4MLPA

Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
492
structure length
492
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Cryptochrome-2
total genus 179
structure length 492
sequence length 492
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4mlpA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4mlpA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mlpA01
4KR6A 4ZCPA 3MLBA 1ULHA 3COVA 2QJTA 4CQNA 1JIKA 1WQ3A 3HL4A 4ZCTA 3ILVA 2CV0A 5HUJA 1QNFA 3DV2A 4MUIA 3U1VA 1OWNA 3CLSD 3G5AA 4KPUA 2VTBB 5FO1A 1U7DA 4MWBA 1D2RA 5KHAA 2QUJA 1KQOA 4HK4A 1K97A 2HZ7A 3ELBA 4AQ7A 5TS2A 1EXDA 1IQ0A 1N2IA 5DK4A 4XFDA 2HGZA 4QBTA 4ZT3A 3SEZA 3IDFA 2BYTA 1O96B 3CLUC 2YXNA 3MUEA 4ND7A 2X0KA 4H3SA 1H3EA 3X1JA 1EFVA 3SP1A 3IOCA 4KKVA 3G59A 1N77A 3CLRD 1JHDA 3FY4A 3NBKA 1KH1A 1MAUA 4MW7A 4R2LA 3FH0A 2JA2A 1F9AA 4NX2A 2ZUEA 1NURA 1LI7A 5LFAA 2QUHA 3Q10A 5K0TA 1M8FA 4EG1A 1F4LA 4PBRA 1SURA 3GMIA 1GPMA 3OP1A 3KT3A 3E27A 3M5WA 4R2MA 3CVUA 5AHWA 1G8GA 3G6KA 1JEEA 3INNA 2BTEA 1MAWA 2GOYA 4XFJA 1NUQA 1KKUA 4OJMX 1WZ2A 3AKZA 1IHOA 2DR2A 2AG6A 3AIIA 2X3FA 2J08A 1GLNA 4F3RA 1R6TA 3IMEA 3AL0C 5LM3A 4MUHA 3I05A 3AG5A 3N9IA 2XRYA 1OD6A 1N2JA 3F3MA 1QTQA 1TYDE 4I6EA 3HGMA 4QREA 4ZCQA 5J5AA 2ZUFA 1WXEA 1T6XA 1O94D 1QRUA 2GKSA 1CT9A 1J1ZA 1R6UA 3IVGA 2E18A 2NSYA 4YP5A 3SYTA 4G5FA 1IFXA 2DUMA 1FFYA 1KP3A 1MB9A 3L93A 1MRZA 1XJQA 4MW5A 3FDXA 1WXGA 1N75A 1F7UA 3FI0A 3H97A 1KORA 4YBRA 1TEZA 1J09A 1I6KA 1K92A 3KT8A 1KR2A 3ZXSA 5FNZA 3VU8A 3RJZA 4DLPA 4ZCRA 1IQRA 4MWEA 2CYCA 4K03A 2V0CA 1YIDA 4MVCA 4MAFA 2HMAA 3CLSC 2VXOA 3VRHA 3KT0A 4KR7A 4EG3A 3COWA 1U3DA 5H16A 3P0JA 1M83A 4P2BA 3TS1A 2X1MA 3HV0A 1MJHA 3UMVA 5TEVA 1JZQA 4RPIA 5BNZA 3CA8A 1GTSA 1NUUA 1K4MA 4KR9A 4EFKA 1JEDA 3P52A 1OWMA 1MC1A 1P7PA 3FNRA 4NDAA 3A2KA 2VTBA 2OQ2A 3P0HA 1N2OA 3N8HA 1BS2A 2CV2A 3TQIA 3CLRC 1ZH6A 4L2IB 4Q93A 1J20A 4HJXA 4G6ZA 1OWOA 4WSOA 4EF6A 1KP2A 3LCJA 4EG6A 4MW0A 2C5SA 1Y42X 4U8HA 1ZUNA 2PZAA 1XNHA 3COZA 4HPWA 4TS1A 2H29A 2TS1A 1QRSA 4CT0A 2O8VA 2CT8A 4R0NA 2QTRA 1XNJA 4MW9A 1WXFA 4JXZA 2A86A 1U7XA 1UFVA 1NZJA 3TZLA 1N2GA 1J70A 1N1DA 5H7XA 1V47A 2Z3VA 1YUMA 1WY5A 1J21A 4ZT4A 4ZT5A 2YWCA 1MOPA 4MUFA 3GUZA 4PBSA 3PNYA 4UZFA 4ZT6A 2A1UB 3CLTC 1OWLA 1WJGA 3IMCA 3TQOA 4F4HA 2Z09A 4MUJA 4MUKA 1NP7A 2WSIA 5DEOA 4GU5A 2CFOA 1ILEA 2E89A 1U3CA 4ND6A 4EG5A 3QTBA 1M8GA 1IQUA 4JZYA 4NZPA 3A4IA 1TQ8A 2XRZA 3IODA 1OBCA 1J1UA 1DNPA 2O5RA 3H05A 1JIIA 1H1TA 4RUKA 2EJCA 1O94C 2A1TR 3IMGA 3ISJA 1TYBE 3CVXA 3H99A 3LE8A 3QTTA 3ZXIA 2DERA 4PBTA 1QQTA 5DB4A 3ZJTA 4NAHA 1GN8A 1H3FA 2PZBA 3VGJA 1QJCA 3H9BA 1Q15A 1M8KA 1VBKA 1N3LA 1KH2A 1NUPA 1EFPA 3ND6A 1IVSA 2A1UA 2DLCX 3QE4A 2WQ7A 1EJ2A 5KWVA 1NUSA 1V8FA 2D13A 1M1ZA 3DO8A 1JECA 2Z08A 3FG9A 3FWKA 4HJRA 1O95D 2DETA 3IVXA 1GAXA 3UC5A 1YULA 3PNBA 1ZH0A 3MLAA 1COZA 2R5WA 3Q12A 5HG0A 2CV1A 1O6BA 2A1TS 2H2AA 4CDMA 3IOEA 3L92A 3UK2A 3ZGZA 3SDBA 3MXTA 2QTNA 2JANA 4MVYA 3CR8A 1Q77A 3IUBA 3RK1A 1EE1A 1T6YA 4CDNA 4YP7A 4OUDA 1QRTA 1O5TA 4DDMA 2J07A 1JILA 1G59A 1NYLA 3FETA 1X6VA 3N05A 1N2HA 2A4MA 2A7XA 4PY2A 4XSVA 1NSYA 1B6TA 1QU2A 1T9GS 3CVYA 5DASA 2CYBA 3SZ3A 4U7JA 1ZJWA 5IHXA 2YY5A 3RFFA 4NATA 3HFJA 2WB2A 4ZT7A 4UZEA 5IJXA 4DDKA 4JYZA 1FYDA 1PFWA 4QRDA 3PNVA 1QU3A 3PXUA 4MVXA 1N2EA 3ND7A 1YIAA 2I1LA 1X8XA 5HUHA 1TYCA 2PIDA 2WQ6A 3X1KA 3K9WA 5J59A 2A88A 4KPUB 1O97D 1VBMA 1O0CA 3ZIUA 2IELA 2AKEA 2AZXA 4MUNA 4ARIA 1WQ4A 1U0BB 3CLTD 2D54A 5K0SA 4EGAA 2PG3A 4L2IA 1NUTA 3ND5A 4GRIA 5EKDA 4NAUA 3ZJUA 1YUNA 1OWPA 2J4DA 5TEWA 2QUKA 3UY4A 2E0IA 1MBZA 1M8JA 2CSXA 2YWBA 4AS1A 1OBHA 3KT6A 4MWCA 3COYA 4MW1A 1KAQA 4I6GA 1I2DA 2QJFA 1PG2A 2V0GA 1IRXA 3ZJVA 4JFAA 2B7LA 3P0IA 3K32A 2CYAA 4J75A 2JAXA 1K4KA 5JBNA 1M8PA 4DDHA 1EFPB 2GM3A 4JXXA 1KQNA 1S4MA 2A84A 4YP6A 3C8ZA 1H3NA 5TGTA 3A04A 4EG4A 3PRHA 3JXEA 1JIJA 3OTWA 4DJAA 4MWDA 1O95C 3X1MA 2IJGX 1KQPA 4WNYA 2J5BA 4DE5A 5J58A 4J76A 4K0RA 2DXIA 3IVCA 1GTRA 2IP1A 1EFVB 4E1AA 1WOYA 4ARCA 3ZUGA 1JZSA 1PFVA 4ZT2A 1PFUA 4MUGA 3CVWA 3D6VA 2PXHA 1RQGA 3IUEA 1XNGA 1KAMA 5F23A 1Q11A 1YI8A 3CLUD 4EG7A 1TYAE 3Q4GA 1EUQA 1HYBA 3BL5A 1O0BA 3CVVA 3RBAA 1IH8A 1Q19A 4FZJA 4G5YA 1JGTA 3S3TA 1VBNA 1MB2A 2PFSA 1TFUA 4MLPA 1PG0A 1LI5A 2OV4A 2DPLA 2QTMA 1F7VA 3GLVA 4MW2A 2RE8A 1N2BA 3SZGA 3N2YA 3TZEA 2E21A 3HZRA 4MVWA 3TNJA 4MULA 4MUEA 4Q16A 1KH3A 3RHSA 2CUZA 3A05A 1NI5A 4I6JA 3IH5A 1GZUA 3HMQA 4YMIA 4MW4A 1G8FA 1O97C 3NBAA 4X0EA 2J09A 3MMXA 5FO0A 3FOCA 3KFLA 4A91A 2NZ2A 2PZ8A 4MW6A 4OUDB 3DLAA 1R6XA 4BWVA 2RD2A 1PFYA 3AG6A 3LOQA 4EG8A 2X1LA 3NV7A 1I6LA 2ZP1A 1VL2A 3H9CA 1T9GR 1I6MA 1T6ZA 3RK0A 1JMVA 3DPIA 3IOBA 2EL7A 4S1OA 4DNXA 2QUIA 2DEUA 4U63A 1WXHA 2G36A 1LW7A 3FIUA 1EUYA 3D6UA 1VLHA 3UOWA 1G8HA 2QJOA 1A8HA 1N78A 2D5BA 4MQ6A 3SEQA 1O96A 1WKBA 3FHJA 3AFHA 1WXIA 4ZCSA 5KCMA 5LLTA
chains in the Genus database with same CATH superfamily
4KR6A 4DG9A 4XRRA 4AY6A 1U4OA 2CG2A 1I24A 2V4MA 1PJLA 2NYUA 3BXEA 3D7MA 2OQVA 1CV2A 1V55E 4EGSA 1QVVA 5C8DA 3C14C 3TSOA 4LGMA 2BM1A 3RSCA 4J8SA 2PK3A 4W5QA 2BJWA 1R0WA 4G9BA 4HRAA 1KDZA 1GL9B 3ZCRA 5B2EA 2G71A 1M33A 1E2EA 1T9AA 3LKZA 5ENQD 6ADHA 4X85A 1T5OA 3IDAA 3VYWA 5A4IS 4J0CA 4A0HA 5JNSA 4J7XA 3VTXA 2IYSA 1EZ4A 1NZDA 1ZY2A 2J6HA 1U7HA 3CKMA 4EMBA 4TKVA 5TS2A 1HEUA 4MV5A 5CAEB 4BVJA 1L5MA 1Y7PA 1XKQA 2ZIXA 5DI9A 5KWEA 1J9EA 2XDYA 1JPUA 3DUFA 3PEYA 1AA9A 1OR8A 2EDAA 1WR8A 1PQWA 1SHZA 3FZEA 3IDFA 4LXTA 4QBTA 4UU7A 4EX6A 3R6LA 3JALB 1DEHA 4Y2PA 5JO9A 2ZYSA 3T5XA 1EVLA 1SBYA 5JMND 2VJKA 2IHJA 3DAHA 2D2FA 2FSVC 2QZ9A 4JHLA 1N4DA 3FNEA 1KRHA 3PFKA 4I1OA 4RFSB 4XVRA 4BAZA 1KAGA 2KCKA 1ELOA 3RNOA 1J97A 3WJ7A 4TN1A 1V4NA 2IKQA 5IH7A 4DA4A 2PQNA 2H06A 1TJFA 2LUHA 3A6GA 3QWIA 2WIBA 4V1CA 1AUPA 4OVKA 3K2EA 4BVFA 5M5BA 1M8FA 3NASA 4QLBA 1DC7A 4Z9XA 4X1OA 3MQ2A 4J1TC 2CDAA 1UG3A 3DAGA 3OTIA 1GY8A 5KJNA 4NU8X 5IC4A 2YC2C 3GD5A 2F3RA 2FVYA 3GMIA 1U1FA 2VNJA 3N7AA 3PYLA 3VZRA 3THXA 1Y6GA 1E8ZA 3FROA 4NL4H 4C0BA 5AHWA 3PSHA 1JB9A 1L5OA 1QB7A 1SIWA 4HS9A 4M1TA 3ESYA 4RD1A 5JQGB 2NYRA 1ZR4A 3AM1A 1ESZA 2CLKB 1FUEA 2ZRCA 3AEUA 3G0DA 4Y6RA 3C43A 3TQSA 4EHIA 2PYIA 1I4EB 4A7PA 3UCXA 2ZJ7A 4CCSA 3LEWA 2AOXA 4LNUD 2A78A 4KAFA 3RW9A 3S2IA 3NNDA 4UHKA 3PI6A 1KYYA 1PJQA 3V30A 1IHOA 1QKIA 4URXR 1HDRA 1JR2A 4IG4A 1LPBB 2WWIA 4JU8A 4AX4A 1TEHA 3ROTA 3UPTA 3RC9A 4W5NA 3PQ6A 4ARUA 1A2KC 1KIAA 5IEJA 3R76A 2B7CA 3W6NA 4TN5A 5ALFA 5B4VA 4RTKA 3EDYA 5A05A 3E05A 3RUIA 3RO2A 5F35A 4G1BA 2RFMA 4APFA 1GNPA 1WV1A 3MWEA 4MS1B 4N12A 3RRNA 5GIOE 1USWA 3WGOA 2VHJA 3TLBA 2EHJA 2J8SD 2VNKA 5EMLA 2PWYA 1QRUA 3DSXA 2QG4A 5JSHA 2ZJ6A 2FTKE 4EYQA 1A9XA 1G3NB 1DIBA 1E79D 1YBFA 1SZAA 2FWBA 2G3YA 3WWZA 4EUNA 3MT0A 1CF9A 4P22A 4BMDA 2QEQA 4IFIA 1IWOA 4YVOA 4HH1A 2BGTA 3PUZA 3UX4A 5ALPA 2IXGA 2ZWPA 3QUAA 2NACA 3M82A 1WXGA 2J8ZA 3OTHA 3X1ZA 3TZ6A 1H2TC 1NBME 4JGIA 2JLAA 3CGHA 3HDHA 5EP2A 5G53C 2IITA 4URZR 4YRGA 2YXLA 4WZBE 3GZNB 2HU7A 1HL7A 2V8OA 4HMQA 4MIEA 3N0RA 4WX2B 2CSUA 5AYVA 4BO8A 4DIFA 4F5DA 4QKQA 5BYAA 3OIFA 5AJLA 1V96A 4TT3A 3CEQA 1SVOA 3BWYA 3HJAA 4ZJUA 3U4AA 2EX0A 5JLJA 2EP7A 2HHCA 2OENG 2VH5R 4XM1A 5BQ5A 5AKZA 1Z4OA 1RADA 4NENB 3RIYA 2ZRHA 2EDCA 1TEXA 5JMOA 3BMNB 1REQB 5DMXA 3M9XA 4W9NA 2JHFA 2L42A 1NR7A 2VXOA 3KT0A 3HRHA 4G1EB 1MJFA 2CE7A 1G63A 2QOEA 3AY3A 3S2SA 2WSYB 2NZ8A 2N3ZA 2VHUA 3HL0A 3P0JA 4V24A 1S89A 2FZEA 5FFMA 3TSZA 3UK6A 4RIEA 5G40A 5ITVA 1YZTA 4P2BA 1SKUA 3OF5A 5C7OO 1BTOA 3DCJA 4Z0NA 3CRQA 1BLXB 4JW1A 2W11A 3OH8A 1HQKA 3RJ9A 2MHCA 4G56A 4CHGA 2A14A 2BUCA 1U2QA 3WL4A 3ZWCA 4BNUA 4D4LA 4HH3C 3D0KA 1XCLA 4XR9A 4YRCA 1MC1A 1H2VC 5EE5B 3SBXA 2GUGA 3LP5A 1MVNA 3N2LA 3SQLA 4RVCA 1BU5A 1VQ1A 5FULA 4AJNA 3P2KA 4LYDA 5M72A 1V8ZA 2KBEA 4TYWA 2O52A 1KFKB 5CD9A 1DJPA 2D62A 1ZH6A 5AW2A 2OGWA 3PEFA 1O7JA 2SNIE 2XEXA 3PLRA 2PT9A 1VPEA 1QF7A 4X1YB 4EVRA 3LUBA 3E81A 5DLPA 2OT3B 4TV9A 3RJMA 3X1WA 1YA0A 1DHTA 4UQXA 3RD5A 4ZXFA 2HDNB 4ATGA 3NDBB 4DSOA 3M4JA 3M1YA 4I81A 4Y9TA 1DCKA 3NWEA 5C0OE 1RZ4A 4NBVA 1ULAA 1UODA 4XUCA 3OZEA 4HPWA 3IX7A 4PZCA 2IX9A 2YMPA 1NSFA 2DG2A 2CJYA 3KJZA 4YLEA 2XMDA 4AWAA 5F12A 4DCOA 1W6UA 1E9RA 2FLWA 4O4IF 1DXQA 2SHKA 2WNIA 5CAEA 4TX1A 5I7VA 1PT6A 3I6ZA 4GPMA 2KSQA 3T5MA 4L3OA 3W3AH 3G2MA 2RMKA 2OBBA 2HL6A 4CHTA 4JJ4A 2YWCA 4HWKA 5F3RA 1NMYA 1D0VA 2IHZA 3ZU7B 3CH7A 1EEXB 1E2BA 1QDEA 2E4WA 2XCLA 4C2UA 1GPDG 5ALLA 5BSTA 3HDJA 3OOSA 5B2FA 5AQAA 4HMPA 2XDWA 4O6VA 2VJCA 3IQHX 4HSEA 4Q00A 4HL6A 1AGYA 4JT9A 3OQ6A 4S24A 3RF6A 4ZGGA 5AD1A 1FMLA 2GQ0A 3DT6A 4IJMA 4NCXA 3Q79A 1G41A 5LZ7A 3EF0A 3CG0A 2HA7A 4F3KA 1CCWA 3A4IA 4X65B 4EPZA 2Y1EA 2P8JA 4YRFA 3K2QA 2GM4A 4GEKA 4M98A 4KQXA 5FL7D 5BVGA 4FYHA 4Z53A 2O2JA 4BC1A 2ADOA 2ORIA 3RV4A 2OP1A 1CWUA 3QWPA 1QONA 1Q0SA 3QPWA 1YRHA 2ZUVA 1GNLA 3S1AA 5KVSA 2P11A 1U5BB 2WOOA 2YINA 2ZSKA 1UUFA 1PT8A 3IAS6 4PIPA 3IAS1 4IIYA 1KH2A 4OBWA 4IDPA 3ONLA 1XAIA 2BP7B 3RT7A 1CUGA 1PUJA 3DL7A 4LF4B 1ZGAA 2CVPA 2B2NA 2OL4A 3L01A 3NVMB 3CURA 1H65A 2DFKB 2R7LA 1W1IA 1GARA 3A1SA 3FG9A 4HJRA 4URWR 3ZS9A 2DKFA 1RWWA 2F8MA 2JFVA 1P1HA 1ZH0A 5JADA 3I2IA 3U16A 3A32A 3FTEA 7YASA 1PZGA 1W96A 2C5BA 2XD9A 1EFRA 2H1LA 4DR7B 4DJJA 1ZH8A 3FJYA 3HHMA 3JQGA 2EIXA 3PQ7A 1FDRA 1K8ZB 3JRNA 4JEIA 1ZD4A 1EUDA 3VVCA 5REQB 1PD1A 2ZZMA 1U9ZA 3BD7A 5LPNA 3SVTA 3I62A 4FDMA 1A7AA 4WGGA 1XZHA 3SX4A 1QMPA 2BFDB 1TKAA 4NYIR 2J59A 4I99A 1YI0A 3GUUA 1WW2A 1ZJ6A 3GJQA 5AKKA 1EWKA 1V41E 2WM3A 4P54A 3SHOA 4AURA 5D0OD 2B35A 3H1EA 4QDJA 1Z2PX 1T6YA 3F6QA 1GQOA 1A4UA 1X1DA 2HCRA 1W5EA 4FP9A 4K5CA 4O4HB 1O5TA 5M7EA 5T4HA 3VSEA 3IUQA 4F04A 2PM6A 4IX1A 4D9BA 4XGNA 3RVKA 1DQZA 1EQUA 4D4HA 5A1TA 4M87A 4BWRA 3A9RA 1U7UA 4O4HF 3BXHA 1KJYA 4GG1A 4WJKB 1QG0A 2W6PA 1F48A 4PY2A 2K4MA 1XX6A 5MF6A 4LF8B 1WU7A 1T9GS 1L5YA 3QLVC 5HEKA 2PPVA 5DPMA 3D4NA 4KI7A 1JSLA 4IOKA 3VHQA 4JX9A 4MR9B 1K5HA 2O7RA 3QLEA 4CM3A 2OAGA 4I9CA 3EH2A 4WNDA 4KVZA 4M1EA 2F48A 2KWIA 4IFEA 4R1TA 2XB8A 5AKLA 3ROKA 3EZYA 4QPZA 1D2NA 5AW1A 4ETWA 3Q9LA 3PNVA 4KQIA 1QU3A 4MVXA 3Q8LA 1IXYA 2WC1A 2C9ZA 2P2CA 2FHSA 1T8YA 4UHBA 1N1EA 4K26A 1HRDA 4ZQHA 5L95A 2F0YA 1UBFA 1YDFA 1IN5A 4KMSA 4OVVA 2FO7A 2VJAA 4QYXA 4G2VA 3K9WA 4B2IA 1BXGA 1KVRA 5B58C 2NW6A 2GTPA 4X44A 5J59A 1UIMA 3HCOA 4QTZA 4DL9A 4HNVA 1K7CA 3DB1A 3KHTA 1O1YA 2IYZA 5TMEA 5FYQA 1PJCA 3ZVLA 4JI8B 2C5LA 1BWQA 2WPDA 5AM5A 3ZIUA 4D9CA 5IMSA 2FPPB 1PQPA 4FMCF 4HFMA 1L5WA 2FMIA 1Z8HA 3NOGD 1YH3A 3AETA 3P8ZA 4LEIA 5A7HA 2C7RA 3ZBTA 3VPHA 4BFZA 4C78A 4CT4B 3NPAA 5J2TA 3IEMA 1NUTA 2CNNA 3PEUA 4JH0A 6AT1A 4KXYA 1R0BA 5DGIA 3GP5A 3T3OA 2PS0A 4J90A 1OJLA 1B0ZA 2GCOA 3HVKA 1NFQA 1B0PA 1H6DA 2WMYA 3SF0A 3FVWA 3QI7A 5A0VA 4AKGA 2QAJA 3VKHA 3D0OA 2JK0A 3PH0C 4MWCA 4YDYA 3IULA 3L7AA 5KX5F 3QFSA 4HB0A 1A4XA 1Q6ZA 2AXNA 4MRAA 1ZMRA 2ZS7A 1DBVO 2PO5A 1Z28A 4AY5A 1U0JA 3C39A 3ONNA 4RKEA 5DZSA 1EDOA 1HEIA 1H4VB 4EELA 1K4KA 4DARA 1T3GA 4YFYA 3TJRA 5JBNA 5I9MA 2OXIA 4UWGA 5JMPA 1ESCA 2QE6A 1XROA 3LUDA 3OQHA 4A82A 4YCSA 3HY3A 3I3SR 3LLUA 2B5VA 1GTL1 2D0DA 3GRPA 5HOQA 3WFIA 1N4AA 2LGJA 3M5DA 4B4WA 2O8FA 2GRAA 3KFXA 4J3JA 5DSXA 4IGAA 5BRNA 1X38A 1AKVA 1XRQA 1E1YA 2FPLA 4LCEA 4NFYA 3JXEA 4AKHA 1QQ6A 1BE6A 5GJCA 1AXGA 2VJBA 1U0LA 4U02A 2BFEB 2FWMX 1NT4A 1A04A 3BGIA 4QEKA 1OLSA 1KQPA 5DULA 1ZB1A 4IN3B 2VNSA 3M7IA 5K2MA 4C2TA 3G8YA 3PJEA 4G9EA 1GTMA 4EBAA 2Q8NA 3OZXA 3G9XA 4Y1RB 821PA 3RS3A 2E1RA 2Y6UA 5CDSA 3KAQA 1JMKC 1N4RA 4QELA 3WAKA 1Q6YA 3FOEC 1YV9A 4R9NA 3T4XA 5I9BA 3OQMA 1ZONA 2GZ2A 2I22A 3BQNB 4IDFA 3RIXA 4DG8A 3R4CA 5CLIA 4MYUA 4Y6OA 5FBKA 1DCMA 4DLTA 2PYDA 4PEVA 1PWYE 3CUTA 3FUDA 1DELA 2VXYA 4N8DA 4DHEA 2H4HA 1QS0B 1NN3A 3VTYA 4IGFA 2BR4A 4HOSA 3CKKA 3ITEA 3I28A 4HGQA 2VA9A 4HDMB 3T3GA 2QN2A 1W25A 2GD6A 3CVVA 2M1XA 1EUCB 2QD5A 3SJZA 3OEHD 4OYLA 2DFVA 4I5GA 2B98A 2CVHA 3S3TA 1Y82A 3G2HA 2AZTA 1AHHA 3T7CA 3QVJA 4OQEA 2ZGVA 4GD3Q 2BZSA 3WGKA 4A27A 2J6BA 1V16B 5IARA 4MLPA 1EGAA 4QBKA 1DP4A 1X0VA 1Y6QA 2AN5A 2EARA 4WZAB 4EVIA 4TV9F 2BDTA 3JRWA 2H6GA 1ZI9A 2M98A 1Y1KE 1Y7TA 3N3AC 3QF7A 4TGLA 3VPFA 3L07A 3P9YA 5EKSA 3VZPA 1B2LA 2GSWA 4WUTA 2WM8A 3GCGA 4M21A 5U9CA 2E21A 1JXMA 2GB4A 4IEIA 1VHQA 5BYBA 1CIVA 4YGYA 1AKUA 1GR0A 4QOEA 5K3FB 2BUBA 2IYRA 1IEVA 1HF8A 1C14A 3C3YA 1ZM9A 1C4WA 3HMQA 3AVTA 4MW4A 2R0QC 1KKMA 2ST1A 3OPNA 1WHTB 1ICIA 3CRVA 4GW3A 4X3CA 4PZ9A 3BHNA 3EGDB 3Q8KA 1ZICA 5FO0A 1EM6A 2LRHA 4N0MA 2DT8A 3FYTA 2QM0A 3ESZA 1KEEB 1U6JA 1USGA 1M34E 2OFPA 5IYZA 1QV6A 4RJ2A 1R15A 1E7RA 5K6RA 1E2KA 2X5NA 4QOHA 4URKA 4HQDA 3S29A 4HN9A 1SPBS 3MCUA 1G8SA 2RKBA 4U6SA 5DP1A 3ABOB 2L19A 3PIDA 4ZO9A 3UW1A 1CQIA 4CG2A 5CHEE 1VL2A 1XI2A 5A6CA 1MN6A 3EGWA 3MD0A 5J1SB 3QEJA 3DZHA 3DPIA 5AOAA 5KNDH 4R1MA 2JIBA 5I6DA 4M8KA 5HK9A 1RFGE 1CY1A 4C20A 1EDDA 1TN8A 2OXRA 2G36A 3PFWO 4Q3EA 1MB3A 5G1NA 3OHPA 4DR4B 3AU5A 3GDGA 2Q50A 4XIGS 3ZZTA 4AN0A 2P2NA 2H48A 5HIAA 3ABIA 1KMMA 3HCPA 2WJ4A 1TK9A 4XDZA 5I47A 1A5BB 4F97A 1UJCA 5HZMA 5TPWB 1Y9DA 5B4UA 2QM3A 2Q7OE 4Z8XA 2PBRA 2NADA 1N78A 2GVDC 1U7TA 1O96A 5REQA 3VR6D 5BN1A 1MEEA 2GMWA 4B8WA 3N2NA 4UEQA 1QQEA 2FFRA 5ILQA 5BSEA 1YVUA 4I4CA 5C80A 1SFRA 1HT2E 1X2EA 5FBQB 1BXRA 3UENA 4FC8A 5JYDA 4MCJA 2QJTA 2ETVA 2ASEA 3G2WA 2CZCA 3MJCA 4FN5A 3AWIA 3OM1A 2E5LB 5D2MC 4U7DA 3R3WA 4F96A 3INYA 2HJ9A 4OKIA 2X76A 1OC4A 2WKSA 3R7RA 5CCMA 3O92A 4WKOA 4ZAZA 3FLBA 2QN7A 3FULA 3H3JA 3QNWA 3VOBA 3W9YA 4HUQA 5B7GA 2ATIA 1JR3D 4XI0A 5D85A 3WB1A 1FDUA 2P79A 3TPZA 1U7DA 2ZGDA 1G2PA 4IUBS 4MWBA 1LV8A 2IGBA 4R9RA 4TV8F 1VG0B 3LY5A 4AXXA 2Q2WA 2QY6A 3EZXA 3VPXA 1CERA 3UGTA 1KMQA 3SBTB 3UIPC 4FULA 1CVRA 2PL3A 2WYOA 2J46A 3AL3A 3I9V1 3JW8A 5F1KA 4B33A 4ETIA 4ZVUA 5I7EA 4NV3A 2RHCA 2QTLA 2Q6LA 2JEOA 1MAHA 2WU8A 1QH1B 2GAIA 3G5UA 3KQSA 4KGDA 5AKXA 1JTFA 2WJ3A 4LOJA 4OGGA 1PRYA 4ND7A 3V8NA 4C05A 4F85A 4IYRA 2X5OA 3ESKA 3DEFA 1J00A 3NH6A 2HRQA 2CC2A 1SG9A 2GVNA 4YIKA 3RB8A 5C52B 1OX4A 1FBTA 1SCDA 1SC6A 3GGCA 2XVZA 4RXMA 4RZHA 1M6VB 1Y8ZA 2ACKA 1KH1A 1ZM7A 2XIJA 4OP1A 3P2IA 2R6R1 3B7PA 5FBRB 1Z5OA 1Z88A 1J39A 1ZSNA 2ECPA 2CLMB 3I34X 2IQIA 3LUPA 3NORA 4MZDA 1Z16A 3KPVA 4K6MA 2R6DA 4HB2A 3ZVRA 2C7QA 1OX6A 3MG9A 5HI7A 3B7SA 1HDZA 2I2OA 4Q9HA 2OD7A 4D3ZA 4D97A 2Y9PB 4P3XA 2JGMA 1QXSA 4JL8A 1DBWA 4HQOA 2Z9DA 1VCHA 2ZXFA 2GCIA 5JXIA 4LSMA 3AQ4A 2J3QA 1SVKA 5A6SA 1P1RA 4LRQA 1XP5A 3NBMA 4RY2A 1PHPA 1GAJA 4LNGA 3A1WA 4XE0A 2XGGA 4XFJA 1XT6A 3JQ0A 2O6LA 1KP9A 3AS5A 2B4KA 3LHSA 1ZINA 4Q0MA 1E4EA 1SBTA 4TWIA 2J9ZB 1XK7A 1UWLA 3ROEA 3B85A 4QXAA 1QZ2A 2WP8J 4R7TA 2XXAA 1YJBA 2X3FA 3THWA 2DWCA 3D8RA 4MCAA 1SKMA 3PJGA 3ZY3A 5JJCA 2XQ0A 1GFZA 2MOKA 3PDIB 5EQJB 1FS5A 3EZLA 3K1YA 4I7EA 2ZJZA 1VSBA 1XLUA 1Z0AA 1UM9A 4NU0A 3R7NA 1W75A 3OZAA 2C7OA 2NO0A 1PO7A 2WT4A 3NBYC 2VT3A 4W8HA 1YRWA 3ENQA 4MGKR 3UT0A 3ADOA 1MW9X 2FW8A 3DO6A 3LVBA 3DULA 4L5BA 4YXWA 5G55A 4B45A 2WJJA 3CEPB 3CW8X 1IHXA 1Z4QA 3QKRA 4KSCA 3TTYA 3AS8A 2HSZA 2JCXA 2R7MA 5IM4F 3T5TA 1R6UA 4KQ1A 2E18A 2WY2D 1R4AA 5KJKA 2B4QA 3DPSA 3CK7A 5A5VA 3DE6X 3KD3A 3T3MB 2C8VA 2JHAA 3IR5A 2WXGA 3DTVD 3DXXA 3V6MA 2IIPA 5B36A 2XENA 3MFYA 3ZGQA 1C30A 1XAHA 3K1ZA 2DVWA 4HRLA 2HF9A 3K6SB 4NACA 1US8B 5KOJA 2ETXA 2PZJA 3NKLA 1L7QA 4FNGA 3RAEC 4TMFA 3JV7A 2BDEA 4KGZA 2MYNA 1UDAA 3K0FA 4TLEA 4QXRA 3WL3A 2ZE5A 3MAGA 4X91A 5CT6A 5I9IA 4K5BA 3OBIA 3EODA 2ACEA 2MU1A 1CEXA 3CGWA 3UK0A 4UFPA 4M1OA 2GPWA 5EYPB 4ZK2A 2VPZA 5BNTA 1GDTA 1FDIA 3NNNA 1C5KA 1DAGA 2H8KA 1WSWA 5IASA 3F7MA 4D9MA 2UUBB 2ZANA 5LXTA 1M2OA 5F77A 1H5QA 3VV2A 1U3DA 4CMIB 3DBLA 3W77A 4EG3A 2ZSDA 3AIKA 4GICA 4HLLA 2A2ZA 2C7BA 4BO1A 3WGQA 5I9NA 3SX2A 5L3VA 1VI2A 3UM3A 3JD4A 4MK4A 1LH0A 4WV3A 5LQSA 4HTFB 3H17A 4QL3A 2Q4BA 5EMJA 3UMVA 5DO9A 3FGPA 3SZOA 3UMSA 2IE8A 3L8DA 3ZEIA 4KBYA 1Q2XA 4JJIA 1DC4A 4CZ2D 4JY7A 2QRQA 2VOEA 3PS6A 1NNSA 1KEWA 5J5CA 3VTFA 3MBOA 3CH4B 5ENZA 4BFTA 4ZC8A 2BTDA 1GA1A 3AR7A 5G41A 2VTBA 4BMPB 1Y5NA 1BEUB 1LSJA 5IAOA 3MNFA 2DWPA 2Z8YM 4CEJB 1IOLA 4E4RA 2MSKA 2JHCA 5BV1A 1XTPA 2R8OA 4HVLA 1CIJA 1KT0A 1OWOA 2R86A 2HJHA 1EHYA 4FGZA 4PCUA 2UUCB 1RWQA 3ANSA 3ESAA 3ICOA 2A0WA 2J9XB 2JLSA 1DKPA 1ZNXA 1R16A 1E32A 2VNHA 4QUDA 4EY5A 2OFWA 4WBNF 3ER9A 4J8PA 3SVZA 2YWHA 3HE3A 1R0SA 2WD8A 4O1PA 3B2QA 4B8YA 2QRGA 1K0FA 4JD5A 5LQKA 3HXKA 4LQDA 3FRIA 5IKPA 1WETA 4FX2A 1PI3A 4NBRA 2XE7A 1A8QA 3JQAB 5AW6A 3DLIA 3GZSA 2C2XA 2AW3A 4FDUA 4N7BA 1RKVA 3FFTA 4QGAA 5IT5A 3AVWA 4JB3A 3DEIA 1QANA 4CQLB 4L0QA 3LQ1A 5ECWA 3K0CC 4TXJA 4WERA 2G9UA 4GRDA 3WJ1A 4ND3A 4B89A 2XCIA 3RFUA 3GUZA 1SR8A 1X7YA 1G3MA 2ZWAA 3MTBA 4HH4A 1YJQA 2C0LA 1O5IA 5BYJA 3MW8A 4G25A 1JEAA 4Z5XA 2ES4A 3H5RA 2H9IA 2HDHA 4IULA 4AXHA 3GQVA 4KTTE 3HIZA 5CFMA 1E8DA 3APCA 2RG8A 2GPAA 4IVPA 4GTPA 1EB8A 4JZYA 2BFBB 1KI4A 1TQ8A 2O8CB 1II9A 4KLAA 2ECQA 3QY9A 2GEFA 1N5OX 3I83A 3G5LA 5HKBA 2ESRA 1E7UA 4E85A 1EEHA 1XMQB 2AZDA 4H6PA 4AY4A 3GLSA 4ZAVA 3ISJA 3TIVA 2H57A 4KB5A 1BCSB 4Q4HA 3ZJTA 4Y6CA 1QAMA 4YDRA 1H3FA 5D51S 3ZG6A 3LLCA 4Z4HA 4XIIA 3PNQA 2P2DA 1ZWKA 1YZNA 3ENZA 4PHTA 1ADJA 1Q15A 1ZMBA 1EUZA 4IP0A 3ZTTA 2HUNA 1CR2A 1PW5A 1WKCA 4F9TA 2GJ4A 3ZDFA 2YXEA 2CCJA 4O3FA 2F17A 2J67A 3NHFA 2GBCA 3A4MA 4MJLA 3OSUA 4MQUA 4ZU1X 3LWZA 5A0FA 1SCJA 4PS7A 2I6UA 4FDLA 2F1IA 1VCOA 2LP4Y 3Q7QA 4HNSA 2JLYA 4E7OA 3PNBA 3D7SA 3M4XA 4Y2JA 2ISCA 1L1RA 2QL6A 4Z3KA 4DANA 1JBEA 4OHZA 3UWPA 2ISQA 5K3FA 3V3TA 4S1WA 3ZN2A 4UWLA 5A0TA 5BR7A 1NZFA 3C5CA 4IDBA 4A2PA 3FKSD 2WMNB 4CDMA 3SFZA 1N7HA 2ZVPX 4KUHA 4NS4A 3UK2A 2MCFA 4IDHA 4DLVA 1N52A 3O2JA 5JR3A 2ODPA 4BDTA 4TXRA 1N7JA 2ODNA 2JANA 1GM5A 4BPBA 2OWEA 3JVEA 1XCMA 4L75A 3CZPA 4F53A 1IUOA 1E5VA 3FTUA 1W93A 3O4GA 4OTZA 2Y77A 3A31A 5AXCA 1VPWA 4NV0A 3IUBA 1AIPA 1NAHA 3EVZA 4XOIA 1KE2A 4MQBA 5CNIA 5AQ9A 4WXRA 3ZIMA 2FUEA 3L7MA 2NP7A 3LOPA 1UKCA 1KETA 4BQOA 5FZQA 4C7XA 1D4OA 4MICA 2B37A 1PFQA 4J1TA 5JECA 1H2EA 5JAQA 3TJMA 5IJWA 2VPQA 4I46A 4WNGA 1SELA 1L5GB 2A7XA 4XSVA 4JLUA 4GZ5A 2RHTA 4UD2A 1K8KG 1BDMA 1UT6A 3IDSA 3CVYA 5DASA 2B1IA 5CLJA 3SZ3A 3S7TA 2ONDA 3NATA 3OLZA 3OT1B 4FJ2A 5G1PA 2OMEA 1PJ8A 1KZ6A 1X94A 2AJ8A 2DLNA 5DISB 2I2XB 1C9JA 2P7IA 1ZNWA 3Q7RA 2PR2A 2W4MA 4RMHA 1CNFA 1YS7A 1XA3A 2DX7A 3DWFA 4QFBA 1L5LA 4H7YA 2WSSD 4RANA 1UWVA 2H7YA 3QU4A 4HQ0A 1EVEA 2H6HA 2HV8A 1R9GA 4PAOA 3RASA 3VR3D 4JNCA 4B3HA 2A5DA 2QLJA 2P3LA 3PZ3A 1BDJA 2F7SA 3OETA 4JX8A 4NKRA 2HD4A 1JCSA 1N0RA 3C3PA 2IDZA 4OLJA 3NC4A 1PNOA 2G67A 4K05A 2WTEA 4XLZA 3V34A 3VDXA 4WH0A 3VZQA 5K8IA 3PZDA 3P71T 2GFIA 4YALA 2QTVB 1Y8RB 5JT1A 1RWXA 4BMCA 4G4JA 4DW8A 1FFSA 1D2HA 4RKQA 2YUTA 4AZ0A 4L27A 2O14A 1QIJA 5K1ZA 1WVIA 2WXFA 3ZD9A 5TIIA 4DUZB 3A8TA 1S8AA 5AUOB 1Z25A 2J5RA 5E0OA 2WXRA 3BXPA 4CTJA 4EUHA 5KEIA 1U0BB 2BKEA 3ERCA 3MT7A 1K2WA 2JH9A 2Q5JA 4FM9A 1Q20A 2LPMA 3NAGA 3EY9A 2IWRA 1FLDA 3KYCA 5F5XA 4G5GA 3AUJB 2Y4UA 5EKDA 3IP5A 1CUEA 1L7VC 1DO8A 1OFVA 5HA5A 4L95C 2O8BA 5AI0A 4ITUA 4MWZA 5AW7A 4CQMA 4KX3A 3Q85A 4U2CA 1MV8A 4W5JA 2ZUTA 1M2EA 1P6QA 3B9QA 1KKLA 2I65A 3LPAA 1IMOA 2G40A 2K2QB 4UE2A 4H0NA 3W3ZB 2GHRA 3RAGA 5HW0A 1RC0A 4AB1A 1PG2A 1CR0A 3IFSA 3NHJA 3N2IA 4KXKB 1IRXA 1K27A 3E30A 3R9WA 5FV4A 1FTYA 4YAJA 2FPGB 5A62A 3Q5EA 3VH3A 4CRWA 4H7HA 1ZIDA 3GBSA 1LU9A 4YT5A 1V5IA 5EKUA 1EFPB 1XTQA 4HRYA 2WXQA 3NBXX 4M22A 3D4PA 3GZJA 2CLIB 4C6HA 3R3YA 2R00C 1X7XA 3DVAA 1NC3A 3BDAA 4LRTB 4BMSA 3V2IA 1SXJB 3DXMG 4B3CA 1I3OA 3EQ6A 3C3WA 3FSGA 3UKJA 1KXJA 5ESWA 4CKWB 4QTXA 4AU1A 1IJKA 3EEIA 1OXXK 3OTWA 2PWPA 1Y5IA 4MWDA 4X61A 4A2WA 5IXSA 2BHLA 2CUTA 1DKNA 1XA4A 5FHQA 1P1JA 1A82A 4I1SA 4FGLA 5AXDA 1GDHA 3P9ZA 3ACBA 1ZEMA 3QI2A 1ZVVA 2AFHE 1NE7A 3AIMA 4PFJA 1SUFA 3GMSA 3BEOA 3TWSA 4R9VA 2O54A 1CY2A 2ZLBA 4R6XA 5DYGA 4DBZA 1GTRA 2DXIA 4C0HA 3O4VA 3BE8A 3O0TA 3MELA 4H1TA 2YYYA 2NXCA 3SNHA 4XI9A 4DIBA 2IH2A 3C98A 1VLJA 2I9PA 2HC9A 3WSVA 1RLTA 2FPIA 1OVGA 2HA5A 4QXMA 4R7ZA 5UKDA 3LT0A 2GPNA 3D3EA 3ELDA 3NYRA 2PXHA 1ZDMA 3JYSA 3G8CA 1KHHA 1RQGA 2XOEA 1CJKC 4W6ZA 5JY1A 4B6PA 5IJAA 1GZ3A 4JVSA 1PL0A 1UXIA 2JCGA 3LX4A 1W34A 5HF9A 4FKZA 3RM3A 5F23A 1U6IA 3K09A 4UBOA 3WDLA 4AX8A 2IEYA 1RI5A 3UTMA 1N2CA 3EULA 1VRWA 4IUYA 4JAVC 4P4UA 1O0BA 3IAFA 4EFNA 3W2HA 1MC5A 5FOVA 1OZ0A 4OFZA 3DMRA 5KKCA 3AF6A 2Z95A 5BR8B 1VC2A 1JWFA 1IE3A 3VNBA 5DH9A 2R6JA 3L0OA 3C24A 2PZKA 1KWKA 1CYEA 2XS1A 3TOCA 1QG4A 4LTDA 3DZ8A 2XYVA 4FW9A 1UZUA 3BB4A 2JBWA 2RGRA 3MLEA 5ESDA 3U7QB 4ERXA 1ZXXA 4AUKA 3ZFWA 5GVSA 4YCNA 4UUBA 4PFSA 2ZRIA 4U04A 4HPJB 1V3QE 5EWJA 4LZNA 4ZVNA 5LUAA 1B74A 2FRDA 3HZRA 3O8CA 1C4XA 1R4ZA 2IIQA 4NEGA 4C06A 1XSEA 1YRBA 2VPTA 2BGLA 4TRNA 3TQQA 5BWNA 5KQMA 5JJKA 5K0GA 4GZDA 4ITVA 2W6QA 3AILA 3L84A 1RHMA 3DL4A 1YJXA 3THXB 3GZ1A 4B2YA 2CLEB 3C6ZA 5IBPA 4CU5A 1NBMA 2RDMA 1Z39A 5D1HA 1KJ9A 2X38A 5FFNA 3ZLVA 4I3FA 2CKDA 4J6IA 5AQEA 3KVRA 3GLGE 4EY6A 1DKLA 5JVDA 2VDOB 5JZOA 1PQUA 3HU2A 3IT3A 4JVOA 3QEAZ 1NATA 2RBEA 3HUEA 1COWA 3BEDA 4FEAA 4LDQA 4PPGA 4CU2A 1F6WA 1KYVA 3BGSA 5FUYA 4GZ3A 1P1BA 3BGVA 2I2WA 2IRWA 3NT4A 4DRXB 3FU0A 1ZISA 4KVMA 3H6GA 1TN6A 4PHGA 4AW9A 2ZGGA 2V3VA 3S28A 3VDQA 3NV7A 4DCCA 5I4BA 9MHTA 1BHSA 2C4KA 3F6EX 3NAMA 3RHTA 4KN8A 2RGDA 2VCHA 2HHHB 3VHRA 1H85A 2F6RA 2AKYA 2OC9A 4UHFA 4LZAA 2J9QA 2OTCA 2XBUA 3HR4A 1WXHA 1AO3A 1MRNA 3EWIA 3FOAA 2Z8ZA 3OZUA 3DDHA 3QYAA 4N7RA 1DXOA 1HEYA 3LUFA 3OAAD 4Y7DA 5FHRA 2VSXA 3WMFA 3ROQA 3ZBPA 1ORDA 3F6PA 1A5AB 5BNIA 5LCWC 2D1YA 1G6Q1 4OVUA 1RPAA 2IPNA 3AR6A 1PC2A 3HA2A 3P9IA 4WK4B 5AJVB 3T7IA 4PTZA 1N8SA 5KJ1A 2ACVA 2WWGA 2YCBA 3GZ4A 5K0CA 2JD0A 2FO1E 2PCJA 4Y2VA 3PXBA 3ZU4A 1VE9A 3D2BA 5JZBA 1IK4A 1R9MA 4OI2A 3GCWA 1C0IA 4YH1A 2HRRA 1T8TA 3DONA 3IV7A 4NG4A 4P4LA 5EXXA 1LTKA 5EVJA 1FRQA 3QC1A 2PZIA 1CDOA 1IIBA 2REOA 1QYWA 1G6KA 3FYHA 3JQ8A 4CV1A 4B80A 2WXIA 5A23A 1ORRA 3ZXXA 1IG0A 3RUFA 3S5JA 4O2BA 4XVCA 1O3YA 4HQFA 2PV0A 1VIYA 2PVSA 3TW4A 4CIDA 1NJ6A 3WAGA 2ZYTX 3BDIA 3HL4A 4R8LA 3TLAA 1UR5A 2CL7X 3LHIA 2O06A 2O1XA 3F4BA 2OO3A 1XWWA 4ZYVA 5HUJA 1VG9B 3U4TA 1QCDA 1BE0A 4NCIA 4AXBA 5ESRA 1DUVG 1GPAA 4LGCA 4OXYA 4NYJQ 2K2WA 3CWCA 1QO7A 2ZIRA 3KZ1E 4BHTA 5IZCA 1QIHA 4DF3A 3FDJA 1SCKA 3CEJA 3DUFB 4IFTA 1JI0A 3BUSA 5I4CA 1VGRA 1NNLA 5HGJA 2NUTA 3M4ZA 1PEDA 3SHVA 3TGOA 1BIFA 1N92A 2P9FA 4KE7A 2PVCA 3DOUA 4LTMA 2ZBQA 3GFBA 3CRMA 4J6EA 2J0QA 1XZBA 2OVFA 5EP3A 1Y5RA 2IYFA 3TL5A 1NPDA 4OLHA 1EFVA 2HBRA 2PUBA 4I4TF 5EGNA 2X14A 5FYDA 3IHKA 1I0IA 4JA9A 2ASVA 3OZRA 3IIEA 3MOIA 3FY4A 2VTDA 1XEXB 5HVNA 2NTNA 1VE3A 4MLDA 2VAWA 4GOLD 3R5JA 3M4NA 4X5OA 3WHPA 5IKOA 5K0TA 3OI7A 4HWGA 2NU7A 2O8CA 5DLDA 1A3CA 1GCOA 3NT2A 1ZLYA 1JEOA 2DAPA 3GARA 4B3RB 4ZWNA 3O38A 4D9KA 2FFJA 4AJHA 2CFZA 1G4HA 3E27A 2BZ0A 3JD0A 3C6MA 3G2UA 3OHMA 4H60A 4DXAA 5DDIP 4XCQA 2BMDA 4H7KA 2JIQA 1KPSB 3A25A 2TRSB 3WGJA 4P7FA 4C5AA 4D82A 1IN6A 1NSTA 4FYWA 3VUFA 1KGDA 1BHO1 2FV8A 3HUUA 5CDUA 1Z5UA 2DRIA 2B4YA 2VL7A 5IEBA 3N8IA 5F5NA 3DLBA 5JCZA 5KUTA 4OMDA 4DCSA 1AKNA 4J8DA 1ZCAA 1MDFA 4QT4A 3THYB 1IONA 1R6TA 2XF2A 1PFGA 4QUEA 3KYBA 4FLEA 5KU7A 2NXJA 4KPGA 4DOMA 1PJBA 5BUQA 1N2JA 5ANLA 1ORTA 4JLDA 3FTXA 1I5RA 3ZHQA 2B69A 3T5VA 1XYYA 1U8ZA 2ZBPA 3LKVA 1Y9AA 4TUYB 3N2EA 1JFSA 2FEZA 1U0OC 3JASA 2WMOA 1UEJA 1HDXA 3QIVA 2VDPB 2XQGA 4FADA 3EE6A 3F5DA 4F5EA 1JHZA 2IYLD 1ZIXA 4URYR 3QSGA 4UTRA 7MDHA 2I7XA 1U0NA 1ZBDA 3NFYA 2A9PA 2ODEA 3M81A 5LWQA 3H5IA 4RPKA 1BQ4A 1MRZA 2IUYA 3L93A 3TDMA 4HAIA 5G4LA 4O33A 1XTSA 2XYHA 3B78A 2XCCA 3SE0A 1WEHA 3OD1A 4B4OA 1RZUA 1N8KA 4GOOD 5EOVA 4D9FA 3IT1A 4DRZA 5EXEA 1BX3A 4KXXA 3R5KA 4ZZ0A 5C1BA 1KORA 1YXMA 3HDYA 5A04A 1YA6A 4HWRA 4AUMA 4CN9A 4BY9E 3ZX4A 3O90A 2X9LA 3PR2B 5MGNA 3WYCA 3ZXSA 3HXFA 1DRKA 2ZSHA 3M6LA 3IR7A 4DYVA 4F2WA 5KOHB 2Q3LA 2FR8A 2YVQA 3QHQA 4A8TA 4DLAA 1LLQA 5J4HA 4BDSA 3U3JA 4MWEA 3NIDB 2GS9A 1YIDA 2E4UA 4LZOA 3BMOA 3EIQC 2IIBA 2XMCA 4OP3A 2X4LA 3CRW1 1JLHA 1O6GA 1ZM2A 2MINB 2YH2A 2BGRA 3FNQA 4PZYA 5JMTA 2EP8A 3L1IA 5HKKA 1R4NB 1HX8A 2RGXA 2ZM6B 3MPUA 3HA3A 1G55A 1RBYA 1PNVA 2PWBA 5HK8A 1GJRA 3QPAA 4QGSA 3LIPA 2W58A 2XVXA 2ZWIA 1YAHA 5CT8A 4DX7D 1GGMA 1T25A 1D2GA 1GTVA 1R64A 3JQ9C 4DR3B 1GPH1 3WWCA 1V8DA 2D2IA 4B2LA 1JEDA 3KQQA 5JBQA 3UMJA 2IY0C 4GI3A 4L1BA 5B7QA 2BMFA 5FLXA 2HSDA 4MX8A 4XM2A 4BX3A 1YCHA 3OT5A 1TJNA 4G1UC 3WNBA 3GP8A 1ONOA 2FWAA 3D6TB 3OA0A 2Y71A 3AC0A 3Q9UA 3FJ1A 1G7TA 3RQIA 4M9ZA 4KO1S 3AESA 3MWJA 4JT8A 3KJGA 1CZRA 1TJPB 2WU0A 3CNLA 1E0DA 4TKUB 3LUKA 1NXTA 1PT7A 1E2MA 1FJ2A 2LKCA 4G9GA 4U2EA 1CDDA 2PMWB 4ZRDA 3WGTA 3QX3A 3AFGA 1UC9A 2Y1XA 2UYOA 4PSVA 2K5UA 3DYVA 4A8JC 3O2SB 4DAEA 4DB4A 5H7PA 5LYYA 1QIEA 3GVPA 2PZAA 3GJXC 5CHEA 3TB4A 2V54A 2Z83A 5AJWA 2WICA 3RVNA 3PUKA 1TF5A 3FLAA 3ITNA 3MS7A 4R0NA 4CEHA 3OEYA 1PW7A 4B87A 1IN7A 3JQCA 3TOSA 5K8JB 5AKEA 1MMFB 2XMSA 4ZVMA 3DNPA 1U1CA 4I5EA 4KBQA 5GADl 1QE5A 4AMYA 1YL7A 2EWMA 2G9VA 5CA0B 5A3SA 1EG2A 3GEIA 3G68A 1BPOA 3BPSA 1QC5A 4Q48A 3WLMA 3ITDA 2QJWA 3OMWA 3STYA 3ZV5A 2VHWA 4D4GA 1HFKA 2NMVA 1WEKA 2QW0X 5EWMB 3CMCO 3FCSB 4CUJA 2WZQA 3DWIA 1H05A 1VLZA 2W48A 3C8HA 4HFGA 1A4IA 1MKYA 3RUDA 2FUG6 3ZQ6A 3SMQA 4JB2A 2C82A 3EXIB 3TAHA 3VR4A 4HS2A 2V4ZA 1E0SA 3EQ7A 1T34A 3F97A 3LFUA 3N39C 3OFNA 3OJWA 4FR2A 4C87A 2WMNA 5H9WA 3MWYW 4QU0A 3SKVA 5INTA 2GYUA 2IYXA 4IYPA 1P77A 2JAUA 2JIRA 4GDMA 1UDXA 3DE0X 3RRFA 4DNQA 1KQ3A 4DLXA 2QXTA 2P1ZA 3G0CA 3CVXA 3IVRA 1UPCA 1C3OB 3QFRA 5ENDA 5ESXA 4YAGA 2X4DA 4G5OA 1GN8A 2PZBA 2WXOA 4YJFB 4DSUA 3IQGX 1H23A 3B70A 3O8QA 1GFWA 1NQ5A 1EQAA 4NOKA 5AI4A 2XSZD 4E5KA 5IKEA 3A4NA 3UXEA 1B0AA 1KDOA 2EXXA 3O1JC 3MWEB 2GSDA 3T41A 1Y48E 4JJ6A 2J9RA 2HQOA 2C78A 5JW6A 4KQ2A 4ANVA 1X7YB 1DOZA 1ZD2P 3NF1A 3DSTA 2I5PO 4LJ4A 4WVLA 5K51A 5TT0A 2IV7A 1QGDA 1Z4MA 3MWGA 4LWZA 3ET5A 4URHA 3DO8A 3DSVA 3IO3A 1F2VA 3GMTA 2P9NG 5ICSA 1YULA 3BQOA 2QMEA 1HE1C 2GI4A 2VBGA 3R8XA 3T3DA 1JSCA 1DO2A 1MJGA 3T3HA 2ERXA 3DR3A 1EJ6A 1WSBA 3TYXA 1Y1LA 2CXNA 3H4IA 4G0YA 1SXGA 3BRSA 4L72A 2TECE 4EM6A 4L4UA 1BEZA 1GZHB 3S2ZA 3WNCA 3ABME 1D09A 1U0SY 5ARGA 3KSZO 3RYIB 2W6MA 4L4YA 4EWLA 4I43A 2AFVA 4INJA 4LX0A 5A1JA 2F55A 4ZDWA 3E32A 2BFWA 4F4JA 3FSGD 5LKRA 1V1MA 3OCXA 4D8UA 2QZPA 4Q7EA 3HM9A 4IIHA 2FYTA 4UHHA 1GUBA 2BHNA 1SBHA 1EE1A 2VJPA 2P27A 1A9PA 3HYNA 3IP7A 1Q2UA 4HLCA 1YQQA 3UFXA 3DBHA 3H8SA 2HCTA 5GGYA 3UJ6A 5K8UA 3JZMA 5KX5B 2JFXA 1G38A 1KBZA 1MX5A 4AL4A 1QLWA 1R8XA 4EQZA 1TRKA 2GN8A 2EOAA 1MGPA 3ONEA 3NHPA 1M1NA 1T2CA 3NHWA 4QUGA 4CM9D 2QX9A 3BHIA 5KNLA 3DO5A 1Y0BA 4KAAA 3SGLA 3HGTA 1U8YA 3BIWA 3O8OB 5FNVF 3PKZA 1PJSA 4U7JA 1NVMB 5F4ZA 4BOYA 2YNMD 3DYBA 3FKSA 4OCZA 4PQGA 4EQ6B 1M74A 5D3MA 1VHLA 3EG5A 1UFKA 2NUAA 4XFKA 1B2RA 1CYDA 5F7XA 1B76A 4LNUB 4GA1A 1KO4A 3EXG1 2XMGA 5GZ6A 3SZMA 3CB2A 4KH1A 3VYVA 4AJPA 1SULA 4GOND 3A11A 1MO5A 3MK31 4UXJA 3RRMA 1QOZA 4P58A 2X7JA 2ZPAA 3KYJB 3EVDA 2W8ZA 1IRIA 3Q2IA 3TUJC 1ML3A 3DVQX 1Z3XA 4Q1VA 4F0JA 5HP4A 1Y89A 2G8LA 2XEDA 3EFEA 4C6RA 1YRQA 4DRXA 2C2KA 5CTAA 3CPSA 4RGBA 5B3LA 1Z3IX 1B8PA 2G82A 2I6TA 3L0SA 3PKJA 3ZE6A 4KYIB 1GKUB 3HO1A 4B6FA 1T1EA 1C81A 1XMIA 4BATA 3PVSA 4XJVA 1JFTA 4Q7MB 1OT5A 1BXKA 5G4KA 4FCWA 5A06A 1AMNA 3G0HA 1IXRC 2Q7FA 1BO6A 1FRNA 3JVIA 4OYSA 2QXUA 1NQXA 2MSLA 3KUCA 4JLMA 1U28C 2IW1A 3FN4A 4FFDA 4YJHA 1NFIE 5EMNA 2IOYA 3SHQA 2LCQA 4NICA 3ULEG 2HA4A 4CEHB 2IHNA 4ZRNA 1YVDA 3VR3A 4YRQA 2DHRA 1RWBA 4KNVA 4II3A 4XX0B 4IIVA 3A1VA 1XTBA 3MM4A 4OJKA 3MBKA 4XPIA 3RLFA 3HKBB 3FFAA 4FI3C 4RLHA 4TL6A 4US1R 4F21A 1P2GA 1CB0A 4LN1A 3NZUA 5LMNB 1Z62A 4Y98A 4JXTA 4XEIG 1XN1A 1GADO 1UN8A 2DPGA 1J0AA 2EJVA 1ESMA 3D8SA 4F93B 2PUFA 4NECA 1F9EA 1TK2A 5LU9A 1I2CA 2JAXA 1UOPA 4R8VA 4TV8B 3D0QA 4DADA 1XVLA 1IM2A 1I13A 1TYEB 2Q3FA 3DXYA 3T6KA 2D5CA 2XKBA 1EXMA 3S7FA 1I2ZA 3LD9A 4Y6GB 2DUJA 5C8XA 4OO3A 3KQKA 4MUXA 3VSDA 3PVLA 4RA9A 5CFZA 5KTSA 4E5NA 4EG4A 4B81A 4IXWA 2V7PA 5HQ3A 1FK8A 2MYUA 1AS2A 2Q9BA 1E3SA 3BH0A 1W5BA 2HJSA 4KYOB 3ORRA 3O3MB 3QVUA 8LDHA 2KMLA 1NZNA 1ZH2A 4XQCA 1OKKA 2UUPA 1T9CA 4B93B 3MKQA 3ZXPA 4M60A 5EXDA 1PYOA 3FNIA 4E6HA 2QAGA 3OE5A 2X3MA 1GL7A 1DBPA 5EVCA 1CB7A 3IB3A 3L7DA 4OG2A 4U7EB 3UO8B 4F56A 3DE2X 4Y2YA 1J24A 4HCJA 3PPIA 4DVGA 1LPOA 3FKQA 1P3Y1 2WXJA 1KY4A 4TRQA 1CETA 3FCOA 2NT3A 4ARCA 2IHYA 8ABPA 4J16C 1Y9ZA 1LCIA 2RGNC 3HXLA 5MGBA 4WKCA 3CN7A 5FQ8A 1RYFA 4FOLA 3LX6A 3L4EA 4HN2A 3RROA 5D86A 3WK4A 3ZDCA 2LNIA 3X1DA 4ZDJA 3LWNA 4R71A 3PRZA 1UPXA 1V2GA 1Y81A 1YB6A 2H5IA 3H4MA 5EWLB 3C6KA 2BGUA 3EFHA 3QITA 1XNGA 1VJ5A 3V2XA 1ZIYA 2EX1A 3D3JA 4IIGA 1YS6A 3CLUD 5C4GB 3Q4GA 5C5CA 3U7HB 4P3PA 2H3HA 3ZI4A 4UI9K 2HMWA 1N6PA 4FQ8A 2BV3A 1MF7A 4K2HA 2REQB 4MS1A 2VBCA 4WFIA 2BBOA 4PAWA 3WL7A 5CK5A 5BSMA 3IUMA 2HA2A 3AHGA 4X7RA 2BUGA 1HOTA 2ECKA 4NBWA 2FH5B 1UPFA 3M6XA 5DYNA 2JGRA 4GR9A 3S2FA 4ASUD 1A88A 3EVBA 5I4KA 2Q1SA 1Z4PX 2HMVA 4C0MA 2GM5A 1IEWA 1G8AA 1SA0B 3CVOA 3HCFA 2P9PG 2FW1A 3ER6A 3ENVA 3JWPA 4FBGA 2X6IA 1OBOA 4IO1A 1GZVA 4MPRA 4Q7KA 2RE8A 4D46A 1WPGA 2X9QA 4WD3A 5EINA 3FMPB 3OKAA 4C4YA 3ZCUA 3DZGA 3SR4A 1R0LA 3EG9A 1P6XA 2YIDA 3W6OA 4B44A 4RLSA 3B5EA 1FDOA 3Q9SA 3RHSA 5HS0A 3LQFA 2CUZA 3PXCX 1UK8A 2NU6B 3LA8A 3LSYA 3C4JA 1JIQA 3KAKA 4YMIA 3NJ4A 3IERA 5CCBA 2V7UA 2BISA 2FDCA 2Q9UA 3GGGA 2R62A 4YXWD 2ZE6A 4JLKA 2W98A 1SXJD 4ZYTA 2WUDA 1LDNA 2FZCA 3HJBA 4MDEA 1SIBE 4A91A 3CO5A 4Q9NA 1WG8A 3DLAA 4D0SA 5D5HA 3OPXA 2V7QA 4YDHB 4G4SO 1OCEA 2X5XA 4ESOA 3IILA 3DMGA 3S1LA 4C5BA 1NI4A 4HX9A 1SUSA 4PN3A 5JU6A 5DYIA 1MENA 1NVFA 3ZDEA 3R5TA 5J4LA 1CQZA 2C20A 5TVKA 3IOBA 3RSGA 2XAAA 3EPHA 5J5VA 1OB2A 4DLOA 1AN0A 4MR9A 3L0DA 1XVIA 4DZZA 3PEVA 4N03A 3KETA 1YMQA 4LE2A 2AE2A 1KMCA 3KOYA 2H31A 4RDIA 5FWXA 1QRAA 5IS2A 2BKAA 4ENSA 1FNNA 1OT8A 3EXFB 2QLTA 5FOUA 3V2OA 1IOZA 2XB6A 3OLXA 1XL1A 2V55B 4QUBA 4RGQA 4X97A 1C9YA 2BMVA 4Z9AA 2HCJB 4EHBA 1FJXA 1J7JA 5HOEA 2JLBA 1KEPA 2AZMA 1TVEA 4KIGA 3SQNA 4U95D 3ZY4A 3HO6A 3L1JA 1BQEA 5FD8A 5IG2A 3K0EA 5JUWA 4QIHA 2C3PA 1UMDA 2JC3A 3HJRA 1HLDA 2NXNA 9LDBA 1WE2A 4M3OA 1CTQA 3FCUB 4ATZD 2OEWA 4Q1DA 2G1UA 3D6AA 1KY2A 4XRGA 4M4SA 5EPOA 5CFRA 5JHHB 2PX5A 1VGQA 3FDZB 1PNQA 1SGWA 3HBNA 2EZ4A 3OX4A 1ULZA 3VR4H 2JZCA 3UHOA 5BUSA 2XRMA 1TAUA 3QKIA 1GTJ1 5EHIA 5KU1A 1IKND 3IP9A 1QNFA 3UKRG 3C3DA 3D4IA 1IUNA 3FBTA 4UMVA 3D59A 1DIAA 3V79K 3C1AA 1SA4A 1XTKA 4RPLA 4DLUA 5GY7A 2BD0A 4O2LA 5E8RA 3VVLA 4RTRA 1Z74A 1NOIA 3K0CA 4MQEB 5JCOA 4GXNA 5T4BA 1M6EX 2HXSA 3TEJA 1FQKA 5B37A 1RWVA 1E94E 1XVUA 3I9MA 1EK6A 1KQOA 1V26A 1W30A 4HORA 2RK6A 1UPUA 3CHMA 2C2WA 2FG7C 4NJOA 4P82A 4UM9D 2R8YA 2X1VA 4Y9SA 5HF5A 4ZZ2A 5B6IA 5JYEA 3JUEA 4XFDA 1T5DX 3IQEA 3T0IA 4OU5A 5LJIA 2GPTA 1H2ZA 1SVIA 3CZMA 2NAFA 3EAGA 4AULA 1JU4A 1VPDA 3A3NA 2XZOA 4UQYA 9ABPA 4MRNA 1DJOA 4OHMA 3VR0A 3H2YA 1SQ5A 1T4BA 4S1VA 3NC0C 4XUGB 3FUNA 3UMBA 3G59A 2I7DA 3R5HA 4J94A 3EAQA 5FTKA 3NDIA 3CSSA 1OYWA 2FEAA 1UWCA 1W4AA 3AKCA 3B51X 1KZ7B 3KKPA 4FVTA 1Z0ZA 4HPXB 5E3HA 4Y2SA 4YMTA 5ITSA 1S01A 3K6JA 2J33A 4EG1A 1D1PA 4ZAYA 1P73A 1HE2A 2C9MA 4G8BA 4KR0A 1SURA 3ECSA 3PF9A 3ZPJA 2J0SA 4MKHA 5C31A 1N9GA 4EZLA 1Y5LA 2ZCVA 5H80A 4BVGA 5JQGA 3CV3A 5DM4A 5L4SA 3C3AA 2CB0A 4RPCA 4JELA 1TC2A 1KFCB 5MN5A 2GOYA 1Q17A 4JA7A 1V5EA 1W1UA 2PN1A 3H3XA 3FYDA 3REOA 3TZQA 1M0WA 4FHEA 3K96A 2FN7A 3HXQA 4TZ0A 2C2MA 3U39A 2A0YA 4A03A 3K94A 2DTDA 5I7UA 3I4FA 4UCFA 1XWIA 3MJDA 3RK6A 3L77A 3W9SA 2HA3A 4UCWA 1N5JA 3UCFA 5JNVA 1BDIA 3TD2A 4GXQA 5CEAA 2VUUA 4BMVA 4KO4S 4AUNA 2PMKA 5KPDA 2VS1A 3N87A 2WJHA 2R8ZA 1AUOA 4L5JA 5F9MA 4N5CA 4C43A 3U7QA 1LC0A 3CNBA 3MWKA 3P2OA 3P2YA 2Q2VA 1HKUA 3WWPA 5CXQA 5DHTA 1DC6A 2YIMA 4ZOCA 2HB6A 2HXGA 2W9XA 2H5JA 3E0XA 2YNQA 3K0HA 3KOWA 3ZYKA 4UDNA 5LDDC 1OLSB 2FMHA 4GGOA 4I50A 3B36A 2QYJA 1NW6A 4QDTA 3FPGA 1QLJA 4Q94A 5CEJA 2PO7A 3T3NA 2W22A 2R05A 3JYHA 4MEAA 1PBTA 2J3JA 3ROGA 3X2FA 4U2KA 1TK3A 3HBFA 4GX2A 5TV2A 1F7UA 1U9YA 3KEFA 4DBLE 3GNLA 1HG2A 2P6PA 2DECA 3Q7FA 3L17A 3SDSA 5I7WA 3H97A 4I50F 3TR6A 4GP6A 1E63A 5FPKA 4IV5A 4UWFA 2ZXUA 2WM9B 3ZWVA 4EECA 4RD3A 3B9RA 4ROSA 3SQXA 4LSZA 4UNPA 4BNIA 4LE0A 1G60A 4DLPA 5EJ6A 4X1YA 1CP2A 2DR3A 5KYUB 3EIWA 1GNRA 4IGIA 1Z33A 2OO5C 1JTVA 1M2OB 3LQ2A 5EJ8A 3ZZMA 1U4NA 3FPEA 1L6IA 2ZI7A 4HZIA 5PGMA 1GVHA 1RE0A 1FP2A 3AF1A 1KO1A 2DJIA 4F3NA 1FLAA 3CINA 1HDYA 1M83A 1MAVA 5T3UA 4M1SA 2J5XA 1ZZEA 4Q7JB 4PGFA 2WQHA 2YWDA 1TT5A 1P80A 2JGDB 3FE2A 5EHNA 1FYEA 2OCPA 4PS8A 4RW0A 4BP1A 1AA6A 1USIA 3JXIA 1EHCA 1YHYA 3KXLA 1Y4ZA 3LDUA 4FIZA 4XLTA 2X0EA 3BCSA 5E6SB 3N2GB 4CQJA 4HTAA 4LDZA 1JB1A 3IIJA 1XZLA 2WINI 1ODLA 3UC9A 1AMUA 3HCEA 4FINA 4Z0PA 3V6LA 3CV0A 5E3IA 4D41A 3QOFA 4MRSA 3KO8A 2V9PA 3MCZA 4XGQA 4D4IA 4P34A 2P9LG 4HAVA 4PFKA 4Z4QA 1MC4A 7REQB 5SZHB 4MR8B 1T10A 1CS0A 4LNHA 1MNQA 4PM4A 4OPMA 1Y42X 1GIAA 2G0NA 4LXXA 3ILXA 2Y1FA 3DSWA 4E1VA 4G0ZA 4LV5B 4X71A 3LJ3A 1SUPA 4C4PA 4M1WA 1IBMB 4FONA 3M6VA 1BFUA 1CRLA 1J5XA 1GYPA 3O4IA 4M76B 4TS1A 3SBOA 3BGDA 3I01A 1QRSA 3BXXA 3KYCB 5JVDF 3HVEB 1ONPA 4JXJA 2A86A 4OM7A 5GOTA 5AAOA 1MG0A 5A4FS 4WWNA 1J70A 1OIXA 3TXAA 1MT3A 3ZV7A 4XQ9A 1OLXB 1F5SA 3BXFA 1IZ9A 5GOZA 4BJ3A 4EUFA 4KLNA 5A9SB 3T5AA 4RDCA 1WY5A 1T0PA 4KWTA 3VZSA 3H13A 4AI6A 2BTOA 3I9OA 2A0KA 2AEEA 3N8NA 4BEWA 3UOGA 1FXSA 2VHQA 4PYQA 4M88A 2FSGA 2VBFA 4ARSA 1T1IA 5C8ZA 3GLHB 2JJ2D 4LJ5A 3DH0A 1E3WB 4N54A 4AJOA 2H2WA 3ZWXA 3AR8A 4J1SA 4DC0A 3AXTA 4L2LA 2OXEA 3N2KA 2G07A 5H0IA 3DNFA 1OBCA 4L6AA 1VDYA 3WICA 1DNPA 1T13A 4O4LF 4XX0A 1MOSA 3S2UA 3TNLA 4XH9B 4CCYA 3MIIA 4ARBA 4L73A 2JARA 2GA8A 5IM4A 1T1RA 2X19A 3VR5H 2QD4A 3PFNA 1Z06A 2F90A 3E4CA 4BC0A 5EIEA 3I1IA 1X1AA 4I1OB 1ZK2A 1K63A 4ARZA 1K1EA 2AEMA 4LF7B 2E2WA 2L18A 1NP6A 1GG5A 3JAWB 1NUPA 1PZNA 1CY8A 2ONJA 3FNFA 5JNUA 4OGKA 5IM5A 1WBDA 1H4SA 3HJFA 1PJ2A 1NUSA 1SNYA 4MGZR 1JECA 1S7GA 1FE8A 3PRKE 2QF7A 1M0EA 1O95D 4PPQA 4QFVA 4J0FA 4PR0A 3SY2A 4FTWA 4EZBA 3O9ZA 1XKLA 3MLAA 2JKZA 3R2JA 4LBWA 2B78A 4Q3NA 3UJ9A 1UEIA 3N8KA 4KWEA 4HUTA 1JHUA 2LE0A 3TLGB 4FYJA 3A6FA 4INAA 2YMLA 4BNYA 1L4FA 1UMKA 2OHVA 2RG7A 4U39A 2QP9X 1OLUA 1X7HA 2B99A 1MO6A 3JAKB 1C9NA 3KR1A 4U7GA 2PRSA 3V1NA 4FFMA 3ZKWA 1JHPA 3L8CA 3I12A 4FILA 3SI7A 1JSXA 3ZVNA 2O50A 5KNCA 3MJVA 4A6DA 4I2WA 3BH7A 4L15A 4PO1A 3KEZA 1N95A 3U48A 4MARA 4MYRA 1JDPA 2Q07A 3IEIA 1CVIA 3UB2A 4PHHA 1DE0A 4NP6A 1AHNA 5IPFA 2SICE 3O9MA 1QIDA 3WGGA 4H9GA 3FETA 5CDTA 3BE4A 1KGSA 1N2HA 4K6CA 3E8MA 4MIYA 2H1FA 4U9UA 1T0UA 4X54A 4AF6A 3DDOA 4B3IA 4IQ0A 4W63A 3QENA 2AOUA 3MJEA 4QHYA 5HJ7A 4KSBA 1Z5SC 4P8RA 2ONKA 2UVQA 4CG1A 4D0GA 4Y2UA 4CM4B 1QKJA 1SXHA 1ULBA 3HP1A 3I73A 4OEHA 5FXMA 2IVFA 2UYQA 3RWOA 4D74A 1KVUA 1X19A 2IK8A 3A1CA 1TM1E 3OWXA 3PDJA 4HNAA 1VTKA 4JA0A 3BN3A 2XQJA 4FLBA 2GBIA 5JQGF 2Q8QA 5CM8B 1TU3A 4FS8A 5J9FA 1XRNA 1MO3A 4P3NA 1C0LA 3MQFA 4HX5A 3KPWA 3LX5A 3W8RA 4DEVA 5BN3A 4B46A 3BWVA 1QE0A 2W6ID 4F72A 4HG2A 5ARCA 4INOA 1YZFA 3CK9A 3VMFA 3RO3A 5ILOA 1YB5A 1OZAA 3QE9Y 3AOEC 3TPCA 5CB6A 4QJBA 5KIAA 3GYGA 4CEMA 3Q0TA 4I1VA 5FTWA 3FU5A 4RU1A 3T5BA 3R7FA 3D6HA 3A70A 3DDNA 4CPDA 1FTNA 4DMHA 5HKKD 5IHPA 3MRTA 2IA5A 2C54A 4O4LB 2F3QA 2OWDA 3ZE0B 3ZCVA 1DKOA 5I3ZA 1B16A 5E6UB 3A3OA 4RK4A 5LB4A 2YWBA 2FSSA 3IQWA 1D4AA 1SUAA 3DVSX 1DIGA 1P4SA 1WQ1R 4GOJA 4MRUA 2J3IA 4QUAA 4LF9B 2X0JA 1C7ZA 4QOFA 3OQPA 3NTRA 2B4TO 4EZJA 2DCMA 1AQLA 2RFAA 4YDWA 2F3TA 3MJWA 1OLOA 3CHPA 3GRYA 4D4KA 4ILIA 2ZRFA 5DNWA 5FWQA 2WF7A 4LHXA 4WK2B 1FZTA 4A1SA 5J08A 2WSBA 4PIVA 4Z86A 4EFDA 3RFTA 5KJEA 4ZJZA 5G2NA 1E1RD 3UQYS 2A3NA 1DAEA 2HNKA 2R1TA 2ZEJA 4OKNA 4BLOA 1ZD8A 4EKGA 3GF4A 5EQFA 2OUKA 3GGOA 3H9JA 3ASYA 4AO7A 2CBXA 2VKQA 3ZHTA 3DLCA 2W43A 1NVWQ 1OV6A 2DCPA 2OXTA 4ZI7B 2J4CA 4P31A 3LDFA 5U4QA 5CGQB 4Q3DA 1YJCA 4DDUA 3CNOA 2XUFA 4L7QA 1T36B 5J58A 1IHYA 2AG0A 1V54E 1ZQ9A 2YRXA 3HCNA 1JWGA 1I3NA 1DUIA 2J3MA 1W5FA 2H63A 4QICA 1RAHA 2WU4A 1QFJA 2YYZA 4MUMA 4PZLA 2XEVA 1E3WA 3I23A 4RAOA 5KKAA 4EO7A 4Y7CA 3A6DA 3I37X 1V0JA 1L5JA 3I04M 3RWBA 3ZTYA 2HA6A 2QRJA 1AP7A 2HF7A 3C41J 4PC7A 4NCJA 1HC7A 3UXMA 4L4RA 3L13A 4DWVA 3IESA 3B60A 4IDDA 3NBQA 2ETBA 2GF9A 1VKHA 1WMAA 3FVVA 4EW1A 4N5IX 4ANFA 3EEOA 3CXRA 1BROA 1QZXA 3G0OA 4EG7A 2E4ZA 2AFRA 3TCKA 2ZT7A 5CW2A 2PS9A 3NR2A 1T9BA 3OZGA 4QDXA 3ICQB 1MJNA 4FUQA 1OUVA 1QYMA 3HG7A 3EARA 1PEYA 3F78A 4Y6PA 3K9NA 5IDYA 5TJHA 5C5EA 1VBNA 2VGXB 1MB2A 4NH4A 4CF4A 2HREA 3D8HA 5CYOA 3QKRB 3VR4D 1JVSA 4GAEA 4U5XA 4OFWA 3VO2A 3P9KA 3HFRA 3W8EA 3QLVA 4YECA 1ZIOA 1L7DA 1P9LA 3NJRA 4N6NA 5FPQA 2O4UX 3OPMA 4DMLA 4KR3A 2H16A 1UJMA 1GPLA 3DS8A 4FHDA 4QYSA 3JQ7A 4EABA 2CL6X 4O2AA 3V4SA 3TZEA 5JSZB 2K7FA 3JQDA 4UHEA 2O2HA 1PSDA 3W3AD 1B73A 5CMYA 3Q0EA 2FRDC 1GGNA 3FCAA 1FP4A 3PKIA 1T3HA 1Z37A 1RXYA 4HNGA 4KDRA 4TYQA 2GVZC 1NA3A 2VQ3A 1EJ0A 3A05A 3EZ6A 1C8BA 4KDEA 5CVJA 5BQXA 1VCIA 4G5QA 1KDPA 4YUXA 1Z68A 3HU5A 3P2MA 3OIWA 3QBEA 4NENA 3K9IA 1S64A 2GRQB 4OU4A 1DLJA 3L7CA 2CHGA 4GM0A 4HXYA 4F1WA 4IDNA 4IOLA 3C3OA 1FCJA 3LT1A 3PT5A 2XZDG 3ZE8A 4X8LA 1W5SA 1PJZA 4OQLA 3BGWA 1SC9A 4XJXA 3I2YX 2PWAA 4B84A 4IIJB 3AG6A 4BNWA 1TR4A 4F3TA 3OAAA 4HRVA 1G98A 1XDBA 2O0HA 4NYMQ 4UPEA 3C74A 3H9CA 3KSAC 5KNGA 1T9GR 1N25A 3NVDA 5AESA 1GPKA 1S0UA 3N1UA 4QULA 5C32A 2XEEA 1A7UA 1JDJA 1HLFA 1KI3A 2RHDA 3C87A 3DHYA 1GPNA 1ZD9A 2VYIA 1DTWB 2GPYA 1N6KA 3KDAA 2WB4A 3LS2A 4J4TA 4L6CA 4R5HA 2WM9A 1I01A 3E9EA 2EFGA 3T8KA 1XD8A 2HQSA 2IEIA 3RTAA 3V00A 3WIEA 2R68A 4NDNE 4QATA 4CMJA 2Y3AA 4ND1A 1XDWA 2JKVA 2C3YA 5DWVA 3R9XB 2QR5A 3PX2A 2CB9A 1XQ1A 5L7WA 2VH2A 2MYTA 1XALA 4N1AA 2OESA 5BMVF 2AXQA 3QYPA 2XTJA 2YJ6A 1BW9A 2FSVA 2JRLA 1UBOS 2O1SA 1SBIA 2ZRGA 3L0ZA 4FFVA 2HWWA 2B30A 4LDJA 5AHOA 4AZWA 3UNXA 3FUEA 2QRLA 2J3EA 4IDGA 4JFRA 5GPBA 3PCTA 3RS9A 4AM9A 1F2TA 1ZVMA 3L7LA 1RRFA 3MLBA 4ZCPA 2BFOA 2JIPA 3DP9A 1G21A 5DNAA 4CBVA 5AVQA 4G1FA 4V03A 2FCRA 1ZQ1A 3S99A 2RGWA 2FP4B 4MRVA 5TMBA 4J3FA 4YV0A 3KS2A 1E60A 1I30A 3L8YA 4ZN6A 1I9GA 4KPUA 2BJVA 2FUKA 3K0AB 2HOQA 2OBFA 2ORVA 2YIJA 4WFJA 1JEQB 1V8OA 5FO1A 3WZMA 1OSNA 2BKLA 4D7AA 1T2AA 1P3DA 1CQXA 1N6LA 4N2SA 3U4IA 4IRMA 1E1LA 3NBZC 4IO0A 1XXHA 4X6XA 4D8WA 2FUG1 2ICAA 3BSYA 2AR9A 4GMFA 5FI5A 1RCTE 3HYMB 2GW1A 1N2IA 3D8NA 2VP3A 2ETAA 1Z38A 2AX3A 2VDWA 5H5JA 2V5AA 3RVPA 1Z7EA 3OFVA 4BRWA 1O96B 3UJ3X 3I2FA 2YXNA 2VHXA 3Q41A 3V55A 4GLOA 2XVAA 5DXAA 4PIMA 2B3DA 4U1RA 3AZOA 5EE9A 3DF7A 4UQLA 3AM5A 1Y3DE 2DHEA 2VCEA 4FFOA 2VHTA 1L7OA 1RW4A 3P2BA 1ZK1A 1FW8A 4KJZA 4PZAA 1IM5A 4UBIA 1N0WA 2EYQA 3CLRD 2C5AA 1HT0A 3D3WA 3L8MA 1D9SA 1U4SA 1MAUA 2QX8A 1QK3A 5CIYA 3KLOA 2G09A 1TZKA 2Y3IA 2ZPTX 4R2LA 4CGVA 3HCRA 4XXHA 5HBGA 3DOOA 2XUGA 2ZUEA 1T36A 3N8GA 1J9ZA 3HHPA 3ZV6A 3AB8A 4DR6B 1WMFA 3K9LA 3EGXB 3PE6A 1ECLA 1F4LA 1QBKC 3FWVA 1Z5NA 4Y2RA 2P69A 3NTXA 5DHUA 4F86A 1VL8A 3PI7A 3X1XA 4MCHA 1E6CA 1F2UA 2A58A 2O7SA 2PYZA 4R2XA 4UMDA 2GZRA 2IE0A 1TQDA 4HBDA 1E1NA 4L51A 4F8JA 4A1OA 3CVUA 3Q3EA 3EDTB 1L7RA 2EC5A 1TADA 3EOZA 3G6KA 3HEBA 1O4VA 4IZHA 3WTCA 2XOKA 1XZAA 4XD7A 5DIZA 4DUIA 4WRRA 4Z7OB 2VFAA 1M6NA 3QARA 1KMHB 1RTKA 1MU0A 1QYDA 4UBNA 1Z47A 1C4KA 2CXHA 3GQBA 5JE8A 5HSGA 3JAWA 1LS1A 2X6QA 2V98A 1CY4A 3ANXA 4A0QA 1YRYE 3IB6A 4PSKA 4UM5A 2JFUA 3AIIA 2P2GA 5BUCA 1AN9A 3UA4A 1RXSA 3OEEA 3WWEA 5IT4A 3IL2A 3VR2A 3UAYA 2G9ZA 1SCNE 2WKWA 1IPHA 3LXRA 2VN8A 3FZYA 3E34A 4I2ZA 1R7RA 2R8EA 3T4UA 1YZHA 2WJYA 1NA0A 2QLMA 4ZV7A 4EHDA 1W73A 4PHCA 1TIBA 5J5AA 4RM3A 3ZWPA 1SKAA 2H1HA 1F0YA 3ULQA 2EZUA 2LXNA 5C46F 4R6WA 1DCQA 1M66A 2PJZA 4PWYA 4RE6A 1VFPA 2IHKA 3V33A 3OZDA 1H9AA 5BRJA 3UPUA 1NPTO 3D54D 3QX7A 2WLTA 4LHWA 4O25A 3SLGA 2TMKA 3TI7A 1YRAA 5EJGA 3QLUC 2GGSA 5A5DA 4CETA 3B3AA 5F3WB 2LTAA 2GWHA 2ZSBA 3KTFA 4AZ3A 4EA8A 4RIFA 1DZIA 3HV2A 1IEXA 1X1QA 1EVQA 1X15A 1WHTA 2V0NA 1ZH4A 2JFWA 4URUR 5F1PA 4XUEA 3ROZA 3DG9A 3J80A 2WFAA 4BSXA 1IMJA 2OUIA 4TYPA 2MR6A 2R03A 2HO1A 1RNLA 2J32A 1HRKA 2AT1A 1J2TA 5AI9A 4ZVKA 4AVYA 4NOMA 5AP9A 2D4AA 3ZHUA 3L06A 4KTVE 4ZFNA 3K70C 3DW3X 3FYUB 4G85A 5K0JA 1E1QD 1XEAA 1LRKA 5EHZA 1G3RA 1S1CA 1U0TA 3SN6A 3RJZA 2J6IA 2W93A 2GCNA 4K7JA 5ALWA 3WQHA 5AVRA 5IXJA 1IQRA 4AG5A 1NVUQ 3T95A 4XR4A 2ZR7A 4MA5A 4DV4B 2V0CA 3SIXA 4D8XA 1KS2A 2WXPA 1E9DA 3FH8A 4D10C 1WA5A 2VEOA 5CVUA 1E8WA 4KWCA 5KBYA 5CMLA 3BFVA 4H17A 3PZ4A 1KHTA 3FTDA 2FMUA 1JKJB 1JFVA 2XYGA 2V6MA 3IPXA 2O2EA 5EQTA 2AXEA 1UMDB 4MITA 1TFRA 1XDUA 3ZHZA 1OPRA 2A6PA 2P3OA 3KS9A 3NH9A 1SKQA 2C97A 2RGGA 3QOWA 3TKYA 4TKLA 3HV0A 3BUAA 1BKYA 2N1MA 1C0KA 1X3SA 4FSDA 3C5VA 1XMSA 2R8BA 3FMGA 3UBMA 4CIAA 1MCZA 1K8XB 2CNKA 2YOGA 3U7EB 4K5AB 4KR9A 7MHTA 5DHAA 4ZKDA 4PX5A 5BW5A 1J0EA 5FQNA 2YS6A 3EK2A 2EJBA 2H52A 5G02A 3P9PA 4I36A 3ZZ0A 5KMGB 4PFQA 1P3JA 3RE1A 2OCDA 4LSZE 2LIPA 3L5KA 1O58A 3KPYA 3Q88A 4TTVA 1T0HB 5IXYA 5KYTA 2W2KA 3Q7TA 3IIMA 1HU3A 2F3SA 2ZG6A 4EHFA 5IBRA 2Z8XA 3PNTB 4KH0A 1GNQA 2B1JA 1OY3D 1LRLA 1GLGA 1TM2A 3Q1KA 2VHVA 3SJAA 3W7VA 3SYLA 4Z1OA 5A3QA 1H4TA 1ETHA 1WX1A 3C3QA 3Q9NC 1YQ9A 3BBPA 2B7BA 1LJ8A 2J31A 2GYVA 1XNHA 2WF8A 3B8HA 5AARA 3D5QA 3KKNA 1SCIA 2C03A 2X8AA 2K6GA 3THRA 1V3VA 4X6UA 1HY3A 2GK3A 2XVYA 3OC0A 1RYHA 4MR7A 3VO8A 2Q5FA 2CK3D 2F1HA 2WF9A 2R6ZA 1M6VA 1RCFA 3C3KA 1U81A 3KPUA 4H4DA 4WFQA 4X3OA 2NVBA 3BZBA 4RD0A 3TZLA 3OCCA 6CHYA 3I5YA 2HQBA 1M7GA 1V47A 2H1VA 2Z3VA 3T9BA 1VYVA 3B7UX 4UNSA