2GRPB

Crystal structure of human rangap1-ubc9-y87a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
157
structure length
157
Chain Sequence
PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 I
total genus 56
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grpB00
2GROB 2GRQB 2IY0C 2GRRB 1Z5SC 2GRPB 2GRNB 1KPSB 3UIPC 5D2MC 2IO2C 3UINC 3UIOC 2IO3C
chains in the Genus database with same CATH superfamily
3RIBA 3ZW3A 5B1AE 3UI2A 4N5QA 1DNPA 4CCAA 3D9HA 3EHQA 2X38A 1OWMA 5ITZF 1NI1A 1S70B 3ASOE 1LF8A 4GMLA 2GGFA 2P9KG 3S7FA 3TWVA 2ETBA 2V5QC 4YVQC 4CDMA 2NXPA 3CHQA 1FCHA 2B6CA 3LY9A 3QDNA 4I17A 4XE0A 1WM5A 3SFYA 2ZU6B 4I9EA 4C0MA 2LSVA 3PUKA 3SF4A 4UWHA 4HBDA 2X3MA 2CHZA 4JHKA 2C2LA 3RU0A 4DPRA 2HR2A 2P9IG 4JL0A 4O1PA 2FEZA 1WDYA 3IHVA 5G2NA 2J09A 1UN9A 3OAWA 3AS8A 3UINC 1NP7A 3ZEFA 3L17A 1MX6A 3NBNB 5EILA 2EIJE 4I1AA 3AS5A 4A1GA 4C0EA 1D9SA 2NYJA 1N52A 4BWRA 2GRPB 2UY1A 1JCSA 1Z3XA 4F1SA 3LY7A 3VTYA 4I2ZA 3AG1E 5B1BE 3B7SA 4KXKB 3SZ7A 3ESLA 3UX4A 4WWPA 1SZ9A 2J49A 5LFAA 2L6JA 3FDHA 2KXPC 5KJKA 1IHBA 3W9FA 2XGMA 3WG7E 4GU5A 5ENOD 4DX5D 3DSVA 1FVHA 3FU6A 4AY5A 3TXNA 2DIWA 2PL2A 3B13A 4F7AA 2WXHA 3CQCB 3J5PA 4RLYA 4APOA 2WXRA 2XENA 3P2BA 4GZCA 4XX5A 5CMYA 3C98A 3UM1A 3WXXA 2XGSA 5JJTA 2BF0X 3UT7A 4FC8A 2VGEA 2P9SG 2XQ0A 3RSEG 4OVVA 3TAXA 4RQIA 4DI3A 5JJ7A 1N4PA 3CVPA 3SQVA 5BW8C 3UKRG 3I4RB 2WXFA 3FUNA 1MZCA 5E75A 3EHRA 5BV1A 3ENEA 1RZ4A 4TXQA 3RRMB 3CVWA 2OV8A 2GW1A 3FEYA 5CEDB 3AG3E 3FULA 4XIFA 3BU8A 4L7TA 3U9WA 3EU9A 3ZFWA 3TG4A 5AIJA 5FQ6A 4NURA 4WNDA 4B8CB 5ENRD 4GTRA 5LOZA 2H6HA 2A5EA 4TRQA 2MOWA 4GTPA 3ZVVA 4GTVA 3V2XA 2R03A 4HI9A 5ENQD 2IOLA 3S7DA 1H2VC 1QQEA 1O1TA 5JHAA 2VJ8A 4GMJA 4J8YA 5KJMA 4EECA 3SNXA 5CCLA 2AXUA 3MCXA 1N4QA 4BX9A 1E8XA 3ZYLA 4KMOA 1QBQA 4ATZD 2GRLA 2XZTG 1PAQA 4J8EA 3D9KA 3D3MA 2IEJA 5EDSA 3UT4A 2XPZA 3HXCA 1ELRA 4BT9A 2PM6A 3G2WA 3UKUG 2XGOA 3TWSA 4E85A 4PH4B 3JCKC 2E2EA 3AS4A 2IJGX 1NA0A 2CG2A 4ILIA 5JJ6A 5ARGA 1H0AA 3LVQE 2DWZA 3CSTA 4IULA 3Q9UC 2J4BA 2XPIA 5FQ8A 2XPYA 3MKQA 4A63B 3ZYQA 2Y4UA 4YDYA 4HOUA 2F8YA 2J9QA 1NFIE 3NAWA 3TWTA 1UOHA 3PNTB 5CEAA 5LX8A 2RKKA 2J4DA 4DI4A 4PDXA 4D10C 1E8ZA 1U3DA 4FHKA 4BSXA 3Q7AA 1AWCB 2OVBA 5ANRA 4GTTA 2IO2C 4OVUA 4GCOA 3QNKA 1KT0A 2QC9A 1ZBPA 4YDEA 5KCMA 4I2WA 2XEEA 3DPYA 3DPDA 3FH8A 4WAFA 3TG5A 2FF4A 3NZUA 4G25A 3Q4AB 4JHRA 3N71A 1N9AA 5AAOA 1S64A 2WXOA 4WWNA 5BNWA 5HQ8A 3S2AA 3VLDA 2WXLA 2EIME 3K9IA 1KLXA 3B7BA 1HZ4A 3KAEA 2NSZA 4G8KA 2GROB 1E8WA 1OWLA 1JPLA 1TEZA 3L9TA 3PE3A 3JQ0A 5D2MC 1NL4A 3QAQA 4AXHA 4U8YD 3TWWA 2R17C 1FVFA 4LSZE 2WXGA 3HXDA 5FINA 1OUVA 1ZU2A 3G2SA 5AARA 4EZLA 3G2UA 2E0IA 4AM9A 5G55A 4EZJA 4FJYA 3HYMB 3W9GA 4Y6CA 2GRMA 2BUGA 2QY7A 3PVLA 3VTXA 1BD8A 4XI0A 4Q94A 3AJIA 3JQ1A 3DSUA 5EX3A 4FHJA 4O1OA 1TNOA 2WMNA 2JEKA 5A7DB 4J8DA 2XRYA 2UWJG 5C1DA 3HXEA 3ZXSA 4GTQA 2YNQA 3IEGA 3CVLA 2VSOE 4B0ZA 2R02A 1E8YA 2IQCA 3I5PA 4RG6A 4JHJA 2AWIA 5HRYA 2LSUA 3B7UX 3PS6A 4L2YA 2LUHA 4XEIG 2L9BA 3ULQA 4H7YA 1TNYA 1INZA 1LD7A 2PQNA 3V30A 1HFAA 3APCA 3Q15A 5FTPA 4HFGA 4Y6WA 3ABKE 3Q9NC 5DBKA 3D9LA 4EZKA 3O48A 1TN6A 1JWGA 2Q7FA 3AU4A 3O4ZA 4AP2A 1GW6A 3MGBA 3QARA 2RG8A 4I6EA 2FI7A 3Q49B 3QOUA 2VSYA 3CEQA 2KATA 4HLLA 3TWXA 3DEOA 3HXBA 4G26A 2H6FA 4G11A 3NB2A 3C3QA 5AQBA 4GTMA 2BTDA 3T5VA 3RAUA 2MYOA 4L9PA 1EPUA 1N4SA 4YNDA 1N94A 3URZA 3Q7FA 4N2SA 1DVPA 4NACA 5EYLA 3LEWA 3FHEA 3C5RA 3EDTB 4A3VA 5KNGA 3KS2A 3AG2E 4FJZA 2CHWA 4ZHBA 2X6KA 3L82A 3ZIMA 4LEUA 1MX2A 4Q69A 5DIZA 4I9CA 2KCLA 2UY1B 3J5QB 1IQRA 3CLJA 5BXOA 2FBNA 3ONLA 4I1OB 2DZOA 5AQ7A 1JCQA 4ILGA 1UJKA 2XZDG 4GA1A 2QZAA 1OCOE 2V5FA 1YMPA 2XS1A 2X6FA 3L08A 3UPVA 3UIOC 1EDUA 4KBQA 5HKPA 3UMVA 4LNGA 3D9OA 4GAAA 4AV7A 2KZTB 4HB5A 3LJ3A 3E30A 5ENNA 5BUZA 4WUYA 3BG0B 2EIKE 4JD2G 4L23A 1DCQA 1MJ0A 4U0SA 3CSFA 1VDYA 5CMWA 1U2VG 4N39A 3SFXA 4JEHA 4HRNA 2ILRA 3FTSA 2CG3A 1UJJA 3FH5A 3FUMA 5E76A 1SZAA 2F0YA 3EHMA 3T5XA 4DUIA 4XI9A 3FUFA 5D66A 4GZ3A 3PDNA 2HE0A 3FUKA 5CERB 3QWWA 2FO1E 1E7UA 3QJZA 1Z3YA 2Y0BG 2OCCE 4B93B 4N5CA 3DEPA 1E90A 3L13A 1BI8B 2LAIA 1A5EA 2B0OE 4GPMA 2AVPA 2WXNA 4B94A 4MLPA 1Q2ZA 3MZLB 3D9NA 3NZSA 5D0OD 1WG0A 2V0PA 3ZHEA 4U07A 4G1TA 5A23A 4YDWA 4GCNA 3D9MA 3LPZA 3CQGB 3E33A 4L2LA 4TUUA 5FZRA 3TJPA 3D9JA 4DX1A 1SA5A 5KBAA 3U66A 3ASNE 3RRUA 3B95A 3R7RA 3U3WA 3ASGA 4JB8P 4ANXA 3B7TA 4UI9J 3ML9A 5LCWC 5AQAA 4A55A 4I1MA 3G2TA 3LDZA 4OAVB 3GW4A 2LAHA 1Y8MA 3PH0C 3L54A 3MJWA 5JMND 4AIFA 4JC8A 4N3BA 4XKBA 3CVQA 3SO8A 3PE4A 5EIBE 2RFMA 2IOSA 4UWFA 4MKTA 4NIKA 4UWGA 4AOFA 4DX6D 2ZGGA 4J8FA 4BT8A 3ZRHA 3TWUA 4ME2A 1UW4B 4CDRA 3NF1A 3UM0A 3S7JA 3FUDA 4G23A 3KEAA 1IHGA 3L22A 1H2UA 1E7VA 5B3SE 2WXKA 4WNGA 5BPPA 1YA0A 2DYRE 5FQ4A 2VSXE 3ZN3A 3MEKA 2JABA 4U04A 3FEXA 5CRUA 4GB9A 4MS6A 3FU3A 3LXUX 3SY2A 2OOEA 1TN8A 2V4HC 3TL5A 4UI9K 3DBSA 3VLFA 1A17A 3KEZA 3SBTB 1X81A 1FPPA 4BETA 4QFVA 1N54A 1MQSA 2WB2A 4ANWA 3EJNA 3APDA 2KC7A 2WVIA 3CHOA 3QK0A 1XNFA 3QWVA 4I6JA 2WMOA 3IXEA 5M72A 1HU3A 4PUCA 2VGYA 2XS8A 4HRLA 3JUIA 5BV0A 3CIAA 2Y1LE 2ZIRA 2CFZA 4LG6A 3MKRA 3ONKA 1S0PA 2IU1A 2ZXWE 1NA3A 2XCBA 3ISMC 5LP0A 4YDOA 5ENTD 5FZSA 1QZ2A 3ZYKA 4FLBA 3FFLA 2FULA 1OWNA 1OWPA 3DSTA 4ILHB 3CV0A 5D0QD 1SQMA 1X5BA 1QNFA 4QQIA 2XHEA 1OCZE 3V79K 5BXUA 3PZ1A 2H6GA 1KZPA 4GYYA 3CK8A 4NQ0A 3FTZA 1TNUA 4B8AA 2R5SA 5BT1A 3HG0D 2R59A 3DSXA 2KCKA 3R9AB 3UIPC 5CCMA 5AYWD 4KYOB 3E4BA 3NOGD 4CDNA 2IY0C 4JZYA 3MX3A 4HLEA 4EPZA 3CVYA 3SFZA 4TXPA 2OEWA 2V4LA 1V54E 2MHKA 3PZDA 4XKCA 1TYQG 3CK7A 4O6FA 3Q5MA 3FUIA 4ABNA 1D8DA 2J08A 2RD0A 5KWDA 3L16A 4IRUA 4U96D 3CGHA 3CKCA 4JPSA 1N4RA 1TJCA 3CHRA 3CHMA 5JA4D 4P29A 1FT2A 2H6IA 4J8SA 5T8IA 4GZDA 3OXGA 3ZNGA 3ESKA 4OYSA 1HG5A 4F3VA 1MYOA 4GPKA 3ZHEB 3FTYA 4IN3B 4ANVA 4GTSA 2QYJA 1TN7A 4KZCA 4U63A 4YVOA 1HXIA 1XGWA 2WQHA 4EBAG 3E32A 3X2QE 4APFA 2WXQA 4BY6A 1HH8A 4BTAA 3RKVA 3FUEA 4XZ4A 2WM9A 1K8KG 4RVBA 4UQXA 2WXIA 2IO3C 3SHFA 3ZKJA 2WQ6A 3D9IA 1LTXA 3ULEG 2J8SD 2X6IA 1L5JA 2I1KA 3FU5A 4TXRA 1U3CA 4UQYA 1B89A 2V8SE 1K3ZD 2KM4A 2EQXA 2XEHA 5FIOA 4CZ2D 2A5UA 3HDXA 2GRRB 4I6GA 3PREA 3PNLB 4K5AB 4GZ6A 3V2OA 4LUNU 3QKYA 4CRWA 3G2VA 3Q75A 4J6IA 1QYMA 1KT1A 3IKOB 4IYPA 3EUVA 1OXJA 2GRNB 3EIJA 3OTNA 1TJFA 3DXMG 4DJAA 3C72A 3FTVA 3OXFA 3LCAA 1IQUA 3DXKG 1JUQA 2LNIA 1P5QA 3IV0A 4KVMA 4A3TA 4U0UA 5CBOA 2VQ2A 3UT8A 3C3OA 1Z6TA 1IXVA 1HE8A 3ASFA 4DK5A 5JHBA 2LXMA 4GA0A 1IYGA 2DYSE 4ANUA 4C9BB 1JWFA 3TXMA 4GYWA 3I3NA 3PEVB 5A6CA 5IY5E 4DLQA 3ZUVB 2PQRA 1W3BA 3DRAA 2CFUA 4CEMA 4B89A 4WWOA 3EIQC 3CVXA 3RJVA 3BG1B 2PNNA 2R2LA 2PM7A 4C48B 4LERA 2KCVA 4N2QA 1EYHA 3ZYMA 5ENPD 4HOQA 1LD8A 4UI9C 3KSQA 4JVSA 3PZ2A 5KJLA 2BEDA 1ELWA 4A1SA 2DCPA 3CHSA 1H6PA 3U4TA 4M3OA 4DLOA 2WXPA 5FQ7A 3AAAC 4DX7D 5KNHD 1HF8A 1N95A 3JXIA 1N0QA 3BEEA 3ABME 5G04J 4DRXE 3VLEA 5AJLA 5CBNA 3OXLA 4HOTA 5G05C 1O1RA 4G8LA 2ETCA 2XEVA 4U95D 3T9KA 4LNUD 4JXTA 4FADA 3ULYA 3RO3A 2WQ7A 2YHEA 4FLHA 5AJDA 4AY6A 4AJWA 4U8HA 4FULA 2IONA 1WY6A 5FT9A 1SVXA 2YQ8A 4HS2A 3TWRA 2AXZA 3PUJA 4KZ0A 2AW6A 4UUCA 1ELKA 3DSWA 2BKKB 4UWKA 4EHMA 2VYIA 4E6HA 5AENA 3LJNA 4BESA 4WNEA 4CT4A 2F37A 2IF4A 1AP7A 3FUHA 4X8QA 3F6QA 3UM2A 3FH7A 3V31A 4KT6B 2RFAA 4FA6A 3DWLG 4KVOA 5ANLA 4I43A 1Z5SC 3CR3A 4ACLA 3E37A 3NQPA 2AJAA 3QC1A 1UN8A 4G24A 3PEUB 2L0TB 3RO2A 5G05J 1BPOA 3HVEA 2WXJA 3SD5A 1K1AA 2JLBA 2X6JA 3IBEA 3CVNA 4GMRA 4JEUA 3BUAA 4OAUC 2F8XK 3CVVA 2CHXA 1NZNA 3TGOA 4J7WA 4AVXA 4PS3A 2BKGA 3APFA 4HI8A 1HO8A 3ZGQA 2HO1A 2WPVA 3AG4E 2C0MA 3FUJA 3JUEA 1IKND 2ETAA 2YHCA 2HYZA 3HXFA 3LYAA 4PS8A 1OCCE 3UM3A 4BFRA 5AN8A 2OVFA 4M7CA 2HM8A 4GYOA 2L6BA 5T4YA 1TNBA 2QFCA 4J0UA 2ZGDA 4H7XA 5ENSD 1OT8A 3ZU7B 3BQOA 4GZ5A 4W9RA 4HORA 2DBAA 3EU5A 1FT1A 1N11A 3ZPJA 1MX4A 3R7QA 1BLXB 3SI5A 4CT0A 1Y6IA 3I4GA 3NOCD 2EINE 5EYPF 1HS6A 1K1BA 4GA2A 5CECB 3PZ3A 2VTBB 4ATGA 5HS0A 4ZFHA 2C0LA 3ML8A 2A4ZA 3LVRE 3JYSA 4LNBA 3R9MA 3HRAA 1H2TC 2X6HA 3KSLA 5J90A 5J08A 2R05A 3KD7A 3JXJA 3PZ4A 2GRQB 5T3RA 1KZOA 2P9NG 3RRNB 3ASDA 4F6RD 1TNZA 4DX2A 1WAO1 1YCSB 3FU0A 4CGWA 3GZ2A 3ZXPA 3UUXA 4N3AA 3AU5A 1O5MA 4JA9A 3T8MA 3CVUA 4HRMB 2Y3AA 2P2CP 2VSNA 4RSYA 4HOSA 1DC2A 1D8EA 4URKA 4BX8A 3FTUA 1H6KA 2XCCA 1SA4A 2OEVA 1HX8A 1OY3D 4JA7A 1TR4A 3ASHA 5EN5D 3MKQB 4N3CA 5FJYA 3CK9A 2PZIA 1H19A 5CRVA 2I2OA 4WNFA 4U7EB 3U64A 2P9LG 4GTOA 2I6HA 3D9PA 2EILE 3MA5A 4HQDA 2XRZA 4V3IA 4K0RA 3Q79A 3T8KA 2KZTA 1N0RA 1MHQA 1ZB1A 4L1BA 4FP7A 1UG3A 3UXGA 3B7RL 3MV3B 3E34A 1HG2A 3CKBA 5C2YA 5EKQD 3FWVA 4CGVA 2LXLA 4LCTA 5EIDA 4TUMA 1OWOA 4FU3A 4RG9A 3L6AA 4MRUA 4AEZC 1BI7B 2WXMA 2DZNA 2IFUA 4PS7A 1PC2A 3GYZA 5FZQA 3GZ1A 1DCEA 3Q47B 4UWLA 2P58C 5H7PA 4U8VD 1V55E 5G04C 3HIZA 4HVBA 3RK6A 2LO6A 2I1JA 4TV3A 2J07A 2NC9A 3GZSA 3TWQA 3P1UA 3QWPA 2AXVA 1KPSB 1PY1A 4CYMD 2VTBA 1G3NB 3IHYA 3DSSA 4BTBA 4BSZB 2Y69E 3LKUA 5HI7A 2Y4TA 5AQ9A 1RW2A 3FTWA 2FO7A 3HVEB 3Q78A 1JCRA 4Z68A 1E96B 2ONDA 3UTMA 3LY8A 3ABLE 4Q96A 3UQ3A 2DVWA 2QYUA 2P9UG 1OCRE 2L0IA 2VGXA 4MBGA 4HXIA 1O1SA 2MRIA 5FWQA 5CHEE 4LRZA 4O60A 3MV2B 2ZISA 3C3RA 3SBSA 1H6OA 4ACKA 3S7BA 3SGHA 3FY4A 4K03A 4BERA 2YINA 3MYVA 4G2VA 2M63A 2VGXB 5ARFA 1SW6A 4EQFA 5LCWJ 4R7LA 3EHNA 3PRZA 4K5BA 4EBAA 1EF1C 4F1PA 4NRHB 1S63A 2P9PG 3FTXA 4K5CA 5KJNA 3CHPA 3Q73A 1YYHA 3FP3A 3QB2A 3HHMA 4JW1A 5EX0A 4F53A 4HNAD 1BU9A 2I9CA 4UQZA 2KBXA 3LS8A 4BEPA 4U0ZA
chains in the Genus database with same CATH topology
2GROB 2GRQB 2IY0C 2GRRB 1Z5SC 2GRPB 2GRNB 1KPSB 3UIPC 5D2MC 2IO2C 3UINC 3UIOC 2IO3C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRO B;  2GRQ B;  2IY0 C;  2GRR B;  1Z5S C;  2GRP B;  2GRN B;  1KPS B;  3UIP C;  5D2M C;  2IO2 C;  3UIN C;  3UIO C;  2IO3 C; 
#chains in the Genus database with same CATH topology
 3RIB A;  3ZW3 A;  5B1A E;  3UI2 A;  4N5Q A;  1DNP A;  4CCA A;  3D9H A;  3EHQ A;  2X38 A;  1OWM A;  5ITZ F;  1NI1 A;  1S70 B;  3ASO E;  1LF8 A;  4GML A;  2GGF A;  2P9K G;  3S7F A;  3TWV A;  2ETB A;  2V5Q C;  4YVQ C;  4CDM A;  2NXP A;  3CHQ A;  1FCH A;  2B6C A;  3LY9 A;  3QDN A;  4I17 A;  4XE0 A;  1WM5 A;  3SFY A;  2ZU6 B;  4I9E A;  4C0M A;  2LSV A;  3PUK A;  3SF4 A;  4UWH A;  4HBD A;  2X3M A;  2CHZ A;  4JHK A;  2C2L A;  3RU0 A;  4DPR A;  2HR2 A;  2P9I G;  4JL0 A;  4O1P A;  2FEZ A;  1WDY A;  3IHV A;  5G2N A;  2J09 A;  1UN9 A;  3OAW A;  3AS8 A;  3UIN C;  1NP7 A;  3ZEF A;  3L17 A;  1MX6 A;  3NBN B;  5EIL A;  2EIJ E;  4I1A A;  3AS5 A;  4A1G A;  4C0E A;  1D9S A;  2NYJ A;  1N52 A;  4BWR A;  2GRP B;  2UY1 A;  1JCS A;  1Z3X A;  4F1S A;  3LY7 A;  3VTY A;  4I2Z A;  3AG1 E;  5B1B E;  3B7S A;  4KXK B;  3SZ7 A;  3ESL A;  3UX4 A;  4WWP A;  1SZ9 A;  2J49 A;  5LFA A;  2L6J A;  3FDH A;  2KXP C;  5KJK A;  1IHB A;  3W9F A;  2XGM A;  3WG7 E;  4GU5 A;  5ENO D;  4DX5 D;  3DSV A;  1FVH A;  3FU6 A;  4AY5 A;  3TXN A;  2DIW A;  2PL2 A;  3B13 A;  4F7A A;  2WXH A;  3CQC B;  3J5P A;  4RLY A;  4APO A;  2WXR A;  2XEN A;  3P2B A;  4GZC A;  4XX5 A;  5CMY A;  3C98 A;  3UM1 A;  3WXX A;  2XGS A;  5JJT A;  2BF0 X;  3UT7 A;  4FC8 A;  2VGE A;  2P9S G;  2XQ0 A;  3RSE G;  4OVV A;  3TAX A;  4RQI A;  4DI3 A;  5JJ7 A;  1N4P A;  3CVP A;  3SQV A;  5BW8 C;  3UKR G;  3I4R B;  2WXF A;  3FUN A;  1MZC A;  5E75 A;  3EHR A;  5BV1 A;  3ENE A;  1RZ4 A;  4TXQ A;  3RRM B;  3CVW A;  2OV8 A;  2GW1 A;  3FEY A;  5CED B;  3AG3 E;  3FUL A;  4XIF A;  3BU8 A;  4L7T A;  3U9W A;  3EU9 A;  3ZFW A;  3TG4 A;  5AIJ A;  5FQ6 A;  4NUR A;  4WND A;  4B8C B;  5ENR D;  4GTR A;  5LOZ A;  2H6H A;  2A5E A;  4TRQ A;  2MOW A;  4GTP A;  3ZVV A;  4GTV A;  3V2X A;  2R03 A;  4HI9 A;  5ENQ D;  2IOL A;  3S7D A;  1H2V C;  1QQE A;  1O1T A;  5JHA A;  2VJ8 A;  4GMJ A;  4J8Y A;  5KJM A;  4EEC A;  3SNX A;  5CCL A;  2AXU A;  3MCX A;  1N4Q A;  4BX9 A;  1E8X A;  3ZYL A;  4KMO A;  1QBQ A;  4ATZ D;  2GRL A;  2XZT G;  1PAQ A;  4J8E A;  3D9K A;  3D3M A;  2IEJ A;  5EDS A;  3UT4 A;  2XPZ A;  3HXC A;  1ELR A;  4BT9 A;  2PM6 A;  3G2W A;  3UKU G;  2XGO A;  3TWS A;  4E85 A;  4PH4 B;  3JCK C;  2E2E A;  3AS4 A;  2IJG X;  1NA0 A;  2CG2 A;  4ILI A;  5JJ6 A;  5ARG A;  1H0A A;  3LVQ E;  2DWZ A;  3CST A;  4IUL A;  3Q9U C;  2J4B A;  2XPI A;  5FQ8 A;  2XPY A;  3MKQ A;  4A63 B;  3ZYQ A;  2Y4U A;  4YDY A;  4HOU A;  2F8Y A;  2J9Q A;  1NFI E;  3NAW A;  3TWT A;  1UOH A;  3PNT B;  5CEA A;  5LX8 A;  2RKK A;  2J4D A;  4DI4 A;  4PDX A;  4D10 C;  1E8Z A;  1U3D A;  4FHK A;  4BSX A;  3Q7A A;  1AWC B;  2OVB A;  5ANR A;  4GTT A;  2IO2 C;  4OVU A;  4GCO A;  3QNK A;  1KT0 A;  2QC9 A;  1ZBP A;  4YDE A;  5KCM A;  4I2W A;  2XEE A;  3DPY A;  3DPD A;  3FH8 A;  4WAF A;  3TG5 A;  2FF4 A;  3NZU A;  4G25 A;  3Q4A B;  4JHR A;  3N71 A;  1N9A A;  5AAO A;  1S64 A;  2WXO A;  4WWN A;  5BNW A;  5HQ8 A;  3S2A A;  3VLD A;  2WXL A;  2EIM E;  3K9I A;  1KLX A;  3B7B A;  1HZ4 A;  3KAE A;  2NSZ A;  4G8K A;  2GRO B;  1E8W A;  1OWL A;  1JPL A;  1TEZ A;  3L9T A;  3PE3 A;  3JQ0 A;  5D2M C;  1NL4 A;  3QAQ A;  4AXH A;  4U8Y D;  3TWW A;  2R17 C;  1FVF A;  4LSZ E;  2WXG A;  3HXD A;  5FIN A;  1OUV A;  1ZU2 A;  3G2S A;  5AAR A;  4EZL A;  3G2U A;  2E0I A;  4AM9 A;  5G55 A;  4EZJ A;  4FJY A;  3HYM B;  3W9G A;  4Y6C A;  2GRM A;  2BUG A;  2QY7 A;  3PVL A;  3VTX A;  1BD8 A;  4XI0 A;  4Q94 A;  3AJI A;  3JQ1 A;  3DSU A;  5EX3 A;  4FHJ A;  4O1O A;  1TNO A;  2WMN A;  2JEK A;  5A7D B;  4J8D A;  2XRY A;  2UWJ G;  5C1D A;  3HXE A;  3ZXS A;  4GTQ A;  2YNQ A;  3IEG A;  3CVL A;  2VSO E;  4B0Z A;  2R02 A;  1E8Y A;  2IQC A;  3I5P A;  4RG6 A;  4JHJ A;  2AWI A;  5HRY A;  2LSU A;  3B7U X;  3PS6 A;  4L2Y A;  2LUH A;  4XEI G;  2L9B A;  3ULQ A;  4H7Y A;  1TNY A;  1INZ A;  1LD7 A;  2PQN A;  3V30 A;  1HFA A;  3APC A;  3Q15 A;  5FTP A;  4HFG A;  4Y6W A;  3ABK E;  3Q9N C;  5DBK A;  3D9L A;  4EZK A;  3O48 A;  1TN6 A;  1JWG A;  2Q7F A;  3AU4 A;  3O4Z A;  4AP2 A;  1GW6 A;  3MGB A;  3QAR A;  2RG8 A;  4I6E A;  2FI7 A;  3Q49 B;  3QOU A;  2VSY A;  3CEQ A;  2KAT A;  4HLL A;  3TWX A;  3DEO A;  3HXB A;  4G26 A;  2H6F A;  4G11 A;  3NB2 A;  3C3Q A;  5AQB A;  4GTM A;  2BTD A;  3T5V A;  3RAU A;  2MYO A;  4L9P A;  1EPU A;  1N4S A;  4YND A;  1N94 A;  3URZ A;  3Q7F A;  4N2S A;  1DVP A;  4NAC A;  5EYL A;  3LEW A;  3FHE A;  3C5R A;  3EDT B;  4A3V A;  5KNG A;  3KS2 A;  3AG2 E;  4FJZ A;  2CHW A;  4ZHB A;  2X6K A;  3L82 A;  3ZIM A;  4LEU A;  1MX2 A;  4Q69 A;  5DIZ A;  4I9C A;  2KCL A;  2UY1 B;  3J5Q B;  1IQR A;  3CLJ A;  5BXO A;  2FBN A;  3ONL A;  4I1O B;  2DZO A;  5AQ7 A;  1JCQ A;  4ILG A;  1UJK A;  2XZD G;  4GA1 A;  2QZA A;  1OCO E;  2V5F A;  1YMP A;  2XS1 A;  2X6F A;  3L08 A;  3UPV A;  3UIO C;  1EDU A;  4KBQ A;  5HKP A;  3UMV A;  4LNG A;  3D9O A;  4GAA A;  4AV7 A;  2KZT B;  4HB5 A;  3LJ3 A;  3E30 A;  5ENN A;  5BUZ A;  4WUY A;  3BG0 B;  2EIK E;  4JD2 G;  4L23 A;  1DCQ A;  1MJ0 A;  4U0S A;  3CSF A;  1VDY A;  5CMW A;  1U2V G;  4N39 A;  3SFX A;  4JEH A;  4HRN A;  2ILR A;  3FTS A;  2CG3 A;  1UJJ A;  3FH5 A;  3FUM A;  5E76 A;  1SZA A;  2F0Y A;  3EHM A;  3T5X A;  4DUI A;  4XI9 A;  3FUF A;  5D66 A;  4GZ3 A;  3PDN A;  2HE0 A;  3FUK A;  5CER B;  3QWW A;  2FO1 E;  1E7U A;  3QJZ A;  1Z3Y A;  2Y0B G;  2OCC E;  4B93 B;  4N5C A;  3DEP A;  1E90 A;  3L13 A;  1BI8 B;  2LAI A;  1A5E A;  2B0O E;  4GPM A;  2AVP A;  2WXN A;  4B94 A;  4MLP A;  1Q2Z A;  3MZL B;  3D9N A;  3NZS A;  5D0O D;  1WG0 A;  2V0P A;  3ZHE A;  4U07 A;  4G1T A;  5A23 A;  4YDW A;  4GCN A;  3D9M A;  3LPZ A;  3CQG B;  3E33 A;  4L2L A;  4TUU A;  5FZR A;  3TJP A;  3D9J A;  4DX1 A;  1SA5 A;  5KBA A;  3U66 A;  3ASN E;  3RRU A;  3B95 A;  3R7R A;  3U3W A;  3ASG A;  4JB8 P;  4ANX A;  3B7T A;  4UI9 J;  3ML9 A;  5LCW C;  5AQA A;  4A55 A;  4I1M A;  3G2T A;  3LDZ A;  4OAV B;  3GW4 A;  2LAH A;  1Y8M A;  3PH0 C;  3L54 A;  3MJW A;  5JMN D;  4AIF A;  4JC8 A;  4N3B A;  4XKB A;  3CVQ A;  3SO8 A;  3PE4 A;  5EIB E;  2RFM A;  2IOS A;  4UWF A;  4MKT A;  4NIK A;  4UWG A;  4AOF A;  4DX6 D;  2ZGG A;  4J8F A;  4BT8 A;  3ZRH A;  3TWU A;  4ME2 A;  1UW4 B;  4CDR A;  3NF1 A;  3UM0 A;  3S7J A;  3FUD A;  4G23 A;  3KEA A;  1IHG A;  3L22 A;  1H2U A;  1E7V A;  5B3S E;  2WXK A;  4WNG A;  5BPP A;  1YA0 A;  2DYR E;  5FQ4 A;  2VSX E;  3ZN3 A;  3MEK A;  2JAB A;  4U04 A;  3FEX A;  5CRU A;  4GB9 A;  4MS6 A;  3FU3 A;  3LXU X;  3SY2 A;  2OOE A;  1TN8 A;  2V4H C;  3TL5 A;  4UI9 K;  3DBS A;  3VLF A;  1A17 A;  3KEZ A;  3SBT B;  1X81 A;  1FPP A;  4BET A;  4QFV A;  1N54 A;  1MQS A;  2WB2 A;  4ANW A;  3EJN A;  3APD A;  2KC7 A;  2WVI A;  3CHO A;  3QK0 A;  1XNF A;  3QWV A;  4I6J A;  2WMO A;  3IXE A;  5M72 A;  1HU3 A;  4PUC A;  2VGY A;  2XS8 A;  4HRL A;  3JUI A;  5BV0 A;  3CIA A;  2Y1L E;  2ZIR A;  2CFZ A;  4LG6 A;  3MKR A;  3ONK A;  1S0P A;  2IU1 A;  2ZXW E;  1NA3 A;  2XCB A;  3ISM C;  5LP0 A;  4YDO A;  5ENT D;  5FZS A;  1QZ2 A;  3ZYK A;  4FLB A;  3FFL A;  2FUL A;  1OWN A;  1OWP A;  3DST A;  4ILH B;  3CV0 A;  5D0Q D;  1SQM A;  1X5B A;  1QNF A;  4QQI A;  2XHE A;  1OCZ E;  3V79 K;  5BXU A;  3PZ1 A;  2H6G A;  1KZP A;  4GYY A;  3CK8 A;  4NQ0 A;  3FTZ A;  1TNU A;  4B8A A;  2R5S A;  5BT1 A;  3HG0 D;  2R59 A;  3DSX A;  2KCK A;  3R9A B;  3UIP C;  5CCM A;  5AYW D;  4KYO B;  3E4B A;  3NOG D;  4CDN A;  2IY0 C;  4JZY A;  3MX3 A;  4HLE A;  4EPZ A;  3CVY A;  3SFZ A;  4TXP A;  2OEW A;  2V4L A;  1V54 E;  2MHK A;  3PZD A;  4XKC A;  1TYQ G;  3CK7 A;  4O6F A;  3Q5M A;  3FUI A;  4ABN A;  1D8D A;  2J08 A;  2RD0 A;  5KWD A;  3L16 A;  4IRU A;  4U96 D;  3CGH A;  3CKC A;  4JPS A;  1N4R A;  1TJC A;  3CHR A;  3CHM A;  5JA4 D;  4P29 A;  1FT2 A;  2H6I A;  4J8S A;  5T8I A;  4GZD A;  3OXG A;  3ZNG A;  3ESK A;  4OYS A;  1HG5 A;  4F3V A;  1MYO A;  4GPK A;  3ZHE B;  3FTY A;  4IN3 B;  4ANV A;  4GTS A;  2QYJ A;  1TN7 A;  4KZC A;  4U63 A;  4YVO A;  1HXI A;  1XGW A;  2WQH A;  4EBA G;  3E32 A;  3X2Q E;  4APF A;  2WXQ A;  4BY6 A;  1HH8 A;  4BTA A;  3RKV A;  3FUE A;  4XZ4 A;  2WM9 A;  1K8K G;  4RVB A;  4UQX A;  2WXI A;  2IO3 C;  3SHF A;  3ZKJ A;  2WQ6 A;  3D9I A;  1LTX A;  3ULE G;  2J8S D;  2X6I A;  1L5J A;  2I1K A;  3FU5 A;  4TXR A;  1U3C A;  4UQY A;  1B89 A;  2V8S E;  1K3Z D;  2KM4 A;  2EQX A;  2XEH A;  5FIO A;  4CZ2 D;  2A5U A;  3HDX A;  2GRR B;  4I6G A;  3PRE A;  3PNL B;  4K5A B;  4GZ6 A;  3V2O A;  4LUN U;  3QKY A;  4CRW A;  3G2V A;  3Q75 A;  4J6I A;  1QYM A;  1KT1 A;  3IKO B;  4IYP A;  3EUV A;  1OXJ A;  2GRN B;  3EIJ A;  3OTN A;  1TJF A;  3DXM G;  4DJA A;  3C72 A;  3FTV A;  3OXF A;  3LCA A;  1IQU A;  3DXK G;  1JUQ A;  2LNI A;  1P5Q A;  3IV0 A;  4KVM A;  4A3T A;  4U0U A;  5CBO A;  2VQ2 A;  3UT8 A;  3C3O A;  1Z6T A;  1IXV A;  1HE8 A;  3ASF A;  4DK5 A;  5JHB A;  2LXM A;  4GA0 A;  1IYG A;  2DYS E;  4ANU A;  4C9B B;  1JWF A;  3TXM A;  4GYW A;  3I3N A;  3PEV B;  5A6C A;  5IY5 E;  4DLQ A;  3ZUV B;  2PQR A;  1W3B A;  3DRA A;  2CFU A;  4CEM A;  4B89 A;  4WWO A;  3EIQ C;  3CVX A;  3RJV A;  3BG1 B;  2PNN A;  2R2L A;  2PM7 A;  4C48 B;  4LER A;  2KCV A;  4N2Q A;  1EYH A;  3ZYM A;  5ENP D;  4HOQ A;  1LD8 A;  4UI9 C;  3KSQ A;  4JVS A;  3PZ2 A;  5KJL A;  2BED A;  1ELW A;  4A1S A;  2DCP A;  3CHS A;  1H6P A;  3U4T A;  4M3O A;  4DLO A;  2WXP A;  5FQ7 A;  3AAA C;  4DX7 D;  5KNH D;  1HF8 A;  1N95 A;  3JXI A;  1N0Q A;  3BEE A;  3ABM E;  5G04 J;  4DRX E;  3VLE A;  5AJL A;  5CBN A;  3OXL A;  4HOT A;  5G05 C;  1O1R A;  4G8L A;  2ETC A;  2XEV A;  4U95 D;  3T9K A;  4LNU D;  4JXT A;  4FAD A;  3ULY A;  3RO3 A;  2WQ7 A;  2YHE A;  4FLH A;  5AJD A;  4AY6 A;  4AJW A;  4U8H A;  4FUL A;  2ION A;  1WY6 A;  5FT9 A;  1SVX A;  2YQ8 A;  4HS2 A;  3TWR A;  2AXZ A;  3PUJ A;  4KZ0 A;  2AW6 A;  4UUC A;  1ELK A;  3DSW A;  2BKK B;  4UWK A;  4EHM A;  2VYI A;  4E6H A;  5AEN A;  3LJN A;  4BES A;  4WNE A;  4CT4 A;  2F37 A;  2IF4 A;  1AP7 A;  3FUH A;  4X8Q A;  3F6Q A;  3UM2 A;  3FH7 A;  3V31 A;  4KT6 B;  2RFA A;  4FA6 A;  3DWL G;  4KVO A;  5ANL A;  4I43 A;  1Z5S C;  3CR3 A;  4ACL A;  3E37 A;  3NQP A;  2AJA A;  3QC1 A;  1UN8 A;  4G24 A;  3PEU B;  2L0T B;  3RO2 A;  5G05 J;  1BPO A;  3HVE A;  2WXJ A;  3SD5 A;  1K1A A;  2JLB A;  2X6J A;  3IBE A;  3CVN A;  4GMR A;  4JEU A;  3BUA A;  4OAU C;  2F8X K;  3CVV A;  2CHX A;  1NZN A;  3TGO A;  4J7W A;  4AVX A;  4PS3 A;  2BKG A;  3APF A;  4HI8 A;  1HO8 A;  3ZGQ A;  2HO1 A;  2WPV A;  3AG4 E;  2C0M A;  3FUJ A;  3JUE A;  1IKN D;  2ETA A;  2YHC A;  2HYZ A;  3HXF A;  3LYA A;  4PS8 A;  1OCC E;  3UM3 A;  4BFR A;  5AN8 A;  2OVF A;  4M7C A;  2HM8 A;  4GYO A;  2L6B A;  5T4Y A;  1TNB A;  2QFC A;  4J0U A;  2ZGD A;  4H7X A;  5ENS D;  1OT8 A;  3ZU7 B;  3BQO A;  4GZ5 A;  4W9R A;  4HOR A;  2DBA A;  3EU5 A;  1FT1 A;  1N11 A;  3ZPJ A;  1MX4 A;  3R7Q A;  1BLX B;  3SI5 A;  4CT0 A;  1Y6I A;  3I4G A;  3NOC D;  2EIN E;  5EYP F;  1HS6 A;  1K1B A;  4GA2 A;  5CEC B;  3PZ3 A;  2VTB B;  4ATG A;  5HS0 A;  4ZFH A;  2C0L A;  3ML8 A;  2A4Z A;  3LVR E;  3JYS A;  4LNB A;  3R9M A;  3HRA A;  1H2T C;  2X6H A;  3KSL A;  5J90 A;  5J08 A;  2R05 A;  3KD7 A;  3JXJ A;  3PZ4 A;  2GRQ B;  5T3R A;  1KZO A;  2P9N G;  3RRN B;  3ASD A;  4F6R D;  1TNZ A;  4DX2 A;  1WAO 1;  1YCS B;  3FU0 A;  4CGW A;  3GZ2 A;  3ZXP A;  3UUX A;  4N3A A;  3AU5 A;  1O5M A;  4JA9 A;  3T8M A;  3CVU A;  4HRM B;  2Y3A A;  2P2C P;  2VSN A;  4RSY A;  4HOS A;  1DC2 A;  1D8E A;  4URK A;  4BX8 A;  3FTU A;  1H6K A;  2XCC A;  1SA4 A;  2OEV A;  1HX8 A;  1OY3 D;  4JA7 A;  1TR4 A;  3ASH A;  5EN5 D;  3MKQ B;  4N3C A;  5FJY A;  3CK9 A;  2PZI A;  1H19 A;  5CRV A;  2I2O A;  4WNF A;  4U7E B;  3U64 A;  2P9L G;  4GTO A;  2I6H A;  3D9P A;  2EIL E;  3MA5 A;  4HQD A;  2XRZ A;  4V3I A;  4K0R A;  3Q79 A;  3T8K A;  2KZT A;  1N0R A;  1MHQ A;  1ZB1 A;  4L1B A;  4FP7 A;  1UG3 A;  3UXG A;  3B7R L;  3MV3 B;  3E34 A;  1HG2 A;  3CKB A;  5C2Y A;  5EKQ D;  3FWV A;  4CGV A;  2LXL A;  4LCT A;  5EID A;  4TUM A;  1OWO A;  4FU3 A;  4RG9 A;  3L6A A;  4MRU A;  4AEZ C;  1BI7 B;  2WXM A;  2DZN A;  2IFU A;  4PS7 A;  1PC2 A;  3GYZ A;  5FZQ A;  3GZ1 A;  1DCE A;  3Q47 B;  4UWL A;  2P58 C;  5H7P A;  4U8V D;  1V55 E;  5G04 C;  3HIZ A;  4HVB A;  3RK6 A;  2LO6 A;  2I1J A;  4TV3 A;  2J07 A;  2NC9 A;  3GZS A;  3TWQ A;  3P1U A;  3QWP A;  2AXV A;  1KPS B;  1PY1 A;  4CYM D;  2VTB A;  1G3N B;  3IHY A;  3DSS A;  4BTB A;  4BSZ B;  2Y69 E;  3LKU A;  5HI7 A;  2Y4T A;  5AQ9 A;  1RW2 A;  3FTW A;  2FO7 A;  3HVE B;  3Q78 A;  1JCR A;  4Z68 A;  1E96 B;  2OND A;  3UTM A;  3LY8 A;  3ABL E;  4Q96 A;  3UQ3 A;  2DVW A;  2QYU A;  2P9U G;  1OCR E;  2L0I A;  2VGX A;  4MBG A;  4HXI A;  1O1S A;  2MRI A;  5FWQ A;  5CHE E;  4LRZ A;  4O60 A;  3MV2 B;  2ZIS A;  3C3R A;  3SBS A;  1H6O A;  4ACK A;  3S7B A;  3SGH A;  3FY4 A;  4K03 A;  4BER A;  2YIN A;  3MYV A;  4G2V A;  2M63 A;  2VGX B;  5ARF A;  1SW6 A;  4EQF A;  5LCW J;  4R7L A;  3EHN A;  3PRZ A;  4K5B A;  4EBA A;  1EF1 C;  4F1P A;  4NRH B;  1S63 A;  2P9P G;  3FTX A;  4K5C A;  5KJN A;  3CHP A;  3Q73 A;  1YYH A;  3FP3 A;  3QB2 A;  3HHM A;  4JW1 A;  5EX0 A;  4F53 A;  4HNA D;  1BU9 A;  2I9C A;  4UQZ A;  2KBX A;  3LS8 A;  4BEP A;  4U0Z A; 
#chains in the Genus database with same CATH homology
 2GRO B;  2GRQ B;  2IY0 C;  2GRR B;  1Z5S C;  2GRP B;  2GRN B;  1KPS B;  3UIP C;  5D2M C;  2IO2 C;  3UIN C;  3UIO C;  2IO3 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...