2GRPB

Crystal structure of human rangap1-ubc9-y87a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
157
structure length
157
Chain Sequence
PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 I
total genus 56
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grpB00
1KPSB 2GRPB 2GRNB 2GROB 3UIOC 2GRRB 2GRQB 2IY0C 3UINC 3UIPC 2IO2C 2IO3C 1Z5SC 5D2MC
chains in the Genus database with same CATH superfamily
4JPSA 2XZTG 5B3SE 2XGMA 3VLDA 3NAWA 4L1BA 4K03A 1SVXA 3L08A 5FWQA 4AP2A 4EBAG 4N3BA 5KWDA 4J8YA 1UN8A 4G23A 3LKUA 4K5CA 1N95A 2KC7A 3CVNA 4APOA 4UQZA 2GW1A 1K3ZD 2R02A 4Q69A 3I4RB 2QC9A 4GPKA 1DCQA 5BT1A 1UW4B 1FPPA 3LDZA 2DYRE 1BPOA 4DRXE 2V5QC 4TUUA 3ZW3A 3JQ0A 2EILE 3NF1A 5A23A 1K1AA 3SY2A 4CT0A 4TXRA 4DX6D 3TXNA 1E8ZA 2F8YA 2E0IA 3QKYA 3UUXA 3L6AA 1H2UA 3MX3A 2GRPB 1O5MA 4AVXA 3JUIA 3LJ3A 1HG5A 2P9UG 2IO2C 4H7YA 1NA3A 2WPVA 4JZYA 4XX5A 4HOUA 2ZU6B 4WWNA 2DZOA 1ELRA 3QNKA 2GRLA 3KD7A 3FDHA 2FULA 1TJFA 3MYVA 3RK6A 2VTBA 4CGVA 4CCAA 5BV1A 4IYPA 4GB9A 3FTZA 4HBDA 1IHGA 5D0QD 3Q9UC 5LCWC 3W9FA 5LP0A 3T9KA 4HVBA 3C3QA 4I2WA 4LUNU 3UKUG 3RAUA 4LCTA 3LY8A 4HLLA 4HOQA 4C48B 5DBKA 1HF8A 3TGOA 3ASOE 4BSXA 4AM9A 2KBXA 1Z5SC 5BXOA 5EILA 5ARGA 2KZTA 1JCRA 3G2VA 5BPPA 4CGWA 3JXIA 3KSQA 3EJNA 4ILGA 2NXPA 5ENPD 1FVHA 1DC2A 2V4LA 5AN8A 5LFAA 2KCLA 3RJVA 2FO7A 3ZUVB 2GRMA 4IN3B 3Q47B 4FJZA 4WAFA 1WM5A 4U0SA 4OAVB 3TWWA 4GZ3A 2I2OA 2IQCA 4UWKA 3HG0D 3DRAA 1Y8MA 3JUEA 3GZ2A 5B1BE 5C1DA 4K5BA 1Y6IA 3ASNE 3ML8A 5ITZF 2PQRA 3GYZA 5EIDA 3QJZA 5CMYA 3TWXA 5ENSD 4GZDA 4ME2A 3ASGA 4Q96A 1HH8A 5FINA 2I9CA 4EHMA 2C0LA 2AXVA 4DX2A 4F1PA 4MLPA 4C0MA 4F53A 4I2ZA 4GMRA 3EDTB 3ASHA 1BI7B 1HFAA 2P9NG 5CCLA 4GMJA 2WQHA 3LYAA 2BTDA 5AENA 2MRIA 3FUNA 2J09A 4ZFHA 2R59A 3FH7A 1MX4A 2CG3A 3C3OA 3DEOA 2I1KA 2WXNA 4Y6WA 2XPZA 3BEEA 4BSZB 1HZ4A 5BUZA 4WWPA 3RRMB 4EQFA 3T8MA 3JYSA 4XI0A 2DZNA 4F6RD 3HXFA 4U8YD 2MYOA 4X8QA 2IONA 2H6FA 5EYLA 3ASFA 4HI8A 4F7AA 3DEPA 1O1SA 3J5PA 2RD0A 2P9SG 4GYOA 2GGFA 2DIWA 2WMOA 4LNBA 3AS5A 3LXUX 5HRYA 3SHFA 1B89A 4I6EA 4OYSA 4A1GA 3CQCB 1PC2A 5KBAA 2J49A 1S63A 3D9MA 4KXKB 4FP7A 3JQ1A 2PQNA 3DSUA 5ANLA 1N52A 3FH5A 3DPYA 1MQSA 4Z68A 1OT8A 3QAQA 1ELWA 2Q7FA 3T8KA 1WG0A 3QWPA 4N2QA 3VLEA 2KCKA 3FU6A 3I4GA 4BTAA 3BU8A 5ENNA 3MKRA 2XGOA 3ZYQA 1OWLA 4YDWA 3FTUA 4EZJA 1H6PA 4GTOA 1SQMA 2V0PA 4CDRA 3T5XA 5AQ7A 4U04A 5JJ6A 2AXZA 2WXIA 4DI4A 2UWJG 3SFZA 4BY6A 1KT0A 2GROB 3S7BA 4BX8A 4O1PA 4ZHBA 2R17C 4HFGA 3WXXA 2L0IA 3ENEA 1SA5A 4FU3A 2ZGDA 2KZTB 3NOGD 1A5EA 3MV2B 2GRNB 3FWVA 3Q78A 5CBNA 2YHEA 1TYQG 4ILHB 3D9NA 4I6JA 2Y4UA 3D9KA 4C0EA 2R03A 4O1OA 4U07A 2UY1B 1NFIE 2EQXA 3AJIA 3EU9A 3CSFA 4KMOA 2OOEA 1TJCA 2BF0X 2VGEA 1MHQA 2FF4A 4ANVA 1X5BA 3FUDA 5ENQD 5E75A 1LTXA 3S7JA 3J5QB 4KVMA 3EHMA 4J8FA 3CHQA 1ELKA 2OVBA 4HQDA 4U95D 4A3TA 1ZBPA 2R05A 2LSUA 4DUIA 1EDUA 1QZ2A 5HQ8A 3RU0A 2IU1A 1JWFA 5HS0A 2GRRB 2WVIA 3DSWA 2LSVA 4KYOB 1N4PA 4HI9A 2ZXWE 3FTSA 2WQ6A 2V8SE 4MKTA 2J07A 2XEHA 4ANXA 5FZRA 1BU9A 3FU3A 3HVEB 3PE3A 2VGXA 3PEUB 5CEAA 1P5QA 2AVPA 4U96D 3P1UA 3E30A 3G2TA 4B93B 5JJ7A 2XQ0A 4GTPA 4AIFA 3LPZA 2AJAA 2WXKA 4A55A 5BXUA 4NRHB 3RSEG 2KATA 4ATGA 3B7BA 4ANUA 5CRUA 3AU5A 1LF8A 3UXGA 3X2QE 3UINC 1EF1C 4UI9J 4DX5D 1TNUA 3PDNA 5HKPA 3CVVA 3U4TA 3ZRHA 1NI1A 2HE0A 3ZFWA 5A6CA 3LCAA 3TG4A 1PAQA 3RRNB 3Q7AA 4WNDA 1TN7A 3S2AA 4FADA 3UI2A 4ABNA 4I1AA 2PL2A 3NZUA 1EYHA 3DSSA 4GZ6A 1BI8B 3ESLA 1BD8A 2FEZA 3OXLA 4G24A 3D9PA 3HXEA 4I17A 1DNPA 4V3IA 3MJWA 4NIKA 3ZNGA 2P2CP 3E33A 3RO3A 5JHAA 5D66A 1WDYA 3PUJA 3VTXA 4FLHA 4N2SA 2I1JA 3SFXA 2X6KA 2X6FA 3CHMA 2FI7A 4JHRA 5AQBA 2ZIRA 5EIBE 3UX4A 3FUEA 1K8KG 5EX3A 4FA6A 4L23A 2FO1E 1TNOA 3CK7A 3SNXA 4ILIA 4JW1A 1RW2A 1AWCB 3OAWA 4G26A 1TN8A 3C72A 5BNWA 1TN6A 4LEUA 5CERB 2UY1A 4ATZD 3APCA 1KPSB 3TWRA 1JCSA 4D10C 4L7TA 4N3AA 1KT1A 5ARFA 1OCOE 4UWGA 3TWQA 4I6GA 5G05J 2FBNA 3DSXA 4TXQA 2P9IG 1OWPA 3B7SA 1SZAA 4BEPA 3CGHA 3C98A 4JD2G 2GRQB 3FTXA 1OY3D 4KZ0A 3S7FA 2J8SD 1NL4A 4CYMD 3OXFA 1H0AA 1G3NB 3TG5A 1JCQA 2WM9A 2EIKE 4JHKA 2QZAA 1VDYA 3UT7A 3CK8A 2ETAA 2NSZA 3UKRG 1BLXB 2XPYA 4J6IA 4O6FA 5T4YA 4NQ0A 4GCOA 3SZ7A 1NP7A 3RO2A 2WXHA 3Q49B 4RLYA 4BWRA 2HYZA 1S0PA 3QB2A 3HIZA 3CVPA 3LJNA 1QBQA 4JA9A 1U2VG 4IULA 5A7DB 3PE4A 2NC9A 4FULA 4GTMA 3DSVA 3KSLA 2XHEA 3KAEA 4ANWA 4QFVA 4BETA 2DVWA 4U8HA 5AARA 2Y0BG 5ENRD 3G2WA 5AQ9A 2KM4A 3CHRA 3CKCA 1OXJA 2NYJA 4UUCA 4OAUC 1QNFA 2X6JA 3E32A 3AS4A 4U0ZA 3D9IA 1H6OA 3ZYKA 1YMPA 4CDNA 1HX8A 3LVQE 5CCMA 1SW6A 3EIJA 1TNYA 1Q2ZA 3AAAC 2CG2A 3Q73A 3KEAA 1TNZA 1UJKA 2KCVA 4PS3A 3HRAA 3UPVA 3PREA 2ILRA 2WXJA 2VSOE 3B13A 4FHKA 5FZSA 1V55E 3CVXA 5G05C 4O60A 4N5CA 4GCNA 2LAHA 4JB8P 2IOLA 3RKVA 1UG3A 2WXRA 2RKKA 2YHCA 3L13A 3OXGA 2YNQA 2XCCA 3FUMA 3EU5A 3V2OA 1SA4A 5FQ4A 2F8XK 2QYJA 5LOZA 4GTVA 1N4QA 3ZN3A 4BESA 2VGXB 4YVOA 3HXBA 3HVEA 4B8AA 1IYGA 1INZA 2H6IA 2WXLA 3FUJA 1IQRA 5JJTA 3D9LA 3E34A 3R7QA 1IXVA 4DI3A 3O48A 3GZ1A 3PVLA 5FQ6A 1YCSB 2CFZA 1FCHA 2L9BA 4FHJA 4RVBA 4W9RA 4YNDA 4FC8A 1JUQA 2J9QA 4GMLA 4GA1A 3MKQB 4PS7A 3NBNB 2WB2A 3NB2A 4YDYA 3FEXA 4AJWA 4GZCA 4Y6CA 5ENTD 2V5FA 3FHEA 4NACA 5J08A 3E37A 1HXIA 4DLOA 5FIOA 1PY1A 1MYOA 1D8DA 2WMNA 4DLQA 3IKOB 3FULA 2L6BA 2L6JA 4HS2A 4G1TA 2LUHA 4GTQA 1ZB1A 3NZSA 1O1RA 3Q75A 3FTYA 1X81A 2RFMA 2M63A 1UOHA 3PS6A 1S70B 1HE8A 4I43A 4WNEA 4OVVA 3Q15A 3TWUA 5E76A 4K0RA 1N0RA 2HR2A 4PUCA 5CEDB 4UWHA 2DYSE 3UIPC 3K9IA 4AEZC 4M7CA 5JMND 3CLJA 4BX9A 1N11A 3LEWA 3FH8A 2BEDA 3ASDA 3FU5A 3FY4A 2BKGA 2XRZA 2PM6A 3PZDA 4XZ4A 3HDXA 1MZCA 3QWWA 3Q9NC 3Q7FA 3SBSA 2JLBA 3Q79A 3CQGB 3MZLB 4AY6A 1E7VA 2A4ZA 1K1BA 3UM2A 2IEJA 4N3CA 3MCXA 4LRZA 1E96B 3UT4A 4BT9A 3ZPJA 4GPMA 4XEIG 4AXHA 3EUVA 3PRZA 2LNIA 3ZXPA 5BV0A 4GZ5A 3ONLA 4KBQA 1DVPA 3TWTA 1W3BA 4JL0A 4U8VD 1N0QA 2XS1A 1LD7A 3CHPA 3MEKA 4EBAA 2F37A 1U3CA 3R9MA 4E85A 2CFUA 3IHVA 3PUKA 1IHBA 2JABA 5LX8A 2WXGA 1ZU2A 1E8XA 4RSYA 2Y1LE 1YYHA 2WXQA 3Q4AB 1D9SA 3PH0C 2VJ8A 5EDSA 2CHWA 2J08A 4UI9K 5FJYA 4APFA 2P9LG 4BERA 2X6HA 4XKBA 3DWLG 4HRMB 4UI9C 5AIJA 3MA5A 4YDOA 2XS8A 4YVQC 3B95A 3HHMA 3ULQA 5CBOA 4JVSA 5DIZA 2CHZA 3FUHA 2VSNA 1TEZA 4KVOA 3R9AB 5KNGA 2MOWA 5G55A 5KJKA 2VQ2A 3AG2E 2BUGA 4G11A 5M72A 4PH4B 3ML9A 3PZ2A 1HU3A 4LG6A 5JHBA 2H6GA 5FT9A 4XIFA 4J8SA 3FUFA 2IF4A 4XKCA 2XGSA 5H7PA 3L22A 3ZYLA 3FP3A 2X3MA 5D2MC 2ZGGA 2EINE 2XEEA 2Y4TA 5ENOD 4UWLA 2DBAA 1OCZE 3BG0B 3HXDA 3AS8A 1HS6A 3SBTB 1Z3XA 4GTTA 4K5AB 2PNNA 4EZKA 3V30A 2CHXA 2LXMA 2QFCA 4JEUA 5KJNA 2YQ8A 4J8DA 3DPDA 3MGBA 3N71A 2OEWA 3APFA 3D9JA 3VLFA 1DCEA 3QOUA 1XNFA 3O4ZA 3UM3A 3GZSA 3UQ3A 1OUVA 3MV3B 4RG9A 5FQ8A 3ABLE 1UN9A 3U9WA 2AXUA 1JPLA 4RG6A 5ANRA 3CSTA 4EECA 4TV3A 4HNAD 3U64A 1XGWA 3QDNA 3JXJA 3TL5A 2LXLA 3AG4E 1OCRE 2IY0C 3W9GA 4GA0A 3SF4A 4JC8A 4LNGA 4E6HA 1WAO1 3IHYA 3SI5A 2XEVA 1NZNA 5EYPF 2WXPA 1E7UA 1E8YA 3QK0A 3UIOC 2V4HC 3EHQA 4TXPA 4J0UA 2ONDA 3DXMG 3V2XA 4GTSA 3QARA 4HRLA 2R2LA 3B7TA 2RG8A 4XI9A 2QY7A 3UTMA 2OV8A 1FT1A 2AW6A 4CZ2D 1HG2A 3CVQA 5AJDA 3GW4A 3ZHEB 1JWGA 1S64A 4UQXA 2ZISA 5FTPA 3PZ3A 3IBEA 2QYUA 4UQYA 3IXEA 3LS8A 3NQPA 1GW6A 2EIME 2P9PG 3BUAA 4J8EA 2EIJE 1OWMA 2RFAA 1H2TC 2DCPA 3SD5A 3CVLA 4GU5A 1N9AA 5EKQD 2YINA 4EZLA 3SQVA 4YDEA 4IRUA 3F6QA 3V31A 4DX7D 1O1TA 4CT4A 5G2NA 3CVUA 3EIQC 3ONKA 5LCWJ 4GAAA 2R5SA 3T5VA 3ABME 5CMWA 3FUIA 2A5UA 5JA4D 2XCBA 1E90A 1H19A 4U7EB 3CHSA 3ISMC 3BQOA 2OEVA 4B94A 1N54A 3PZ4A 4CEMA 4GYWA 2VYIA 1OWOA 4JEHA 3CEQA 4JA7A 4WWOA 3ABKE 3S7DA 5T8IA 3L16A 2XPIA 4I9EA 1QYMA 1H6KA 2LO6A 3MKQA 1TNBA 4KZCA 3FFLA 5KCMA 2OVFA 1KLXA 4MBGA 4I9CA 3ZIMA 3OTNA 1KZOA 4B8CB 3ZXSA 2J4BA 4F1SA 2I6HA 4BT8A 4C9BB 3VTYA 2OCCE 2F0YA 1L5JA 5J90A 3B7UX 2MHKA 3CV0A 3FTVA 5G04J 2H6HA 3FEYA 4DX1A 1Z3YA 5CECB 3SFYA 3RRUA 3ZYMA 4TUMA 4G2VA 3QC1A 3ZVVA 2IO3C 3IEGA 3L17A 4L2YA 1MJ0A 4B89A 1RZ4A 2L0TB 4JXTA 2IOSA 3L9TA 4L9PA 5FQ7A 3TJPA 2J4DA 3ZEFA 2A5EA 2VGYA 1WY6A 4DK5A 4L2LA 3R7RA 3DXKG 2DWZA 3PZ1A 2HO1A 3EHRA 3ZHEA 1TR4A 3D9OA 3BG1B 3G2SA 4HOSA 5B1AE 3UT8A 5T3RA 2PZIA 4GTRA 1A17A 3Q5MA 4QQIA 2KXPC 3UM1A 3HXCA 4DJAA 3UM0A 3AU4A 3CVWA 4CDMA 1OCCE 3L54A 4ACLA 1EPUA 5IY5E 4AY5A 1FVFA 1IKND 1U3DA 3TAXA 4TRQA 1V54E 4CRWA 5KJMA 2XRYA 5CHEE 2Y3AA 4BFRA 5CRVA 4G8LA 5G04C 3B7RL 3FTWA 2IFUA 3LY7A 1QQEA 4M3OA 3UMVA 2WQ7A 3HYMB 4G8KA 3FUKA 2Y69E 4A63B 3U66A 2JEKA 1OWNA 3CVYA 3ZKJA 5C2YA 2WXFA 3ULYA 4FJYA 5HI7A 2X38A 2P9KG 3LY9A 4WUYA 1IQUA 4H7XA 4HB5A 4HRNA 5AQAA 2C0MA 2AWIA 3V79K 3D3MA 4HORA 3AG3E 4R7LA 2X6IA 3I5PA 4N5QA 3CHOA 1MX6A 3TWVA 2B6CA 2LAIA 4HXIA 3EHNA 4RQIA 3IV0A 1HO8A 1N94A 4HOTA 5AAOA 1LD8A 2VSXE 1N4SA 3PNLB 4URKA 2VSYA 4N39A 3KS2A 3SGHA 5FZQA 4MS6A 4ACKA 3D9HA 3CIAA 3TWSA 2PM7A 4LERA 3G2UA 3RIBA 4WNFA 2E2EA 5EN5D 3KEZA 4NURA 4GYYA 3NOCD 3CR3A 4HLEA 4PDXA 1YA0A 4GA2A 3AG1E 4U63A 4WNGA 4LNUD 1KZPA 4U0UA 5AYWD 2IJGX 5AJLA 5KJLA 3ZU7B 5EX0A 4A1SA 5BW8C 4J7WA 3SO8A 4XE0A 1FT2A 3C5RA 3DBSA 2XENA 4LSZE 4AV7A 3ZGQA 2ETBA 3ESKA 2BKKB 3P2BA 4UWFA 1D8EA 2WXOA 1MX2A 4AOFA 1AP7A 2B0OE 2WXMA 4KT6B 3ULEG 4I1MA 1N4RA 4FLBA 1SZ9A 5D0OD 3C3RA 3DSTA 3LVRE 3WG7E 3CKBA 4DPRA 3URZA 3I3NA 4I1OB 1UJJA 4P29A 2XZDG 4MRUA 4EPZA 3L82A 3PEVB 4A3VA 3JCKC 3CK9A 3QWVA 4F3VA 5KNHD 1H2VC 3APDA 2VTBB 2ETCA 2HM8A 4PS8A 4Q94A 4JHJA 3U3WA 4OVUA 4B0ZA 3E4BA 1NA0A 3FU0A 2P58C 4G25A 1E8WA 2C2LA 3TXMA 4BTBA 1Z6TA 3PNTB
chains in the Genus database with same CATH topology
1KPSB 2GRPB 2GRNB 2GROB 3UIOC 2GRRB 2GRQB 2IY0C 3UINC 3UIPC 2IO2C 2IO3C 1Z5SC 5D2MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KPS B;  2GRP B;  2GRN B;  2GRO B;  3UIO C;  2GRR B;  2GRQ B;  2IY0 C;  3UIN C;  3UIP C;  2IO2 C;  2IO3 C;  1Z5S C;  5D2M C; 
#chains in the Genus database with same CATH topology
 4JPS A;  2XZT G;  5B3S E;  2XGM A;  3VLD A;  3NAW A;  4L1B A;  4K03 A;  1SVX A;  3L08 A;  5FWQ A;  4AP2 A;  4EBA G;  4N3B A;  5KWD A;  4J8Y A;  1UN8 A;  4G23 A;  3LKU A;  4K5C A;  1N95 A;  2KC7 A;  3CVN A;  4APO A;  4UQZ A;  2GW1 A;  1K3Z D;  2R02 A;  4Q69 A;  3I4R B;  2QC9 A;  4GPK A;  1DCQ A;  5BT1 A;  1UW4 B;  1FPP A;  3LDZ A;  2DYR E;  1BPO A;  4DRX E;  2V5Q C;  4TUU A;  3ZW3 A;  3JQ0 A;  2EIL E;  3NF1 A;  5A23 A;  1K1A A;  3SY2 A;  4CT0 A;  4TXR A;  4DX6 D;  3TXN A;  1E8Z A;  2F8Y A;  2E0I A;  3QKY A;  3UUX A;  3L6A A;  1H2U A;  3MX3 A;  2GRP B;  1O5M A;  4AVX A;  3JUI A;  3LJ3 A;  1HG5 A;  2P9U G;  2IO2 C;  4H7Y A;  1NA3 A;  2WPV A;  4JZY A;  4XX5 A;  4HOU A;  2ZU6 B;  4WWN A;  2DZO A;  1ELR A;  3QNK A;  2GRL A;  3KD7 A;  3FDH A;  2FUL A;  1TJF A;  3MYV A;  3RK6 A;  2VTB A;  4CGV A;  4CCA A;  5BV1 A;  4IYP A;  4GB9 A;  3FTZ A;  4HBD A;  1IHG A;  5D0Q D;  3Q9U C;  5LCW C;  3W9F A;  5LP0 A;  3T9K A;  4HVB A;  3C3Q A;  4I2W A;  4LUN U;  3UKU G;  3RAU A;  4LCT A;  3LY8 A;  4HLL A;  4HOQ A;  4C48 B;  5DBK A;  1HF8 A;  3TGO A;  3ASO E;  4BSX A;  4AM9 A;  2KBX A;  1Z5S C;  5BXO A;  5EIL A;  5ARG A;  2KZT A;  1JCR A;  3G2V A;  5BPP A;  4CGW A;  3JXI A;  3KSQ A;  3EJN A;  4ILG A;  2NXP A;  5ENP D;  1FVH A;  1DC2 A;  2V4L A;  5AN8 A;  5LFA A;  2KCL A;  3RJV A;  2FO7 A;  3ZUV B;  2GRM A;  4IN3 B;  3Q47 B;  4FJZ A;  4WAF A;  1WM5 A;  4U0S A;  4OAV B;  3TWW A;  4GZ3 A;  2I2O A;  2IQC A;  4UWK A;  3HG0 D;  3DRA A;  1Y8M A;  3JUE A;  3GZ2 A;  5B1B E;  5C1D A;  4K5B A;  1Y6I A;  3ASN E;  3ML8 A;  5ITZ F;  2PQR A;  3GYZ A;  5EID A;  3QJZ A;  5CMY A;  3TWX A;  5ENS D;  4GZD A;  4ME2 A;  3ASG A;  4Q96 A;  1HH8 A;  5FIN A;  2I9C A;  4EHM A;  2C0L A;  2AXV A;  4DX2 A;  4F1P A;  4MLP A;  4C0M A;  4F53 A;  4I2Z A;  4GMR A;  3EDT B;  3ASH A;  1BI7 B;  1HFA A;  2P9N G;  5CCL A;  4GMJ A;  2WQH A;  3LYA A;  2BTD A;  5AEN A;  2MRI A;  3FUN A;  2J09 A;  4ZFH A;  2R59 A;  3FH7 A;  1MX4 A;  2CG3 A;  3C3O A;  3DEO A;  2I1K A;  2WXN A;  4Y6W A;  2XPZ A;  3BEE A;  4BSZ B;  1HZ4 A;  5BUZ A;  4WWP A;  3RRM B;  4EQF A;  3T8M A;  3JYS A;  4XI0 A;  2DZN A;  4F6R D;  3HXF A;  4U8Y D;  2MYO A;  4X8Q A;  2ION A;  2H6F A;  5EYL A;  3ASF A;  4HI8 A;  4F7A A;  3DEP A;  1O1S A;  3J5P A;  2RD0 A;  2P9S G;  4GYO A;  2GGF A;  2DIW A;  2WMO A;  4LNB A;  3AS5 A;  3LXU X;  5HRY A;  3SHF A;  1B89 A;  4I6E A;  4OYS A;  4A1G A;  3CQC B;  1PC2 A;  5KBA A;  2J49 A;  1S63 A;  3D9M A;  4KXK B;  4FP7 A;  3JQ1 A;  2PQN A;  3DSU A;  5ANL A;  1N52 A;  3FH5 A;  3DPY A;  1MQS A;  4Z68 A;  1OT8 A;  3QAQ A;  1ELW A;  2Q7F A;  3T8K A;  1WG0 A;  3QWP A;  4N2Q A;  3VLE A;  2KCK A;  3FU6 A;  3I4G A;  4BTA A;  3BU8 A;  5ENN A;  3MKR A;  2XGO A;  3ZYQ A;  1OWL A;  4YDW A;  3FTU A;  4EZJ A;  1H6P A;  4GTO A;  1SQM A;  2V0P A;  4CDR A;  3T5X A;  5AQ7 A;  4U04 A;  5JJ6 A;  2AXZ A;  2WXI A;  4DI4 A;  2UWJ G;  3SFZ A;  4BY6 A;  1KT0 A;  2GRO B;  3S7B A;  4BX8 A;  4O1P A;  4ZHB A;  2R17 C;  4HFG A;  3WXX A;  2L0I A;  3ENE A;  1SA5 A;  4FU3 A;  2ZGD A;  2KZT B;  3NOG D;  1A5E A;  3MV2 B;  2GRN B;  3FWV A;  3Q78 A;  5CBN A;  2YHE A;  1TYQ G;  4ILH B;  3D9N A;  4I6J A;  2Y4U A;  3D9K A;  4C0E A;  2R03 A;  4O1O A;  4U07 A;  2UY1 B;  1NFI E;  2EQX A;  3AJI A;  3EU9 A;  3CSF A;  4KMO A;  2OOE A;  1TJC A;  2BF0 X;  2VGE A;  1MHQ A;  2FF4 A;  4ANV A;  1X5B A;  3FUD A;  5ENQ D;  5E75 A;  1LTX A;  3S7J A;  3J5Q B;  4KVM A;  3EHM A;  4J8F A;  3CHQ A;  1ELK A;  2OVB A;  4HQD A;  4U95 D;  4A3T A;  1ZBP A;  2R05 A;  2LSU A;  4DUI A;  1EDU A;  1QZ2 A;  5HQ8 A;  3RU0 A;  2IU1 A;  1JWF A;  5HS0 A;  2GRR B;  2WVI A;  3DSW A;  2LSV A;  4KYO B;  1N4P A;  4HI9 A;  2ZXW E;  3FTS A;  2WQ6 A;  2V8S E;  4MKT A;  2J07 A;  2XEH A;  4ANX A;  5FZR A;  1BU9 A;  3FU3 A;  3HVE B;  3PE3 A;  2VGX A;  3PEU B;  5CEA A;  1P5Q A;  2AVP A;  4U96 D;  3P1U A;  3E30 A;  3G2T A;  4B93 B;  5JJ7 A;  2XQ0 A;  4GTP A;  4AIF A;  3LPZ A;  2AJA A;  2WXK A;  4A55 A;  5BXU A;  4NRH B;  3RSE G;  2KAT A;  4ATG A;  3B7B A;  4ANU A;  5CRU A;  3AU5 A;  1LF8 A;  3UXG A;  3X2Q E;  3UIN C;  1EF1 C;  4UI9 J;  4DX5 D;  1TNU A;  3PDN A;  5HKP A;  3CVV A;  3U4T A;  3ZRH A;  1NI1 A;  2HE0 A;  3ZFW A;  5A6C A;  3LCA A;  3TG4 A;  1PAQ A;  3RRN B;  3Q7A A;  4WND A;  1TN7 A;  3S2A A;  4FAD A;  3UI2 A;  4ABN A;  4I1A A;  2PL2 A;  3NZU A;  1EYH A;  3DSS A;  4GZ6 A;  1BI8 B;  3ESL A;  1BD8 A;  2FEZ A;  3OXL A;  4G24 A;  3D9P A;  3HXE A;  4I17 A;  1DNP A;  4V3I A;  3MJW A;  4NIK A;  3ZNG A;  2P2C P;  3E33 A;  3RO3 A;  5JHA A;  5D66 A;  1WDY A;  3PUJ A;  3VTX A;  4FLH A;  4N2S A;  2I1J A;  3SFX A;  2X6K A;  2X6F A;  3CHM A;  2FI7 A;  4JHR A;  5AQB A;  2ZIR A;  5EIB E;  3UX4 A;  3FUE A;  1K8K G;  5EX3 A;  4FA6 A;  4L23 A;  2FO1 E;  1TNO A;  3CK7 A;  3SNX A;  4ILI A;  4JW1 A;  1RW2 A;  1AWC B;  3OAW A;  4G26 A;  1TN8 A;  3C72 A;  5BNW A;  1TN6 A;  4LEU A;  5CER B;  2UY1 A;  4ATZ D;  3APC A;  1KPS B;  3TWR A;  1JCS A;  4D10 C;  4L7T A;  4N3A A;  1KT1 A;  5ARF A;  1OCO E;  4UWG A;  3TWQ A;  4I6G A;  5G05 J;  2FBN A;  3DSX A;  4TXQ A;  2P9I G;  1OWP A;  3B7S A;  1SZA A;  4BEP A;  3CGH A;  3C98 A;  4JD2 G;  2GRQ B;  3FTX A;  1OY3 D;  4KZ0 A;  3S7F A;  2J8S D;  1NL4 A;  4CYM D;  3OXF A;  1H0A A;  1G3N B;  3TG5 A;  1JCQ A;  2WM9 A;  2EIK E;  4JHK A;  2QZA A;  1VDY A;  3UT7 A;  3CK8 A;  2ETA A;  2NSZ A;  3UKR G;  1BLX B;  2XPY A;  4J6I A;  4O6F A;  5T4Y A;  4NQ0 A;  4GCO A;  3SZ7 A;  1NP7 A;  3RO2 A;  2WXH A;  3Q49 B;  4RLY A;  4BWR A;  2HYZ A;  1S0P A;  3QB2 A;  3HIZ A;  3CVP A;  3LJN A;  1QBQ A;  4JA9 A;  1U2V G;  4IUL A;  5A7D B;  3PE4 A;  2NC9 A;  4FUL A;  4GTM A;  3DSV A;  3KSL A;  2XHE A;  3KAE A;  4ANW A;  4QFV A;  4BET A;  2DVW A;  4U8H A;  5AAR A;  2Y0B G;  5ENR D;  3G2W A;  5AQ9 A;  2KM4 A;  3CHR A;  3CKC A;  1OXJ A;  2NYJ A;  4UUC A;  4OAU C;  1QNF A;  2X6J A;  3E32 A;  3AS4 A;  4U0Z A;  3D9I A;  1H6O A;  3ZYK A;  1YMP A;  4CDN A;  1HX8 A;  3LVQ E;  5CCM A;  1SW6 A;  3EIJ A;  1TNY A;  1Q2Z A;  3AAA C;  2CG2 A;  3Q73 A;  3KEA A;  1TNZ A;  1UJK A;  2KCV A;  4PS3 A;  3HRA A;  3UPV A;  3PRE A;  2ILR A;  2WXJ A;  2VSO E;  3B13 A;  4FHK A;  5FZS A;  1V55 E;  3CVX A;  5G05 C;  4O60 A;  4N5C A;  4GCN A;  2LAH A;  4JB8 P;  2IOL A;  3RKV A;  1UG3 A;  2WXR A;  2RKK A;  2YHC A;  3L13 A;  3OXG A;  2YNQ A;  2XCC A;  3FUM A;  3EU5 A;  3V2O A;  1SA4 A;  5FQ4 A;  2F8X K;  2QYJ A;  5LOZ A;  4GTV A;  1N4Q A;  3ZN3 A;  4BES A;  2VGX B;  4YVO A;  3HXB A;  3HVE A;  4B8A A;  1IYG A;  1INZ A;  2H6I A;  2WXL A;  3FUJ A;  1IQR A;  5JJT A;  3D9L A;  3E34 A;  3R7Q A;  1IXV A;  4DI3 A;  3O48 A;  3GZ1 A;  3PVL A;  5FQ6 A;  1YCS B;  2CFZ A;  1FCH A;  2L9B A;  4FHJ A;  4RVB A;  4W9R A;  4YND A;  4FC8 A;  1JUQ A;  2J9Q A;  4GML A;  4GA1 A;  3MKQ B;  4PS7 A;  3NBN B;  2WB2 A;  3NB2 A;  4YDY A;  3FEX A;  4AJW A;  4GZC A;  4Y6C A;  5ENT D;  2V5F A;  3FHE A;  4NAC A;  5J08 A;  3E37 A;  1HXI A;  4DLO A;  5FIO A;  1PY1 A;  1MYO A;  1D8D A;  2WMN A;  4DLQ A;  3IKO B;  3FUL A;  2L6B A;  2L6J A;  4HS2 A;  4G1T A;  2LUH A;  4GTQ A;  1ZB1 A;  3NZS A;  1O1R A;  3Q75 A;  3FTY A;  1X81 A;  2RFM A;  2M63 A;  1UOH A;  3PS6 A;  1S70 B;  1HE8 A;  4I43 A;  4WNE A;  4OVV A;  3Q15 A;  3TWU A;  5E76 A;  4K0R A;  1N0R A;  2HR2 A;  4PUC A;  5CED B;  4UWH A;  2DYS E;  3UIP C;  3K9I A;  4AEZ C;  4M7C A;  5JMN D;  3CLJ A;  4BX9 A;  1N11 A;  3LEW A;  3FH8 A;  2BED A;  3ASD A;  3FU5 A;  3FY4 A;  2BKG A;  2XRZ A;  2PM6 A;  3PZD A;  4XZ4 A;  3HDX A;  1MZC A;  3QWW A;  3Q9N C;  3Q7F A;  3SBS A;  2JLB A;  3Q79 A;  3CQG B;  3MZL B;  4AY6 A;  1E7V A;  2A4Z A;  1K1B A;  3UM2 A;  2IEJ A;  4N3C A;  3MCX A;  4LRZ A;  1E96 B;  3UT4 A;  4BT9 A;  3ZPJ A;  4GPM A;  4XEI G;  4AXH A;  3EUV A;  3PRZ A;  2LNI A;  3ZXP A;  5BV0 A;  4GZ5 A;  3ONL A;  4KBQ A;  1DVP A;  3TWT A;  1W3B A;  4JL0 A;  4U8V D;  1N0Q A;  2XS1 A;  1LD7 A;  3CHP A;  3MEK A;  4EBA A;  2F37 A;  1U3C A;  3R9M A;  4E85 A;  2CFU A;  3IHV A;  3PUK A;  1IHB A;  2JAB A;  5LX8 A;  2WXG A;  1ZU2 A;  1E8X A;  4RSY A;  2Y1L E;  1YYH A;  2WXQ A;  3Q4A B;  1D9S A;  3PH0 C;  2VJ8 A;  5EDS A;  2CHW A;  2J08 A;  4UI9 K;  5FJY A;  4APF A;  2P9L G;  4BER A;  2X6H A;  4XKB A;  3DWL G;  4HRM B;  4UI9 C;  5AIJ A;  3MA5 A;  4YDO A;  2XS8 A;  4YVQ C;  3B95 A;  3HHM A;  3ULQ A;  5CBO A;  4JVS A;  5DIZ A;  2CHZ A;  3FUH A;  2VSN A;  1TEZ A;  4KVO A;  3R9A B;  5KNG A;  2MOW A;  5G55 A;  5KJK A;  2VQ2 A;  3AG2 E;  2BUG A;  4G11 A;  5M72 A;  4PH4 B;  3ML9 A;  3PZ2 A;  1HU3 A;  4LG6 A;  5JHB A;  2H6G A;  5FT9 A;  4XIF A;  4J8S A;  3FUF A;  2IF4 A;  4XKC A;  2XGS A;  5H7P A;  3L22 A;  3ZYL A;  3FP3 A;  2X3M A;  5D2M C;  2ZGG A;  2EIN E;  2XEE A;  2Y4T A;  5ENO D;  4UWL A;  2DBA A;  1OCZ E;  3BG0 B;  3HXD A;  3AS8 A;  1HS6 A;  3SBT B;  1Z3X A;  4GTT A;  4K5A B;  2PNN A;  4EZK A;  3V30 A;  2CHX A;  2LXM A;  2QFC A;  4JEU A;  5KJN A;  2YQ8 A;  4J8D A;  3DPD A;  3MGB A;  3N71 A;  2OEW A;  3APF A;  3D9J A;  3VLF A;  1DCE A;  3QOU A;  1XNF A;  3O4Z A;  3UM3 A;  3GZS A;  3UQ3 A;  1OUV A;  3MV3 B;  4RG9 A;  5FQ8 A;  3ABL E;  1UN9 A;  3U9W A;  2AXU A;  1JPL A;  4RG6 A;  5ANR A;  3CST A;  4EEC A;  4TV3 A;  4HNA D;  3U64 A;  1XGW A;  3QDN A;  3JXJ A;  3TL5 A;  2LXL A;  3AG4 E;  1OCR E;  2IY0 C;  3W9G A;  4GA0 A;  3SF4 A;  4JC8 A;  4LNG A;  4E6H A;  1WAO 1;  3IHY A;  3SI5 A;  2XEV A;  1NZN A;  5EYP F;  2WXP A;  1E7U A;  1E8Y A;  3QK0 A;  3UIO C;  2V4H C;  3EHQ A;  4TXP A;  4J0U A;  2OND A;  3DXM G;  3V2X A;  4GTS A;  3QAR A;  4HRL A;  2R2L A;  3B7T A;  2RG8 A;  4XI9 A;  2QY7 A;  3UTM A;  2OV8 A;  1FT1 A;  2AW6 A;  4CZ2 D;  1HG2 A;  3CVQ A;  5AJD A;  3GW4 A;  3ZHE B;  1JWG A;  1S64 A;  4UQX A;  2ZIS A;  5FTP A;  3PZ3 A;  3IBE A;  2QYU A;  4UQY A;  3IXE A;  3LS8 A;  3NQP A;  1GW6 A;  2EIM E;  2P9P G;  3BUA A;  4J8E A;  2EIJ E;  1OWM A;  2RFA A;  1H2T C;  2DCP A;  3SD5 A;  3CVL A;  4GU5 A;  1N9A A;  5EKQ D;  2YIN A;  4EZL A;  3SQV A;  4YDE A;  4IRU A;  3F6Q A;  3V31 A;  4DX7 D;  1O1T A;  4CT4 A;  5G2N A;  3CVU A;  3EIQ C;  3ONK A;  5LCW J;  4GAA A;  2R5S A;  3T5V A;  3ABM E;  5CMW A;  3FUI A;  2A5U A;  5JA4 D;  2XCB A;  1E90 A;  1H19 A;  4U7E B;  3CHS A;  3ISM C;  3BQO A;  2OEV A;  4B94 A;  1N54 A;  3PZ4 A;  4CEM A;  4GYW A;  2VYI A;  1OWO A;  4JEH A;  3CEQ A;  4JA7 A;  4WWO A;  3ABK E;  3S7D A;  5T8I A;  3L16 A;  2XPI A;  4I9E A;  1QYM A;  1H6K A;  2LO6 A;  3MKQ A;  1TNB A;  4KZC A;  3FFL A;  5KCM A;  2OVF A;  1KLX A;  4MBG A;  4I9C A;  3ZIM A;  3OTN A;  1KZO A;  4B8C B;  3ZXS A;  2J4B A;  4F1S A;  2I6H A;  4BT8 A;  4C9B B;  3VTY A;  2OCC E;  2F0Y A;  1L5J A;  5J90 A;  3B7U X;  2MHK A;  3CV0 A;  3FTV A;  5G04 J;  2H6H A;  3FEY A;  4DX1 A;  1Z3Y A;  5CEC B;  3SFY A;  3RRU A;  3ZYM A;  4TUM A;  4G2V A;  3QC1 A;  3ZVV A;  2IO3 C;  3IEG A;  3L17 A;  4L2Y A;  1MJ0 A;  4B89 A;  1RZ4 A;  2L0T B;  4JXT A;  2IOS A;  3L9T A;  4L9P A;  5FQ7 A;  3TJP A;  2J4D A;  3ZEF A;  2A5E A;  2VGY A;  1WY6 A;  4DK5 A;  4L2L A;  3R7R A;  3DXK G;  2DWZ A;  3PZ1 A;  2HO1 A;  3EHR A;  3ZHE A;  1TR4 A;  3D9O A;  3BG1 B;  3G2S A;  4HOS A;  5B1A E;  3UT8 A;  5T3R A;  2PZI A;  4GTR A;  1A17 A;  3Q5M A;  4QQI A;  2KXP C;  3UM1 A;  3HXC A;  4DJA A;  3UM0 A;  3AU4 A;  3CVW A;  4CDM A;  1OCC E;  3L54 A;  4ACL A;  1EPU A;  5IY5 E;  4AY5 A;  1FVF A;  1IKN D;  1U3D A;  3TAX A;  4TRQ A;  1V54 E;  4CRW A;  5KJM A;  2XRY A;  5CHE E;  2Y3A A;  4BFR A;  5CRV A;  4G8L A;  5G04 C;  3B7R L;  3FTW A;  2IFU A;  3LY7 A;  1QQE A;  4M3O A;  3UMV A;  2WQ7 A;  3HYM B;  4G8K A;  3FUK A;  2Y69 E;  4A63 B;  3U66 A;  2JEK A;  1OWN A;  3CVY A;  3ZKJ A;  5C2Y A;  2WXF A;  3ULY A;  4FJY A;  5HI7 A;  2X38 A;  2P9K G;  3LY9 A;  4WUY A;  1IQU A;  4H7X A;  4HB5 A;  4HRN A;  5AQA A;  2C0M A;  2AWI A;  3V79 K;  3D3M A;  4HOR A;  3AG3 E;  4R7L A;  2X6I A;  3I5P A;  4N5Q A;  3CHO A;  1MX6 A;  3TWV A;  2B6C A;  2LAI A;  4HXI A;  3EHN A;  4RQI A;  3IV0 A;  1HO8 A;  1N94 A;  4HOT A;  5AAO A;  1LD8 A;  2VSX E;  1N4S A;  3PNL B;  4URK A;  2VSY A;  4N39 A;  3KS2 A;  3SGH A;  5FZQ A;  4MS6 A;  4ACK A;  3D9H A;  3CIA A;  3TWS A;  2PM7 A;  4LER A;  3G2U A;  3RIB A;  4WNF A;  2E2E A;  5EN5 D;  3KEZ A;  4NUR A;  4GYY A;  3NOC D;  3CR3 A;  4HLE A;  4PDX A;  1YA0 A;  4GA2 A;  3AG1 E;  4U63 A;  4WNG A;  4LNU D;  1KZP A;  4U0U A;  5AYW D;  2IJG X;  5AJL A;  5KJL A;  3ZU7 B;  5EX0 A;  4A1S A;  5BW8 C;  4J7W A;  3SO8 A;  4XE0 A;  1FT2 A;  3C5R A;  3DBS A;  2XEN A;  4LSZ E;  4AV7 A;  3ZGQ A;  2ETB A;  3ESK A;  2BKK B;  3P2B A;  4UWF A;  1D8E A;  2WXO A;  1MX2 A;  4AOF A;  1AP7 A;  2B0O E;  2WXM A;  4KT6 B;  3ULE G;  4I1M A;  1N4R A;  4FLB A;  1SZ9 A;  5D0O D;  3C3R A;  3DST A;  3LVR E;  3WG7 E;  3CKB A;  4DPR A;  3URZ A;  3I3N A;  4I1O B;  1UJJ A;  4P29 A;  2XZD G;  4MRU A;  4EPZ A;  3L82 A;  3PEV B;  4A3V A;  3JCK C;  3CK9 A;  3QWV A;  4F3V A;  5KNH D;  1H2V C;  3APD A;  2VTB B;  2ETC A;  2HM8 A;  4PS8 A;  4Q94 A;  4JHJ A;  3U3W A;  4OVU A;  4B0Z A;  3E4B A;  1NA0 A;  3FU0 A;  2P58 C;  4G25 A;  1E8W A;  2C2L A;  3TXM A;  4BTB A;  1Z6T A;  3PNT B; 
#chains in the Genus database with same CATH homology
 1KPS B;  2GRP B;  2GRN B;  2GRO B;  3UIO C;  2GRR B;  2GRQ B;  2IY0 C;  3UIN C;  3UIP C;  2IO2 C;  2IO3 C;  1Z5S C;  5D2M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...