4MLPA

Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
492
structure length
492
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Cryptochrome-2
publication title Crystal structure of mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase.
pubmed doi rcsb
source organism Mus musculus
total genus 179
structure length 492
sequence length 492
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4mlpA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4mlpA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mlpA01
4I6GA 1BS2A 1JIJA 1F4LA 1T6XA 2QJOA 1ILEA 3D6VA 3N8HA 1WQ3A 1ZUNA 1N3LA 1WJGA 1WXIA 1SURA 3UK2A 1R6UA 2VXOA 2Z09A 1RQGA 1QU2A 1IQ0A 2TS1A 3UMVA 2J09A 1VBKA 2WSIA 1LI7A 1IHOA 1M83A 3HGMA 2VTBB 1NYLA 1R6TA 4EG3A 1JEDA 1H3EA 4ZT2A 2VTBA 4ZT5A 1GTSA 1J1UA 3CVUA 4K03A 1MAWA 3IVGA 1O0CA 4NAUA 3MLAA 3KFLA 1TFUA 1OWMA 4DDMA 1F7VA 1KH1A 1Q77A 3PNBA 4R2MA 1O5TA 4MAFA 1MJHA 2QUKA 4TS1A 1D2RA 3VU8A 2ZP1A 1MOPA 1TQ8A 2CFOA 4UZFA 3NV7A 1NUTA 1WY5A 1ZH0A 2ZUFA 2D13A 3ZGZA 4QBTA 3PNYA 3ND7A 5FO0A 5K0TA 3Q10A 3UC5A 1IVSA 4EG8A 1KKUA 2QJTA 1MRZA 2RD2A 4HJRA 4MW6A 4YMIA 1WKBA 2IP1A 1GPMA 3N05A 1XNHA 4NAHA 3FG9A 1IQUA 2QJFA 2A1TS 4ZCQA 5IHXA 4ARCA 4EG6A 2HGZA 3CA8A 2WQ7A 2CUZA 1YULA 3VGJA 4G5YA 1EFVB 2HMAA 4NX2A 1DNPA 5FNZA 3X1KA 3SEZA 4WNYA 1S4MA 4MUGA 4MQ6A 1OD6A 1ZJWA 2E89A 2I1LA 1F9AA 1G8FA 3KT8A 4K0RA 3X1JA 2QTRA 1TYDE 3UY4A 4JXXA 2PZ8A 3FNRA 1F7UA 5EKDA 4R2LA 1NZJA 2J08A 1M8PA 2X0KA 3PXUA 1Q19A 1PFUA 2D54A 1MAUA 3AG5A 1JEEA 1KAQA 5J5AA 4I6JA 1COZA 3CLUC 5BNZA 4AQ7A 3N9IA 2WB2A 1WXEA 1WOYA 1J20A 2CSXA 3FY4A 4WSOA 2G36A 1O96B 1JZQA 4MUIA 3CLSD 1JZSA 1QRTA 4EFKA 3JXEA 3MLBA 2DPLA 3K32A 1CT9A 2R5WA 1O96A 4L2IB 1QTQA 3IMGA 3COYA 4MUHA 4MUFA 2IELA 5FO1A 3ILVA 2J4DA 5DB4A 1O6BA 3G6KA 4OJMX 3L93A 3CVVA 1N2BA 4L2IA 3SZGA 2BTEA 3GMIA 2JA2A 3AFHA 3COVA 1Q11A 5DASA 2X1MA 4MUEA 1NUPA 1U3DA 3ZUGA 1G8HA 1TYBE 4MW2A 3CLSC 2A88A 2H2AA 3HZRA 4Q93A 4AS1A 1LI5A 2Z3VA 2DERA 4XFDA 4YP6A 5LM3A 2A4MA 1N77A 4R0NA 3SDBA 1Y42X 3HL4A 1XJQA 4KR9A 2OQ2A 3H97A 5K0SA 1EFPB 3GLVA 3FOCA 1N1DA 3SYTA 1GZUA 1QJCA 5J58A 3U1VA 1EUYA 1H3NA 3TZEA 5KWVA 5HUHA 3ZXSA 4Q16A 1I6MA 1EFPA 3C8ZA 4MW0A 4PBTA 1M8GA 3A2KA 3UOWA 1O94D 2GM3A 3H99A 3CLRD 4S1OA 3TNJA 1IQRA 4MVYA 1EXDA 2DUMA 3CVWA 1KP2A 4MUJA 4YP7A 1IH8A 4OUDA 3IDFA 1YUNA 1VLHA 1GN8A 3IH5A 3F3MA 2BYTA 4J76A 4MWBA 3Q12A 2DEUA 3M5WA 3ND6A 4F4HA 1QQTA 3FDXA 1I6KA 4DDKA 1T6ZA 1MBZA 1N2EA 3QTBA 4NATA 4ND7A 3PNVA 4ZT7A 3L92A 3TS1A 3X1MA 2DR2A 1Q15A 2YWCA 3LCJA 3CLRC 1QU3A 3IUBA 2XRZA 2E21A 1YUMA 4MWDA 3NBKA 1T9GS 1QNFA 1J70A 1H1TA 1NUQA 3A05A 3HFJA 3SZ3A 1EUQA 2CT8A 2EJCA 5KHAA 4NZPA 3VRHA 4KPUB 1U0BB 1FYDA 4ZT4A 4P2BA 2RE8A 3SP1A 1PFWA 4MWEA 4PBRA 2O5RA 1WXGA 1WZ2A 4MUNA 3FI0A 4E1AA 2GKSA 2CV2A 4KPUA 3K9WA 3RBAA 3D6UA 1O0BA 3LOQA 4DLPA 2AG6A 2QUHA 2H29A 4EG1A 2NSYA 3QE4A 1TYCA 3IODA 4ZT6A 2Z08A 1YI8A 1MC1A 1OWLA 2CYAA 3SEQA 4JYZA 1JHDA 1JILA 4CT0A 3MXTA 1A8HA 1PFYA 1JIIA 1V47A 2A1TR 5F23A 5LLTA 3DPIA 3PRHA 2AZXA 3LE8A 5JBNA 4EF6A 3IUEA 4HJXA 1J21A 3DLAA 3CVYA 2QUIA 3COZA 2HZ7A 3IOEA 4ND6A 3H9CA 3P0JA 1G59A 3OP1A 2C5SA 3FH0A 1B6TA 2OV4A 3MUEA 1GAXA 5J59A 2E18A 1KAMA 1XNGA 3MMXA 4KR7A 3ZIUA 2PIDA 2X3FA 1R6XA 1ZH6A 1K97A 2DLCX 1N75A 2NZ2A 4H3SA 2EL7A 3FETA 1NP7A 2A84A 3KT3A 4QRDA 4I6EA 2X1LA 5DEOA 4CDMA 3CVXA 4DE5A 1OWNA 5TS2A 2PFSA 1OWOA 1VBNA 4ZCTA 1X6VA 2E0IA 2CV0A 3ZJUA 5H16A 1GLNA 5HUJA 4EG5A 1U7XA 4BWVA 1HYBA 1OBHA 2PG3A 1QRSA 3H9BA 4ARIA 2J07A 3INNA 1VL2A 4NDAA 2DETA 2JAXA 3RHSA 5KCMA 2A7XA 4OUDB 1P7PA 2YXNA 2YWBA 4G5FA 4CQNA 1I6LA 3IMCA 1MB2A 4PY2A 4ZT3A 1JGTA 2PZAA 3FWKA 4DNXA 1I2DA 4MW9A 2AKEA 1VBMA 1XNJA 3CLTD 3AG6A 3P52A 4MLPA 4MVXA 1NURA 3G5AA 1UFVA 4MUKA 3I05A 3S3TA 3A4IA 1YIAA 4MW1A 1PG2A 3ZJVA 3TQOA 1GTRA 4MWCA 4ZCPA 5H7XA 2ZUEA 4KR6A 3ZXIA 2B7LA 4J75A 3ELBA 1O94C 4EG7A 2GOYA 1NSYA 3Q4GA 5IJXA 1M8FA 1NUUA 2JANA 4MW7A 3ZJTA 3RK1A 5TEVA 3HMQA 3FIUA 2IJGX 3QTTA 1KQOA 1N2IA 3KT6A 4DJAA 2PZBA 5AHWA 3CLTC 1KR2A 4U63A 2PXHA 2V0CA 3NBAA 4JZYA 3RJZA 1M1ZA 5HG0A 1KQPA 3IVXA 3G59A 1O95D 1K92A 2O8VA 4CDNA 4MW4A 1H3FA 1FFYA 2D5BA 2A1UB 4XFJA 1QRUA 2A86A 3IOBA 1MB9A 3IVCA 2J5BA 1U3CA 4DDHA 1IRXA 4A91A 1KP3A 1T6YA 3N2YA 4RUKA 2A1UA 2CV1A 1TEZA 3OTWA 3RFFA 1T9GR 4GRIA 1NI5A 4RPIA 2V0GA 3CLUD 3H05A 3TQIA 1PG0A 2CYCA 1V8FA 4HK4A 3IMEA 4MVCA 3P0IA 4UZEA 1O95C 1NUSA 1N2JA 3E27A 2CYBA 4YP5A 3HV0A 1KQNA 2YY5A 1EE1A 3DV2A 1N2GA 1WXFA 1K4KA 3AIIA 1EFVA 3COWA 4X0EA 1O97D 4JFAA 3IOCA 4MULA 4U7JA 4XSVA 4MW5A 3ISJA 3DO8A 5DK4A 2DXIA 4HPWA 4G6ZA 4EG4A 3AKZA 1OWPA 5LFAA 1EJ2A 1KH3A 1JECA 3P0HA 3CR8A 3AL0C 1K4MA 1KH2A 1G8GA 3FHJA 1TYAE 5TEWA 4YBRA 1LW7A 3RK0A 1U7DA 1X8XA 4EGAA 1N78A 1J1ZA 1OBCA 4FZJA 4QREA 5TGTA 3TZLA 3A04A 3ND5A 4GU5A 2QTNA 4JXZA 3KT0A 1N2OA 4U8HA 1ULHA 2QUJA 2XRYA 2QTMA 1JMVA 1M8JA 1O97C 4ZCRA 4F3RA 3GUZA 1N2HA 1IFXA 4ZCSA 2WQ6A 1JIKA 4PBSA 1PFVA 3BL5A 4KKVA 1WQ4A 1J09A 4MVWA 1KORA 1WXHA 1YIDA 1M8KA
chains in the Genus database with same CATH superfamily
4AU1A 4A1OA 2DWQA 4FHDA 5ARBA 2H0AA 3BXZA 3EZYA 2O6LA 1Y6GA 3NTVA 3SNKA 1CUDA 1XWWA 3EUAA 5KTNA 3IJ5A 3HGMA 4U39A 1SXPA 3O3OB 3W6OA 4EG3A 5ES3A 3HRAA 3CUKA 3H2IA 3AYXB 5KB3A 1K68A 5LCWC 4P36A 4EX6A 3N6RA 1C2YA 5EYPF 2VQFB 1IXZA 1P9RA 1L8QA 1EQ2A 2HN9A 1YZYA 4IOJA 3LRPA 4C43A 2V1UA 4L7VA 3W4IA 2YMLA 2NO0A 2ET6A 4DM4A 1RVDA 3NKLA 4UAGA 4LHZA 1PLKA 3N2GA 2FK8A 4XEIG 1LBEA 1YZNA 3DR3A 4U00A 3VBEA 3GT7A 5C8ZA 1T91A 1T34A 3NX4A 4YAGA 3G68A 3BGDA 1NT4A 1XPOA 2FF7A 1E3QA 3B9QA 4P5DA 4IXMA 4M87A 3PRYA 2QDKA 2PUTA 4WK2B 3H17A 5LP6C 4AQ7A 4ALMA 1NL4A 4BNIA 5HRCA 3DOJA 2JNWA 1R4ZA 1CT9A 3MJEA 1HLGA 1OHHD 1MOZA 3V2GA 1FT2A 4YNDA 1XLTA 4ER7A 1V7QA 2JA2A 3H1GA 4JC5A 5EQDA 3QX7A 4LZZA 3RBXA 3ESXA 1L5RA 3BJRA 4LWOA 2ZBDA 1UJCA 2D3WA 2VWPA 2O1WA 2VQ2A 3TBFA 2AB0A 3KXIA 3RKSA 3KEGA 3KXPA 2HJGA 1GPBA 4DOMA 3O8OB 3RKVA 2NU9A 2H06A 3FMPB 3R9XB 1C9DB 1JWFA 4FGWA 3KSDO 1M0WA 1FVXA 5E2AA 1IBMB 3QKRA 4G89A 2FUG6 3OT4A 1H6OA 1V0JA 3ER8A 3TSWA 2QPAA 4I4NA 1Q5PA 4OLFA 3EEYA 1R5JA 2JD0A 4PLCA 1CVRA 3MJDA 4R1NA 2UZ0A 4RSYA 2CYAA 2B4QA 1PUJA 4GMDA 1GZHB 3CVPA 3KUXA 4JJFA 3QWPA 1UWCA 1H6DA 3VSEA 3BBPA 1IEWA 4Q7JB 2WJPA 5CGZA 3AI3A 3Q7QA 1DBPA 4H1UA 1DCFA 3HEAA 4BE7B 5JT1A 1KOJA 2JLXA 2EHJA 1M2GA 1GYPA 2ST1A 3ZHSA 1QE0A 3WL5A 4M8LA 1TVKA 3HO6A 2GDZA 1P2BA 1M2OB 3SM3A 1UKCA 3BWXA 2QG4A 3A58B 4L8FA 4WW0A 3OCVA 1SCNE 4MK4A 4M3NA 5B58C 1FL9A 4I9FA 4EB6A 4MHTA 5JU6A 4X44A 1QIMA 5A05A 4F04A 4H7XA 1R50A 5IEBA 2FO7A 4BVGA 2IVFA 3DNMA 4APFA 3PZBA 4CVNA 4BNMA 4OQNA 3ZX4A 2I7CA 2VYND 2IZZA 2IJGX 2R5FA 8GPBA 3ZHUA 1CUIA 3PF9A 4E46A 2ZB7A 4DKJA 2ZYRA 4RELA 1U3GA 1X70A 4CQMB 4GI2A 1OJ7A 2Z2IA 1JEAA 4HAIA 1OU0A 4CT4B 3HS3A 3AS8A 3H05A 3ZQ6A 3IMEA 1Z6QA 4TMKA 1N2JA 2ECKA 5IY5E 2XAAA 1W2WB 1WM1A 1Z56C 4GXQA 1H8EA 3PEWA 1YZUA 4F1JA 1AUVA 5F1KA 3WRYC 3LUJA 1KEZA 4PZ9A 1Y1RA 5FJYA 4ZV9A 5FR2A 3ADCA 2FB9A 3DDOA 4ZCRA 3WDSA 2DH5A 3FVRA 2QW0X 3ZWKA 1XZMA 5JHAA 1P5JA 4ACKA 3ZY4A 2YXLA 1HO8A 5H0IA 3M6VA 3B6JA 1LH0A 1ZO8A 3NLLA 3QM1A 4A2CA 5K05A 2C8JA 5FQ8A 4DA6A 3VTXA 4LGMA 4TL6A 1CV2A 2DCMA 5BRNA 3K6SB 1AY0A 1JPNA 1MB4A 1E0KA 4KYUA 7MDHA 5AM2A 4E0BA 3MWEA 1MOPA 2W2LA 3UW3A 3NAGA 4J1SA 3V4VB 4UHBA 3QEKA 5ENZA 1ZK2A 4TSFD 2HBQA 3O4HA 3DBSA 3DAYA 2PSDA 4TKZA 2J9YB 5JYCA 3EH2A 4GPKA 4LISA 3LCUA 3CB4A 2AVDA 5GOZA 5F76A 3DO5A 2CUZA 4V2IA 4TTQA 1QYRA 3PCRB 5FWQA 2I1LA 3GH1A 1VI5A 5IXJA 2AJAA 4OBBA 3ZGQA 2W83A 1F7UA 2PD6A 3CX7A 2YBEA 4UXIA 3PDNA 4YAWA 3I12A 2PU7A 4J8FA 4FZ3A 4UEWA 2XKKA 3G5UA 2YASA 1NAIA 5C81A 4RMNA 1Q14A 4LC0A 4RTOA 3QKWA 1UKZA 2C07A 3CZ5A 1TYBE 4YRIA 3PDCA 3GLUA 1DADA 4BHTA 5TDHA 2Q3DA 5JYDA 4EFDA 2D2XA 1ACLA 1CDEA 1ZH2A 2MDTA 3PHHA 4W5NA 3N0XA 1NVVQ 3SQMA 2P0YA 3FFAA 4MWBA 4D43A 4BNTA 3HM2A 1FBTA 5KYXB 5LX8A 4MSUA 4NATA 2BEKA 1EQAA 3C1AA 4RU1A 4KQJA 3HFJA 4XEHA 5GY7A 1PYOA 3TLZA 3KJQA 1KXZA 1NTOA 1G8PA 5KQLA 2WSYB 3DFZA 4KR0A 1DXHA 1MC5A 4OL9A 2ZS9A 4DCJA 1RSZA 2O8FA 1YRQA 1TCVA 1HZZC 2VDMB 2LSVA 4JYPA 5JXHA 1YE5A 2OBYA 4Q03A 2CF6A 2AC4A 5ICCA 1R9MA 5AOVA 1ZXBA 4K9PA 4BIIA 1OE0A 1XXHA 4NPAA 3LBYA 1TZ2A 9ABPA 4KR2A 1O0SA 2GJ4A 9LDBA 3O8QA 5KSWB 4EQFA 3COZA 4MQ4A 3DWIA 2P9IG 1Q1NA 2OC9A 4OEHA 4WNAA 4RIEA 3OIVA 1PVVA 4Y6QA 5JR3A 1MR3F 5CITA 1H2WA 3RTCA 3HEBA 2ZRDA 1F4PA 1EGMB 3O83A 5DEOA 1KO5A 2C2ZA 2R65A 3AW8A 4JL8A 2FLVA 3WXXA 5H16A 5DBFA 3L0YA 1KIMA 1J2JA 5HCNA 1P1JA 2QTAA 2CVZA 4CYMA 4YQZA 3PQEA 1M76A 4RVHA 3ELDA 5CB8A 4Q1AA 1OIVA 3DMGA 4WMLA 3M89A 3DSUA 3AB8A 2AEFA 1JGTA 2H4JA 3SICE 4LWPA 1Z63A 2OCBA 1KMCA 4LHXA 1SBIA 2EG5A 1P4AA 4E2ZA 2OBBA 5G1OA 3OQ1A 4R05A 4M9ZA 5I7EA 1E2DA 2XBUA 3ZZUA 2F6RA 4NBLA 3CHQA 5EXPA 1NUUA 3BFPA 5HP4A 3W5CA 1RQNA 5DW0A 3NQ41 4V2UA 4U6NA 1TIPA 2J6IA 4A0HA 1JPUA 3LDAA 1W1WA 2C95A 3M6WA 1FY2A 3BQNB 3HP4A 2X5JO 1U8ZA 4CN8A 2J5BA 3D1VA 3GGCA 3I01M 3RVBA 4R9RA 1AUOA 5FBRB 2ODBA 5BN5B 4R9SA 1ZQ9A 1BHO1 2BBWA 1UWLA 4BETA 2PANA 2QTWB 1NW8A 5TIIA 4P8RA 5JJTA 4W1SA 3AETB 1K4MA 4KACA 1BCSB 1QYDA 5C8YA 4KREA 1RWKA 4J8DA 1RWPA 4IHKA 2EOAA 2CHXA 4ZYZA 1J2YA 2G9ZA 3GLGE 4NV3A 3U7RA 3MCTA 3QX3A 3E5MA 3N8IA 2EZ8A 2VK4A 3NB0A 3E7XA 4ZHQB 1KO4A 2H5EA 3N2EA 3RJTA 4A6PA 1HSZA 7ADHA 1CIJA 3CPSA 2IZ5A 2B2CA 3HVEB 3S2GA 3N5CA 1YJBA 1G2QA 1IEVA 2IUYA 2C7RA 2CJWB 2CL0X 1U8AA 1KETA 3BM5A 2P2CA 3GN1A 2D1TA 2PKYX 2VHQA 4C5BA 1FDWA 4QYIA 3RO3A 3OUTA 4GKAA 4ZOAA 4JGIA 2Y1DA 5EHNA 1GVHA 4P22A 5IAAA 2QQGA 3RUHA 5BQOA 4U9IS 3GYGA 5A06A 1GPMA 3IESA 3K70D 2QL5A 5MN4A 1HDGO 1IQUA 3GUYA 1OQAA 1MABA 2QA5A 1ZD8A 5CDTA 1YJQA 2H4XA 4FBGA 2PQNA 1FMJA 1G3MA 4MS1B 1RBZA 3DVRX 3RYFB 2A0KA 1IU9A 5ILQA 3VR5D 2AL7A 4ER5A 4IIVA 4RA6B 3P1UA 4IPTA 3DWFA 1YKSA 4EO9A 3B82A 4N12A 5G55A 4YVFA 1EGVB 3P32A 3N0WA 1VJCA 3OPYI 4KRGA 5HJ5A 3T7IA 4U2FA 2CD9A 5ALYA 5L4SA 1MX1A 1D9SA 4JXKA 1E2JA 4E31A 4OQDA 3F7TA 1PRYA 5DASA 5C9ZA 4O25A 3G2HA 1RYDA 2DIWA 2RFMA 4YAUA 1SB8A 3W6ZA 2RG8A 4ESOA 3IAS6 1SCIA 4ER6A 2J9FA 1WUJS 4H0FA 3RSOA 2VK8A 1JHMA 1T1JA 5HUHA 3OY7A 3IEIA 2OWDA 3APFA 4JLNA 4NBSA 1PZHA 4BC0A 4Z4FA 3OZTA 1P7YA 4BEBA 3D8HA 1KHTA 2DSTA 1Y3FE 5L53A 5C7OO 5DSTA 3KUCA 4DBLE 2C7PA 4Q9NA 1FNSA 2ZGVA 4MWDA 3FUKA 1RNLA 1ECBA 1YF3A 2WIKA 4RM3A 2OCDA 4H6PA 3QLVA 1HQYE 4L08A 3RS3A 5KHLB 2ZJ0A 5DBOA 1Y0BA 4IQ0A 4RMIA 1N0IA 3EWSA 3ZHEA 3IQHX 2YWXA 3HYMB 1LRLA 1MDFA 5AJWA 2VHEA 2WAXA 1VRCA 5LMZA 4IJKA 5EQTA 1NN3A 3LF2A 4E7OA 1X1RA 3TRHA 2FMUA 3C4JA 3NM5A 3SSNA 2B82A 1DJMA 1AKUA 4ZEVA 1ECGA 5FL7D 5HIIA 3SLRA 3QHAA 2ZCVA 1XDUA 2KLBA 3P0JA 4K6FA 3HA2A 4LS3A 2XT0A 1JHOA 1MQSA 3HCPA 3I9MA 1GXSB 4M46A 3E9EA 4CW7A 1ZITA 5TS2A 2WQHA 3C5CA 4BMYA 3K0SA 3QQPA 1WUKS 4C3UA 2G08A 4QUHA 1Z34A 3WBJA 4JS0A 4NJMA 2JAXA 3HCAA 1FNMA 3M3PA 3KSBC 2EKLA 4KXWA 2GF9A 2OXEA 2FDXA 4PYIA 3FEYA 2L6BA 3IAM1 1NKVA 1HL7A 2XCUA 3BMOA 2G1UA 1DRJA 1USUA 4A1FA 4REQB 5IS2A 1EIWA 1DIHA 2YMPA 3IPAA 4QPZA 2VDVE 4FEAA 1BE0A 4PNZA 1EI9A 1E2PA 1IBCA 5C51B 2CXRA 3KX2A 1DDOA 1U0EA 3KKLA 2AWNA 4BVEA 3DBLA 1NBWB 3K4QA 1KRHA 4KN5A 3RIBA 3V80A 3D6HA 4I1OA 2WYOA 3UG6A 5CU7A 1AUXA 1QXSA 1Q3KA 2PVCA 1B7GO 3WIDA 5EYLA 4KWCA 3A9TA 3AG4E 2ZGGA 1N2GA 2I1KA 2I87A 4KH0A 4Q1VA 3TTWA 1QOZA 3PI6A 2JIDA 1P2DA 5HKLA 2D8AA 1Z4JA 2EEZA 1FTWA 2Y1LA 2QN1A 2RIRA 5KVSA 1MX9A 2KQUA 1R4NB 1E5QA 1FCJA 3SC2B 4UUPA 3I2IA 2OCLA 3D9JA 3RC9A 4B79A 2F4NA 1F17A 3UH1A 1GGEA 1J06A 4RX1A 2ZIGA 3QI2A 3UJPA 2IBMA 4NHEA 4OHCA 5HTKA 5KNCH 4H35A 4RNDB 2AMJA 1P45A 3ABQB 5IYZB 1E9FA 4V03A 3Q8WA 3WBBA 3CH7A 3UIOC 1L5HB 2OHXA 2Z2ZA 3LO8A 1JAZA 1X1CA 1TQ8A 4QPCA 2WJHA 1BHQ1 1VDZA 1AOXA 4I19A 4F9TA 5EMLA 3LECA 1P4JA 1IN7A 2W2NA 3SPXA 3PP8A 5JDIC 1Y3BE 2K2WA 5A3RA 1RJFA 3CTPA 3EHQA 1EFVB 3CCCA 5ITZA 2X4IA 1X39A 4CMCA 4CTMA 1XTRA 4OU5A 1R2QA 2FW9A 2D54A 2Q9BA 3HUUA 1G8KA 2EKPA 2NN3C 5IANA 1QAMA 4AZVA 1Y1KE 4IDPA 3THYB 4EF5A 3LU1A 3W2TA 3IEXA 1JAYA 4HOSA 3BIJA 2XMRA 1J07A 1N5JA 3MXOA 2Y4OA 5DN6A 4W7HA 4CU2A 2XTMA 2N47A 5T8KC 3QW2A 1DG1G 1AMOA 1L8OA 1Z8HA 1KOLA 2DHDA 4UM7A 1F1JA 2NV6A 1J9ZA 1A2OA 3HKEB 2LE0A 4CRWB 4HVBA 1SVOA 1E6LA 4HMPA 2N46A 5AK5A 3UT8A 1ULTA 2ZR7A 3ANYB 5F9MA 3VU3A 3DHWC 3IR5A 1ZGCA 1PG5A 3BCRA 2PUBA 3C98A 1Q6ZA 1SVXA 1K8RA 3NH9A 5LU8A 3BG1B 3U4QB 1A1SA 4NCHA 1N1EA 2RH4A 4YMHA 4HWRA 2BIFA 4EA6A 2BZ0A 3U3ZA 3L6BA 3FEXA 4BP3A 4YP0A 4XB1A 4DLZA 4BSZB 4WUVA 4F7WA 3P9NA 2CD7A 4GNRA 5IFLA 3C7KA 2HIAA 2JLUA 5EZYB 1DIRA 5JPCA 1PNOA 2XB2A 1U31A 4L74A 4BNXA 4XE5A 3TL5A 3EZ2A 1CUGA 1RPJA 4I99A 4YCNA 2HLDD 2PX2A 5KMGA 4XJVA 3B1JA 4LPKA 2ESRA 1XTQA 2RAPA 1QGUB 2PN1A 1PNVA 4K86A 2QUAA 3T5VA 1N0WA 5JZBA 4G0OA 4P29A 3KEQA 4BGDA 2CMKA 1Q57A 2OP1A 2VNJA 5HUQA 2W98A 4CTOA 4WJKB 5IASA 1MG0A 3G89A 5BNTA 3BF8A 2L18A 2QJRA 2YICA 3RREA 4FKZA 2PKRA 2WMNA 4A2PA 3ZZ0A 1DTWB 2H31A 5J2TF 3HI4A 3JQGB 4LOAA 1H69A 2CMGA 2FPXA 4BVBA 3SC3A 4M54A 3FUMA 4Q1BA 3UT7A 1FU7A 1DKUA 3AFOA 3QUBA 3LQQA 1V7CA 3H9GA 1W46A 4PM4A 1XDWA 3T7DA 1C1DA 3WE7A 4INOA 3QHPA 1HPLA 2ZSDA 3NM6B 2ZB3A 4YRZA 4DFDA 3OWHA 1FPQA 1KSFX 4IJ6A 3TMKA 4KBYA 2XOKD 2YJ4A 4K3VA 4KWTA 2X4DA 4L85A 4BXOA 2Q41A 3VI4B 3LC0A 4AECA 4J3FA 4WLOA 1XCJA 1ZYUA 1Q0SA 3ASGA 1Z6GA 4O4HB 4OHZA 2GYYA 3HI6A 4XSVA 1FRFS 2XV1A 3ROFA 1Z0FA 1NPTO 1A27A 3G0IA 4WNEA 3TQTA 4YRNA 1Z5GA 1P72A 2AG0A 1QDLB 2P2DA 4J0KA 4EFNA 3CRMA 1DEKA 1MG5A 4OYLA 4CTNA 2QT0A 3F5QA 1E99A 3DFFA 3F9CA 1U9CA 3W4JA 1OKKD 1F3OA 3NG1A 3OJLA 3OXLA 4OHVA 2BGJA 4S1NA 3OTHA 3H84A 4KIFA 1WVIA 4IDEA 1HT2E 4HNTA 4QGFA 1LD8A 1VHDA 2I6FA 1QK4A 2CMFA 1P5ZB 5CVTA 4RYLA 2VPTA 1KZ4A 4ZFHA 3L6UA 3PNBA 3TOXA 4C0EA 4MV3A 3OJOA 4XE0A 1TUBB 3WLFA 5H02A 5AOAA 1JNXX 5DTQA 1GUBA 4QBGB 5BR1A 2REOA 2YY6A 4BNDA 4IWNA 3CUTA 3IOMA 1EFKA 1P60A 4EM6A 3I5MA 3LG2A 1XEXA 4FS3A 3T7KA 3TB4A 3TTYA 5IARA 3UOGA 2QROA 1HV8A 3KE8A 4CLEA 1UPUA 4DIBA 1FUYB 3SN6A 1FT1A 1N5IA 2IO2C 5GZ1A 2VZLA 4RSGA 3HJFA 1QHSA 1A1VA 2CLEB 1Y37A 4W8GA 1R6BX 2O0JA 1CUUA 2Y0CA 2AJ8A 2WLSA 4KHPB 3UVEA 4MS4B 1GN9A 2MYTA 2P9YA 4WIAA 1F0YA 5BYBA 2R6R1 3TKLA 3KB1A 5FO1A 2P41A 1F8GA 4A2WA 2TMYA 2QY7A 4MGYR 3CNHA 4S35A 2XSZA 3SEAA 2JJ1A 4P9NA 2A4MA 1H9AA 5IJ0A 1KKMA 4XI9A 3RIYA 3VHLB 1HE2A 1DC5A 1UH5A 1HDYA 4XVCA 1XRNA 2WV9A 4ID9A 3S8MA 2ECPA 1VLZA 2CEKA 3WAKA 3K4HA 2ZUBA 3RTBA 4CQMD 3QVUA 3IDFA 3AO0B 3U13A 4G23A 3BE6A 3TMYA 2OORC 4XWGA 4EDFA 2WFLB 3AVOA 4ZAWA 1FW6A 1SVNA 4JXTA 4BQQA 4LX8A 4TWRA 3R09A 3VYRB 1VHTA 3HYRA 1NUQA 4MVJD 3ZWWA 5DI3A 4JLKA 1SY7A 2YOGA 3FU3A 4UDYX 4BGVA 3ZX5A 4GAAA 1Q12A 2YYSA 3H19A 1VHLA 4ERNA 2ZBRA 1STOA 3GZSA 1GTL1 2VR1A 2OO5C 1ZLYA 1RAFA 3VNSA 1SXJC 3U19A 2A9OA 4GMHA 4OQXA 1XEWY 4D9MA 3D3QA 3PDWA 4KU4A 2EDAA 3G7SA 1I5OA 4BVAA 3G2JA 1E9RA 3R0XA 3L6CA 5TJHA 2J3LA 2PV7A 2FW8A 2I0FA 1TU0A 5L40A 4M7WA 4ILKA 1EIZA 4E14A 2NSJA 3RAJA 4IS2A 1SU4A 3BFKA 2Y0EA 3MWJA 4AP9A 3U17A 4D4KA 4YVQC 3WMRA 2QAJA 1NVEA 2FVYA 1M6NA 3A4YA 2CB0A 3E9CA 2XDAA 1DVRA 3TKYA 3ZGXA 3GH3A 1KPIA 4X1IA 1HX7A 4PU0A 1R16A 3F7MA 4ZCMA 2GBIA 1F8UA 1I7SB 1JIQA 1GPDG 3CQ9A 4IDCA 1JBEA 1F2TB 2GK4A 4CBVA 4R8SA 3VR1A 3MTIA 4CKEA 4YA6A 4IZOA 4PSVA 3FX2A 3C6QA 1SCQA 4Q7EA 4UQZA 2UVPB 2ZSHA 5GM1A 1OVGA 2D5BA 1U0NA 1QS0B 3VNRA 3PNKA 1U1FA 5DHRA 5FL3A 2LPMA 2JLYA 2P90A 3L46A 4IRUA 5ESDA 4UTPA 4Y2XA 4MVJM 4JJEA 3ERCA 1ZD5A 4HS9A 2C96A 2Q5CA 3P2YA 2FFJA 5JROA 4UTNA 1XQ6A 3AIIA 2WIDA 4EY3A 2C2WA 5BR4A 4URWR 4INJA 1OWPA 1FQOA 1IHUA 1L4YA 4G0WA 1C7JA 4DR4B 3ZNQA 1UF9A 2WDPA 4BKOA 5DMHA 1DJNA 1LDBA 4MR8B 3EXG1 3L18A 4WLEA 3G2VA 5B4VA 3G8CA 3LZCA 1J22A 3MERA 2ZSIA 1EFUA 1BS2A 5JASA 1DLJA 1Z22A 4NVRA 4W5QA 3HJNA 1HE8B 4MP6A 3FUEA 1T2DA 4DMHA 1U7HA 3CVLA 3QIAA 4ZJUA 4IHAA 3J7TA 3UTDA 1REQA 4ADSG 4ZU3A 3ETHA 3U5ZB 4B6EA 1TAGA 1C9EA 2ZLBA 4A55A 4L4XA 5LDDC 3D7KA 3IHVA 2BZGA 3ZU4A 4H6VA 3B7UX 3ONNA 3K3PA 4GLFA 4M53A 5DNUA 3LA8A 5I7RA 4LMAA 4DC1A 1V4NA 3RRUA 3FUFA 1XTUA 3REQA 2MYPA 2PGXA 1JSLA 5CBPA 4FQ5A 2NQTA 5I51A 2NVUA 3MTQA 1T43A 2XMCA 4LJ5A 4JBIA 3PVZA 3QXSA 1YHNA 2Z95A 4KI7A 1CKEA 1NZJA 1PFUA 4LOJA 4BNYA 1VTKA 3HLTA 4K8OA 1A2QA 4HBDA 4MO9A 4U0KA 3W9YA 3E3LA 1K75A 5EIBC 1BOFA 2ZE5A 1QTNA 1A4XA 4MA5A 4GZ6A 4QD3A 1OLXB 4LFBB 2IY7A 4OP1A 4DRXA 4Q7KA 3NAWA 4RHYA 1YVDA 1NUPA 2ZAGA 4MUXA 5FBLB 2FN3A 3PGLA 2D1RA 3WHKA 2PYIA 1Y7TA 1JEYA 3GLVA 5H8WA 2R6HA 1DIGA 1BE6A 3J5PA 3PTZA 2FTKE 4LTMA 3QU4A 2ZB2A 1X7YA 4RHEA 4RFSA 3PHLA 1M6VB 4BFTA 2ZETA 5HM6A 5JC1A 2IIQA 2ZI5A 4ASUA 2X1HA 1W0KA 1Y5IA 5DHFA 3FSGD 4IDOA 3I34X 3PQ4A 4PG6A 2CHVA 2HHCA 1NBIA 1H9BA 3ZDQA 4GQIA 4LSZE 1RWOA 3VRHA 1DWPA 4CMIB 5FOVA 5K3SA 2XEVA 4TL9A 1XPJA 4WY8A 1D3AA 3RBAA 4JCCA 4Z4QA 4ETMA 2VWHA 4GMXA 2RI1A 4JJAA 5BSVA 1GL3A 2AZXA 1UXJA 4NENA 4HOYA 3BJIC 5JSUA 4IMPA 4ND6A 3JQBC 2YY7A 2K7ZA 2IW1A 4TQGA 3OIGA 1H2VC 5F35A 3KQTA 3DSXA 1OYOA 2B2NA 4OHYA 3F8WA 1DUIA 4YJ3B 4LHSA 4S2UA 4CR7A 3PXAA 1GNPA 3GVIA 3UIEA 3ZJUA 2WFAA 3U4TA 2WPDA 1SQ6A 1EUDA 2ZJ8A 4ND3A 1OCCE 1P18A 2Z4RA 3BMCB 2QXUA 3G5MA 2DETA 3BFVA 3NH6A 5JARA 4ODIA 4B0PA 3GFBA 3GFSA 4II7A 1A5ZA 4AVXA 2BKXA 3BKWA 4K6MA 3I30X 3PEFA 3ZW9A 1K6XA 3UQZA 4WQMA 4F53A 2WJGA 3TBKA 5IKPA 2A5LA 3HN6A 3JWEA 3VZCA 2Z4TA 1I3KA 1M1ZA 1BO6A 1N7HA 1QYIA 4WLUA 1CJMA 4XFJA 4F4FA 2PSSA 1E3LA 1ENPA 4JT9A 1F8XA 3NHBA 2O3TA 5HMLA 3P2MA 1KSJA 4F38A 5BWMA 3FU5A 1NW9B 3SFTA 3F5SA 2Y66A 3SNHA 1TTHA 1EG7A 1H6CA 1JHVA 2NUAA 1NW5A 1V8OA 1GZVA 3DS8A 3R4VA 4YUZA 4EF4A 2HWXA 4HI0E 3PGXA 2AF3C 1T3LA 3DE0X 1WPGA 1ODKA 4B6GA 2GCPA 1WQ3A 1EWYA 1WJGA 2Q7OE 1BEEA 3T52A 1XZEA 3PNLB 2BFCB 2I91A 3VI3B 2XUAA 4UD6A 1X0VA 4CCSA 1NLMA 4PRYA 2QF7A 1RJ9B 1XAIA 3K1AA 3LVBA 2PDAA 3FFLA 3FMGA 1E94E 2JJYA 3TFWA 3G0OA 2WXPA 3LTEA 1OXTA 2IV3A 4AJJA 4JI7B 5JCJD 5K8JB 3TPZA 4BO5A 4OVUA 4D82A 3QPAA 1ORHA 1C8VB 3ONVA 4QGHA 1HBJA 4YPVA 1XZ8A 4A23A 3THWB 2QN9A 2AZ4A 3C3JA 4D02A 1NF3A 4YV0A 3NT5A 5IVIA 5ALMA 2FEWB 3TEFA 3M8KA 3QVKA 1SUFA 2V45A 2AJCA 2HMAA 4XWAA 2P91A 2O14A 3USCS 4U0ZA 4HUQB 3I04M 3IHWA 1SEVA 1G55A 3M5DA 4I6JA 5DF1A 1N6RA 2QP4A 1ZGGA 2QN7A 4QEKA 3QUQA 4N5IX 4RK4A 2FJ0A 4G5QA 1IOZA 2J0QA 5JMTA 1W2HA 4AP6A 4BV2A 1WV1A 1QB7A 4OJMX 5CA0F 2ONYA 1IUPA 2I4NA 2HW8A 5FX2A 5DNVA 1U7UA 1TAUA 1QQAA 2QBYB 3NHPA 2H4HA 2VXCA 2O57A 3G9XA 4KNYA 4WFKA 2AX3A 2L82A 2V6BA 2P9CA 2R6ZA 1EXDA 3L8YA 4YRAA 1EDOA 2PT6A 3I1IA 3ESRA 4FD2A 4TZ6A 4HSGA 1Q16A 4KFTA 1PTKA 4UQXA 3EZNA 3LRXA 4M7OA 3Q73A 4TUYF 3A6JA 5AUOB 1PT7A 4MYRA 3AS5A 1D2CA 1DFGA 1E7SA 3CSSA 4MJLA 2IZ1A 3AJIA 3C7TA 4YDWA 4NOKA 4BZXA 2ZYUX 2PCJA 3H7AA 5CW2A 2G82A 3GLSA 1RQPA 3EQ8A 4FHGA 4LAFA 1DC8A 2BOVA 5LP0A 4OSPA 4BGIA 4JT8A 2ORYA 4DQLA 5DCUA 1JILA 2YNMC 1XLVA 3QOXA 3K9BA 3X1YA 3L0DA 5JD4A 3FYUB 2H2HA 5B2FA 1C50A 3FA2A 5ENRD 1KMMA 4CNBA 3HKDA 3C24A 4QQNA 1KFCB 3B53X 2WSLA 3VOBA 3BREA 2REQA 4QZVA 3IPRA 3FUJA 3EC2A 1P1FA 2UZ3A 4B6RA 6ADHA 3IBGA 4ND1A 1I24A 5FUWA 3SFVA 5I4BA 1KZ1A 9GPBA 1VIDA 3ZKJA 3GXBA 3LT5A 1SBTA 2VDWA 1LK7A 1W6RA 3UWPA 5M5BA 2ABWA 2PBZA 4J0FA 4BO8A 2GPYA 4BE4A 2ZQZA 3LC7O 4MUKA 1AZSC 5JQGF 1YOVB 3ELBA 5DHAA 5ULLA 1Z4NA 1K98A 1SBNE 2VQ3A 4R9UC 4LYHA 4UCQA 4UMFA 3W5HA 4B3MB 5AKHA 3GZ1A 3BDVA 3S70A 3H0CA 2N3ZA 4N0PA 1RLMA 4WKNA 2G5TA 1KS9A 3U09A 3CEQA 1NXWA 1J42A 4WKCA 3C0KA 2ZR9A 1O6GA 3CR3A 1IMOA 5JJBA 1YQ9A 4BTAA 2JH3A 3K1TA 4DZZA 4R68A 2AUTA 1P6UA 1K4KA 4Y2VA 4DSOA 5JNVA 4HOUA 1RR6A 1GV1A 4RBNA 1M67A 1ODSA 5JO9A 4F4UA 3VNAA 1CEEA 3D2BA 2JGLA 4HFRA 3C3RA 1J1ZA 3WMWA 1Q1BA 4UMEA 3EGDB 5JO0A 5EJ8A 1PAQA 1LQTA 2HA5A 4B4WA 2VSFA 2GMWA 4D3FA 3NCTA 4K9NA 4KP7A 2QRVA 1OY1A 3PIRA 4ED9A 1ELWA 1V6AA 2KX7A 4R1TA 1GNVA 3ZZMA 2EXXA 1IHOA 5HK8A 1FNDA 3L8DA 3AQIA 3KQQA 5ECGC 4IIYA 1FX1A 1E2MA 4PC1A 1DBRA 4ZFNA 1WUTA 4Q4JA 1EEXB 4ABNA 3EMVA 2XUGA 3HJCA 4BV9A 4DR6B 1HDEA 4JUAA 4GEKA 3JTEA 4N7MA 521PA 3HFSA 4LC9A 4XGQA 5LWHA 2QJFA 4JH0A 2CG3A 1M34B 4O5OA 3E05A 1YS2X 4N9WA 5ELMA 2I4OA 4A10A 2VYCA 3B78A 4RA9B 4O1OA 3BWYA 2CXQA 1GRNA 1TTPB 1MAVA 4LX0A 3NHLA 2J9XB 1ZK3A 1U3TA 3TXMA 5D3KA 5BNZA 3FPSA 4L9PA 1AUQA 1TFRA 1MX4A 1XZNA 3D7MA 4CKBA 1VJ0A 2XUHA 3RW9A 1BCRB 3BXPA 2R2GA 3IELA 4RJ2A 4IIUA 1YD7A 3WC4A 4ZOQI 1A04A 4AC9A 4DUYB 1L1RA 3CLSC 2VJMB 3K9CA 3HYSA 1MHQA 1E32A 2EW1A 1Z0UA 3KV1A 4IIDA 3LBAA 3FI9A 4R3WA 3T9DA 3QVXA 3KVRA 3RVMA 3GCGA 2AS0A 2BTQA 5A4IS 4BGEA 2IY9A 1Y1QA 1I33A 5JATA 3NOGD 5EI5A 5GJCA 2Q3JA 3RSSA 3WLEA 3DMTA 3RRXA 2V9ZA 3QTBA 3R0QA 1FLVA 3I09A 3D9NA 2OFFA 4B9EA 1X13A 3FCUB 4V38A 3UKUG 5KWJA 3GEPA 1UBFA 2YS6A 4NKRA 1W36C 1C7IA 2O5RA 2YZKA 2A5EA 1W19A 4ERXA 4O1MA 1WMDA 4AZTA 2OM2A 1I13A 4WL0A 1RLUA 2VEDA 1B8VA 2WWFA 1NBMD 2FR8C 3W6PA 3SFXA 4BMXA 2JFUA 4HJXA 1SCUA 2YFHA 3CG4A 4YR9A 3WWPA 2J6CA 3DONA 4BCCA 4ALNA 1CEXA 1IYGA 1AN9A 1HC7A 5K4AA 3LY8A 3C48A 3T3PB 2WIFA 1BMFA 1E8WA 4TS9A 4C4OA 2D4AA 1Z36A 5CFMA 3GJ6A 2PGIA 2C29D 4BY6A 1OWOA 2W93A 4ABYA 5LKAA 1W88A 4H7YA 1OGJA 1T9AA 2VPPA 3L8EA 2Q6IA 4R8KA 4J0EA 1Q0QA 1PS9A 4OMUA 5EE9A 1Z6YA 4YRBA 1VG0B 2H1RA 1FFBA 2BBOA 4PAGA 3C6MA 3ASFA 2Y1FA 3SX0A 4Z2AA 5BV8A 1RM3A 3ZUPA 5AVUA 1SR8A 2XUFA 2FX2A 4R1OA 3GHYA 2O19A 1PJ8A 3EBOA 2C4KA 3D0KA 4PFJA 1BVHA 2CB9A 4B4UA 4MTCA 4H0NA 1TQ2A 4HAYA 4XD7A 3B36A 4UHCA 3GV0A 4G1VA 5K0JA 5A04A 2GGFA 1JDUA 1I1QB 2Q50A 5IM4A 4N7JA 2CYCA 2VYIA 2W6IA 4KZ0A 1KZYC 4DGSA 3AR4A 3TECE 1RDFA 2ONDA 1GT6A 1K8XB 3WLLA 2IEAA 4HATA 5ELLA 2H2GA 4EQ6B 1NP6A 1N78A 3IIMA 4NP6A 3NHRA 4I66A 4JHLA 1ISFA 2RHHA 3Q98A 1O97C 4NDZA 4P4SA 2JFGA 3FCXA 2AW6A 4KKVA 1KORA 1YIDA 3P4YA 1YS6A 2YCLA 4EGSA 2ZPTX 3IHTA 4Q37A 5EXXA 2R8EA 5ALEA 4L6AA 1IQ0A 1ZSNA 3QBJA 4Y7DA 2ZT7A 3OQJA 5A0TA 1U2GA 4BFZA 2FUCA 2RHGB 1ECLA 3OX1A 2X19A 2VHWA 3QENA 3T5DA 2YHCA 1TM5E 1QFXA 3ZQUA 2C4NA 3MEQA 5M34A 1Z33A 1CDDA 2ZBEA 3SD5A 4PO9A 5GV8A 4DMRA 4CM7A 2Z1DA 2V59A 3OECA 4EI7A 1QZTA 5C18A 5C5EA 4P3OA 4TGLA 3P2BA 1XDSA 1H6KA 2O59A 1ZH8A 4X3PA 3WG7E 5MFPA 1GQQA 4J1NA 2PMEA 1P6QA 1ZD9A 1DRKA 4I9NA 5JFGA 4DVGA 2QM0A 1YXMA 3B6IA 2ZJ2A 3T41A 3NO4A 4L50A 4LJ9A 2Z56A 2AUMA 1D2MA 3DBHA 5HS0A 1QORA 2OB1A 1BC5A 1ZRMA 3ZTTA 1EKXA 4AKEA 4LJAA 4D4IA 2C7BA 5BW8A 3FE2A 2Q07A 3R5KA 1SHJA 3L4BA 3CVVA 2Q5OA 3G2SA 3O4FA 4RZXA 4CM8A 5CH3A 3PRKE 3GT0A 5HKBA 1MV5A 2EWVA 4FFLA 1I0LA 5IJZA 4TV8A 2J45A 1EVZA 5HGXA 3GA0A 3T1OA 2JI7A 3GFQA 2P2LA 5CA1F 2K4MA 3C8ZA 3WFJA 3JYQA 2VF5X 4YEDA 4HLDA 2VATA 3SJUA 3BWVA 1CVIA 3T1YB 4MUJA 3O8RA 3FW1A 2HKIA 3WSVA 4M83A 2ZATA 4L27A 1TXGA 3ABKE 3D0OA 3FLAA 1QQTA 2WTNA 2VGEA 4J16C 4EGJA 3QY9A 4YJGB 1BTOA 1ST3A 3GA7A 3A05A 5FUQA 2X2FA 4OREX 2ZRBA 2FFBA 3OFVA 4IINA 1M72A 4P2BA 2GJSA 3RS5A 2JGFA 5IABA 1U98A 5DPMA 4DIOA 1H22A 2Z2XA 3LKBA 4HRNA 3U7FB 5B1HA 2ZUSA 2RARA 2P6MA 2RJ3A 1I1OA 4X7PA 3DQZA 1O7JA 4Z9XA 5J5VA 4F45A 1LPMA 4RORA 4RHTA 3H5RA 1PGQA 3S68A 4GNKA 4Z4HA 3E4DA 3RE1A 2WE7A 4OXQA 4FR2A 4EHNA 3OOJA 4M0EA 3BILA 3HJUA 1GITA 4EW6A 3Q72A 3TXYA 1TZMA 1E7MA 1UPBA 1Q91A 4E3WA 4H15A 4RV5A 3N07A 3WYBA 2WVGA 3MINB 2EZ9A 5DHTA 2RFLA 2C61A 3IV7A 3P52A 3P4UA 2WXFA 2OAEA 1QHHA 3SBEA 5M2QA 1QVRA 1ZGBA 4LIPD 5TE9A 5FJIA 4MCAA 1NSYA 2VPZA 2QWXA 1R8XA 5HFAA 1U7WA 3V32A 4K87A 2HYIC 1Y81A 4A3TA 2O8FB 1I4EB 3IOYA 3C8UA 1L2TA 2VHYA 2O2EA 1JU4A 4P98A 1P77A 4W1QA 4HDNB 3MWGA 1G41A 4IHJB 2EKQA 5B3SE 4MVCA 1V5WA 2C31A 5B1YA 1RXUA 2ZS8A 4MB0A 4AFNA 3DO8A 3CW8X 3SI5A 2GD0A 3P0HA 4U95D 4YBRA 1W581 3CKMA 1JHQA 4L5AA 5HK9A 3MAJA 821PA 2HIGA 4DX2A 2XVAA 4DPLA 3GEIA 2EQXA 2UUAB 2GXQA 4A7PA 1P1HA 2H5IA 4N8EA 2HQOA 2J3HA 1SKUA 2WVHA 4I6GA 3N2LA 3FVVA 4KFUA 3PJEA 2H9YA 4KLZA 1QPBA 5EVJA 2Q6OA 3JQAA 2IQIA 4N5CA 2VJCA 2VOEA 3PSHA 2ID8A 2PEZA 3BGVA 2X1VA 5EG5A 3EMKA 1W4LA 5ALKA 4YX9A 1H6PA 2QZAA 5BVGB 3T8MA 3VUEA 1FF9A 3BB4A 2D2FA 1CWUA 5BYAA 3OJXA 4TRJA 4QRIA 2NV0A 1UBGA 4JYCA 4HDCA 2IHKA 5FKJA 3BMXA 1OIXA 4D9KA 1CETA 5FPPA 1JFFB 4XOIA 4MVJG 1J0DA 4DAOA 4I3GA 2G8NA 5LXTB 3C6BA 5G40A 3X1KA 5EDSA 2WJAA 3T3IA 3B48A 2KLHA 3L2OB 3SOZA 4MICA 4BN4A 1A98A 5C8YB 1CR2A 3OVMA 3RGWS 2PRSA 1E8DA 3H9UA 4R5HA 1NBAA 3PR2B 3FUWA 4X6XA 3JCKC 4GPZA 3MT8A 3R3UA 1JZSA 1AS0A 3DSWA 3DE7X 5EKTA 4NU0A 1H0RA 2Y68A 1O96A 1M34E 3B2NA 1PT8A 1TC2A 4YAOA 1KMQA 1UPCA 3I5PA 2O23A 1TT7A 4IY1A 5EPUA 2JAPA 2A57A 3PICA 4WCFA 2C4TA 1RWQA 1AHIA 1EX9A 3WYEA 4YRFA 3H2KA 3F96A 2EERA 1C9MA 1KI4A 3HDGA 2AVPA 1BJTA 3I2FA 4JPSA 4NFYA 1NVXQ 4QG7A 4UNQA 4IVQA 2FFRA 4TKMA 8AT1A 1T6ZA 1XMPA 2QNBA 3U39A 4P82A 2LCIA 2NAFA 3H5WA 4ENWA 1CLUA 1QNFA 4B3HA 1GZ6A 1GKLA 2I1VB 4B4OA 1SC1A 4ZKEA 2W43A 3L01A 5COAA 1V8BA 3BS4A 1KDTA 2PR7A 1WXGA 1WZ2A 3RG8A 5CHEA 4D42A 1EWVA 3MS2A 3MAAC 4Z54A 3FLBA 4PINA 4HN4B 2V5FA 4RVNA 4RHXA 1TD9A 3NYRA 2Q1YA 1L6RA 1J21A 3HACA 1JIVA 3ZYCA 3YASA 1NRWA 3VZQA 4WZBA 2KCKA 1YC5A 3GP8A 2ODQA 3QY0A 1YOBA 2DMRA 3VX4A 3P2EA 5CJ2A 3S7ZA 4A5SA 1A9OA 1K2VN 4KBFA 1ZFNA 4BQEA 1J8DA 1LX6A 5DIZA 3TE6A 3WLSA 1ZRHA 2GF2A 2PFSA 2O5VA 2VT6A 4JP3A 5JZ9A 3DEOA 4GYKA 4MJ3A 4KX3A 3NV9A 2ZT5A 4E5VA 4B6FA 1L7PA 2DFLA 4E5SA 2H5JA 1K7EB 3LGSA 3ICOA 1XKTA 3QE0A 4EVRA 4BMVA 3EY9A 4OI1A 1KO8A 2HRRA 1GTRA 4Q24A 4BLVA 3KTFA 1ESEA 2R8XA 4WUYA 3TUJC 3Q4GA 4HD8A 4U63A 3ZHEB 1TJ5A 4X41A 1UMKA 3NGLA 3UIPC 1CHNA 1D7OA 2PR2A 5FZRA 3DVLA 1ZGAA 4GS5A 1TGVA 2ECOA 1SBHA 1Y1LA 2JARA 1HMYA 2ZBPA 3WS7A 3A1SA 3FR7A 1HQCA 2PUEA 1FK8A 5C3UA 2M6LA 3Q7TA 4KPFC 3OE4A 1TVMA 2UZ1A 3GNTA 4LOKA 1MB3A 4ARAA 3ZZTA 5JRDS 4B8AA 5EHZA 2C77A 1LW7A 1YONA 4MUBA 2B8EA 4ND8B 4YFVA 1BH6A 2MYOA 3UQYS 1ZM2A 2ZPAA 4JQYA 3JD0A 4WDQA 4CMBA 2RSLA 1DWOA 3O93A 4EECA 2XMBA 1J8VA 2AXUA 2H7XA 2G07A 1ODFA 2XZTG 4GPMA 1NBHA 1UJ6A 1Z4IA 2A30A 2HAEA 3ZU7B 2K87A 2OHIA 3A1WA 4MQ5A 3WL4A 2GO7A 3HBNA 3I3OA 3IERA 5JH7A 1HDIA 2JJ8A 4NAUA 3MLAA 1GRQA 5A4AA 4LRUA 5GONF 5JALA 3G49A 4MHOA 1BJKA 5A4FS 4IR7A 2OV6A 1Q7GA 5AAOA 1OCRE 1LSOA 4AUMA 3GRRA 3PUVA 3SHOA 5E38A 4ZQGA 1XRQA 4MMXB 4XPIB 1M9NA 1U28C 5C7YA 5YASA 3OQNA 2VDJA 2Y6VA 2XVMA 3RB8A 5FI0B 4JC8A 3DKPA 4J7CA 2C83A 4KPGA 4CKYA 1WP4A 4XJSA 3ABLE 1NDQA 2VBIA 3QBDA 4QUEA 1E8ZA 1VCNA 3SKVA 3I32A 1CUFA 1CSEE 1O1SA 4V0OA 4EHAA 3FY4A 4OJQA 4LY6A 3SX2A 3EHNA 3N39C 3MM4A 4RWZA 4EX7A 3CJQA 1LSSA 3PNPA 2I6XA 1O08A 4AJIA 1GPKA 1NLYA 1PNTA 1XA0A 4EGCB 4UW9A 3Q8MA 3TGPA 1S7GA 3HZRA 1Z6XA 1B23P 1AQYA 4MB6A 3EVFA 5T4HA 1TC1A 3U26A 1DAFA 1TGYA 4O2BB 3O48A 1KJIA 2QX4A 1FMLA 4IUDS 4MW0A 1SZAA 2JHCA 2FPPA 2OTCA 5DXFA 1C4XA 1C30A 1E5VA 1Z7GA 4OLHA 2H57A 1NNLA 5IF3A 4LCTA 4HPXB 4QYSA 5B6PA 5KJLA 3F98A 5AXCA 4DLRA 3G9QA 2JFPA 5K45A 3DWGA 1SOUA 1G2IA 5ITZB 2XNKA 4WRRA 2H8KA 2PH7A 4KPUB 4BNGA 221PA 2CNWA 2GKSA 2JIBA 1P4RA 2WF6A 1AS2A 3HJTA 1WEKA 4JY7A 1QGYA 5JAQA 4BMPB 3FTZA 2O8DB 3RUFA 3P71T 5F51A 4HAXA 3BK2A 5FLEX 2GBFA 4OATA 1AHNA 4F97A 3L6RA 1RI3A 4P54A 1FP7A 1SW6A 1COWA 1TRKA 3D4OA 3WLRA 3CU5A 2OAQ1 1G291 1JKIA 3WBFA 1C7QA 1ENOA 3DCYA 1JVSA 2FOLA 3HBMA 2F3UA 3QEMA 5JSKA 4D0GA 4YROA 3RWOA 2DPGA 5DM1A 5D3MB 4DBZA 2HA2A 2G06A 3RHSA 3ZVRA 3WGQA 4B6JA 4KDEA 2QG6A 2FK7A 2OCXA 4FBMA 3QF4A 3OICA 5I4KA 1I2DA 5DNWA 4J4TA 3AG6A 1BEZA 3T5BA 4N0DA 3DTTA 3CX6A 2B1GA 1XVVA 2R11A 3V9PA 1RC1A 5AM4A 3I58A 2R02A 4NMLA 1CJTC 4BYMA 5LD2B 5EP3A 3DTVB 4M9RA 4X1KB 3HXLA 3H3JA 1W76A 3UK6A 3DF9A 5B58T 3ENWA 4GGPA 4PYNA 1DKNA 2XKAA 4CZ2A 4ZVTA 4AM8A 1XE3A 3ZKWB 1DDGA 3H5OA 2FNAA 2D1YA 5CP8A 4YDEA 3N2YA 2OMEA 2ODEA 3S6JA 3WO1A 2QVLA 3UV7A 2QZ4A 5EZ6B 3DBIA 3OCUA 5EP2A 4AZ0A 5BMVF 2H07A 3D9OA 1JXOA 1W25A 2WTXA 2ZAIA 2Q62A 4ZAYA 3KKKA 5DK4A 3T1HB 1AS3A 4F3KA 5HKOA 5IVKA 1YA0A 1KH2A 2ZEJA 5K7SA 1JMKC 1UW4B 4M60A 1H1DA 2F1JA 3S8YA 1RT9A 2BH9A 2PUCA 3IQZA 4FLEA 5CJJA 5B55A 4CMJA 1XEWX 4Y8VA 4EY6A 2WMNB 1RAGA 1J24A 4D6PA 1PK7A 1PN3A 4BO0A 4CHTA 2VHJA 1V35A 1P9OA 1KJQA 3LX8A 2DHEA 2J5KA 4LHVA 1SC3A 1L7VC 3O1LA 2RGUA 2V5AA 4FB4A 1H65A 4B73A 1GD1O 1VXOA 2I3BA 5CTJA 2YVUA 3O4VA 1WCXA 1WP9A 1QLHA 4ZO8A 4C0AC 3N3BC 3GAZA 2O3SA 1OLUA 3ZLJA 2QLLA 2ADFA 1LC3A 3Q15A 5C35A 5BWNA 3LPZA 4DREA 1QP7A 1LFDB 4LQ4A 3PXXA 1ZCBA 1YTUA 1R18A 3PX2A 3DE3X 1P1BA 3SBSA 2NLOA 1Z18A 3PWZA 1BDHA 1Y4AE 2HMTA 1ZUD1 4TYPA 4C7BA 5FEUA 3WGTA 2R79A 4QAJA 2IH5A 2FZGA 4KPYA 5EY5B 4JBNA 5BT1A 1SBQA 3NPMA 5KNBH 2Q1WA 3ADKA 5LA6F 4N5HX 2FR1A 4D9GA 4P08A 2Z57A 4N0EA 5AVSA 4OOFA 3ZEFA 4QSMA 3ZI4A 1RI2A 2C9YA 3SIWA 4YP6A 3VDXA 3DVSX 3VPAA 3AESB 1DUSA 3W77A 3REGA 5JNRA 3H2HA 1YQXA 4Q69A 3AEQA 4GL4A 2EFEB 3GFFA 4RVSA 1P8JA 3AZQA 4UOQA 3LQYA 3T61A 4ZP1A 5FHQA 3I45A 1QF7A 2R9VA 2IHBA 1NUAA 3FROA 1D6NA 2CMDA 3PNVA 4TWJA 4A1SA 3OJ0A 5JAZA 1JSCA 3TEJA 2WHEA 5B7PA 4FNOA 3VU0A 4TYQA 1ZNQO 5HF9A 3PUXA 2I3AA 4O2AB 3I6BA 3OFSA 2R1VA 1T35A 3BF7A 3LY5A 3JATA 4JC4A 3M3HA 4Y0NA 4D10C 5LBIA 4NCIA 4HRLA 4PLHA 2G0TA 4CT0A 4HLLA 1UM9B 2XGJA 4LVOA 4W9RA 1WPXA 3MRTA 3ZHZA 1N54A 5BQFA 3SR4A 1DI0A 4V0RA 3V1TC 4BX3A 5LDGA 2OWEA 3O6VA 3V4FA 3M6IA 1OLSA 1KYYA 4IS3A 2O8BA 3AMVA 3UAOA 2YJNA 1CLEA 5IJ0B 1ARZA 1VYUA 4D96A 4DR3B 2D2IA 5JPDA 4EYOA 3KB2A 1D7AA 4HZUA 5TY0A 3LS8A 4KXXA 1VYVA 1BE8A 2LTAA 3D5QA 2R1TA 2IW3A 5KU1A 4DB4A 2H3HA 1EX6A 4FTWA 3WGKA 1AO0A 4A82A 3AJ8A 4W63A 1YIAA 3E7DA 1V95A 5IP5A 1HOTA 5I4IA 2IEDA 4D3YA 1GY8A 1M2VA 4GX0A 4NSNA 2XNJA 2V74B 3UK0A 2Y0BA 4RM2A 1Y1SA 2XXAB 3G9UA 1XAHA 3R9WA 2L0XA 2OBMA 2WICA 1G9SA 2V58A 1UBCA 5K03A 4PPYA 4RFVA 4HGNA 5B3AA 2CV1A 1DG9A 3PUYA 3O95A 2BKUA 1T1RA 4ABTA 2YHEA 1KI7A 3GELA 5HVNA 4ZYYA 1TUEA 4NARA 1E3IA 4X8QA 2B4KA 3GEBA 5LFAA 3OETA 3KSAC 4MNTA 5F9FA 2OCKA 5AKGA 3WNVA 2I8AA 4IFTA 4UJ5A 2SBTA 1TJNA 5LVAA 4BZQA 4LJSA 3HWRA 5HA5A 4OKIA 1ZCJA 1VL5A 2KYRA 3LPLA 1YJ8A 3HXKA 3OJCA 5GADl 1WD5A 2Q7DA 2EGUA 2PUDA 4QJBA 3RT7A 1R00A 3DLPX 1WX1A 2E1PA 1NZFA 4CEHA 4B7ZA 4XX1A 5FTLA 1WNTA 2I9KA 1CY4A 1XYVA 1ZC4A 3J81k 1U3UA 4CKEB 3CFYA 2BP7B 1TPYA 2V03A 2ASEA 4K6KA 2WTUA 4JUBA 5AVTA 3B70A 3PJGA 4PYOA 2C0LA 5IKOA 1D2RA 4IJUA 2E55A 3KEMA 1FNCA 2R44A 1XRSB 4CMKA 4HDOB 1OMOA 1H1LB 1OUVA 3AJ9A 4RY0A 5B30A 3PD7A 4ZCLA 5KNCA 4BEVA 5KOJA 4EG6A 4RW0A 1AA6A 2QN6A 4Q00A 3C45A 4QHSA 1PDVA 1QP4A 1UZUA 2EARA 1SD5A 3DOEA 2ZRNA 3X3HA 3AOGA 1BH2A 1COZA 1E7YA 4DILA 2YOFA 2YZMA 1X2BA 3AKYA 4WOKA 3KZOA 2AEJA 4EITA 4WBNA 1YBMA 2WJ6A 3CVQA 1DO8A 4LZPA 2R5WA 1RZ4A 3C8HA 1H2FA 5A1TA 1OAAA 3W1EA 3Q8LA 1QYXA 2I03A 1SPBS 5ICEA 2DUUA 2TMDA 3A0UA 3OCYA 1PQUA 1W85B 3X2SA 3SS8A 3LPDA 4MB2A 3AFNA 1VM6A 1C7FA 5DHUA 1GGVA 4ZZ3A 4L8GA 5EUQB 5LU9A 1ZIPA 3EY4A 2Y1LE 2E1RA 1R0XA 2VLIA 2DR3A 2RGEA 3ZVLA 4FMDB 2C5GA 1JX6A 3FMVA 1RRFA 4BNLA 2LUOA 1YDMA 2WTMA 4K28A 1U2QA 2KCVA 4RTNA 3T4UA 4FFNA 3EC7A 5DZSA 5ADUS 4WZZA 1N0UA 5CBOA 1X3SA 4QWWA 3R6LA 1NNUA 2H5LA 2CDNA 4FOSA 3U7QA 2BFEB 3KD7A 4XA8A 1TYCA 1P73A 2XZDA 4R1UA 3NP9A 1Y6FA 4FNAA 3EXFB 1QAOA 4LBVA 5LOVF 4K6OA 1SFRA 5BVHA 4RXUA 3WIEA 4XUEA 4IMJB 4ZO4A 3CSDA 2W6PA 1TNUA 2HPZA 2Z30A 4W8HA 5AFSA 2XYHA 1NP7A 1ZCZA 4PIVA 3GGJA 2QV7A 4WUTA 1HEIA 3DKKA 4G97A 1O9GA 4IKEA 3HB9A 3DPYA 3HU5A 4Q3KA 3QYPA 2WLTA 1K1BA 3ZR4B 3K5IA 3WGIA 4DPRA 4ENPA 1BA2A 4ZQBA 3UUWA 4BLPA 3GRPA 3CSUA 1CZOA 5F7JA 3PQ7A 3ZU5A 1Y8RB 2NO4A 3N2NA 2ZJFA 1N2IA 4CG3A 4D3DA 2W4QA 4CCWA 3RRZA 3LHIA 1HGXA 1HG0A 3C15C 5K1ZA 5EIEA 3UUGA 4COOA 4A91A 1TN6A 2ZVQX 4WN3A 2ZBQA 2IF2A 4UU0A 2ORVA 1OUMA 3GI1A 5BO5A 1FU8A 2P67A 2O3JA 3K05A 4XB2A 5TQ2A 4GVXA 3L8MA 1FLAA 2UXBB 4QA9A 4FCTA 4I4TA 3ZE7A 3L43A 3I53A 1XDGA 2GSDA 1AQNA 4O63O 3IB6A 1CQJA 1PTJA 3AL0C 5BN1A 1SO8A 2AK3A 1MEEA 3R1IA 5LN1A 3T6KA 4RIGA 3OAAD 2DFVA 1Y1TA 3ZS9A 1JSZA 3WMGA 2NNWB 2R7NA 5C3MA 5BV2P 4QJ4A 1EP9A 2VP6A 4DR1B 3KS2A 2V4UA 4KGXA 1NC3A 2GESA 2FV8A 2VBGA 4W1RA 3LQ4A 3Q79A 5DJ5A 2M6SA 4FD3A 1CQIA 3OKFA 3BICA 2GTHA 3D4PA 4GYYA 2Y1EA 3ZPJA 3SR3A 1C4WA 1KGSA 3I5YA 1MAHA 2BUBA 1SWWA 2GASA 1DIAA 1L5ZA 4IGEA 5KNDD 3ZWVA 1HLDA 3K16A 1RQXA 2YZ7A 3LFHA 4ZK2A 1D8EA 2LZ0A 2VL7A 1IM8A 2FZCA 2P9KG 2H2WA 3SCZA 5K0TA 4GP6A 4G1MB 1ABBA 3IUNA 2HH9A 3QWFA 2RBGA 3RC3A 4L5BA 2PKXA 1NVFA 4H3HB 2VP2A 5CLLA 4ZEXA 3IDOA 2FXIA 4C78A 4Z5XA 1KDRA 4GTVA 4DCNA 5E3IA 3FTVA 1Z37A 1Z8NA 2NU7A 2P7IA 4OGLA 4D2IA 3ZW3A 1BWQA 4U0SA 5I3CA 2OHFA 4ZC8A 4Z9BA 5BUCA 1UK9A 1YCFA 4JBGA 1NT2A 4F3TA 3UGKA 1LPNA 3IXLA 4C01A 4PS7A 3WWEA 1RVV1 1TEVA 2Y3IA 3NHSA 3VJMA 4YAKA 2DG2A 3ZGVA 3JVDA 1EA5A 1MOSA 1UXGA 4A8JA 3LWZA 2RAFA 4EZKA 3RTDA 2AI1A 2F8MA 2YFKA 5HZGA 1NXQA 4URKA 3PDJA 1SPXA 2KCLA 1E60A 4Z86A 1HYEA 2MHCA 1PK8A 4MQFA 3S1SA 2LAHA 3KDAA 1YUMA 2D00A 1NFFA 2KATA 2GS9A 5F3WB 3HQ4O 4ZARA 4QTTB 3T1NA 1IXYA 1OH6A 3FPJA 1PY1A 2NXNA 3ZV7A 4KIUA 3EVZA 4TWBA 1UEIA 4KVFA 2E49A 3FJOA 1V1RA 2YZNA 5AW3A 1XTVA 5AYVA 1FMCA 3E84A 2ZI7A 4EG1A 4NXMB 1XTZA 3RVLA 2NU8B 2VPIA 1Z7EA 1Z3XA 5AW1A 2QLJA 3N74A 5F23A 1YS9A 4F9EA 4MVJF 3L0SA 4RK6A 1H5NA 1T5TA 3A14A 3NASA 2COKA 3MGAA 2JLZA 4Q6WA 2WJ3A 2X6TA 2GRJA 3V7WA 3SYLA 4OLBA 5DW3A 4LNUA 3AKDA 5DNEA 1UC8A 4P7JA 3ULEG 3MWFA 4DLNA 3FUXA 2C2GA 3WGLA 4PXYA 1AK2A 3ZGLA 1WEHA 5A7HA 1W49A 1MRSA 1WPQA 4BATA 1CJCA 4EHKA 4F1PA 4LE0A 2HTFA 1AKRA 5E6RB 1YDHA 3M9LA 2ZRFA 2EIJE 1NI4B 4H08A 5CW1A 1EK0A 1B16A 3ZWDA 1QG4A 4WFIA 2FSVC 4LTNA 4J6EA 1WRBA 5GIOE 1FYEA 4JW1A 2HSZA 1LJLA 4HAWA 5NULA 1P4HA 2BVNA 1MH1A 4J0GA 2HQSA 3ACDA 3EPLA 4M0CA 5JV5A 3ZXPA 2DQSA 4RJLA 4IIJA 1KRXA 2VAVA 1WIWA 4NZ9A 1B8OA 5F9HA 3JD2A 2WXJA 4IDFA 1JN0A 2AF4C 4RNCA 3GZNA 1UOEA 2DPXA 1JXMA 5T6BA 4XKBA 1HYHA 2A5JA 5HJ2A 2G9RA 1SUSA 3B52X 3KDSE 1QV7A 2QRHA 2FE1A 5E4FA 4QJIA 4ZVPA 4PW0A 3UG7A 4B84A 4TV9A 4BMCA 3WLOA 4D98A 2OECA 1SB9A 4R16A 2YVQA 4KXVA 3A7EA 4R1LA 1QF9A 2RKBA 4HOQA 3DXFA 4BZWA 2ZYIA 1N3LA 1IZ9A 2WMDA 4RTRA 2P5UA 1VL1A 3AIMA 1QPGA 3G88A 3JAWA 4ECEA 3EIOA 4P7BA 4LF7B 2IEZA 3W90A 3W2FA 4EHLA 5JCZA 3FHLA 4NE2A 4QULA 1G18A 3Q3CA 2VDKB 1FP1D 1G6KA 3QKSA 3P45A 3WX0A 5DM2A 4H1VA 2JGAA 3D4LA 1TF7A 2BFNA 1SD2A 4OBWA 3WK4A 2WUFA 3N2GB 1E1RA 3NAQA 1Q50A 3OIUA 2ZTVA 3LD9A 1G20A 2H8GA 3DUWA 4BRWA 4ZTBA 4DSNA 5TPZA 2FW0A 2PAAA 2XT6A 4C0LA 4HLQB 5IAJA 3B1YA 3HCWA 1M54A 3BD7A 1T1GA 2MINA 3BFXA 1UJ4A 4R0MA 1G7RA 2PSJA 4XX5A 1JZQA 2E4UA 4DMUB 2X40A 2FQQA 3KJGA 4HEQA 4UFNA 3WDLA 5ARDA 1PEDA 4BRSA 2JFVA 4ZQIA 1KJWA 2CZGA 1C8BA 4ZXFA 2Y4NA 4X3OA 2JD2A 3VPXA 3K9IA 3STXA 3W6NA 2OGZA 1YASA 3DTVD 3D8TA 4Q93A 3NJ8A 2EATA 4TN5A 5LM3A 4NBWA 3EZXA 1BN6A 3QHQA 1FFEA 5FPSA 3U40A 4CL8A 3TZEA 3WV5A 2AW3A 1JDBC 2NU9B 4RADA 1QRDA 5DU2A 3ZXUB 3GPCA 3ZG6A 3CVWA 1QP8A 4WNFA 4S0XA 1U2VG 4HB3A 4J76A 4O3MA 3AJEA 3QKRB 2EX1A 1D04A 1KK3A 4OHRA 2NWQA 3RGGA 4X8OA 3DULA 4JITA 2AEMA 1H1TA 2CJFA 3LUDA 2JS7A 3M81A 1UAAA 2J4CA 3UT5A 1CF9A 3PZ3A 3NXKA 4GA2A 2X6RA 1GCAA 1YZVA 1E2KA 4O1PA 4PRLA 5IRCD 3EOZA 3O82A 4JQSA 2VXYA 3ND8A 2L2QA 3UAYA 3TNYA 3W3AH 5KSOA 4UWKA 1SG9A 1KJJA 1PIWA 4Q01A 2Y1WA 2I6HA 2GRUA 4NEHB 3D8NA 2IOFA 1NZNA 3M34A 2WOOA 2PSFA 2RKKA 3UMBA 2HEGA 4RACA 1AKQA 4QTYA 1SQ0A 1JALA 1TVKB 5HOEA 5F3DA 5FPTA 2FEXA 2CUNA 4JEHA 2WUGA 1UBJS 3SHQA 2ZYHA 1GQ2A 2H1FA 4FDUA 4RGBA 4X61A 1IDOA 2YJTD 1ELKA 6REQA 3C39A 3OLVA 5EWMA 1IB0A 2C3PA 1EGAA 3MCUA 2ILRA 3IUJA 3ONDA 4EB6B 1J2EA 2ZE7A 4RJKA 5ED4A 1W4CA 3NKFA 5M3BA 4OSOA 3ZDCA 4M38A 4KRXA 2P35A 1ZNYA 4NK5A 2AKAB 3BJEA 3A32A 3PUZA 2VJ8A 4RD3A 1QCZA 4WKPA 1Q74A 2YV2A 3IL2A 3KHKA 4BYGA 1OAOC 3WWYA 3Q6IA 1TNBA 3Q2KA 3W5SA 1TMYA 1VA5A 1BI7B 1CS0A 4LF9B 5FULA 1CRZA 4KLRA 3P19A 4OO3A 2X4LA 2XWQA 3NC0C 4E5UA 1SCUB 4KLNA 4ANWA 3AM5A 1OIWA 5B1SA 3HPRA 4X0EA 4YJKA 2AOUA 4LRZA 5KYTA 3B6KA 5DSXA 5IUJC 5TEWA 4NMXB 5G05J 3H5TA 4YI5A 5FPQA 1YFZA 2QXTA 4QFMA 5LMNB 2SCUA 3OOHA 3K72B 1VLQA 1P0FA 1M8JA 1W88B 4X84A 4M9QA 1ISSA 3E70C 1VE1A 2JRLA 2XY4A 3BL5A 2W48A 5DGTA 1T6XA 3B7SA 3ZW8A 2F00A 4L5YA 2SHKA 1XNRB 2GBLC 3OQIA 2OHHA 4HH3C 1I5EA 3CRZA 3C87A 1YRWA 2HRCA 4F3YA 4EPYA 3T35A 1OZ0A 2Y4TA 1T6BY 3VO9A 2W6NA 3MCVA 1RWVA 1DPFA 3N3AC 3P9XA 2I4RA 4MRSA 5KX5A 3RTEA 3MWEB 2WUVA 1A17A 2X9VA 4DMCA 4ZCIA 2CFOA 4B8CB 2D13A 2OQVA 2OOSA 3BD9A 2D5AA 3WOHA 1KY4A 2IYFA 1FVFA 4GBJA 5I4CA 2B6CA 4Y6SA 1BXKA 1BU9A 3KEZA 3OIDA 3L07A 2ZQYA 5JCPA 4FFMA 3UYKA 3FFXA 2H6IA 1YFKA 2JJ1D 5FNZA 4CMAA 3J81A 4DMFA 1V9LA 3QKYA 2QIPA 5BSFA 2VZEA 4YJHA 4OKNA 2F8TA 1BMQA 1VMAA 5IXYA 4GVPA 3C72A 2HMUA 4XR9A 3PXUA 2QUZA 3AR7A 3HY3A 1P31A 5DKFA 3OQOA 4UWLA 1PU2A 4FHZA 3A70A 2G36A 4P4SB 2ILTA 1L4EA 5GGXA 4JLPA 1K7CA 4ES6A 3H5IA 2W6JD 4UI9C 4PG4A 1YZKA 1FDOA 1BVYF 4DPMA 1EESA 2ZIRA 4YDSA 4HAVA 3EG9A 1XRLA 4IUYA 1NRIA 5IJAA 5TT1A 4WOBA 4K46A 2H3EA 4H7JA 1OCZE 2Q1SA 3R0JA 2C3YA 4Z0TA 2KB0A 3P0FA 1OV6A 2JIMA 2Q6LA 1YUNA 3HVRA 1G16A 3HFRA 5ECYA 1JFTA 4YN3A 4MARA 4CR6A 5EZQA 4MZXA 5FBVB 2BGWA 2QD2A 4YJFA 3TLGA 1NHWA 1PWYE 4LRWA 1SVWA 4L76A 1V55E 3U9WA 4UDXX 3AUFA 3OIFA 4DLBA 1JW9B 3A2NA 5IXSA 1IG0A 2W4MA 4QAQA 3M0EA 4B85A 1XXHB 1JH9A 1ODLA 2UUBB 1HFJA 2PT5A 2Q3BA 3PYXA 2O4CA 3O8QB 2XOEA 3GGSA 4PLPA 3OF2A 4K6GA 3GAFA 2O3QA 4WNAB 1UFOA 5TPWA 4REMA 1E2QA 4UVDA 5HGJA 4PF1A 1VXRA 3PR3A 2NXCA 5AW7A 2XXJA 5FUYA 1XL0A 5TMDA 4HXIA 4R98A 1VP3A 1XCGB 1ZOLA 2XE8A 1BPOA 3FUNA 3OBBA 1FE8A 1DCEA 3A37A 1VKRA 1F0PA 4EPTA 4CIXA 2IU4A 2ERCA 1ODTC 1INLA 4PHFA 4DL9A 3MFYA 1E5TA 3RADC 4YDYA 2J9GA 1SXIA 1W73A 3IIIA 3K96A 4KR6A 2RGNC 5DOVA 3IA2A 5E9JA 1SCAA 3EAQA 2Y6UA 1EFCA 3X43A 2GEVA 3BHMA 5CFNA 1EVIA 4CFZA 5EIHA 3COJA 2I7VA 4DG5A 5T4BA 3EXHA 3ABRB 5F5NA 1RHJA 3V3KA 1VRVA 2FSPA 1T24A 4Y1RA 4JHRA 1KH3A 3GOQA 1R37A 1QK5A 3GUHA 4Y2RA 2Q7FA 1LZKA 2VWGA 1FDTA 3M6MD 1VHJA 3BXOA 4G0UA 2JKYA 3UGTA 3R20A 3HVJA 4R2JA 4U8HA 1UJBA 3VSCA 3I2HA 3QF7A 2DBYA 1VI2A 4ISCA 3ITNA 3GUZA 2PWYA 2XE7A 3HWSA 2WJZB 4YMGA 4RTSA 2VOJA 1SC4A 2BDUA 4RIFA 3ET5A 1MD9A 2IEBA 3MB5A 1A4UA 3WA7A 3EH1A 4YUAA 5JXGA 1T3TA 5DTIA 4BKMA 2MSCB 1J23A 2Y2UA 4QSHA 4QYIB 1O0CA 3GG9A 3D6TB 5JYEA 2APJA 4MVJI 1KDOA 5EKSA 4KSYA 1OXVA 5KTRA 2Q8QA 4ZU6X 1Y9AA 3Q3GE 3G0CA 1MABB 2R8YA 1X19A 4YMIA 4MKZA 1A8IA 3R74A 3NP7A 3DB1A 4Y2UA 4BV3A 2QRZA 5EZYF 2QT9A 3DVAA 2KJQA 1VP9A 1UR5A 2R4UA 3FNRA 1I2AA 4UQPA 1L1FA 3QOFA 4D4GA 2PTHA 3C3OA 4X8MA 3GRAA 4PG8A 1Q0RA 1JFLA 2JCSA 3Q40A 4HQOA 4MA0A 1B3BA 3C70A 3K32A 3AP1A 1N4SA 4KQHA 4NPHA 4PPQA 4GE0A 4A0QA 3NHWA 1DX6A 2CBXA 2PMKA 1E5DA 3RSGA 4DDTA 5BUSA 2J8SD 5CMLA 2J9FB 5LJLA 1A8QA 2X15A 1PV1A 1N77A 4OFZA 1XVTA 3IE1A 5IZCA 3BCSA 3R76A 3I1JA 1IL0A 3PQDA 4PH4B 5JLAA 5IC5A 3ZNOA 2F3RA 2ZSFA 1KQ3A 5KWVA 3MELA 3RTAA 1SG6A 3CHSA 1IULA 3FRIA 1YJCA 1U4OA 1P61B 3V00A 2W11A 3ZWQA 5HIAA 3S7JA 4M1TA 2PNFA 4R2WA 4JEMA 3AIKA 5K3OA 2VCHA 1EVYA 1QO7A 3T3EA 4L57A 3KYDA 3HKBA 4MP3A 2ZE8A 3CLRC 4JWTA 3VNQA 4KXFB 4UVEA 2CT8A 5G1NA 5BN3A 3RODA 3MZLB 3HDHA 4NHOA 4BP1A 1S01A 1UC5B 4FFBA 3ABME 3WOVA 3UT6A 3DQPA 4S05A 2IXFA 3QTLA 4JOBA 5B36A 1B8NA 3GWZA 1WL8A 5E1OA 3APDA 3SJAA 3QU7A 4O4HF 1RM0A 1S2IA 4BB5A 3KALA 3IBYA 2BEJA 3HV2A 3ZWAA 3LPAA 2C97A 2IYSA 3PDIA 1N9GA 3MWDA 3TLKA 1IZZA 4MOWA 3ASZA 1RWXA 1JIUA 2PV0A 1T9BA 4QM7A 2NZ2A 1SUEA 2WZBA 1ORTA 4Q02A 4KYIB 2JGNA 5KQGA 5MN6A 1WQ1R 3NYIA 4C0QC 2OD9A 3HXCA 1KEPA 2X7JA 2L0TB 3RRBA 1RMYA 4NJMB 3IJRA 4GPD1 1HTTA 5I9SA 5LLDA 1QTRA 1JVNA 4HWGA 4RY9A 2X0EA 2PVPA 3BMOB 3M4ZA 5ARFA 4PS3A 3CO5A 3ZGNA 3DMHA 2O5EA 4OXYA 3TTVA 3VM6A 4NIMA 1NJ5A 4K26A 3ZTYA 3T06B 1QZ2A 2HSJA 5FTPA 4JVMA 5I6DA 4Z53A 2CXOA 1DQPA 4L75A 2BGGA 2JHAA 4HKTA 2KBEA 2PO7A 1MX6A 3DBLB 2PZBA 3M3DA 3PL1A 1E7WA 3QXJA 2FX3A 3OC6A 2QT1A 3HBFA 3QVVA 5SZHB 4L8WB 5FTKA 4I1OB 1K92A 2NO5A 4GPIB 3MCAA 2PJRA 2WF7A 4JP5A 1PKXA 3ANNA 2J3EA 1ZP6A 2QKYA 2YRWA 1UJNA 5TVGA 5FWYA 2WYHA 2ZYWX 4BNWA 2BMFA 4R2KA 2ZYGA 2X9NA 3CV3A 1PCXA 2BHRA 4UBMA 3BXGA 2QX8A 3HBAA 4B17A 5CFRA 3MKRA 2FOIA 4HFJA 1KZGB 1YACA 2C4VA 3NDBB 2NP6A 4AURA 4PS1A 3AVWA 4QUDA 5EMJA 5HE9A 1NW7A 4FZJA 3BYZA 3U62A 4RK7A 1ZQ1A 1T25A 1JMVA 3AT1A 4BB0A 1AT1A 3F3KA 3JD1A 2YQ4A 1PBTA 3ONEA 1PR0A 4B31A 4XYBA 3T34A 1QIFA 4KVOA 5MGBA 1GA6A 1FQWA 4WCVA 4LQDA 4UEKA 5LSAA 3UHFA 4EZEA 1H23A 2IFUA 3VFDA 3OI7A 1ZVKA 3FCOA 1VSQA 3C8DA 2OBFA 4KL8S 2KWIA 2BV3A 5EJ2A 3A3PA 1AXRA 4OQMA 3VR4D 4DCTA 5TSDA 1UBUS 1YMVA 3ZRHA 3GVXA 2NZUG 2X8BA 4N9QA 3AERA 1EFLA 4HEA6 5AJHA 3KAPA 5ESRA 1XD2A 4TXRA 2R6GA 1KEWA 1ZJWA 3MV2B 1UJMA 2XTAA 4YV1A 3BE8A 2AC7A 1B4DA 4V1CI 3IQWA 4AZWA 2HHLA 3PUWA 3ZQKA 2ZK7A 2BHNA 4ZODA 1MAUA 4KIJA 4OB7A 3C7AA 4Y9UA 2V6GA 1V3VA 1JEJA 2WSMA 3L8FA 1A9ZA 3ONLA 2CSUA 1AKNA 3H9EO 4RZ2A 5K4HA 3ZGYA 1FJHA 2HU8A 1WCIA 2G67A 4NOMA 3ZVMA 4MUEA 3ZVKA 1KKLA 1TF5A 1N7GA 1NJ1A 4GR5A 2H2AA 2CLIB 4UMVA 1JBKA 2I2CA 4QT0A 4G1BA 2JIZA 1OXBB 3SZLA 4LCEA 3B1KA 5KPDA 3TLBA 1IOVA 3I64A 1EDUA 3PJFA 4B7XA 1WW2A 5D7NA 4DZRA 5L3ZA 5E1DA 3D3WA 3AS4A 1M7GA 3SR0A 2DWCA 3WQSB 3GEHA 4DDUA 2OPBA 4GD3Q 2V7PA 3LLUA 1J70A 1BI8B 1TTTA 3HDYA 3EGVA 3RVOA 4AJLA 2QTCA 4U8YD 3UUEA 3IQXA 4GWGA 4PBRA 5KBYA 1JQJC 4FP7A 1P5RA 2HJSA 4B89A 2OZEA 3U49A 2Z9BA 1VI6A 4A03A 3KJEA 4U2KA 1L8XA 5JCOC 1KVTA 1U0SY 4WXEA 1J97A 5KMGB 1C29B 3OMWA 4BT8A 1E1CA 3WGUA 3R7LA 5A6VA 3G2MA 3OESA 2O6HA 2W4IA 1T8PA 4BJHB 2HU7A 3KZKA 3HRHA 3RO2A 2XJ4A 1TL7C 5D2MC 5CFPA 5A1JA 4L3WA 4FQ7A 3ROEA 3MJCA 1L9KA 1XDZA 1F8FA 1VBNA 4P81A 3F71A 1XXHE 4F3NA 1THGA 4I2NA 3QPCA 1FDVA 1IY2A 3QQ5A 1SXHA 4O4IA 2H6HA 1RYBA 4HP8A 4HCJA 2OG2A 4WNGA 4AIIA 5FP0A 1I4TD 5A03A 4UUBA 4AM9A 4X91A 3TG5A 3QRWA 3L05A 4B76A 3BSWA 3TXXA 3C3EA 1GARA 4YGYA 3Q0TA 1C1DB 1CDOA 2WZCA 3MYRA 1P7WA 4C89A 3IUMA 4F85A 1ESZA 2P9SG 1N5MA 5EMHA 3WGHA 5T57A 1X1EA 3HSSA 2WP8J 2I9CA 1LRKA 4BQNA 1B26A 1G3QA 2O2XA 4DDHA 2VEOA 3OHPA 3H4MA 4BXOB 2UY1A 1BDBA