3FFLA

Crystal structure of the n-terminal domain of anaphase-promoting complex subunit 7
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
126
Chain Sequence
MNVIDHVRDMAAAGLHSNVRLLSSLLLTLSNNNPELFSPPQKYQLLVYHADSLFHDKEYRNAVSKYTMALQQKKALCLPSEIEVKYKLAECYTVLKQDKDAIAILDGIPSRQRTPKINMLLANLYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the N-terminal Domain of Anaphase-Promoting Complex Subunit 7
rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Anaphase-promoting complex subunit 7
total genus 48
structure length 126
sequence length 146
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3fflA00
5JJ6A 5CHEE 2Y4TA 2QFCA 3IEGA 3LPZA 3QWPA 1TJCA 3OXFA 5LCWC 4BT9A 2VGXA 5KJKA 3FFLA 2XPIA 2NC9A 3LY9A 5BW8C 4RG6A 3CVQA 4CGVA 3CKBA 5LCWJ 4WNGA 3MKRA 4GYOA 2UY1B 5D0OD 4I2WA 5EX3A 3CEQA 4G2VA 5A7DB 5CCMA 1QQEA 4KYOB 4WNFA 5EKQD 2FBNA 3GZ1A 4G23A 4JA9A 4W9RA 4A1SA 4N3AA 2L6JA 3OXLA 4O6FA 5CCLA 3RU0A 5HQ8A 1ZBPA 2V5FA 2XEVA 3CVLA 4KBQA 3QWWA 4WNEA 3ULQA 4AM9A 4G1TA 3RO3A 1YA0A 4CDRA 4N2SA 5A6CA 4HORA 2JLBA 5KJNA 2DBAA 4ABNA 3GYZA 4XIFA 4UI9C 5HI7A 2PQNA 3MEKA 5DBKA 2PZIA 1ELRA 4I9CA 2LSUA 4N39A 4HOSA 2Q7FA 5C1DA 3PE3A 3TGOA 4N5CA 4GCNA 2VSNA 3E4BA 3ZGQA 5JJ7A 2P58C 2XGOA 3CK8A 2BUGA 4GZ5A 4I1AA 3MV2B 5G04C 3RO2A 3SF4A 2VSYA 3TG5A 3LYAA 2FEZA 4H7YA 3UQ3A 4UQZA 1Y8MA 1KT1A 2KCLA 3AS4A 2Y4UA 3CVNA 3EDTB 4J8DA 1A17A 4WNDA 3S7JA 3UPVA 3HYMB 3QKYA 3KD7A 4J0UA 3VTXA 4APOA 2C2LA 3CKCA 2WQHA 3U4TA 5KJMA 3Q49B 3Q4AB 3JYSA 2HR2A 4G26A 1KLXA 4NRHB 4IN3B 3ASHA 4GYYA 3QOUA 1XNFA 2YHCA 5D0QD 5BNWA 2C0MA 4GA0A 4AY5A 5JJTA 2R5SA 1QZ2A 3K9IA 3BEEA 4N3BA 3S7DA 4GZ3A 2XGMA 1WAO1 2FO7A 4LEUA 4H7XA 3ZHEA 4Y6WA 4AIFA 1KT0A 2VGYA 4GCOA 2XGSA 1OUVA 2XCCA 2ONDA 4I2ZA 1WM5A 3QDNA 4J8FA 3WXXA 3R9AB 4CGWA 4N3CA 2E2EA 2KC7A 3N71A 3O48A 4U0UA 3KAEA 4UQYA 3S7FA 2XCBA 1ELWA 2KATA 4WUYA 5FZQA 1IYGA 3LCAA 4U04A 4GA2A 4GA1A 3ASDA 4HOUA 4XI9A 3PE4A 4YVOA 4HOTA 3S7BA 5G05C 4U0ZA 3OXGA 3TG4A 4HOQA 4RG9A 4XI0A 1HZ4A 2WPVA 2GW1A 4N2QA 5G05J 2AVPA 2VGXB 3Q15A 3FP3A 3RIBA 1E96B 3RKVA 4Y6CA 2J9QA 5FTPA 1NA3A 4EQFA 3AS8A 3LKUA 4B94A 3FWVA 3KS2A 4U0SA 2UWJG 3CK7A 1NZNA 2UY1A 3ESKA 5FJYA 2I6HA 4BWRA 3ZHEB 5DIZA 3RJVA 4UQXA 4ME2A 2C0LA 4JHRA 1B89A 4BTBA 1ZU2A 3ZN3A 2IFUA 4JA7A 3QWVA 3ZPJA 3CK9A 3Q47B 2VQ2A 4UI9K 4F3VA 4U07A 3MV3B 5AYWD 2PQRA 3GZ2A 5FZRA 5BT1A 4UI9J 5FT9A 2HO1A 5M72A 2FI7A 3SZ7A 4BT8A 3AS5A 5ARFA 2HYZA 1P5QA 3LY8A 3PDNA 3Q5MA 4G25A 1PC2A 2IF4A 4GYWA 3ASGA 5G04J 1IHGA 4KXKB 3UUXA 3ZFWA 3URZA 4GPKA 2PL2A 4JL0A 1FCHA 3CVPA 1W3BA 4NQ0A 1HH8A 2FF4A 3NF1A 2OOEA 3CV0A 4GZ6A 4I17A 5ARGA 2KCVA 5FZSA 3ASFA 2VYIA 4G24A 1HXIA 5EX0A 4J8EA 5KJLA 2YQ8A 3TAXA 4I9EA 3MA5A 4YVQC 3VTYA 2KCKA 1NA0A 2MHKA 2LNIA 3GW4A 4BTAA 3LY7A 4YNDA 3U3WA 2LSVA 4AY6A
chains in the Genus database with same CATH superfamily
4G11A 3QWPA 3LPZA 4CT4A 3UINC 3FDHA 3ZEFA 4KYOB 1Z6TA 4W9RA 3AG4E 3PUJA 4FU3A 4I1MA 1OWMA 2AXVA 2WXNA 3ZYLA 3FTSA 2ETBA 1RW2A 1QYMA 4N39A 1S64A 3L9TA 4C48B 2ZGDA 1KZOA 5JJ7A 4V3IA 3RO2A 3DBSA 2MYOA 3HYMB 5ENTD 4Z68A 4IN3B 1MX4A 4GCOA 2EQXA 3P1UA 3ABME 5AQBA 3LCAA 3ONKA 4B0ZA 3ASDA 2X6HA 3MGBA 2CHXA 3TG4A 3LVQE 2AVPA 1TJFA 3D9JA 4L7TA 5KNGA 4GMRA 3RJVA 2A5UA 1ZU2A 5JHBA 1OWNA 5FQ8A 4EZKA 2FI7A 1P5QA 3PDNA 3NB2A 3UIPC 2WXRA 1SA4A 1U3CA 3E30A 3ASFA 5T3RA 3SFXA 4J8EA 2YQ8A 3VLDA 4Q94A 1SZAA 3LY7A 1FVFA 1O5MA 3FUDA 1JWGA 5LCWC 2WXGA 4WNGA 2IU1A 5EKQD 4M7CA 2L6JA 2R17C 1N11A 3HRAA 3HXBA 4TUMA 3LS8A 4KMOA 4JZYA 2WXLA 4GTVA 3TWRA 3RRUA 1TYQG 2XRZA 5G55A 3PZ2A 4IRUA 4ACKA 3I5PA 1KT1A 4BY6A 4J0UA 1H19A 2LXMA 4APOA 3MZLB 4K5CA 3QOUA 1MHQA 3FUJA 2LXLA 5JJTA 4WWNA 1VDYA 4E85A 3QDNA 1NFIE 5HKPA 3N71A 2XCBA 3PEUB 3DXKG 3IV0A 4A3TA 2ZGGA 2R05A 2WPVA 2MOWA 3KSLA 5G05J 3TWQA 1DC2A 2AJAA 4ANWA 3ZN3A 3NAWA 5CRVA 4EBAG 4GTQA 1PAQA 5B1AE 1JUQA 3FUMA 3UUXA 4O60A 2GRMA 5HRYA 2AW6A 1EF1C 4TUUA 4CT0A 1EDUA 5B1BE 5CEDB 4BTAA 3FULA 3ASNE 4XX5A 4CRWA 2NC9A 2J4BA 3CVQA 3HHMA 2R59A 4ZHBA 4AY6A 3T9KA 4A1SA 3ZYMA 1HE8A 3OXLA 3Q7AA 1N94A 3I4GA 4GPMA 2Y3AA 5A6CA 1E8WA 2PQNA 1V55E 2R2LA 4HOSA 3B7UX 2QYJA 2H6GA 2XGOA 3B7BA 3EU9A 1U2VG 4DPRA 1Q2ZA 2CHZA 3AS4A 1H6PA 3UKRG 2HR2A 5BNWA 3DSXA 2C0MA 4R7LA 3DWLG 2EIJE 4IYPA 4UQYA 4Q69A 3APDA 2QYUA 1E8XA 2ZU6B 4XI9A 1HU3A 3Q7FA 3DSTA 1E96B 1Z3YA 4Y6CA 5BUZA 1O1RA 2P9KG 3CHPA 3SZ7A 5ENQD 3Q5MA 4BEPA 4BERA 3TXNA 1OCOE 5EX0A 2RD0A 4YVQC 4MBGA 4FA6A 3Q75A 4FADA 3FHEA 4BT9A 4FC8A 1HF8A 4I6EA 3NOCD 4EZLA 5LCWJ 5CBNA 4GMLA 2UY1B 2L6BA 3GZ1A 4G23A 3FU5A 1UOHA 3QWWA 3MCXA 2X6KA 3T8MA 3LVRE 2XPYA 4ACLA 1HG5A 5DBKA 1TNUA 1K1AA 4JPSA 3CK8A 1O1TA 4H7YA 1D8EA 3VTXA 1WY6A 3UKUG 4C0MA 2WXHA 4BSZB 4AY5A 3S7DA 3UT8A 4GB9A 3FUFA 2GRQB 3MX3A 4HRLA 4F7AA 4AJWA 3FUHA 4YVOA 1X5BA 3D9PA 4AP2A 1JPLA 4JVSA 3ESKA 1BPOA 3J5PA 4JHJA 4U07A 4XKBA 3GZ2A 5LFAA 2AXZA 3ZFWA 5G04J 2PL2A 3TWSA 3CHQA 3DRAA 3CSFA 1K3ZD 3FEYA 4I9EA 5ENSD 2WVIA 3ML8A 3CHOA 3T5XA 5FWQA 2QFCA 2P9NG 2XRYA 3CQCB 2BTDA 4GTSA 4CGVA 2P9UG 1HO8A 1QNFA 3FH8A 1SZ9A 2I9CA 5E76A 3CQGB 5AQ9A 4FJZA 3DPYA 2IEJA 4AEZC 4J7WA 1E8YA 2V4LA 3FH7A 3AJIA 2PM7A 2DZNA 2J08A 3MV2B 4U8YD 2EINE 1YMPA 2GRNB 2WXIA 4J8DA 4FJYA 5CBOA 3D9IA 3Q4AB 4AOFA 4F1SA 1XNFA 4P29A 2F37A 4JXTA 4H7XA 4BX8A 5AIJA 2DIWA 3C3QA 1OUVA 4PS8A 4PDXA 5AENA 3HVEB 3B7TA 4RG9A 2VGEA 4AV7A 4GZDA 1S70B 4B94A 1N0RA 3V30A 4BWRA 2H6HA 2OEWA 1N4PA 1DCEA 4KVOA 3CHMA 3LY8A 4G25A 2IF4A 3CVUA 4ILHB 2IONA 2I2OA 4A3VA 1HH8A 1NL4A 1U3DA 4GZ6A 4I17A 3ZIMA 4HFGA 4DLOA 3C3RA 4YDOA 4XEIG 2MHKA 2OV8A 1H6OA 3OXFA 1MJ0A 5JMND 4YDEA 5ANLA 4DX5D 4AVXA 2V5FA 1K1BA 4UI9C 2ZIRA 1UW4B 1S63A 1K8KG 3PZDA 3L17A 4N5QA 2P58C 3SNXA 4M3OA 4JB8P 4EBAA 5KJMA 1QBQA 2FO1E 4IULA 3EHQA 2M63A 3ASHA 4E6HA 3NQPA 4GZ3A 4LEUA 2CHWA 4NIKA 1Z3XA 1NI1A 4FHKA 2E2EA 1H2UA 2IJGX 4LUNU 3TXMA 2QY7A 1NP7A 3S7BA 1O1SA 2WXFA 4ATGA 3PNTB 1SW6A 3OAWA 2NXPA 4XZ4A 5ITZF 3G2UA 2X6JA 4XE0A 2IFUA 3AAAC 4C0EA 2L0IA 1N54A 3VLFA 5ENOD 3KEZA 1G3NB 2V4HC 4JEUA 4GPKA 2WXPA 2FF4A 3NF1A 4LNBA 3PNLB 4JW1A 3VTYA 2HM8A 2DYRE 4GAAA 3D9KA 1H2TC 3FFLA 3UM2A 2YINA 5BPPA 3ZXSA 3CVLA 4TV3A 3DSWA 3UM0A 4WNEA 3U64A 4UWKA 3PE3A 3ISMC 2VTBA 3R7RA 5KWDA 3UQ3A 2FULA 2VSOE 3S7JA 3UPVA 3ZVVA 3SY2A 1N52A 5CECB 2VJ8A 2GRLA 5D0QD 3FUEA 2R5SA 5FQ6A 2RFAA 4Y6WA 4X8QA 2P2CP 3SBTB 4NACA 3TWWA 2ZXWE 1TN8A 3AG3E 3G2WA 3RK6A 2ETAA 3AS8A 2V0PA 4UQXA 4JD2G 3ZPJA 3QWVA 5D2MC 3FEXA 3C3OA 3CK9A 4FHJA 5AYWD 4OAVB 3QK0A 3UI2A 3U9WA 4GYWA 2VTBB 2XS8A 1TN7A 2OCCE 2H6FA 1D9SA 3JXJA 3V2XA 3KS2A 1ELKA 2OVBA 2P9SG 2I1KA 4WAFA 5A7DB 4BSXA 2WMNA 2FBNA 2RKKA 4RQIA 4N2SA 3B7SA 4HNAD 3ZUVB 2QZAA 5CMYA 2BF0X 3G2VA 2XENA 4BESA 3ZNGA 4HXIA 3TWXA 3ZW3A 1JWFA 5AARA 4CEMA 1TN6A 3UT7A 1RZ4A 1MX6A 5BXUA 2KCLA 5B3SE 4DK5A 2WQHA 4C9BB 4GYYA 4MS6A 3FUNA 4UWHA 5CERB 2R03A 3BEEA 1WAO1 3NZSA 3BG0B 2R02A 4J8FA 3O48A 2KATA 3DPDA 3DEPA 1LTXA 5J90A 2DYSE 3PEVB 2NYJA 3KSQA 2VGXB 2EIME 3F6QA 3W9GA 4U0SA 5ENNA 3CK7A 2WM9A 5ENRD 3FTUA 1D8DA 4TRQA 4EHMA 2IQCA 3CIAA 3Q9NC 4UI9J 5ARFA 5J08A 1HS6A 2J09A 4RVBA 2J07A 2JEKA 5G2NA 4I43A 2X6FA 4DX6D 3L54A 4G24A 2J4DA 3RAUA 4YNDA 3ABLE 1MYOA 2DZOA 1TJCA 5KJKA 5CCLA 3MKRA 5D0OD 3CVYA 4UWGA 3CEQA 1QQEA 4U96D 5BV0A 3UT4A 4DRXE 1UG3A 3CGHA 3ULQA 4AM9A 4FLBA 2V8SE 1BU9A 2DBAA 3GYZA 5HI7A 3MEKA 1ELRA 2IOLA 3AG1E 1HG2A 4ZFHA 4N5CA 3O4ZA 4I1OB 2FEZA 1X81A 1Y8MA 3APFA 2LAHA 4LNUD 3CVNA 3L22A 3EIJA 3TWTA 2J49A 4U95D 1N9AA 3C72A 3FU0A 5EYLA 4GA0A 1E90A 1OWLA 1LD7A 2WXQA 2BEDA 2XCCA 5LP0A 3SGHA 4CGWA 3C98A 4FULA 5FZQA 4HVBA 4BETA 3HVEA 1TNYA 3CHRA 3PE4A 2E0IA 4MLPA 4OAUC 3D9MA 1EPUA 2KBXA 5FJYA 2I6HA 5IY5E 5AQAA 2GRRB 3DSVA 1IXVA 2RFMA 1Z5SC 3APCA 3FTVA 4ANUA 4TXRA 3ASGA 4DUIA 4L9PA 5D66A 1FT2A 3JQ0A 2P9LG 1HXIA 4K5AB 2NSZA 4UUCA 3EHMA 2IO2C 3LY9A 1V54E 3CKBA 3ESLA 3FTZA 4GYOA 4ILGA 5EX3A 3Q9UC 4J8YA 4JA9A 1H0AA 5EN5D 3ZRHA 5EIDA 4LG6A 3RRNB 2J8SD 4K5BA 2JABA 2Q7FA 4O1PA 3E37A 2F0YA 2WXJA 4I1AA 5G04C 1SQMA 4WNDA 3X2QE 3L13A 3Q73A 4DLQA 3CKCA 1H2VC 3UM3A 4NRHB 2YHCA 4L2LA 3MJWA 5HS0A 1N0QA 3CVXA 3ZHEA 3NZUA 2VGYA 5FQ7A 3S7FA 2KM4A 3MKQA 3S2AA 4U04A 4GA2A 4GA1A 1DNPA 4XI0A 3JXIA 1L5JA 3LKUA 4L23A 1NZNA 2I1JA 3Q78A 4EPZA 1B89A 4BTBA 4XKCA 2EIKE 3V79K 4DX2A 4PUCA 2CG3A 3BQOA 2DCPA 4DX1A 4KXKB 1WG0A 3LEWA 1OCZE 4Q96A 1BLXB 3EIQC 4PH4B 3JUEA 2WXKA 1NA0A 2LNIA 3G2SA 4I6GA 5T4YA 3MKQB 3E34A 2XPIA 3ONLA 4RG6A 4G2VA 3DEOA 5HQ8A 4N3AA 4O6FA 1GW6A 2AWIA 3D9NA 3G2TA 4ABNA 3PS6A 3RSEG 3D9OA 2PZIA 4TXQA 2A5EA 3TG5A 1Y6IA 3IBEA 3R9MA 2DVWA 1A17A 5H7PA 3U4TA 4BX9A 3SFZA 3ASOE 4QQIA 4AIFA 2OVFA 1FPPA 2KZTA 3CVWA 3FU6A 4U63A 3WXXA 3NBNB 1JCQA 1ELWA 3HIZA 5CRUA 1UN9A 3V31A 3OXGA 4HOQA 4N2QA 5AJLA 1SA5A 2MRIA 3FP3A 5AAOA 5AJDA 4F6RD 2C0LA 2RG8A 1BI8B 2VQ2A 2PNNA 5BT1A 3FH5A 1ZB1A 3IKOB 3URZA 1LD8A 4CCAA 4JL0A 3CVPA 4AXHA 2OOEA 3CV0A 4B8CB 2ZISA 2VYIA 3LXUX 4YDWA 5KJLA 3WG7E 2LUHA 3EU5A 3JQ1A 3ZGQA 3EUVA 4HB5A 2PM6A 3IEGA 1H6KA 4GTTA 3HXDA 3TJPA 3PUKA 4J8SA 5FIOA 3RU0A 3CSTA 3OTNA 4KBQA 5LX8A 3HXFA 4J6IA 4HORA 5KJNA 3PRZA 3D9LA 5ENPD 1OY3D 5CEAA 3QJZA 2CFUA 3DSUA 4GCNA 2VSNA 3E4BA 4KZCA 4GZ5A 2WMOA 4HLEA 2WB2A 4GTMA 3LYAA 4HS2A 3ZYQA 4HBDA 3EDTB 3ENEA 3L16A 3AU5A 3QAQA 1KLXA 2P9PG 3SFYA 3K9IA 4N3BA 3MYVA 5EYPF 1DVPA 1UJKA 2XGSA 4I2ZA 4A1GA 2ONDA 2KXPC 4U0UA 4U0ZA 3VLEA 4LERA 3EHRA 2XEHA 3JCKC 3L82A 3R7QA 4L2YA 1IHBA 2UWJG 4LRZA 4HI9A 5LOZA 2A4ZA 1TNZA 4NURA 3Q47B 4UI9K 4F3VA 3CR3A 3UX4A 5JHAA 1YCSB 4WWOA 4F1PA 3U66A 1W3BA 4NQ0A 2IY0C 3HDXA 3V2OA 1MZCA 5ARGA 2KCKA 2LO6A 3U3WA 1IQUA 5E75A 5FQ4A 5KCMA 3I4RB 1N95A 1HX8A 4WNFA 4DJAA 1DCQA 2WXOA 4CDMA 3FTYA 3LJNA 1UJJA 4G1TA 3UMVA 4GTRA 4CYMD 1E7VA 4WWPA 2B0OE 2DWZA 3SO8A 4EECA 3TGOA 3CHSA 2XQ0A 1OWOA 2BUGA 4GTOA 4O1OA 3QB2A 4UQZA 4D10C 3ZYKA 3SD5A 3PZ3A 3Q49B 1OCRE 3JYSA 3PH0C 3RRMB 4B93B 4HQDA 1KT0A 1E8ZA 1WM5A 3ABKE 2KC7A 1FVHA 1IYGA 2GGFA 3B7RL 4HRMB 2ETCA 2XZDG 4F53A 2GW1A 1TNBA 5EDSA 4LCTA 3T5VA 2LAIA 4G8KA 3FU3A 5DIZA 4ANVA 4ANXA 3ZXPA 1EYHA 1YYHA 3FY4A 1MX2A 1PC2A 4A55A 1IHGA 4FLHA 3B95A 1FCHA 2X6IA 3SI5A 2CG2A 1TEZA 2H6IA 2KCVA 4U8HA 1IQRA 3TAXA 3HXCA 3D3MA 3B13A 3GZSA 4K0RA 3FTWA 1AP7A 3FUKA 2CFZA 4I2WA 2XZTG 1ZBPA 2WQ7A 4U8VD 4CDRA 3I3NA 4LNGA 4UWLA 1S0PA 2QC9A 3HG0D 1AWCB 4JC8A 3L6AA 3QNKA 2GROB 2Y4UA 1KZPA 3J5QB 3ZU7B 1QZ2A 5BXOA 2VSXE 3ZKJA 2L0TB 4KVMA 3AG2E 3C5RA 5KBAA 4N3CA 3KAEA 4UWFA 1SVXA 4HRNA 1HZ4A 2Y0BG 1LF8A 5FTPA 2F8YA 2Y1LE 2KZTB 3UIOC 5FINA 4HI8A 2XEEA 4JA7A 3MV3B 4ILIA 2L9BA 2V5QC 2YHEA 2X3MA 4RSYA 4I6JA 2IO3C 3BUAA 4JHKA 3Q79A 4GTPA 3KEAA 3QC1A 4APFA 1N4RA 2Y4TA 1KPSB 3AU4A 4A63B 1TNOA 3ML9A 5BW8C 3EJNA 5CMWA 3PZ1A 5AQ7A 1OT8A 4OVVA 2XEVA 3JUIA 1UN8A 5JA4D 1YA0A 3TWVA 3LJ3A 4QFVA 4XIFA 2P9IG 2X38A 2XS1A 2LSUA 5C1DA 3QARA 2BKKB 3DSSA 1IKND 4OYSA 3SHFA 4B8AA 3SF4A 2VSYA 3QKYA 3KD7A 2C2LA 4G26A 1JCSA 3IXEA 3TWUA 4B89A 4K03A 1A5EA 4DI4A 4ATZD 4YDYA 1E7UA 4RLYA 4EZJA 3R9AB 3PZ4A 2WXMA 4WUYA 4GZCA 4KZ0A 4HOTA 4OVUA 4PS7A 2J9QA 1NA3A 3L08A 4EQFA 4GMJA 2UY1A 3ZHEB 4LSZE 1OCCE 2XHEA 5FZRA 3BG1B 5FT9A 2HO1A 4FP7A 5M72A 1WDYA 2HYZA 1BD8A 4DX7D 4GU5A 3ULEG 2HE0A 3UXGA 1BI7B 3CLJA 4MRUA 4TXPA 3LDZA 1PY1A 5T8IA 4JEHA 3MA5A 2LSVA 3UTMA 5JJ6A 5CHEE 4DI3A 2VGXA 5KNHD 4KT6B 1MQSA 4U7EB 5CCMA 3SBSA 3TL5A 2GRPB 5EILA 1OWPA 5AN8A 2Y69E 3D9HA 3RO3A 2YNQA 2JLBA 2EILE 3W9FA 1TR4A 4MKTA 4I9CA 5C2YA 5ANRA 3EHNA 1OXJA 5A23A 5EIBE 2OEVA 1INZA 3IHYA 1JCRA 3FTXA 1N4SA 2ILRA 3E32A 4G8LA 4URKA 3ULYA 2XGMA 2FO7A 1XGWA 4PS3A 3HXEA 2WQ6A 2AXUA 3CVVA 4L1BA 4HOUA 5G05C 3T8KA 2XPZA 3Q15A 3RKVA 3RIBA 3UM1A 3FUIA 3FWVA 1HFAA 1FT1A 2BKGA 4ME2A 4JHRA 5BV1A 3IHVA 3NOGD 1N4QA 3SQVA 4HLLA 2PQRA 2F8XK 3PVLA 2B6CA 4BT8A 3AS5A 3DXMG 3BU8A 4CZ2D 3P2BA 3PREA 5FZSA 4CDNA 4BFRA 2IOSA 3GW4A 3E33A
chains in the Genus database with same CATH topology
3CHOA 4G11A 3T5XA 5FWQA 2QFCA 3QWPA 2XRYA 3LPZA 1TJCA 4CT4A 1IQUA 3CQCB 5E75A 2BTDA 3FDHA 5KJKA 3ZEFA 5FQ4A 5KCMA 4CGVA 5CCLA 3MKRA 5D0OD 3I4RB 3CVYA 4UWGA 3CEQA 1HX8A 1HO8A 1QQEA 4KYOB 4WNFA 5BV0A 1QNFA 1Z6TA 3FH8A 4W9RA 3UT4A 4DJAA 1SZ9A 2WXOA 3PUJA 4CDMA 2I9CA 5E76A 3CQGB 3FTYA 4FJZA 4FU3A 1UJJA 1UG3A 3CGHA 4I1MA 3ULQA 1OWMA 4FLBA 4AM9A 2AXVA 4G1TA 3UMVA 4AEZC 2WXNA 3ZYLA 2V8SE 3FTSA 2DBAA 1E7VA 3GYZA 4WWPA 5HI7A 3MEKA 1ELRA 1E8YA 2IOLA 4N39A 4EECA 1HG2A 2V4LA 3FH7A 3TGOA 2PM7A 4N5CA 5JJ7A 3CHSA 2XQ0A 4V3IA 1OWOA 2BUGA 2J08A 3MV2B 3O4ZA 4I1OB 3RO2A 2FEZA 3QB2A 4UQZA 1Y8MA 3APFA 2LAHA 4D10C 3ZYKA 3DBSA 2WXIA 3CVNA 3L22A 4J8DA 3SD5A 3EIJA 3HYMB 2J49A 4FJYA 3D9IA 3Q49B 3Q4AB 3JYSA 4IN3B 4AOFA 4F1SA 1XNFA 3FU0A 3PH0C 4GA0A 1E90A 4P29A 3RRMB 1OWLA 4JXTA 4H7XA 4BX8A 2WXQA 5AIJA 1KT0A 1E8ZA 2DIWA 4GCOA 1OUVA 2XCCA 1WM5A 5LP0A 3SGHA 4PS8A 4CGWA 2KC7A 3C98A 4FULA 2EQXA 3P1UA 4PDXA 5FZQA 5AENA 1FVHA 3LCAA 4HVBA 1IYGA 2GGFA 3ONKA 3B7RL 3HVEB 3HVEA 4B0ZA 3ASDA 3CHRA 2X6HA 3MGBA 3PE4A 2CHXA 3B7TA 4F53A 3TG4A 2E0IA 4RG9A 4MLPA 3LVQE 2GW1A 4AV7A 3D9MA 1EPUA 1TJFA 2AVPA 3D9JA 4GZDA 5EDSA 3T5VA 4L7TA 4LCTA 4B94A 2LAIA 4BWRA 5FJYA 2I6HA 3FU3A 5DIZA 3RJVA 2A5UA 4ANVA 4ANXA 1ZU2A 5JHBA 4KVOA 1OWNA 5FQ8A 1EYHA 3FY4A 4EZKA 2FI7A 3CHMA 1P5QA 3APCA 3FTVA 3LY8A 3PDNA 4G25A 4ANUA 1PC2A 2IF4A 4A55A 3ASGA 4ILHB 1IHGA 3CVUA 2IONA 4FLHA 2WXRA 2I2OA 4A3VA 1FCHA 2X6IA 1U3CA 3SI5A 1HH8A 2CG2A 3JQ0A 1TEZA 1U3DA 4GZ6A 4I17A 2KCVA 3ZIMA 4HFGA 4U8HA 3ASFA 5T3RA 4DLOA 1IQRA 1HXIA 4J8EA 2YQ8A 3VLDA 4Q94A 2NSZA 3TAXA 1SZAA 2MHKA 3LY7A 3D3MA 1FVFA 2OV8A 3B13A 3FUDA 3OXFA 3GZSA 1JWGA 3EHMA 3FTWA 4K0RA 5LCWC 2WXGA 3LY9A 3FUKA 3CKBA 3ESLA 3FTZA 2CFZA 4GYOA 4ILGA 4WNGA 4I2WA 2IU1A 5EX3A 5ANLA 5EKQD 4JA9A 1H0AA 2L6JA 4AVXA 2R17C 1ZBPA 2V5FA 2WQ7A 3LS8A 4KMOA 4CDRA 3I3NA 4JZYA 2WXLA 3ZRHA 4UI9C 4UWLA 1UW4B 3RRUA 3RRNB 2XRZA 2Q7FA 3PZDA 1S0PA 2WXJA 3L17A 5G55A 4IRUA 2P58C 4ACKA 4I1AA 5G04C 4JC8A 3I5PA 3L6AA 3SNXA 1KT1A 1SQMA 3QNKA 4M3OA 2Y4UA 4WNDA 4BY6A 3L13A 4J0UA 4DLQA 4EBAA 1H19A 4APOA 3CKCA 3MZLB 1H2VC 5KJMA 4IULA 4NRHB 2M63A 3ASHA 3QOUA 2YHCA 4L2LA 3MJWA 1MHQA 3FUJA 4E6HA 3NQPA 5JJTA 1QZ2A 3CVXA 4GZ3A 4LEUA 2VSXE 4WWNA 1VDYA 2CHWA 3ZHEA 4E85A 3NZUA 2VGYA 2L0TB 3QDNA 4KVMA 1Z3XA 4FHKA 5FQ7A 4N3CA 2E2EA 1H2UA 3N71A 3KAEA 3S7FA 2KM4A 2IJGX 2XCBA 3PEUB 3IV0A 3MKQA 4UWFA 3S2AA 4U04A 4GA2A 4LUNU 3TXMA 4A3TA 4GA1A 2QY7A 1NP7A 3S7BA 2WXFA 1DNPA 4XI0A 1HZ4A 2WPVA 2MOWA 4ATGA 5G05J 3PNTB 1LF8A 3OAWA 5FTPA 1L5JA 2NXPA 3LKUA 4XZ4A 2KZTB 3G2UA 2X6JA 4L23A 1NZNA 4XE0A 2I1JA 4ANWA 4EPZA 1B89A 4BTBA 3ZN3A 2IFUA 4JA7A 4XKCA 4C0EA 4EBAG 2L0IA 3MV3B 4ILIA 1N54A 3VLFA 1PAQA 2L9BA 1JUQA 3KEZA 2YHEA 4PUCA 2CG3A 4JEUA 2DCPA 3FUMA 2X3MA 3UUXA 4RSYA 4GPKA 4I6JA 4KXKB 4JHKA 2GRMA 2WXPA 3LEWA 2FF4A 3NF1A 2AW6A 4Q96A 1EF1C 3EIQC 3QC1A 4TUUA 4PH4B 4CT0A 4APFA 1EDUA 2WXKA 3PNLB 4JW1A 3VTYA 1NA0A 2LNIA 3G2SA 4BTAA 4I6GA 2HM8A 5T4YA 3MKQB 2Y4TA 3FULA 3AU4A 4XX5A 4GAAA 3D9KA 1H2TC 3FFLA 2XPIA 4CRWA 2NC9A 2YINA 3ONLA 2J4BA 3ML9A 3CVQA 3HHMA 2R59A 4RG6A 5BW8C 3EJNA 5CMWA 4AY6A 4G2VA 5BPPA 4A1SA 3ZYMA 1HE8A 5HQ8A 4N3AA 4O6FA 3OXLA 3ZXSA 4OVVA 2XEVA 3CVLA 1GW6A 2AWIA 3D9NA 3I4GA 4TV3A 4WNEA 3JUIA 1UN8A 2Y3AA 3U64A 1YA0A 5A6CA 1E8WA 3G2TA 4UWKA 4ABNA 3LJ3A 3PS6A 4QFVA 4XIFA 2PQNA 2X38A 3D9OA 2PZIA 2LSUA 4HOSA 5C1DA 3PE3A 3QARA 3B7UX 4OYSA 3SHFA 2XGOA 3R7RA 4B8AA 2VTBA 3TG5A 3SF4A 3UQ3A 1Y6IA 2VSYA 4DPRA 3IBEA 2CHZA 2FULA 2VSOE 3AS4A 3S7JA 3UPVA 1A17A 3ZVVA 3QKYA 3KD7A 2C2LA 3U4TA 3SFZA 4BX9A 1N52A 2HR2A 4G26A 2VJ8A 2GRLA 5BNWA 5D0QD 2C0MA 3FUEA 2R5SA 5FQ6A 4B89A 4K03A 4DI4A 4R7LA 4AIFA 2OVFA 4IYPA 4Y6WA 1E7UA 2KZTA 3CVWA 3FU6A 4U63A 3SBTB 4NACA 3WXXA 4EZJA 3R9AB 2WXMA 4UQYA 4Q69A 1ELWA 4WUYA 3HIZA 4GZCA 3APDA 1UN9A 4KZ0A 1E8XA 2ZU6B 4XI9A 4HOTA 3G2WA 4OVUA 3OXGA 3RK6A 4HOQA 1HU3A 4N2QA 5AJLA 2MRIA 3FP3A 1E96B 1Z3YA 2J9QA 4PS7A 4Y6CA 5BUZA 1NA3A 3L08A 4EQFA 3AS8A 4GMJA 2V0PA 2UY1A 5AJDA 3ZHEB 4UQXA 2C0LA 3ZPJA 3QWVA 2XHEA 3FEXA 3CK9A 2RG8A 2VQ2A 4FHJA 5AYWD 5FZRA 3BG1B 3CHPA 3QK0A 5FT9A 2HO1A 3FH5A 4FP7A 5BT1A 3SZ7A 5M72A 2HYZA 3U9WA 3Q5MA 3IKOB 4GYWA 3URZA 4CCAA 2VTBB 4GU5A 4JL0A 3CVPA 4AXHA 2OOEA 3CV0A 4B8CB 3CLJA 3TXNA 4MRUA 2VYIA 3LXUX 5EX0A 3LDZA 1PY1A 5T8IA 5KJLA 2RD0A 4JEHA 3MA5A 4YVQC 3JQ1A 3ZGQA 4FA6A 2LSVA 3KS2A 5JJ6A 5CHEE 1ELKA 2OVBA 2PM6A 3IEGA 3FHEA 1H6KA 4FADA 4BT9A 4DI3A 2VGXA 4FC8A 2I1KA 1HF8A 4I6EA 4EZLA 3TJPA 5LCWJ 3PUKA 4KT6B 4GMLA 4WAFA 1MQSA 2UY1B 5A7DB 4J8SA 4BSXA 5CCMA 3SBSA 2WMNA 3TL5A 2FBNA 3GZ1A 4G23A 3RU0A 3CSTA 1OWPA 3FU5A 3OTNA 4KBQA 3QWWA 3MCXA 3RO3A 5LX8A 3B7SA 4N2SA 2YNQA 2X6KA 4J6IA 3T8MA 4HORA 2JLBA 5KJNA 3LVRE 3PRZA 2XPYA 5CMYA 2BF0X 3D9LA 1HG5A 3G2VA 4ACLA 5DBKA 4HXIA 4I9CA 4MKTA 5C2YA 3ZW3A 3QJZA 2CFUA 1JWFA 5ANRA 3EHNA 4JPSA 4GCNA 2VSNA 3E4BA 4KZCA 3CK8A 5A23A 4GZ5A 4CEMA 2WMOA 4HLEA 2WB2A 3UT7A 3LYAA 4H7YA 4HS2A 1INZA 3IHYA 3ZYQA 2KCLA 3EDTB 3ENEA 3VTXA 4DK5A 3FTXA 3L16A 1WY6A 3AU5A 4C0MA 2WQHA 3QAQA 2ILRA 4C9BB 1KLXA 4GYYA 4URKA 2WXHA 4MS6A 3FUNA 4UWHA 4AY5A 3K9IA 3BEEA 4N3BA 3MYVA 3S7DA 2XGMA 1DVPA 1WAO1 1UJKA 2FO7A 3UT8A 3NZSA 3BG0B 2XGSA 4I2ZA 4A1GA 2ONDA 4GB9A 1XGWA 3FUFA 4PS3A 4J8FA 3O48A 4U0UA 3MX3A 2WQ6A 2KATA 3DPDA 2AXUA 3CVVA 4L1BA 4F7AA 4AJWA 5J90A 3FUHA 4HOUA 1X5BA 4YVOA 3PEVB 5G05C 4U0ZA 3D9PA 2XPZA 2VGXB 3Q15A 4LERA 3RIBA 3RKVA 3VLEA 1JPLA 4AP2A 3JCKC 4JVSA 3R7QA 4L2YA 3FUIA 3FWVA 4U0SA 5ENNA 2UWJG 3CK7A 2WM9A 3ESKA 1HFAA 4LRZA 1BPOA 3FTUA 4ME2A 5LOZA 4TRQA 2A4ZA 4JHRA 5BV1A 2IQCA 3IHVA 3CIAA 4NURA 3Q47B 4UI9K 4F3VA 3CR3A 3UX4A 4JHJA 4U07A 4XKBA 2PQRA 3GZ2A 5JHAA 4UI9J 3PVLA 4BT8A 3AS5A 5ARFA 5J08A 5LFAA 1HS6A 2AXZA 2J09A 4RVBA 2J07A 2JEKA 4WWOA 5G04J 5G2NA 3ZFWA 2PL2A 3U66A 1W3BA 3CHQA 3P2BA 4NQ0A 3CSFA 4I43A 3PREA 3HDXA 5ARGA 5FZSA 2X6FA 3L54A 4G24A 2J4DA 3FEYA 4CDNA 4BFRA 2IOSA 4I9EA 2KCKA 2LO6A 3GW4A 2WVIA 4YNDA 3U3WA 3ML8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JJ6 A;  5CHE E;  2Y4T A;  2QFC A;  3IEG A;  3LPZ A;  3QWP A;  1TJC A;  3OXF A;  5LCW C;  4BT9 A;  2VGX A;  5KJK A;  3FFL A;  2XPI A;  2NC9 A;  3LY9 A;  5BW8 C;  4RG6 A;  3CVQ A;  4CGV A;  3CKB A;  5LCW J;  4WNG A;  3MKR A;  4GYO A;  2UY1 B;  5D0O D;  4I2W A;  5EX3 A;  3CEQ A;  4G2V A;  5A7D B;  5CCM A;  1QQE A;  4KYO B;  4WNF A;  5EKQ D;  2FBN A;  3GZ1 A;  4G23 A;  4JA9 A;  4W9R A;  4A1S A;  4N3A A;  2L6J A;  3OXL A;  4O6F A;  5CCL A;  3RU0 A;  5HQ8 A;  1ZBP A;  2V5F A;  2XEV A;  3CVL A;  4KBQ A;  3QWW A;  4WNE A;  3ULQ A;  4AM9 A;  4G1T A;  3RO3 A;  1YA0 A;  4CDR A;  4N2S A;  5A6C A;  4HOR A;  2JLB A;  5KJN A;  2DBA A;  4ABN A;  3GYZ A;  4XIF A;  4UI9 C;  5HI7 A;  2PQN A;  3MEK A;  5DBK A;  2PZI A;  1ELR A;  4I9C A;  2LSU A;  4N39 A;  4HOS A;  2Q7F A;  5C1D A;  3PE3 A;  3TGO A;  4N5C A;  4GCN A;  2VSN A;  3E4B A;  3ZGQ A;  5JJ7 A;  2P58 C;  2XGO A;  3CK8 A;  2BUG A;  4GZ5 A;  4I1A A;  3MV2 B;  5G04 C;  3RO2 A;  3SF4 A;  2VSY A;  3TG5 A;  3LYA A;  2FEZ A;  4H7Y A;  3UQ3 A;  4UQZ A;  1Y8M A;  1KT1 A;  2KCL A;  3AS4 A;  2Y4U A;  3CVN A;  3EDT B;  4J8D A;  1A17 A;  4WND A;  3S7J A;  3UPV A;  3HYM B;  3QKY A;  3KD7 A;  4J0U A;  3VTX A;  4APO A;  2C2L A;  3CKC A;  2WQH A;  3U4T A;  5KJM A;  3Q49 B;  3Q4A B;  3JYS A;  2HR2 A;  4G26 A;  1KLX A;  4NRH B;  4IN3 B;  3ASH A;  4GYY A;  3QOU A;  1XNF A;  2YHC A;  5D0Q D;  5BNW A;  2C0M A;  4GA0 A;  4AY5 A;  5JJT A;  2R5S A;  1QZ2 A;  3K9I A;  3BEE A;  4N3B A;  3S7D A;  4GZ3 A;  2XGM A;  1WAO 1;  2FO7 A;  4LEU A;  4H7X A;  3ZHE A;  4Y6W A;  4AIF A;  1KT0 A;  2VGY A;  4GCO A;  2XGS A;  1OUV A;  2XCC A;  2OND A;  4I2Z A;  1WM5 A;  3QDN A;  4J8F A;  3WXX A;  3R9A B;  4CGW A;  4N3C A;  2E2E A;  2KC7 A;  3N71 A;  3O48 A;  4U0U A;  3KAE A;  4UQY A;  3S7F A;  2XCB A;  1ELW A;  2KAT A;  4WUY A;  5FZQ A;  1IYG A;  3LCA A;  4U04 A;  4GA2 A;  4GA1 A;  3ASD A;  4HOU A;  4XI9 A;  3PE4 A;  4YVO A;  4HOT A;  3S7B A;  5G05 C;  4U0Z A;  3OXG A;  3TG4 A;  4HOQ A;  4RG9 A;  4XI0 A;  1HZ4 A;  2WPV A;  2GW1 A;  4N2Q A;  5G05 J;  2AVP A;  2VGX B;  3Q15 A;  3FP3 A;  3RIB A;  1E96 B;  3RKV A;  4Y6C A;  2J9Q A;  5FTP A;  1NA3 A;  4EQF A;  3AS8 A;  3LKU A;  4B94 A;  3FWV A;  3KS2 A;  4U0S A;  2UWJ G;  3CK7 A;  1NZN A;  2UY1 A;  3ESK A;  5FJY A;  2I6H A;  4BWR A;  3ZHE B;  5DIZ A;  3RJV A;  4UQX A;  4ME2 A;  2C0L A;  4JHR A;  1B89 A;  4BTB A;  1ZU2 A;  3ZN3 A;  2IFU A;  4JA7 A;  3QWV A;  3ZPJ A;  3CK9 A;  3Q47 B;  2VQ2 A;  4UI9 K;  4F3V A;  4U07 A;  3MV3 B;  5AYW D;  2PQR A;  3GZ2 A;  5FZR A;  5BT1 A;  4UI9 J;  5FT9 A;  2HO1 A;  5M72 A;  2FI7 A;  3SZ7 A;  4BT8 A;  3AS5 A;  5ARF A;  2HYZ A;  1P5Q A;  3LY8 A;  3PDN A;  3Q5M A;  4G25 A;  1PC2 A;  2IF4 A;  4GYW A;  3ASG A;  5G04 J;  1IHG A;  4KXK B;  3UUX A;  3ZFW A;  3URZ A;  4GPK A;  2PL2 A;  4JL0 A;  1FCH A;  3CVP A;  1W3B A;  4NQ0 A;  1HH8 A;  2FF4 A;  3NF1 A;  2OOE A;  3CV0 A;  4GZ6 A;  4I17 A;  5ARG A;  2KCV A;  5FZS A;  3ASF A;  2VYI A;  4G24 A;  1HXI A;  5EX0 A;  4J8E A;  5KJL A;  2YQ8 A;  3TAX A;  4I9E A;  3MA5 A;  4YVQ C;  3VTY A;  2KCK A;  1NA0 A;  2MHK A;  2LNI A;  3GW4 A;  4BTA A;  3LY7 A;  4YND A;  3U3W A;  2LSV A;  4AY6 A; 
#chains in the Genus database with same CATH topology
 4G11 A;  3QWP A;  3LPZ A;  4CT4 A;  3UIN C;  3FDH A;  3ZEF A;  4KYO B;  1Z6T A;  4W9R A;  3AG4 E;  3PUJ A;  4FU3 A;  4I1M A;  1OWM A;  2AXV A;  2WXN A;  3ZYL A;  3FTS A;  2ETB A;  1RW2 A;  1QYM A;  4N39 A;  1S64 A;  3L9T A;  4C48 B;  2ZGD A;  1KZO A;  5JJ7 A;  4V3I A;  3RO2 A;  3DBS A;  2MYO A;  3HYM B;  5ENT D;  4Z68 A;  4IN3 B;  1MX4 A;  4GCO A;  2EQX A;  3P1U A;  3ABM E;  5AQB A;  3LCA A;  3ONK A;  4B0Z A;  3ASD A;  2X6H A;  3MGB A;  2CHX A;  3TG4 A;  3LVQ E;  2AVP A;  1TJF A;  3D9J A;  4L7T A;  5KNG A;  4GMR A;  3RJV A;  2A5U A;  1ZU2 A;  5JHB A;  1OWN A;  5FQ8 A;  4EZK A;  2FI7 A;  1P5Q A;  3PDN A;  3NB2 A;  3UIP C;  2WXR A;  1SA4 A;  1U3C A;  3E30 A;  3ASF A;  5T3R A;  3SFX A;  4J8E A;  2YQ8 A;  3VLD A;  4Q94 A;  1SZA A;  3LY7 A;  1FVF A;  1O5M A;  3FUD A;  1JWG A;  5LCW C;  2WXG A;  4WNG A;  2IU1 A;  5EKQ D;  4M7C A;  2L6J A;  2R17 C;  1N11 A;  3HRA A;  3HXB A;  4TUM A;  3LS8 A;  4KMO A;  4JZY A;  2WXL A;  4GTV A;  3TWR A;  3RRU A;  1TYQ G;  2XRZ A;  5G55 A;  3PZ2 A;  4IRU A;  4ACK A;  3I5P A;  1KT1 A;  4BY6 A;  4J0U A;  1H19 A;  2LXM A;  4APO A;  3MZL B;  4K5C A;  3QOU A;  1MHQ A;  3FUJ A;  2LXL A;  5JJT A;  4WWN A;  1VDY A;  4E85 A;  3QDN A;  1NFI E;  5HKP A;  3N71 A;  2XCB A;  3PEU B;  3DXK G;  3IV0 A;  4A3T A;  2ZGG A;  2R05 A;  2WPV A;  2MOW A;  3KSL A;  5G05 J;  3TWQ A;  1DC2 A;  2AJA A;  4ANW A;  3ZN3 A;  3NAW A;  5CRV A;  4EBA G;  4GTQ A;  1PAQ A;  5B1A E;  1JUQ A;  3FUM A;  3UUX A;  4O60 A;  2GRM A;  5HRY A;  2AW6 A;  1EF1 C;  4TUU A;  4CT0 A;  1EDU A;  5B1B E;  5CED B;  4BTA A;  3FUL A;  3ASN E;  4XX5 A;  4CRW A;  2NC9 A;  2J4B A;  3CVQ A;  3HHM A;  2R59 A;  4ZHB A;  4AY6 A;  3T9K A;  4A1S A;  3ZYM A;  1HE8 A;  3OXL A;  3Q7A A;  1N94 A;  3I4G A;  4GPM A;  2Y3A A;  5A6C A;  1E8W A;  2PQN A;  1V55 E;  2R2L A;  4HOS A;  3B7U X;  2QYJ A;  2H6G A;  2XGO A;  3B7B A;  3EU9 A;  1U2V G;  4DPR A;  1Q2Z A;  2CHZ A;  3AS4 A;  1H6P A;  3UKR G;  2HR2 A;  5BNW A;  3DSX A;  2C0M A;  4R7L A;  3DWL G;  2EIJ E;  4IYP A;  4UQY A;  4Q69 A;  3APD A;  2QYU A;  1E8X A;  2ZU6 B;  4XI9 A;  1HU3 A;  3Q7F A;  3DST A;  1E96 B;  1Z3Y A;  4Y6C A;  5BUZ A;  1O1R A;  2P9K G;  3CHP A;  3SZ7 A;  5ENQ D;  3Q5M A;  4BEP A;  4BER A;  3TXN A;  1OCO E;  5EX0 A;  2RD0 A;  4YVQ C;  4MBG A;  4FA6 A;  3Q75 A;  4FAD A;  3FHE A;  4BT9 A;  4FC8 A;  1HF8 A;  4I6E A;  3NOC D;  4EZL A;  5LCW J;  5CBN A;  4GML A;  2UY1 B;  2L6B A;  3GZ1 A;  4G23 A;  3FU5 A;  1UOH A;  3QWW A;  3MCX A;  2X6K A;  3T8M A;  3LVR E;  2XPY A;  4ACL A;  1HG5 A;  5DBK A;  1TNU A;  1K1A A;  4JPS A;  3CK8 A;  1O1T A;  4H7Y A;  1D8E A;  3VTX A;  1WY6 A;  3UKU G;  4C0M A;  2WXH A;  4BSZ B;  4AY5 A;  3S7D A;  3UT8 A;  4GB9 A;  3FUF A;  2GRQ B;  3MX3 A;  4HRL A;  4F7A A;  4AJW A;  3FUH A;  4YVO A;  1X5B A;  3D9P A;  4AP2 A;  1JPL A;  4JVS A;  3ESK A;  1BPO A;  3J5P A;  4JHJ A;  4U07 A;  4XKB A;  3GZ2 A;  5LFA A;  2AXZ A;  3ZFW A;  5G04 J;  2PL2 A;  3TWS A;  3CHQ A;  3DRA A;  3CSF A;  1K3Z D;  3FEY A;  4I9E A;  5ENS D;  2WVI A;  3ML8 A;  3CHO A;  3T5X A;  5FWQ A;  2QFC A;  2P9N G;  2XRY A;  3CQC B;  2BTD A;  4GTS A;  4CGV A;  2P9U G;  1HO8 A;  1QNF A;  3FH8 A;  1SZ9 A;  2I9C A;  5E76 A;  3CQG B;  5AQ9 A;  4FJZ A;  3DPY A;  2IEJ A;  4AEZ C;  4J7W A;  1E8Y A;  2V4L A;  3FH7 A;  3AJI A;  2PM7 A;  2DZN A;  2J08 A;  3MV2 B;  4U8Y D;  2EIN E;  1YMP A;  2GRN B;  2WXI A;  4J8D A;  4FJY A;  5CBO A;  3D9I A;  3Q4A B;  4AOF A;  4F1S A;  1XNF A;  4P29 A;  2F37 A;  4JXT A;  4H7X A;  4BX8 A;  5AIJ A;  2DIW A;  3C3Q A;  1OUV A;  4PS8 A;  4PDX A;  5AEN A;  3HVE B;  3B7T A;  4RG9 A;  2VGE A;  4AV7 A;  4GZD A;  1S70 B;  4B94 A;  1N0R A;  3V30 A;  4BWR A;  2H6H A;  2OEW A;  1N4P A;  1DCE A;  4KVO A;  3CHM A;  3LY8 A;  4G25 A;  2IF4 A;  3CVU A;  4ILH B;  2ION A;  2I2O A;  4A3V A;  1HH8 A;  1NL4 A;  1U3D A;  4GZ6 A;  4I17 A;  3ZIM A;  4HFG A;  4DLO A;  3C3R A;  4YDO A;  4XEI G;  2MHK A;  2OV8 A;  1H6O A;  3OXF A;  1MJ0 A;  5JMN D;  4YDE A;  5ANL A;  4DX5 D;  4AVX A;  2V5F A;  1K1B A;  4UI9 C;  2ZIR A;  1UW4 B;  1S63 A;  1K8K G;  3PZD A;  3L17 A;  4N5Q A;  2P58 C;  3SNX A;  4M3O A;  4JB8 P;  4EBA A;  5KJM A;  1QBQ A;  2FO1 E;  4IUL A;  3EHQ A;  2M63 A;  3ASH A;  4E6H A;  3NQP A;  4GZ3 A;  4LEU A;  2CHW A;  4NIK A;  1Z3X A;  1NI1 A;  4FHK A;  2E2E A;  1H2U A;  2IJG X;  4LUN U;  3TXM A;  2QY7 A;  1NP7 A;  3S7B A;  1O1S A;  2WXF A;  4ATG A;  3PNT B;  1SW6 A;  3OAW A;  2NXP A;  4XZ4 A;  5ITZ F;  3G2U A;  2X6J A;  4XE0 A;  2IFU A;  3AAA C;  4C0E A;  2L0I A;  1N54 A;  3VLF A;  5ENO D;  3KEZ A;  1G3N B;  2V4H C;  4JEU A;  4GPK A;  2WXP A;  2FF4 A;  3NF1 A;  4LNB A;  3PNL B;  4JW1 A;  3VTY A;  2HM8 A;  2DYR E;  4GAA A;  3D9K A;  1H2T C;  3FFL A;  3UM2 A;  2YIN A;  5BPP A;  3ZXS A;  3CVL A;  4TV3 A;  3DSW A;  3UM0 A;  4WNE A;  3U64 A;  4UWK A;  3PE3 A;  3ISM C;  2VTB A;  3R7R A;  5KWD A;  3UQ3 A;  2FUL A;  2VSO E;  3S7J A;  3UPV A;  3ZVV A;  3SY2 A;  1N52 A;  5CEC B;  2VJ8 A;  2GRL A;  5D0Q D;  3FUE A;  2R5S A;  5FQ6 A;  2RFA A;  4Y6W A;  4X8Q A;  2P2C P;  3SBT B;  4NAC A;  3TWW A;  2ZXW E;  1TN8 A;  3AG3 E;  3G2W A;  3RK6 A;  2ETA A;  3AS8 A;  2V0P A;  4UQX A;  4JD2 G;  3ZPJ A;  3QWV A;  5D2M C;  3FEX A;  3C3O A;  3CK9 A;  4FHJ A;  5AYW D;  4OAV B;  3QK0 A;  3UI2 A;  3U9W A;  4GYW A;  2VTB B;  2XS8 A;  1TN7 A;  2OCC E;  2H6F A;  1D9S A;  3JXJ A;  3V2X A;  3KS2 A;  1ELK A;  2OVB A;  2P9S G;  2I1K A;  4WAF A;  5A7D B;  4BSX A;  2WMN A;  2FBN A;  2RKK A;  4RQI A;  4N2S A;  3B7S A;  4HNA D;  3ZUV B;  2QZA A;  5CMY A;  2BF0 X;  3G2V A;  2XEN A;  4BES A;  3ZNG A;  4HXI A;  3TWX A;  3ZW3 A;  1JWF A;  5AAR A;  4CEM A;  1TN6 A;  3UT7 A;  1RZ4 A;  1MX6 A;  5BXU A;  2KCL A;  5B3S E;  4DK5 A;  2WQH A;  4C9B B;  4GYY A;  4MS6 A;  3FUN A;  4UWH A;  5CER B;  2R03 A;  3BEE A;  1WAO 1;  3NZS A;  3BG0 B;  2R02 A;  4J8F A;  3O48 A;  2KAT A;  3DPD A;  3DEP A;  1LTX A;  5J90 A;  2DYS E;  3PEV B;  2NYJ A;  3KSQ A;  2VGX B;  2EIM E;  3F6Q A;  3W9G A;  4U0S A;  5ENN A;  3CK7 A;  2WM9 A;  5ENR D;  3FTU A;  1D8D A;  4TRQ A;  4EHM A;  2IQC A;  3CIA A;  3Q9N C;  4UI9 J;  5ARF A;  5J08 A;  1HS6 A;  2J09 A;  4RVB A;  2J07 A;  2JEK A;  5G2N A;  4I43 A;  2X6F A;  4DX6 D;  3L54 A;  4G24 A;  2J4D A;  3RAU A;  4YND A;  3ABL E;  1MYO A;  2DZO A;  1TJC A;  5KJK A;  5CCL A;  3MKR A;  5D0O D;  3CVY A;  4UWG A;  3CEQ A;  1QQE A;  4U96 D;  5BV0 A;  3UT4 A;  4DRX E;  1UG3 A;  3CGH A;  3ULQ A;  4AM9 A;  4FLB A;  2V8S E;  1BU9 A;  2DBA A;  3GYZ A;  5HI7 A;  3MEK A;  1ELR A;  2IOL A;  3AG1 E;  1HG2 A;  4ZFH A;  4N5C A;  3O4Z A;  4I1O B;  2FEZ A;  1X81 A;  1Y8M A;  3APF A;  2LAH A;  4LNU D;  3CVN A;  3L22 A;  3EIJ A;  3TWT A;  2J49 A;  4U95 D;  1N9A A;  3C72 A;  3FU0 A;  5EYL A;  4GA0 A;  1E90 A;  1OWL A;  1LD7 A;  2WXQ A;  2BED A;  2XCC A;  5LP0 A;  3SGH A;  4CGW A;  3C98 A;  4FUL A;  5FZQ A;  4HVB A;  4BET A;  3HVE A;  1TNY A;  3CHR A;  3PE4 A;  2E0I A;  4MLP A;  4OAU C;  3D9M A;  1EPU A;  2KBX A;  5FJY A;  2I6H A;  5IY5 E;  5AQA A;  2GRR B;  3DSV A;  1IXV A;  2RFM A;  1Z5S C;  3APC A;  3FTV A;  4ANU A;  4TXR A;  3ASG A;  4DUI A;  4L9P A;  5D66 A;  1FT2 A;  3JQ0 A;  2P9L G;  1HXI A;  4K5A B;  2NSZ A;  4UUC A;  3EHM A;  2IO2 C;  3LY9 A;  1V54 E;  3CKB A;  3ESL A;  3FTZ A;  4GYO A;  4ILG A;  5EX3 A;  3Q9U C;  4J8Y A;  4JA9 A;  1H0A A;  5EN5 D;  3ZRH A;  5EID A;  4LG6 A;  3RRN B;  2J8S D;  4K5B A;  2JAB A;  2Q7F A;  4O1P A;  3E37 A;  2F0Y A;  2WXJ A;  4I1A A;  5G04 C;  1SQM A;  4WND A;  3X2Q E;  3L13 A;  3Q73 A;  4DLQ A;  3CKC A;  1H2V C;  3UM3 A;  4NRH B;  2YHC A;  4L2L A;  3MJW A;  5HS0 A;  1N0Q A;  3CVX A;  3ZHE A;  3NZU A;  2VGY A;  5FQ7 A;  3S7F A;  2KM4 A;  3MKQ A;  3S2A A;  4U04 A;  4GA2 A;  4GA1 A;  1DNP A;  4XI0 A;  3JXI A;  1L5J A;  3LKU A;  4L23 A;  1NZN A;  2I1J A;  3Q78 A;  4EPZ A;  1B89 A;  4BTB A;  4XKC A;  2EIK E;  3V79 K;  4DX2 A;  4PUC A;  2CG3 A;  3BQO A;  2DCP A;  4DX1 A;  4KXK B;  1WG0 A;  3LEW A;  1OCZ E;  4Q96 A;  1BLX B;  3EIQ C;  4PH4 B;  3JUE A;  2WXK A;  1NA0 A;  2LNI A;  3G2S A;  4I6G A;  5T4Y A;  3MKQ B;  3E34 A;  2XPI A;  3ONL A;  4RG6 A;  4G2V A;  3DEO A;  5HQ8 A;  4N3A A;  4O6F A;  1GW6 A;  2AWI A;  3D9N A;  3G2T A;  4ABN A;  3PS6 A;  3RSE G;  3D9O A;  2PZI A;  4TXQ A;  2A5E A;  3TG5 A;  1Y6I A;  3IBE A;  3R9M A;  2DVW A;  1A17 A;  5H7P A;  3U4T A;  4BX9 A;  3SFZ A;  3ASO E;  4QQI A;  4AIF A;  2OVF A;  1FPP A;  2KZT A;  3CVW A;  3FU6 A;  4U63 A;  3WXX A;  3NBN B;  1JCQ A;  1ELW A;  3HIZ A;  5CRU A;  1UN9 A;  3V31 A;  3OXG A;  4HOQ A;  4N2Q A;  5AJL A;  1SA5 A;  2MRI A;  3FP3 A;  5AAO A;  5AJD A;  4F6R D;  2C0L A;  2RG8 A;  1BI8 B;  2VQ2 A;  2PNN A;  5BT1 A;  3FH5 A;  1ZB1 A;  3IKO B;  3URZ A;  1LD8 A;  4CCA A;  4JL0 A;  3CVP A;  4AXH A;  2OOE A;  3CV0 A;  4B8C B;  2ZIS A;  2VYI A;  3LXU X;  4YDW A;  5KJL A;  3WG7 E;  2LUH A;  3EU5 A;  3JQ1 A;  3ZGQ A;  3EUV A;  4HB5 A;  2PM6 A;  3IEG A;  1H6K A;  4GTT A;  3HXD A;  3TJP A;  3PUK A;  4J8S A;  5FIO A;  3RU0 A;  3CST A;  3OTN A;  4KBQ A;  5LX8 A;  3HXF A;  4J6I A;  4HOR A;  5KJN A;  3PRZ A;  3D9L A;  5ENP D;  1OY3 D;  5CEA A;  3QJZ A;  2CFU A;  3DSU A;  4GCN A;  2VSN A;  3E4B A;  4KZC A;  4GZ5 A;  2WMO A;  4HLE A;  2WB2 A;  4GTM A;  3LYA A;  4HS2 A;  3ZYQ A;  4HBD A;  3EDT B;  3ENE A;  3L16 A;  3AU5 A;  3QAQ A;  1KLX A;  2P9P G;  3SFY A;  3K9I A;  4N3B A;  3MYV A;  5EYP F;  1DVP A;  1UJK A;  2XGS A;  4I2Z A;  4A1G A;  2OND A;  2KXP C;  4U0U A;  4U0Z A;  3VLE A;  4LER A;  3EHR A;  2XEH A;  3JCK C;  3L82 A;  3R7Q A;  4L2Y A;  1IHB A;  2UWJ G;  4LRZ A;  4HI9 A;  5LOZ A;  2A4Z A;  1TNZ A;  4NUR A;  3Q47 B;  4UI9 K;  4F3V A;  3CR3 A;  3UX4 A;  5JHA A;  1YCS B;  4WWO A;  4F1P A;  3U66 A;  1W3B A;  4NQ0 A;  2IY0 C;  3HDX A;  3V2O A;  1MZC A;  5ARG A;  2KCK A;  2LO6 A;  3U3W A;  1IQU A;  5E75 A;  5FQ4 A;  5KCM A;  3I4R B;  1N95 A;  1HX8 A;  4WNF A;  4DJA A;  1DCQ A;  2WXO A;  4CDM A;  3FTY A;  3LJN A;  1UJJ A;  4G1T A;  3UMV A;  4GTR A;  4CYM D;  1E7V A;  4WWP A;  2B0O E;  2DWZ A;  3SO8 A;  4EEC A;  3TGO A;  3CHS A;  2XQ0 A;  1OWO A;  2BUG A;  4GTO A;  4O1O A;  3QB2 A;  4UQZ A;  4D10 C;  3ZYK A;  3SD5 A;  3PZ3 A;  3Q49 B;  1OCR E;  3JYS A;  3PH0 C;  3RRM B;  4B93 B;  4HQD A;  1KT0 A;  1E8Z A;  1WM5 A;  3ABK E;  2KC7 A;  1FVH A;  1IYG A;  2GGF A;  3B7R L;  4HRM B;  2ETC A;  2XZD G;  4F53 A;  2GW1 A;  1TNB A;  5EDS A;  4LCT A;  3T5V A;  2LAI A;  4G8K A;  3FU3 A;  5DIZ A;  4ANV A;  4ANX A;  3ZXP A;  1EYH A;  1YYH A;  3FY4 A;  1MX2 A;  1PC2 A;  4A55 A;  1IHG A;  4FLH A;  3B95 A;  1FCH A;  2X6I A;  3SI5 A;  2CG2 A;  1TEZ A;  2H6I A;  2KCV A;  4U8H A;  1IQR A;  3TAX A;  3HXC A;  3D3M A;  3B13 A;  3GZS A;  4K0R A;  3FTW A;  1AP7 A;  3FUK A;  2CFZ A;  4I2W A;  2XZT G;  1ZBP A;  2WQ7 A;  4U8V D;  4CDR A;  3I3N A;  4LNG A;  4UWL A;  1S0P A;  2QC9 A;  3HG0 D;  1AWC B;  4JC8 A;  3L6A A;  3QNK A;  2GRO B;  2Y4U A;  1KZP A;  3J5Q B;  3ZU7 B;  1QZ2 A;  5BXO A;  2VSX E;  3ZKJ A;  2L0T B;  4KVM A;  3AG2 E;  3C5R A;  5KBA A;  4N3C A;  3KAE A;  4UWF A;  1SVX A;  4HRN A;  1HZ4 A;  2Y0B G;  1LF8 A;  5FTP A;  2F8Y A;  2Y1L E;  2KZT B;  3UIO C;  5FIN A;  4HI8 A;  2XEE A;  4JA7 A;  3MV3 B;  4ILI A;  2L9B A;  2V5Q C;  2YHE A;  2X3M A;  4RSY A;  4I6J A;  2IO3 C;  3BUA A;  4JHK A;  3Q79 A;  4GTP A;  3KEA A;  3QC1 A;  4APF A;  1N4R A;  2Y4T A;  1KPS B;  3AU4 A;  4A63 B;  1TNO A;  3ML9 A;  5BW8 C;  3EJN A;  5CMW A;  3PZ1 A;  5AQ7 A;  1OT8 A;  4OVV A;  2XEV A;  3JUI A;  1UN8 A;  5JA4 D;  1YA0 A;  3TWV A;  3LJ3 A;  4QFV A;  4XIF A;  2P9I G;  2X38 A;  2XS1 A;  2LSU A;  5C1D A;  3QAR A;  2BKK B;  3DSS A;  1IKN D;  4OYS A;  3SHF A;  4B8A A;  3SF4 A;  2VSY A;  3QKY A;  3KD7 A;  2C2L A;  4G26 A;  1JCS A;  3IXE A;  3TWU A;  4B89 A;  4K03 A;  1A5E A;  4DI4 A;  4ATZ D;  4YDY A;  1E7U A;  4RLY A;  4EZJ A;  3R9A B;  3PZ4 A;  2WXM A;  4WUY A;  4GZC A;  4KZ0 A;  4HOT A;  4OVU A;  4PS7 A;  2J9Q A;  1NA3 A;  3L08 A;  4EQF A;  4GMJ A;  2UY1 A;  3ZHE B;  4LSZ E;  1OCC E;  2XHE A;  5FZR A;  3BG1 B;  5FT9 A;  2HO1 A;  4FP7 A;  5M72 A;  1WDY A;  2HYZ A;  1BD8 A;  4DX7 D;  4GU5 A;  3ULE G;  2HE0 A;  3UXG A;  1BI7 B;  3CLJ A;  4MRU A;  4TXP A;  3LDZ A;  1PY1 A;  5T8I A;  4JEH A;  3MA5 A;  2LSV A;  3UTM A;  5JJ6 A;  5CHE E;  4DI3 A;  2VGX A;  5KNH D;  4KT6 B;  1MQS A;  4U7E B;  5CCM A;  3SBS A;  3TL5 A;  2GRP B;  5EIL A;  1OWP A;  5AN8 A;  2Y69 E;  3D9H A;  3RO3 A;  2YNQ A;  2JLB A;  2EIL E;  3W9F A;  1TR4 A;  4MKT A;  4I9C A;  5C2Y A;  5ANR A;  3EHN A;  1OXJ A;  5A23 A;  5EIB E;  2OEV A;  1INZ A;  3IHY A;  1JCR A;  3FTX A;  1N4S A;  2ILR A;  3E32 A;  4G8L A;  4URK A;  3ULY A;  2XGM A;  2FO7 A;  1XGW A;  4PS3 A;  3HXE A;  2WQ6 A;  2AXU A;  3CVV A;  4L1B A;  4HOU A;  5G05 C;  3T8K A;  2XPZ A;  3Q15 A;  3RKV A;  3RIB A;  3UM1 A;  3FUI A;  3FWV A;  1HFA A;  1FT1 A;  2BKG A;  4ME2 A;  4JHR A;  5BV1 A;  3IHV A;  3NOG D;  1N4Q A;  3SQV A;  4HLL A;  2PQR A;  2F8X K;  3PVL A;  2B6C A;  4BT8 A;  3AS5 A;  3DXM G;  3BU8 A;  4CZ2 D;  3P2B A;  3PRE A;  5FZS A;  4CDN A;  4BFR A;  2IOS A;  3GW4 A;  3E33 A; 
#chains in the Genus database with same CATH homology
 3CHO A;  4G11 A;  3T5X A;  5FWQ A;  2QFC A;  3QWP A;  2XRY A;  3LPZ A;  1TJC A;  4CT4 A;  1IQU A;  3CQC B;  5E75 A;  2BTD A;  3FDH A;  5KJK A;  3ZEF A;  5FQ4 A;  5KCM A;  4CGV A;  5CCL A;  3MKR A;  5D0O D;  3I4R B;  3CVY A;  4UWG A;  3CEQ A;  1HX8 A;  1HO8 A;  1QQE A;  4KYO B;  4WNF A;  5BV0 A;  1QNF A;  1Z6T A;  3FH8 A;  4W9R A;  3UT4 A;  4DJA A;  1SZ9 A;  2WXO A;  3PUJ A;  4CDM A;  2I9C A;  5E76 A;  3CQG B;  3FTY A;  4FJZ A;  4FU3 A;  1UJJ A;  1UG3 A;  3CGH A;  4I1M A;  3ULQ A;  1OWM A;  4FLB A;  4AM9 A;  2AXV A;  4G1T A;  3UMV A;  4AEZ C;  2WXN A;  3ZYL A;  2V8S E;  3FTS A;  2DBA A;  1E7V A;  3GYZ A;  4WWP A;  5HI7 A;  3MEK A;  1ELR A;  1E8Y A;  2IOL A;  4N39 A;  4EEC A;  1HG2 A;  2V4L A;  3FH7 A;  3TGO A;  2PM7 A;  4N5C A;  5JJ7 A;  3CHS A;  2XQ0 A;  4V3I A;  1OWO A;  2BUG A;  2J08 A;  3MV2 B;  3O4Z A;  4I1O B;  3RO2 A;  2FEZ A;  3QB2 A;  4UQZ A;  1Y8M A;  3APF A;  2LAH A;  4D10 C;  3ZYK A;  3DBS A;  2WXI A;  3CVN A;  3L22 A;  4J8D A;  3SD5 A;  3EIJ A;  3HYM B;  2J49 A;  4FJY A;  3D9I A;  3Q49 B;  3Q4A B;  3JYS A;  4IN3 B;  4AOF A;  4F1S A;  1XNF A;  3FU0 A;  3PH0 C;  4GA0 A;  1E90 A;  4P29 A;  3RRM B;  1OWL A;  4JXT A;  4H7X A;  4BX8 A;  2WXQ A;  5AIJ A;  1KT0 A;  1E8Z A;  2DIW A;  4GCO A;  1OUV A;  2XCC A;  1WM5 A;  5LP0 A;  3SGH A;  4PS8 A;  4CGW A;  2KC7 A;  3C98 A;  4FUL A;  2EQX A;  3P1U A;  4PDX A;  5FZQ A;  5AEN A;  1FVH A;  3LCA A;  4HVB A;  1IYG A;  2GGF A;  3ONK A;  3B7R L;  3HVE B;  3HVE A;  4B0Z A;  3ASD A;  3CHR A;  2X6H A;  3MGB A;  3PE4 A;  2CHX A;  3B7T A;  4F53 A;  3TG4 A;  2E0I A;  4RG9 A;  4MLP A;  3LVQ E;  2GW1 A;  4AV7 A;  3D9M A;  1EPU A;  1TJF A;  2AVP A;  3D9J A;  4GZD A;  5EDS A;  3T5V A;  4L7T A;  4LCT A;  4B94 A;  2LAI A;  4BWR A;  5FJY A;  2I6H A;  3FU3 A;  5DIZ A;  3RJV A;  2A5U A;  4ANV A;  4ANX A;  1ZU2 A;  5JHB A;  4KVO A;  1OWN A;  5FQ8 A;  1EYH A;  3FY4 A;  4EZK A;  2FI7 A;  3CHM A;  1P5Q A;  3APC A;  3FTV A;  3LY8 A;  3PDN A;  4G25 A;  4ANU A;  1PC2 A;  2IF4 A;  4A55 A;  3ASG A;  4ILH B;  1IHG A;  3CVU A;  2ION A;  4FLH A;  2WXR A;  2I2O A;  4A3V A;  1FCH A;  2X6I A;  1U3C A;  3SI5 A;  1HH8 A;  2CG2 A;  3JQ0 A;  1TEZ A;  1U3D A;  4GZ6 A;  4I17 A;  2KCV A;  3ZIM A;  4HFG A;  4U8H A;  3ASF A;  5T3R A;  4DLO A;  1IQR A;  1HXI A;  4J8E A;  2YQ8 A;  3VLD A;  4Q94 A;  2NSZ A;  3TAX A;  1SZA A;  2MHK A;  3LY7 A;  3D3M A;  1FVF A;  2OV8 A;  3B13 A;  3FUD A;  3OXF A;  3GZS A;  1JWG A;  3EHM A;  3FTW A;  4K0R A;  5LCW C;  2WXG A;  3LY9 A;  3FUK A;  3CKB A;  3ESL A;  3FTZ A;  2CFZ A;  4GYO A;  4ILG A;  4WNG A;  4I2W A;  2IU1 A;  5EX3 A;  5ANL A;  5EKQ D;  4JA9 A;  1H0A A;  2L6J A;  4AVX A;  2R17 C;  1ZBP A;  2V5F A;  2WQ7 A;  3LS8 A;  4KMO A;  4CDR A;  3I3N A;  4JZY A;  2WXL A;  3ZRH A;  4UI9 C;  4UWL A;  1UW4 B;  3RRU A;  3RRN B;  2XRZ A;  2Q7F A;  3PZD A;  1S0P A;  2WXJ A;  3L17 A;  5G55 A;  4IRU A;  2P58 C;  4ACK A;  4I1A A;  5G04 C;  4JC8 A;  3I5P A;  3L6A A;  3SNX A;  1KT1 A;  1SQM A;  3QNK A;  4M3O A;  2Y4U A;  4WND A;  4BY6 A;  3L13 A;  4J0U A;  4DLQ A;  4EBA A;  1H19 A;  4APO A;  3CKC A;  3MZL B;  1H2V C;  5KJM A;  4IUL A;  4NRH B;  2M63 A;  3ASH A;  3QOU A;  2YHC A;  4L2L A;  3MJW A;  1MHQ A;  3FUJ A;  4E6H A;  3NQP A;  5JJT A;  1QZ2 A;  3CVX A;  4GZ3 A;  4LEU A;  2VSX E;  4WWN A;  1VDY A;  2CHW A;  3ZHE A;  4E85 A;  3NZU A;  2VGY A;  2L0T B;  3QDN A;  4KVM A;  1Z3X A;  4FHK A;  5FQ7 A;  4N3C A;  2E2E A;  1H2U A;  3N71 A;  3KAE A;  3S7F A;  2KM4 A;  2IJG X;  2XCB A;  3PEU B;  3IV0 A;  3MKQ A;  4UWF A;  3S2A A;  4U04 A;  4GA2 A;  4LUN U;  3TXM A;  4A3T A;  4GA1 A;  2QY7 A;  1NP7 A;  3S7B A;  2WXF A;  1DNP A;  4XI0 A;  1HZ4 A;  2WPV A;  2MOW A;  4ATG A;  5G05 J;  3PNT B;  1LF8 A;  3OAW A;  5FTP A;  1L5J A;  2NXP A;  3LKU A;  4XZ4 A;  2KZT B;  3G2U A;  2X6J A;  4L23 A;  1NZN A;  4XE0 A;  2I1J A;  4ANW A;  4EPZ A;  1B89 A;  4BTB A;  3ZN3 A;  2IFU A;  4JA7 A;  4XKC A;  4C0E A;  4EBA G;  2L0I A;  3MV3 B;  4ILI A;  1N54 A;  3VLF A;  1PAQ A;  2L9B A;  1JUQ A;  3KEZ A;  2YHE A;  4PUC A;  2CG3 A;  4JEU A;  2DCP A;  3FUM A;  2X3M A;  3UUX A;  4RSY A;  4GPK A;  4I6J A;  4KXK B;  4JHK A;  2GRM A;  2WXP A;  3LEW A;  2FF4 A;  3NF1 A;  2AW6 A;  4Q96 A;  1EF1 C;  3EIQ C;  3QC1 A;  4TUU A;  4PH4 B;  4CT0 A;  4APF A;  1EDU A;  2WXK A;  3PNL B;  4JW1 A;  3VTY A;  1NA0 A;  2LNI A;  3G2S A;  4BTA A;  4I6G A;  2HM8 A;  5T4Y A;  3MKQ B;  2Y4T A;  3FUL A;  3AU4 A;  4XX5 A;  4GAA A;  3D9K A;  1H2T C;  3FFL A;  2XPI A;  4CRW A;  2NC9 A;  2YIN A;  3ONL A;  2J4B A;  3ML9 A;  3CVQ A;  3HHM A;  2R59 A;  4RG6 A;  5BW8 C;  3EJN A;  5CMW A;  4AY6 A;  4G2V A;  5BPP A;  4A1S A;  3ZYM A;  1HE8 A;  5HQ8 A;  4N3A A;  4O6F A;  3OXL A;  3ZXS A;  4OVV A;  2XEV A;  3CVL A;  1GW6 A;  2AWI A;  3D9N A;  3I4G A;  4TV3 A;  4WNE A;  3JUI A;  1UN8 A;  2Y3A A;  3U64 A;  1YA0 A;  5A6C A;  1E8W A;  3G2T A;  4UWK A;  4ABN A;  3LJ3 A;  3PS6 A;  4QFV A;  4XIF A;  2PQN A;  2X38 A;  3D9O A;  2PZI A;  2LSU A;  4HOS A;  5C1D A;  3PE3 A;  3QAR A;  3B7U X;  4OYS A;  3SHF A;  2XGO A;  3R7R A;  4B8A A;  2VTB A;  3TG5 A;  3SF4 A;  3UQ3 A;  1Y6I A;  2VSY A;  4DPR A;  3IBE A;  2CHZ A;  2FUL A;  2VSO E;  3AS4 A;  3S7J A;  3UPV A;  1A17 A;  3ZVV A;  3QKY A;  3KD7 A;  2C2L A;  3U4T A;  3SFZ A;  4BX9 A;  1N52 A;  2HR2 A;  4G26 A;  2VJ8 A;  2GRL A;  5BNW A;  5D0Q D;  2C0M A;  3FUE A;  2R5S A;  5FQ6 A;  4B89 A;  4K03 A;  4DI4 A;  4R7L A;  4AIF A;  2OVF A;  4IYP A;  4Y6W A;  1E7U A;  2KZT A;  3CVW A;  3FU6 A;  4U63 A;  3SBT B;  4NAC A;  3WXX A;  4EZJ A;  3R9A B;  2WXM A;  4UQY A;  4Q69 A;  1ELW A;  4WUY A;  3HIZ A;  4GZC A;  3APD A;  1UN9 A;  4KZ0 A;  1E8X A;  2ZU6 B;  4XI9 A;  4HOT A;  3G2W A;  4OVU A;  3OXG A;  3RK6 A;  4HOQ A;  1HU3 A;  4N2Q A;  5AJL A;  2MRI A;  3FP3 A;  1E96 B;  1Z3Y A;  2J9Q A;  4PS7 A;  4Y6C A;  5BUZ A;  1NA3 A;  3L08 A;  4EQF A;  3AS8 A;  4GMJ A;  2V0P A;  2UY1 A;  5AJD A;  3ZHE B;  4UQX A;  2C0L A;  3ZPJ A;  3QWV A;  2XHE A;  3FEX A;  3CK9 A;  2RG8 A;  2VQ2 A;  4FHJ A;  5AYW D;  5FZR A;  3BG1 B;  3CHP A;  3QK0 A;  5FT9 A;  2HO1 A;  3FH5 A;  4FP7 A;  5BT1 A;  3SZ7 A;  5M72 A;  2HYZ A;  3U9W A;  3Q5M A;  3IKO B;  4GYW A;  3URZ A;  4CCA A;  2VTB B;  4GU5 A;  4JL0 A;  3CVP A;  4AXH A;  2OOE A;  3CV0 A;  4B8C B;  3CLJ A;  3TXN A;  4MRU A;  2VYI A;  3LXU X;  5EX0 A;  3LDZ A;  1PY1 A;  5T8I A;  5KJL A;  2RD0 A;  4JEH A;  3MA5 A;  4YVQ C;  3JQ1 A;  3ZGQ A;  4FA6 A;  2LSV A;  3KS2 A;  5JJ6 A;  5CHE E;  1ELK A;  2OVB A;  2PM6 A;  3IEG A;  3FHE A;  1H6K A;  4FAD A;  4BT9 A;  4DI3 A;  2VGX A;  4FC8 A;  2I1K A;  1HF8 A;  4I6E A;  4EZL A;  3TJP A;  5LCW J;  3PUK A;  4KT6 B;  4GML A;  4WAF A;  1MQS A;  2UY1 B;  5A7D B;  4J8S A;  4BSX A;  5CCM A;  3SBS A;  2WMN A;  3TL5 A;  2FBN A;  3GZ1 A;  4G23 A;  3RU0 A;  3CST A;  1OWP A;  3FU5 A;  3OTN A;  4KBQ A;  3QWW A;  3MCX A;  3RO3 A;  5LX8 A;  3B7S A;  4N2S A;  2YNQ A;  2X6K A;  4J6I A;  3T8M A;  4HOR A;  2JLB A;  5KJN A;  3LVR E;  3PRZ A;  2XPY A;  5CMY A;  2BF0 X;  3D9L A;  1HG5 A;  3G2V A;  4ACL A;  5DBK A;  4HXI A;  4I9C A;  4MKT A;  5C2Y A;  3ZW3 A;  3QJZ A;  2CFU A;  1JWF A;  5ANR A;  3EHN A;  4JPS A;  4GCN A;  2VSN A;  3E4B A;  4KZC A;  3CK8 A;  5A23 A;  4GZ5 A;  4CEM A;  2WMO A;  4HLE A;  2WB2 A;  3UT7 A;  3LYA A;  4H7Y A;  4HS2 A;  1INZ A;  3IHY A;  3ZYQ A;  2KCL A;  3EDT B;  3ENE A;  3VTX A;  4DK5 A;  3FTX A;  3L16 A;  1WY6 A;  3AU5 A;  4C0M A;  2WQH A;  3QAQ A;  2ILR A;  4C9B B;  1KLX A;  4GYY A;  4URK A;  2WXH A;  4MS6 A;  3FUN A;  4UWH A;  4AY5 A;  3K9I A;  3BEE A;  4N3B A;  3MYV A;  3S7D A;  2XGM A;  1DVP A;  1WAO 1;  1UJK A;  2FO7 A;  3UT8 A;  3NZS A;  3BG0 B;  2XGS A;  4I2Z A;  4A1G A;  2OND A;  4GB9 A;  1XGW A;  3FUF A;  4PS3 A;  4J8F A;  3O48 A;  4U0U A;  3MX3 A;  2WQ6 A;  2KAT A;  3DPD A;  2AXU A;  3CVV A;  4L1B A;  4F7A A;  4AJW A;  5J90 A;  3FUH A;  4HOU A;  1X5B A;  4YVO A;  3PEV B;  5G05 C;  4U0Z A;  3D9P A;  2XPZ A;  2VGX B;  3Q15 A;  4LER A;  3RIB A;  3RKV A;  3VLE A;  1JPL A;  4AP2 A;  3JCK C;  4JVS A;  3R7Q A;  4L2Y A;  3FUI A;  3FWV A;  4U0S A;  5ENN A;  2UWJ G;  3CK7 A;  2WM9 A;  3ESK A;  1HFA A;  4LRZ A;  1BPO A;  3FTU A;  4ME2 A;  5LOZ A;  4TRQ A;  2A4Z A;  4JHR A;  5BV1 A;  2IQC A;  3IHV A;  3CIA A;  4NUR A;  3Q47 B;  4UI9 K;  4F3V A;  3CR3 A;  3UX4 A;  4JHJ A;  4U07 A;  4XKB A;  2PQR A;  3GZ2 A;  5JHA A;  4UI9 J;  3PVL A;  4BT8 A;  3AS5 A;  5ARF A;  5J08 A;  5LFA A;  1HS6 A;  2AXZ A;  2J09 A;  4RVB A;  2J07 A;  2JEK A;  4WWO A;  5G04 J;  5G2N A;  3ZFW A;  2PL2 A;  3U66 A;  1W3B A;  3CHQ A;  3P2B A;  4NQ0 A;  3CSF A;  4I43 A;  3PRE A;  3HDX A;  5ARG A;  5FZS A;  2X6F A;  3L54 A;  4G24 A;  2J4D A;  3FEY A;  4CDN A;  4BFR A;  2IOS A;  4I9E A;  2KCK A;  2LO6 A;  3GW4 A;  2WVI A;  4YND A;  3U3W A;  3ML8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...