMXA 3T5GA 5I7RA 4YNBA 4PRKA 2R11A 5K0GA 3I9NA 3F6PA 3O4HA 3MRVA 2EYUA 4HNRA 1XU9A 5KWJA 1AF4A 3BORA 3WB2A 1W9HA 2DWZA 3LKZA 4NJOA 3KOXA 4LXUA 4DI4A 1RZ3A 3WLIA 1VSBA 6REQB 2A4ZA 4OBEA 1R5OA 1W96A 2F3SA 1YFLA 1LPBB 1E94E 4B3TB 1IQUA 2R7MA 3GYBA 3FWNA 3GJ6A 3S2EA 1RRCA 1NF9A 1RJ9B 2WWHA 2FX5A 2E5LB 3BTSA 4D45A 2QZ4A 3CZCA 2KBEA 3ITDA 5AVYA 3E3MA 3NZSA 3P2YA 4YDSA 1DQNA 1PZMA 2QTVB 2VT6A 4Q4DA 3PJDA 2B2CA 1L8AA 5D3QA 2A7QA 3EW9A 3O7MA 4JT2A 4OI4A 4OXXA 2R17C 3ZHQA 5A7HA 5E8JA 3VISA 3WKCA 4U2FA 4BO0A 5JASA 3SSOA 2OCBA 2R6GA 2VSOA 3AU8A 4NARA 3I8XA 4KODA 1PFKA 2D5CA 3N28A 5A5EA 1Y33E 3N87A 3RIEA 4YDEA 1C3XA 2XE6A 3KR2A 2IUUA 2A35A 4IGFA 1JQLB 3MCVA 3NBAA 3Q2IA 5FR2A 1LD7A 1SM4A 2RHOA 1UPCA 5FLEX 4QTYA 3PTAA 3K9QO 1TMGE 3ZEIA 4URKA 3NBYC 1PE0A 4IINA 1R4MA 2FSFA 2PFGA 5ILOA 4C29A 5KDOA 1V0JA 2BRUC 2Z1MA 3GZNA 4RWEA 4W5QA 2V7PA 3TWQA 4UZEA 3NNSA 2H7CA 1SD5A 3DE6X 4WN3A 5BSUA 3IT2A 4KYIB 4P86A 1SU7A 5I8ZA 4CM6A 3JVVA 1D6SA 2AT1A 2DCMA 2PRJA 1EWTA 1H0RA 3P0JA 5ELXA 2UZ1A 3T8MA 3KUCA 3ENVA 4FMPA 4ES6A 1LS1A 1BEUB 2EKDA 1G3QA 4MHSA 4OXNA 1Y8RA 4J1SA 4LDJA 2G1JA 4HPXB 3L8YA 5GONA 3QU5A 2WJGA 4GR5A 4O2AA 3QBDA 2M32A 4OI1A 1J8QA 3DFFA 1T6BY 2ZWOA 3FIJA 2MYTA 5C51B 4FSXA 2CJXA 2JHPA 5FTJA 4G5FA 1I7PA 5KHAA 3C5RA 4YRDA 4BASA 1JG2A 1XPJA 4WL0A 5A4DA 5LDDC 1C9DB 1ACLA 1GGJA 5FI0B 1KZ6A 3DB1A 1CHNA 4DS3A 2QU8A 3CY6A 1SK8A 2QDKA 1Z5PA 2ZOSA 1EDZA 5IMSA 2OBYA 1RE0A 1WSDA 3F9CA 1SA5A 3R7WA 3SS9X 3EIUA 1JDJA 4KXQA 3PDIB 4MS1B 4R9VA 5DF1A 1UADA 1X7WB 2Z2IA 3IEIA 1N78A 2CD7A 1XRQA 3HWSA 1W75A 1Q0TA 3IE0A 5LQSA 3UJDA 3N0RA 3F4KA 4FNOA 2DHRA 3ULKA 4EARA 1DBPA 1C9KA 3EXFB 3PJEA 2RKWA 4Q1EA 3SC4A 4BZWA 3CUKA 4G56A 5ES4B 1K68A 1PL8A 3KWLA 3BWEA 1P0IA 2QRVA 2RJOA 1U8FO 4LNUD 2XAUA 2WIKA 3PEUA 3FYDA 1WHSA 1DADA 1ZJ5A 4Q4AA 1WRBA 1VSQA 1FNMA 3WAGA 5F9FA 2AC2A 4FHEA 4TYQA 4ENRA 1KDPA 5BQPA 4F38A 3G5MA 2UZIR 5IKEA 2JFHA 1BJKA 2DH6A 3L7MA 1G16A 4K5QA 4C0BA 5CAEA 2AJBA 2PGXA 2DJIA 3IDQA 3W8DA 5LBTA 2QTAA 2VDNB 1JHAA 3V80A 4WXYB 3B78A 1OU0A 1XZDA 4YAKA 4JJ8A 3MT7A 4X44A 3TTWA 3X1XA 1LDGA 2RGUA 1SQFA 3JQ8A 4H17A 4K8OA 4TWJA 4D1YA 5M04A 2QL6A 4XJTA 2H4HA 2BELA 4A8PA 3DLBA 4CM5A 5JC1A 5IAKA 1QPBA 4EVRA 3G9TA 2COKA 5EJ6A 5HSGA 4I1YA 1X7WA 2Q7XA 2RIPA 4J07A 4F6RD 1MAWA 3HL0A 4LDQA 2VBCA 2B8EA 2KE5A 3EFOA 3L01A 3ESDA 4UUBA 4R1OA 3RG2A 4LSZA 1GLNA 3FVWA 3N3AC 4BFSA 1FXWA 3O2QB 3WHIA 2TECE 3LY5A 3N74A 1NBMD 2G9QA 4KLRA 4BLVA 4ZOQI 4MZXA 4DX7D 5M5BA 5I47A 4YH1A 2QD5A 3GXBA 4LNAA 2OD9A 2J3MA 3D9OA 1JUQA 2PGDA 3Q3VA 2JNWA 3JVEA 3LGXA 4MR8A 4R2KA 2H9IA 2JI8A 1S1MA 4GXQA 3FCSB 1TGVA 2AWOA 5FO1A 4HOQA 4IJMA 3NWJA 1GQRA 2JLCA 3CEJA 1GP2A 5JHHB 1ISSA 2Y9PB 2FBNA 2R8RA 4LK3A 5KTOA 1T9DA 3S28A 5J2UF 3B48A 3HVRA 4QOGA 3U3KA 2RFLA 1CV2A 1Z5WA 3HXPA 2IHTA 3ICCA 3LBYA 3FZQA 5E9JA 4R7TA 3GLQA 1WDLA 4X6UA 1P1JA 4XTRA 5BRJA 4CEJA 4NCIA 4R5MA 2Z6AA 1X0XA 3VQTA 3JAWB 1U2ZA 1WMEA 4UU0A 1ORVA 3TL5A 3IXLA 1PLJA 1O94C 5ALJA 2W58A 3E5RA 1TCAA 2DBRA 1YVDA 2R7LA 3C7CB 5EFOA 1VBKA 5JS8A 4KUGA 1SGWA 4FP9A 4FEEA 1UXIA 2WT8A 5KTPA 1JYSA 5A06A 1XTUA 1CRZA 1TUGA 4RDIA 4CI0B 2ES4A 5B4UA 4N9WA 4M8KA 3B38A 3VZSA 2J5RA 4UUCA 1ML3A 1EUZA 2DHCA 1XROA 3RO2A 4IZHA 4OQPA 4XPZA 5EP3A 5C8YA 3TPCA 1JRLA 3U31A 3H2YA 3V42A 3A6LA 4CFZA 1JDNA 3BA6A 1HQDA 1DCKA 5F51A 3U61B 1XNQB 5F1KA 1GQQA 4F4HA 1NW6A 1N11A 4YPOA 1V2HE 4DNPA 2XDYA 3P45A 1WXQA 3QKUA 1GADO 2JJ8A 2IP1A 5CX1A 3QGMA 3GN2A 4QHYA 1AKNA 3DD5A 4UE3S 4D3FA 1EUQA 1UWVA 1U11A 1ESDA 1NJ6A 5DGDA 4B3DA 1QGOA 3I2JA 4F8YA 5JNRA 2BMAA 2PTHA 3TM5A 4DPMA 5TARA 5BN5A 3T5XA 3PQFA 3Q3GE 3KELA 4NMXB 1NNI1 2ODAA 4FYHA 3FZYA 5B3KA 1L5LA 5KNCH 2JLAA 2CDNA 4RQTA 2PMCA 4HYYA 7MHTA 1QIDA 2WE8A 4RY9A 2HSGA 1FDWA 3AL2A 1DT5A 3GRUA 3OT1A 4I81A 3VYUB 3OFKA 5JR3A 1EF1C 2VYVD 3MTEA 1R4ZA 4KLAA 4R40A 4TZTA 3I9KA 2WMOA 4EHFA 1OIXA 1U0SY 2DQYA 3ILXA 4AMBA 1PL6A 5C37A 4ZZ0A 2P40A 1YAHA 1PT9A 1BMFA 3BDAA 1A9QA 2C84A 1DOHA 1E9RA 1H05A 3KTAA 1FT1A 3IBTA 2J9XB 2XTJA 3EQ6A 3SY2A 2H08A 5SY4A 4DBLE 1KO7A 4GOXA 4BVFA 3N2NA 1N9GB 3T9DA 1Q22A 2QC9A 1ZM3A 3NJ4A 4BSZB 1NVAA 1WO8A 3FW1A 5AW1A 1FK8A 2VDWB 3KYCB 1IAQA 1CC1S 3L0IB 3OEWA 3JWIA 4OI2A 1V4BA 2A33A 4WNEA 4QQRA 4P81A 2R1VB 3G59A 3WRYC 4AWAA 1ZUD1 4F4JA 1ODTC 2CLOB 2QTMA 2O5VA 5EJAA 5CLLA 2CL0X 5HILA 3T7IA 4B73A 1PS0A 3IOMA 1E90A 3PNBA 4OFZA 2FUG1 1X1CA 2AW3A 2J9FB 2M6SA 2P5UA 4UI9K 2Y4OA 3A28A 4X0EA 4TLEA 5CTAA 3TSCA 2QN7A 5HKAA 2OO5A 3RI3A 1UPAA 4OQYA 5FEMA 2HA7A 2B4AA 3EXG2 4MV8A 4CKEA 5FAKA 5I9IA 8MHTA 2JDIA 1Q0QA 3HSKA 2FZWA 3UWMA 4DZTA 4TXNA 1U1CA 1VYHA 2AOWA 4CUJA 1QANA 3OWHA 1J49A 2AN9A 3I5UA 3RAFC 5JT1A 2WJYA 121PA 4Q3BA 4RMIA 2WM3A 4FQ5A 2WI8A 4BQRA 4BNVA 4MAAA 1ORTA 3W79A 5T3RA 2ZWPA 4L8GA 1P9OA 1UBCA 4DY4A 1W5TA 1KOLA 4QOIA 3ZQUA 2NSZA 5IYZF 1GPNA 1IAVA 1RIIA 1T8SA 1T36B 3ESCA 4GGMX 3CGWA 4B47A 5HKPA 4CYMD 1G6Q1 4MWGA 2GF9A 1GYPA 2FPGB 2M1XA 2L82A 2ZYRA 3GW8A 3IT0A 1R5JA 2FUG6 3R0QA 3D9PA 4RESA 3ROZA 4BVKA 4C4OA 5KI6A 4F6RB 4B6OA 3HHPA 2H2HA 5D86A 3SE0A 2AK3A 1N0QA 2Q9BA 4GFDA 3S1LA 1UP7A 4QVGA 1DTSA 1L6RA 4KVOA 5JD6A 3SYLA 3MV2B 1QHYA 3EF1A 4M0CA 3H6KA 3W5UA 4CL8A 1OX6A 3VV2A 2GAOA 4EATA 2BM0A 5L3RA 1MT3A 3ROFA 1WPXA 5JVDB 3GZJA 5IVKA 4C7XA 1A8QA 4I2NA 4A2QA 4JB8P 3AOEA 4D9FA 1FP2A 3KR9A 1E0AA 2OFOA 1SCUA 1U2GC 3BCHA 5K45A 3VJRA 1RBQA 5HM6A 2FQWA 3L6BA 1VI6A 5I7UA 2K6GA 1KK2A 3RC8A 1TUBB 3B2QA 4KLNA 4CV3A 2XODA 1U0JA 4PAOA 3WDMA 3C3OA 1ML4A 5AOAA 5JDCA 1GNQA 1SG9A 2EGUA 5CLJA 4KDRA 4B6SA 3M1LA 1V5WA 5EX3A 2HXGA 2W2VA 1QNFA 4H77A 3LZDA 3OJXA 2BZGA 4ZQIA 4B4UA 2V6GA 3UOAB 4NG5A 9LDBA 3IP3A 3NOGD 1GLGA 4ZVOA 3UT0A 2K2WA 1UZMA 4O4LF 1H2AS 4UEJA 1Z8DA 3P4XA 1UJBA 5JV5A 1J09A 1WXEA 2JFUA 4KWIA 4YFYA 3M9XA 2DPYA 2QBYB 4CEHB 1KARA 5DGHA 4UBNA 2HOQA 2O8CA 4ZQCB 3W5JA 4Z4IA 3SLRA 1V6AA 2XLCA 4HWGA 3I37X 3SX0A 4HDQB 5D0QD 2XCBA 1ZH6A 1JG7A 3M1YA 1O5MA 1JB9A 1WQ3A 3ASUA 4JUBA 4MLZA 4AZ3B 2E0IA 1YZQA 3K3PA 3WGZA 2ASEA 2E82A 3PEWA 5BN1A 4GPZA 2IGTA 4RCVA 3I34X 4RZ3A 3SJ7A 2P5TB 3FAZA 3WDLA 3LVRE 4C0MA 1ZDMA 3AEUB 3GLUA 3Q78A 3OJLA 3PEFA 4WCDA 3OC6A 9GPBA 1XQ1A 1RAAA 3BMCB 4HLNA 4FHGA 4ECAA 2R6ZA 2XT9A 4HZUB 1JJVA 1SWWA 2HR2A 3A6PC 3CVXA 1UKBA 3AHIA 4GZDA 3TE6A 1QTIA 5FPTA 5CM9C 4IHJA 5KHOC 3R3HA 4A6PA 1QONA 2OXFA 1KDYA 2A5EA 2C4WA 3OZIA 4YMSA 2QX7A 2V7GA 4OV6B 3QWVA 1MX2A 4DMUB 3AKCA 4ESHA 3L40A 5DBGA 2X1LA 2GRQB 4LOAA 2QUHA 4PCUA 4D42A 2OGSA 2XRYA 2QR3A 1VHLA 2PKEA 3EWNA 3JX9A 3VKVA 4EW1A 1E7SA 4FFRA 4G65A 4P7JA 4YACA 2F90A 3R9XB 3LUGA 1UT5A 2D4HA 3MVEA 1J90A 3UCEA 3F4BA 3G2SA 3CV3A 1IBKB 5EYPF 4ZD6A 1Q1ZA 1PWEA 4HY3A 4QUBA 3PZ3A 4R3WA 3WMGA 5FOUA 4ETNA 4WIAA 2IY9A 3QXHA 1E18A 4KO8A 1U80A 4I9UA 5E3IA 2WB2A 1JYFA 1KVUA 1VJRA 3CZ4A 5HBGA 2OD7A 3SJBA 3OCCA 3Q15A 3GL9A 1V5IA 1VMEA 3IKMB 3WLOA 2A3NA 2P3SA 3LNTA 3WQQA 2RAPA 4L4ZA 3UHOA 4GL2A 2P1DA 2RAVA 2P0YA 4E1AA 3FI0A 2GEVA 1L1FA 2PBFA 3OIFA 5DN6D 3NHJA 2C95A 3TTSA 5JWHA 5BSGA 3PJRA 1UPFA 3N2GA 3MV3B 1WPQA 3H04A 4I5DA 5TX7A 3W9FA 3L6OO 3OPYB 4H7XA 1OWNA 4IHQA 3KQNA 4P3XA 2XSZD 2X86A 2WJIA 3ZVLA 2ZBPA 3BE4A 2QJTA 3ISVA 5IT9A 2HA2A 1IB6A 2IS2A 2BJWA 1ST3A 5THKA 1F8XA 3EHEA 2YHIA 4UNIA 3MCAA 2QVGA 2OWEA 3RAUA 3MKQB 4N18A 2WHEA 2QROA 4V0SA 3T3EA 5L3VA 2I54A 1MJNA 5EE1A 2D59A 3LUFA 4IIJA 2J3JA 5JUWA 4YCSA 1EMDA 5KX5B 5TLSA 2YQ4A 1EB8A 1ZGJA 3E70C 4D8YA 4EO7A 5G02A 1DCFA 4YRFA 2OXIA 4OAOA 3U19A 3THRA 2X7HA 3KVVA 1JLSA 5A3QA 3MILA 5L4LA 3IUEA 1R8YA 5AVUA 1KMNA 1W0CA 2IEIA 5COQA 3CZRA 4G8LA 1Y1RA 4JJAA 3JYSA 4NYJR 5GVSA 4HQRA 4KU4A 3EVCA 4LHSA 3S7BA 4FLFA 2ZI7A 2RH9B 2XQVA 1NY5A 2JFOA 4RPLA 1A9SA 2Z3VA 3B8EA 3FTQA 1E2KA 4N5MA 3C2QA 1GOTA 2D1FA 5J5CA 4AMZA 5KTKA 5EERA 4F0JA 5K2OA 4LKRA 1YB5A 5LZ8A 2IU1A 2OD2A 1BVYF 3HMKA 2PH5A 1B8PA 1UDXA 1VB3A 1Y37A 4LFBB 3ETCA 2ZT5A 1GPAA 4AY6A 2GH1A 2QTNA 2VDRB 3D7NA 4JJZA 1TT5B 4DM4A 2P9JA 4RTOA 2XCTB 1V7CA 1FSFA 3DZFA 4BQSA 4F1WA 1MHQA 5IAAA 3ED1A 1W9MA 2A8YA 3JQRA 3L92A 2UVPA 2PIAA 1BA3A 1N4SA 3CNLA 4UMDA 3ZHSA 4J3NA 5DULA 1YOVB 2QMZA 1QQTA 3C3EA 4H6VA 4ZOAA 3V8EA 4ARAA 4EUSA 2PUBA 3BS4A 1G291 2QENA 2QSYA 3UKRG 1HZZC 2C99A 2I6FA 3QPUA 5CLGA 5DM70 4NBVA 4A5SA 5DWDA 4Q7KA 3B8HA 2H9AA 3TMKA 3HXFA 4UCWA 4PCLA 4Y2JA 3WRYA 1HLDA 5EKUA 1BKDR 4U5XA 3DPSA 4XCVA 3MTJA 2P2YA 3TGOA 3I4RB 3L8MA 4X1KB 4FYXA 1F6BA 1JEYA 2XCSB 1C0EA 4WTOA 1I3MA 1JPVA 1XDZA 4KHZA 1Z35A 4M9CA 5A0FA 1R88A 3TN7A 3TQOA 3ZE2B 1NUQA 5FIOA 4ANFA 1SKMA 1XVAA 4B8YA 4OHYA 1MFPA 4ZHSA 1U2RA 1ZOIA 5H68A 3CVPA 4B8CB 4X45A 3GFRA 2ODTX 4FFPA 5IULC 1HE3A 3AOGA 4IDAA 2VGXB 1X8JA 2HHAA 1Q1NA 3RJ5A 1Q20A 8ATCA 4AKTA 5JYDA 4LMPA 4J0QA 2FPIA 1P45A 2YVKA 3HVEB 2CVPA 3M3DA 3UENA 3HNOA 4OGWA 4Z3KA 4HYTA 2ZSAA 3QTBA 2PYDA 4F5YA 1UZLA 3DBSA 1TE2A 1NMZA 3SXJA 2Y4TA 1SXJD 3LLUA 3OEED 4J3JA 5B36A 1E0SA 5LM3A 1NJGA 3JWEA 4BNDB 5A9TA 4CQMB 3AF6A 4NNJA 4BP9A 4XOUA 4CM4B 1IY2A 1Y7TA 5D00A 3RR2A 4B45A 3T12A 1H2TC 4HUQB 1QIKA 4BQNA 4EENA 3UJ9A 4G1UC 2BLLA 3PC3A 1TN7A 2JJ1A 4N65A 5F1YA 1KI6B 1F38A 1BYIA 4X1OA 3BMXA 1U99A 1YZTA 5M3BA 1LRLA 3JWGA 4BPBA 3IEVA 4EEKA 1V3QE 3VMFA 1F8UA 2G76A 4V0MA 4Z4QA 4J7WA 1WY7A 2XVXA 3HA2A 3MTIA 3KYDA 3IR5A 1JQDA 4MKXA 4GPEA 5CBPA 3HR7A 4B3MB 2CWDA 3HCNA 3IEGA 5C53B 4NFYA 4G8CA 1N7IA 2LV8A 1G3NB 4FHKA 3WBKA 5L7WA 2ZBFA 5DMXA 3IEMA 4DBLC 4JDUA 3C8UA 2QTBA 4U0SA 5EINA 2LRHA 3GRCA 1JMVA 2J49A 3QMMA 5EWLB 3UB2A 1JMYA 1R50A 3A70A 4D9EA 1KBQA 3DSWA 1M0EA 3N5CA 1PT8A 5JY6A 3F7TA 3VJLA 2ZRKA 3MGBA 3ZJYA 1Y9JA 2VZLA 4ESEA 1ZGZA 4C6TB 1N7HA 1V4VA 1KO4A 3IHWA 1W47A 2H18A 2PX6A 3GY0A 3PFGA 1W2WB 3F1KA 3T99A 2C4UA 1Q0UA 3DFUA 2WMOB 4JJ6A 5C0OE 2DUWA 4MRRA 2VJCA 1XG5A 2OECA 4PE5B 2XMZA 1XNJA 3S2SA 5B1BE 1AKMA 4G0OA 4OJTA 1FU8A 2BIFA 2R4TA 1YI1A 2OAQ1 2V03A 3BBLA 3FLEA 3IQXA 5FO0A 1XNRB 2C58A 2ZSEA 3VPSA 5JZOA 2IH5A 3S7JA 1INLA 4X6XA 2CDAA 4CLRA 5LA6A 2GN8A 5EQJB 4Z2YA 1JGTA 3CEAA 4D6YA 1Z33A 4J16C 5JO9A 5CBPB 1N9GA 2ZRQA 3OQIA 4FJ1A 4A73A 2EIKE 4RHUA 1R0BA 2VJPA 3IMEA 4RMGA 3RV4A 4Q18A 1J5EB 2HRRA 1RBMA 5FBRB 3IAS6 2FHPA 4O6FA 1OUVA 3PYXA 4K9QA 3V2HA 1W30A 5FJYA 4ESVA 4UUNA 2FPLA 4HI0E 1Z4KA 3F49S 3BVPA 1S01A 4PLPA 3EAGA 3NBUA 3MWDB 1ZN2A 3C5CA 4M0PA 3OUTA 1KH3A 1SKBA 3B9RA 4MP3A 2ZIFA 4LXYA 2RKBA 2B30A 3W34A 4N2SA 2YV4A 4DR4B 1OLSA 1NI4B 2BFAA 3ISJA 4ROTA 2Y0CA 2Z9BA 3OT4A 1H5UA 1LD3A 2BPOA 2GJ4A 4GTMA 2COUA 4P0TA 4ZU6X 4HEHA 3I6BA 3ZDRA 1F8GA 1RQGA 2Z5FA 4CKBB 1J39A 4EVIA 5BN5B 1Y5RA 1MX5A 3HB1A 3VDMA 4UNRA 4U7FA 3KHKA 4RULA 2QTZA 4E4YA 2CHWA 3VLDA 1BW9B 3EY4A 3GT3A 3PU6A 4PX9A 4YRQA 4C08A 4EH1A 4IOKA 2Z09A 4CPDA 2DQKA 2W2NA 5CX1B 1ULHA 2YIMA 5J1TB 1FLAA 5HKOA 2PUVA 2B0JA 3QUCA 1M66A 2BKLA 1QIGA 2DBZA 4GEGA 1J7KA 1F4VA 1FXSA 2J7KA 4TL9A 3DW1X 4N1AA 3TZEA 3DFIA 3QEMA 3PTLA 2OR3A 3KB1A 3LS2A 3LKUA 2J8SD 2DPXA 3ZWPA 3H87A 1EM6A 2P2LA 4IIJB 5ALZA 3AJIA 3EAQA 3SF4A 3W5BA 5DDIP 1VXRA 4UAVA 1ZG3A 3O90A 3W6NA 2QXYA 4RFVA 4F96A 5E75A 2IYEA 4YYZA 5ARCA 5CVUA 2D2XA 2ZGDA 1DAKA 1GQSA 1GY8A 2HPAA 2OV6A 2Y68A 3B7WA 3EAFA 1DIRA 3QUTA 1GTL1 2BAGA 4Q4LA 2PT6A 4X60A 5KKCA 1H85A 2YCLA 5JPDA 2BTQB 1RC8A 2OHJA 2KBFA 3TI7A 2QXTA 1XLWA 3NF1A 1I6KA 2V3CC 2B69A 2X8AA 3C5VA 2FQXA 1HT3A 5K4AA 3NQ41 3PZ1A 5JCJD 1UFQA 4CMHA 1G8GA 2GHIA 1NJ5A 2XPIA 1RJEA 2NYUA 3BGIA 3DTVD 2B83A 3AHFA 4M22A 2C20A 1W3BA 1WABA 3TZLA 4K5CA 1MA3A 3OJEA 4NFHA 4X54A 2WSBA 3AI2A 5ULLA 5I9MA 3QH4A 1QYDA 1T29A 3RJ9A 4CKXA 5A5FA 3CVJA 4DF3A 2NO5A 3Q9UA 2RFAA 4JT9A 4GLLA 5IJXA 4JFAA 3PC7A 1E0JA 2W8ZA 2JL1A 4Z53A 4GLJA 4L9AA 3B1ZA 1N8SA 4ZAWA 4CQMD 2EQ5A 1HQKA 2CB9A 2YNQA 2ZJ4A 4C21A 5JMND 3Q5EA 4XKCA 1JIKA 1JT9A 2YXEA 5F78A 1RPJA 5BXOA 1FQWA 1YZVA 3BXZA 1IUPA 3OCWA 3PXCX 5T6MA 5I4BA 2QYOA 2WU0A 3INGA 2G63A 4HF7A 1W8IA 3BCRA 1J42A 3MKQA 1TPZA 4CDNA 5C31A 1A9YA 1KFEB 3WA7A 2BZ0A 2CL5A 1Q3KA 4DSZA 1RXCA 3ZJUA 1JTEA 1N1EA 1O8CA 4AQYB 2NT3A 1JAXA 2VLIA 4MQ6A 3F71A 3AC0A 3K1AA 3PKZA 2XYQA 4HRXA 1D9ZA 1P7VA 1PL0A 2F2TA 1KC1A 1RI4A 5E6UB 4QO8A 4HT3B 1Y8QB 2P9QA 1OBHA 4BDSA 1BMDA 5AESA 5HFNA 1IY1A 1W36D 3MOIA 5BMOA 3A1TA 4GU5A 2VPPA 3LC1O 5TJHA 3BGWA 3V3TA 2CLHB 1MAUA 2NTVA 3MT0A 3N0VA 1QOZA 1XVLA 3EISA 4X20A 3RRNA 5AM1A 2BT4A 3WV5A 3ZW7A 2FSGA 2PUEA 1ZSNA 4AN1A 4EPXA 1PJLA 1SBIA 1L1QA 5AM4A 3ZCPA 4C6HA 2PT7A 4JP1A 4DILA 1RPTA 2AOTB 3D5QA 4FDLA 3N7TA 3EGCA 4W9MC 1H22A 1CB0A 2C3UA 4N82A 4Q1CA 1MZVA 1RCTE 2VTKA 4FGWA 4PYNA 4YVOA 2YWHA 1GTVA 4JVMA 3O26A 2Y1CA 4J0EA 2IXFA 4ENPA 3UM2A 3GXOA 4EG7A 3B3AA 3NHBA 5L3SB 3R9XA 1JHZA 2BFCA 1NN1A 2WK1A 3CLVA 2FSIA 4Z9BA 3PDUA 5JAPA 5KWVA 1JTFA 5GTDA 4P1ZA 4XCXA 4IEIA 4DMRA 1G5TA 1NA5A 1Q6ZA 2XGMA 1H2RS 3GJ3A 1L5VA 1SIWA 2GXQA 2JGEA 3OTWA 3WFIA 1T2DA 1BWPA 1TYAE 2CNBA 4JLUA 3GJ5A 3I72A 2WPVA 2BFNA 2P9KG 1Z26A 3R0ZA 5THQA 4DJ5X 1CQJB 3J80A 4C06A 2E4UA 2A9KA 2P3LA 4NL4H 2PWYA 2IOQA 4OBBA 2OPHA 1H93A 1OTHA 1D8DA 2IXDA 3AEQA 3EOAI 3CF2A 1PTJC 1Z6AA 1FCHA 1PVDA 3QF4B 3PEEA 5EE0A 5EG5A 5LZ2A 5B7QA 1UOHA 4ZDWA 4ZT5A 7ABPA 1YS1X 2GJSA 5T64A 3VPHA 3ZOKA 1OD6A 1PUXA 4IFBA 5KTSA 3G3EA 4EI9A 4AOFA 2IO3C 2W6ID 1ETHA 2GF0A 1JA1A 3GRAA 2Q29A 1PYOA 1QHXA 3Q49B 3CF4G 5E4YA 1ARZA 3SM3A 2XEVA 1EX1A 4DLNA 5K8JB 3FTUA 2EZ9A 4UMVA 4BTVA 3HVEA 1OAKA 4MS6A 1SC9A 3GQBA 2H8KA 4HUQA 5JQGA 1OFGA 4RLSA 1E0KA 4M3OA 1I4DD 3RFFA 5HNKA 3CYFA 1ZM2A 3SQVA 2R00A 1ZU2A 4FA6A 2XUQA 4PBTA 4CM4A 4WVFA 2RHTA 1XUOA 1LLUA 1JIUA 3WYAA 2FSPA 1GHTA 5JPIA 4MLDA 3HXEA 1MJ5A 4NP6A 5I9LA 5A1JA 3ZHEB 1EIZA 1N3BA 2NU8B 5KOHA 1NY6A 4DSNA 2PR2A 2AN4A 3R41A 5JSKA 3GT4A 2OZPA 3WL6A 4NMWA 5JS1A 5JPCA 4YUWA 3OTNA 4IX1A 1ZK4A 4G1BA 1THZA 4NDZA 4BN4A 3CQGB 1T5DX 3UQ3A 1N33B 3JVIA 4JAVC 4UPDA 4C05A 1OB5A 3CU5A 5DNUA 3OZVA 3IUQA 3V4VB 2CXUA 3LDFA 3QPBA 4HS2A 2HM7A 2W2PA 3W9BA 4MW5A 5JNTA 4PPNA 1E2BA 1PJ4A 3JXJA 2PCLA 3EODA 3LJ3A 1DZIA 3DOEA 2WXLA 1SKYB 4AYWA 2C4HA 2RHWA 4G25A 1UM9B 4ATGA 5A04A 2R5WA 5F7JA 3KEOA 2EERA 5A2GA 1V5FA 5K3EA 1SCUB 3W2IA 2QY9A 3MLEA 2IWRA 3WSWA 5AUNB 2DLCX 2WJ4A 5DLYA 5DVZA 3BRSA 2F55A 4ARSA 6REQA 4F9TA 2IEZA 2HDNB 2KLHA 1WM5A 4BJHB 3HBMA 3VH4A 4PLHA 4RHCA 4WJZA 1MA0A 2AEMA 3AXTA 2PQ6A 3A2LA 3IDSA 5DTMA 4Z3OA 1SBHA 2SICE 3MRSA 1Y82A 2AG5A 4FLMA 5T67A 3T52A 3D5TA 3FDHA 2Q0HA 3GWZA 4MBGA 1C7IA 3N0WA 4U7JA 1L4KA 1KP2A 4KNWA 3VDRA 4B3RB 3UXGA 1NUPA 3IQWA 1FBTA 4LV6A 4ZEOA 4ZO7A 1QQAA 3CB2A 4C14A 2DIWA 2D62A 5HEKA 4BKQA 1J8YF 1SCKA 3B6EA 3LTNC 4C4YA 4KWCA 3G0HA 1M3SA 4HWRA 1OWPA 4D25A 4A1GA 1Y81A 4U7WA 2ZB2A 4P08A 1KY2A 3PIDA 3RUEA 2X6FA 1XHLA 4ZT4A 1RWOA 2HQRA 3CF6R 3PXGA 3SBDA 3MBIA 5KSYA 2RKKA 1JP7A 2BEWB 5GPBA 4BTAA 4TZ6A 4XI9A 4OSEA 2ZB3A 3THXA 1QXSA 1WCIB 3BXFA 3L6AA 2V7QA 3QUSA 4KQ9A 1UN8A 3UQYS 2VP0A 3AQ4A 4HJXA 4JD2G 3WTBA 3PUYA 3N8IA 4DR6B 1QK4A 5KPDA 2RB5A 1TKBA 4M98A 2JVJA 4N0QA 1HZJA 1N2EA 2QRHA 4GAAA 2QZJA 2AZXA 4L3OA 1VL6A 2XIQA 1I6MA 2PJDA 3CH5A 2XMSA 2ODEA 5F2EA 3QI7A 4FN5A 3CRMA 2XCOA 1P18A 1PJ3A 2XYVA 5CXUA 2FEMA 2FR1A 4A9AA 3OPQA 3QJ5A 1V7QA 2WINI 3U60B 3DOOA 1M2VB 3FJOA 3H0KA 3DE5X 2QYUA 1LLFA 1OXKB 4J76A 1WVIA 4IDBA 2HU8A 1MUUA 3BRCA 5U4XA 1YCDA 3RU7A 2PKRA 2H1RA 3DULA 2AFRA 4PNZA 3CVQA 1TZMA 2Z4RA 4YRJA 1QHSA 4CLHA 2J87A 3NTRA 3QITA 3TQQA 4QBIA 4C6SA 2F8TA 1Y1LA 3DWEX 1M73E 2W9XA 3AL0C 2A0YA 3HBFA 2O23A 2OGZA 2GCGA 2WZBA 3EQ9A 4I08A 3PDHA 1EVIA 1Y9ZA 3D4PA 1IM2A 4IH9A 5CX4A 5BOVA 5HRAA 3SXUB 2HXSA 1T0PA 4ND7A 3EMBA 4L8YA 3GZ1A 3IQZA 3TOSA 2CBZA 5C80A 4J29A 2IEAA 2BTOA 4W99A 3WGKA 4EA9A 1JG6A 2QN2A 1TJ5A 4G11A 1COWA 2QM3A 4G84A 3Q9NC 5E1MA 5AQBA 4LWZA 4TV9B 1ZS9A 5TQ0B 2QTGA 4C43A 2X3UA 1I4WA 3QVLA 2VHEA 4KQIA 1N4QA 3CVYA 2PKYX 3S7FA 4YP7A 1GL6A 3PSAA 5KMGB 3H18A 4EDHA 3H4MA 3AKZA 5B53A 3UC5A 3DLCA 1K89A 4Q9IA 1XCGB 3DZ8A 3UG6A 1CQWA 1TAUA 3I52A 1M0WA 1U4NA 1G41A 1Z6YA 4G1CA 2VWQA 3A11A 4CNQA 2FR8C 3HBLA 1N6KA 5D51S 3B89A 2R68A 3IQHX 2LDXA 3PC4A 1J1IA 3TGPA 2PGLA 4KW7A 3DAOA 4B7UA 1NVBA 2LTAA 1LWNA 3I5MA 1DX4A 5K03A 3PLAE 2ETXA 3O38A 4TSFD 4YGYA 1F1BA 2FN4A 3PX7A 1NAIA 4V03A 3DOCA 4GBMA 1KT1A 3PZRA 1EYHA 2Z3ZA 2WXOA 4M8IA 1QC5B 4YMLA 1XHEA 5TRTA 1VL8A 1JDUA 2C9MA 1D7AA 3IUMA 3MW8A 5G1NA 2Q50A 4M86A 1CZNA 1UC8A 3K5IA 1EUCA 4MTLA 4GTSA 5K3SA 5KYKA 2R5NA 3SD7A 2Y0DA 5D3ZA 1AZLA 4PBSA 1M2WA 3IESA 4D74A 3EZ9A 1XPRA 3TQHA 3AETA 1YIOA 4ND6A 1GU0A 1K9VF 3RVLA 4B7ZA 1KYVA 4BMYA 4G5SA 2O1WA 1P17A 2BDEA 1NJ8A 2Q2OA 3KTFA 2ZVQX 2WVGA 3QOFA 3T3HA 2CDRA 2QDXA 4QEZA 1QYMA 2Y2UA 4UWFA 4GRAA 1HUQA 3S2YA 3ROXA 4DCOA 2YVAA 1I8TA 5ESDA 4PLWA 4JB0A 2IQCA 3B13A 4UWLA 2QAGB 3K9WA 4Q24A 1IQRA 5A9SA 4RC9A 3D7MA 4YCJA 3S7ZA 5KDLA 2DUNA 1LXCA 1WQ1R 3BJRA 4UAUA 2I4OA 1JEEA 1A8IA 4J1NA 1AE1A 3HXQA 2J4DA 2HHJA 2HLDA 3GPIA 2IPLA 4WAUA 3QJZA 1XNFA 3HKBA 1YQGA 2AHRA 1ESMA 3Q73A 5AUOB 1BS9A 1E8MA 1DC5A 2PD3A 2BHNA 3HPRA 3OU2A 4AWBA 3GK3A 2UY1B 3ZWAA 5G2NA 4JI8B 1JQBA 2BE7A 1DHRA 2R1UA 1YONA 5F33A 2P11A 3T4EA 1D07A 1YO6A 2HEIA 1OBOA 5BPPA 5AI0A 1Z0FA 3X2QE 2IFTA 4BO4A 3SOZA 5BR7A 5E2BA 5KWIA 2QTLA 3G13A 3C0KA 1E5QA 5LL6P 1E1KA 3D2AA 3BFXA 4FKMA 1XDWA 1CJVC 5I9BA 1KC3A 3FB1A 3VBCA 8ABPA 1NZDA 1JDZA 2I4RA 3LSTA 4F92B 4JLPA 3O4VA 3W6OA 5CURA 2C1ZA 1UWKA 2IQIA 1B1AA 1NSYA 2WIAA 2EFDB 5F2OA 4AURA 2LCQA 4ZIRA 1P9LA 1E64A 2FMHA 3FFTA 1OBCA 4WJKB 5IDVA 3RC3A 1L5ZA 3A1VA 4Q1DA 2EFYA 4NE7A 1RWQA 3I45A 4YUZA 4RYLA 4ZARA 1LW7A 4TQGA 2OQVA 3UTCA 3PREA 1U2DC 4WCVA 3O3NB 1Z0AA 4PHFA 3LAWA 4ZCRA 3B9PA 1WG8A 3ND5A 4QUJA 4QGBA 4QXQA 5EXTA 4ZCLA 3EG9A 1P3JA 3PTZA 1LBIA 4Z7QB 2HJGA 4MVWA 1T91A 2WQ6A 4D97A 5JXWA 3O2SB 1UINA 4NTZA 3UUFA 4P36A 1EBBA 3EEYA 5CRVA 4YDOA 3TAUA 3E9YA 1FDTA 4EGFA 4BN5A 5HZGA 6ABPA 2CJFA 3OLWA 3T7SA 3F74A 3NHZA 1X6VA 3WYEA 2GZAA 2O8VA 3MINA 1R37A 3MXOA 1RT9A 5EKQD 4XOIA 1SY7A 5KYUB 2CG2A 1FJ2A 4E7OA 1M0TA 2OYSA 1DRWA 2QLTA 3IVGA 4BIIA 3BKWA 1AXRA 2FB9A 1E1QD 1L7NA 2WYOA 1A7JA 2NZYA 1XV5A 1FDIA 1CZOA 3RLIA 1NG9A 3NTOA 2P0AA 1ODLA 2Q3DA 3WLRA 3FUJA 1E2UA 3VC7A 4TLMB 2OMKA 4KYVA 5KTMA 5E2AA 1QFXA 2QRKA 4JYBA 1J00A 1E2MA 2RFMA 1ZAKA 2I2FA 4JMLA 1C14A 4L5YA 4QVKA 2OZLB 3LO8A 1VM6A 2O8FB 3UV7A 1QG2A 1D3AA 3T7RA 3TXXA 4QG3A 2CXPA 5DBHX 2HQOA 1BFKA 3LPMA 5CDUA 3ZIDA 1N0IA 4WKCA 2Q07A 4HNTA 3HKCB 5KVQA 1RKVA 1QYIA 1IXSB 2PBRA 2F8XK 2BM9A 3LH5A 3LYHA 3P9PA 3BWXA 3H2JA 4FE4A 4FGLA 4RLFA 3OZDA 4TXJA 2XBMA 3R7BA 3CG0A 4R1NA 2V4UA 1MRSA 2IITA 3TLJA 3BB3A 2X13A 1VJGA 2AX3A 5HK8A 4YVQC 4F46A 2ZANA 1QZXA 5CT6A 2A3RA 4RTRA 1E3LA 3QPWA 1XZAA 2V7TA 4KR3A 2R79A 2WXRA 1I2CA 2BSXA 4MQFA 3OM8A 4KVFA 1CDZA 2Z3WA 2FW1A 1QUEA 3V8QA 1MOQA 3V2GA 2KZTB 2HD4A 2WTNA 2O0MA 4KR6A 4QOSA 5JFOA 3DEKA 3FMGA 3ZWVA 4TRNA 1PAUA 4GC9A 5L4NA 3U40A 1GPUA 4NDNE 4EJFA 2Q1UA 1PN3A 2D1SA 2XQ0A 2E37A 4L2IB 1ZH0A 4HLLA 2VPIA 3SPXA 3UATA 1I10A 3FR8A 4W6ZA 5BORA 3HIZA 1OZGA 2O1XA 1KK3A 3CZ9A 1CUGA 2YZ2A 4Q3LA 3KSMA 2EG9A 2E6KA 2XUKA 4JDPA 1ECCA 2PK3A 4LVCA 2QW0X 4H7HA 2ZRNA 4PG7A 3SSMA 2P68A 1DJNA 1IE3A 1L5SA 1OX4B 1ZJ6A 2HBZA 1NVKA 5FI3A 1R4NB 3A1WA 4I3HA 3VKWA 1C2YA 4F7AA 5AHWA 3HEBA 2J9QA 2CFIA 4EPTA 2BEUA 1WB5A 4GPAA 5B4VA 4E88A 1XDDA 2ZXUA 1UIRA 4HNQA 5CH5A 3UJ7A 4DUIA 1E1LA 1A9TA 1XD8A 3QU7A 1USWA 4OXIA 4B9AA 4BNUA 5JDIA 1J56A 3Q41A 2HE0A 1IVNA 1H94A 3PX3A 5JCOC 3AG3E 1KFKB 5CFRA 2BEJA 3Q3JB 3LQFA 2VDQB 4IG9A 4LSZE 4HB3A 1E3WA 5EIBD 2AQKA 1XA3A 3ZYLA 2ZTMA 3MHTA 3AVUA 1TEVA 2Z6QA 2VIIA 4LYFA 5HM8A 3A3YA 3M6LA 3IL2A 1BNCA 1KU0A 3W6UA 4BFXA 3QA9A 3IXQA 2G17A 5CBKA 3ULQA 1JI0A 2YHSA 5MFPA 4Y1FA 4OK5A 4X1KA 3DXMG 1S70B 1OSNA 5AH0A 5CP8A 4AF6A 1G38A 4ZCSA 1ZVKA 3BL6A 3C41J 5PNTA 4Q34A 3CHYA 4O2BF 1J23A 4PZ0A 5B3JA 3A9SA 2O1EA 3DTVA 2CNKA 2BFOA 1RXVA 4MCAA 2Z8ZA 1ANKA 2R1VA 1R7RA 4LNBA 3CEMA 1FC0A 3O1HB 1YZHA 4KSCA 5DSZA 4YRPA 5DNYB 1KJQA 4OXQA 4PBRA 2VSNA 2JI7A 4O29A 4TV8A 3RUCA 1RHUA 3I04A 4KNYA 2O54A 2IOLA 5EWJA 4WBNA 1UCFA 3AIIA 4L9WA 2O50A 1XMPA 3PK0A 1P0QA 3A9VA 3SZOA 2VHWA 1CVLA 3UKOA 1K98A 3VMMA 4S1PA 4DPKA 1C7EA 2ADMA 1KZPA 4FIZA 4F04A 3ET5A 3MD9A 3PQCA 4PC1A 7MDHA 1I7QB 4M7CA 1USIA 1P9RA 2IYUA 5E6SA 2B78A 3RNOA 1JG4A 4NAVA 3R8CA 3ZWNA 4A4DA 4YPVA 4OH7A 5EI5A 2FRXA 4U8HA 3DE4X 3SF8B 4YBRA 3EPKA 2NIPA 4BCCA 4DLZA 2X0DA 4EBAA 2PJUA 3RVQA 4TM8A 4PHCA 1MVNA 2P77A 2LXMA 3ENEA 4MIKA 1DWUA 2XNKA 2AZMA 2VBGA 5JWOA 2X7XA 4WNFA 1APBA 3IAUA 1NU8A 5WRFA 2BMWA 1LDMA 1KP3A 3TI9A 2JJ2D 2G04A 3EXIB 4JBIA 3ZVRA 4BNZA 5KJ6A 1PFQA 2WTXA 2QT1A 2QTCA 2R1TA 4NK4A 3S99A 4ZN6A 3KE9A 4JI0B 1A77A 2AW6A 5IWAB 1KRWA 4BEPA 2VF5X 3UGQA 1E6UA 4MRMA 3JAMA 2ZUEA 4DR2B 3PEUB 1OJLA 4AP6A 3ZZNA 2QG9A 1RP1A 5T4EA 4BU1A 5LJLA 3Q10A 1EFVA 1JWBB 1AO0A 1C29B 3L7DA 3IJEB 3R6LA 2DHDA 4RHXA 4R9SA 1MGPA 5LLSA 1BFDA 2IY0C 2QW8A 3COYA 3HFSA 4M0EA 5EE5B 3JSAA 1I30A 4FUQA 2OY0A 4WLUA 5IVIA 1K2VN 1U0TA 2FW9A 3HGMA 4U8GA 3LY8A 5KEIA 3KZNA 1HZ4A 4DNQA 3IILA 3SEZA 3R7NA 3UT5B 2J0SA 3UINC 4EL5A 2J5XA 4CMBA 5FBKA 2DQSA 4MPDA 1TU4A 4G5QA 1NULA 1UR5A 1OLXA 4DDWA 2BFPA 5BQ5A 4EFNA 4LTMA 3ICOA 5KAPA 3V30A 1GPYA 5TJ9A 3WBBA 4WWPA 2J5KA 5T3UA 1Z6TA 4HEJA 1TVKA 2WF7A 4B40A 4A2PA 1B42A 3HBJA 4M9QA 4FDAA 3UJCA 3U9SA 4J0HA 3WYFA 3RJTA 4AKHA 1IXKA 1NR5A 3Q9UC 4ZODA 3C4QA 4G09A 5EWMA 1GGEA 3NGXA 2H31A 4MW9A 1GGMA 5THXA 1MX6A 3ETLA 3U3OA 3CEPB 3DMRA 4HZIA 2YH2A 3GVXA 5J3JA 2H07A 3FTEA 2WMYA 4B3XA 5H0IA 2WM8A 2ZDQA 3SVZA 1K5DA 1TW3A 2H4XA 3FH0A 3O9ZA 1J9ZA 2WDPA 2GWHA 1UG3A 3E1GA 3EXIA 3L0PA 3P2JA 1YHZA 1AY0A 4MYUA 3TJMA 1ZMTA 2I6GA 2JJ2A 1A04A 2ZYSA 4LCTA 1ATZA 4BFCA 5F9HA 2V4HC 3DD1A 3S2AA 5AQ1A 2GCOA 2PD6A 3RSCA 2I2BA 1RXSA 1MIOA 1TUEA 4AJIA 1HFAA 4BNHA 1NI5A 8OHMA 1Y4ZA 4E6HA 1FFEA 1R4MB 2BDTA 1F48A 2GRUA 2Y1OA 4JBXA 4YP1A 1RM0A 4H7KA 1CUFA 3BEOA 3ZYMA 5SZIA 5A5VA 3G8DA 5LR6A 2V8SE 4IRMA 4R1MA 3ELYA 1U0OC 5GQSA 2YINC 3NTUA 4CE6A 1N2IA 2ZULA 3JD1A 1M6HA 4YCAA 4TKZA 3C4JA 4TSRA 4D8VA 1SWVA 1JDSA 2NYAA 1KMHB 3UFXA 2E9SA 3LLVA 4HNGA 1GL9B 1TM7E 3A10A 3TQFA 4V0OA 1WW8A 4BFWA 1CEQA 2OBMA 3KZXA 1V7ZA 1C5KA 1D2NA 1X86B 2ZYUX 4YJGA 5FPHA 4A8HA 5LX8A 1MT0A 1THGA 3CN7A 1J21A 1YH3A 3L49A 1IZZA 4QWWA 5HMLA 4ZI5A 1I2AA 4D9HA 2QUAA 1X7GA 3OJFA 1CT9A 4KRYA 4DX6D 3FDXA 4MNTA 4NS1A 4OQMA 1YS2X 2WU3A 2CBXA 2Q27A 2XZTA 2II6A 3H5AA 5LP6B 1NQWA 4BHTA 4DC0A 1ZEMA 4DWWA 2LNIA 5DOZA 5L3ZA 3DVRX 1RCUA 3E9EA 3DE1X 4AVXA 3WGQA 4NXMB 3W90A 3T9CA 1WKVA 1TNZA 1JJBA 1JL3A 2EP5A 2H2AA 3IAM6 1FYWA 2WU4A 2OAGA 3HCFA 2GRNB 2JGNA 3P9ZA 5EZ5A 5LKAA 1EFUA 5HR5A 2CLKB 4YRZA 5CU7A 2G1PA 2OSBA 3BXEA 1WBBA 2HIAA 3I2IA 4EKGA 1GCAA 2XVYA 3HVKA 2VPWA 3LUHA 3MC1A 3MINB 4GZ6A 4GMDA 4UCQA 1RBZA 1OZAA 3TNDA 4MQLA 4I9CA 1ZIDA 3N7UA 3ABQB 5U1PA 4P4TA 1YC2A 3PEVA 1U8AA 2YASA 4L4XA 4A8TA 4D98A 4N8SA 4BP3A 4HDKA 1JIXA 3L04A 4MYSA 1K3ZD 1SQGA 2CMHA 1IIBA 2PLNA 3B1KA 4LHXA 4B32A 3ZN3A 3HI6A 3ADBA 1M5RA 2AJCA 3AVWA 2O8EA 2FEPA 3GEIA 4TT3D 4I4NA 5JEDA 4MUHA 3ASNE 2C00A 4EOGA 2YR0A 4HS4A 2XENA 3RPEA 3WAJA 1Y8MA 3PLRA 1GNVA 1MH1A 1C4WA 1SMKA 2P69A 2XY4A 3C1AA 3V2XA 2AXPA 4TKVB 2NWQA 3F5QA 4PZ9A 3BGVA 3NDIA 2QTTA 2HDHA 3CRW1 4LE1A 2XDWA 2PRYA 5FJIA 1EX9A 1FYXA 4LPKA 5ICSA 5JNSA 3VGPA 1YMUA 2I6QA 1RTKA 4L6IA 4ZVMA 1XZIA 5LZ5A 3D7KA 4HL6A 3ASFA 2OORC 3TTXA 3BILA 1Q14A 5G1PA 5BWOA 2GZ3A 3A26A 3LV8A 1ND5A 2QUIA 4R6WA 4U3JB 1EI9A 1UBJS 2W2TA 2WG1A 3EXHA 3FVQA 4FZVA 3WK9A 1JAHA 2QMEA 4BVJA 3Q8WA 1UBLS 2H5LA 3A7DA 3O6VA 4B6FA 4N5HX 2C31A 2KZTA 3CVLA 3A4LA 4IOMA 4YP0A 4Q7LA 1NBAA 4UARA 1AS2A 1BVHA 2H1HA 1T0HB 2ZRBA 3P9YA 4G2TA 3F0TA 4OB6A 5DX1A 5ITSA 3A3PA 3Q8LA 1U7HA 3ES9A 2YZMA 3JALA 4JU9A 2YNMD 1ST2A 1XTQA 4A55A 1QQ7A 1E63A 1UXJA 1RW2A 2F1HA 2IHZA 3FXAA 4WEQA 3FWYA 1UJ5A 1C7QA 1CZKA 2CXQA 3SKXA 4GKJB 5LBIA 2BGGA 3FOEC 1RMQA 1CKEA 3CBGA 4RK7A 1Y1KE 1IG0A 3QJGA 4IQFA 1NVVR 1IONA 4V3IA 1GRVA 2C4VA 2RJNA 2ZRIA 4MRUA 1A69A 2NACA 3FYUC 1TIKA 3AP2A 3U56A 4E5PA 1WLYA 1Q0LA 4B83A 4MQFB 4E4TA 1JDPA 4GZLA 5GIPE 4I4TF 5ES3A 5BY2A 5EYLA 2YN0A 1NL4A 1KZ9A 2Q6VA 2RI1A 4G85A 5J40A 4KE9A 1CUBA 4RY8A 1BGVA 2A86A 3QLVC 1NGSA 2W0MA 5I7OA 4WY8A 4UULA 2CN1A 2BGKA 1TKAA 2H3HA 5DTRA 2ZQ5A 1WMDA 2WC1A 4PO8A 5ANRB 5HF5A 3KAQA 2AR0A 2BM1A 3BIXA 3L6UA 3MUEA 3FHJA 2ETCA 1NVEA 2EJBA 3H9GA 2XOKD 3OLZA 1A96A 1I9CA 1Z12A 2VPZA 4K2HA 4DLBA 5K20A 3IODA 2OO3A 3PDWA 1BRTA 2VJNA 5AWFC 3UMGA 3IOBA 5EY5B 1GKIA 5GJWC 3H4VA 2ZYTX 3FHOA 3HUTA 4MV1A 3KAPA 1DKMA 4NPAA 1UFVA 1FVOA 2OZLA 2QIOA 1UT6A 5CIWA 3UJ6A 4B7AA 4C7VA 4KZPA 4KCGA 1PF7E 1KMMA 5DM4A 5F7OA 4NBRA 2RKOA 1CJTC 2W98A 4Y2RA 3L9XA 4KI7A 1JLHA 4HRAA 5C8DA 1GV0A 2JCVA 3G2MA 4NZYA 2RK3A 4RD6A 2GYUA 2M6KA 3IQGX 2WLSA 3B7PA 2C5LA 4MW2A 5BO5A 4B3JA 3O2NA 3Q15C 4C2UA 3G2NA 5IKXA 4L76A 5FFMA 3QNMA 2PH1A 2WTAA 3JR3A 4EGJA 2E4ZA 1A8SA 1VJ0A 4B6EA 4DKJA 4Q69A 3DZCA 4RKQA 1K8XB 2C0CA 2TSYB 3DCNA 4KPUB 2UUAB 5DTEA 4RZQA 4NOKA 2CDCA 2D8AA 4PANA 1Q3TA 3OP1A 5KYNA 5JI3E 3AF0A 3CVWA 2C42A 2VQDA 2WT4A 3BJIC 2WF9A 2H16A 3IRVA 1WF6A 2WD9A 3DDUA 1CY4A 2F9LA 2I6UA 3I8SA 2IYZA 4NKRA 5HG0A 4U8YD 4R2LA 4HATA 4UCXA 5SYNA 1H8EA 1NZFA 2MSWA 1NZJA 3E2MA 4AZWA 4E21A 1SG0A 1LNZA 2GETA 5J4LA 4RTKA 1GRRA 3IMFA 2UWJG 5M72A 5IWCA 5DYNA 4I2VA 4ZZ1A 2OXCA 4CKWA 4G6ZA 4CGZA