2GRPB

Crystal structure of human rangap1-ubc9-y87a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
157
structure length
157
Chain Sequence
b'PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 56
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grpB00
1Z5SC 2GRPB 3UIOC 2IY0C 2GRRB 3UIPC 2GRQB 2GRNB 2IO3C 5D2MC 1KPSB 2GROB 3UINC 2IO2C
chains in the Genus database with same CATH superfamily
3RU0A 5FZSA 4J7WA 2B6CA 3FTYA 2R5SA 5LCWJ 1N95A 2KZTA 3EUVA 4EBAG 5HI7A 3ZPJA 5CMWA 5T3RA 1Y8MA 4LNUD 2RG8A 5D2MC 1NP7A 1NA3A 3SFZA 2DYSE 2JEKA 4AVXA 4EHMA 3VLDA 5HS0A 3CVWA 4WUYA 3CGHA 2BF0X 3LCAA 4ZHBA 1IYGA 2KCKA 2LAHA 4JC8A 3CV0A 1O1RA 3PS6A 3DPDA 5G04J 3IHYA 4LNGA 1SW6A 2WXJA 3ZKJA 4GMRA 3APCA 3FU5A 5AN8A 2JABA 4GMLA 1OWMA 2PL2A 5AQ7A 5KCMA 1BLXB 3HXFA 3PEVB 5FQ8A 2E2EA 5FQ7A 1LD7A 2VTBA 4BT9A 3LJ3A 1UOHA 2VGXA 2OVFA 3LVRE 2CHZA 3JXIA 2I6HA 4BT8A 2DWZA 2P58C 2YQ8A 4HORA 4E85A 4ANXA 4I2WA 3ZN3A 2L0TB 3SD5A 3NB2A 3PNTB 3X2QE 1HH8A 4FADA 3T8KA 3HHMA 3APFA 2WXHA 2FBNA 2RKKA 4PH4B 2BTDA 2XENA 3HXBA 3JUEA 1PY1A 2WXOA 4U8YD 3G2WA 4UI9J 2F0YA 2ILRA 4U0ZA 3IEGA 3SBSA 5FIOA 3PZ4A 2WMOA 3T8MA 3K9IA 1OWNA 3UKRG 2XEVA 5AQAA 4GA1A 4K0RA 3QAQA 3RRNB 2XZDG 4A1GA 4EECA 1O5MA 4IULA 3ONLA 3UT8A 3QWWA 4GA0A 2QZAA 1HU3A 3ZIMA 3B7SA 3I4RB 1E7VA 3C3RA 1OWOA 3CVYA 1WM5A 3FH7A 4TUMA 4XX5A 1TN6A 3Q9UC 3FTWA 3ZVVA 3DPYA 2DIWA 1YMPA 4A1SA 3NOGD 2PM7A 4BY6A 4YVQC 5CMYA 4UQZA 4CYMD 3KSLA 4HLEA 4YDOA 3ZXSA 2ETAA 2VSXE 1W3BA 4DX5D 3ZFWA 1MX6A 3B7TA 3LPZA 4JPSA 4HNAD 1E8YA 2KCVA 3MJWA 2P9IG 1X81A 3PZDA 3FUJA 2FULA 1VDYA 4TXPA 4UI9K 5BXOA 3AAAC 4FLBA 4G25A 2EQXA 1TR4A 3CVNA 4YNDA 2BKGA 4U96D 1H2VC 4PS8A 4EZKA 3L13A 3C3QA 3E33A 4JA7A 5G2NA 2KC7A 3SFYA 1OUVA 4UI9C 1H2UA 3OTNA 1JCQA 4H7XA 4HOUA 3HXDA 4FLHA 2AXZA 3TWQA 2ZGDA 4HBDA 1OCOE 3AG3E 2ETCA 3KEAA 1N0QA 2WXMA 5AAOA 4HS2A 4FJZA 3TG5A 3MV3B 2V4HC 3FUIA 4J8DA 5KNHD 3FFLA 3KAEA 4ACLA 1XNFA 2FEZA 3Q7AA 1ZBPA 2XRZA 3EIQC 4IN3B 3UX4A 2LAIA 4WNFA 3FEYA 4GTOA 2CHWA 2WXPA 3SF4A 1TNOA 3PEUB 3RO3A 3ZYMA 4GZCA 1HS6A 2A4ZA 4Y6WA 4AM9A 3PDNA 3Q7FA 2WXKA 3MEKA 3OXGA 2CHXA 1TEZA 4GTMA 4B8CB 3NOCD 5ANLA 1SZ9A 3UIOC 2GROB 3VLFA 1UN9A 4PUCA 2AXVA 4MLPA 1UJJA 4WWOA 2X6KA 4B93B 4JEHA 4FU3A 1LTXA 2J8SD 1N0RA 5FQ6A 3QOUA 5FQ4A 4BSXA 3LKUA 4KXKB 4U04A 3UINC 3HRAA 5HRYA 3EJNA 3FU6A 3UI2A 3CK7A 2PNNA 4BTAA 4WNGA 3Q78A 5KBAA 1KPSB 5KNGA 5AJDA 2J09A 4XKBA 1HXIA 3W9FA 3DWLG 5D66A 5CBNA 2X6FA 4F1PA 2KM4A 1IKND 3E30A 2YINA 2VSOE 4NIKA 3S2AA 3MV2B 4J8EA 3RO2A 1FVHA 1S0PA 3L54A 4KZ0A 3ASNE 2PM6A 3QKYA 5G05C 1NL4A 4ABNA 1WDYA 3OXFA 3C98A 3MKQB 4L1BA 2AW6A 4LNBA 3FUMA 3SBTB 1U2VG 3PH0C 5JJTA 4P29A 1MYOA 1Z3YA 3CK9A 3V79K 5CBOA 4ACKA 1H0AA 3B7RL 2BUGA 3CVXA 4LRZA 5AARA 3LDZA 4CDMA 5CERB 3WXXA 4CDNA 4HB5A 1OCCE 3WG7E 4CCAA 4OVUA 2X38A 4FP7A 4ME2A 1KZPA 4KMOA 3I5PA 4J6IA 1U3CA 3PREA 1X5BA 4XE0A 4UWFA 2V8SE 4W9RA 3SQVA 2NYJA 3FH5A 3HG0D 5AYWD 3UKUG 5C1DA 5BW8C 4FA6A 5LFAA 2E0IA 2RD0A 1HX8A 4I6JA 1E8WA 3S7BA 4AP2A 2H6IA 3MX3A 4DPRA 3FULA 2IOSA 1KT0A 2EINE 4RLYA 4U7EB 2I1JA 3V30A 1QZ2A 1Y6IA 1TN8A 1E8ZA 4DRXE 5ENQD 3LXUX 4UUCA 2J07A 4R7LA 2QFCA 2ZU6B 2Y4TA 3CVUA 3IBEA 4HI9A 3BU8A 1EYHA 4HOQA 5IY5E 3LJNA 1SA4A 4DK5A 3IXEA 2LO6A 3RAUA 3HVEB 4GZ5A 2LXLA 3SFXA 3FTXA 2AVPA 3Q47B 4WAFA 1H6KA 3FUEA 3PVLA 4X8QA 3Q79A 3UTMA 2C0MA 1YCSB 1DCEA 2P9PG 2VGEA 3F6QA 4G8KA 5EDSA 1Q2ZA 4K5BA 4GZ6A 4K03A 2GRNB 2HE0A 2OEVA 2KZTB 4B89A 4O6FA 1FT1A 1AWCB 3NZUA 1S63A 1RW2A 1RZ4A 1DNPA 3TWWA 1YA0A 2WM9A 3AG4E 3ASHA 4L2YA 3E32A 3QJZA 5CCMA 2R03A 4DUIA 3T5XA 2XCBA 4FHKA 2WMNA 5ENPD 4MBGA 1N4RA 3FUFA 1HFAA 4Y6CA 2DBAA 4ZFHA 3SI5A 4Q69A 1OXJA 4G11A 2VJ8A 3DXMG 4B94A 1Z3XA 3FUHA 2OEWA 2OCCE 2Y1LE 2X3MA 3TWSA 3PUKA 4K5CA 4JZYA 1N4PA 1AP7A 4FHJA 3Q49B 4G24A 4GTTA 4OVVA 4DX2A 2MRIA 3CVPA 4WNDA 3O4ZA 2ZIRA 3KD7A 4HFGA 2VTBB 5JHAA 1DCQA 2LSUA 3D9OA 3V31A 5EYPF 3TWRA 3FTVA 2JLBA 1QNFA 2HO1A 4RVBA 3DSTA 3UT4A 4N3BA 4GZ3A 3EU5A 2J9QA 4AOFA 3ML9A 1K3ZD 2XPIA 3RRUA 4JHKA 4L23A 2I1KA 4U0SA 3RK6A 4KZCA 1IQRA 3P1UA 5EILA 3FUKA 5KJNA 5M72A 4DI4A 5BNWA 3QC1A 2DYRE 1JUQA 4H7YA 4CGVA 5A6CA 3ZW3A 2XPYA 5LCWC 3CKBA 1PC2A 3ISMC 2J08A 3CHSA 2ZXWE 1SQMA 2P9NG 3FTSA 3AU5A 3CHOA 3KEZA 2C0LA 2WXIA 4QQIA 1S64A 3UUXA 4LG6A 2KXPC 4LEUA 2VSNA 5JMND 1GW6A 4U8HA 5AQ9A 1ZB1A 3U3WA 4BSZB 1JCRA 2GW1A 3FDHA 1N11A 3TGOA 4TXRA 1MX2A 4AEZC 1Z5SC 1OT8A 3FP3A 4YDEA 2WXFA 3CR3A 3HYMB 4U0UA 5D0QD 5JA4D 1NFIE 3EHMA 3MA5A 5BUZA 4I43A 4N3CA 1OCRE 3U4TA 5G04C 3R9AB 3R9MA 3JYSA 4E6HA 2HR2A 2P9LG 2XEEA 4A3TA 1N9AA 3FWVA 5AJLA 4G23A 4NURA 5LP0A 4KVOA 3D9KA 3ML8A 3UXGA 3UPVA 3ULQA 4BX8A 3GZ1A 1TN7A 4ANWA 4N2SA 4HRMB 3CHMA 3DSUA 3QNKA 1JWGA 1MQSA 1D9SA 3QB2A 1IXVA 4FC8A 4OYSA 1FCHA 4I9CA 4OAVB 4GYOA 4RG6A 3QK0A 2LXMA 3CK8A 4HVBA 4ATGA 2IQCA 4TRQA 3HIZA 2IF4A 2WQ6A 5ITZF 3ASGA 2DZOA 2DCPA 4GTRA 5CRVA 3URZA 4WNEA 5FINA 5H7PA 3LYAA 2WB2A 2KATA 1IHBA 2I2OA 3ZXPA 4OAUC 3HXEA 3E37A 2XGSA 4J8SA 3HDXA 3IV0A 5E76A 5ARGA 4EBAA 2UWJG 2QC9A 3JXJA 2X6HA 4DI3A 3C72A 3LY9A 4JB8P 1OWLA 4UWLA 4K5AB 2IFUA 4O1OA 2XGOA 3BEEA 2V4LA 4FULA 4GCNA 3BUAA 4BEPA 5FZQA 4QFVA 2IJGX 4YDYA 3TWUA 4CT0A 4AIFA 2QY7A 3I3NA 4RG9A 5AENA 4RSYA 3ZNGA 1H19A 2L9BA 4KBQA 3LVQE 2H6GA 1JCSA 2HYZA 2M63A 4EQFA 2QYUA 3EIJA 2GRRB 1FVFA 4EZJA 3EHNA 4KT6B 2J49A 5KJMA 3D9PA 4BERA 4HI8A 4HXIA 3UMVA 3OAWA 3UM1A 3RKVA 3D9NA 3G2TA 3VTYA 1BPOA 2L6BA 4PS3A 2WXRA 2WVIA 5ENRD 2F37A 5LX8A 2AJAA 3DSWA 5JJ6A 4MS6A 2EIKE 5EYLA 2RFAA 3CVVA 4J0UA 3QWVA 2A5UA 3LEWA 1SZAA 3U66A 4M3OA 1FPPA 3D9HA 3FY4A 4GAAA 1TYQG 3BG1B 2R59A 3CHPA 1E7UA 1O1SA 2YNQA 1K1BA 1BI8B 4J8FA 5B1AE 4ATZD 2CFUA 1KLXA 4BWRA 5DBKA 1H2TC 3G2SA 3ULEG 1TNZA 2GRQB 4AXHA 1BD8A 2XQ0A 3MKRA 4G1TA 4JHRA 2CG2A 2UY1A 4F7AA 4AY5A 2LUHA 3MYVA 4U07A 2MYOA 2XHEA 2XS1A 2WQ7A 2L6JA 2CFZA 5T4YA 5B3SE 3QWPA 4N39A 2R2LA 3CIAA 1P5QA 5DIZA 3E4BA 2BEDA 4C0EA 3PUJA 2ETBA 3SHFA 1A5EA 3D9IA 1DVPA 1QYMA 4TV3A 3QARA 4JW1A 2RFMA 5EIDA 3D9LA 2WXLA 1NZNA 4XI9A 3T5VA 4GMJA 4LUNU 4UWGA 3FU0A 3D3MA 1IQUA 4I9EA 5CRUA 4I6GA 5BV0A 3VTXA 4I17A 3L08A 3NAWA 3APDA 3ASFA 3JCKC 1OWPA 3OXLA 2CG3A 5CECB 3TG4A 3CSFA 5ENNA 3FTZA 2C2LA 4UWKA 2R02A 2IO3C 4U95D 4XKCA 2WXGA 4O1PA 4BFRA 4EZLA 5BXUA 4WWNA 5KWDA 2XEHA 1PAQA 2WXNA 1TNYA 5HKPA 1JWFA 4DLOA 4PDXA 3ZHEA 3AG2E 4XI0A 3RRMB 3UT7A 4FJYA 1ELKA 5ENSD 3PNLB 3ZGQA 4HRNA 3RSEG 4HOTA 3DSSA 2Q7FA 5KJLA 2KCLA 3RIBA 4KYOB 3UM2A 5JHBA 2ZGGA 1TJCA 3AU4A 5LOZA 4J8YA 1KT1A 5EKQD 2GRLA 5EN5D 4GTPA 3UQ3A 3ONKA 4BETA 2J4DA 2NXPA 5CCLA 1E8XA 4APOA 2VYIA 2FI7A 4A55A 5EX3A 4TXQA 3FH8A 4GA2A 2NC9A 3AG1E 3C5RA 4CDRA 3SY2A 4I1OB 1OY3D 3ASOE 3EHRA 2PQNA 3ESLA 1HZ4A 3B13A 3Q9NC 3DBSA 3LY8A 3PZ1A 4C9BB 2Y4UA 4Q94A 1BU9A 3TXMA 2MHKA 5ENOD 4ANUA 2YHCA 1E96B 3CVLA 3BQOA 4I2ZA 3ABLE 3D9JA 3J5QB 4GZDA 3PZ2A 2XPZA 3CHQA 4C48B 3P2BA 3Q4AB 2VGXB 4GPMA 3LY7A 1OCZE 3JQ1A 2VQ2A 3SGHA 1O1TA 3JUIA 1D8EA 1HE8A 4B0ZA 3MZLB 3UM0A 2QYJA 4L2LA 4CZ2D 5FZRA 4XZ4A 5KJKA 1K8KG 2MOWA 2WXQA 3CEQA 2IY0C 3TL5A 4GU5A 4JL0A 2J4BA 2IOLA 4JHJA 1DC2A 3ENEA 2V5QC 5A7DB 3B95A 2AXUA 3G2VA 4WWPA 2FO1E 3D9MA 2DVWA 5EX0A 4DX1A 3S7DA 4IYPA 1ELWA 4KVMA 4XIFA 3CHRA 2F8XK 4YDWA 2I9CA 5EIBE 1H6PA 2H6HA 4GPKA 3AS8A 3FHEA 2IU1A 4ILIA 2OV8A 1SA5A 5E75A 2Y0BG 2P9UG 1ELRA 2HM8A 3V2OA 3ZYLA 5BV1A 4HQDA 4EPZA 1TNUA 3TWXA 1V55E 2ONDA 3UIPC 1BI7B 3NF1A 1HF8A 2YHEA 5ENTD 1QBQA 3VLEA 1L5JA 3GZSA 2ZISA 2XZTG 3HXCA 3L16A 3TWVA 3J5PA 5J08A 3L9TA 1H6OA 2VSYA 3R7QA 4O60A 2L0IA 4XEIG 5CHEE 1TNBA 3C3OA 2GRMA 3G2UA 5D0OD 1ZU2A 5BPPA 3L17A 3AS4A 2XCCA 5ANRA 1MX4A 1LF8A 4NRHB 2XS8A 2H6FA 3TAXA 4AY6A 1XGWA 3IKOB 4F3VA 2V5FA 3NBNB 1NI1A 4N5CA 2B0OE 2XGMA 4GTVA 3UM3A 3CQGB 3DEOA 3U64A 4DX7D 4I1AA 3N71A 4Z68A 4LCTA 1HG5A 3PRZA 3EU9A 4GB9A 3RJVA 4LERA 4C0MA 2LSVA 1EDUA 4F6RD 2EIME 3SZ7A 4BTBA 5ARFA 3Q73A 5B1BE 2KBXA 3TJPA 2F8YA 4I6EA 4CRWA 3FTUA 5G05J 3R7RA 3ZU7B 1HG2A 5CEDB 2GRPB 3ESKA 2Y69E 4HOSA 3V2XA 4JA9A 4AJWA 2PQRA 4F53A 2IO2C 1UG3A 3DEPA 3O48A 3W9GA 1WAO1 3T9KA 4UWHA 5A23A 4DLQA 1EPUA 3KSQA 4ILGA 4A3VA 3S7JA 4NACA 2X6IA 2A5EA 1Z6TA 1WY6A 4PS7A 4F1SA 2OVBA 4JEUA 1WG0A 4I1MA 4ILHB 3CKCA 4U8VD 1N54A 1G3NB 4DJAA 4GYWA 1E90A 4YVOA 4A63B 2WPVA 2R05A 3DSXA 4GTSA 3TXNA 5AIJA 2EILE 3ZEFA 5FT9A 4LSZE 1UN8A 2XRYA 1QQEA 3FEXA 2PZIA 2Y3AA 3ABKE 4MKTA 4HRLA 1YYHA 3I4GA 3EDTB 1FT2A 1EF1C 2IEJA 2P9KG 3FU3A 4GYYA 1MJ0A 4MRUA 3CLJA 5CEAA 2X6JA 3L82A 2GGFA 5C2YA 1N94A 4CT4A 4IRUA 3L6AA 2IONA 3ZYQA 3DSVA 3NZSA 4D10C 4L7TA 4JVSA 3FUNA 4BESA 2UY1B 1UJKA 4L9PA 1N4QA 1TJFA 3GZ2A 1A17A 3FUDA 5G55A 3AS5A 1B89A 1NA0A 4RQIA 5FTPA 4Q96A 3QDNA 3NQPA 3B7BA 3MKQA 4N3AA 4G8LA 2LNIA 1N4SA 2DZNA 1JPLA 2VGYA 3SNXA 5T8IA 1S70B 3IHVA 4GTQA 3EHQA 3Q5MA 5AQBA 3ZYKA 4N2QA 4CEMA 3LS8A 3GW4A 2P2CP 2R17C 1HO8A 4CGWA 3BG0B 1UW4B 2BKKB 5FJYA 1K1AA 4BX9A 1LD8A 3CVQA 1SVXA 4TUUA 3ABME 4UQXA 4DX6D 5FWQA 2V0PA 3TWTA 4AV7A 4NQ0A 3MCXA 1D8DA 3U9WA 4JXTA 4V3IA 2AWIA 2EIJE 3MGBA 1IHGA 3KS2A 3ZUVB 3L22A 3ZRHA 3Q15A 2P9SG 3Q75A 3ASDA 2FF4A 4G2VA 4ANVA 5HQ8A 1INZA 3ZHEB 4N5QA 4JD2G 3CSTA 5JJ7A 5J90A 4GCOA 5BT1A 3B7UX 1MZCA 4UQYA 1MHQA 3JQ0A 4URKA 2WQHA 3AJIA 4HLLA 3PE4A 4G26A 1V54E 3S7FA 4U63A 3CQCB 4B8AA 3PE3A 4APFA 1N52A 2OOEA 3HVEA 3DRAA 3E34A 3GYZA 1KZOA 3SO8A 3PZ3A 4M7CA 1U3DA 3ULYA 2NSZA 2FO7A 3DXKG
chains in the Genus database with same CATH topology
1Z5SC 2GRPB 3UIOC 2IY0C 2GRRB 3UIPC 2GRQB 2GRNB 2IO3C 5D2MC 1KPSB 2GROB 3UINC 2IO2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5S C;  2GRP B;  3UIO C;  2IY0 C;  2GRR B;  3UIP C;  2GRQ B;  2GRN B;  2IO3 C;  5D2M C;  1KPS B;  2GRO B;  3UIN C;  2IO2 C; 
#chains in the Genus database with same CATH topology
 3RU0 A;  5FZS A;  4J7W A;  2B6C A;  3FTY A;  2R5S A;  5LCW J;  1N95 A;  2KZT A;  3EUV A;  4EBA G;  5HI7 A;  3ZPJ A;  5CMW A;  5T3R A;  1Y8M A;  4LNU D;  2RG8 A;  5D2M C;  1NP7 A;  1NA3 A;  3SFZ A;  2DYS E;  2JEK A;  4AVX A;  4EHM A;  3VLD A;  5HS0 A;  3CVW A;  4WUY A;  3CGH A;  2BF0 X;  3LCA A;  4ZHB A;  1IYG A;  2KCK A;  2LAH A;  4JC8 A;  3CV0 A;  1O1R A;  3PS6 A;  3DPD A;  5G04 J;  3IHY A;  4LNG A;  1SW6 A;  2WXJ A;  3ZKJ A;  4GMR A;  3APC A;  3FU5 A;  5AN8 A;  2JAB A;  4GML A;  1OWM A;  2PL2 A;  5AQ7 A;  5KCM A;  1BLX B;  3HXF A;  3PEV B;  5FQ8 A;  2E2E A;  5FQ7 A;  1LD7 A;  2VTB A;  4BT9 A;  3LJ3 A;  1UOH A;  2VGX A;  2OVF A;  3LVR E;  2CHZ A;  3JXI A;  2I6H A;  4BT8 A;  2DWZ A;  2P58 C;  2YQ8 A;  4HOR A;  4E85 A;  4ANX A;  4I2W A;  3ZN3 A;  2L0T B;  3SD5 A;  3NB2 A;  3PNT B;  3X2Q E;  1HH8 A;  4FAD A;  3T8K A;  3HHM A;  3APF A;  2WXH A;  2FBN A;  2RKK A;  4PH4 B;  2BTD A;  2XEN A;  3HXB A;  3JUE A;  1PY1 A;  2WXO A;  4U8Y D;  3G2W A;  4UI9 J;  2F0Y A;  2ILR A;  4U0Z A;  3IEG A;  3SBS A;  5FIO A;  3PZ4 A;  2WMO A;  3T8M A;  3K9I A;  1OWN A;  3UKR G;  2XEV A;  5AQA A;  4GA1 A;  4K0R A;  3QAQ A;  3RRN B;  2XZD G;  4A1G A;  4EEC A;  1O5M A;  4IUL A;  3ONL A;  3UT8 A;  3QWW A;  4GA0 A;  2QZA A;  1HU3 A;  3ZIM A;  3B7S A;  3I4R B;  1E7V A;  3C3R A;  1OWO A;  3CVY A;  1WM5 A;  3FH7 A;  4TUM A;  4XX5 A;  1TN6 A;  3Q9U C;  3FTW A;  3ZVV A;  3DPY A;  2DIW A;  1YMP A;  4A1S A;  3NOG D;  2PM7 A;  4BY6 A;  4YVQ C;  5CMY A;  4UQZ A;  4CYM D;  3KSL A;  4HLE A;  4YDO A;  3ZXS A;  2ETA A;  2VSX E;  1W3B A;  4DX5 D;  3ZFW A;  1MX6 A;  3B7T A;  3LPZ A;  4JPS A;  4HNA D;  1E8Y A;  2KCV A;  3MJW A;  2P9I G;  1X81 A;  3PZD A;  3FUJ A;  2FUL A;  1VDY A;  4TXP A;  4UI9 K;  5BXO A;  3AAA C;  4FLB A;  4G25 A;  2EQX A;  1TR4 A;  3CVN A;  4YND A;  2BKG A;  4U96 D;  1H2V C;  4PS8 A;  4EZK A;  3L13 A;  3C3Q A;  3E33 A;  4JA7 A;  5G2N A;  2KC7 A;  3SFY A;  1OUV A;  4UI9 C;  1H2U A;  3OTN A;  1JCQ A;  4H7X A;  4HOU A;  3HXD A;  4FLH A;  2AXZ A;  3TWQ A;  2ZGD A;  4HBD A;  1OCO E;  3AG3 E;  2ETC A;  3KEA A;  1N0Q A;  2WXM A;  5AAO A;  4HS2 A;  4FJZ A;  3TG5 A;  3MV3 B;  2V4H C;  3FUI A;  4J8D A;  5KNH D;  3FFL A;  3KAE A;  4ACL A;  1XNF A;  2FEZ A;  3Q7A A;  1ZBP A;  2XRZ A;  3EIQ C;  4IN3 B;  3UX4 A;  2LAI A;  4WNF A;  3FEY A;  4GTO A;  2CHW A;  2WXP A;  3SF4 A;  1TNO A;  3PEU B;  3RO3 A;  3ZYM A;  4GZC A;  1HS6 A;  2A4Z A;  4Y6W A;  4AM9 A;  3PDN A;  3Q7F A;  2WXK A;  3MEK A;  3OXG A;  2CHX A;  1TEZ A;  4GTM A;  4B8C B;  3NOC D;  5ANL A;  1SZ9 A;  3UIO C;  2GRO B;  3VLF A;  1UN9 A;  4PUC A;  2AXV A;  4MLP A;  1UJJ A;  4WWO A;  2X6K A;  4B93 B;  4JEH A;  4FU3 A;  1LTX A;  2J8S D;  1N0R A;  5FQ6 A;  3QOU A;  5FQ4 A;  4BSX A;  3LKU A;  4KXK B;  4U04 A;  3UIN C;  3HRA A;  5HRY A;  3EJN A;  3FU6 A;  3UI2 A;  3CK7 A;  2PNN A;  4BTA A;  4WNG A;  3Q78 A;  5KBA A;  1KPS B;  5KNG A;  5AJD A;  2J09 A;  4XKB A;  1HXI A;  3W9F A;  3DWL G;  5D66 A;  5CBN A;  2X6F A;  4F1P A;  2KM4 A;  1IKN D;  3E30 A;  2YIN A;  2VSO E;  4NIK A;  3S2A A;  3MV2 B;  4J8E A;  3RO2 A;  1FVH A;  1S0P A;  3L54 A;  4KZ0 A;  3ASN E;  2PM6 A;  3QKY A;  5G05 C;  1NL4 A;  4ABN A;  1WDY A;  3OXF A;  3C98 A;  3MKQ B;  4L1B A;  2AW6 A;  4LNB A;  3FUM A;  3SBT B;  1U2V G;  3PH0 C;  5JJT A;  4P29 A;  1MYO A;  1Z3Y A;  3CK9 A;  3V79 K;  5CBO A;  4ACK A;  1H0A A;  3B7R L;  2BUG A;  3CVX A;  4LRZ A;  5AAR A;  3LDZ A;  4CDM A;  5CER B;  3WXX A;  4CDN A;  4HB5 A;  1OCC E;  3WG7 E;  4CCA A;  4OVU A;  2X38 A;  4FP7 A;  4ME2 A;  1KZP A;  4KMO A;  3I5P A;  4J6I A;  1U3C A;  3PRE A;  1X5B A;  4XE0 A;  4UWF A;  2V8S E;  4W9R A;  3SQV A;  2NYJ A;  3FH5 A;  3HG0 D;  5AYW D;  3UKU G;  5C1D A;  5BW8 C;  4FA6 A;  5LFA A;  2E0I A;  2RD0 A;  1HX8 A;  4I6J A;  1E8W A;  3S7B A;  4AP2 A;  2H6I A;  3MX3 A;  4DPR A;  3FUL A;  2IOS A;  1KT0 A;  2EIN E;  4RLY A;  4U7E B;  2I1J A;  3V30 A;  1QZ2 A;  1Y6I A;  1TN8 A;  1E8Z A;  4DRX E;  5ENQ D;  3LXU X;  4UUC A;  2J07 A;  4R7L A;  2QFC A;  2ZU6 B;  2Y4T A;  3CVU A;  3IBE A;  4HI9 A;  3BU8 A;  1EYH A;  4HOQ A;  5IY5 E;  3LJN A;  1SA4 A;  4DK5 A;  3IXE A;  2LO6 A;  3RAU A;  3HVE B;  4GZ5 A;  2LXL A;  3SFX A;  3FTX A;  2AVP A;  3Q47 B;  4WAF A;  1H6K A;  3FUE A;  3PVL A;  4X8Q A;  3Q79 A;  3UTM A;  2C0M A;  1YCS B;  1DCE A;  2P9P G;  2VGE A;  3F6Q A;  4G8K A;  5EDS A;  1Q2Z A;  4K5B A;  4GZ6 A;  4K03 A;  2GRN B;  2HE0 A;  2OEV A;  2KZT B;  4B89 A;  4O6F A;  1FT1 A;  1AWC B;  3NZU A;  1S63 A;  1RW2 A;  1RZ4 A;  1DNP A;  3TWW A;  1YA0 A;  2WM9 A;  3AG4 E;  3ASH A;  4L2Y A;  3E32 A;  3QJZ A;  5CCM A;  2R03 A;  4DUI A;  3T5X A;  2XCB A;  4FHK A;  2WMN A;  5ENP D;  4MBG A;  1N4R A;  3FUF A;  1HFA A;  4Y6C A;  2DBA A;  4ZFH A;  3SI5 A;  4Q69 A;  1OXJ A;  4G11 A;  2VJ8 A;  3DXM G;  4B94 A;  1Z3X A;  3FUH A;  2OEW A;  2OCC E;  2Y1L E;  2X3M A;  3TWS A;  3PUK A;  4K5C A;  4JZY A;  1N4P A;  1AP7 A;  4FHJ A;  3Q49 B;  4G24 A;  4GTT A;  4OVV A;  4DX2 A;  2MRI A;  3CVP A;  4WND A;  3O4Z A;  2ZIR A;  3KD7 A;  4HFG A;  2VTB B;  5JHA A;  1DCQ A;  2LSU A;  3D9O A;  3V31 A;  5EYP F;  3TWR A;  3FTV A;  2JLB A;  1QNF A;  2HO1 A;  4RVB A;  3DST A;  3UT4 A;  4N3B A;  4GZ3 A;  3EU5 A;  2J9Q A;  4AOF A;  3ML9 A;  1K3Z D;  2XPI A;  3RRU A;  4JHK A;  4L23 A;  2I1K A;  4U0S A;  3RK6 A;  4KZC A;  1IQR A;  3P1U A;  5EIL A;  3FUK A;  5KJN A;  5M72 A;  4DI4 A;  5BNW A;  3QC1 A;  2DYR E;  1JUQ A;  4H7Y A;  4CGV A;  5A6C A;  3ZW3 A;  2XPY A;  5LCW C;  3CKB A;  1PC2 A;  3ISM C;  2J08 A;  3CHS A;  2ZXW E;  1SQM A;  2P9N G;  3FTS A;  3AU5 A;  3CHO A;  3KEZ A;  2C0L A;  2WXI A;  4QQI A;  1S64 A;  3UUX A;  4LG6 A;  2KXP C;  4LEU A;  2VSN A;  5JMN D;  1GW6 A;  4U8H A;  5AQ9 A;  1ZB1 A;  3U3W A;  4BSZ B;  1JCR A;  2GW1 A;  3FDH A;  1N11 A;  3TGO A;  4TXR A;  1MX2 A;  4AEZ C;  1Z5S C;  1OT8 A;  3FP3 A;  4YDE A;  2WXF A;  3CR3 A;  3HYM B;  4U0U A;  5D0Q D;  5JA4 D;  1NFI E;  3EHM A;  3MA5 A;  5BUZ A;  4I43 A;  4N3C A;  1OCR E;  3U4T A;  5G04 C;  3R9A B;  3R9M A;  3JYS A;  4E6H A;  2HR2 A;  2P9L G;  2XEE A;  4A3T A;  1N9A A;  3FWV A;  5AJL A;  4G23 A;  4NUR A;  5LP0 A;  4KVO A;  3D9K A;  3ML8 A;  3UXG A;  3UPV A;  3ULQ A;  4BX8 A;  3GZ1 A;  1TN7 A;  4ANW A;  4N2S A;  4HRM B;  3CHM A;  3DSU A;  3QNK A;  1JWG A;  1MQS A;  1D9S A;  3QB2 A;  1IXV A;  4FC8 A;  4OYS A;  1FCH A;  4I9C A;  4OAV B;  4GYO A;  4RG6 A;  3QK0 A;  2LXM A;  3CK8 A;  4HVB A;  4ATG A;  2IQC A;  4TRQ A;  3HIZ A;  2IF4 A;  2WQ6 A;  5ITZ F;  3ASG A;  2DZO A;  2DCP A;  4GTR A;  5CRV A;  3URZ A;  4WNE A;  5FIN A;  5H7P A;  3LYA A;  2WB2 A;  2KAT A;  1IHB A;  2I2O A;  3ZXP A;  4OAU C;  3HXE A;  3E37 A;  2XGS A;  4J8S A;  3HDX A;  3IV0 A;  5E76 A;  5ARG A;  4EBA A;  2UWJ G;  2QC9 A;  3JXJ A;  2X6H A;  4DI3 A;  3C72 A;  3LY9 A;  4JB8 P;  1OWL A;  4UWL A;  4K5A B;  2IFU A;  4O1O A;  2XGO A;  3BEE A;  2V4L A;  4FUL A;  4GCN A;  3BUA A;  4BEP A;  5FZQ A;  4QFV A;  2IJG X;  4YDY A;  3TWU A;  4CT0 A;  4AIF A;  2QY7 A;  3I3N A;  4RG9 A;  5AEN A;  4RSY A;  3ZNG A;  1H19 A;  2L9B A;  4KBQ A;  3LVQ E;  2H6G A;  1JCS A;  2HYZ A;  2M63 A;  4EQF A;  2QYU A;  3EIJ A;  2GRR B;  1FVF A;  4EZJ A;  3EHN A;  4KT6 B;  2J49 A;  5KJM A;  3D9P A;  4BER A;  4HI8 A;  4HXI A;  3UMV A;  3OAW A;  3UM1 A;  3RKV A;  3D9N A;  3G2T A;  3VTY A;  1BPO A;  2L6B A;  4PS3 A;  2WXR A;  2WVI A;  5ENR D;  2F37 A;  5LX8 A;  2AJA A;  3DSW A;  5JJ6 A;  4MS6 A;  2EIK E;  5EYL A;  2RFA A;  3CVV A;  4J0U A;  3QWV A;  2A5U A;  3LEW A;  1SZA A;  3U66 A;  4M3O A;  1FPP A;  3D9H A;  3FY4 A;  4GAA A;  1TYQ G;  3BG1 B;  2R59 A;  3CHP A;  1E7U A;  1O1S A;  2YNQ A;  1K1B A;  1BI8 B;  4J8F A;  5B1A E;  4ATZ D;  2CFU A;  1KLX A;  4BWR A;  5DBK A;  1H2T C;  3G2S A;  3ULE G;  1TNZ A;  2GRQ B;  4AXH A;  1BD8 A;  2XQ0 A;  3MKR A;  4G1T A;  4JHR A;  2CG2 A;  2UY1 A;  4F7A A;  4AY5 A;  2LUH A;  3MYV A;  4U07 A;  2MYO A;  2XHE A;  2XS1 A;  2WQ7 A;  2L6J A;  2CFZ A;  5T4Y A;  5B3S E;  3QWP A;  4N39 A;  2R2L A;  3CIA A;  1P5Q A;  5DIZ A;  3E4B A;  2BED A;  4C0E A;  3PUJ A;  2ETB A;  3SHF A;  1A5E A;  3D9I A;  1DVP A;  1QYM A;  4TV3 A;  3QAR A;  4JW1 A;  2RFM A;  5EID A;  3D9L A;  2WXL A;  1NZN A;  4XI9 A;  3T5V A;  4GMJ A;  4LUN U;  4UWG A;  3FU0 A;  3D3M A;  1IQU A;  4I9E A;  5CRU A;  4I6G A;  5BV0 A;  3VTX A;  4I17 A;  3L08 A;  3NAW A;  3APD A;  3ASF A;  3JCK C;  1OWP A;  3OXL A;  2CG3 A;  5CEC B;  3TG4 A;  3CSF A;  5ENN A;  3FTZ A;  2C2L A;  4UWK A;  2R02 A;  2IO3 C;  4U95 D;  4XKC A;  2WXG A;  4O1P A;  4BFR A;  4EZL A;  5BXU A;  4WWN A;  5KWD A;  2XEH A;  1PAQ A;  2WXN A;  1TNY A;  5HKP A;  1JWF A;  4DLO A;  4PDX A;  3ZHE A;  3AG2 E;  4XI0 A;  3RRM B;  3UT7 A;  4FJY A;  1ELK A;  5ENS D;  3PNL B;  3ZGQ A;  4HRN A;  3RSE G;  4HOT A;  3DSS A;  2Q7F A;  5KJL A;  2KCL A;  3RIB A;  4KYO B;  3UM2 A;  5JHB A;  2ZGG A;  1TJC A;  3AU4 A;  5LOZ A;  4J8Y A;  1KT1 A;  5EKQ D;  2GRL A;  5EN5 D;  4GTP A;  3UQ3 A;  3ONK A;  4BET A;  2J4D A;  2NXP A;  5CCL A;  1E8X A;  4APO A;  2VYI A;  2FI7 A;  4A55 A;  5EX3 A;  4TXQ A;  3FH8 A;  4GA2 A;  2NC9 A;  3AG1 E;  3C5R A;  4CDR A;  3SY2 A;  4I1O B;  1OY3 D;  3ASO E;  3EHR A;  2PQN A;  3ESL A;  1HZ4 A;  3B13 A;  3Q9N C;  3DBS A;  3LY8 A;  3PZ1 A;  4C9B B;  2Y4U A;  4Q94 A;  1BU9 A;  3TXM A;  2MHK A;  5ENO D;  4ANU A;  2YHC A;  1E96 B;  3CVL A;  3BQO A;  4I2Z A;  3ABL E;  3D9J A;  3J5Q B;  4GZD A;  3PZ2 A;  2XPZ A;  3CHQ A;  4C48 B;  3P2B A;  3Q4A B;  2VGX B;  4GPM A;  3LY7 A;  1OCZ E;  3JQ1 A;  2VQ2 A;  3SGH A;  1O1T A;  3JUI A;  1D8E A;  1HE8 A;  4B0Z A;  3MZL B;  3UM0 A;  2QYJ A;  4L2L A;  4CZ2 D;  5FZR A;  4XZ4 A;  5KJK A;  1K8K G;  2MOW A;  2WXQ A;  3CEQ A;  2IY0 C;  3TL5 A;  4GU5 A;  4JL0 A;  2J4B A;  2IOL A;  4JHJ A;  1DC2 A;  3ENE A;  2V5Q C;  5A7D B;  3B95 A;  2AXU A;  3G2V A;  4WWP A;  2FO1 E;  3D9M A;  2DVW A;  5EX0 A;  4DX1 A;  3S7D A;  4IYP A;  1ELW A;  4KVM A;  4XIF A;  3CHR A;  2F8X K;  4YDW A;  2I9C A;  5EIB E;  1H6P A;  2H6H A;  4GPK A;  3AS8 A;  3FHE A;  2IU1 A;  4ILI A;  2OV8 A;  1SA5 A;  5E75 A;  2Y0B G;  2P9U G;  1ELR A;  2HM8 A;  3V2O A;  3ZYL A;  5BV1 A;  4HQD A;  4EPZ A;  1TNU A;  3TWX A;  1V55 E;  2OND A;  3UIP C;  1BI7 B;  3NF1 A;  1HF8 A;  2YHE A;  5ENT D;  1QBQ A;  3VLE A;  1L5J A;  3GZS A;  2ZIS A;  2XZT G;  3HXC A;  3L16 A;  3TWV A;  3J5P A;  5J08 A;  3L9T A;  1H6O A;  2VSY A;  3R7Q A;  4O60 A;  2L0I A;  4XEI G;  5CHE E;  1TNB A;  3C3O A;  2GRM A;  3G2U A;  5D0O D;  1ZU2 A;  5BPP A;  3L17 A;  3AS4 A;  2XCC A;  5ANR A;  1MX4 A;  1LF8 A;  4NRH B;  2XS8 A;  2H6F A;  3TAX A;  4AY6 A;  1XGW A;  3IKO B;  4F3V A;  2V5F A;  3NBN B;  1NI1 A;  4N5C A;  2B0O E;  2XGM A;  4GTV A;  3UM3 A;  3CQG B;  3DEO A;  3U64 A;  4DX7 D;  4I1A A;  3N71 A;  4Z68 A;  4LCT A;  1HG5 A;  3PRZ A;  3EU9 A;  4GB9 A;  3RJV A;  4LER A;  4C0M A;  2LSV A;  1EDU A;  4F6R D;  2EIM E;  3SZ7 A;  4BTB A;  5ARF A;  3Q73 A;  5B1B E;  2KBX A;  3TJP A;  2F8Y A;  4I6E A;  4CRW A;  3FTU A;  5G05 J;  3R7R A;  3ZU7 B;  1HG2 A;  5CED B;  2GRP B;  3ESK A;  2Y69 E;  4HOS A;  3V2X A;  4JA9 A;  4AJW A;  2PQR A;  4F53 A;  2IO2 C;  1UG3 A;  3DEP A;  3O48 A;  3W9G A;  1WAO 1;  3T9K A;  4UWH A;  5A23 A;  4DLQ A;  1EPU A;  3KSQ A;  4ILG A;  4A3V A;  3S7J A;  4NAC A;  2X6I A;  2A5E A;  1Z6T A;  1WY6 A;  4PS7 A;  4F1S A;  2OVB A;  4JEU A;  1WG0 A;  4I1M A;  4ILH B;  3CKC A;  4U8V D;  1N54 A;  1G3N B;  4DJA A;  4GYW A;  1E90 A;  4YVO A;  4A63 B;  2WPV A;  2R05 A;  3DSX A;  4GTS A;  3TXN A;  5AIJ A;  2EIL E;  3ZEF A;  5FT9 A;  4LSZ E;  1UN8 A;  2XRY A;  1QQE A;  3FEX A;  2PZI A;  2Y3A A;  3ABK E;  4MKT A;  4HRL A;  1YYH A;  3I4G A;  3EDT B;  1FT2 A;  1EF1 C;  2IEJ A;  2P9K G;  3FU3 A;  4GYY A;  1MJ0 A;  4MRU A;  3CLJ A;  5CEA A;  2X6J A;  3L82 A;  2GGF A;  5C2Y A;  1N94 A;  4CT4 A;  4IRU A;  3L6A A;  2ION A;  3ZYQ A;  3DSV A;  3NZS A;  4D10 C;  4L7T A;  4JVS A;  3FUN A;  4BES A;  2UY1 B;  1UJK A;  4L9P A;  1N4Q A;  1TJF A;  3GZ2 A;  1A17 A;  3FUD A;  5G55 A;  3AS5 A;  1B89 A;  1NA0 A;  4RQI A;  5FTP A;  4Q96 A;  3QDN A;  3NQP A;  3B7B A;  3MKQ A;  4N3A A;  4G8L A;  2LNI A;  1N4S A;  2DZN A;  1JPL A;  2VGY A;  3SNX A;  5T8I A;  1S70 B;  3IHV A;  4GTQ A;  3EHQ A;  3Q5M A;  5AQB A;  3ZYK A;  4N2Q A;  4CEM A;  3LS8 A;  3GW4 A;  2P2C P;  2R17 C;  1HO8 A;  4CGW A;  3BG0 B;  1UW4 B;  2BKK B;  5FJY A;  1K1A A;  4BX9 A;  1LD8 A;  3CVQ A;  1SVX A;  4TUU A;  3ABM E;  4UQX A;  4DX6 D;  5FWQ A;  2V0P A;  3TWT A;  4AV7 A;  4NQ0 A;  3MCX A;  1D8D A;  3U9W A;  4JXT A;  4V3I A;  2AWI A;  2EIJ E;  3MGB A;  1IHG A;  3KS2 A;  3ZUV B;  3L22 A;  3ZRH A;  3Q15 A;  2P9S G;  3Q75 A;  3ASD A;  2FF4 A;  4G2V A;  4ANV A;  5HQ8 A;  1INZ A;  3ZHE B;  4N5Q A;  4JD2 G;  3CST A;  5JJ7 A;  5J90 A;  4GCO A;  5BT1 A;  3B7U X;  1MZC A;  4UQY A;  1MHQ A;  3JQ0 A;  4URK A;  2WQH A;  3AJI A;  4HLL A;  3PE4 A;  4G26 A;  1V54 E;  3S7F A;  4U63 A;  3CQC B;  4B8A A;  3PE3 A;  4APF A;  1N52 A;  2OOE A;  3HVE A;  3DRA A;  3E34 A;  3GYZ A;  1KZO A;  3SO8 A;  3PZ3 A;  4M7C A;  1U3D A;  3ULY A;  2NSZ A;  2FO7 A;  3DXK G; 
#chains in the Genus database with same CATH homology
 1Z5S C;  2GRP B;  3UIO C;  2IY0 C;  2GRR B;  3UIP C;  2GRQ B;  2GRN B;  2IO3 C;  5D2M C;  1KPS B;  2GRO B;  3UIN C;  2IO2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...