4MLPA

Mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
492
structure length
492
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLSRY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
publication title Crystal structure of mammalian cryptochrome in complex with a small molecule competitor of its ubiquitin ligase.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 179
structure length 492
sequence length 492
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4mlpA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4mlpA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4mlpA01
3CLSD 4WSOA 2YXNA 2X1LA 4OUDB 3FH0A 1I6MA 1T6XA 4MUFA 1R6XA 1EFVA 1TFUA 1ZH0A 5IJXA 1BS2A 1PFYA 4MWDA 3COYA 3ND7A 1EE1A 1N2JA 1IFXA 4EF6A 4JYZA 1MB9A 4ZT4A 1WXFA 1ILEA 1KP2A 1NUPA 4G6ZA 4JFAA 4YMIA 3COVA 1B6TA 1IHOA 1PG2A 1M83A 1JIKA 1MB2A 1N2EA 1EUQA 4KKVA 4MWEA 3PNYA 4ZT2A 4YP7A 1JMVA 1O95D 1VBKA 1QRSA 3CVXA 3TQOA 4YP6A 3E27A 4YBRA 3IMCA 4NX2A 3BL5A 1QJCA 3CLTD 2D54A 1P7PA 2AZXA 2QJTA 2PIDA 1XNJA 1UFVA 1WJGA 3N05A 2IELA 3ZIUA 1G8FA 4EG8A 3P52A 2C5SA 3ILVA 1O96A 1HYBA 2J09A 1G8HA 1OD6A 4XFJA 5TEWA 1GAXA 3CLRC 2Z09A 1N2OA 4UZFA 1J1ZA 1K97A 4DNXA 1KH2A 3ZXIA 3N9IA 3NBAA 5TGTA 4EG5A 4J75A 3A05A 3K9WA 1Q11A 3PRHA 3M5WA 4L2IA 3QTTA 3NV7A 3CVVA 1QNFA 2YWCA 4PBTA 2D13A 2CYBA 2HMAA 2J5BA 4Q93A 3FDXA 2CT8A 5EKDA 4MUIA 4MAFA 3ZXSA 5H7XA 5F23A 3U1VA 4ZT5A 4MULA 5HUJA 2DR2A 3IOEA 1EFPA 4F4HA 4R0NA 4KR7A 2A84A 4CDNA 2A1TR 1F4LA 2ZP1A 2GM3A 2QTRA 4KR9A 1J21A 4S1OA 4MUGA 1T6YA 3ZGZA 4ZT6A 2QUHA 2EL7A 1KAQA 2YWBA 4HJXA 3MUEA 3X1MA 4YP5A 1V47A 4EG6A 3TZLA 3AFHA 3GLVA 2V0GA 1OWLA 2XRYA 1PFVA 3SYTA 1FYDA 1O0CA 4NATA 4PBSA 4DE5A 3RK1A 4BWVA 2Z3VA 2VTBB 1MC1A 2CSXA 1T6ZA 2OQ2A 4X0EA 2E0IA 3OTWA 4ZCRA 3HMQA 1U3DA 1J70A 4ARIA 1JZQA 1M1ZA 3IMEA 1YUMA 3KT6A 1MAWA 4MW4A 2VTBA 2H2AA 1YULA 4EFKA 1O94C 3CR8A 1WXHA 2PG3A 3F3MA 3KT8A 3HZRA 5LM3A 4GRIA 3AL0C 4KR6A 3FHJA 2DXIA 4MQ6A 4DJAA 2H29A 3TQIA 1F9AA 1YUNA 3FETA 1EXDA 4H3SA 1DNPA 1VBNA 2CYCA 5DASA 2ZUEA 3PXUA 3KT0A 4MWCA 2HGZA 1QQTA 3ND5A 3D6VA 4PY2A 2R5WA 1IRXA 3RFFA 1V8FA 1WY5A 4OUDA 5AHWA 2V0CA 3TS1A 3L93A 1O0BA 2CV2A 3DLAA 1QU2A 1VBMA 4RPIA 1Q19A 1KH3A 4TS1A 1N2HA 4I6GA 3IMGA 4HPWA 1N2IA 1ZUNA 1M8JA 5FO0A 1JZSA 1MJHA 2HZ7A 2BYTA 1KORA 2OV4A 3INNA 4Q16A 4ZT3A 4I6EA 1N75A 3ISJA 5JBNA 1GLNA 3AG6A 3MXTA 4OJMX 2BTEA 2YY5A 1TYAE 4ZCPA 1WKBA 1JIIA 2JANA 1MOPA 1LI5A 4QBTA 3H9BA 3ZJUA 2QUJA 5J58A 3FOCA 4U8HA 5HG0A 4EG7A 3CVYA 1K4KA 2QJFA 3UC5A 3ZJVA 4QREA 3N2YA 4JZYA 2CV1A 1OWMA 1O97C 3FY4A 2JAXA 1N78A 2WSIA 4DDMA 1NUTA 2GOYA 1PFUA 3IVXA 1WOYA 4MW1A 4FZJA 4P2BA 3G59A 1QTQA 1U3CA 4CDMA 1N3LA 4MW2A 1EJ2A 1MRZA 4R2LA 5J5AA 4U63A 3CLUC 4QRDA 4MUHA 1D2RA 3CLSC 2AKEA 1NUUA 4EGAA 1N77A 3LOQA 3G5AA 3Q10A 3NBKA 3HL4A 1G8GA 1RQGA 1MAUA 3DPIA 3UMVA 4MWBA 3CA8A 4WNYA 5H16A 2E18A 5KHAA 4MVCA 5FO1A 2J08A 1PFWA 2WQ6A 2QTNA 4ZT7A 1JEEA 3ND6A 1OWOA 4E1AA 3KT3A 1KH1A 4RUKA 3IVCA 3SZ3A 3SZGA 3DV2A 3Q12A 1J20A 1LW7A 3GMIA 1WQ3A 3PNBA 1U7DA 3HV0A 2I1LA 1JEDA 4ND6A 1GTSA 1O95C 1WZ2A 5KCMA 3FG9A 1GPMA 4ARCA 1IQRA 1YIAA 1KP3A 1NI5A 1OWPA 5J59A 3CLTC 2DLCX 2DEUA 4NAUA 2VXOA 3IODA 3X1KA 4DLPA 4JXXA 3RBAA 3K32A 1X8XA 2X0KA 4NDAA 1I2DA 4F3RA 3S3TA 1TEZA 4I6JA 1GZUA 1T9GR 3ELBA 3MMXA 4G5FA 1NURA 2PXHA 3FI0A 1J09A 1TQ8A 4ZCSA 2Z08A 1M8FA 3GUZA 3H97A 4EG1A 1OBCA 3IOCA 1WXIA 1G59A 1N1DA 2ZUFA 4ZCTA 1XNGA 3AG5A 4NAHA 4UZEA 4MVWA 1COZA 2E21A 2B7LA 1JECA 3UY4A 1TYDE 2A86A 1Q15A 4MUEA 4MLPA 2PZBA 1J1UA 3A4IA 4AS1A 2J4DA 1O5TA 4NZPA 1M8PA 2A88A 3RHSA 4U7JA 1NZJA 5LLTA 2WB2A 2AG6A 2A4MA 2GKSA 2QTMA 3IOBA 1H1TA 5DB4A 1GN8A 3P0JA 2X1MA 1XNHA 2PZAA 3LE8A 1MBZA 1PG0A 4MW6A 1I6LA 1M8GA 4XFDA 4K0RA 1A8HA 1N2BA 4EG4A 3PNVA 1R6TA 1N2GA 3H9CA 1I6KA 2CUZA 1JILA 2DETA 1X6VA 1LI7A 1KQPA 4GU5A 1OWNA 4MUKA 1M8KA 1NYLA 1S4MA 4A91A 3FNRA 3HFJA 1F7UA 1YIDA 2O5RA 3CVWA 3VRHA 1WXGA 1TYCA 2X3FA 5K0TA 1FFYA 3Q4GA 4EG3A 5K0SA 5DK4A 1O96B 1CT9A 1TYBE 3COZA 3P0HA 2A1UB 2J07A 1IH8A 2E89A 3KFLA 4ND7A 3TNJA 3A04A 1JIJA 2O8VA 3JXEA 4MW7A 3VGJA 1U0BB 3CVUA 4JXZA 3P0IA 1QU3A 4R2MA 3HGMA 1GTRA 4L2IB 2A1UA 3VU8A 1O94D 5DEOA 4MVYA 2IP1A 1QRUA 1R6UA 1WXEA 3AIIA 2NZ2A 2A1TS 3I05A 3RK0A 2QJOA 3IVGA 3QTBA 2CFOA 3LCJA 3IUBA 3SEQA 1H3EA 4K03A 3TZEA 3FWKA 2RD2A 1SURA 1EUYA 1WQ4A 1VLHA 4MUJA 4DDHA 2CYAA 5TEVA 1KQNA 1H3FA 3C8ZA 1JHDA 4HJRA 5HUHA 1EFPB 3FIUA 3L92A 5TS2A 3RJZA 2PFSA 3D6UA 3SEZA 1H3NA 1ZH6A 4MVXA 2DUMA 1YI8A 1ZJWA 3IH5A 1VL2A 4CQNA 1NUQA 3IDFA 3H99A 2QUKA 4KPUB 3SP1A 3H05A 3MLBA 2RE8A 3DO8A 3ZUGA 1T9GS 1ULHA 3COWA 2CV0A 2QUIA 3N8HA 2WQ7A 3G6KA 2D5BA 3ZJTA 3IUEA 1JGTA 4AQ7A 1IQUA 4KPUA 4MW9A 5IHXA 1KQOA 4CT0A 1KAMA 3CLRD 1NP7A 4J76A 2EJCA 3MLAA 2PZ8A 3UK2A 5FNZA 1O97D 4G5YA 1KR2A 2NSYA 4MW5A 2IJGX 2DPLA 3QE4A 1F7VA 1IVSA 4MUNA 1Q77A 3X1JA 2JA2A 1O6BA 3SDBA 4ZCQA 4HK4A 1Y42X 1KKUA 2XRZA 4XSVA 3OP1A 4PBRA 1U7XA 1XJQA 3AKZA 1NSYA 1K4MA 3A2KA 1EFVB 1QRTA 5LFAA 5KWVA 2G36A 4MW0A 5BNZA 1K92A 2TS1A 3UOWA 3CLUD 2DERA 1IQ0A 2A7XA 1NUSA 4DDKA 1OBHA
chains in the Genus database with same CATH superfamily
3OCVA 1UBMS 4WSOA 4GXRA 2YXEA 3DHEA 3ITEA 3PJEA 5ITWA 3OZAA 3WIOA 2IU6A 1ZR2A 3PNOA 5KYGA 1DRVA 4C30A 4BLTA 4BNXA 2VLBA 1C9YA 3EGXB 1SHZA 1T0BA 1Y4AE 2COKA 5EE9A 4CFZA 5IH7A 4MB2A 4WN9B 3P2EA 1LBIA 4PS0A 3KZ1E 2GEKA 2BL4A 4DNXA 2C3OA 4TN5A 2IWHA 3I4LA 3FSRA 1B2LA 4DLYA 3E0QA 3EY9A 1H0RA 3DDNA 4AS3A 4DG8A 3LRPA 3L13A 2XVYA 2JGDB 3T3HA 4YXWA 4ZT5A 4FP7A 2AN3A 2V74B 3NTOA 2ZI3A 3GW4A 4IPTA 3ACDA 1SC1A 4H6VA 3S1AA 2P6OA 2XGJA 2J3KA 5JJ7A 1UOEA 4PSUA 2FDCA 2O2SA 4EPYA 2VHCA 1B89A 4JC0A 1NI4A 3H7AA 4U7FA 3EU5A 5AW8A 2Y4OA 3W3AD 1AA6A 1JU9A 4KJXA 1ZK2A 3C6MA 1F2TB 4A3TA 2YYSA 4UFPA 1B8OA 1Y7LA 1SXHA 5D66A 4J2HA 3LT4A 5AHXA 4FGKA 5KI6A 1QGAA 4PYJA 2GCPA 4RNCA 4RSYA 4Q3OA 1F8XA 3HA3A 3B3GA 1XEFA 3A1TA 2XB4A 5JAMA 3P19A 2H07A 5EA2A 2VN8A 4MR7A 2RIRA 3VC2A 3DC7A 1DEOA 4D6YA 5IBQA 2J3HA 5J58A 2DBQA 3G82C 3RG8A 3MJCA 2MOKA 3NNSA 2HK7A 4WFIA 5CLGA 1QMPA 1OPRA 1PYDA 3AMVA 2J9XB 2R96A 3GLRA 3N8NA 2L42A 4IDAA 5C4MA 5CDSA 3AFIA 3Q3GE 5FWQA 1F0KA 3AEUA 1N11A 3B5JA 2NV6A 3FUDA 4GQIA 3WZ2A 3FKQA 4GP7A 2D7CA 2VHYA 4OHYA 2YTZA 5HTKA 4ENTA 1JR3D 3IHKA 4QL3A 2R11A 2JC3A 3GK3A 3JZAA 5C81A 4B5LA 4H59A 3ED1A 1GA6A 1B6SA 2BFPA 1KDOA 4B46A 3NVKI 3B6IA 4LDPA 2Z3ZA 4E32A 3HUTA 3MGBA 3QX7A 4MVWA 4JYMA 5EHIA 3TMAA 3L46A 2P9QA 5DDIP 5BQFA 4UAVA 1NW7A 2HFJA 1LDYA 5LOZA 1LK7A 3LX8A 2FX5A 5JEEA 3HBNA 4U7TB 1RBZA 4RG6A 2IP2A 2BGGA 5HOEA 2QVYX 3WDSA 4MCIA 4FT4A 4LE1A 1L7QA 2PQMA 4RKEA 2C8JA 3LCMA 3CX4A 3FOAA 4G5QA 2MSWA 1KYQA 3N0TA 4R7LA 2I99A 1RJ9B 5HQ8A 3RODA 1JXAA 5BSHA 1FNBA 5BRNA 5HHTA 3A9VA 2W2TA 1DJQA 2OHHA 3MTAA 1G2QA 4ZVQA 5GJCA 5HUHA 1DCKA 3UJAA 4U7DA 1E89A 3KG2A 1ZUHA 4MKGA 3UV6A 3WKBA 4PV7A 3WVNA 1OOEA 1TA4A 2ZG6A 2C96A 4EJMA 1ZCFA 5F4BA 2QUIA 1GTVA 4FULA 3WG9A 2WM2A 1A4XA 2O7VA 2J7KA 4GB9A 2D1YA 1KAMA 2ZYTX 2O2GA 4AV7A 1TO1E 2HK8A 2P62A 1CPYA 1XHFA 5ICFA 1XUOA 4NCIA 2ACWA 1ZG3A 2WLTA 4OA8A 3UFBA 5FWNA 2RK6A 5FJJA 3HB1A 3O92A 1XFDA 2NT4A 1E4OA 1YVEI 2FZ4A 2AXUA 3GZ2A 2VXCA 1Z4KA 2IE8A 1SA4A 2I1VB 2O2YA 4P92A 4O1IA 2GHRA 1KPHA 1MO4A 1ETHA 1D03A 3GLGA 2YX1A 3O8LA 4YJHA 1SHLA 4IDBA 4R7ZA 3WBJA 2QTWB 1PK7A 3T06B 5B1BE 2R7NA 3PFBA 3U1BA 1FLVA 4DWWA 2V59A 2AN4A 3SPXA 5C2YA 2YJ3A 3LF1A 2DGDA 1J8DA 1QGUB 2XPCA 1RAIA 2BD0A 1DOHA 2YFKA 3V4RA 1EFPA 4EX7A 5HIMA 5DKFA 1FE8A 2I4MA 2FSHA 3VSEA 2SKDA 4HB3A 5D3KA 1KAQA 4ARZB 1QHYA 4NQZA 1Q22A 3A6GA 1PLJA 1ABEA 1MD9A 3ETHA 2VNJA 4HI8A 2RGAA 1PJRA 3ODPA 5F12A 3ZH9B 3PUYA 2BEWB 2NN3C 3AEKA 1NVXQ 3OAAD 3V4VB 3VMMA 4CKXA 1IZ8A 4N9QA 3T3EA 3QF7A 3MV3B 4DTCA 2R6JA 4EI8A 5BVHB 3JD4A 5IKOA 1EVIA 3SJCA 1XD2B 5FOQA 4F0JA 5EJFA 4FDMA 2YZMA 2PGDA 2ERYA 4A8JA 1KY5A 1ZOLA 2R68A 2P9CA 3TXAA 3K05A 1LF5A 4K9SA 1M10A 3N6XA 3THRA 1LVHA 5LOVF 1I5OA 5D7NA 3D1VA 4IJWA 4UDOA 4DV6B 3IVMA 2P90A 1GG2A 4MW1A 4JYBA 2CXQA 4FBMA 5H70A 1U3CA 1F20A 3DHYA 1U3GA 2EVWX 1YA8A 4XWKA 1RC8A 1X94A 3KKMA 1AGXA 2F90A 3M4NA 5IAGA 4CCWA 4F56A 2IOFK 3SKXA 2GXSA 3LDUA 4RY2A 2EZ8A 5CVUA 1W48A 5HCUA 1Y5RA 1W2HA 3L0DA 2PV0A 1SG0A 1H6PA 2Q9UA 4P83A 1UBNA 3JYHA 1WNTA 4BNVA 1QRAA 3V1UA 5ENVA 4C4OA 3IHTA 5ADVA 2H54A 4I9EA 1GN9A 1P9NA 1LDEA 5MGBA 2B82A 4P7JA 5A1TA 4ZQFA 3WKEA 2PUJA 4NC9A 5KOJB 1NFFA 4GPTA 2Q2NA 3FUIA 2WIDA 4PPNA 4DG9A 5EKXA 1HV8A 4NOKA 3OZEA 5I9SA 4K5AB 2OEPA 2ZRKA 1I0ZA 2HW8A 2GJAA 3S7FA 1N2BA 1Y89A 4AQDA 1MW9X 4URZR 3FSEA 4DK5A 3K5HA 4RGVA 1HTBA 2QQFA 2NIPA 3UMFA 2VWQA 5BW5A 2ZPUA 3COZA 3PR2B 2HMVA 3WL8A 3ZIAD 2WWRA 3WA6A 3FWPA 4R41A 1P33A 2F6RA 3L0ZA 3OZVA 4R8RA 5E6RB 3RYHA 5DEOA 3JWGA 4L15A 4UM9D 4DPMA 3TZEA 3FWKA 2ZBDA 4BZQA 3QBJA 3NB0A 3RQSA 5ALGA 1QHNA 3NBUA 1J8MF 4BFLA 1SFRA 4BY6A 3OHPA 1FY2A 4DSTA 3IALA 4R01A 3W8FA 4BVJA 5EVJA 5C18A 1FP1D 2BRUC 1KPSB 3Q2KA 5AIBA 1EFRA 3DAOA 5JR3A 3P4UA 3RSSA 3DE3X 3ZJTA 3H5OA 1U63A 2P3QA 3Q75A 4KQHA 3UT5A 1MUUA 2IF4A 1R10A 4J4HA 4MS6A 1OZAA 3JQ8A 3LHDA 4Q1FA 3EZ6A 2CHQA 5IC5A 2JLAA 2R2GA 4QYSA 4HNSA 3A11A 4K40A 2ETAA 3W8EA 4L5BA 5JS7A 5KHOC 2ALJA 1KAGA 2ENUA 3K73O 1BS2A 1CUDA 5J90A 5K01A 1WB6A 1Y63A 1Z4PX 3CVNA 2P79A 4ESHA 5K2MA 1LLQA 5TDHA 1WXWA 1UT5A 3NGLA 4L9RA 4X60A 4L28A 3M6IA 2UV8A 4X85A 1CKEA 4PGMA 2HWUA 4HNTA 1GRCA 2R86A 2ORYA 1R5JA 2POQX 4J0HA 1LS6A 2IGTA 1IXSB 2PX0A 1O9BA 1E8ZA 2YV5A 1Y1TA 3ZXSA 4QODA 3O4GA 3HEMA 2FPPA 1UZAA 4PNZA 1EX6A 3PUVA 1SHUX 1KVSA 2V7WA 3GVCA 2Y1KA 4H1UA 2P3OA 4S1OA 4TKVB 1W6RA 3MUEA 1TN7A 2PH7A 3IAM1 3TWTA 3LLMA 2RGEA 4HZUA 1U0LA 4H3VA 1RFGE 3U4QB 5TGDA 2JVKA 3C3PA 2O8BA 2OORC 2YJNA 5I5GA 4E3WA 3BAZA 4V0MA 2DXIA 2PSSA 2PY6A 3SNKA 3C24A 4QFBA 2PJZA 4F4JA 3CG0A 3WK7A 2DPHA 2W6IA 4WZBA 1KIFA 4I1UA 1ELOA 4R9RA 5HIKA 3BE4A 1NQOA 1ZJZA 1E9CA 5JBNA 3DVQX 2E5LB 3PHIA 4G8DA 2XLCA 2C1EA 3I01M 5AVZA 3ZUPA 3UAVA 4E70A 5BWNA 1XELA 3D1JA 3E7PA 3ZBQA 4J8YA 4WNFA 4RHTA 1JU4A 3ZWKA 1UJJA 4DCJA 4IYPA 4L4XA 4HATA 2O50A 1G64A 5BOSA 2LXLA 3ND6A 1Y98A 4N3NA 1RZ4A 1IM5A 2V7PA 1P81A 3OPXA 2GBLA 5FTKA 4GYOA 3WJ1A 2ZBUA 4M2LA 3LUHA 4WLOA 1WAMA 3TTXA 5A4AA 1G4UR 3CCFA 1VIMA 2QXYA 1R0YA 3QUTA 1FX0B 4M9UA 2KSQA 5J5CA 3S2FA 2WU8A 3FVTA 4HRXA 5E2BA 4EO9A 1RC0A 1M73E 4IIJF 4CR6A 3SJBA 1V16B 1M0SA 2AKAB 2QLNA 2Q2OA 4NP6A 2W42A 1NBOA 1U0JA 4RK7A 3AFGA 5IJ9B 2A9RA 1YZ3A 1WXGA 4R0MA 3ZUVB 5DHFA 2PSFA 4HUTA 1FFSA 1LQUA 2R4QA 2HPVA 5HPYB 3R7FA 3P0IA 1Z45A 3IPXA 1IOWA 5HQ3B 3FB4A 1D0VA 1CRZA 2BI7A 1D4AA 4GFDA 4HVBA 1GGKA 4IFEA 3EEYA 3IQWA 4M7WA 2GUWA 1AH2A 2CDBA 1A4RA 2OCBA 3H6GA 4F3CA 4GTTA 4YXWD 4A6PA 5LQKA 3T3DA 1JDSA 3RV3A 2R1VA 4LXYA 1A5BB 3T41A 5H5JA 1ORDA 3BMQA 3A6KA 5EIDA 1NRWA 1W1WA 2KZTA 1EP1B 1G8KA 5A4IS 4Q1CA 3RFXA 1NL3A 2J31A 1JFLA 3OE4A 3QEKA 2NP7A 2RAPA 3UK2A 4EQZA 3CH5A 1LA2A 2CFSA 1XXHE 4B3JA 4HXGA 4DXHA 2Z9CA 2HXGA 4DC1A 5CCEA 4L3WA 2JD0A 1NA0A 4AXHA 4M87A 1AZSC 3VU3A 1I80A 4OQFA 1ADFA 2C1ZA 5BSVA 5ICGA 2XS1A 3MRVA 2OSBA 2QMZA 3K1AA 4LXXA 1T43A 1AG9A 3EDCA 1HRKA 3JQ1A 2P2YA 1WMBA 2C07A 2KB0A 2QR5A 3VVBA 2GWHA 3O3OB 5D5HA 3MIIA 2VLIA 4DIKA 1NWHA 4OMFG 1PVOA 4EATA 3PQDA 4P34A 4EG5A 2IOQA 3KAQA 3ZC3A 4G5XA 2EBWA 3OX4A 3DAPA 3KOXA 4TXRA 3ILSA 3QKSB 5LMNB 5A1JA 3DDWA 2RC6A 5F7JA 3ADCA 1B42A 1Z4QA 4C7BA 3V32A 2AUTA 1XAGA 3WWYA 4MARA 3GRVA 4MR9A 2AEMA 3IP3A 2YIVX 2AG8A 3NNNA 5DEIA 5AUPB 3C15C 4EFLA 2J3LA 1GGNA 1QHHB 1CJTC 5HM8A 1EINA 3LRXA 4RTRA 1R16A 4A1FA 4MRMA 4P0TA 2FQXA 2EKPA 2WF7A 3W8RA 1VQ1A 1T5SA 2XUPA 4MUXA 4EA6A 4S3MA 4AJLA 1VHTA 2ZUEA 1EESA 1UXOA 4EFNA 1WMEA 3GBSA 1JA1A 4L6CA 1PVDA 1P19A 3G8DA 1I9CA 3PK0A 2YVQA 1ZPDA 1JKFA 3E2IA 4AZ0B 1N2IA 4MIOA 1KORA 4JV5B 1RAEA 1UAAA 5FAXA 3O1JC 1XTZA 4Q3BA 4HCJA 1ACLA 3P2KA 1AKYA 3QRWA 5BPPA 2H7YA 3KYDA 4BKUA 3CVYA 1W5EA 1WEKA 2ZRNA 3BJZA 3MMPA 2NZWA 1EA5A 2GOYA 3O7WA 4D5GA 3DD5A 3R41A 2RMKA 5L8VA 4YIHA 4CWAA 1PBTA 4JUFA 4KWIA 4M0EA 1FMFA 1P4RA 1IY9A 1I51A 1Y1QA 2R8YA 4M86A 3QX8A 1JJAA 4C2AA 2R00C 1KO1A 1TTPB 4O1HA 7YASA 1ZW6A 3ESQA 1QVWA 2QRKA 2P8SA 3ZWMA 5CFOA 4BVBA 5BQOA 2VEOA 2HDHA 1MJ5A 3IV6A 2PRIA 3RC8A 4P5EA 3PE6A 4MRUA 5K4HA 4P38A 4IAOA 1ZJ6A 1JECA 4WK0B 1WF3A 4W5OA 4BP1A 4YK7A 5EXXA 3QUAA 1PV2A 5IVIA 3TM4A 3QLTA 3WDKA 3DEHA 3FEXA 1P17A 3IT2A 1MXFA 1IYZA 3GT7A 4E2ZA 5GADl 1JILA 1ZFNA 4C7VA 3UUWA 3NIDB 1HA3A 3QW4B 1QVAA 3H1TA 4JS0A 2B3TA 1TM1E 2QX8A 1M2WA 3T1QA 2UVQA 3Q3HA 1IHGA 1M6EX 3SE0A 1FK8A 4ZOLA 1UW4B 1S1CA 3NOGD 1N4DA 1RPTA 3UT6A 4KO2S 2IS2A 5TNXA 3KSQA 3FMIA 5AXDA 2G8LA 4LFBB 4CKWA 1ICEA 3HV2A 3TH5A 2UXBB 1NBHA 2TSYB 1IK4A 2R7KA 3CX7A 5J1TB 5GJWC 1B43A 5CNIA 3ACBA 1O08A 4B1FA 3IO5A 1A7UA 3VR3A 4HLDA 1D2NA 3R3YA 1ORWA 5LZ7A 3K94A 1CQIA 2NU7B 8ABPA 2Q2WA 3ZGLA 2V7TA 1ND5A 4TTPA 1V5FA 1E8WA 2AS0A 3QEMB 2YIDA 4F84A 3KQQA 3F5QA 4YRJA 4UWLA 3FZEA 1L5YA 1Z4OA 3UH0A 4DDKA 3I8SA 1KIAA 4AWBA 2GVNA 4O4LB 1WW3A 2QVBA 2ORIA 4FLMA 2HU2A 3LBIA 4JQZA 3EMVA 1E2UA 2JK0A 5TMDA 3N75A 3CEHA 1SRRA 3OEHA 2PGIA 1GAEO 4KKVA 2GX6A 1HDOA 4NRHB 1OT3A 3ZLJA 2WWIA 1NDQA 2NWQA 3QEJA 3S2ZA 3MPUA 1YQWA 4WAFA 5JCJA 3A7EA 2HOQA 4MB0A 2PLNA 2OAQ1 1XXHA 4OVUA 1EVYA 2P78A 5IASA 4YJ3F 1CBUA 3BWEA 2YDXA 4J0GA 4QDKA 3WQSB 2YQ4A 3G2QA 4ZI7A 1SBCA 3ENWA 3E9QA 1SHJA 4N01A 2G77B 4HMPA 1E20A 4IMJB 2REOA 5AKZA 1DKMA 3C2QA 3L08A 4DV0B 2Q0HA 3EDRA 2ZSBA 3NU1A 5BYJA 4ENRA 3X1MA 1ORTA 3TXMA 3KQNA 2FN3A 1O03A 3L0PA 1T5LA 3U4IA 3UUGA 3CM0A 5ADWA 2FHSA 4U7HA 1BVHA 1H2RS 3ZNGA 5F4ZA 4DQLA 4UNSA 3GVXA 3ZGOA 3BB4A 1B6GA 1XAJA 2P9BA 3UM1A 4GA0A 2GEBA 4D1YA 4OOEA 3E70C 2DX7A 1U80A 4KK3A 2XUIA 2W2PA 3BCSA 3CT6A 2DY0A 4V0RA 4Z4EA 2YYYA 1JEJA 4C6TA 1ZIPA 4LSZE 3VH3A 3IR5A 3PQ4A 3CNHA 1N25A 4Q9LA 1HZ4A 4JJFA 1NPYA 4DY4A 1E1LA 1P9OA 1ANKA 1NTRA 5CH3A 3M6MD 4QBTA 3VJKA 4N3CA 5LCXA 3PEVB 1FFEA 3M9WA 2VP2A 1E98A 1OWMA 4G67A 4WJZA 1HLFA 3S55A 2HRDA 1M76A 3T5DA 1E7MA 5K0JA 5G2NA 3LWDA 3GPIA 5ED4A 4CMHA 4XE5A 3HB4X 4HGRA 2IIPA 3P2YA 2P9HA 4DAOA 2IBSA 2QTNA 5KVQA 3KR2A 3CUUA 3GJQA 1UP6A 4OHXA 4OREX 4YO8A 3QFSA 5BNWA 3X2SA 5TLSA 1EFRD 1D9ZA 2KCKA 1E1YA 2HNKA 3ZDBA 1GSIA 3F2VA 3T3OA 3AHEA 3WR5A 3LPDA 1IBSA 5IDVA 5SZIA 2WXGA 1XZMA 1GV1A 3FFWA 5JZSA 1KFKB 4OK5A 4WWNA 3HDHA 2DQSA 1EE9A 4RXMA 1K1EA 2W83A 2Q3HA 5JVDF 1MQAA 3BQNB 5CMLA 5CK5A 2ID8A 2I4NA 1IHBA 2VYIA 2XOEA 1NVKA 3WNCA 1TJCA 5D84A 3X2FA 3EF3A 4HDRB 1CJKC 2QTAA 5FOVA 2RH4A 2G08A 2BEVA 3C8HA 2JIBA 3SQVA 1URPA 2IYFA 2ZYHA 5IN5A 1K9VF 2AV6A 4Y1GA 1JEYB 2P6MA 1UBEA 1UN9A 1XU7A 3E2PA 1OI7A 4CM4A 2RSLA 3NLLA 5EEHA 4DLTA 5I7AA 4UD2A 4F12A 4C5AA 2IF2A 2JHPA 1CETA 1Q21A 1T10A 4O25A 2ZUUA 1OH5A 2CMGA 1WNFA 1FZTA 4RJIA 2FQWA 3ITDA 5HR5A 1L4HA 3K72B 3L6RA 2Y1CA 3W2HA 4IOLA 1XGWA 5LNK6 3L1VA 1M1XB 2R60A 2MR5A 3FFLA 2WHXA 3ABOB 4LYJA 1FDRA 3LV8A 4YC7A 1U1DA 2C4MA 4ANVA 1WHTA 3FAKA 4X1OA 4M1MA 3OJEA 4C0SA 2FZWA 2QD1A 2ECQA 3ADKA 3DE6X 3ORQA 4PPFA 3JCKC 5AD1A 1P1JA 2XHEA 4F11A 4QOHA 1C9JA 1QV6A 3MINB 1ZGAA 3CUYA 3RVNA 4UPEA 3EXG2 2YXNA 1TM7E 2J6IA 3BFJA 3BXZA 3KSZO 5HILA 3PFIA 1NG9A 4BFXA 5KYXA 5E9AA 4JWTA 4JJ8A 3ZI4A 3V8MA 2W6ID 4IP0A 3MZLB 1WUJS 3SHOA 1GL6A 4OM8A 1KU0A 4I1RA 3D2LA 5AUQA 2GCOB 4BQOA 1CF4A 4QECA 4G0UA 2RKOA 4Q0MA 3CLTD 1HQDA 4QDTA 1V2GA 1WVIA 3ORYA 4Q9AA 3DFIA 4C7JA 4E0BA 1RMYA 3VO2A 1QFJA 3GJ7A 1AX9A 3E5NA 2EW1A 4NCKA 2GNAA 3OWOA 5DPMA 4PAGA 3CSFA 5KMGA 2P27A 2H5EA 4F5ZA 1XROA 1HNNA 3WZMA 1I0LA 4UWHA 2VAWA 1U9JA 5EHXA 3PJDA 4WV3A 1JQJC 1KO7A 5C5IA 3O4HA 1R8QA 1NJGA 3CR7A 5FHRA 3FUKA 1T6YA 1UG3A 3GFOA 5CX1B 4FFBB 4MCHA 4RCZA 3OU6A 3ZW7A 3UKRG 5C46F 4PE5B 3WAKA 5CA1F 1YZFA 1SD2A 3SYLA 5DOVA 4HSEA 1YR3A 3C14C 3BD8A 3V97A 1P0PA 1EP2B 1BU9A 4AIFA 3KT6A 1F12A 4BMOB 2AC4A 3NCTA 3TQIA 4BGDA 3T3PB 3FBWA 3E05A 3O8NA 5E3IA 3NBFA 4FIZA 5KSWB 3LHKA 1JRLA 4JYPA 3ZWPA 2VF8A 3UJCA 1HM5A 2JJYA 2WHPA 1QQ5A 1V1RB 4G37A 4AYWA 3DBSA 2QRVB 4GIBA 3EY4A 1XG5A 4MJ7A 2J3DA 3TXYA 3SQDA 2JATA 1ZNWA 5DNWA 1V8DA 3QIVA 2BTEA 4RKWA 2YY5A 3ER6A 2Z9BA 3RRXA 1DWOA 4LNUB 3E3AA 1XVAA 4J1TC 1JHVA 1P0FA 2R1ZA 3OCZA 4J8DA 1VMDA 1E2LA 5JALA 1IBRA 2QMUA 1H2FA 2B0JA 3OQHA 5ILOA 2P5TB 3ULKA 4IIEA 5C5EA 5EMKA 1BOFA 4AP5A 2EIKE 4MWBA 5TMEA 3EDQA 4FOLA 3HP4A 4TQAA 5BMVA 1NIPA 1ADGA 4LSZA 4A6DA 3S5UA 1YA0A 1WUHS 4EDHA 2FRDC 3V9PA 1AQ6A 1EZ4A 1SY7A 3NYWA 3IQFA 3I6QA 1H23A 3EXHB 3OU7A 1AMUA 3OURA 3ECAA 2XE4A 4N8DA 1VLMA 4TWRA 1WBJB 1D1TA 2FEWB 4WVFA 1Q0ZA 5FPYA 2G04A 2P9KG 4BBPA 1QO7A 3WB2A 4R5MA 5FA8A 2XIQA 2QKYA 3H83A 4Q9DA 1J5XA 1L7NA 2N47A 4D26A 1KZPA 3Q5DA 3RTBA 2C94A 4JLSA 1X6VA 2YVLA 4P4SB 1OU4A 1GRVA 1A76A 2K6GA 1TKBA 2HLPA 4YH1A 3K8OE 2PMKA 2B7BA 3ENZA 4YAOA 1P73A 5JNSA 3DULA 2QRNA 2BV3A 2EAUA 3FI9A 4LRQA 2XBMA 3DW3X 5KYUB 1NW3A 3UHPA 2MSKA 4YCJA 2DKNA 3NXKA 4U04A 2ZULA 4OU5A 1Z36A 4G8LA 3WRXC 3STYA 1IL0A 5EUBA 3R9XB 3CVJA 3SBXA 4XVCA 4HC4A 2FX3A 3BH0A 3FIUA 2ZI5A 4K9NA 4UHJA 4UU8A 3M4JA 3EQ9A 5SYMA 3HJFA 2XA1A 2X22A 5CPFA 2G1UA 2VYND 1R0RE 3LK6A 1A04A 3SZOA 5EPOA 3TJRA 3L7CA 4PCAA 3AZQA 2Q2VA 3RRFA 4N5LA 1P7YA 2IPMA 3TW0A 2OCYC 1AY0A 2H1RA 2PE5A 5AM3A 4ACKA 1UKZA 5C52B 1EFUA 1MIHA 1P4AA 5ITSA 5KKNB 4D4MA 3E22A 4YJGA 4PBRA 2O57A 4DR6B 3PT9A 2IHJA 1DC7A 3FOEC 1WS6A 1IUNA 1R4ZA 1EVZA 2QZZA 3ROZA 3RRJA 2WHYA 2NPOA 1KGSA 4DCVA 2VEDA 1XU4A 3KTOA 1ZUNB 3HWWA 1ZB1A 3COVA 3VR4H 4I17A 2BMVA 2H4ZA 5KAMA 3OX2A 4CIAA 1D6MA 1XNJA 4HS4A 1PP4A 4AYXA 2B8EA 3NIWA 4L51A 3R24A 1UKBA 1RVV1 3K0HA 3ICCA 4CLOB 2H5LA 5AVQA 4BGEA 4GM4A 3KTAA 4IO1A 4FDVA 4RPGA 1S5PA 1OV4A 4DX6D 3WIUA 1V1MB 1JTFA 5CIYA 1ZWKA 3A0RB 1U2RA 2MSDB 3QWIA 3E33A 3Q1KA 4R0NA 1DMSA 4HFGA 2WPDD 3ZV5A 3TE7A 4LY6A 3JXIA 1IIRA 1JBEA 3F6YA 4I3HA 3S2IA 3GLVA 1ZUWA 4KO3S 2Z56A 4K9PA 2XCRB 4N5IX 4YCMA 1YE8A 1P0CA 1E58A 5A5EA 2AZDA 2J0UA 1R0BA 2D0OB 4YP9A 4CLRA 4XE0A 2GK4A 4KI7A 4LPSA 3QJ5A 3TFQA 4JI7B 2D8MA 2RB5A 4N3GA 1GIAA 2HJSA 3GZJA 2JCYA 1H2YA 5BSMA 5KVAA 3TINA 3R3UA 2X6KA 2WPVA 4HGYA 3UAOA 1HEYA 4QUJA 4II2A 1XA3A 5JFOA 2OV4A 4N1AA 2E3JA 3RAGA 4UZSA 3CT4A 4CM8A 1O8CA 4PN7A 3QZUA 3LXUX 2FJUA 1U9YA 3AY7A 4DX7D 4PGHA 4AY5A 2F8TA 4K3VA 2R17C 1ZY2A 3PQ5A 1DKLA 1T8RA 1GTL1 5T41A 1N5IA 2WVGA 2OEVA 2Q3JA 1JXMA 4MWGA 3UENA 1CIVA 3I1JA 4JR0A 4QDXA 3Q2IA 2FLWA 3GLHE 5J4LA 3QFRA 2CLLB 2O3QA 3DE2X 4RTPA 2C98A 2Z2XA 1BXRB 1YHNA 1CG6A 2P9ZA 4PGAA 2GZ3A 3D8TA 5ADUS 2QN7A 5C4GB 2O8CA 2QRMA 1SC9A 3VR3D 2WI8A 3KEQA 4EI9A 3H5WA 2EP5A 4BQQA 1GCGA 5IHPA 5E4TA 4WMLA 3GJ6A 1S63A 3ZBTA 3OBIA 1TQ8A 5FR2A 3SFTA 3PPVA 3PWZA 2CHEA 1GFSA 2Q5HA 3UV3A 1T1GA 1FS4A 3RVQA 5FNVF 1LDNA 3MD0A 3LUCA 3R20A 4RFSA 5A3VA 1RPAA 1XZGA 3TR0A 5DULA 4IIVA 4YRDA 3GPLA 1AUVA 4O4HB 4QGFA 2OO5C 2BTQB 4O4IA 4Y67A 1SU8A 3PCRB 3FNRA 5ERXA 4EG3A 1LFDB 5I7UA 1K9SA 2H1CA 5JCJD 5JNVA 1SD5A 2LVBA 3KQKA 3NHSA 3STVA 1B1AA 4L5CA 4KQFA 4LYGA 2FN8A 3PGVA 1YT5A 2LTAA 2ZTMA 4D82A 4UMEA 2DTEA 1HT1E 4XRRA 2AKYA 1LU9A 2WZQA 3DUWA 3BK1A 4QNNA 4MVXA 3IOMA 1ZLXA 1PAQA 2QJRA 3H87A 5C8ZA 4YWHA 5FJIA 3WOHA 5LBIA 4ITRC 2UUAB 3L8YA 3LY5A 2VL7A 1KFEB 1ONSA 3THWA 2EJCA 3C74A 5AW6A 3D64A 2DPLA 3HJHA 3ILHA 2PLRA 3BXPA 2ZSJA 2BZGA 5KWJA 1FW8A 4OXQA 2DR3A 3EOBI 4ZVTA 5SYAA 1Z17A 4X66B 3VZCA 5F1KA 4J8FA 3ET5A 1XMXA 2SECE 4WXEA 3OQ1A 4MYHA 2ZSEA 2RGDA 2ZLBA 4MOWA 4L3VA 3CRRA 2XZTG 5FOTA 2GD1O 3V2UA 1KP2A 1BH6A 3NANA 4JGGA 5JQGF 1N7GA 4ZV7A 5E1DA 5FJYA 1NN3A 3Q7AA 4Y2HA 4RD1A 3TTWA 1TA0A 2ZYWX 3G2HA 4IVRA 2CEKA 3CCCA 3IRVA 2EZ9A 1P5RA 1U4NA 4CL0A 1YA6A 1XTVA 3OECA 1TL7C 3DO6A 5IKXA 1J1ZA 2BHSA 1NQAO 5E6UA 4HT3B 5FL7A 5A4KA 4LCTA 3IEUA 2FI1A 4KNVA 1SOVA 2CFCA 3DXXA 4KFSA 5FZRA 1JW9B 2WWVD 1W4ZA 3G02A 4YUZA 2WXRA 2PZLA 3JQDA 4DQUA 1ZCJA 4DJEC 4U9UA 4LIPD 5EXPA 2BFDB 4R51A 3P2BA 4I5IA 4WESB 2Z8XA 2QN9A 4DWJA 2IOSA 4NATA 3UJHA 3FD8A 2CSXA 3AU9A 5JLAA 1H85A 4M1OA 5DX1A 1HTWA 1Y4UA 3CEQA 1Z6QA 2X5KO 4IJ5A 3P1UA 5DOZA 4C29A 4ZHQA 1UMBB 1FYWA 3GRYA 1K6IA 3GDGA 4M0KA 4NECA 3VBCA 1YJ8A 3BK7A 3V1LA 1IHDA 1DGQA 1BJRE 3RJMA 3UZUA 3ZV3A 5AOBA 1N1EA 4JLNA 4CW7A 4EMBA 1VBMA 1BGWA 4PC7A 3RYFB 4R1TA 4OAOA 5EL0A 2B20A 3GCWA 1KYYA 3D6AA 4XKJA 1JMYA 4Z3KA 4JLMA 1U1EA 1U99A 1Z5PA 1TU0A 1UJ6A 4QOGA 2D1QA 3HRAA 3A9UA 3GPCA 1XRNA 3FU0A 3FLAA 4L9AA 2E4AA 1XZEA 4WOKA 5FYQA 1XCJA 3ID6C 4UUOA 2OZLB 3U3DA 4KIGA 1Q17A 1H0AA 4MEJA 2Y3AA 4Q7JB 3MELA 3WMFA 2GS9A 2Q4EA 1JF8A 3Q12A 2AK2A 5DHUA 3EUVA 1CB7A 4XDYA 7GPBA 1LBQA 2FQ1A 4F38A 1FJGB 3HKEB 1FLDA 3S6JA 1OMOA 4HOQA 5JH7B 1SXIA 4Q94A 3CWQA 3BJRA 3MCZA 4BNJA 1AHNA 5CIWA 5CLIA 4FBGA 1CC1S 1HFAA 5EZYF 4B6PA 2V6GA 3A27A 4Q39A 3FZQA 2A30A 1RQRA 4R9NA 5B6PA 3PHJA 1CYDA 4J7WA 4DLVA 4YCCA 5FWDA 1VG0B 1S3SA 2BEUB 3GDFA 5EQJB 3HY6A 4MW6A 4LXGA 4FJZA 2CJFA 2JABA 4BQNA 3H9CA 4Z4GA 5IARA 2VYCA 3OM9A 5LCWC 3UT8A 4A91A 4Y6RA 4LSWA 1MABB 4LXUA 3TPCA 5K0SA 3R8XA 3A04A 2BUBA 3R5JA 1CJCA 1J0AA 2QVCA 3PQEA 1QHSA 1R6VA 3ZCUA 1A4IA 1TQHA 2BT4A 3AIIA 3E30A 3ZVKA 4NL4H 5FUQA 2H0AA 5JXIA 2XJ9A 3F0TA 4M0MA 2AYYA 4S1NA 2ZGGA 5KNDD 2QYOA 1RYEA 1OJ7A 3X43A 1XVUA 1GPJA 2BGIA 5KNBA 1E4EA 4XLTA 4JC8A 3L7OA 2A2ZA 5E4JA 2PPVA 1JXQA 4JA0A 1BCSA 2B37A 2XJ4A 3R9AB 4NMXB 5FLKA 3IV7A 1IQUA 2V6FA 1KI2A 3EGEA 3V1YA 3UV7A 1RXWA 1M5TA 5FTMA 3JQRA 2ODTX 3F46A 4R2IA 2OQRA 5ALQA 2CD7A 3FNGA 4E4RA 3FPHA 4MDFA 3ZZUA 3Q9SA 2Y1OA 4K9DA 2WFAA 2CL6X 3ZWCA 1QYMA 2M6KA 3BN3A 2CVHA 3K96A 4APFA 1DX4A 4DLBA 3R3HA 1U8YA 3A31A 1TCBA 2KXPC 4Y9DA 4FLFA 4CFYA 1X80A 4MPJA 1CZOA 4G07A 4S05A 4PWZA 1DQRA 2G1PA 4CF4A 1D9SA 3GRKA 4C01A 4E6HA 5CFRA 5B3LA 2VF2A 1QV9A 1WJGA 4KNYA 4PG6A 1SD1A 1OD6A 2PS1A 2G83A 5AKJA 2OQIA 3WAGA 3A05A 1I8TA 1YIOA 5M2QA 1YB2A 2CXSA 4CEMA 2CL5A 2F43A 2FUCA 2BF0X 2WW8A 3E82A 1QH8A 5DBKA 3EFBA 3RC7A 4OQZA 4C4RA 3QGMA 4K8RB 4XOUA 2I1WA 3LQFA 4HDQB 3A6PC 2ZE7A 5EJ6A 4H6PA 4XB2A 1T8WA 4TKLA 5TJHA 2BBTA 1N6RA 5JDCA 1OHHA 5LQRA 1P5QA 4Q1DA 2FLKA 3BA1A 3VJLA 4GPKA 1B4DA 1HT2E 1X8KA 2JA1A 1IONA 1UADA 3ZY5A 4KAJA 3AHDA 3DFKA 5C3UA 3TLYA 1P5JA 4NMWA 3ZWBA 1O5IA 3ULQA 3DWFA 2A94A 1FLAA 4PEVA 2CLKB 3ROGA 2OBBA 1KH3A 5DNEA 4B17A 5KJMA 4AROA 1ZO8A 4LV8B 3GEGA 5FIOA 1SUPA 3ZU2A 3EZ7A 1HDIA 3AM4A 3PZBA 1LI5A 2IE0A 4LY3A 4D45A 3GRCA 3Q78A 1B8PA 1GPUA 4ZAZA 4ID3A 4W6ZA 3LCCA 4P2BA 2EIJE 3EA0A 3HBAA 2ICAA 5CEDB 3BGWA 3HXKA 3CLSC 2WMDA 1KBQA 4GUDA 1XJCA 2XOKD 1QZ2A 3UUFA 3BDAA 4FMBB 4IG9A 3TR5A 3JSXA 3C7CB 2DWPA 4KXMA 2C4HA 3AC0A 5E38A 1SNYA 3NYRA 2VT6A 2OQVA 2XLBA 1OY3D 3Q85A 3UWOA 3PXEA 4JVSB 4B47A 3G7SA 2YH2A 5U1PA 4QTYA 2ST1A 4BVHA 1H65A 2ZJ3A 1C41A 5CX4A 1HLPA 1UXJA 4F9TA 4JJ6A 2ZTSA 4JOSA 4TUYA 1N9GA 4OKNA 1G59A 2PGXA 3HE3A 3I3NA 2BM8A 4KQGA 5E8JA 1OROA 2CHFA 2HAEA 3KNZA 3KFXA 1NY5A 5HKKA 1NBEA 3K0FA 2O7RA 3NTRA 5AUOB 1ZR4A 4NENB 3IQXA 4PLWA 3USES 2VCYA 4MVJP 5DT2A 1JWLA 2HDOA 4JDPA 3OC0A 3FJ1A 4LGVA 4D9FA 3PWKA 2I6HA 1HG5A 4QHTA 5HIJA 4IICA 1RRFA 1HQYE 1RM4A 4EEXA 1QYIA 3OZIA 3NUGA 5CBOA 3A4LA 4NJOA 5JBIA 4MPDA 3QA3E 2ZJBA 4HLEA 1JHDA 3G0DA 3MS4A 3F67A 5EHQA 1BKYA 3SEZA 3PC4A 4WOBA 1KDVA 1QHGA 3BQ9A 4NURA 2GPSA 1Y4ZA 5B58C 3BZUA 4ZCMA 1M34B 1DIOB 5TPWB 3C1UA 2EBUA 1M6YA 4BSXA 4QNMA 1ZD9A 4J76A 2PZ8A 5J4HA 3K16A 3QE4A 3H2JA 1AIPA 3ZZTA 5CCLA 3AR3A 4ZVLA 4FJ0A 3HJRA 4YROA 4ZWNA 1CU1A 2QA5A 2PRKA 3FUJA 2JHFA 5CM2Z 3EIQA 3I4RB 1TNZA 1QPBA 1XIVA 2HFKA 3WMGA 2D1RA 1DBSA 2I2DA 1VJRA 3BEEA 4OQMA 2DM6A 1VTKA 5FD8A 2HWYA 3UK0A 3LPZA 3GDWA 2BFBA 3V80A 3MD9A 4YMIA 2DU8A 1V3VA 4BATA 4ZYUA 3RYCA 3IBEA 4JK3A 3BOSA 2OYCA 3FCUB 5BSEA 4B0OA 2R62A 3RYIB 4MRAA 4E3ZA 1VPVA 4BNUA 4CRWA 1NP6A 1RAFA 4B3XA 1R9NA 2DE0X 2XZTA 4DCGA 2VAVA 3EA5A 5DN6D 4H77A 1I4EB 1XZJA 1Z25A 4LE0A 4KLZA 4RVBA 3UFXB 4CNQA 5F7ZA 2WU4A 1T5HX 2H52A 1SWVA 5KWIA 3TFWA 4KTTE 3OF5A 1WR8A 3H8SA 3D59A 2MR6A 1T36A 4YP5A 3T8KA 4P86A 4ZAGA 3L17A 1Y8MA 2RHMA 3IVAA 2W71A 3K15A 4LK3A 3X1ZA 2W90A 4C21A 1I7DA 3RANA 1TO6A 2H1WA 8ATCA 3I9LA 3ON5A 1UEIA 2ISSD 1G9XA 3ML8A 4FADA 2H29A 1FYXA 4YB8A 4TRRA 4R1LA 4DLKA 1A9TA 3DZKA 3E5HA 4HFMA 5B3JA 1BFKA 3CONA 4H31A 4PY2A 2O23A 1WY5A 3GCDA 4E2YA 3RC3A 1GT91 3VYSB 3D6TB 3H2GA 1YRQA 3DT8A 3DMYA 3MQ4A 4RH3A 3VKVA 2DUJA 3D8SA 1HT0A 1OCRE 4ZIRA 1WKBA 2AX4A 4R2KA 3TL5A 3BICA 2FW6A 2E5FA 5GQSA 1TYZA 2X19A 4RTQA 1M1UA 2IYXA 4G86A 4G0OA 4QXQA 4JA9A 1JIUA 3C3MA 4N0MA 2XI4A 5HNKA 2YWHA 4S0XA 3TZQA 4X1YA 2HBQA 1E92A 4AZVA 4IIDA 2RG1A 1ULSA 3OLQA 1G8GA 5C9ZA 3KLOA 2MSNA 3GPBA 5K8IA 2YN2A 3T9EA 1E9DA 3N2KB 1RWQA 1MB0A 4P0QB 3SZGA 4DMCA 3D7MA 4GTRA 4EHNA 4L8VA 4GE0A 2JFBA 3ZCVA 2OY0A 1KC3A 2NP6A 5LBTA 2RGNC 4WK6A 5CT5A 1NI5A 4F92B 1A27A 4NAUA 3HEAA 3IODA 1NYQA 4KIJA 2PL5A 4P80A 4QDOA 4H0FA 2JFWA 421PA 4RSHA 3BGIA 3FI0A 1X7WA 1XAHA 2C84A 2D2IA 3LMKA 4D6XA 4JEHA 4AWAA 5BPFA 4ZODA 4I4CA 1NPTO 4J9VA 4AS1A 1XP5A 2PJDA 2HF9A 3GRUA 1RI2A 1TCVA 3RHSA 1JI0A 3W34A 1KKLA 3L6EA 3L1KA 4ZOQI 3G89A 3VOSA 2FE4A 4F46A 1MYOA 2OVBA 3X0DA 1C4WA 4UQPA 3DBVO 3I5XA 1UWLA 3U4CA 4HEQA 1B7GO 1XTJA 1Q83A 3QU2A 1JFFB 3DFFA 2B0OE 3OPYB 4C3ZA 3ZOZA 1KEVA 3HA7A 4O4JF 2CLSA 4HLNA 4M46A 3UXHA 5FHQA 3ZKWA 1NJFA 4R16A 4LPKA 3TQFA 4BNNA 2C88A 1OXVA 1AN9A 1U2EA 2Z5LA 4DYDA 3PNQA 5FL7D 1NSTA 3QLVC 1IPHA 3SK0A 3I9KA 4CEJB 2HPZA 2V6MA 4EMTA 5E6SA 2ZROA 1JDPA 1KXZA 2ZIRA 1PZMA 3MTBA 3EFOB 3H86A 3T99A 1P45A 1QYWA 2V6JA 3AHCA 3WFIA 1NYTA 4QXPA 3MMZA 4E88A 1IHYA 2XBLA 4RVNA 2AA3A 2ZI7A 1EG2A 2WKWA 4ZOCA 1ESDA 4CT0A 4YAGA 3EQ2A 4RX1A 3K0EA 4YAKA 2CUNA 3BERA 5KDLA 1RAHA 4Z2YA 2XMZA 5CEFA 4L78A 2Z57A 1EZ1A 4DADA 1T3TA 4B80A 5EWJB 2OCKA 3UOAB 2OSVA 4XQGA 4WADA 4JB8P 1P0QA 4XAQA 4FX2A 4JP5A 1Z6TA 2HTEA 5I7RA 3QX9A 4OGGA 5A7GA 2WTAA 2V9PA 4LJLA 1Q16A 2B92A 3ZYCA 3M0EA 4AKSA 2VZ0A 3C3BA 4A8PA 3TW8B 1DTWB 4QPCA 4QUHA 1Q92A 2KJQA 5LIPA 1DDIA 2VP5A 2ECPA 3DEAA 1EDOA 1D09A 4CPDA 3CH4B 1B1CA 4GOND 3QU5A 3SX2A 1KH2A 1D8TA 3K9WA 2X6HA 2PCLA 4G8CA 4AK9A 1JUDA 3TECE 2M1XA 3KZXA 3URKA 1OASA 2PR2A 1H93A 2EHDA 1TMOA 3RIXA 4GH5A 3KP1A 4FEEA 1SJ9A 2Q5IA 1KFJB 4F4FA 1P61B 3OT1A 2EZUA 2A78A 4CQMA 1BFDA 1FJHA 5IT9A 1S2DA 2QYTA 4GQAA 4XR4A 4M7PA 1B2RA 2C2BA 2JI9A 4RW0A 4JGBA 1G5QA 1E5QA 3UXMA 4OQNA 3F8SA 3NCHA 4AO6A 3L18A 1WXHA 2R84A 5CAEA 3HZRA 3I53A 4UNNA 4EVSA 4HX9A 1OT5A 3CZ4A 1KNXA 1USGA 2O0JA 2AC7A 3KKNA 1ZGBA 4QFDA 2CDRA 5CJPA 1LC3A 4UCWA 1EX7A 3UG7A 1JWBB 3H18A 3AXTA 5EZ5A 2XITA 5B2EA 4RQBA 3FGNA 4D41A 2ZJYA 5LXTB 3NPAA 1UKEA 3PXXA 4XGRA 1GYQA 1TYAE 4NEQA 3KSLA 4MZDA 1UK6A 2ZU0C 5HG0A 3B53X 1JKMA 3IXEA 4YRPA 2NAPA 1WLSA 1M2VB 4YUVA 1N0WA 4XM0A 4KYOB 3KHSA 3HR8A 2BGJA 1DC6A 2O5VA 3KUDA 2RGXA 2ACKA 1BE6A 4OPMA 4AECA 4HHEA 1R50A 1AB6A 4C5CA 1KE2A 1I30A 1Z35A 2JIDA 2P2GA 2J6HA 5KNBD 5GIPE 2WMOA 4QIHA 1CQZA 3G9ZA 2E4YA 4ARAA 5EJIA 2GH1A 3R3ZA 3SGHA 2GKGA 3DJYA 1KHTA 1MP0A 3L7AA 2YJ4A 2HHHB 4Z4IA 2FSUA 1Q57A 3U3KA 2VHVA 4GDMA 4B7AA 1CQPA 4ODIA 1UXGA 2J1LA 1T1JA 3MS7A 2V8SE 3Q79A 3WP0A 3RVPA 5TQJA 1OW3B 3LCVB 2BKUA 3HS3A 4NNPA 2P69A 3UT7A 1H1TA 1GN8A 2XV1A 5IEJA 3V7YA 1RWKA 3ZWWA 4QYIA 1E2QA 2P9PG 3UW1A 2YWXA 4Y98A 2YS7A 3N2LA 3E48A 1W93A 3L8GA 2GZ1A 5HFJA 2FSSA 2EFYA 1DB3A 3WHKA 3T7TA 2G82A 3ML1A 3UAYA 1XB2A 2LRHA 4IDGA 2G0NA 3SBOA 3UHAA 1LS1A 3FLMA 4X6LA 5CB4F 5HWSA 2Q41A 1MZVA 1DUSA 3EG9B 5F3RA 2ZUSA 3CVUA 3EMKA 2LXNA 1FZQA 3U9LA 2BH9A 5HFNA 3GEDA 3H8VA 4F96A 3NAQA 5DGIA 1ZBPA 5MHTA 4D8VA 4HTFA 2OHOA 4MUJA 4MJ3A 1P4SA 3L92A 3MWGA 3QEOA 1OF1A 1Z5SC 4R6WA 2MDTA 5JSQA 4JH0A 3G2LA 3FR8A 3BGSA 2DIWA 5BWLA 4I1OA 1TVKB 3BMNB 1ORIA 1BGVA 1ZEJA 4Z8YA 3V8RA 2ZS7A 1GKKA 1GSOA 2B1GA 2IA5A 4G56A 2W9XA 2FFQA 4RMIA 3D8HA 2RHJA 3KPYA 4EO7A 3DM9B 1Z68A 1FMCA 4EHDA 5GPBA 2IF0A 1Z6XA 3F6CA 4WDQA 1P62B 3PC8A 4DV4B 1NSYA 5ALZA 5C8YB 2XRFA 3KL4A 4WUYA 5LB4A 5COBA 4BWFB 1FTNA 1JG1A 1TI7A 3D0RA 3NHUA 1T5TA 3DVLA 3JW8A 5JADA 5D0QD 2X38A 4REOA 2WJAA 2A0KA 4IGAA 4I1VA 3WS7A 1DAKA 3TZ6A 1NXWA 4EYSA 5KZMB 3ZU5A 4DT1A 2XD4A 4HOUA 1K8XB 4CMGA 1XMVA 3OE1A 4QPPA 4B4WA 2ZANA 1BQ4A 1BEEA 1ZCAA 3NEAA 3JAKB 4MVJG 2LCFA 4B71A 5B3KA 7REQB 2GN4A 4HQFA 3Q7QA 2YY6A 3L0YA 3T35A 3LPMA 3TQSA 5A5GA 2R0QC 3MVEA 4H08A 4P7BA 4X3PA 1INLA 1CQJA 2BCEA 3GXOA 5EIOA 4NG5A 3BHJA 3W79A 4F4HA 4TROA 2A84A 3CNNA 2BMWA 3HKCB 2F8SA 4KR9A 4ITUA 4B6RA 1F2DA 5CFMA 3B89A 2HCFA 4Q4HB 5EKTA 2VPXA 4TT3A 4Q9HA 2Z3VA 3JQAA 3L1IA 2IEJA 3GD7A 1PZNA 1V95A 3AKYA 3LCAA 2ADFA 3LLUA 3FYHA 1OIXA 1P1KA 4JX9A 5IT4A 1Z0ZA 1KJZA 4JHRA 3G9UA 4TX1A 5HKKD 4BUCA 2IKSA 4GD3Q 3DLCA 3IP5A 2HJWA 1Z82A 4F1WA 1SKYE 2H2IA 4X5OA 3INNA 4I9CA 4JT8A 4UCXA 4R8MA 3B13A 5CVVA 1VRWA 2E1RA 3PX2A 4GMHA 3SGLA 2F3RA 1CS0A 1H0SA 2VUIB 5CLJA 4HOTA 4HGNA 4HNAB 3I58A 1HMYA 3R3SA 2LXMA 3T5MA 1JALA 4Y30A 3B5EA 3T7SA 1L4GA 3BMCB 4UOQA 5EGSA 2A7QA 3QPVA 3RO3A 4OLHA 2BDEA 1X1AA 1FXWF 2JIMA 1HI9A 3A6JA 1UJNA 1K7EB 2W6MA 4OQXA 1QIHA 4UOEA 1HYEA 3I0NA 1DAMA 1U1FA 3ZHUA 4ECEA 4FM9A 4EJ0A 1QXSA 4Y2UA 2V8BA 1H69A 5IY5E 4K3UA 1TT5B 2HF7A 3LP5A 3PNMA 1VL0A 4BBJA 4G1CA 2JVIA 2XAAA 3L7NA 1DRWA 3NYIA 4K5QA 5LP0A 4TTQA 3HVIA 4NXNB 3CFYA 3JCZA 3P0EA 4NE7A 3IHLA 3HO8A 3B1KA 4LJYA 2JFOA 4PHHA 3WQHA 2W8BB 2XWQA 1JHMA 1LDMA 2IYRA 4OUKX 3SBTB 1FSSA 3BEDA 1CEXA 2AGVA 1H2VC 1ISIA 4IHJA 2XEEA 4X8OA 2WC1A 3DSWA 3LWZA 3Q3IA 4K6FA 1XZFA 4TYWA 5EP2A 4FHGA 3O9ZA 3EIUA 4N5CA 4C7KA 3ZHBA 2Z2ZA 5B7PA 4OY3A 1J5PA 3EXIB 3BG1B 4GUAA 4ARUA 4PX2A 5KQRA 1USWA 5F2KA 1T2UA 4QFVA 1TZJA 2YOGA 4Y6GB 4RKRA 3ETLA 5SY9A 3SFYA 3SYNA 4CL3A 4J7UA 3QAQA 3LCJA 4K03A 3VA7A 1YACA 5A71A 4GWLA 3OZTA 3ITKA 1J8QA 1E3DA 1YCDA 4QVKA 4OGLA 2XYGA 3V79K 1ID1A 2HSGA 2A5LA 3PR3A 1IUKA 4LJ8A 1E7VA 2QUKA 1BDMA 5C7OO 3QG1A 2WFZA 4AM9A 4NYJR 3H3JA 1X5BA 2CJYA 5FUWA 3CLRD 2FULA 3AHHA 1PR5A 3DBLA 5FINA 5CD9A 4F2GA 3CWZA 3S7DA 3O4JA 1G63A 4UW9A 2XRZA 3KOWA 1BO6A 4AM8A 4GGMX 5DWDA 2FVYA 3OCCA 2Y4TA 4DSZA 5JYDA 1NKVA 2R8RA 3OY7A 2O8NA 2X1LA 4I1IA 4DM4A 5C8VA 5I8PA 4MLCA 1VPEA 1HX8A 1N2JA 1QVRA 4G6ZA 3PLAE 2AW6A 4TS4A 4W8HA 1XZ8A 4M7RA 1Z22A 2HU5A 3RU0A 4E2XA 4AY4A 1UFVA 5TE9A 3EW7A 3PGA1 3K09A 2JFXA 4KRYA 1N2CE 2G5CA 4MVJE 2ZVJA 3P26A 1X13A 4CT5A 1AKMA 2PRYA 4YAJA 1F17A 4RJ2A 1SBNE 1YB6A 4J7CA 2HMTA 2PH3A 4E2FA 2C3MA 4KXKB 3GLFB 2AWOA 1VCNA 16PKA 1KDPA 1V2HE 4L8WB 3KLBA 5KC9A 2A9KA 5I7EA 3FYUC 4M1EA 2GN6A 2F62A 3QOUA 2WR8A 1X1DA 1OBFO 1IVNA 1ID8A 1QYDA 1SH7A 3SD7A 3TUJC 2ZT7A 3HCFA 4DGSA 4P35A 4RA9A 1JHAA 1DRUA 2ZAIA 3TLGB 3ZW9A 3L49A 3SSNA 2XMDA 3B7PA 2HIAA 2VGYA 1W0CA 3K0CA 3UK7A 2OZVA 1NDUA 2ZIAA 3I5UA 3BU8A 4KV9A 1WCXA 2GPBA 4BVFA 3OQIB 2YZKA 4II7A 1SA0B 3K8YA 2WXIA 1IJEA 3OD5A 4ZVUA 4MWTA 3IVRA 4FYIA 3UIEA 4Y0AA 2FE1A 2EC5A 3OETA 5AICA 1SCUA 4XYLA 4FW9A 5E1MA 3RRMA 3MSCA 3TQCA 1EJBA 4RH0A 2EKLA 1UBCA 4R3WA 1RI3A 3F6SA 3GAFA 2YS6A 2XCLA 4R83A 3BULA 1HKHA 1LI4A 2DF8A 4FJ1A 2NU6A 5HQTA 4L8LA 2H2FA 4B89A 4M1ZA 2XCOA 2D2XA 4MUHA 5LOVB 3Q9LA 3M3DA 4X71A 3GJ5A 4OHPA 1DQPA 4O2BA 2EFCB 1UPBA 2AVNA 1KY3A 2C54A 2DFNA 5B1HA 4LVNA 2ZJOA 3I1IA 4EYQA 4HOSA 4XW2A 1DJMA 2GGSA 4NACA 3UWPA 2C9MA 3KYCB 2ZREA 4UMVA 5IBRA 1IN5A 4IIYA 3G49A 3DSUA 1T2CA 3BWCA 1T9ZA 3V1KA 1FT1A 1MTZA 2VHTA 3QWHA 1CEQA 4B3IA 4JODA 4HFJA 2GZAA 2GF0A 2WSBA 1P6UA 4L0DA 1PGNA 4XYBA 3UHFA 1M8PA 1O6ZA 4B09A 3NF1A 3ZGYA 1N4QA 2DJIA 2C04A 1OI3A 1Y1RA 4I36A 3VR1A 4JBNA 1ESNA 3UAGA 3H5TA 4DNOA 1TIPA 2IX3A 1F7UA 2V8OA 3UHOA 1ISHA 3E2MA 5D5QA 4Z4QA 3A2NA 3OCYA 4KLAA 5GM2A 3H2BA 4TTAA 3AL3A 1Y3AA 5CT9A 3MWFA 4CN9A 4WWPA 4DB2A 3AFNA 1M7BA 2YNMA 1M1NB 3TQTA 3HYLA 1Q0RA 4NESA 5TB5A 4Z9FA 4MV1A 2B6HA 4W9RA 3UA4A 4S04A 4DTIA 3L0CA 3C6KA 3WSWA 2CNWA 2YFYA 3DSRA 5IZCC 2K2WA 5HDQA 4H7JA 2MSEB 3UXEA 2J8ZA 1LPNA 3KWMA 3ZDDA 4RC9A 1Z2AA 3X44A 5T3RA 1ZC4A 4CQMD 3TGWA 1RYHA 1NMXA 2YV2A 3K2BA 4EPXA 3D0QA 3ZLTA 1N4SA 2GTPA 4WASA 1H5UA 3OHMA 4BX0A 1IN8A 3HXFA 2G72A 4X54A 3ZWVA 3FZGA 2BCJQ 2H4YA 3N28A 4CKCA 2ZPTX 1R8SA 4GI1A 3T38A 4OH7A 4RE6A 1JZSA 2AMVA 3HL0A 2R7AA 2GLXA 4RO0A 4AJ2A 1JQEA 1ULZA 3K2IA 1TW3A 1EFVA 4DR7B 1N9KA 1Z7BA 5G3YA 3IURA 3CKKA 2TMGA 3KJEA 2AJDA 2CC2A 2LCQA 3K9FC 1K06A 5EINA 3DXYA 4NX2A 3I2KA 4YQYA 3SY2A 1IB0A 3R40A 1O5MA 2X2OA 5CCMA 4OYLA 4Q01A 5CA0B 1G41A 2CHZA 2VBIA 4Q19A 3QVLA 2BZSA 3PRHA 4E5NA 2O19A 3U0BA 3QTTA 1GNPA 5AENA 3KZNA 3C8DA 4QO7A 2W4QA 3GLSA 5JWOA 1KWKA 3II6X 5AI0A 5KBAA 4QE3A 1JBKA 4ERXA 2HNAA 4F6RA 3L82B 4OL9A 5REQB 3ANNA 3APCA 4JR1A 4QPJC 2ZBPA 3AUUA 3CSUA 4YYZA 3UJNA 4MSUA 4KPFC 1HZZA 1N2CA 4MVJA 3D6HA 3U44B 4ZTBA 1A3CA 1QYCA 4ZYXA 2UZ1B 4NU8X 3HSYA 1RXVA 5HF8A 5M3BA 4G2NA 3PCTA 1YL5A 4EELA 2X5OA 5LM3A 3K9CA 1ZM3A 3MJ4A 3FXAA 4FU0A 4QWMA 3TPFA 3HKDB 4L4UA 1YJXA 3E1GA 2YRFA 5IFLA 1Z88A 2JIZA 3IAUA 2BJHA 1YJBA 3FJOA 3I2YX 5F1PA 1J2TA 3HUDA 2Z8YA 4ANWA 2R9VA 3C5CA 2KM4A 1N5LA 4NULA 4YPVA 3LVQE 4GOOD 4A27A 4WERA 1AC5A 4RVDA 4I6GA 3KCNA 4BTVA 1JG2A 4ZGBA 1XYVA 3OEHD 4MA0A 2OBYA 1Q14A 3WJAA 2GM9A 4G8JA 2IDJA 2O2HA 2QJFA 4ZVKA 2HHCA 3REGA 4RDIA 4QOEA 2J85A 4KX5A 5EJ4A 2G0TA 2IHTA 3G79A 1Z5OA 3W3AH 1RPZA 3VI4B 1W1UA 2LZ0A 3NM5A 3DYVA 2OZEA 2F1RA 4OJQA 1N77A 2GVDC 2WU0A 3WBBA 1IB6A 1OH6A 3OQPA 4MUMA 4Z1MA 4YGYA 4FT2A 1L7DA 3DOFA 5C31A 4FGWA 4ZOBA 2XW6A 3QWAA 5JRJA 4YDSA 4BO5A 3O38A 1JEDA 5AK3A 1UXIA 2GMWA 5IT0A 4I9UA 4C2BA 1LF8A 4JJ4A 1KYTA 1QLHA 1GCOA 1RWNA 2ILTA 4BRWA 2K5UA 4RBNA 1YZUA 4R1UA 1BAPA 4EO4A 4B81A 3WNQA 3GG2A 1OV6A 1NNSA 3LUFA 3HPRA 4B3MB 4UEOA 1CVIA 1WCV1 1X7HA 4JJ7A 5B30A 2B8NA 2VF4X 2HGSA 5B1SA 1OYYA 3U9SA 1IBKB 4RZQA 1G21B 1RLUA 4UREA 1DOZA 2IPLA 2LDXA 1XK6A 2VH2A 4IIJB 1A8IA 4XVRA 3T7EA 2I6SA 3KQSA 2WT9A 4ND1A 3NX4A 4X44A 4C3VA 1QH1B 3NHJA 3QE0A 3OHSX 2P6RA 3DDCA 1EUZA 4MMZB 5TC4A 4WA7A 4LBYA 3UW3A 2I3AA 3DBRB 2H6FA 4GDFA 5JTTA 5CNMA 4GGPA 3LT2A 4FXOA 1PQPA 4XOIA 1GQYA 3QYJA 3QTBA 3GJXC 2J9FB 3MKQB 2VKTA 5A23A 5G3ZA 1R15A 4LHEA 2IYNA 2O3SA 3O3NB 3VKUA 4X8QA 3VMFA 2DYRE 1Z7GA 4N39A 2GEJA 3OMXA 1Y9DA 4JDUA 4P4GA 2ZIVB 2BUGA 3HB0A 3PNLA 5DRTA 4WBNB 1RU3A 4H9GA 3G6KA 2Q4DA 4EQ6B 3S1SA 3KQTA 1AHHA 4JBLA 1O5OA 5HZMA 4TT3D 2H6EA 4GW3A 5LNK1 4KLCA 3H1FA 3VFDA 4M9XA 3L1JA 4OXXA 4BQPA 4WCFC 3QVXA 4M0PA 2VUUA 5A3SA 2VTKA 1OXJA 2BVNA 2YCBA 2JFGA 3FB1A 3A1DA 2IXDA 4MRPA 3EIHA 1CULC 3VNQA 2VBGA 3P9QA 4YV0A 2H59A 2BI4A 2QJWA 1PTJC 4B2LA 3APFA 5K8TA 1NUPA 2Y8EA 3C7KA 5DX0A 4FGZA 2HQRA 3KVYA 1VJDA 3NYQA 4ALNA 4G2VA 4A6XA 4QXAA 4LYEA 3EZFA 4P6VF 4FYKA 3EHEA 1HYGA 3PX3A 3RWOA 3E9EA 2G3YA 1EH5A 2OAEA 3CPSA 5LMUB 1SPBS 4AXXA 4EB6B 4LUNU 1C3OA 4RHUA 4RYDA 4XEUA 3LJ3A 2D0DA 5KU7A 2FPIB 3KKKA 3FDXA 4CQJA 1CZRA 3NXSA 3ZGQA 1HDYA 1C4OA 1TM4E 2VRNA 1F4LA 4HUQB 1YE5A 1T1IA 1RC1A 4GCOA 5TR9A 1ZD8A 3LUAA 3OEWA 3DE1X 3BHIA 3W0LB 4F45A 2HX1A 4AXBA 1F0YA 3HMQA 2ERXA 3PHGA 1JPJA 1P1CA 4ZALA 3O47A 1IHXA 4AMZA 3RUEA 3VYTB 1M0EA 1OA1A 4FR2A 4Q7LA 2QX7A 2RGCA 3FYDA 5KNDH 3NDPA 2GCGA 1YJCA 1P8AA 3RUIA 3GLHA 3SF8B 1THMA 5FTLA 1N2HA 2JD1A 4KQCA 5ENRD 3AR9A 2QL6A 1O95A 1XRMA 3QVTA 4UULA 1AQLA 1H2TC 3OMLA 1KZHA 1DC3A 2OGSA 3MB5A 4C05A 4PLVA 4JOCA 3PDWA 2CBGA 2BKAA 5AVYA 3TZCA 4A82A 3L04A 1OAOC 3LZ6A 2AQ8A 4LAFA 1JNYA 3C3JA 4JB8A 5KHAA 5FO1A 1M2FA 5EHNA 1K63A 5FI5A 1S96A 4AKTA 1ETUA 1D8EA 4UHHA 3FOFC 1T29A 1YR6A 2CWDA 1J20A 1VLJA 2D06A 1MAAA 1GPMA 5A9RA 1S2OA 3T0IA 4PX3A 3C4QA 4Q7MB 3PZ3A 3QU7A 4XVHA 1R0SA 1QH9A 2PQRA 1I2DA 3O84A 2XUOA 1L8QA 1LVUA 4X7MA 2YINC 5LJIA 3A4MA 4GG1A 4LBWA 1XVTA 3NTUA 3E23A 3IOYA 3KU1A 2JHAA 3I04M 3K9HA 1T1EA 2GAAA 4BPBA 2NG1A 5K51A 4AN4A 4WQMA 4GMRA 3GEIA 1XJ0A 1ZD2P 5H7PA 1A1VA 4C9BB 4RF5A 2DQZA 1KQPA 1UOOA 2GZDA 4RKQA 1RKVA 1XTQA 2A59A 5LWQA 1U7UA 1Y8RA 3HG7A 2GFIA 1RMQA 3COPA 1ZIDA 2HIHA 1RWWA 3B3AA 1EX9A 3UTCA 2BGMA 2PUVA 2BLLA 1X8LA 4HG2A 1WXEA 5I45A 1PWZA 2O1EA 4EYOA 1QCCA 5C37A 4RZSA 1YS9A 2HJVA 2Q6VA 5AJTA 5KSYA 3SR3A 2XXAA 2GZ2A 1O1SA 2C2GA 3KAKA 3GUVA 1TMGE 4WXPA 1PE0A 4OHCA 3BA6A 1LCIA 1ZU4A 3EC7A 5HIAA 3RW9A 2WJGA 3BSFA 3TX2A 2HA4A 1UM9A 5DYNA 5KQGA 3VAZA 1I7NA 3O1LA 3AI7A 4ES6A 5HMMA 1YK1A 4PZUA 1X7YA 4EG0A 2QLJA 2Q1TA 4AMGA 2J5RA 2IHBA 3BC1A 2XH8A 1QRTA 2ZB8A 4L7TA 2XUGA 3FTNA 1MEJA 1E9VA 1B74A 4DXAA 2V97A 1Q1AA 3GMTA 3UQYS 1EFHA 4WT7A 4Y2SA 4BTBA 1MB9A 2V5VA 2FSPA 4NJEA 5F9FA 1U0TA 2CFRA 3NH9A 2ZETA 4B0PA 1FSZA 4HN4B 1SXJE 4AVYA 1HX7A 4QEDA 1IMOA 2ZJ8A 4TL8A 3C4JA 1Z63A 2EQXA 1ZVVA 3EXG1 2QTVB 1WX1A 1AQIA 2A0FA 1JDBC 3BIJA 4IHAA 4DJDC 3G17A 4Y2PA 2HBYA 4E5YA 4DV3B 4QVIA 3MTDA 4MXDA 2EBHX 1V39A 3QOWA 3L79A 4YJ2A 1NVBA 2QROA 2YWBA 4BNGA 2EXXA 1WMDA 3ELUA 5BR8B 2XZDG 3C16C 3UTDA 1HWYA 3AP2A 1TW2A 3M3PA 5F2EA 8MHTA 3OJWA 2ZJAA 2DWZA 4ZQGA 3MV2B 2ASVA 4D5EA 3ICQB 3KAJA 1SVIA 4CR8A 3IUSA 1TNYA 3R4VA 3BTUA 4WLVA 2WM9A 2J33A 3ELDA 1NF9A 2HSDA 5JAPA 1SVXA 1NAIA 2WD8A 3APDA 3CUVA 3LYUA 2W43A 2PL2A 4K2AA 2J9YB 5A3QA 3LO5A 2FW7A 2WOOA 2J45A 3FU3A 1DRKA 1KHHA 3U37A 1PJ4A 4YJFA 3LJNA 4LG6A 2LWIA 5IW8A 2IPXA 4ZRMA 3SF0A 4MS1B 2FDXA 2I8AA 1V1JA 4U8HA 4LC1A 1YC2A 4R81A 1XI2A 1FC0A 3DMPA 5DXJA 3ZU6A 5J3JA 4RNDB 5DM70 3VUEA 4EGQA 5CNKA 2QMEA 1CLUA 4WD3A 5KYYB 1C9NA 2YNMD 1WIWA 4E5PA 2W2XA 1W2GA 2QL9A 1N6LA 2GEUA 3AR5A 2JF0A 3AEXA 4MVCA 3K6SB 1Q0TA 4LOLA 3L3BA 1C3XA 4PYQA 2WAYA 1NT2A 2PZJA 5EJ7A 4A8JC 3AH8A 3I4GA 2GYYA 1T2FA 1Z0IA 4D02A 3U5TA 4IS3A 4D4KA 2EKBA 2OAGA 3HJTA 4QSMA 1PC2A 1GU7A 1VJGA 4ESEA 2BDTA 3H11B 2ZYVX 2I1QA 4DVGA 3I83A 4DA0A 4OSPA 5LL6P 3ZWDA 3K4PA 3UNXA 5HKBA 4F3YA 4JUCA 2CLCX 1P44A 3B51X 2ATXA 4JJGA 4QUAA 2WB2A 3ROEA 1U7ZA 4J91A 4FZRA 5TMBA 1WU7A 4GM1A 2OD7A 4ZOLF 4L1KA 3MT8A 4TYYA 2I2BA 2AIRA 3OKAA 3K7EA 3PDIB 2I4TA 1BD8A 1SHKA 4TVSA 3B95A 5I5EA 4UUPA 3QMWA 1ESMA 3LVFO 2AW3A 1OQAA 2FK8A 2BKGA 1UWKA 4YRKA 1BJTA 4F2PA 3MTEA 3EGDB 4ROTA 1DIHA 2YICA 4PZEA 1XVIA 3U9WA 1L7OA 4RM2A 2YYZA 4L22A 1C7IA 3T1TA 2A9VA 1G4HA 1SA5A 3JARB 5A6CA 1YMVA 1JCQA 3KKOA 3B9PA 3DKRA 2KYRA 1DIGA 5K99A 4B6EA 2VAMA 1UJMA 5B55A 2HBRA 1TPZA 3FJYA 3A06A 4KPUB 2DQYA 4NEHB 1ECLA 4BKRA 4B3SB 4C7OA 2NV2B 1BN7A 1RWXA 3G2KA 3DPUA 5SZJA 2HEIA 2IS4A 1VECA 3UMRA 2GPNA 3U3ZA 3WXMA 3EWIA 4QSHA 2NSJA 4DILA 4F3NA 2IYWA 1KXJA 1NJ1A 2UVPA 3E4BA 2WQHA 2RGRA 3IIIA 3WBKA 3UB4A 4X94A 3C3KA 1WCWA 1BXGA 2JIZD 3I42A 1RWPA 4H15A 4CM6A 4HPXB 3VPAA 5I7VA 4JEMA 2PH1A 4O2AB 1AKEA 4Z5XA 4Q4JA 4C06A 1SOWA 5C5DA 1M0WA 2Y2UA 1VSVA 4ZZIA 4ZI7F 4YP6A 1ZGJA 5HI7A 4CR7A 1XD9A 1C8BA 3O95A 4UU1A 2DFTA 3PFKA 4B8YA 3AINA 3NBYC 1J49A 4A10A 3N76A 3CU5A 3ZVNA 4XEIG 1P4JA 3N9IA 2IPOA 4ZOAA 1HQKA 2GJ4A 4LEUA 2SCUB 2VNSA 1KMQA 1OUVA 1EYHA 4EDFA 1UDBA 2AR0A 4NBWA 4HGPA 4CXMA 3TZBA 4QUEA 3U1VA 1JLKA 1YRHA 4Z1MD 3PJRA 3WLPA 3ISMC 4YVOA 3PVSA 1U2SA 1O9HA 1HO8A 3M6LA 5C34B 3DDUA 1SXJA 3A7DA 3R8FA 3SXUB 3NDIA 2BSXA 1K2VN 3U4HA 4DUGA 3QU4A 4BVLA 4XPIB 1G98A 2GF9A 3P9NA 1M0TA 2PG3A 1SQMA 2WFLA 1I94B 1ZVJA 3LDAA 5LUBA 1E7SA 2J3MA 1Y1PA 3H2KA 1HBJA 3DF7A 3CK9A 3H04A 2DVWA 3CRMA 1P7WA 3QOFA 4TKZA 1Q3TA 2CGEA 3L01A 5L7WA 2H8KA 2PM6A 3FAZA 5LDGA 1PEKE 4QO8A 3O6VA 2LV8A 2PJUA 2H1OA 4FGJA 2J9GA 4XCVA 4ZZ2A 2F1IA 3I3SR 3WGNA 1EXWA 3Q7IA 3EPLA 4RIFA 4DCOA 5HKOA 4GWGA 3TTUA 4PHGA 3WGHA 5FWYB 5B1IA 3HUFA 3SICE 3QKTA 3ZYLA 2PWBA 3WLKX 3VTKA 3GT3A 4WKPA 4INJA 4BWYA 1D8AA 3P2MA 2IU0A 1QP0A 5LZ5A 3WL4A 3RC2A 4JYCA 3HXLA 1KDRA 4QQRA 4W6QA 1XOIA 3CLTC 2HBZA 3K30A 3AY6A 3WYEA 5KJKA 2ZWAA 4PHFA 2DOKA 4O29A 1XTIA 2BN4A 3BG0B 2P0EA 5MGNA 5JPCA 3L07A 4OHWA 4E7OA 1SK9A 1JLHA 2IZ7A 4AI6A 1CUGA 2JB9A 1VZ2A 3I62A 3IRUA 4LZJA 3T12A 4IRUB 1INZA 4XFDA 3KB6A 2GROB 3B1XA 1L5SA 3IAHA 4LVUA 4LOJA 2GBLC 3OT5A 4ZQCB 5DHQA 3WMXA 2QQEA 3EVTA 3MX3A 2QU7A 3X1WA 1ATZA 1JJBA 1U2PA 1NN5A 5EY5B 1PJTA 2EGHA 4ALIA 4N4AA 3AKEA 4GNKA 1HE5A 1Z7EA 1VGQA 3RREA 3ENNA 5PGMA 3T4PA 2A8YA 5G4KA 3VKHA 1RRKA 2O8EA 1VKHA 4CTNA 1PI3A 3STUA 5K3FA 3ZJ4A 5L4SA 3M4YA 2FI7A 1IZYA 4PLPA 3P71T 3WL7A 3HM2A 1R3DA 1K08A 5IXSA 1F0NA 2E87A 2RI1A 3OPQA 3AB8A 2G71A 3UUXA 3ANSA 1J39A 1XKTA 1ZICA 2ZE5A 4GZ3A 4HSGA 5K4GA 1Y48E 5BXOA 2YRXA 3G85A 3MLAA 4ZI5A 1TQ4A 3AEQA 4C20A 4NBTA 2LD4A 4Q9IA 2X14A 4AY3A 4KAAA 2GQ0A 1O6BA 1NL4A 1Z3IX 3D9QX 1RHRA 1QZ3A 1SU4A 3ONNA 1E18A 1VYTA 4FFWA 5JS2A 1DRJA 4V1CB 5FL3A 2JGIA 4YRQA 4PZZA 1MT0A 2ZJ6A 4J07A 3PYXA 2J9QA 5KUTA 1SZAA 1GNTA 3H8JA 2IBTA 1WW8A 2ZK7A 1AB5A 5KNBH 2DWCA 3FHOA 1OLXA 3FROA 1M2OA 4ZT2A 1C50A 3E8MA 3P20A 4QBIA 1O95D 3LQ1A 4XUCA 4W1PA 5KJCA 2OM6A 2IHYA 4L9PA 1VIDA 3ASGA 3BQOA 2LKDA 2P9GA 3H19A 5GIOE 5CXXA 4QAJA 2QLTA 3LD9A 1M1YB 3PG5A 1Q0QA 1NW8A 3F71A 3O48A 3QVKA 4BZZA 1EFCA 1M2KA 3UMSA 2VHXA 3TUZC 4GYWA 2FUG6 2XMBA 2IHNA 3LCRA 4QLOA 4MV0A 4AWXA 4YNBA 4DYVA 4NBRA 5E4FA 5K0FA 2HDWA 3R7NA 4OCZA 2HMSA 2FPRA 2QTFA 1MC1A 3FWYA 3GLIE 3V1NA 2G63A 2AYZA 1EP3B 1Z8NA 3BWYA 4HPJB 5T4YA 3DVAA 2PUWA 1GKIA 3LIIA 3QARA 4EZLA 4JD2G 1X3LA 2WF6A 3D6VA 5EERA 4FZVA 2XZDA 4OUDA 3LJKA 5F76A 4J7XA 4ISBA 1GGJA 1JQ5A 3ANMA 1I1QB 2VJOA 5ABPA 1T24A 1Y8QB 3ESAA 5GZ3A 5ENNA 4JU9A 3QXGA 3GOQA 3WFJA 4PYIA 5K8CA 5BMVF 2HB6A 4RVOA 3OPNA 2A3RA 4QU9A 2BE7A 2E4VA 3PRZA 4COKA 5BQ3A 2SNIE 4OAUC 4E11A 4G0WA 2H4JA 3AR2A 3CW2A 1GOTA 3I34X 1QGZA 2BEDA 2G28A 2GPJA 4YTEA 1KDZA 1PKXA 5THXA 1KQ3A 3FTQA 3QVGB 3JWEA 5AN8A 2YL2A 2CW5A 1FP2A 2Z5FA 5DBOA 2FP4B 1OWOA 1RW2A 1YQQA 2O0KA 1E5DA 1BFUA 2IY9A 3WL5A 4FZ3A 4TV8A 2GPTA 3E9DA 1JT9A 5ECWA 5KSPA 1E9FA 1YB4A 2FWNA 3D4OA 2ZUTA 4AW9A 2BGNA 1A2KC 1YL7A 1OHHD 4RGYA 1KVUA 2ZRPA 2GRUA 2HIGA 2C31A 3SR0A 1ZD1A 5CDFE 3B2QA 3BD9A 2K7FA 2PX3A 1KMHB 2PZBA 3TYXA 1A2BA 2GRMA 3NW9A 4MA5A 2Z9DA 4HAUA 5IDYA 2YHEA 4JKYA 1FMJA 1DAIA 4B45A 5AKYA 5GP1A 3IBFA 2HXSA 1J00A 1EVKA 1Q6ZA 3PJGA 5I48A 1PS0A 3F97A 2FWBA 3KUXA