2GRPB

Crystal structure of human rangap1-ubc9-y87a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
157
structure length
157
Chain Sequence
PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 56
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grpB00
2GRRB 5D2MC 2GRNB 2GRPB 3UIOC 1Z5SC 1KPSB 2IO3C 2IY0C 2GROB 2IO2C 3UIPC 3UINC 2GRQB
chains in the Genus database with same CATH superfamily
2LAIA 4AXHA 4NACA 5DBKA 2OEWA 3IKOB 4HOTA 5HS0A 4F1SA 3FUIA 2J49A 4G2VA 3D9KA 3L54A 3CHQA 2KZTB 1MQSA 4GMLA 2KC7A 3LXUX 2WXKA 3CVYA 4ATGA 5ENRD 4A55A 5JHAA 2WXHA 2RFMA 3PUJA 3ZNGA 4RG6A 3LDZA 2ZU6B 2XS1A 3DRAA 2VGYA 3ML8A 4Y6CA 3QB2A 1U2VG 1Z5SC 3SF4A 3NOCD 4HOQA 4J0UA 2XEVA 5CECB 4HNAD 3PRZA 4JHKA 5LCWC 4CGWA 4FA6A 1KT1A 2X6IA 2AVPA 3APFA 1TN8A 3CK8A 2IOSA 3RAUA 3RKVA 5CMYA 3PNLB 1H6OA 3FUNA 2IEJA 2WQ6A 3GW4A 1JWGA 3ZEFA 3JYSA 3UIPC 2WQHA 3UT7A 1IQUA 5BXUA 3ONLA 3KAEA 3D9NA 2XZTG 3B95A 4H7YA 1TEZA 4GTVA 1Z6TA 1XGWA 4GZ3A 2RKKA 3EHMA 2ZIRA 4EZKA 3SBTB 3O48A 1HG5A 4QQIA 5HRYA 2KATA 4M7CA 2WXRA 4GTTA 2CFUA 3TWRA 4D10C 2H6FA 3CVLA 1FT1A 3KD7A 3CQGB 3TGOA 4GMJA 3ZKJA 3HDXA 2IO3C 4IULA 2L9BA 3FDHA 2J8SD 4LNBA 2EQXA 4YDEA 1SA4A 4UWFA 3L16A 3Q75A 4BEPA 3QJZA 4U96D 4APOA 2VGXB 4UWHA 4B94A 3SFYA 4L2YA 2DCPA 5HKPA 2XEEA 3CK9A 4RSYA 2DYRE 4GZDA 2IQCA 3KSQA 5BV0A 4OVVA 2ZGGA 3FTUA 5EYPF 4LRZA 4PDXA 2JABA 4HLLA 3G2VA 5E76A 4HI8A 3FUMA 3CVQA 4AOFA 3EU9A 1HS6A 4YVOA 4I1OB 3CVWA 3PEVB 5E75A 4ATZD 5LX8A 4GTRA 1TN6A 4EQFA 3ZN3A 4FADA 1JWFA 1E96B 3MJWA 3V2OA 3NAWA 3Q79A 3C5RA 3Q5MA 5J90A 1ELRA 3ISMC 1DC2A 4F3VA 4C9BB 2YNQA 5EKQD 3FUFA 2KXPC 3AS8A 4I6EA 4GYWA 5FZSA 1TNBA 2XZDG 3X2QE 3QWPA 2I6HA 3RK6A 4GZCA 2FF4A 3UKUG 3FU0A 3U66A 4MS6A 3HXEA 1B89A 2M63A 3SFZA 3C3RA 2GRQB 3ZUVB 4H7XA 2E0IA 1IYGA 2NXPA 1E8ZA 1K1BA 3CGHA 3ZW3A 3J5QB 5B1BE 4BSZB 3PZ1A 2F37A 4O60A 5FJYA 3P2BA 4NQ0A 2VTBB 2A5EA 3UQ3A 1HO8A 1MX2A 3QKYA 3UXGA 1OWOA 3FWVA 3ULQA 3TWTA 5EX0A 4G1TA 4L2LA 4Y6WA 4HVBA 1E8WA 3D3MA 4DRXE 3LY9A 4ILGA 2J9QA 2BUGA 2XQ0A 1S70B 3PZDA 4ILHB 3KEAA 5KJLA 2AXUA 4ANWA 3IBEA 3OXGA 2EINE 3NZUA 2OV8A 2AXZA 2PM7A 3CR3A 3TG4A 3LS8A 1FT2A 1HXIA 3LVRE 2Y1LE 3W9GA 3FU3A 3CKBA 2IF4A 4JC8A 2WB2A 1UG3A 4DX2A 5IY5E 3MKQB 5CERB 3CHMA 3E33A 2VGEA 4JA7A 4K5AB 3L08A 4U95D 3R7QA 5FQ6A 5KCMA 5A7DB 2XRZA 3SHFA 1IHBA 2C0MA 4G24A 2HR2A 5D66A 4WUYA 4FHKA 3UPVA 3UKRG 3NZSA 3HXFA 4WNFA 2P9UG 1BPOA 3TXMA 2X6KA 2ONDA 4XX5A 3APDA 4CT0A 4DX6D 3P1UA 4CRWA 4N5CA 5LFAA 3KEZA 3CVNA 4PS8A 4F1PA 1BD8A 2P2CP 2RG8A 2XHEA 4AJWA 3BUAA 3G2WA 3E30A 3Q9NC 4PS7A 3AJIA 4GTOA 3IV0A 2X3MA 3OXLA 3UM1A 5CEAA 4UQYA 1G3NB 2V4HC 3FUEA 1AWCB 2E2EA 5ITZF 3DPDA 1BI7B 3RSEG 4A3TA 3UX4A 4UI9J 1EPUA 1ZB1A 4FLBA 3DSSA 1O1SA 3JQ0A 5EIBE 3AAAC 3C3OA 4YDWA 4B0ZA 3FTWA 3E34A 5EX3A 4LCTA 4I43A 4JD2G 3G2TA 4A3VA 2J4BA 1TJFA 1JCRA 4KYOB 2KZTA 5A6CA 5HI7A 4EPZA 4JZYA 4JHJA 5ENNA 1FVFA 2R05A 4ANVA 4B89A 1NA3A 3VLEA 4HRNA 4LERA 3EIJA 5G55A 3FEXA 3Q47B 5EDSA 4NIKA 3L9TA 5CCLA 1LF8A 3RJVA 3Q7AA 4QFVA 3CLJA 1NZNA 2P9NG 4DJAA 1PC2A 4M3OA 4U07A 1HX8A 3FU5A 1X81A 5KJNA 1Q2ZA 3ZXPA 1H19A 3ZIMA 4DX7D 4TXRA 4U04A 2C0LA 2IOLA 1OCRE 4BESA 4ZHBA 2WVIA 2CHWA 4HI9A 1N95A 5BPPA 5BT1A 3ZVVA 3ZHEB 5CMWA 4AIFA 1JPLA 1FVHA 2IFUA 4PS3A 4I17A 3LCAA 3L22A 1MHQA 2WXOA 1X5BA 4LUNU 1KZOA 4G25A 1RW2A 4XKCA 1N94A 1E7VA 1D8DA 3DSTA 3SQVA 3GYZA 1WDYA 2BTDA 4GCOA 4KMOA 1LD8A 3ASFA 1Y6IA 1KT0A 1N0RA 1K3ZD 3EJNA 3CIAA 5ANRA 5ENSD 2ZXWE 4DPRA 2AJAA 5EIDA 4JA9A 3HXCA 2PNNA 3DBSA 5ENQD 3TWQA 3SI5A 2Y4TA 3FTSA 1HZ4A 2XRYA 2IONA 4MBGA 4UWLA 1KZPA 3C72A 2CG2A 1NL4A 4XIFA 4A63B 2R17C 3LY7A 2L0IA 5DIZA 3MGBA 3I5PA 1OWPA 5D2MC 2H6GA 1DVPA 2XGOA 4UWGA 3U9WA 4GZ5A 2VGXA 3GZ2A 3HVEB 4Z68A 2YINA 2VYIA 2HYZA 1SVXA 1JCSA 3TJPA 3LEWA 1TNYA 5C1DA 5LCWJ 1U3DA 3GZ1A 4OAUC 1ZBPA 2DVWA 1IKND 3SD5A 2Y4UA 3MYVA 4J8EA 3ABKE 4XKBA 4L23A 4L9PA 5FT9A 3TAXA 3S7BA 2KM4A 2PL2A 4CDRA 2V5FA 4KXKB 2BF0X 3Q78A 1JUQA 2V8SE 4I6JA 4GTMA 3ASGA 3UTMA 3BG0B 3UT8A 4AEZC 1A5EA 3MA5A 3PE4A 5BV1A 2XCBA 2PQRA 3AS5A 2Y3AA 1INZA 4LEUA 3BU8A 3SZ7A 1S0PA 4DK5A 3ESLA 2WXMA 3LY8A 4RQIA 3UM0A 3FHEA 5FZQA 4F53A 5ARGA 2XPYA 3ESKA 2WM9A 1V55E 2AWIA 5ENTD 3ZYMA 2RFAA 2I1JA 4NURA 1SZ9A 3D9JA 1XNFA 3QK0A 3HG0D 3SNXA 4N2SA 4IN3B 4ACKA 4HXIA 3RIBA 4BT8A 3CV0A 4I2WA 5FZRA 4ILIA 5CEDB 2CHXA 3UM3A 1UJKA 4BERA 2R2LA 2VTBA 3S7FA 2FBNA 2XENA 2GRRB 3UUXA 3UT4A 3FTZA 3IHYA 4IYPA 3PEUB 5B1AE 4I1MA 5G05J 2DBAA 3PZ4A 2EILE 2X6FA 1MZCA 3V30A 2V5QC 2NC9A 1O1TA 4I9EA 3Q4AB 4GA1A 4GPMA 4E85A 4C0EA 5KWDA 2OCCE 4PUCA 4U0UA 2P9KG 2P9PG 5FINA 1D9SA 2J4DA 2WXLA 3DSUA 4IRUA 4GA2A 3CSTA 1W3BA 5D0OD 4BY6A 4CDNA 4DI3A 1E8XA 2ETAA 4KZ0A 1MJ0A 1N54A 4AVXA 3MKQA 1A17A 2QYUA 5AJLA 3TWSA 4XI0A 5M72A 1OT8A 5AYWD 2YHCA 3PVLA 4FLHA 3NOGD 3R9AB 4G11A 4J6IA 3CHSA 3FTYA 5CRVA 3R7RA 1BLXB 1FCHA 4BT9A 3T5XA 4FJZA 5BUZA 4GTQA 3SFXA 5AAOA 3Q15A 2I2OA 4OYSA 2BKGA 3C3QA 2P9IG 2WQ7A 3PUKA 1ELKA 4MLPA 3FP3A 3RRNB 3OAWA 1L5JA 3SO8A 3FH8A 1TR4A 3V79K 1YA0A 1OCOE 3JUIA 2WXIA 3LPZA 4LG6A 4J8YA 3W9FA 2QYJA 5JMND 4XE0A 4EBAG 4URKA 3HRAA 3D9IA 4JVSA 3PE3A 2GRMA 4ACLA 4A1GA 3MZLB 3G2SA 4TUUA 4L7TA 3ASHA 3PNTB 4LNUD 2LXMA 5ENOD 2HE0A 5AJDA 3QWVA 3UIOC 4GYYA 1BI8B 2B6CA 1OCZE 2Y69E 1S63A 3Q7FA 5KJKA 4B93B 2XS8A 3BG1B 5JJ6A 4U8HA 3JUEA 4K5BA 4W9RA 3JXIA 1D8EA 5HQ8A 2I9CA 4WNEA 4JEHA 3D9HA 4FC8A 1DNPA 3PH0C 2R03A 2QFCA 2XGMA 3L17A 3OTNA 3FUDA 1LD7A 4EZJA 4BFRA 4WWPA 2EIKE 1UN9A 3LJNA 3JXJA 2VQ2A 2V4LA 5CCMA 3WG7E 5KJMA 4GA0A 4ZFHA 1HE8A 2X6HA 3D9OA 4Q96A 1WY6A 4AP2A 3N71A 2GRLA 3ASOE 3EDTB 3BQOA 3IEGA 3L6AA 4WWNA 5FTPA 4ABNA 3ZHEA 2A5UA 3AU4A 1NA0A 4GCNA 3RO2A 4MRUA 4E6HA 3DSWA 2ETCA 3ULYA 1FPPA 3LVQE 4G8LA 4GU5A 4XI9A 4BETA 3DPYA 4U8YD 5B3SE 1MYOA 4YNDA 2PM6A 2X6JA 4WNDA 5G04J 4DLQA 3NB2A 2L6BA 3ZGQA 4RVBA 1N4RA 1IQRA 1P5QA 4DX1A 5FQ8A 5CBOA 3GZSA 3NQPA 1TN7A 4CDMA 3IXEA 2KCLA 1E90A 3L82A 3WXXA 3MCXA 3E4BA 3FY4A 2UY1B 4X8QA 3KS2A 4GB9A 5AQ7A 2JLBA 2IO2C 3FU6A 2XEHA 3FULA 1H2UA 3MV2B 4U8VD 3B13A 4C48B 4XEIG 3HVEA 3HYMB 1QQEA 3QOUA 2OOEA 3QC1A 3EUVA 1QBQA 3G2UA 1NFIE 1K1AA 1UN8A 4CEMA 1YCSB 4JW1A 3ENEA 4GPKA 1OWNA 4HBDA 3VLDA 2LUHA 3RRUA 4AM9A 4DI4A 3D9LA 5A23A 2XGSA 3HXDA 4WNGA 1QNFA 1VDYA 1SQMA 4ANXA 3CHRA 3IHVA 2J08A 3DSVA 2IY0C 3S7JA 4B8AA 4CGVA 3RRMB 5D0QD 3QWWA 2R5SA 3I3NA 4I1AA 4U0SA 4KT6B 2R02A 4HOUA 4J8FA 5G2NA 2OVBA 4EZLA 4AY5A 2VSOE 2DZOA 3T5VA 3AG1E 4YDOA 5AQ9A 3UINC 4U0ZA 4DUIA 2VJ8A 1NP7A 1N4PA 3J5PA 1Z3YA 2LSVA 3AG2E 3CHOA 4BX8A 4GZ6A 3F6QA 5LP0A 2J07A 4OVUA 3SGHA 2DYSE 1HFAA 2P9LG 3T8KA 3AG4E 4APFA 3VTXA 2ETBA 4J7WA 5JA4D 1MX4A 5ANLA 2A4ZA 4GMRA 3TWXA 3RU0A 3PZ3A 3CK7A 5ENPD 3U3WA 5T4YA 5FQ4A 3FTXA 3FH7A 1N0QA 1NI1A 4JHRA 2IJGX 3ZXSA 4JL0A 3KSLA 4FHJA 4TV3A 1UOHA 3TG5A 2Y0BG 4FU3A 4KVMA 3E37A 2KBXA 3CSFA 2QY7A 2GRPB 3ZYLA 3CVXA 2MRIA 4OAVB 4J8DA 1EYHA 3LJ3A 4YVQC 3CVUA 1SA5A 4O1PA 1UJJA 5FIOA 4CT4A 2WPVA 3QAQA 3B7TA 1U3CA 3ZFWA 1H2TC 4K0RA 5KBAA 2ILRA 5AARA 4HS2A 1OWLA 3DSXA 3LKUA 2B0OE 4HB5A 4BWRA 3HHMA 4O6FA 2NYJA 3FH5A 4HFGA 1BU9A 1EF1C 4WWOA 2WXPA 4KZCA 3FUJA 4EECA 2J09A 4LNGA 1O1RA 5CHEE 3PZ2A 4F6RD 2JEKA 3U4TA 1PY1A 2H6IA 4UQXA 4LSZE 4CZ2D 4RLYA 1WM5A 4YDYA 3LYAA 1GW6A 3URZA 1IXVA 2KCVA 3PS6A 5AN8A 4UWKA 2WXFA 4XZ4A 5BXOA 1N9AA 2CG3A 1TNZA 1Y8MA 3JQ1A 3NBNB 4DX5D 3UM2A 2PQNA 1YYHA 3OXFA 4A1SA 5G05C 4HRLA 1N11A 2F8YA 3CKCA 3ZYQA 3APCA 1N52A 3ZYKA 5EILA 3VTYA 3ZRHA 3QDNA 1OY3D 4N2QA 4AY6A 2EIME 3QARA 1TNUA 2FI7A 3FUKA 2EIJE 1N4QA 4K03A 3BEEA 4UUCA 5JJTA 3ZU7B 1DCEA 1EDUA 2HO1A 4L1BA 1Z3XA 4Q69A 4JEUA 2XPZA 5BNWA 4PH4B 3EHNA 3DWLG 3FEYA 3MEKA 5J08A 2F8XK 2MOWA 4HORA 2QZAA 2ZISA 4G26A 2QC9A 4EHMA 4J8SA 4FP7A 3V31A 4MKTA 4BSXA 2GRNB 3K9IA 3CQCB 2Q7FA 4WAFA 1HH8A 2L6JA 3TWVA 2HM8A 2RD0A 4BTBA 1PAQA 2LAHA 1OCCE 4P29A 2R59A 3O4ZA 4TXPA 3ONKA 3AU5A 1K8KG 2P9SG 2PZIA 4TXQA 5C2YA 2LO6A 1MX6A 4GTPA 1TJCA 2AW6A 4ANUA 4GAAA 3S7DA 3EU5A 3ULEG 5CRUA 4GYOA 4N3BA 4KVOA 2DIWA 4TRQA 3JCKC 5FQ7A 2H6HA 3CHPA 1KLXA 4U63A 5JHBA 3Q9UC 1WG0A 4HQDA 1LTXA 5EN5D 1SZAA 4UQZA 4I6GA 3B7UX 4C0MA 2VSYA 3UMVA 3U64A 2NSZA 3PREA 2FULA 5EYLA 3SBSA 1ELWA 3RO3A 1HG2A 2LNIA 3DXMG 3E32A 4O1OA 3HXBA 4CCAA 5JJ7A 1TYQG 2XCCA 3D9MA 1TNOA 3C98A 2WXNA 3ASNE 2I1KA 3ML9A 2LSUA 2OVFA 2IU1A 4U7EB 5KNGA 3B7RL 4B8CB 3ZPJA 2GGFA 2UY1A 4I2ZA 2KCKA 4JPSA 2L0TB 3Q73A 4I9CA 1S64A 4CYMD 4TUMA 4R7LA 5AENA 2V0PA 2X38A 2UWJG 4BX9A 2WMNA 2OEVA 3HIZA 1KPSB 3NF1A 3R9MA 5H7PA 1SW6A 1HU3A 1AP7A 3CEQA 5CBNA 2ZGDA 3I4GA 3EHRA 3L13A 1H6KA 1OXJA 4N5QA 1E7UA 2WXJA 3TXNA 3EHQA 3SY2A 4N3AA 4Q94A 4UI9C 3AS4A 2BEDA 2GW1A 2VSNA 4GTSA 1N4SA 3B7SA 4F7AA 2MYOA 4G23A 2DZNA 5AQAA 4FULA 4K5CA 1QZ2A 3T8MA 3B7BA 3D9PA 3ABME 1H0AA 2WXQA 4N3CA 3PDNA 2DWZA 3DEOA 5G04C 4HLEA 2FEZA 5AIJA 3CVPA 2P58C 1E8YA 4JB8P 2CFZA 1DCQA 3T9KA 3Q49B 1V54E 3V2XA 2F0YA 3MKRA 2CHZA 5AQBA 3VLFA 3MV3B 2MHKA 4EBAA 1HF8A 2LXLA 3DEPA 1IHGA 1QYMA 4N39A 3DXKG 4BTAA 1RZ4A 4HRMB 5KNHD 4V3IA 1OWMA 5BW8C 4RG9A 3S2AA 1YMPA 5LOZA 3ABLE 4JXTA 3ASDA 3TWWA 1WAO1 3EIQC 2GROB 2FO7A 1OUVA 3TWUA 4ME2A 4AV7A 2AXVA 4G8KA 4DLOA 4FJYA 2BKKB 2WMOA 5ARFA 2VSXE 5T8IA 1ZU2A 3MX3A 5FWQA 2C2LA 5T3RA 4NRHB 2XPIA 1JCQA 3CVVA 1UW4B 3TL5A 3FFLA 3QNKA 4UI9K 4HOSA 3UI2A 3I4RB 3AG3E 3FTVA 1O5MA 3FUHA 4KBQA 2YHEA 1H6PA 2WXGA 2YQ8A 2FO1E 1H2VC
chains in the Genus database with same CATH topology
2GRRB 5D2MC 2GRNB 2GRPB 3UIOC 1Z5SC 1KPSB 2IO3C 2IY0C 2GROB 2IO2C 3UIPC 3UINC 2GRQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRR B;  5D2M C;  2GRN B;  2GRP B;  3UIO C;  1Z5S C;  1KPS B;  2IO3 C;  2IY0 C;  2GRO B;  2IO2 C;  3UIP C;  3UIN C;  2GRQ B; 
#chains in the Genus database with same CATH topology
 2LAI A;  4AXH A;  4NAC A;  5DBK A;  2OEW A;  3IKO B;  4HOT A;  5HS0 A;  4F1S A;  3FUI A;  2J49 A;  4G2V A;  3D9K A;  3L54 A;  3CHQ A;  2KZT B;  1MQS A;  4GML A;  2KC7 A;  3LXU X;  2WXK A;  3CVY A;  4ATG A;  5ENR D;  4A55 A;  5JHA A;  2WXH A;  2RFM A;  3PUJ A;  3ZNG A;  4RG6 A;  3LDZ A;  2ZU6 B;  2XS1 A;  3DRA A;  2VGY A;  3ML8 A;  4Y6C A;  3QB2 A;  1U2V G;  1Z5S C;  3SF4 A;  3NOC D;  4HOQ A;  4J0U A;  2XEV A;  5CEC B;  4HNA D;  3PRZ A;  4JHK A;  5LCW C;  4CGW A;  4FA6 A;  1KT1 A;  2X6I A;  2AVP A;  3APF A;  1TN8 A;  3CK8 A;  2IOS A;  3RAU A;  3RKV A;  5CMY A;  3PNL B;  1H6O A;  3FUN A;  2IEJ A;  2WQ6 A;  3GW4 A;  1JWG A;  3ZEF A;  3JYS A;  3UIP C;  2WQH A;  3UT7 A;  1IQU A;  5BXU A;  3ONL A;  3KAE A;  3D9N A;  2XZT G;  3B95 A;  4H7Y A;  1TEZ A;  4GTV A;  1Z6T A;  1XGW A;  4GZ3 A;  2RKK A;  3EHM A;  2ZIR A;  4EZK A;  3SBT B;  3O48 A;  1HG5 A;  4QQI A;  5HRY A;  2KAT A;  4M7C A;  2WXR A;  4GTT A;  2CFU A;  3TWR A;  4D10 C;  2H6F A;  3CVL A;  1FT1 A;  3KD7 A;  3CQG B;  3TGO A;  4GMJ A;  3ZKJ A;  3HDX A;  2IO3 C;  4IUL A;  2L9B A;  3FDH A;  2J8S D;  4LNB A;  2EQX A;  4YDE A;  1SA4 A;  4UWF A;  3L16 A;  3Q75 A;  4BEP A;  3QJZ A;  4U96 D;  4APO A;  2VGX B;  4UWH A;  4B94 A;  3SFY A;  4L2Y A;  2DCP A;  5HKP A;  2XEE A;  3CK9 A;  4RSY A;  2DYR E;  4GZD A;  2IQC A;  3KSQ A;  5BV0 A;  4OVV A;  2ZGG A;  3FTU A;  5EYP F;  4LRZ A;  4PDX A;  2JAB A;  4HLL A;  3G2V A;  5E76 A;  4HI8 A;  3FUM A;  3CVQ A;  4AOF A;  3EU9 A;  1HS6 A;  4YVO A;  4I1O B;  3CVW A;  3PEV B;  5E75 A;  4ATZ D;  5LX8 A;  4GTR A;  1TN6 A;  4EQF A;  3ZN3 A;  4FAD A;  1JWF A;  1E96 B;  3MJW A;  3V2O A;  3NAW A;  3Q79 A;  3C5R A;  3Q5M A;  5J90 A;  1ELR A;  3ISM C;  1DC2 A;  4F3V A;  4C9B B;  2YNQ A;  5EKQ D;  3FUF A;  2KXP C;  3AS8 A;  4I6E A;  4GYW A;  5FZS A;  1TNB A;  2XZD G;  3X2Q E;  3QWP A;  2I6H A;  3RK6 A;  4GZC A;  2FF4 A;  3UKU G;  3FU0 A;  3U66 A;  4MS6 A;  3HXE A;  1B89 A;  2M63 A;  3SFZ A;  3C3R A;  2GRQ B;  3ZUV B;  4H7X A;  2E0I A;  1IYG A;  2NXP A;  1E8Z A;  1K1B A;  3CGH A;  3ZW3 A;  3J5Q B;  5B1B E;  4BSZ B;  3PZ1 A;  2F37 A;  4O60 A;  5FJY A;  3P2B A;  4NQ0 A;  2VTB B;  2A5E A;  3UQ3 A;  1HO8 A;  1MX2 A;  3QKY A;  3UXG A;  1OWO A;  3FWV A;  3ULQ A;  3TWT A;  5EX0 A;  4G1T A;  4L2L A;  4Y6W A;  4HVB A;  1E8W A;  3D3M A;  4DRX E;  3LY9 A;  4ILG A;  2J9Q A;  2BUG A;  2XQ0 A;  1S70 B;  3PZD A;  4ILH B;  3KEA A;  5KJL A;  2AXU A;  4ANW A;  3IBE A;  3OXG A;  2EIN E;  3NZU A;  2OV8 A;  2AXZ A;  2PM7 A;  3CR3 A;  3TG4 A;  3LS8 A;  1FT2 A;  1HXI A;  3LVR E;  2Y1L E;  3W9G A;  3FU3 A;  3CKB A;  2IF4 A;  4JC8 A;  2WB2 A;  1UG3 A;  4DX2 A;  5IY5 E;  3MKQ B;  5CER B;  3CHM A;  3E33 A;  2VGE A;  4JA7 A;  4K5A B;  3L08 A;  4U95 D;  3R7Q A;  5FQ6 A;  5KCM A;  5A7D B;  2XRZ A;  3SHF A;  1IHB A;  2C0M A;  4G24 A;  2HR2 A;  5D66 A;  4WUY A;  4FHK A;  3UPV A;  3UKR G;  3NZS A;  3HXF A;  4WNF A;  2P9U G;  1BPO A;  3TXM A;  2X6K A;  2OND A;  4XX5 A;  3APD A;  4CT0 A;  4DX6 D;  3P1U A;  4CRW A;  4N5C A;  5LFA A;  3KEZ A;  3CVN A;  4PS8 A;  4F1P A;  1BD8 A;  2P2C P;  2RG8 A;  2XHE A;  4AJW A;  3BUA A;  3G2W A;  3E30 A;  3Q9N C;  4PS7 A;  3AJI A;  4GTO A;  3IV0 A;  2X3M A;  3OXL A;  3UM1 A;  5CEA A;  4UQY A;  1G3N B;  2V4H C;  3FUE A;  1AWC B;  2E2E A;  5ITZ F;  3DPD A;  1BI7 B;  3RSE G;  4A3T A;  3UX4 A;  4UI9 J;  1EPU A;  1ZB1 A;  4FLB A;  3DSS A;  1O1S A;  3JQ0 A;  5EIB E;  3AAA C;  3C3O A;  4YDW A;  4B0Z A;  3FTW A;  3E34 A;  5EX3 A;  4LCT A;  4I43 A;  4JD2 G;  3G2T A;  4A3V A;  2J4B A;  1TJF A;  1JCR A;  4KYO B;  2KZT A;  5A6C A;  5HI7 A;  4EPZ A;  4JZY A;  4JHJ A;  5ENN A;  1FVF A;  2R05 A;  4ANV A;  4B89 A;  1NA3 A;  3VLE A;  4HRN A;  4LER A;  3EIJ A;  5G55 A;  3FEX A;  3Q47 B;  5EDS A;  4NIK A;  3L9T A;  5CCL A;  1LF8 A;  3RJV A;  3Q7A A;  4QFV A;  3CLJ A;  1NZN A;  2P9N G;  4DJA A;  1PC2 A;  4M3O A;  4U07 A;  1HX8 A;  3FU5 A;  1X81 A;  5KJN A;  1Q2Z A;  3ZXP A;  1H19 A;  3ZIM A;  4DX7 D;  4TXR A;  4U04 A;  2C0L A;  2IOL A;  1OCR E;  4BES A;  4ZHB A;  2WVI A;  2CHW A;  4HI9 A;  1N95 A;  5BPP A;  5BT1 A;  3ZVV A;  3ZHE B;  5CMW A;  4AIF A;  1JPL A;  1FVH A;  2IFU A;  4PS3 A;  4I17 A;  3LCA A;  3L22 A;  1MHQ A;  2WXO A;  1X5B A;  4LUN U;  1KZO A;  4G25 A;  1RW2 A;  4XKC A;  1N94 A;  1E7V A;  1D8D A;  3DST A;  3SQV A;  3GYZ A;  1WDY A;  2BTD A;  4GCO A;  4KMO A;  1LD8 A;  3ASF A;  1Y6I A;  1KT0 A;  1N0R A;  1K3Z D;  3EJN A;  3CIA A;  5ANR A;  5ENS D;  2ZXW E;  4DPR A;  2AJA A;  5EID A;  4JA9 A;  3HXC A;  2PNN A;  3DBS A;  5ENQ D;  3TWQ A;  3SI5 A;  2Y4T A;  3FTS A;  1HZ4 A;  2XRY A;  2ION A;  4MBG A;  4UWL A;  1KZP A;  3C72 A;  2CG2 A;  1NL4 A;  4XIF A;  4A63 B;  2R17 C;  3LY7 A;  2L0I A;  5DIZ A;  3MGB A;  3I5P A;  1OWP A;  5D2M C;  2H6G A;  1DVP A;  2XGO A;  4UWG A;  3U9W A;  4GZ5 A;  2VGX A;  3GZ2 A;  3HVE B;  4Z68 A;  2YIN A;  2VYI A;  2HYZ A;  1SVX A;  1JCS A;  3TJP A;  3LEW A;  1TNY A;  5C1D A;  5LCW J;  1U3D A;  3GZ1 A;  4OAU C;  1ZBP A;  2DVW A;  1IKN D;  3SD5 A;  2Y4U A;  3MYV A;  4J8E A;  3ABK E;  4XKB A;  4L23 A;  4L9P A;  5FT9 A;  3TAX A;  3S7B A;  2KM4 A;  2PL2 A;  4CDR A;  2V5F A;  4KXK B;  2BF0 X;  3Q78 A;  1JUQ A;  2V8S E;  4I6J A;  4GTM A;  3ASG A;  3UTM A;  3BG0 B;  3UT8 A;  4AEZ C;  1A5E A;  3MA5 A;  3PE4 A;  5BV1 A;  2XCB A;  2PQR A;  3AS5 A;  2Y3A A;  1INZ A;  4LEU A;  3BU8 A;  3SZ7 A;  1S0P A;  4DK5 A;  3ESL A;  2WXM A;  3LY8 A;  4RQI A;  3UM0 A;  3FHE A;  5FZQ A;  4F53 A;  5ARG A;  2XPY A;  3ESK A;  2WM9 A;  1V55 E;  2AWI A;  5ENT D;  3ZYM A;  2RFA A;  2I1J A;  4NUR A;  1SZ9 A;  3D9J A;  1XNF A;  3QK0 A;  3HG0 D;  3SNX A;  4N2S A;  4IN3 B;  4ACK A;  4HXI A;  3RIB A;  4BT8 A;  3CV0 A;  4I2W A;  5FZR A;  4ILI A;  5CED B;  2CHX A;  3UM3 A;  1UJK A;  4BER A;  2R2L A;  2VTB A;  3S7F A;  2FBN A;  2XEN A;  2GRR B;  3UUX A;  3UT4 A;  3FTZ A;  3IHY A;  4IYP A;  3PEU B;  5B1A E;  4I1M A;  5G05 J;  2DBA A;  3PZ4 A;  2EIL E;  2X6F A;  1MZC A;  3V30 A;  2V5Q C;  2NC9 A;  1O1T A;  4I9E A;  3Q4A B;  4GA1 A;  4GPM A;  4E85 A;  4C0E A;  5KWD A;  2OCC E;  4PUC A;  4U0U A;  2P9K G;  2P9P G;  5FIN A;  1D9S A;  2J4D A;  2WXL A;  3DSU A;  4IRU A;  4GA2 A;  3CST A;  1W3B A;  5D0O D;  4BY6 A;  4CDN A;  4DI3 A;  1E8X A;  2ETA A;  4KZ0 A;  1MJ0 A;  1N54 A;  4AVX A;  3MKQ A;  1A17 A;  2QYU A;  5AJL A;  3TWS A;  4XI0 A;  5M72 A;  1OT8 A;  5AYW D;  2YHC A;  3PVL A;  4FLH A;  3NOG D;  3R9A B;  4G11 A;  4J6I A;  3CHS A;  3FTY A;  5CRV A;  3R7R A;  1BLX B;  1FCH A;  4BT9 A;  3T5X A;  4FJZ A;  5BUZ A;  4GTQ A;  3SFX A;  5AAO A;  3Q15 A;  2I2O A;  4OYS A;  2BKG A;  3C3Q A;  2P9I G;  2WQ7 A;  3PUK A;  1ELK A;  4MLP A;  3FP3 A;  3RRN B;  3OAW A;  1L5J A;  3SO8 A;  3FH8 A;  1TR4 A;  3V79 K;  1YA0 A;  1OCO E;  3JUI A;  2WXI A;  3LPZ A;  4LG6 A;  4J8Y A;  3W9F A;  2QYJ A;  5JMN D;  4XE0 A;  4EBA G;  4URK A;  3HRA A;  3D9I A;  4JVS A;  3PE3 A;  2GRM A;  4ACL A;  4A1G A;  3MZL B;  3G2S A;  4TUU A;  4L7T A;  3ASH A;  3PNT B;  4LNU D;  2LXM A;  5ENO D;  2HE0 A;  5AJD A;  3QWV A;  3UIO C;  4GYY A;  1BI8 B;  2B6C A;  1OCZ E;  2Y69 E;  1S63 A;  3Q7F A;  5KJK A;  4B93 B;  2XS8 A;  3BG1 B;  5JJ6 A;  4U8H A;  3JUE A;  4K5B A;  4W9R A;  3JXI A;  1D8E A;  5HQ8 A;  2I9C A;  4WNE A;  4JEH A;  3D9H A;  4FC8 A;  1DNP A;  3PH0 C;  2R03 A;  2QFC A;  2XGM A;  3L17 A;  3OTN A;  3FUD A;  1LD7 A;  4EZJ A;  4BFR A;  4WWP A;  2EIK E;  1UN9 A;  3LJN A;  3JXJ A;  2VQ2 A;  2V4L A;  5CCM A;  3WG7 E;  5KJM A;  4GA0 A;  4ZFH A;  1HE8 A;  2X6H A;  3D9O A;  4Q96 A;  1WY6 A;  4AP2 A;  3N71 A;  2GRL A;  3ASO E;  3EDT B;  3BQO A;  3IEG A;  3L6A A;  4WWN A;  5FTP A;  4ABN A;  3ZHE A;  2A5U A;  3AU4 A;  1NA0 A;  4GCN A;  3RO2 A;  4MRU A;  4E6H A;  3DSW A;  2ETC A;  3ULY A;  1FPP A;  3LVQ E;  4G8L A;  4GU5 A;  4XI9 A;  4BET A;  3DPY A;  4U8Y D;  5B3S E;  1MYO A;  4YND A;  2PM6 A;  2X6J A;  4WND A;  5G04 J;  4DLQ A;  3NB2 A;  2L6B A;  3ZGQ A;  4RVB A;  1N4R A;  1IQR A;  1P5Q A;  4DX1 A;  5FQ8 A;  5CBO A;  3GZS A;  3NQP A;  1TN7 A;  4CDM A;  3IXE A;  2KCL A;  1E90 A;  3L82 A;  3WXX A;  3MCX A;  3E4B A;  3FY4 A;  2UY1 B;  4X8Q A;  3KS2 A;  4GB9 A;  5AQ7 A;  2JLB A;  2IO2 C;  3FU6 A;  2XEH A;  3FUL A;  1H2U A;  3MV2 B;  4U8V D;  3B13 A;  4C48 B;  4XEI G;  3HVE A;  3HYM B;  1QQE A;  3QOU A;  2OOE A;  3QC1 A;  3EUV A;  1QBQ A;  3G2U A;  1NFI E;  1K1A A;  1UN8 A;  4CEM A;  1YCS B;  4JW1 A;  3ENE A;  4GPK A;  1OWN A;  4HBD A;  3VLD A;  2LUH A;  3RRU A;  4AM9 A;  4DI4 A;  3D9L A;  5A23 A;  2XGS A;  3HXD A;  4WNG A;  1QNF A;  1VDY A;  1SQM A;  4ANX A;  3CHR A;  3IHV A;  2J08 A;  3DSV A;  2IY0 C;  3S7J A;  4B8A A;  4CGV A;  3RRM B;  5D0Q D;  3QWW A;  2R5S A;  3I3N A;  4I1A A;  4U0S A;  4KT6 B;  2R02 A;  4HOU A;  4J8F A;  5G2N A;  2OVB A;  4EZL A;  4AY5 A;  2VSO E;  2DZO A;  3T5V A;  3AG1 E;  4YDO A;  5AQ9 A;  3UIN C;  4U0Z A;  4DUI A;  2VJ8 A;  1NP7 A;  1N4P A;  3J5P A;  1Z3Y A;  2LSV A;  3AG2 E;  3CHO A;  4BX8 A;  4GZ6 A;  3F6Q A;  5LP0 A;  2J07 A;  4OVU A;  3SGH A;  2DYS E;  1HFA A;  2P9L G;  3T8K A;  3AG4 E;  4APF A;  3VTX A;  2ETB A;  4J7W A;  5JA4 D;  1MX4 A;  5ANL A;  2A4Z A;  4GMR A;  3TWX A;  3RU0 A;  3PZ3 A;  3CK7 A;  5ENP D;  3U3W A;  5T4Y A;  5FQ4 A;  3FTX A;  3FH7 A;  1N0Q A;  1NI1 A;  4JHR A;  2IJG X;  3ZXS A;  4JL0 A;  3KSL A;  4FHJ A;  4TV3 A;  1UOH A;  3TG5 A;  2Y0B G;  4FU3 A;  4KVM A;  3E37 A;  2KBX A;  3CSF A;  2QY7 A;  2GRP B;  3ZYL A;  3CVX A;  2MRI A;  4OAV B;  4J8D A;  1EYH A;  3LJ3 A;  4YVQ C;  3CVU A;  1SA5 A;  4O1P A;  1UJJ A;  5FIO A;  4CT4 A;  2WPV A;  3QAQ A;  3B7T A;  1U3C A;  3ZFW A;  1H2T C;  4K0R A;  5KBA A;  2ILR A;  5AAR A;  4HS2 A;  1OWL A;  3DSX A;  3LKU A;  2B0O E;  4HB5 A;  4BWR A;  3HHM A;  4O6F A;  2NYJ A;  3FH5 A;  4HFG A;  1BU9 A;  1EF1 C;  4WWO A;  2WXP A;  4KZC A;  3FUJ A;  4EEC A;  2J09 A;  4LNG A;  1O1R A;  5CHE E;  3PZ2 A;  4F6R D;  2JEK A;  3U4T A;  1PY1 A;  2H6I A;  4UQX A;  4LSZ E;  4CZ2 D;  4RLY A;  1WM5 A;  4YDY A;  3LYA A;  1GW6 A;  3URZ A;  1IXV A;  2KCV A;  3PS6 A;  5AN8 A;  4UWK A;  2WXF A;  4XZ4 A;  5BXO A;  1N9A A;  2CG3 A;  1TNZ A;  1Y8M A;  3JQ1 A;  3NBN B;  4DX5 D;  3UM2 A;  2PQN A;  1YYH A;  3OXF A;  4A1S A;  5G05 C;  4HRL A;  1N11 A;  2F8Y A;  3CKC A;  3ZYQ A;  3APC A;  1N52 A;  3ZYK A;  5EIL A;  3VTY A;  3ZRH A;  3QDN A;  1OY3 D;  4N2Q A;  4AY6 A;  2EIM E;  3QAR A;  1TNU A;  2FI7 A;  3FUK A;  2EIJ E;  1N4Q A;  4K03 A;  3BEE A;  4UUC A;  5JJT A;  3ZU7 B;  1DCE A;  1EDU A;  2HO1 A;  4L1B A;  1Z3X A;  4Q69 A;  4JEU A;  2XPZ A;  5BNW A;  4PH4 B;  3EHN A;  3DWL G;  3FEY A;  3MEK A;  5J08 A;  2F8X K;  2MOW A;  4HOR A;  2QZA A;  2ZIS A;  4G26 A;  2QC9 A;  4EHM A;  4J8S A;  4FP7 A;  3V31 A;  4MKT A;  4BSX A;  2GRN B;  3K9I A;  3CQC B;  2Q7F A;  4WAF A;  1HH8 A;  2L6J A;  3TWV A;  2HM8 A;  2RD0 A;  4BTB A;  1PAQ A;  2LAH A;  1OCC E;  4P29 A;  2R59 A;  3O4Z A;  4TXP A;  3ONK A;  3AU5 A;  1K8K G;  2P9S G;  2PZI A;  4TXQ A;  5C2Y A;  2LO6 A;  1MX6 A;  4GTP A;  1TJC A;  2AW6 A;  4ANU A;  4GAA A;  3S7D A;  3EU5 A;  3ULE G;  5CRU A;  4GYO A;  4N3B A;  4KVO A;  2DIW A;  4TRQ A;  3JCK C;  5FQ7 A;  2H6H A;  3CHP A;  1KLX A;  4U63 A;  5JHB A;  3Q9U C;  1WG0 A;  4HQD A;  1LTX A;  5EN5 D;  1SZA A;  4UQZ A;  4I6G A;  3B7U X;  4C0M A;  2VSY A;  3UMV A;  3U64 A;  2NSZ A;  3PRE A;  2FUL A;  5EYL A;  3SBS A;  1ELW A;  3RO3 A;  1HG2 A;  2LNI A;  3DXM G;  3E32 A;  4O1O A;  3HXB A;  4CCA A;  5JJ7 A;  1TYQ G;  2XCC A;  3D9M A;  1TNO A;  3C98 A;  2WXN A;  3ASN E;  2I1K A;  3ML9 A;  2LSU A;  2OVF A;  2IU1 A;  4U7E B;  5KNG A;  3B7R L;  4B8C B;  3ZPJ A;  2GGF A;  2UY1 A;  4I2Z A;  2KCK A;  4JPS A;  2L0T B;  3Q73 A;  4I9C A;  1S64 A;  4CYM D;  4TUM A;  4R7L A;  5AEN A;  2V0P A;  2X38 A;  2UWJ G;  4BX9 A;  2WMN A;  2OEV A;  3HIZ A;  1KPS B;  3NF1 A;  3R9M A;  5H7P A;  1SW6 A;  1HU3 A;  1AP7 A;  3CEQ A;  5CBN A;  2ZGD A;  3I4G A;  3EHR A;  3L13 A;  1H6K A;  1OXJ A;  4N5Q A;  1E7U A;  2WXJ A;  3TXN A;  3EHQ A;  3SY2 A;  4N3A A;  4Q94 A;  4UI9 C;  3AS4 A;  2BED A;  2GW1 A;  2VSN A;  4GTS A;  1N4S A;  3B7S A;  4F7A A;  2MYO A;  4G23 A;  2DZN A;  5AQA A;  4FUL A;  4K5C A;  1QZ2 A;  3T8M A;  3B7B A;  3D9P A;  3ABM E;  1H0A A;  2WXQ A;  4N3C A;  3PDN A;  2DWZ A;  3DEO A;  5G04 C;  4HLE A;  2FEZ A;  5AIJ A;  3CVP A;  2P58 C;  1E8Y A;  4JB8 P;  2CFZ A;  1DCQ A;  3T9K A;  3Q49 B;  1V54 E;  3V2X A;  2F0Y A;  3MKR A;  2CHZ A;  5AQB A;  3VLF A;  3MV3 B;  2MHK A;  4EBA A;  1HF8 A;  2LXL A;  3DEP A;  1IHG A;  1QYM A;  4N39 A;  3DXK G;  4BTA A;  1RZ4 A;  4HRM B;  5KNH D;  4V3I A;  1OWM A;  5BW8 C;  4RG9 A;  3S2A A;  1YMP A;  5LOZ A;  3ABL E;  4JXT A;  3ASD A;  3TWW A;  1WAO 1;  3EIQ C;  2GRO B;  2FO7 A;  1OUV A;  3TWU A;  4ME2 A;  4AV7 A;  2AXV A;  4G8K A;  4DLO A;  4FJY A;  2BKK B;  2WMO A;  5ARF A;  2VSX E;  5T8I A;  1ZU2 A;  3MX3 A;  5FWQ A;  2C2L A;  5T3R A;  4NRH B;  2XPI A;  1JCQ A;  3CVV A;  1UW4 B;  3TL5 A;  3FFL A;  3QNK A;  4UI9 K;  4HOS A;  3UI2 A;  3I4R B;  3AG3 E;  3FTV A;  1O5M A;  3FUH A;  4KBQ A;  2YHE A;  1H6P A;  2WXG A;  2YQ8 A;  2FO1 E;  1H2V C; 
#chains in the Genus database with same CATH homology
 2GRR B;  5D2M C;  2GRN B;  2GRP B;  3UIO C;  1Z5S C;  1KPS B;  2IO3 C;  2IY0 C;  2GRO B;  2IO2 C;  3UIP C;  3UIN C;  2GRQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...