2GRPB

Crystal structure of human rangap1-ubc9-y87a
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
157
structure length
157
Chain Sequence
PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grpB00
2GRRB 2GRQB 3UINC 1Z5SC 5D2MC 1KPSB 2IO2C 2IY0C 3UIPC 3UIOC 2GRPB 2IO3C 2GRNB 2GROB
chains in the Genus database with same CATH superfamily
5AIJA 2R17C 4ACKA 2KZTB 3VLDA 2OVBA 4ANWA 4FP7A 1N0QA 3PDNA 4HOSA 3SHFA 5FZSA 4KBQA 1MQSA 3IKOB 2H6FA 1RW2A 3PVLA 4HI9A 2IJGX 2Y4TA 5EIDA 3CHPA 4JVSA 3URZA 3JUEA 4GA1A 3TL5A 4ATGA 3UKUG 4MLPA 2BUGA 2XS1A 4ANVA 4MBGA 3GZ2A 2L0TB 2J4DA 3D9PA 2GRPB 5A6CA 2VSNA 2XCBA 2PM6A 3TXMA 4I6JA 2KM4A 4N2SA 1JPLA 2GRNB 4G23A 1HS6A 4GYYA 4UWLA 1H6KA 2WXIA 3CQGB 1K3ZD 2VSXE 2QZAA 3OTNA 3CVYA 3X2QE 2V4LA 5IY5E 3ZW3A 3V79K 3PZ2A 1MX2A 2Q7FA 4WWOA 3TGOA 2I1JA 1HZ4A 2VJ8A 3O4ZA 1OCZE 4DX5D 4XEIG 2IO2C 3UUXA 4KYOB 3CGHA 5KCMA 4EHMA 3J5PA 1N54A 2XQ0A 3LY9A 1ELKA 4I6GA 3NOCD 3VTXA 3IV0A 3CSTA 5EN5D 1E8WA 1WDYA 3C98A 2ETBA 1UN9A 3GZSA 3MZLB 2X6JA 1KZOA 3AS4A 1H2UA 3SNXA 2EIME 1EF1C 3PZ1A 4L1BA 3QC1A 1D9SA 1S0PA 1WY6A 4RVBA 4K5CA 5KJNA 3EHMA 4X8QA 2AJAA 3PRZA 2JEKA 4C0EA 1H19A 3FH5A 1H0AA 4O1OA 5G2NA 4UWHA 3UM0A 3B7TA 3E34A 3ZGQA 2IONA 2I2OA 4KVOA 2LNIA 3ZIMA 4LEUA 4BESA 2GRLA 4TRQA 3QB2A 4YNDA 3EDTB 2IOLA 4WUYA 3WG7E 2GRQB 4N5QA 5AARA 3EHRA 4DJAA 5CBOA 3PZ4A 1IQUA 1N9AA 3GW4A 4RSYA 2ILRA 4BFRA 3R9MA 4LNBA 5B1AE 3ZYQA 5HQ8A 2I6HA 3AJIA 2KBXA 3FUFA 1UW4B 3AG1E 1JCQA 2ZIRA 3QWWA 3RO3A 2L0IA 4KZ0A 1DVPA 3EHQA 1EYHA 3UIOC 4CT0A 1FPPA 3K9IA 2XRZA 4I1OB 2LXMA 3OXFA 1OY3D 2RG8A 3DEPA 4D10C 2VSOE 3ZPJA 3QOUA 1Z6TA 4U7EB 5FINA 3DBSA 1OXJA 1ZB1A 4AIFA 2EIJE 2WVIA 3UQ3A 3GZ1A 1Y8MA 2P2CP 1X5BA 4RLYA 4L2LA 1FCHA 3CKCA 4WNFA 2WXOA 2A5EA 4KVMA 4GPMA 1Z3YA 2LUHA 3TWXA 5T3RA 4MS6A 3FUDA 3E30A 1JCRA 3ZHEA 3RRUA 3I3NA 2Y3AA 3JQ1A 4XX5A 3NB2A 4DRXE 4DX1A 2XPIA 5HKPA 4DX6D 4H7XA 5BV1A 4JA7A 5HI7A 4UI9J 4IYPA 2P9UG 1FVHA 2XGOA 4I6EA 4U04A 4UI9C 1QZ2A 4UQXA 5EYPF 3ZXPA 5BXOA 3EU9A 2OV8A 1WG0A 3QJZA 4A3VA 3RRNB 2F8XK 3APDA 3ZEFA 3UKRG 3N71A 1N95A 3ENEA 4F1PA 4A63B 1JCSA 4UWKA 4TUMA 3UT7A 3CVNA 3ESKA 4JB8P 4AP2A 3TG5A 2XRYA 1E8YA 2ZISA 3OAWA 3ZYMA 2ETCA 2EIKE 4B94A 1K1AA 2KCKA 3SBTB 4G8LA 3PH0C 4LRZA 5JMND 2NYJA 4PUCA 4ZFHA 3U3WA 1ELWA 2PM7A 5KJKA 2FULA 5ENSD 1HE8A 3CEQA 4J0UA 5JJTA 3FTWA 4HFGA 2J07A 1OUVA 3OXGA 1S70B 2GRRB 3CSFA 4APFA 3PE3A 3B7UX 4F53A 5AENA 3ULYA 4Y6CA 4I1MA 3VLFA 5ENQD 2XS8A 4L2YA 4OVVA 3DSVA 4I17A 3AS5A 5LCWC 2BF0X 3TWVA 3MKQA 5EILA 4FADA 3T8KA 4IN3B 2BEDA 3TWQA 5J90A 4HRNA 2L6BA 3QDNA 3S7JA 3CV0A 1N4PA 3NF1A 3S7FA 1N0RA 3APFA 4P29A 5ARGA 5A7DB 3C3QA 5C1DA 5H7PA 4JD2G 3QKYA 3PEUB 3Q9NC 4LUNU 3UPVA 3MKQB 4UQZA 1NI1A 1Y6IA 3QWPA 4F6RD 2WXQA 3SGHA 5FJYA 3DXMG 4U63A 3RKVA 3IEGA 3J5QB 3Q75A 1AP7A 1LF8A 4BSXA 1SW6A 2GW1A 3L6AA 2PNNA 4F7AA 2HYZA 2XZTG 3AG2E 1KZPA 1H6OA 1BI7B 2OVFA 1E7UA 3KEZA 4V3IA 3CHRA 3D9OA 2I9CA 2WXLA 3Q4AB 4B93B 5CRUA 1WM5A 1N4RA 1OCCE 5FZRA 2LSVA 3KEAA 1MX6A 2CFUA 4YDWA 3MEKA 3DSWA 4CYMD 2IF4A 1HX8A 4BWRA 4FJZA 2CHXA 1A17A 4NACA 4HNAD 5FZQA 4WWPA 3UT8A 5BPPA 2Y0BG 5KJLA 3QARA 4U8VD 2VYIA 2QYUA 2MHKA 3B13A 1TNUA 3I5PA 4ZHBA 3P1UA 4M3OA 3NZUA 4XIFA 4MRUA 3OXLA 3V2OA 4XZ4A 4HOTA 1FT1A 4W9RA 3FU5A 3D9LA 4I2WA 3KD7A 3W9FA 4GTTA 4A1SA 3LPZA 3D9HA 1PAQA 4OVUA 1TN8A 3Q7FA 3V31A 2ZGGA 1E7VA 5ENTD 5AQAA 5T4YA 2DVWA 4HRLA 2BKGA 4ILIA 1NL4A 3SZ7A 3L54A 2VSYA 2DCPA 4G25A 4U0UA 3JXJA 1IYGA 2AW6A 2C2LA 3BEEA 4PS8A 4DLQA 3LVRE 4HB5A 2Y4UA 1MYOA 4GPKA 4AEZC 3LY7A 3ASHA 3D3MA 1OT8A 3G2TA 3DSSA 3ESLA 3KAEA 3UT4A 5BV0A 3L9TA 2R05A 1NA0A 2RFMA 3FFLA 5ENOD 4E85A 3GYZA 3CVLA 2H6HA 2X6IA 1Z5SC 3ASNE 2P9KG 4L7TA 5D0OD 5B1BE 3PNLB 5CEDB 4DK5A 2QY7A 3ZNGA 4IRUA 2AWIA 2AXVA 5G05J 3S2AA 5FWQA 4BT9A 1TJFA 4GYWA 5G05C 5HS0A 4HORA 2CFZA 4DLOA 4F1SA 5ITZF 4PH4B 5KBAA 5BXUA 2DWZA 4CGWA 1K1BA 3B7RL 1KT0A 4Y6WA 3R9AB 1FVFA 1O1TA 3FEXA 4G24A 1SZ9A 1HXIA 2XEVA 3G2VA 3ONLA 4UUCA 4AY5A 2MYOA 5ENPD 3TAXA 3S7DA 3NOGD 4OYSA 4E6HA 3MYVA 1G3NB 1OWMA 2UY1B 3R7QA 3DXKG 4AM9A 3ZXSA 4IULA 3FUMA 2M63A 4GMRA 4AXHA 5CMYA 2XPZA 2ZXWE 3TWRA 3L13A 3DRAA 1YYHA 4TXQA 3MX3A 1RZ4A 5DBKA 3LKUA 5FQ8A 4AY6A 3PZDA 3G2SA 3TWWA 4DX2A 4LSZE 2PL2A 2PZIA 3TWUA 2IOSA 1UJKA 2CG3A 3ZN3A 4J6IA 2LSUA 2BTDA 5AYWD 4FU3A 2J08A 3RU0A 1E8XA 5ENRD 5CERB 3B7SA 2LAIA 2NC9A 2WXRA 2KXPC 2V8SE 2WQ7A 4I1AA 5CEAA 1H2TC 1B89A 2VGXB 3HRAA 3C3OA 2FEZA 4JEUA 3BU8A 4G8KA 5EX0A 5EDSA 1PC2A 4BETA 2DZOA 2C0MA 3FUEA 4FJYA 2DZNA 3BUAA 2XHEA 3AAAC 4N2QA 3E32A 5CECB 3FH7A 2I1KA 4U8HA 3LXUX 1PY1A 2IFUA 4DPRA 2XEHA 4ACLA 2DYSE 3D9IA 2KATA 2NXPA 5J08A 3T5XA 1QBQA 4HI8A 3FU3A 3CK8A 4CCAA 3ZU7B 4BERA 2OEWA 1N52A 3QWVA 3PEVB 1XNFA 4FHKA 4GZDA 2L9BA 1K8KG 5JJ7A 5KNHD 2P9LG 1QNFA 4XKBA 3DSUA 3FUKA 2P9IG 3TJPA 3G2WA 4N3AA 4JA9A 3I4RB 3Q47B 4DI4A 4CZ2D 2QFCA 2X6FA 4JHKA 3TWSA 5C2YA 3D9NA 2DIWA 4GA2A 3RK6A 3UM3A 3CVUA 1IHGA 1NFIE 3PE4A 3ULEG 3CIAA 1NZNA 4WAFA 1IHBA 3KS2A 2E0IA 3AU5A 2R5SA 3D9KA 2XENA 3IHVA 2P9SG 4L23A 3SO8A 4DI3A 1IXVA 3CLJA 4J8FA 4K0RA 2R59A 3MV3B 3MJWA 1E90A 3LJ3A 1TNZA 1BD8A 4WNEA 2B6CA 2YNQA 3ML8A 2OOEA 2L6JA 2EQXA 3ML9A 4TXRA 1ELRA 2V5FA 2VTBA 2CG2A 1TYQG 2AVPA 2WXFA 4O6FA 5BW8C 4LNGA 3U64A 3T9KA 3SI5A 3HG0D 1A5EA 3BG0B 5G55A 3MKRA 2RFAA 5FQ4A 1E96B 1Z3XA 1OWOA 5LFAA 3PNTB 2QC9A 3AG4E 4FLHA 4CGVA 2IO3C 3UI2A 2VTBB 3RO2A 4HLEA 3CKBA 4C0MA 3Q7AA 2GGFA 4G11A 1LD8A 3HHMA 5ENNA 5LCWJ 5ARFA 3FTVA 3Q73A 3KSQA 3LY8A 2R2LA 1D8EA 3HYMB 2WPVA 5LP0A 5FQ6A 4KZCA 2FF4A 4GYOA 3CHOA 4MKTA 1AWCB 1TN6A 3QK0A 1TN7A 3D9MA 4LERA 3NQPA 3ZYLA 3FUNA 4PS7A 2IU1A 1MZCA 3ONKA 4U8YD 3ABME 3CQCB 4EZLA 4KMOA 3LVQE 3ZYKA 3EU5A 5ANRA 4UWGA 2WMNA 3MA5A 3FP3A 3MV2B 3Q15A 5CCLA 3QAQA 3VTYA 1U3CA 4OAUC 3I4GA 3CHSA 2YQ8A 2Y69E 5KJMA 4LG6A 4J8DA 1OWLA 1HU3A 3Q79A 4N3CA 1JWGA 4J8SA 1JWFA 2ONDA 1SQMA 4J8YA 3CK7A 3HVEA 5AJDA 1H2VC 5BUZA 3D9JA 4GZ6A 2R02A 3C5RA 2WB2A 2J8SD 3G2UA 1N94A 1H6PA 1TNBA 3W9GA 1SA4A 4GU5A 3B7BA 4ILGA 3HXCA 4GMLA 3NBNB 3CHMA 2LAHA 1FT2A 5D66A 2EILE 3FTZA 1UJJA 3HVEB 1X81A 3FH8A 1OWNA 2LXLA 2JABA 5AN8A 3S7BA 3CVXA 4AOFA 1JUQA 2XEEA 4XE0A 1NA3A 4ANUA 2J09A 3DSXA 5KNGA 2H6GA 3DWLG 1VDYA 4JEHA 3CR3A 4DX7D 1D8DA 2R03A 2MRIA 1N4QA 4JPSA 5ANLA 5M72A 5JJ6A 2XCCA 4AJWA 2KCVA 3APCA 2E2EA 4QQIA 3ASDA 5BT1A 3L82A 2DBAA 4GCOA 4RG9A 3O48A 1MX4A 4CEMA 3DPYA 3UXGA 3DPDA 3UM1A 4JZYA 2CHWA 3FU0A 3BQOA 4HRMB 2H6IA 4XKCA 5KWDA 2WXGA 4N39A 4HVBA 3Q9UC 5LX8A 5AQ7A 1OWPA 1HF8A 2KC7A 3CK9A 3SBSA 1N4SA 4CDRA 2XGMA 4XI9A 4BTBA 4BTAA 4ANXA 2XGSA 1UN8A 2P9PG 4GMJA 2WQ6A 4JL0A 4H7YA 5B3SE 4NQ0A 3FUJA 4K03A 3UTMA 2AXUA 2EINE 3LJNA 3SD5A 2ZGDA 3SFYA 3CVPA 2V4HC 4U95D 2X38A 5AQ9A 1L5JA 4BX8A 2X3MA 3L22A 2P9NG 4HOUA 5FTPA 4NRHB 4ABNA 2UWJG 2UY1A 1N11A 3CVWA 1INZA 4HXIA 3MGBA 3PUJA 3FTXA 1P5QA 4CDMA 3FEYA 5E75A 4K5BA 4YDOA 4A1GA 2PQRA 2C0LA 3L08A 3AU4A 3SFZA 1OCRE 3FTYA 3NAWA 4GB9A 4UWFA 3V2XA 1TNOA 1BU9A 3DEOA 1ZBPA 3IBEA 3ZKJA 4F3VA 2B0OE 1EPUA 3SY2A 3FHEA 2CHZA 5HRYA 5FQ7A 1O1RA 4A3TA 2HM8A 4JW1A 1EDUA 4BT8A 4O1PA 3TXNA 4GZ3A 3C72A 4QFVA 4JXTA 4B8CB 2AXZA 4GCNA 2WXKA 3BG1B 3E33A 3EJNA 1Q2ZA 1NP7A 2WXMA 3FWVA 4BY6A 1SZAA 4TXPA 5FIOA 3HDXA 2VGXA 3TWTA 3DSTA 4CDNA 5EYLA 3EUVA 5A23A 2ETAA 2F0YA 1TJCA 1LTXA 3E37A 3T8MA 2XZDG 1HFAA 3PS6A 4N3BA 5JA4D 2WQHA 1S63A 3MCXA 1TNYA 4U0SA 4J7WA 3FU6A 2RKKA 3LCAA 4URKA 4U0ZA 4ATZD 2VGYA 4FA6A 3ASGA 3ABKE 1XGWA 2WMOA 3P2BA 3V30A 3E4BA 4KT6B 2FBNA 4AV7A 5AQBA 4JHRA 1DCQA 3U66A 3IXEA 5BNWA 4U96D 5E76A 4BX9A 1MHQA 3TG4A 3L17A 4N5CA 3UX4A 3ZUVB 4YVOA 3LDZA 4GTRA 4I9EA 4EZKA 2DYRE 4GZ5A 1DNPA 1S64A 3FUHA 4G26A 2X6KA 2MOWA 3JXIA 3Q49B 4HS2A 4GTSA 5JHBA 1HG5A 4A55A 4G1TA 4EBAG 4GTMA 4LCTA 4EECA 2F37A 2J49A 3FTUA 1TEZA 2J9QA 4FC8A 1V55E 3QNKA 1HO8A 5AAOA 2WXJA 1KT1A 3R7RA 2XPYA 4TUUA 3JCKC 3EIJA 4Z68A 3U4TA 3SFXA 1DCEA 1BPOA 2HO1A 2A5UA 1QYMA 4B89A 1IQRA 4AVXA 4YDEA 4WNDA 2KCLA 1UOHA 4EBAA 2WXHA 5EX3A 3HXBA 1HH8A 1UG3A 1U3DA 4FLBA 3ABLE 3PZ3A 4ME2A 4JC8A 2WM9A 4R7LA 4EZJA 4HBDA 4NURA 4Q96A 4LNUD 2IEJA 2OEVA 4GTOA 4K5AB 3EIQC 3UMVA 4J8EA 3ULQA 3ZHEB 5T8IA 1TR4A 5CMWA 1BLXB 3ZFWA 1ZU2A 5G04J 4UI9K 5CCMA 4XI0A 5G04C 2A4ZA 3UINC 3FULA 3RIBA 3RSEG 2J4BA 3AG3E 2NSZA 2RD0A 1U2VG 3LYAA 3UIPC 2WXNA 3ASFA 1GW6A 2HR2A 3IHYA 4CRWA 4I9CA 2YHEA 4L9PA 5DIZA 2Y1LE 4ILHB 4PS3A 2IY0C 1SA5A 3Q78A 3KSLA 4BSZB 3LEWA 3Q5MA 1QQEA 4GZCA 4PDXA 3UM2A 4HOQA 3L16A 4YDYA 2FI7A 3HXEA 1YMPA 4GAAA 4RQIA 5LOZA 3WXXA 3JYSA 5D0QD 4JHJA 4O60A 5EIBE 1YCSB 4FULA 2V5QC 3FDHA 1BI8B 1E8ZA 3CHQA 4I43A 4GA0A 5JHAA 1LD7A 3HXDA 4WNGA 3HXFA 3JUIA 1HG2A 3F6QA 2PQNA 2FO1E 1W3BA 4UQYA 1KLXA 2P58C 3PUKA 3NZSA 2GROB 3LS8A 1MJ0A 1DC2A 2WXPA 3C3RA 2YINA 4APOA 5EKQD 3ZRHA 4DUIA 3T5VA 3SF4A 4GTQA 3SQVA 2X6HA 4Q69A 3EHNA 2VQ2A 4B0ZA 3U9WA 3PREA 2FO7A 2BKKB 1YA0A 4HLLA 4WWNA 3ISMC 4BEPA 4Q94A 3CVQA 3RRMB 3AS8A 3FY4A 5CBNA 4NIKA 1V54E 2VGEA 3B95A 1O1SA 2LO6A 3ASOE 4YVQC 2QYJA 1SVXA 1OCOE 1O5MA 3RAUA 2OCCE 4RG6A 3RJVA 2F8YA 4G2VA 2JLBA 2GRMA 4KXKB 3ZVVA 4TV3A 5FT9A 1WAO1 4OAVB 4CT4A 4HQDA 5AJLA 3FTSA 2KZTA 4GTVA 2ZU6B 3HIZA 4I2ZA 5D2MC 4FHJA 4C48B 4EPZA 2IQCA 3VLEA 3CVVA 4U07A 1IKND 4C9BB 4B8AA 4EQFA 1KPSB 2YHCA 5CRVA 2V0PA 3FUIA 3JQ0A 2HE0A 4GTPA 5CHEE 4M7CA
chains in the Genus database with same CATH topology
2GRRB 2GRQB 3UINC 1Z5SC 5D2MC 1KPSB 2IO2C 2IY0C 3UIPC 3UIOC 2GRPB 2IO3C 2GRNB 2GROB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRR B;  2GRQ B;  3UIN C;  1Z5S C;  5D2M C;  1KPS B;  2IO2 C;  2IY0 C;  3UIP C;  3UIO C;  2GRP B;  2IO3 C;  2GRN B;  2GRO B; 
#chains in the Genus database with same CATH topology
 5AIJ A;  2R17 C;  4ACK A;  2KZT B;  3VLD A;  2OVB A;  4ANW A;  4FP7 A;  1N0Q A;  3PDN A;  4HOS A;  3SHF A;  5FZS A;  4KBQ A;  1MQS A;  3IKO B;  2H6F A;  1RW2 A;  3PVL A;  4HI9 A;  2IJG X;  2Y4T A;  5EID A;  3CHP A;  4JVS A;  3URZ A;  3JUE A;  4GA1 A;  3TL5 A;  4ATG A;  3UKU G;  4MLP A;  2BUG A;  2XS1 A;  4ANV A;  4MBG A;  3GZ2 A;  2L0T B;  2J4D A;  3D9P A;  2GRP B;  5A6C A;  2VSN A;  2XCB A;  2PM6 A;  3TXM A;  4I6J A;  2KM4 A;  4N2S A;  1JPL A;  2GRN B;  4G23 A;  1HS6 A;  4GYY A;  4UWL A;  1H6K A;  2WXI A;  3CQG B;  1K3Z D;  2VSX E;  2QZA A;  3OTN A;  3CVY A;  3X2Q E;  2V4L A;  5IY5 E;  3ZW3 A;  3V79 K;  3PZ2 A;  1MX2 A;  2Q7F A;  4WWO A;  3TGO A;  2I1J A;  1HZ4 A;  2VJ8 A;  3O4Z A;  1OCZ E;  4DX5 D;  4XEI G;  2IO2 C;  3UUX A;  4KYO B;  3CGH A;  5KCM A;  4EHM A;  3J5P A;  1N54 A;  2XQ0 A;  3LY9 A;  1ELK A;  4I6G A;  3NOC D;  3VTX A;  3IV0 A;  3CST A;  5EN5 D;  1E8W A;  1WDY A;  3C98 A;  2ETB A;  1UN9 A;  3GZS A;  3MZL B;  2X6J A;  1KZO A;  3AS4 A;  1H2U A;  3SNX A;  2EIM E;  1EF1 C;  3PZ1 A;  4L1B A;  3QC1 A;  1D9S A;  1S0P A;  1WY6 A;  4RVB A;  4K5C A;  5KJN A;  3EHM A;  4X8Q A;  2AJA A;  3PRZ A;  2JEK A;  4C0E A;  1H19 A;  3FH5 A;  1H0A A;  4O1O A;  5G2N A;  4UWH A;  3UM0 A;  3B7T A;  3E34 A;  3ZGQ A;  2ION A;  2I2O A;  4KVO A;  2LNI A;  3ZIM A;  4LEU A;  4BES A;  2GRL A;  4TRQ A;  3QB2 A;  4YND A;  3EDT B;  2IOL A;  4WUY A;  3WG7 E;  2GRQ B;  4N5Q A;  5AAR A;  3EHR A;  4DJA A;  5CBO A;  3PZ4 A;  1IQU A;  1N9A A;  3GW4 A;  4RSY A;  2ILR A;  4BFR A;  3R9M A;  4LNB A;  5B1A E;  3ZYQ A;  5HQ8 A;  2I6H A;  3AJI A;  2KBX A;  3FUF A;  1UW4 B;  3AG1 E;  1JCQ A;  2ZIR A;  3QWW A;  3RO3 A;  2L0I A;  4KZ0 A;  1DVP A;  3EHQ A;  1EYH A;  3UIO C;  4CT0 A;  1FPP A;  3K9I A;  2XRZ A;  4I1O B;  2LXM A;  3OXF A;  1OY3 D;  2RG8 A;  3DEP A;  4D10 C;  2VSO E;  3ZPJ A;  3QOU A;  1Z6T A;  4U7E B;  5FIN A;  3DBS A;  1OXJ A;  1ZB1 A;  4AIF A;  2EIJ E;  2WVI A;  3UQ3 A;  3GZ1 A;  1Y8M A;  2P2C P;  1X5B A;  4RLY A;  4L2L A;  1FCH A;  3CKC A;  4WNF A;  2WXO A;  2A5E A;  4KVM A;  4GPM A;  1Z3Y A;  2LUH A;  3TWX A;  5T3R A;  4MS6 A;  3FUD A;  3E30 A;  1JCR A;  3ZHE A;  3RRU A;  3I3N A;  2Y3A A;  3JQ1 A;  4XX5 A;  3NB2 A;  4DRX E;  4DX1 A;  2XPI A;  5HKP A;  4DX6 D;  4H7X A;  5BV1 A;  4JA7 A;  5HI7 A;  4UI9 J;  4IYP A;  2P9U G;  1FVH A;  2XGO A;  4I6E A;  4U04 A;  4UI9 C;  1QZ2 A;  4UQX A;  5EYP F;  3ZXP A;  5BXO A;  3EU9 A;  2OV8 A;  1WG0 A;  3QJZ A;  4A3V A;  3RRN B;  2F8X K;  3APD A;  3ZEF A;  3UKR G;  3N71 A;  1N95 A;  3ENE A;  4F1P A;  4A63 B;  1JCS A;  4UWK A;  4TUM A;  3UT7 A;  3CVN A;  3ESK A;  4JB8 P;  4AP2 A;  3TG5 A;  2XRY A;  1E8Y A;  2ZIS A;  3OAW A;  3ZYM A;  2ETC A;  2EIK E;  4B94 A;  1K1A A;  2KCK A;  3SBT B;  4G8L A;  3PH0 C;  4LRZ A;  5JMN D;  2NYJ A;  4PUC A;  4ZFH A;  3U3W A;  1ELW A;  2PM7 A;  5KJK A;  2FUL A;  5ENS D;  1HE8 A;  3CEQ A;  4J0U A;  5JJT A;  3FTW A;  4HFG A;  2J07 A;  1OUV A;  3OXG A;  1S70 B;  2GRR B;  3CSF A;  4APF A;  3PE3 A;  3B7U X;  4F53 A;  5AEN A;  3ULY A;  4Y6C A;  4I1M A;  3VLF A;  5ENQ D;  2XS8 A;  4L2Y A;  4OVV A;  3DSV A;  4I17 A;  3AS5 A;  5LCW C;  2BF0 X;  3TWV A;  3MKQ A;  5EIL A;  4FAD A;  3T8K A;  4IN3 B;  2BED A;  3TWQ A;  5J90 A;  4HRN A;  2L6B A;  3QDN A;  3S7J A;  3CV0 A;  1N4P A;  3NF1 A;  3S7F A;  1N0R A;  3APF A;  4P29 A;  5ARG A;  5A7D B;  3C3Q A;  5C1D A;  5H7P A;  4JD2 G;  3QKY A;  3PEU B;  3Q9N C;  4LUN U;  3UPV A;  3MKQ B;  4UQZ A;  1NI1 A;  1Y6I A;  3QWP A;  4F6R D;  2WXQ A;  3SGH A;  5FJY A;  3DXM G;  4U63 A;  3RKV A;  3IEG A;  3J5Q B;  3Q75 A;  1AP7 A;  1LF8 A;  4BSX A;  1SW6 A;  2GW1 A;  3L6A A;  2PNN A;  4F7A A;  2HYZ A;  2XZT G;  3AG2 E;  1KZP A;  1H6O A;  1BI7 B;  2OVF A;  1E7U A;  3KEZ A;  4V3I A;  3CHR A;  3D9O A;  2I9C A;  2WXL A;  3Q4A B;  4B93 B;  5CRU A;  1WM5 A;  1N4R A;  1OCC E;  5FZR A;  2LSV A;  3KEA A;  1MX6 A;  2CFU A;  4YDW A;  3MEK A;  3DSW A;  4CYM D;  2IF4 A;  1HX8 A;  4BWR A;  4FJZ A;  2CHX A;  1A17 A;  4NAC A;  4HNA D;  5FZQ A;  4WWP A;  3UT8 A;  5BPP A;  2Y0B G;  5KJL A;  3QAR A;  4U8V D;  2VYI A;  2QYU A;  2MHK A;  3B13 A;  1TNU A;  3I5P A;  4ZHB A;  3P1U A;  4M3O A;  3NZU A;  4XIF A;  4MRU A;  3OXL A;  3V2O A;  4XZ4 A;  4HOT A;  1FT1 A;  4W9R A;  3FU5 A;  3D9L A;  4I2W A;  3KD7 A;  3W9F A;  4GTT A;  4A1S A;  3LPZ A;  3D9H A;  1PAQ A;  4OVU A;  1TN8 A;  3Q7F A;  3V31 A;  2ZGG A;  1E7V A;  5ENT D;  5AQA A;  5T4Y A;  2DVW A;  4HRL A;  2BKG A;  4ILI A;  1NL4 A;  3SZ7 A;  3L54 A;  2VSY A;  2DCP A;  4G25 A;  4U0U A;  3JXJ A;  1IYG A;  2AW6 A;  2C2L A;  3BEE A;  4PS8 A;  4DLQ A;  3LVR E;  4HB5 A;  2Y4U A;  1MYO A;  4GPK A;  4AEZ C;  3LY7 A;  3ASH A;  3D3M A;  1OT8 A;  3G2T A;  3DSS A;  3ESL A;  3KAE A;  3UT4 A;  5BV0 A;  3L9T A;  2R05 A;  1NA0 A;  2RFM A;  3FFL A;  5ENO D;  4E85 A;  3GYZ A;  3CVL A;  2H6H A;  2X6I A;  1Z5S C;  3ASN E;  2P9K G;  4L7T A;  5D0O D;  5B1B E;  3PNL B;  5CED B;  4DK5 A;  2QY7 A;  3ZNG A;  4IRU A;  2AWI A;  2AXV A;  5G05 J;  3S2A A;  5FWQ A;  4BT9 A;  1TJF A;  4GYW A;  5G05 C;  5HS0 A;  4HOR A;  2CFZ A;  4DLO A;  4F1S A;  5ITZ F;  4PH4 B;  5KBA A;  5BXU A;  2DWZ A;  4CGW A;  1K1B A;  3B7R L;  1KT0 A;  4Y6W A;  3R9A B;  1FVF A;  1O1T A;  3FEX A;  4G24 A;  1SZ9 A;  1HXI A;  2XEV A;  3G2V A;  3ONL A;  4UUC A;  4AY5 A;  2MYO A;  5ENP D;  3TAX A;  3S7D A;  3NOG D;  4OYS A;  4E6H A;  3MYV A;  1G3N B;  1OWM A;  2UY1 B;  3R7Q A;  3DXK G;  4AM9 A;  3ZXS A;  4IUL A;  3FUM A;  2M63 A;  4GMR A;  4AXH A;  5CMY A;  2XPZ A;  2ZXW E;  3TWR A;  3L13 A;  3DRA A;  1YYH A;  4TXQ A;  3MX3 A;  1RZ4 A;  5DBK A;  3LKU A;  5FQ8 A;  4AY6 A;  3PZD A;  3G2S A;  3TWW A;  4DX2 A;  4LSZ E;  2PL2 A;  2PZI A;  3TWU A;  2IOS A;  1UJK A;  2CG3 A;  3ZN3 A;  4J6I A;  2LSU A;  2BTD A;  5AYW D;  4FU3 A;  2J08 A;  3RU0 A;  1E8X A;  5ENR D;  5CER B;  3B7S A;  2LAI A;  2NC9 A;  2WXR A;  2KXP C;  2V8S E;  2WQ7 A;  4I1A A;  5CEA A;  1H2T C;  1B89 A;  2VGX B;  3HRA A;  3C3O A;  2FEZ A;  4JEU A;  3BU8 A;  4G8K A;  5EX0 A;  5EDS A;  1PC2 A;  4BET A;  2DZO A;  2C0M A;  3FUE A;  4FJY A;  2DZN A;  3BUA A;  2XHE A;  3AAA C;  4N2Q A;  3E32 A;  5CEC B;  3FH7 A;  2I1K A;  4U8H A;  3LXU X;  1PY1 A;  2IFU A;  4DPR A;  2XEH A;  4ACL A;  2DYS E;  3D9I A;  2KAT A;  2NXP A;  5J08 A;  3T5X A;  1QBQ A;  4HI8 A;  3FU3 A;  3CK8 A;  4CCA A;  3ZU7 B;  4BER A;  2OEW A;  1N52 A;  3QWV A;  3PEV B;  1XNF A;  4FHK A;  4GZD A;  2L9B A;  1K8K G;  5JJ7 A;  5KNH D;  2P9L G;  1QNF A;  4XKB A;  3DSU A;  3FUK A;  2P9I G;  3TJP A;  3G2W A;  4N3A A;  4JA9 A;  3I4R B;  3Q47 B;  4DI4 A;  4CZ2 D;  2QFC A;  2X6F A;  4JHK A;  3TWS A;  5C2Y A;  3D9N A;  2DIW A;  4GA2 A;  3RK6 A;  3UM3 A;  3CVU A;  1IHG A;  1NFI E;  3PE4 A;  3ULE G;  3CIA A;  1NZN A;  4WAF A;  1IHB A;  3KS2 A;  2E0I A;  3AU5 A;  2R5S A;  3D9K A;  2XEN A;  3IHV A;  2P9S G;  4L23 A;  3SO8 A;  4DI3 A;  1IXV A;  3CLJ A;  4J8F A;  4K0R A;  2R59 A;  3MV3 B;  3MJW A;  1E90 A;  3LJ3 A;  1TNZ A;  1BD8 A;  4WNE A;  2B6C A;  2YNQ A;  3ML8 A;  2OOE A;  2L6J A;  2EQX A;  3ML9 A;  4TXR A;  1ELR A;  2V5F A;  2VTB A;  2CG2 A;  1TYQ G;  2AVP A;  2WXF A;  4O6F A;  5BW8 C;  4LNG A;  3U64 A;  3T9K A;  3SI5 A;  3HG0 D;  1A5E A;  3BG0 B;  5G55 A;  3MKR A;  2RFA A;  5FQ4 A;  1E96 B;  1Z3X A;  1OWO A;  5LFA A;  3PNT B;  2QC9 A;  3AG4 E;  4FLH A;  4CGV A;  2IO3 C;  3UI2 A;  2VTB B;  3RO2 A;  4HLE A;  3CKB A;  4C0M A;  3Q7A A;  2GGF A;  4G11 A;  1LD8 A;  3HHM A;  5ENN A;  5LCW J;  5ARF A;  3FTV A;  3Q73 A;  3KSQ A;  3LY8 A;  2R2L A;  1D8E A;  3HYM B;  2WPV A;  5LP0 A;  5FQ6 A;  4KZC A;  2FF4 A;  4GYO A;  3CHO A;  4MKT A;  1AWC B;  1TN6 A;  3QK0 A;  1TN7 A;  3D9M A;  4LER A;  3NQP A;  3ZYL A;  3FUN A;  4PS7 A;  2IU1 A;  1MZC A;  3ONK A;  4U8Y D;  3ABM E;  3CQC B;  4EZL A;  4KMO A;  3LVQ E;  3ZYK A;  3EU5 A;  5ANR A;  4UWG A;  2WMN A;  3MA5 A;  3FP3 A;  3MV2 B;  3Q15 A;  5CCL A;  3QAQ A;  3VTY A;  1U3C A;  4OAU C;  3I4G A;  3CHS A;  2YQ8 A;  2Y69 E;  5KJM A;  4LG6 A;  4J8D A;  1OWL A;  1HU3 A;  3Q79 A;  4N3C A;  1JWG A;  4J8S A;  1JWF A;  2OND A;  1SQM A;  4J8Y A;  3CK7 A;  3HVE A;  5AJD A;  1H2V C;  5BUZ A;  3D9J A;  4GZ6 A;  2R02 A;  3C5R A;  2WB2 A;  2J8S D;  3G2U A;  1N94 A;  1H6P A;  1TNB A;  3W9G A;  1SA4 A;  4GU5 A;  3B7B A;  4ILG A;  3HXC A;  4GML A;  3NBN B;  3CHM A;  2LAH A;  1FT2 A;  5D66 A;  2EIL E;  3FTZ A;  1UJJ A;  3HVE B;  1X81 A;  3FH8 A;  1OWN A;  2LXL A;  2JAB A;  5AN8 A;  3S7B A;  3CVX A;  4AOF A;  1JUQ A;  2XEE A;  4XE0 A;  1NA3 A;  4ANU A;  2J09 A;  3DSX A;  5KNG A;  2H6G A;  3DWL G;  1VDY A;  4JEH A;  3CR3 A;  4DX7 D;  1D8D A;  2R03 A;  2MRI A;  1N4Q A;  4JPS A;  5ANL A;  5M72 A;  5JJ6 A;  2XCC A;  4AJW A;  2KCV A;  3APC A;  2E2E A;  4QQI A;  3ASD A;  5BT1 A;  3L82 A;  2DBA A;  4GCO A;  4RG9 A;  3O48 A;  1MX4 A;  4CEM A;  3DPY A;  3UXG A;  3DPD A;  3UM1 A;  4JZY A;  2CHW A;  3FU0 A;  3BQO A;  4HRM B;  2H6I A;  4XKC A;  5KWD A;  2WXG A;  4N39 A;  4HVB A;  3Q9U C;  5LX8 A;  5AQ7 A;  1OWP A;  1HF8 A;  2KC7 A;  3CK9 A;  3SBS A;  1N4S A;  4CDR A;  2XGM A;  4XI9 A;  4BTB A;  4BTA A;  4ANX A;  2XGS A;  1UN8 A;  2P9P G;  4GMJ A;  2WQ6 A;  4JL0 A;  4H7Y A;  5B3S E;  4NQ0 A;  3FUJ A;  4K03 A;  3UTM A;  2AXU A;  2EIN E;  3LJN A;  3SD5 A;  2ZGD A;  3SFY A;  3CVP A;  2V4H C;  4U95 D;  2X38 A;  5AQ9 A;  1L5J A;  4BX8 A;  2X3M A;  3L22 A;  2P9N G;  4HOU A;  5FTP A;  4NRH B;  4ABN A;  2UWJ G;  2UY1 A;  1N11 A;  3CVW A;  1INZ A;  4HXI A;  3MGB A;  3PUJ A;  3FTX A;  1P5Q A;  4CDM A;  3FEY A;  5E75 A;  4K5B A;  4YDO A;  4A1G A;  2PQR A;  2C0L A;  3L08 A;  3AU4 A;  3SFZ A;  1OCR E;  3FTY A;  3NAW A;  4GB9 A;  4UWF A;  3V2X A;  1TNO A;  1BU9 A;  3DEO A;  1ZBP A;  3IBE A;  3ZKJ A;  4F3V A;  2B0O E;  1EPU A;  3SY2 A;  3FHE A;  2CHZ A;  5HRY A;  5FQ7 A;  1O1R A;  4A3T A;  2HM8 A;  4JW1 A;  1EDU A;  4BT8 A;  4O1P A;  3TXN A;  4GZ3 A;  3C72 A;  4QFV A;  4JXT A;  4B8C B;  2AXZ A;  4GCN A;  2WXK A;  3BG1 B;  3E33 A;  3EJN A;  1Q2Z A;  1NP7 A;  2WXM A;  3FWV A;  4BY6 A;  1SZA A;  4TXP A;  5FIO A;  3HDX A;  2VGX A;  3TWT A;  3DST A;  4CDN A;  5EYL A;  3EUV A;  5A23 A;  2ETA A;  2F0Y A;  1TJC A;  1LTX A;  3E37 A;  3T8M A;  2XZD G;  1HFA A;  3PS6 A;  4N3B A;  5JA4 D;  2WQH A;  1S63 A;  3MCX A;  1TNY A;  4U0S A;  4J7W A;  3FU6 A;  2RKK A;  3LCA A;  4URK A;  4U0Z A;  4ATZ D;  2VGY A;  4FA6 A;  3ASG A;  3ABK E;  1XGW A;  2WMO A;  3P2B A;  3V30 A;  3E4B A;  4KT6 B;  2FBN A;  4AV7 A;  5AQB A;  4JHR A;  1DCQ A;  3U66 A;  3IXE A;  5BNW A;  4U96 D;  5E76 A;  4BX9 A;  1MHQ A;  3TG4 A;  3L17 A;  4N5C A;  3UX4 A;  3ZUV B;  4YVO A;  3LDZ A;  4GTR A;  4I9E A;  4EZK A;  2DYR E;  4GZ5 A;  1DNP A;  1S64 A;  3FUH A;  4G26 A;  2X6K A;  2MOW A;  3JXI A;  3Q49 B;  4HS2 A;  4GTS A;  5JHB A;  1HG5 A;  4A55 A;  4G1T A;  4EBA G;  4GTM A;  4LCT A;  4EEC A;  2F37 A;  2J49 A;  3FTU A;  1TEZ A;  2J9Q A;  4FC8 A;  1V55 E;  3QNK A;  1HO8 A;  5AAO A;  2WXJ A;  1KT1 A;  3R7R A;  2XPY A;  4TUU A;  3JCK C;  3EIJ A;  4Z68 A;  3U4T A;  3SFX A;  1DCE A;  1BPO A;  2HO1 A;  2A5U A;  1QYM A;  4B89 A;  1IQR A;  4AVX A;  4YDE A;  4WND A;  2KCL A;  1UOH A;  4EBA A;  2WXH A;  5EX3 A;  3HXB A;  1HH8 A;  1UG3 A;  1U3D A;  4FLB A;  3ABL E;  3PZ3 A;  4ME2 A;  4JC8 A;  2WM9 A;  4R7L A;  4EZJ A;  4HBD A;  4NUR A;  4Q96 A;  4LNU D;  2IEJ A;  2OEV A;  4GTO A;  4K5A B;  3EIQ C;  3UMV A;  4J8E A;  3ULQ A;  3ZHE B;  5T8I A;  1TR4 A;  5CMW A;  1BLX B;  3ZFW A;  1ZU2 A;  5G04 J;  4UI9 K;  5CCM A;  4XI0 A;  5G04 C;  2A4Z A;  3UIN C;  3FUL A;  3RIB A;  3RSE G;  2J4B A;  3AG3 E;  2NSZ A;  2RD0 A;  1U2V G;  3LYA A;  3UIP C;  2WXN A;  3ASF A;  1GW6 A;  2HR2 A;  3IHY A;  4CRW A;  4I9C A;  2YHE A;  4L9P A;  5DIZ A;  2Y1L E;  4ILH B;  4PS3 A;  2IY0 C;  1SA5 A;  3Q78 A;  3KSL A;  4BSZ B;  3LEW A;  3Q5M A;  1QQE A;  4GZC A;  4PDX A;  3UM2 A;  4HOQ A;  3L16 A;  4YDY A;  2FI7 A;  3HXE A;  1YMP A;  4GAA A;  4RQI A;  5LOZ A;  3WXX A;  3JYS A;  5D0Q D;  4JHJ A;  4O60 A;  5EIB E;  1YCS B;  4FUL A;  2V5Q C;  3FDH A;  1BI8 B;  1E8Z A;  3CHQ A;  4I43 A;  4GA0 A;  5JHA A;  1LD7 A;  3HXD A;  4WNG A;  3HXF A;  3JUI A;  1HG2 A;  3F6Q A;  2PQN A;  2FO1 E;  1W3B A;  4UQY A;  1KLX A;  2P58 C;  3PUK A;  3NZS A;  2GRO B;  3LS8 A;  1MJ0 A;  1DC2 A;  2WXP A;  3C3R A;  2YIN A;  4APO A;  5EKQ D;  3ZRH A;  4DUI A;  3T5V A;  3SF4 A;  4GTQ A;  3SQV A;  2X6H A;  4Q69 A;  3EHN A;  2VQ2 A;  4B0Z A;  3U9W A;  3PRE A;  2FO7 A;  2BKK B;  1YA0 A;  4HLL A;  4WWN A;  3ISM C;  4BEP A;  4Q94 A;  3CVQ A;  3RRM B;  3AS8 A;  3FY4 A;  5CBN A;  4NIK A;  1V54 E;  2VGE A;  3B95 A;  1O1S A;  2LO6 A;  3ASO E;  4YVQ C;  2QYJ A;  1SVX A;  1OCO E;  1O5M A;  3RAU A;  2OCC E;  4RG6 A;  3RJV A;  2F8Y A;  4G2V A;  2JLB A;  2GRM A;  4KXK B;  3ZVV A;  4TV3 A;  5FT9 A;  1WAO 1;  4OAV B;  4CT4 A;  4HQD A;  5AJL A;  3FTS A;  2KZT A;  4GTV A;  2ZU6 B;  3HIZ A;  4I2Z A;  5D2M C;  4FHJ A;  4C48 B;  4EPZ A;  2IQC A;  3VLE A;  3CVV A;  4U07 A;  1IKN D;  4C9B B;  4B8A A;  4EQF A;  1KPS B;  2YHC A;  5CRV A;  2V0P A;  3FUI A;  3JQ0 A;  2HE0 A;  4GTP A;  5CHE E;  4M7C A; 
#chains in the Genus database with same CATH homology
 2GRR B;  2GRQ B;  3UIN C;  1Z5S C;  5D2M C;  1KPS B;  2IO2 C;  2IY0 C;  3UIP C;  3UIO C;  2GRP B;  2IO3 C;  2GRN B;  2GRO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...