3FFLA

Crystal structure of the n-terminal domain of anaphase-promoting complex subunit 7
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
126
Chain Sequence
MNVIDHVRDMAAAGLHSNVRLLSSLLLTLSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALCLPSEIEVKYKLAECYTVLKQDKDAIAILDGIPSRQRTPKINMLLANLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Anaphase-promoting complex subunit 7
publication title Crystal Structure of the N-terminal Domain of Anaphase-Promoting Complex Subunit 7
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 48
structure length 126
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3fflA00
5KJLA 3CVQA 4GA2A 4UQYA 3CKBA 4WNDA 2NC9A 4Y6WA 4ABNA 2VGYA 3MA5A 5KJKA 4NQ0A 4Y6CA 3ZPJA 3MEKA 2Q7FA 2VYIA 3KAEA 1WM5A 2P58C 3RJVA 3PE4A 5D0QD 4G26A 3U3WA 4JA9A 3GZ2A 4CGWA 4U0UA 2C0LA 3UQ3A 2IFUA 2UY1B 3CV0A 5FTPA 2BUGA 4XI0A 3UUXA 2I6HA 3CK9A 2IF4A 4I17A 2FF4A 5FZQA 1QQEA 3ASFA 4I2WA 2XGMA 4N5CA 3CVNA 2GW1A 1NA3A 5KJMA 2UY1A 3R9AB 2HR2A 5JJ7A 2VGXA 3RKVA 4O6FA 5JJTA 5KJNA 3URZA 2KCLA 3LCAA 4YNDA 4H7YA 3QKYA 2OOEA 2PQNA 2FBNA 4N3CA 4G25A 4KXKB 3CVLA 1IYGA 5EKQD 4GYOA 3OXGA 1TJCA 4GYYA 3LY8A 2L6JA 1KT1A 4KBQA 2JLBA 1P5QA 3RU0A 3NF1A 1PC2A 3RO3A 5FJYA 1NA0A 4GZ5A 4BTBA 3GW4A 2XCCA 4U0SA 3AS8A 1A17A 1Y8MA 1ZU2A 3CVPA 4ME2A 3CK8A 1E96B 1HXIA 5EX0A 5G05J 4J8EA 4UQXA 3ZHEB 5FT9A 4KYOB 4RG9A 4N3BA 4I9EA 4G23A 1ELWA 3GZ1A 4F3VA 3S7BA 4GZ3A 5LCWJ 5AYWD 3S7DA 1KLXA 3PE3A 2AVPA 5G04J 4RG6A 4UQZA 1B89A 4JA7A 3RIBA 3IEGA 2XEVA 2KC7A 2FEZA 4IN3B 2DBAA 1W3BA 3ZHEA 4N39A 4APOA 3FWVA 2V5FA 3LPZA 4BT8A 2VQ2A 5CHEE 3FP3A 4LEUA 2Y4TA 4I2ZA 3MV3B 2VSYA 4AY5A 2PL2A 4BTAA 1QZ2A 4BWRA 2C0MA 4G24A 2Y4UA 3QWPA 3TG4A 3SF4A 2E2EA 2LSVA 2J9QA 4I9CA 4H7XA 1HZ4A 2KCKA 4N2QA 4G1TA 2LSUA 3LYAA 2QFCA 4YVOA 1ELRA 5DIZA 3ASGA 3LY9A 4YVQC 3Q49B 4HOQA 2R5SA 3UPVA 5LCWC 5BW8C 3ZN3A 2YHCA 4B94A 5G04C 3CEQA 3FFLA 3Q5MA 3VTYA 4GZ6A 3U4TA 3EDTB 4UI9K 5HI7A 3MV2B 2XPIA 4JHRA 3AS5A 5A6CA 3OXLA 4J8DA 4I1AA 4AM9A 4N2SA 4U04A 3TGOA 3QOUA 3ESKA 3ASDA 4AIFA 5A7DB 2YQ8A 4GPKA 3LY7A 4GCOA 2KCVA 3CK7A 4HOUA 3GYZA 4WNFA 5ARFA 3TG5A 5BNWA 2ONDA 4UI9J 2XGSA 3SZ7A 1IHGA 4GYWA 3JYSA 5CCLA 4U0ZA 4XI9A 1XNFA 4NRHB 2VGXB 2VSNA 3ULQA 5HQ8A 3ZFWA 5D0OD 3S7FA 4BT9A 1FCHA 2C2LA 2HO1A 4GA0A 2UWJG 5ARGA 1NZNA 2HYZA 3E4BA 4N3AA 4J0UA 3S7JA 3QDNA 4AY6A 1HH8A 2PZIA 5DBKA 2KATA 3QWVA 1YA0A 5CCMA 3MKRA 2PQRA 4HOSA 4XIFA 5EX3A 3WXXA 2FO7A 3LKUA 4JL0A 4CGVA 3Q15A 4G2VA 3QWWA 3ASHA 3Q4AB 4HOTA 1KT0A 3HYMB 5JJ6A 5G05C 2WPVA 2LNIA 3Q47B 3ZGQA 3OXFA 5FZSA 4W9RA 3N71A 4WUYA 5C1DA 4HORA 3RO2A 2XCBA 3O48A 5FZRA 5BT1A 4WNEA 4A1SA 1WAO1 4UI9C 2FI7A 4U07A 2WQHA 4GA1A 4GCNA 3KD7A 1OUVA 4EQFA 4J8FA 3BEEA 3TAXA 3CKCA 5M72A 2MHKA 4WNGA 3KS2A 3PDNA 3K9IA 1ZBPA 3AS4A 2XGOA 4CDRA 3VTXA
chains in the Genus database with same CATH superfamily
1UN9A 5KJLA 4GA2A 3G2VA 2WXGA 2ZIRA 2VGYA 3PRZA 4GTMA 3DSXA 5EILA 3L22A 5T3RA 3ZPJA 4DK5A 2Q7FA 4G26A 4JA9A 3GZ2A 1N9AA 2IFUA 5FWQA 5FTPA 3HDXA 4TXPA 4UWFA 2KBXA 1OWMA 4C0EA 3CK9A 4A63B 3OAWA 2FF4A 5FZQA 3CVXA 1QQEA 3FH5A 4HQDA 4N5CA 5KBAA 5EN5D 1E90A 4CZ2D 4I6GA 2EIKE 3MYVA 5G2NA 3RKVA 4DX1A 4O6FA 1QNFA 2RD0A 2EQXA 4H7YA 3NAWA 1N0QA 5AENA 2FBNA 4TUUA 5FINA 2Y69E 4G25A 4KXKB 3UXGA 4ZFHA 2R59A 4R7LA 2IOLA 2IO3C 1TJCA 2XENA 3ZRHA 3FTXA 4KBQA 2JLBA 1TR4A 4OAUC 3PH0C 3SY2A 4JEHA 3EJNA 3ABKE 3PUKA 3NF1A 3DSUA 2QYJA 2A5UA 1NA0A 3EIJA 3Q7FA 2XCCA 4U0SA 2H6HA 1BI8B 3R9MA 1PAQA 4NACA 3AS8A 2J4BA 3EHNA 4U63A 2IU1A 1Y8MA 2B0OE 1UG3A 2A5EA 2I9CA 3CVPA 3UM1A 1V54E 1MX2A 3L13A 3RRMB 3ZYQA 3IHYA 1NI1A 1HXIA 3G2SA 4B89A 5BPPA 4FHJA 4LNUD 1S0PA 2OV8A 2DWZA 3TWSA 3CSTA 4J8EA 2Y3AA 5FT9A 4N3BA 1FPPA 3AU5A 4EBAG 2I1KA 2X6KA 5KWDA 3S7DA 4M7CA 2AVPA 4XEIG 4UQZA 2XEVA 1S64A 2KC7A 4WWOA 3V31A 4IN3B 3JCKC 3SD5A 3HG0D 4N39A 2XZDG 2CHZA 3Q79A 2JEKA 3LPZA 4GMLA 2J08A 4I1OB 5CHEE 4IULA 5IY5E 4L9PA 3ZYMA 1JUQA 1JWFA 3UMVA 4BTAA 3RRNB 1MQSA 3QWPA 2E2EA 2L0IA 4BSZB 4H7XA 1U3CA 2WXKA 3HRAA 2KCKA 4DJAA 4G1TA 4EZLA 1WG0A 4HLEA 2OEWA 3LYAA 2OCCE 4BY6A 1TN6A 4AVXA 3FHEA 2DYRE 3IBEA 3ESLA 3CHMA 3I5PA 4HI8A 5B1BE 1SW6A 3PZDA 1E8XA 2DVWA 4U8VD 5CBNA 3ABME 3TJPA 4GZ6A 3ZYLA 2WQ6A 4UI9K 1N54A 4HI9A 3BQOA 3T5VA 4JHRA 3AS5A 4RVBA 4N2SA 1UN8A 2WMOA 3CVWA 3V30A 4RLYA 4HS2A 3UIPC 4GPKA 2ZXWE 2QY7A 2KCVA 3ZXSA 4FU3A 3QAQA 5BNWA 3DSTA 2ONDA 2Y1LE 4B0ZA 2DYSE 3E34A 1TNYA 1IHGA 1OCZE 1BD8A 3RRUA 1V55E 3Q9UC 1U2VG 5BXUA 2GRMA 3MCXA 5HRYA 2MOWA 3R7QA 2LUHA 1XNFA 3Q78A 1TN8A 5HQ8A 1TNZA 3ZFWA 4BT9A 1FCHA 2C2LA 3PZ2A 5D2MC 4J0UA 3S7JA 2CHXA 4AY6A 5BUZA 2KATA 3UM3A 1QYMA 4UUCA 1MX4A 1O1TA 1N4RA 4B8CB 5EX3A 2XHEA 4U96D 2AXZA 2EINE 3FH7A 1IQUA 3Q4AB 3Q73A 2VTBA 1HE8A 4FP7A 3HYMB 3V2XA 1G3NB 4ACKA 5ENSD 3AG2E 3VLEA 5LP0A 4DX2A 4HORA 5ENQD 2BF0X 4I6JA 2WXPA 3G2WA 1HX8A 1WAO1 3PZ1A 3IKOB 1UJKA 2RFAA 2RG8A 4F1PA 4MS6A 3B7UX 2WXMA 4GA1A 4GCNA 1HF8A 4C9BB 3FUIA 2MHKA 3ULYA 4HBDA 3KS2A 2WXFA 2LAHA 5AARA 3TXMA 1MX6A 2XGOA 4FLBA 2NYJA 2ZU6B 3HXFA 3CKBA 2NC9A 2WXQA 4LSZE 1OWLA 1EPUA 4JVSA 3LVRE 3QB2A 4ABNA 4QFVA 4XKCA 3T8MA 4GB9A 4Q96A 3TWQA 2IOSA 3KAEA 4GTOA 5EIBE 3U64A 3PE4A 4JD2G 3U3WA 4DI4A 1SA5A 3D9MA 4KZ0A 3C98A 3UM0A 1BLXB 2I6HA 3PNLB 2H6GA 4I17A 3QC1A 2XGMA 3CVNA 2GW1A 1NL4A 5KJMA 3P1UA 2UY1A 4QQIA 3DSVA 3L17A 4PDXA 2FO1E 2CG2A 3JQ1A 1IHBA 2KCLA 1YMPA 3CVYA 4ANXA 1TJFA 3CVLA 1IYGA 3U9WA 5EYLA 1K8KG 4TXRA 1Z3YA 4GYOA 2IQCA 4UWKA 3OXGA 1UW4B 1D9SA 3HXEA 1KT1A 4K5BA 3J5PA 3LS8A 4ZHBA 2P9PG 4YDOA 5CERB 3L6AA 1S70B 1OWNA 4J6IA 5FJYA 3L08A 4JZYA 3GW4A 1HG5A 3QNKA 3UT7A 3EIQC 5LFAA 3FEXA 1O1SA 3FUKA 1TNUA 4ME2A 1OWOA 3CK8A 5LOZA 4A3TA 2R03A 5EX0A 3PVLA 1ELKA 2VSOE 2P9IG 3Q7AA 3LJNA 1OCOE 4LCTA 4GTTA 3LJ3A 3T9KA 4OYSA 2XPYA 2WXNA 5CEDB 2CHWA 1ELWA 3ABLE 4F3VA 2R17C 5AYWD 3FDHA 2J49A 3SHFA 5E75A 5G55A 3EUVA 3D9JA 3IEGA 4EECA 2FEZA 5ENRD 1W3BA 3ZHEA 4L1BA 3CVUA 3FWVA 2H6IA 3V79K 1ZB1A 4GZCA 4HNAD 4B93B 1WDYA 3DSWA 5FQ6A 4BEPA 4AXHA 4M3OA 3MV3B 2PL2A 4BWRA 1QZ2A 2AXVA 2C0MA 4JHJA 2Y4UA 2J07A 3TG4A 3LEWA 3SF4A 2J09A 1NFIE 4EBAA 1YYHA 5ENTD 2X6IA 3LDZA 4PS7A 3HXDA 2PNNA 4BX9A 1N94A 2QFCA 4YVOA 3IV0A 3J5QB 1FVFA 3ASGA 3LY9A 2GRLA 4I43A 4HOQA 3U66A 1DC2A 3UPVA 3B7BA 5LCWC 5BW8C 3ZN3A 3L82A 1LD8A 2YHCA 4B94A 4ANWA 5G04C 3CEQA 4DLOA 3UT4A 3G2TA 3BU8A 1MYOA 2XRZA 1RZ4A 4ILGA 1N4PA 3UINC 3D9OA 2XPIA 1JCSA 1H6PA 3JXIA 4I1AA 4IYPA 4K03A 3QOUA 3LVQE 3TWWA 3CR3A 1TEZA 3CIAA 3LY7A 3GZSA 5B1AE 4B8AA 3CK7A 3AJIA 4HOUA 4TXQA 5ITZF 2XEEA 4GAAA 5AN8A 2L6BA 4X8QA 2XZTG 3D9HA 4UI9J 2WXIA 1H6KA 3SZ7A 5T8IA 4U0ZA 2LO6A 3FTSA 2E0IA 4NRHB 2VSNA 3ULQA 2LXMA 4DX6D 2WM9A 4BX8A 3SBTB 5AQAA 2UWJG 2R02A 2ILRA 5ARGA 2IY0C 4N3AA 3CQGB 2CFZA 3AAAC 3QDNA 4DUIA 3G2UA 2PZIA 4I6EA 2GRQB 1KZOA 3P2BA 3MKRA 4HOSA 4L2YA 1LF8A 4K0RA 3LKUA 3FTUA 4CGVA 3Q15A 1IKND 2EILE 4AOFA 1SZ9A 1SA4A 2QYUA 4CRWA 4NIKA 3QJZA 3X2QE 2KZTA 3PZ4A 5JJ6A 4IRUA 2WPVA 2LNIA 5HKPA 1SZAA 3Q47B 5CBOA 3UTMA 4W9RA 3N71A 3ONLA 3FU3A 3RO2A 3O48A 3PEVB 2XQ0A 3TXNA 4HVBA 4DX7D 2WQ7A 4Z68A 4AP2A 1SQMA 3SQVA 4MLPA 5CECB 2WQHA 3KD7A 4EQFA 3VLFA 4J8FA 4JXTA 3SFYA 3AG4E 2HM8A 3UIOC 2IONA 4APFA 5CRVA 3TWRA 3K9IA 1ZBPA 3ZNGA 3PREA 3PEUB 4LNBA 2YHEA 4KMOA 2PM7A 5AJDA 4CDRA 3VTXA 4ATZD 3CVQA 5FIOA 4UQYA 4WNDA 1HO8A 4L23A 2VSXE 3EU9A 4Y6WA 3O4ZA 3MA5A 1UOHA 4NQ0A 2QC9A 3HVEA 1H2TC 4Y6CA 4LRZA 1HU3A 2KXPC 3MEKA 2VYIA 3DXKG 1BI7B 1WM5A 2P58C 3RJVA 4JHKA 5D0QD 3DPDA 4U0UA 2MRIA 3KEZA 3CV0A 2PM6A 1K1BA 4XI0A 1INZA 3UUXA 3FUJA 4GMJA 4GU5A 4MBGA 3MJWA 1X81A 3ASFA 4I2WA 4RSYA 5CMYA 2H6FA 3EU5A 1GW6A 4BETA 3UKRG 2WXLA 4U95D 2HR2A 3SBSA 5JJTA 2VJ8A 4HRNA 4F7AA 3URZA 3F6QA 3JUIA 4JB8P 3QKYA 4O1PA 2OOEA 2PQNA 4N3CA 4FA6A 1E8WA 5AQ7A 2DCPA 1H2VC 2YINA 1OXJA 4DPRA 2XPZA 4ILHB 4U8YD 4GYYA 2P9SG 3W9GA 4CEMA 2AXUA 3WG7E 2GROB 3W9FA 1P5QA 3RU0A 1FT1A 1YCSB 4KVMA 3BG1B 3CSFA 3RO3A 1DCQA 4D10C 5J08A 4GZ5A 4BTBA 5A23A 4KT6B 2V0PA 4J8YA 1A17A 3KSLA 3D3MA 4GPMA 4KVOA 3CGHA 1E8YA 3SFXA 3FTYA 3B7TA 3ML9A 4C48B 1WY6A 4Q94A 4FLHA 3BUAA 4OVVA 2HE0A 4CYMD 4OVUA 2OVBA 3C3RA 2AWIA 5FQ8A 5FQ7A 2I1JA 4G8KA 1O5MA 4UQXA 1X5BA 1E7VA 4FHKA 2OEVA 3DRAA 2EIJE 1DVPA 2OVFA 3QARA 5JHAA 4TUMA 1IQRA 4G23A 3GZ1A 3S7BA 4GZ3A 2GRRB 4NURA 4J8SA 1KLXA 4CDNA 4FJZA 2LXLA 3CHPA 4JA7A 4JPSA 1EDUA 3E30A 4PUCA 3SGHA 4GZDA 4BSXA 1H6OA 1DNPA 1N95A 2V5FA 4BT8A 3I4RB 1Q2ZA 4LEUA 2KZTB 4GTQA 2IJGX 3FTZA 2VSYA 3MX3A 2P9UG 3EHRA 3NB2A 2LSVA 2V4HC 2J9QA 4GTVA 4I9CA 2FULA 1OCCE 3MKQA 3B95A 3D9KA 4BFRA 3D9NA 3FTWA 3TWXA 4KZCA 3UM2A 3FU5A 3RK6A 2BTDA 2LSUA 1S63A 4DX5D 2YNQA 5D66A 3FUFA 4G8LA 3UI2A 4BERA 5KNHD 3FU6A 2X3MA 3PZ3A 3Q49B 4DRXE 2EIME 4A1GA 3DWLG 5EIDA 1AWCB 4WWNA 3ASNE 3FEYA 2IEJA 4AV7A 3AU4A 1UJJA 4TV3A 5T4YA 4HLLA 3FFLA 3Q5MA 3PUJA 4E85A 3EDTB 2XEHA 4L7TA 3HVEB 2ZGGA 5HI7A 3D9LA 1K3ZD 1O1RA 4J8DA 4AM9A 2ZISA 3TGOA 4ANVA 2GGFA 3ASDA 4AIFA 5A7DB 1TYQG 4EPZA 1Z5SC 3PS6A 4XKBA 3JXJA 1U3DA 1E7UA 2DZOA 3APCA 3L54A 5ARFA 4PS8A 1NP7A 2M63A 2JABA 3D9IA 3KEAA 4JC8A 4A55A 5CCLA 4O1OA 4XI9A 3CLJA 4GMRA 3V2OA 4DI3A 3IXEA 3AG1E 3OTNA 4I1MA 5AQ9A 1N0RA 3LXUX 3Q9NC 4N5QA 3DSSA 3TL5A 1N4SA 2VTBB 4CDMA 4TRQA 2HYZA 3E4BA 2IO2C 3FY4A 4CCAA 3NBNB 1OCRE 3CHQA 4L2LA 1HH8A 1HS6A 3FUMA 1OY3D 5CCMA 2PQRA 4XIFA 5EYPF 4WWPA 1JWGA 3NZSA 2FO7A 3FULA 4JEUA 4JL0A 3QWWA 1KT0A 5BV1A 5G05C 5H7PA 3RAUA 3E33A 3ZGQA 1MJ0A 5C1DA 3B13A 5JA4D 2XS1A 1Y6IA 5BXOA 4BESA 4WNEA 4A1SA 2ZGDA 2FI7A 4U07A 3EHMA 1N11A 1BU9A 3IHVA 3CKCA 3UKUG 3TWVA 4WNGA 3C3OA 3MGBA 3ML8A 3AS4A 3VLDA 3Q75A 2CFUA 2Y0BG 4AEZC 3ZUVB 4F1SA 1TNOA 2L9BA 2WXOA 5CMWA 2J8SD 1KPSB 5KJKA 4EZKA 5AAOA 4FULA 2P9KG 2X6FA 3I4GA 4K5CA 3NOGD 2F8YA 4FJYA 3EHQA 4CGWA 2C0LA 4WAFA 3SNXA 3UQ3A 2UY1B 3NZUA 2BUGA 3ZIMA 4UWGA 3ZYKA 3ZVVA 3I3NA 3DEOA 4HRMB 4ATGA 3MKQB 2IF4A 2R2LA 2NXPA 4AJWA 3ISMC 4MKTA 2DIWA 3FTVA 4GTSA 1NA3A 1K1AA 4CT4A 3TWTA 1JPLA 2ETAA 3R9AB 5JJ7A 2VGXA 3E32A 4LERA 5KJNA 2F37A 3LCAA 4YNDA 4XZ4A 1Z6TA 4FADA 3DEPA 3HIZA 4UWHA 2F0YA 5EKQD 1HG2A 4FC8A 1OT8A 1H0AA 3FH8A 4F53A 3LY8A 1TNBA 2L6JA 3JUEA 3SO8A 1MHQA 3FUHA 3T8KA 2RKKA 3JQ0A 2GRPB 1XGWA 3ZXPA 1H2UA 4YDEA 3D9PA 1PC2A 1LTXA 4OAVB 2BEDA 4LNGA 4A3VA 4Q69A 4J7WA 2P2CP 5E76A 3SI5A 2A4ZA 4GTRA 3APDA 3ZW3A 5AIJA 5ENOD 3B7RL 3FUNA 3R7RA 5ANLA 2X6HA 1L5JA 3HXBA 1ZU2A 5ANRA 3FUEA 2WXJA 3SFZA 1E96B 4G11A 5KCMA 2WXRA 4PH4B 4HFGA 5G05J 3ZHEB 2X38A 4KYOB 4V3IA 2I2OA 4RG9A 1D8EA 3UT8A 5LX8A 4PS3A 2J4DA 4I9EA 3ZU7B 5HS0A 5LCWJ 3RSEG 3PE3A 4JW1A 5JMND 5G04J 4RG6A 3ZEFA 1B89A 3RIBA 2NSZA 3KSQA 2KM4A 4U8HA 5ENNA 1VDYA 2DBAA 2XS8A 4MRUA 4APOA 1E8ZA 3L16A 4DLQA 4O60A 2VQ2A 1JCQA 2CG3A 3FP3A 2BKGA 1N4QA 3S2AA 2Y4TA 4F6RD 5CEAA 3C72A 4XE0A 4I2ZA 4AY5A 5CRUA 2AW6A 4G24A 1HZ4A 4N2QA 4LG6A 4RQIA 3ASOE 2B6CA 1A5EA 3MZLB 3FU0A 3CVVA 3PNTB 1KZPA 2LAIA 4URKA 1ELRA 2V8SE 3DBSA 2MYOA 5DIZA 4YVQC 1AP7A 2WMNA 2V4LA 2R5SA 4ILIA 3FUDA 5JHBA 3ONKA 1PY1A 1N52A 3CHRA 3VTYA 2BKKB 1D8DA 3U4TA 3CHSA 2L0TB 4LUNU 3MV2B 5EDSA 5A6CA 3OXLA 5KNGA 2AJAA 4UWLA 5ENPD 4HRLA 4U04A 1H19A 3ESKA 2YQ8A 2F8XK 3HXCA 2WVIA 4GCOA 2VGEA 2P9LG 3DPYA 3E37A 3GYZA 4WNFA 1LD7A 2X6JA 3TG5A 3ZKJA 2V5QC 2XGSA 3C5RA 3QK0A 1FVHA 4GYWA 1HFAA 1IXVA 3JYSA 3CQCB 1FT2A 4YDWA 3B7SA 1OWPA 4CT0A 3C3QA 2VGXB 4EHMA 5D0OD 3S7FA 4U7EB 2HO1A 4GA0A 2WB2A 1NZNA 3ULEG 2QZAA 2DZNA 3HHMA 4HXIA 3APFA 3NQPA 4EZJA 1TN7A 5DBKA 3QWVA 1YA0A 2P9NG 3UX4A 3WXXA 2GRNB 4G2VA 3ASHA 3DXMG 1JCRA 5FQ4A 4HOTA 4YDYA 3BG0B 3T5XA 2ETCA 2ETBA 1Z3XA 4ACLA 4HB5A 3OXFA 4ANUA 5FZSA 3CHOA 4WUYA 3TWUA 2XRYA 5AJLA 5BV0A 3L9TA 1BPOA 2XCBA 5FZRA 5BT1A 4E6HA 4UI9C 5AQBA 4XX5A 1MZCA 1OUVA 2WXHA 3BEEA 5J90A 3TAXA 5M72A 4C0MA 4P29A 2RFMA 3NOCD 3PDNA 5B3SE 4K5AB 1SVXA 5C2YA 1EYHA 3AG3E 3ENEA 2R05A 1RW2A 1EF1C 4GTPA 1QBQA 1DCEA
chains in the Genus database with same CATH topology
2ZU6B 1UN9A 5KJLA 3CVQA 4GA2A 4UQYA 4AEZC 3G2VA 3CKBA 4F1SA 4WNDA 1HO8A 4L23A 2WXGA 2L9BA 2WXOA 5CMWA 2VSXE 2NC9A 2WXQA 1OWLA 1EPUA 4JVSA 4Y6WA 3LVRE 3QB2A 4ABNA 2VGYA 4QFVA 4XKCA 3O4ZA 3PRZA 3MA5A 5KJKA 4NQ0A 4EZKA 3HVEA 1H2TC 4Y6CA 3T8MA 3L22A 4GB9A 4LRZA 4Q96A 1HU3A 5T3RA 3ZPJA 4DK5A 4FULA 2IOSA 2Q7FA 3MEKA 2VYIA 2X6FA 3I4GA 3KAEA 1WM5A 2P58C 3U64A 3RJVA 3PE4A 4JHKA 4FJYA 5D0QD 4G26A 3DPDA 4JA9A 3GZ2A 4DI4A 4CGWA 3U3WA 4U0UA 2C0LA 4WAFA 3D9MA 3SNXA 3UQ3A 2IFUA 2UY1B 2MRIA 3KEZA 5FWQA 3NZUA 4KZ0A 3CV0A 5FTPA 2BUGA 2PM6A 3C98A 4XI0A 1INZA 3HDXA 3UUXA 4UWGA 3ZIMA 3ZYKA 3FUJA 3ZVVA 4GMJA 4UWFA 3I3NA 2I6HA 3PNLB 1OWMA 4GU5A 3CK9A 4C0EA 4ATGA 3OAWA 3MKQB 2IF4A 2NXPA 4I17A 2FF4A 5FZQA 4AJWA 3CVXA 3MJWA 1QQEA 4MKTA 3ASFA 3FH5A 3QC1A 4I2WA 2XGMA 4RSYA 2DIWA 4N5CA 5CMYA 3FTVA 3CVNA 1E90A 2GW1A 1NA3A 1GW6A 4I6GA 4CT4A 2WXLA 1JPLA 5KJMA 3P1UA 2UY1A 3MYVA 3R9AB 5G2NA 2HR2A 3L17A 4PDXA 3SBSA 5JJ7A 2VGXA 2CG2A 3RKVA 4O6FA 3JQ1A 1QNFA 2RD0A 4LERA 5JJTA 2VJ8A 4F7AA 5KJNA 3URZA 2KCLA 3JUIA 3LCAA 2EQXA 4YNDA 4H7YA 4XZ4A 3QKYA 1Z6TA 3CVYA 2OOEA 4FADA 5AENA 2PQNA 2FBNA 4TUUA 4ANXA 3HIZA 4N3CA 4G25A 4UWHA 4FA6A 1TJFA 1E8WA 4KXKB 3CVLA 2DCPA 1IYGA 3U9WA 1H2VC 5EKQD 2YINA 4A3TA 1HG2A 4FC8A 1Z3YA 2R59A 4GYOA 4DPRA 4R7LA 2IQCA 2XPZA 4ILHB 2IOLA 4UWKA 3OXGA 1TJCA 3ZRHA 1H0AA 3FH8A 4F53A 1UW4B 4GYYA 3LY8A 2L6JA 4CEMA 2AXUA 1MHQA 1KT1A 3FTXA 4KBQA 3LS8A 3FUHA 2JLBA 1P5QA 3JQ0A 3RU0A 1XGWA 3PH0C 4KVMA 1H2UA 3L6AA 3EJNA 4JEHA 3BG1B 1OWNA 3PUKA 3NF1A 3D9PA 1PC2A 3CSFA 4J6IA 3RO3A 4D10C 4A3VA 5FJYA 5J08A 3L08A 2A5UA 1NA0A 4GZ5A 4Q69A 4JZYA 4BTBA 3EIJA 3GW4A 1HG5A 5E76A 2XCCA 3QNKA 4U0SA 5A23A 1PAQA 4NACA 3AS8A 3SI5A 2A4ZA 2J4BA 4KT6B 3UT7A 3EIQC 2V0PA 3EHNA 3APDA 4U63A 5LFAA 1A17A 2IU1A 1Y8MA 3D3MA 3ZW3A 5AIJA 4KVOA 3B7RL 3FUNA 1UG3A 3R7RA 3FEXA 3CGHA 5ANLA 2I9CA 1L5JA 2X6HA 1ZU2A 3FUKA 3CVPA 5ANRA 4ME2A 1OWOA 3CK8A 3FUEA 1E8YA 3FTYA 3L13A 5LOZA 3B7TA 3ML9A 2WXJA 3RRMB 3ZYQA 3SFZA 1E96B 1WY6A 3IHYA 4Q94A 1HXIA 4G11A 3G2SA 4FLHA 5EX0A 3PVLA 5KCMA 4B89A 5BPPA 4OVVA 4FHJA 2WXRA 4OVUA 2OVBA 4PH4B 1ELKA 1S0PA 2AWIA 2OV8A 2VSOE 5FQ8A 5FQ7A 4HFGA 2I1JA 5G05J 3CSTA 4J8EA 4UQXA 3ZHEB 1X5BA 2X38A 2Y3AA 1E7VA 5FT9A 4FHKA 4KYOB 4LCTA 4V3IA 2I2OA 4RG9A 3UT8A 3LJ3A 5LX8A 4N3BA 4PS3A 4OYSA 2XPYA 2J4DA 2WXNA 1DVPA 4I9EA 2OVFA 3AU5A 3QARA 2CHWA 4EBAG 5JHAA 2I1KA 1IQRA 4G23A 1ELWA 3GZ1A 4F3VA 3S7BA 4GZ3A 2X6KA 5LCWJ 2R17C 5AYWD 4NURA 3S7DA 4J8SA 1KLXA 3PE3A 4FJZA 4CDNA 2AVPA 3FDHA 4JW1A 2J49A 3SHFA 5G04J 4RG6A 3ZEFA 3CHPA 4UQZA 5E75A 5G55A 1B89A 4JA7A 3RIBA 3D9JA 3IEGA 4EECA 2NSZA 2XEVA 4JPSA 4WWOA 2KC7A 1EDUA 2FEZA 2KM4A 4PUCA 3SGHA 4IN3B 4GZDA 4U8HA 4BSXA 5ENNA 1VDYA 2DBAA 1W3BA 3JCKC 3SD5A 3ZHEA 1DNPA 4MRUA 4N39A 4L1BA 4APOA 3CVUA 3FWVA 1E8ZA 3L16A 2V5FA 4DLQA 2CHZA 4GZCA 2JEKA 3LPZA 4GMLA 4BT8A 3I4RB 2J08A 2VQ2A 4I1OB 5FQ6A 5CHEE 2CG3A 4IULA 3FP3A 4AXHA 4LEUA 3S2AA 2KZTB 2Y4TA 3ZYMA 1JUQA 2IJGX 4XE0A 1JWFA 4M3OA 4I2ZA 3MV3B 3FTZA 3UMVA 2VSYA 4AY5A 2PL2A 4BTAA 1QZ2A 4BWRA 3RRNB 1MQSA 2AXVA 3MX3A 2C0MA 4JHJA 2AW6A 4G24A 2Y4UA 3QWPA 2J07A 3TG4A 3LEWA 3SF4A 2E2EA 2LSVA 2J9QA 4I9CA 2FULA 2L0IA 2J09A 3MKQA 3D9KA 4H7XA 1U3CA 2WXKA 1HZ4A 4BFRA 4EBAA 2KCKA 3D9NA 3FTWA 4DJAA 4N2QA 2X6IA 3LDZA 4G1TA 4PS7A 4KZCA 4EZLA 3FU5A 3RK6A 3MZLB 4BX9A 2BTDA 3FU0A 3CVVA 2LSUA 3PNTB 2YNQA 4HLEA 3FUFA 3LYAA 2LAIA 4URKA 2QFCA 4YVOA 1ELRA 3IV0A 4BY6A 1FVFA 3FU6A 2V8SE 2X3MA 3DBSA 5DIZA 3ASGA 3LY9A 4YVQC 4AVXA 2WMNA 3Q49B 2GRLA 3FHEA 3IBEA 4HOQA 4I43A 4A1GA 3U66A 2V4LA 2R5SA 4WWNA 3ESLA 5LCWC 3UPVA 3FEYA 5BW8C 4AV7A 3AU4A 1UJJA 3CHMA 3FUDA 3I5PA 3ONKA 4ILIA 4TV3A 3ZN3A 5T4YA 2YHCA 5JHBA 4B94A 1PY1A 4ANWA 5G04C 3PZDA 3CEQA 1E8XA 1N52A 3UT4A 3G2TA 4DLOA 3FFLA 3Q5MA 3CHRA 3VTYA 3TJPA 2XRZA 4GZ6A 3U4TA 3PUJA 4E85A 3EDTB 3ZYLA 4L7TA 3CHSA 4ILGA 3HVEB 2WQ6A 4UI9K 1N54A 2L0TB 5HI7A 4LUNU 3MV2B 3D9OA 3D9LA 2XPIA 5EDSA 3T5VA 4JHRA 3AS5A 5A6CA 3OXLA 4RVBA 4J8DA 4I1AA 4AM9A 4N2SA 4UWLA 1UN8A 2WMOA 4U04A 4IYPA 1H19A 3TGOA 4K03A 3QOUA 3CVWA 4ANVA 3LVQE 4HS2A 2GGFA 3ESKA 3ASDA 4AIFA 5A7DB 4EPZA 2YQ8A 3CR3A 1TEZA 4GPKA 2WVIA 3CIAA 3PS6A 4XKBA 3LY7A 3GZSA 1U3DA 1E7UA 4GCOA 2QY7A 4B8AA 2KCVA 3CK7A 3APCA 4HOUA 3ZXSA 4FU3A 4GAAA 3L54A 3GYZA 3QAQA 4WNFA 2X6JA 5ARFA 3TG5A 5BNWA 4PS8A 2ONDA 1NP7A 4B0ZA 2M63A 4UI9J 2WXIA 2XGSA 1H6KA 3QK0A 3SZ7A 1FVHA 1IHGA 3D9IA 1HFAA 4GYWA 4JC8A 5T8IA 4A55A 3RRUA 3JYSA 5CCLA 3CQCB 2GRMA 3MCXA 4U0ZA 4XI9A 2MOWA 2LO6A 3B7SA 3CLJA 3R7QA 1OWPA 3FTSA 1XNFA 4DI3A 4CT0A 2E0IA 4NRHB 2VGXB 2VSNA 3OTNA 4I1MA 3ULQA 5HQ8A 3ZFWA 2WM9A 3LXUX 4BX8A 5D0OD 3S7FA 4BT9A 1FCHA 2C2LA 2HO1A 4GA0A 3TL5A 3SBTB 2VTBB 4CDMA 2UWJG 2WB2A 2ILRA 5ARGA 1NZNA 4TRQA 2HYZA 3E4BA 3FY4A 4N3AA 3CQGB 3HHMA 4CCAA 4J0UA 4HXIA 3APFA 2CFZA 2CHXA 3S7JA 3QDNA 4AY6A 3CHQA 3G2UA 4L2LA 1HH8A 1HS6A 2PZIA 3NQPA 5BUZA 4EZJA 5DBKA 2KATA 4I6EA 3FUMA 3QWVA 1YA0A 3P2BA 5CCMA 3MKRA 2PQRA 4HOSA 4B8CB 4XIFA 4L2YA 5EX3A 3UX4A 4WWPA 1LF8A 1JWGA 3NZSA 3WXXA 2FO7A 3FULA 4K0RA 2XHEA 3LKUA 2AXZA 4JEUA 3FTUA 4JL0A 4CGVA 3Q15A 4G2VA 3QWWA 3ASHA 3FH7A 5FQ4A 4AOFA 1IQUA 1SZ9A 3Q4AB 4HOTA 4CRWA 2VTBA 1HE8A 3BG0B 1KT0A 3QJZA 4FP7A 3T5XA 2KZTA 3HYMB 5JJ6A 5BV1A 5G05C 4IRUA 2WPVA 2LNIA 1SZAA 1Z3XA 3Q47B 3ZGQA 4ACLA 4ACKA 3OXFA 4ANUA 5FZSA 4W9RA 3VLEA 5LP0A 3CHOA 3N71A 4WUYA 3ONLA 5C1DA 4HORA 2XRYA 3B13A 3FU3A 5AJLA 5BV0A 3RO2A 1BPOA 2XCBA 1Y6IA 3O48A 3PEVB 2BF0X 2XQ0A 4I6JA 5FZRA 5BT1A 2WXPA 3TXNA 4E6HA 3G2WA 1HX8A 4HVBA 4WNEA 2WQ7A 4A1SA 1WAO1 3IKOB 1UJKA 4AP2A 2RG8A 4UI9C 1SQMA 2FI7A 4MS6A 3B7UX 4U07A 3EHMA 4MLPA 4XX5A 2WXMA 2WQHA 4GA1A 4GCNA 3KD7A 1OUVA 4EQFA 3VLFA 2WXHA 4J8FA 4JXTA 1HF8A 3BEEA 5J90A 4C9BB 3IHVA 3TAXA 3CKCA 5M72A 2HM8A 3FUIA 4C0MA 2IONA 2MHKA 4P29A 4APFA 4WNGA 3KS2A 3PDNA 3K9IA 5C2YA 1EYHA 1ZBPA 3MGBA 3PREA 3ENEA 3ML8A 2WXFA 3PEUB 2LAHA 3AS4A 1EF1C 2YHEA 3VLDA 4KMOA 3TXMA 2PM7A 5AJDA 2XGOA 4FLBA 2CFUA 4CDRA 3VTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KJL A;  3CVQ A;  4GA2 A;  4UQY A;  3CKB A;  4WND A;  2NC9 A;  4Y6W A;  4ABN A;  2VGY A;  3MA5 A;  5KJK A;  4NQ0 A;  4Y6C A;  3ZPJ A;  3MEK A;  2Q7F A;  2VYI A;  3KAE A;  1WM5 A;  2P58 C;  3RJV A;  3PE4 A;  5D0Q D;  4G26 A;  3U3W A;  4JA9 A;  3GZ2 A;  4CGW A;  4U0U A;  2C0L A;  3UQ3 A;  2IFU A;  2UY1 B;  3CV0 A;  5FTP A;  2BUG A;  4XI0 A;  3UUX A;  2I6H A;  3CK9 A;  2IF4 A;  4I17 A;  2FF4 A;  5FZQ A;  1QQE A;  3ASF A;  4I2W A;  2XGM A;  4N5C A;  3CVN A;  2GW1 A;  1NA3 A;  5KJM A;  2UY1 A;  3R9A B;  2HR2 A;  5JJ7 A;  2VGX A;  3RKV A;  4O6F A;  5JJT A;  5KJN A;  3URZ A;  2KCL A;  3LCA A;  4YND A;  4H7Y A;  3QKY A;  2OOE A;  2PQN A;  2FBN A;  4N3C A;  4G25 A;  4KXK B;  3CVL A;  1IYG A;  5EKQ D;  4GYO A;  3OXG A;  1TJC A;  4GYY A;  3LY8 A;  2L6J A;  1KT1 A;  4KBQ A;  2JLB A;  1P5Q A;  3RU0 A;  3NF1 A;  1PC2 A;  3RO3 A;  5FJY A;  1NA0 A;  4GZ5 A;  4BTB A;  3GW4 A;  2XCC A;  4U0S A;  3AS8 A;  1A17 A;  1Y8M A;  1ZU2 A;  3CVP A;  4ME2 A;  3CK8 A;  1E96 B;  1HXI A;  5EX0 A;  5G05 J;  4J8E A;  4UQX A;  3ZHE B;  5FT9 A;  4KYO B;  4RG9 A;  4N3B A;  4I9E A;  4G23 A;  1ELW A;  3GZ1 A;  4F3V A;  3S7B A;  4GZ3 A;  5LCW J;  5AYW D;  3S7D A;  1KLX A;  3PE3 A;  2AVP A;  5G04 J;  4RG6 A;  4UQZ A;  1B89 A;  4JA7 A;  3RIB A;  3IEG A;  2XEV A;  2KC7 A;  2FEZ A;  4IN3 B;  2DBA A;  1W3B A;  3ZHE A;  4N39 A;  4APO A;  3FWV A;  2V5F A;  3LPZ A;  4BT8 A;  2VQ2 A;  5CHE E;  3FP3 A;  4LEU A;  2Y4T A;  4I2Z A;  3MV3 B;  2VSY A;  4AY5 A;  2PL2 A;  4BTA A;  1QZ2 A;  4BWR A;  2C0M A;  4G24 A;  2Y4U A;  3QWP A;  3TG4 A;  3SF4 A;  2E2E A;  2LSV A;  2J9Q A;  4I9C A;  4H7X A;  1HZ4 A;  2KCK A;  4N2Q A;  4G1T A;  2LSU A;  3LYA A;  2QFC A;  4YVO A;  1ELR A;  5DIZ A;  3ASG A;  3LY9 A;  4YVQ C;  3Q49 B;  4HOQ A;  2R5S A;  3UPV A;  5LCW C;  5BW8 C;  3ZN3 A;  2YHC A;  4B94 A;  5G04 C;  3CEQ A;  3FFL A;  3Q5M A;  3VTY A;  4GZ6 A;  3U4T A;  3EDT B;  4UI9 K;  5HI7 A;  3MV2 B;  2XPI A;  4JHR A;  3AS5 A;  5A6C A;  3OXL A;  4J8D A;  4I1A A;  4AM9 A;  4N2S A;  4U04 A;  3TGO A;  3QOU A;  3ESK A;  3ASD A;  4AIF A;  5A7D B;  2YQ8 A;  4GPK A;  3LY7 A;  4GCO A;  2KCV A;  3CK7 A;  4HOU A;  3GYZ A;  4WNF A;  5ARF A;  3TG5 A;  5BNW A;  2OND A;  4UI9 J;  2XGS A;  3SZ7 A;  1IHG A;  4GYW A;  3JYS A;  5CCL A;  4U0Z A;  4XI9 A;  1XNF A;  4NRH B;  2VGX B;  2VSN A;  3ULQ A;  5HQ8 A;  3ZFW A;  5D0O D;  3S7F A;  4BT9 A;  1FCH A;  2C2L A;  2HO1 A;  4GA0 A;  2UWJ G;  5ARG A;  1NZN A;  2HYZ A;  3E4B A;  4N3A A;  4J0U A;  3S7J A;  3QDN A;  4AY6 A;  1HH8 A;  2PZI A;  5DBK A;  2KAT A;  3QWV A;  1YA0 A;  5CCM A;  3MKR A;  2PQR A;  4HOS A;  4XIF A;  5EX3 A;  3WXX A;  2FO7 A;  3LKU A;  4JL0 A;  4CGV A;  3Q15 A;  4G2V A;  3QWW A;  3ASH A;  3Q4A B;  4HOT A;  1KT0 A;  3HYM B;  5JJ6 A;  5G05 C;  2WPV A;  2LNI A;  3Q47 B;  3ZGQ A;  3OXF A;  5FZS A;  4W9R A;  3N71 A;  4WUY A;  5C1D A;  4HOR A;  3RO2 A;  2XCB A;  3O48 A;  5FZR A;  5BT1 A;  4WNE A;  4A1S A;  1WAO 1;  4UI9 C;  2FI7 A;  4U07 A;  2WQH A;  4GA1 A;  4GCN A;  3KD7 A;  1OUV A;  4EQF A;  4J8F A;  3BEE A;  3TAX A;  3CKC A;  5M72 A;  2MHK A;  4WNG A;  3KS2 A;  3PDN A;  3K9I A;  1ZBP A;  3AS4 A;  2XGO A;  4CDR A;  3VTX A; 
#chains in the Genus database with same CATH topology
 1UN9 A;  5KJL A;  4GA2 A;  3G2V A;  2WXG A;  2ZIR A;  2VGY A;  3PRZ A;  4GTM A;  3DSX A;  5EIL A;  3L22 A;  5T3R A;  3ZPJ A;  4DK5 A;  2Q7F A;  4G26 A;  4JA9 A;  3GZ2 A;  1N9A A;  2IFU A;  5FWQ A;  5FTP A;  3HDX A;  4TXP A;  4UWF A;  2KBX A;  1OWM A;  4C0E A;  3CK9 A;  4A63 B;  3OAW A;  2FF4 A;  5FZQ A;  3CVX A;  1QQE A;  3FH5 A;  4HQD A;  4N5C A;  5KBA A;  5EN5 D;  1E90 A;  4CZ2 D;  4I6G A;  2EIK E;  3MYV A;  5G2N A;  3RKV A;  4DX1 A;  4O6F A;  1QNF A;  2RD0 A;  2EQX A;  4H7Y A;  3NAW A;  1N0Q A;  5AEN A;  2FBN A;  4TUU A;  5FIN A;  2Y69 E;  4G25 A;  4KXK B;  3UXG A;  4ZFH A;  2R59 A;  4R7L A;  2IOL A;  2IO3 C;  1TJC A;  2XEN A;  3ZRH A;  3FTX A;  4KBQ A;  2JLB A;  1TR4 A;  4OAU C;  3PH0 C;  3SY2 A;  4JEH A;  3EJN A;  3ABK E;  3PUK A;  3NF1 A;  3DSU A;  2QYJ A;  2A5U A;  1NA0 A;  3EIJ A;  3Q7F A;  2XCC A;  4U0S A;  2H6H A;  1BI8 B;  3R9M A;  1PAQ A;  4NAC A;  3AS8 A;  2J4B A;  3EHN A;  4U63 A;  2IU1 A;  1Y8M A;  2B0O E;  1UG3 A;  2A5E A;  2I9C A;  3CVP A;  3UM1 A;  1V54 E;  1MX2 A;  3L13 A;  3RRM B;  3ZYQ A;  3IHY A;  1NI1 A;  1HXI A;  3G2S A;  4B89 A;  5BPP A;  4FHJ A;  4LNU D;  1S0P A;  2OV8 A;  2DWZ A;  3TWS A;  3CST A;  4J8E A;  2Y3A A;  5FT9 A;  4N3B A;  1FPP A;  3AU5 A;  4EBA G;  2I1K A;  2X6K A;  5KWD A;  3S7D A;  4M7C A;  2AVP A;  4XEI G;  4UQZ A;  2XEV A;  1S64 A;  2KC7 A;  4WWO A;  3V31 A;  4IN3 B;  3JCK C;  3SD5 A;  3HG0 D;  4N39 A;  2XZD G;  2CHZ A;  3Q79 A;  2JEK A;  3LPZ A;  4GML A;  2J08 A;  4I1O B;  5CHE E;  4IUL A;  5IY5 E;  4L9P A;  3ZYM A;  1JUQ A;  1JWF A;  3UMV A;  4BTA A;  3RRN B;  1MQS A;  3QWP A;  2E2E A;  2L0I A;  4BSZ B;  4H7X A;  1U3C A;  2WXK A;  3HRA A;  2KCK A;  4DJA A;  4G1T A;  4EZL A;  1WG0 A;  4HLE A;  2OEW A;  3LYA A;  2OCC E;  4BY6 A;  1TN6 A;  4AVX A;  3FHE A;  2DYR E;  3IBE A;  3ESL A;  3CHM A;  3I5P A;  4HI8 A;  5B1B E;  1SW6 A;  3PZD A;  1E8X A;  2DVW A;  4U8V D;  5CBN A;  3ABM E;  3TJP A;  4GZ6 A;  3ZYL A;  2WQ6 A;  4UI9 K;  1N54 A;  4HI9 A;  3BQO A;  3T5V A;  4JHR A;  3AS5 A;  4RVB A;  4N2S A;  1UN8 A;  2WMO A;  3CVW A;  3V30 A;  4RLY A;  4HS2 A;  3UIP C;  4GPK A;  2ZXW E;  2QY7 A;  2KCV A;  3ZXS A;  4FU3 A;  3QAQ A;  5BNW A;  3DST A;  2OND A;  2Y1L E;  4B0Z A;  2DYS E;  3E34 A;  1TNY A;  1IHG A;  1OCZ E;  1BD8 A;  3RRU A;  1V55 E;  3Q9U C;  1U2V G;  5BXU A;  2GRM A;  3MCX A;  5HRY A;  2MOW A;  3R7Q A;  2LUH A;  1XNF A;  3Q78 A;  1TN8 A;  5HQ8 A;  1TNZ A;  3ZFW A;  4BT9 A;  1FCH A;  2C2L A;  3PZ2 A;  5D2M C;  4J0U A;  3S7J A;  2CHX A;  4AY6 A;  5BUZ A;  2KAT A;  3UM3 A;  1QYM A;  4UUC A;  1MX4 A;  1O1T A;  1N4R A;  4B8C B;  5EX3 A;  2XHE A;  4U96 D;  2AXZ A;  2EIN E;  3FH7 A;  1IQU A;  3Q4A B;  3Q73 A;  2VTB A;  1HE8 A;  4FP7 A;  3HYM B;  3V2X A;  1G3N B;  4ACK A;  5ENS D;  3AG2 E;  3VLE A;  5LP0 A;  4DX2 A;  4HOR A;  5ENQ D;  2BF0 X;  4I6J A;  2WXP A;  3G2W A;  1HX8 A;  1WAO 1;  3PZ1 A;  3IKO B;  1UJK A;  2RFA A;  2RG8 A;  4F1P A;  4MS6 A;  3B7U X;  2WXM A;  4GA1 A;  4GCN A;  1HF8 A;  4C9B B;  3FUI A;  2MHK A;  3ULY A;  4HBD A;  3KS2 A;  2WXF A;  2LAH A;  5AAR A;  3TXM A;  1MX6 A;  2XGO A;  4FLB A;  2NYJ A;  2ZU6 B;  3HXF A;  3CKB A;  2NC9 A;  2WXQ A;  4LSZ E;  1OWL A;  1EPU A;  4JVS A;  3LVR E;  3QB2 A;  4ABN A;  4QFV A;  4XKC A;  3T8M A;  4GB9 A;  4Q96 A;  3TWQ A;  2IOS A;  3KAE A;  4GTO A;  5EIB E;  3U64 A;  3PE4 A;  4JD2 G;  3U3W A;  4DI4 A;  1SA5 A;  3D9M A;  4KZ0 A;  3C98 A;  3UM0 A;  1BLX B;  2I6H A;  3PNL B;  2H6G A;  4I17 A;  3QC1 A;  2XGM A;  3CVN A;  2GW1 A;  1NL4 A;  5KJM A;  3P1U A;  2UY1 A;  4QQI A;  3DSV A;  3L17 A;  4PDX A;  2FO1 E;  2CG2 A;  3JQ1 A;  1IHB A;  2KCL A;  1YMP A;  3CVY A;  4ANX A;  1TJF A;  3CVL A;  1IYG A;  3U9W A;  5EYL A;  1K8K G;  4TXR A;  1Z3Y A;  4GYO A;  2IQC A;  4UWK A;  3OXG A;  1UW4 B;  1D9S A;  3HXE A;  1KT1 A;  4K5B A;  3J5P A;  3LS8 A;  4ZHB A;  2P9P G;  4YDO A;  5CER B;  3L6A A;  1S70 B;  1OWN A;  4J6I A;  5FJY A;  3L08 A;  4JZY A;  3GW4 A;  1HG5 A;  3QNK A;  3UT7 A;  3EIQ C;  5LFA A;  3FEX A;  1O1S A;  3FUK A;  1TNU A;  4ME2 A;  1OWO A;  3CK8 A;  5LOZ A;  4A3T A;  2R03 A;  5EX0 A;  3PVL A;  1ELK A;  2VSO E;  2P9I G;  3Q7A A;  3LJN A;  1OCO E;  4LCT A;  4GTT A;  3LJ3 A;  3T9K A;  4OYS A;  2XPY A;  2WXN A;  5CED B;  2CHW A;  1ELW A;  3ABL E;  4F3V A;  2R17 C;  5AYW D;  3FDH A;  2J49 A;  3SHF A;  5E75 A;  5G55 A;  3EUV A;  3D9J A;  3IEG A;  4EEC A;  2FEZ A;  5ENR D;  1W3B A;  3ZHE A;  4L1B A;  3CVU A;  3FWV A;  2H6I A;  3V79 K;  1ZB1 A;  4GZC A;  4HNA D;  4B93 B;  1WDY A;  3DSW A;  5FQ6 A;  4BEP A;  4AXH A;  4M3O A;  3MV3 B;  2PL2 A;  4BWR A;  1QZ2 A;  2AXV A;  2C0M A;  4JHJ A;  2Y4U A;  2J07 A;  3TG4 A;  3LEW A;  3SF4 A;  2J09 A;  1NFI E;  4EBA A;  1YYH A;  5ENT D;  2X6I A;  3LDZ A;  4PS7 A;  3HXD A;  2PNN A;  4BX9 A;  1N94 A;  2QFC A;  4YVO A;  3IV0 A;  3J5Q B;  1FVF A;  3ASG A;  3LY9 A;  2GRL A;  4I43 A;  4HOQ A;  3U66 A;  1DC2 A;  3UPV A;  3B7B A;  5LCW C;  5BW8 C;  3ZN3 A;  3L82 A;  1LD8 A;  2YHC A;  4B94 A;  4ANW A;  5G04 C;  3CEQ A;  4DLO A;  3UT4 A;  3G2T A;  3BU8 A;  1MYO A;  2XRZ A;  1RZ4 A;  4ILG A;  1N4P A;  3UIN C;  3D9O A;  2XPI A;  1JCS A;  1H6P A;  3JXI A;  4I1A A;  4IYP A;  4K03 A;  3QOU A;  3LVQ E;  3TWW A;  3CR3 A;  1TEZ A;  3CIA A;  3LY7 A;  3GZS A;  5B1A E;  4B8A A;  3CK7 A;  3AJI A;  4HOU A;  4TXQ A;  5ITZ F;  2XEE A;  4GAA A;  5AN8 A;  2L6B A;  4X8Q A;  2XZT G;  3D9H A;  4UI9 J;  2WXI A;  1H6K A;  3SZ7 A;  5T8I A;  4U0Z A;  2LO6 A;  3FTS A;  2E0I A;  4NRH B;  2VSN A;  3ULQ A;  2LXM A;  4DX6 D;  2WM9 A;  4BX8 A;  3SBT B;  5AQA A;  2UWJ G;  2R02 A;  2ILR A;  5ARG A;  2IY0 C;  4N3A A;  3CQG B;  2CFZ A;  3AAA C;  3QDN A;  4DUI A;  3G2U A;  2PZI A;  4I6E A;  2GRQ B;  1KZO A;  3P2B A;  3MKR A;  4HOS A;  4L2Y A;  1LF8 A;  4K0R A;  3LKU A;  3FTU A;  4CGV A;  3Q15 A;  1IKN D;  2EIL E;  4AOF A;  1SZ9 A;  1SA4 A;  2QYU A;  4CRW A;  4NIK A;  3QJZ A;  3X2Q E;  2KZT A;  3PZ4 A;  5JJ6 A;  4IRU A;  2WPV A;  2LNI A;  5HKP A;  1SZA A;  3Q47 B;  5CBO A;  3UTM A;  4W9R A;  3N71 A;  3ONL A;  3FU3 A;  3RO2 A;  3O48 A;  3PEV B;  2XQ0 A;  3TXN A;  4HVB A;  4DX7 D;  2WQ7 A;  4Z68 A;  4AP2 A;  1SQM A;  3SQV A;  4MLP A;  5CEC B;  2WQH A;  3KD7 A;  4EQF A;  3VLF A;  4J8F A;  4JXT A;  3SFY A;  3AG4 E;  2HM8 A;  3UIO C;  2ION A;  4APF A;  5CRV A;  3TWR A;  3K9I A;  1ZBP A;  3ZNG A;  3PRE A;  3PEU B;  4LNB A;  2YHE A;  4KMO A;  2PM7 A;  5AJD A;  4CDR A;  3VTX A;  4ATZ D;  3CVQ A;  5FIO A;  4UQY A;  4WND A;  1HO8 A;  4L23 A;  2VSX E;  3EU9 A;  4Y6W A;  3O4Z A;  3MA5 A;  1UOH A;  4NQ0 A;  2QC9 A;  3HVE A;  1H2T C;  4Y6C A;  4LRZ A;  1HU3 A;  2KXP C;  3MEK A;  2VYI A;  3DXK G;  1BI7 B;  1WM5 A;  2P58 C;  3RJV A;  4JHK A;  5D0Q D;  3DPD A;  4U0U A;  2MRI A;  3KEZ A;  3CV0 A;  2PM6 A;  1K1B A;  4XI0 A;  1INZ A;  3UUX A;  3FUJ A;  4GMJ A;  4GU5 A;  4MBG A;  3MJW A;  1X81 A;  3ASF A;  4I2W A;  4RSY A;  5CMY A;  2H6F A;  3EU5 A;  1GW6 A;  4BET A;  3UKR G;  2WXL A;  4U95 D;  2HR2 A;  3SBS A;  5JJT A;  2VJ8 A;  4HRN A;  4F7A A;  3URZ A;  3F6Q A;  3JUI A;  4JB8 P;  3QKY A;  4O1P A;  2OOE A;  2PQN A;  4N3C A;  4FA6 A;  1E8W A;  5AQ7 A;  2DCP A;  1H2V C;  2YIN A;  1OXJ A;  4DPR A;  2XPZ A;  4ILH B;  4U8Y D;  4GYY A;  2P9S G;  3W9G A;  4CEM A;  2AXU A;  3WG7 E;  2GRO B;  3W9F A;  1P5Q A;  3RU0 A;  1FT1 A;  1YCS B;  4KVM A;  3BG1 B;  3CSF A;  3RO3 A;  1DCQ A;  4D10 C;  5J08 A;  4GZ5 A;  4BTB A;  5A23 A;  4KT6 B;  2V0P A;  4J8Y A;  1A17 A;  3KSL A;  3D3M A;  4GPM A;  4KVO A;  3CGH A;  1E8Y A;  3SFX A;  3FTY A;  3B7T A;  3ML9 A;  4C48 B;  1WY6 A;  4Q94 A;  4FLH A;  3BUA A;  4OVV A;  2HE0 A;  4CYM D;  4OVU A;  2OVB A;  3C3R A;  2AWI A;  5FQ8 A;  5FQ7 A;  2I1J A;  4G8K A;  1O5M A;  4UQX A;  1X5B A;  1E7V A;  4FHK A;  2OEV A;  3DRA A;  2EIJ E;  1DVP A;  2OVF A;  3QAR A;  5JHA A;  4TUM A;  1IQR A;  4G23 A;  3GZ1 A;  3S7B A;  4GZ3 A;  2GRR B;  4NUR A;  4J8S A;  1KLX A;  4CDN A;  4FJZ A;  2LXL A;  3CHP A;  4JA7 A;  4JPS A;  1EDU A;  3E30 A;  4PUC A;  3SGH A;  4GZD A;  4BSX A;  1H6O A;  1DNP A;  1N95 A;  2V5F A;  4BT8 A;  3I4R B;  1Q2Z A;  4LEU A;  2KZT B;  4GTQ A;  2IJG X;  3FTZ A;  2VSY A;  3MX3 A;  2P9U G;  3EHR A;  3NB2 A;  2LSV A;  2V4H C;  2J9Q A;  4GTV A;  4I9C A;  2FUL A;  1OCC E;  3MKQ A;  3B95 A;  3D9K A;  4BFR A;  3D9N A;  3FTW A;  3TWX A;  4KZC A;  3UM2 A;  3FU5 A;  3RK6 A;  2BTD A;  2LSU A;  1S63 A;  4DX5 D;  2YNQ A;  5D66 A;  3FUF A;  4G8L A;  3UI2 A;  4BER A;  5KNH D;  3FU6 A;  2X3M A;  3PZ3 A;  3Q49 B;  4DRX E;  2EIM E;  4A1G A;  3DWL G;  5EID A;  1AWC B;  4WWN A;  3ASN E;  3FEY A;  2IEJ A;  4AV7 A;  3AU4 A;  1UJJ A;  4TV3 A;  5T4Y A;  4HLL A;  3FFL A;  3Q5M A;  3PUJ A;  4E85 A;  3EDT B;  2XEH A;  4L7T A;  3HVE B;  2ZGG A;  5HI7 A;  3D9L A;  1K3Z D;  1O1R A;  4J8D A;  4AM9 A;  2ZIS A;  3TGO A;  4ANV A;  2GGF A;  3ASD A;  4AIF A;  5A7D B;  1TYQ G;  4EPZ A;  1Z5S C;  3PS6 A;  4XKB A;  3JXJ A;  1U3D A;  1E7U A;  2DZO A;  3APC A;  3L54 A;  5ARF A;  4PS8 A;  1NP7 A;  2M63 A;  2JAB A;  3D9I A;  3KEA A;  4JC8 A;  4A55 A;  5CCL A;  4O1O A;  4XI9 A;  3CLJ A;  4GMR A;  3V2O A;  4DI3 A;  3IXE A;  3AG1 E;  3OTN A;  4I1M A;  5AQ9 A;  1N0R A;  3LXU X;  3Q9N C;  4N5Q A;  3DSS A;  3TL5 A;  1N4S A;  2VTB B;  4CDM A;  4TRQ A;  2HYZ A;  3E4B A;  2IO2 C;  3FY4 A;  4CCA A;  3NBN B;  1OCR E;  3CHQ A;  4L2L A;  1HH8 A;  1HS6 A;  3FUM A;  1OY3 D;  5CCM A;  2PQR A;  4XIF A;  5EYP F;  4WWP A;  1JWG A;  3NZS A;  2FO7 A;  3FUL A;  4JEU A;  4JL0 A;  3QWW A;  1KT0 A;  5BV1 A;  5G05 C;  5H7P A;  3RAU A;  3E33 A;  3ZGQ A;  1MJ0 A;  5C1D A;  3B13 A;  5JA4 D;  2XS1 A;  1Y6I A;  5BXO A;  4BES A;  4WNE A;  4A1S A;  2ZGD A;  2FI7 A;  4U07 A;  3EHM A;  1N11 A;  1BU9 A;  3IHV A;  3CKC A;  3UKU G;  3TWV A;  4WNG A;  3C3O A;  3MGB A;  3ML8 A;  3AS4 A;  3VLD A;  3Q75 A;  2CFU A;  2Y0B G;  4AEZ C;  3ZUV B;  4F1S A;  1TNO A;  2L9B A;  2WXO A;  5CMW A;  2J8S D;  1KPS B;  5KJK A;  4EZK A;  5AAO A;  4FUL A;  2P9K G;  2X6F A;  3I4G A;  4K5C A;  3NOG D;  2F8Y A;  4FJY A;  3EHQ A;  4CGW A;  2C0L A;  4WAF A;  3SNX A;  3UQ3 A;  2UY1 B;  3NZU A;  2BUG A;  3ZIM A;  4UWG A;  3ZYK A;  3ZVV A;  3I3N A;  3DEO A;  4HRM B;  4ATG A;  3MKQ B;  2IF4 A;  2R2L A;  2NXP A;  4AJW A;  3ISM C;  4MKT A;  2DIW A;  3FTV A;  4GTS A;  1NA3 A;  1K1A A;  4CT4 A;  3TWT A;  1JPL A;  2ETA A;  3R9A B;  5JJ7 A;  2VGX A;  3E32 A;  4LER A;  5KJN A;  2F37 A;  3LCA A;  4YND A;  4XZ4 A;  1Z6T A;  4FAD A;  3DEP A;  3HIZ A;  4UWH A;  2F0Y A;  5EKQ D;  1HG2 A;  4FC8 A;  1OT8 A;  1H0A A;  3FH8 A;  4F53 A;  3LY8 A;  1TNB A;  2L6J A;  3JUE A;  3SO8 A;  1MHQ A;  3FUH A;  3T8K A;  2RKK A;  3JQ0 A;  2GRP B;  1XGW A;  3ZXP A;  1H2U A;  4YDE A;  3D9P A;  1PC2 A;  1LTX A;  4OAV B;  2BED A;  4LNG A;  4A3V A;  4Q69 A;  4J7W A;  2P2C P;  5E76 A;  3SI5 A;  2A4Z A;  4GTR A;  3APD A;  3ZW3 A;  5AIJ A;  5ENO D;  3B7R L;  3FUN A;  3R7R A;  5ANL A;  2X6H A;  1L5J A;  3HXB A;  1ZU2 A;  5ANR A;  3FUE A;  2WXJ A;  3SFZ A;  1E96 B;  4G11 A;  5KCM A;  2WXR A;  4PH4 B;  4HFG A;  5G05 J;  3ZHE B;  2X38 A;  4KYO B;  4V3I A;  2I2O A;  4RG9 A;  1D8E A;  3UT8 A;  5LX8 A;  4PS3 A;  2J4D A;  4I9E A;  3ZU7 B;  5HS0 A;  5LCW J;  3RSE G;  3PE3 A;  4JW1 A;  5JMN D;  5G04 J;  4RG6 A;  3ZEF A;  1B89 A;  3RIB A;  2NSZ A;  3KSQ A;  2KM4 A;  4U8H A;  5ENN A;  1VDY A;  2DBA A;  2XS8 A;  4MRU A;  4APO A;  1E8Z A;  3L16 A;  4DLQ A;  4O60 A;  2VQ2 A;  1JCQ A;  2CG3 A;  3FP3 A;  2BKG A;  1N4Q A;  3S2A A;  2Y4T A;  4F6R D;  5CEA A;  3C72 A;  4XE0 A;  4I2Z A;  4AY5 A;  5CRU A;  2AW6 A;  4G24 A;  1HZ4 A;  4N2Q A;  4LG6 A;  4RQI A;  3ASO E;  2B6C A;  1A5E A;  3MZL B;  3FU0 A;  3CVV A;  3PNT B;  1KZP A;  2LAI A;  4URK A;  1ELR A;  2V8S E;  3DBS A;  2MYO A;  5DIZ A;  4YVQ C;  1AP7 A;  2WMN A;  2V4L A;  2R5S A;  4ILI A;  3FUD A;  5JHB A;  3ONK A;  1PY1 A;  1N52 A;  3CHR A;  3VTY A;  2BKK B;  1D8D A;  3U4T A;  3CHS A;  2L0T B;  4LUN U;  3MV2 B;  5EDS A;  5A6C A;  3OXL A;  5KNG A;  2AJA A;  4UWL A;  5ENP D;  4HRL A;  4U04 A;  1H19 A;  3ESK A;  2YQ8 A;  2F8X K;  3HXC A;  2WVI A;  4GCO A;  2VGE A;  2P9L G;  3DPY A;  3E37 A;  3GYZ A;  4WNF A;  1LD7 A;  2X6J A;  3TG5 A;  3ZKJ A;  2V5Q C;  2XGS A;  3C5R A;  3QK0 A;  1FVH A;  4GYW A;  1HFA A;  1IXV A;  3JYS A;  3CQC B;  1FT2 A;  4YDW A;  3B7S A;  1OWP A;  4CT0 A;  3C3Q A;  2VGX B;  4EHM A;  5D0O D;  3S7F A;  4U7E B;  2HO1 A;  4GA0 A;  2WB2 A;  1NZN A;  3ULE G;  2QZA A;  2DZN A;  3HHM A;  4HXI A;  3APF A;  3NQP A;  4EZJ A;  1TN7 A;  5DBK A;  3QWV A;  1YA0 A;  2P9N G;  3UX4 A;  3WXX A;  2GRN B;  4G2V A;  3ASH A;  3DXM G;  1JCR A;  5FQ4 A;  4HOT A;  4YDY A;  3BG0 B;  3T5X A;  2ETC A;  2ETB A;  1Z3X A;  4ACL A;  4HB5 A;  3OXF A;  4ANU A;  5FZS A;  3CHO A;  4WUY A;  3TWU A;  2XRY A;  5AJL A;  5BV0 A;  3L9T A;  1BPO A;  2XCB A;  5FZR A;  5BT1 A;  4E6H A;  4UI9 C;  5AQB A;  4XX5 A;  1MZC A;  1OUV A;  2WXH A;  3BEE A;  5J90 A;  3TAX A;  5M72 A;  4C0M A;  4P29 A;  2RFM A;  3NOC D;  3PDN A;  5B3S E;  4K5A B;  1SVX A;  5C2Y A;  1EYH A;  3AG3 E;  3ENE A;  2R05 A;  1RW2 A;  1EF1 C;  4GTP A;  1QBQ A;  1DCE A; 
#chains in the Genus database with same CATH homology
 2ZU6 B;  1UN9 A;  5KJL A;  3CVQ A;  4GA2 A;  4UQY A;  4AEZ C;  3G2V A;  3CKB A;  4F1S A;  4WND A;  1HO8 A;  4L23 A;  2WXG A;  2L9B A;  2WXO A;  5CMW A;  2VSX E;  2NC9 A;  2WXQ A;  1OWL A;  1EPU A;  4JVS A;  4Y6W A;  3LVR E;  3QB2 A;  4ABN A;  2VGY A;  4QFV A;  4XKC A;  3O4Z A;  3PRZ A;  3MA5 A;  5KJK A;  4NQ0 A;  4EZK A;  3HVE A;  1H2T C;  4Y6C A;  3T8M A;  3L22 A;  4GB9 A;  4LRZ A;  4Q96 A;  1HU3 A;  5T3R A;  3ZPJ A;  4DK5 A;  4FUL A;  2IOS A;  2Q7F A;  3MEK A;  2VYI A;  2X6F A;  3I4G A;  3KAE A;  1WM5 A;  2P58 C;  3U64 A;  3RJV A;  3PE4 A;  4JHK A;  4FJY A;  5D0Q D;  4G26 A;  3DPD A;  4JA9 A;  3GZ2 A;  4DI4 A;  4CGW A;  3U3W A;  4U0U A;  2C0L A;  4WAF A;  3D9M A;  3SNX A;  3UQ3 A;  2IFU A;  2UY1 B;  2MRI A;  3KEZ A;  5FWQ A;  3NZU A;  4KZ0 A;  3CV0 A;  5FTP A;  2BUG A;  2PM6 A;  3C98 A;  4XI0 A;  1INZ A;  3HDX A;  3UUX A;  4UWG A;  3ZIM A;  3ZYK A;  3FUJ A;  3ZVV A;  4GMJ A;  4UWF A;  3I3N A;  2I6H A;  3PNL B;  1OWM A;  4GU5 A;  3CK9 A;  4C0E A;  4ATG A;  3OAW A;  3MKQ B;  2IF4 A;  2NXP A;  4I17 A;  2FF4 A;  5FZQ A;  4AJW A;  3CVX A;  3MJW A;  1QQE A;  4MKT A;  3ASF A;  3FH5 A;  3QC1 A;  4I2W A;  2XGM A;  4RSY A;  2DIW A;  4N5C A;  5CMY A;  3FTV A;  3CVN A;  1E90 A;  2GW1 A;  1NA3 A;  1GW6 A;  4I6G A;  4CT4 A;  2WXL A;  1JPL A;  5KJM A;  3P1U A;  2UY1 A;  3MYV A;  3R9A B;  5G2N A;  2HR2 A;  3L17 A;  4PDX A;  3SBS A;  5JJ7 A;  2VGX A;  2CG2 A;  3RKV A;  4O6F A;  3JQ1 A;  1QNF A;  2RD0 A;  4LER A;  5JJT A;  2VJ8 A;  4F7A A;  5KJN A;  3URZ A;  2KCL A;  3JUI A;  3LCA A;  2EQX A;  4YND A;  4H7Y A;  4XZ4 A;  3QKY A;  1Z6T A;  3CVY A;  2OOE A;  4FAD A;  5AEN A;  2PQN A;  2FBN A;  4TUU A;  4ANX A;  3HIZ A;  4N3C A;  4G25 A;  4UWH A;  4FA6 A;  1TJF A;  1E8W A;  4KXK B;  3CVL A;  2DCP A;  1IYG A;  3U9W A;  1H2V C;  5EKQ D;  2YIN A;  4A3T A;  1HG2 A;  4FC8 A;  1Z3Y A;  2R59 A;  4GYO A;  4DPR A;  4R7L A;  2IQC A;  2XPZ A;  4ILH B;  2IOL A;  4UWK A;  3OXG A;  1TJC A;  3ZRH A;  1H0A A;  3FH8 A;  4F53 A;  1UW4 B;  4GYY A;  3LY8 A;  2L6J A;  4CEM A;  2AXU A;  1MHQ A;  1KT1 A;  3FTX A;  4KBQ A;  3LS8 A;  3FUH A;  2JLB A;  1P5Q A;  3JQ0 A;  3RU0 A;  1XGW A;  3PH0 C;  4KVM A;  1H2U A;  3L6A A;  3EJN A;  4JEH A;  3BG1 B;  1OWN A;  3PUK A;  3NF1 A;  3D9P A;  1PC2 A;  3CSF A;  4J6I A;  3RO3 A;  4D10 C;  4A3V A;  5FJY A;  5J08 A;  3L08 A;  2A5U A;  1NA0 A;  4GZ5 A;  4Q69 A;  4JZY A;  4BTB A;  3EIJ A;  3GW4 A;  1HG5 A;  5E76 A;  2XCC A;  3QNK A;  4U0S A;  5A23 A;  1PAQ A;  4NAC A;  3AS8 A;  3SI5 A;  2A4Z A;  2J4B A;  4KT6 B;  3UT7 A;  3EIQ C;  2V0P A;  3EHN A;  3APD A;  4U63 A;  5LFA A;  1A17 A;  2IU1 A;  1Y8M A;  3D3M A;  3ZW3 A;  5AIJ A;  4KVO A;  3B7R L;  3FUN A;  1UG3 A;  3R7R A;  3FEX A;  3CGH A;  5ANL A;  2I9C A;  1L5J A;  2X6H A;  1ZU2 A;  3FUK A;  3CVP A;  5ANR A;  4ME2 A;  1OWO A;  3CK8 A;  3FUE A;  1E8Y A;  3FTY A;  3L13 A;  5LOZ A;  3B7T A;  3ML9 A;  2WXJ A;  3RRM B;  3ZYQ A;  3SFZ A;  1E96 B;  1WY6 A;  3IHY A;  4Q94 A;  1HXI A;  4G11 A;  3G2S A;  4FLH A;  5EX0 A;  3PVL A;  5KCM A;  4B89 A;  5BPP A;  4OVV A;  4FHJ A;  2WXR A;  4OVU A;  2OVB A;  4PH4 B;  1ELK A;  1S0P A;  2AWI A;  2OV8 A;  2VSO E;  5FQ8 A;  5FQ7 A;  4HFG A;  2I1J A;  5G05 J;  3CST A;  4J8E A;  4UQX A;  3ZHE B;  1X5B A;  2X38 A;  2Y3A A;  1E7V A;  5FT9 A;  4FHK A;  4KYO B;  4LCT A;  4V3I A;  2I2O A;  4RG9 A;  3UT8 A;  3LJ3 A;  5LX8 A;  4N3B A;  4PS3 A;  4OYS A;  2XPY A;  2J4D A;  2WXN A;  1DVP A;  4I9E A;  2OVF A;  3AU5 A;  3QAR A;  2CHW A;  4EBA G;  5JHA A;  2I1K A;  1IQR A;  4G23 A;  1ELW A;  3GZ1 A;  4F3V A;  3S7B A;  4GZ3 A;  2X6K A;  5LCW J;  2R17 C;  5AYW D;  4NUR A;  3S7D A;  4J8S A;  1KLX A;  3PE3 A;  4FJZ A;  4CDN A;  2AVP A;  3FDH A;  4JW1 A;  2J49 A;  3SHF A;  5G04 J;  4RG6 A;  3ZEF A;  3CHP A;  4UQZ A;  5E75 A;  5G55 A;  1B89 A;  4JA7 A;  3RIB A;  3D9J A;  3IEG A;  4EEC A;  2NSZ A;  2XEV A;  4JPS A;  4WWO A;  2KC7 A;  1EDU A;  2FEZ A;  2KM4 A;  4PUC A;  3SGH A;  4IN3 B;  4GZD A;  4U8H A;  4BSX A;  5ENN A;  1VDY A;  2DBA A;  1W3B A;  3JCK C;  3SD5 A;  3ZHE A;  1DNP A;  4MRU A;  4N39 A;  4L1B A;  4APO A;  3CVU A;  3FWV A;  1E8Z A;  3L16 A;  2V5F A;  4DLQ A;  2CHZ A;  4GZC A;  2JEK A;  3LPZ A;  4GML A;  4BT8 A;  3I4R B;  2J08 A;  2VQ2 A;  4I1O B;  5FQ6 A;  5CHE E;  2CG3 A;  4IUL A;  3FP3 A;  4AXH A;  4LEU A;  3S2A A;  2KZT B;  2Y4T A;  3ZYM A;  1JUQ A;  2IJG X;  4XE0 A;  1JWF A;  4M3O A;  4I2Z A;  3MV3 B;  3FTZ A;  3UMV A;  2VSY A;  4AY5 A;  2PL2 A;  4BTA A;  1QZ2 A;  4BWR A;  3RRN B;  1MQS A;  2AXV A;  3MX3 A;  2C0M A;  4JHJ A;  2AW6 A;  4G24 A;  2Y4U A;  3QWP A;  2J07 A;  3TG4 A;  3LEW A;  3SF4 A;  2E2E A;  2LSV A;  2J9Q A;  4I9C A;  2FUL A;  2L0I A;  2J09 A;  3MKQ A;  3D9K A;  4H7X A;  1U3C A;  2WXK A;  1HZ4 A;  4BFR A;  4EBA A;  2KCK A;  3D9N A;  3FTW A;  4DJA A;  4N2Q A;  2X6I A;  3LDZ A;  4G1T A;  4PS7 A;  4KZC A;  4EZL A;  3FU5 A;  3RK6 A;  3MZL B;  4BX9 A;  2BTD A;  3FU0 A;  3CVV A;  2LSU A;  3PNT B;  2YNQ A;  4HLE A;  3FUF A;  3LYA A;  2LAI A;  4URK A;  2QFC A;  4YVO A;  1ELR A;  3IV0 A;  4BY6 A;  1FVF A;  3FU6 A;  2V8S E;  2X3M A;  3DBS A;  5DIZ A;  3ASG A;  3LY9 A;  4YVQ C;  4AVX A;  2WMN A;  3Q49 B;  2GRL A;  3FHE A;  3IBE A;  4HOQ A;  4I43 A;  4A1G A;  3U66 A;  2V4L A;  2R5S A;  4WWN A;  3ESL A;  5LCW C;  3UPV A;  3FEY A;  5BW8 C;  4AV7 A;  3AU4 A;  1UJJ A;  3CHM A;  3FUD A;  3I5P A;  3ONK A;  4ILI A;  4TV3 A;  3ZN3 A;  5T4Y A;  2YHC A;  5JHB A;  4B94 A;  1PY1 A;  4ANW A;  5G04 C;  3PZD A;  3CEQ A;  1E8X A;  1N52 A;  3UT4 A;  3G2T A;  4DLO A;  3FFL A;  3Q5M A;  3CHR A;  3VTY A;  3TJP A;  2XRZ A;  4GZ6 A;  3U4T A;  3PUJ A;  4E85 A;  3EDT B;  3ZYL A;  4L7T A;  3CHS A;  4ILG A;  3HVE B;  2WQ6 A;  4UI9 K;  1N54 A;  2L0T B;  5HI7 A;  4LUN U;  3MV2 B;  3D9O A;  3D9L A;  2XPI A;  5EDS A;  3T5V A;  4JHR A;  3AS5 A;  5A6C A;  3OXL A;  4RVB A;  4J8D A;  4I1A A;  4AM9 A;  4N2S A;  4UWL A;  1UN8 A;  2WMO A;  4U04 A;  4IYP A;  1H19 A;  3TGO A;  4K03 A;  3QOU A;  3CVW A;  4ANV A;  3LVQ E;  4HS2 A;  2GGF A;  3ESK A;  3ASD A;  4AIF A;  5A7D B;  4EPZ A;  2YQ8 A;  3CR3 A;  1TEZ A;  4GPK A;  2WVI A;  3CIA A;  3PS6 A;  4XKB A;  3LY7 A;  3GZS A;  1U3D A;  1E7U A;  4GCO A;  2QY7 A;  4B8A A;  2KCV A;  3CK7 A;  3APC A;  4HOU A;  3ZXS A;  4FU3 A;  4GAA A;  3L54 A;  3GYZ A;  3QAQ A;  4WNF A;  2X6J A;  5ARF A;  3TG5 A;  5BNW A;  4PS8 A;  2OND A;  1NP7 A;  4B0Z A;  2M63 A;  4UI9 J;  2WXI A;  2XGS A;  1H6K A;  3QK0 A;  3SZ7 A;  1FVH A;  1IHG A;  3D9I A;  1HFA A;  4GYW A;  4JC8 A;  5T8I A;  4A55 A;  3RRU A;  3JYS A;  5CCL A;  3CQC B;  2GRM A;  3MCX A;  4U0Z A;  4XI9 A;  2MOW A;  2LO6 A;  3B7S A;  3CLJ A;  3R7Q A;  1OWP A;  3FTS A;  1XNF A;  4DI3 A;  4CT0 A;  2E0I A;  4NRH B;  2VGX B;  2VSN A;  3OTN A;  4I1M A;  3ULQ A;  5HQ8 A;  3ZFW A;  2WM9 A;  3LXU X;  4BX8 A;  5D0O D;  3S7F A;  4BT9 A;  1FCH A;  2C2L A;  2HO1 A;  4GA0 A;  3TL5 A;  3SBT B;  2VTB B;  4CDM A;  2UWJ G;  2WB2 A;  2ILR A;  5ARG A;  1NZN A;  4TRQ A;  2HYZ A;  3E4B A;  3FY4 A;  4N3A A;  3CQG B;  3HHM A;  4CCA A;  4J0U A;  4HXI A;  3APF A;  2CFZ A;  2CHX A;  3S7J A;  3QDN A;  4AY6 A;  3CHQ A;  3G2U A;  4L2L A;  1HH8 A;  1HS6 A;  2PZI A;  3NQP A;  5BUZ A;  4EZJ A;  5DBK A;  2KAT A;  4I6E A;  3FUM A;  3QWV A;  1YA0 A;  3P2B A;  5CCM A;  3MKR A;  2PQR A;  4HOS A;  4B8C B;  4XIF A;  4L2Y A;  5EX3 A;  3UX4 A;  4WWP A;  1LF8 A;  1JWG A;  3NZS A;  3WXX A;  2FO7 A;  3FUL A;  4K0R A;  2XHE A;  3LKU A;  2AXZ A;  4JEU A;  3FTU A;  4JL0 A;  4CGV A;  3Q15 A;  4G2V A;  3QWW A;  3ASH A;  3FH7 A;  5FQ4 A;  4AOF A;  1IQU A;  1SZ9 A;  3Q4A B;  4HOT A;  4CRW A;  2VTB A;  1HE8 A;  3BG0 B;  1KT0 A;  3QJZ A;  4FP7 A;  3T5X A;  2KZT A;  3HYM B;  5JJ6 A;  5BV1 A;  5G05 C;  4IRU A;  2WPV A;  2LNI A;  1SZA A;  1Z3X A;  3Q47 B;  3ZGQ A;  4ACL A;  4ACK A;  3OXF A;  4ANU A;  5FZS A;  4W9R A;  3VLE A;  5LP0 A;  3CHO A;  3N71 A;  4WUY A;  3ONL A;  5C1D A;  4HOR A;  2XRY A;  3B13 A;  3FU3 A;  5AJL A;  5BV0 A;  3RO2 A;  1BPO A;  2XCB A;  1Y6I A;  3O48 A;  3PEV B;  2BF0 X;  2XQ0 A;  4I6J A;  5FZR A;  5BT1 A;  2WXP A;  3TXN A;  4E6H A;  3G2W A;  1HX8 A;  4HVB A;  4WNE A;  2WQ7 A;  4A1S A;  1WAO 1;  3IKO B;  1UJK A;  4AP2 A;  2RG8 A;  4UI9 C;  1SQM A;  2FI7 A;  4MS6 A;  3B7U X;  4U07 A;  3EHM A;  4MLP A;  4XX5 A;  2WXM A;  2WQH A;  4GA1 A;  4GCN A;  3KD7 A;  1OUV A;  4EQF A;  3VLF A;  2WXH A;  4J8F A;  4JXT A;  1HF8 A;  3BEE A;  5J90 A;  4C9B B;  3IHV A;  3TAX A;  3CKC A;  5M72 A;  2HM8 A;  3FUI A;  4C0M A;  2ION A;  2MHK A;  4P29 A;  4APF A;  4WNG A;  3KS2 A;  3PDN A;  3K9I A;  5C2Y A;  1EYH A;  1ZBP A;  3MGB A;  3PRE A;  3ENE A;  3ML8 A;  2WXF A;  3PEU B;  2LAH A;  3AS4 A;  1EF1 C;  2YHE A;  3VLD A;  4KMO A;  3TXM A;  2PM7 A;  5AJD A;  2XGO A;  4FLB A;  2CFU A;  4CDR A;  3VTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...