2J9QA

A novel conformation for the tpr domain of pex5p
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
328
structure length
300
Chain Sequence
b'GMGLTSATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
publication title A Previously Unobserved Conformation for the Human Pex5P Receptor Suggests Roles for Intrinsic Flexibility and Rigid Domain Motions in Ligand Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 111
structure length 300
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2j9qA00
3CK7A 4WUYA 2UY1B 3Q47B 5FZQA 3LKUA 4UI9J 3S7DA 3PE4A 1HZ4A 4GCOA 3Q49B 5M72A 2E2EA 1HXIA 4G25A 3ZN3A 3GYZA 1QQEA 4F3VA 3ASDA 4H7XA 5JJ7A 4YNDA 4G23A 1NZNA 3CVPA 2XGSA 3BEEA 3SF4A 4ME2A 4APOA 5CHEE 4N2SA 2Y4UA 4CGWA 2HR2A 2PZIA 2YHCA 2VGYA 1NA3A 3KD7A 3LYAA 1A17A 3QKYA 2FF4A 4BT9A 3CVLA 2QFCA 4AY6A 3S7BA 3EDTB 5DBKA 4GYYA 3QWWA 3LY9A 4GZ6A 1PC2A 3GZ2A 3ASGA 2PQRA 3MV3B 4N3BA 2XEVA 4N39A 1FCHA 3UQ3A 1OUVA 4JA7A 3WXXA 3PDNA 3ZFWA 4JHRA 4U07A 5FT9A 4YVOA 4Y6WA 2LNIA 2LSUA 4N3CA 2BUGA 5KJLA 3KS2A 2WQHA 5C1DA 1KT0A 3R9AB 3LY7A 1XNFA 2C0MA 3ASFA 5G04J 4YVQC 5CCMA 5HQ8A 5EKQD 4I2ZA 4N2QA 5G04C 3Q15A 3ZGQA 3RO2A 1ELWA 2XCCA 3CKBA 3PE3A 4XI0A 4AM9A 4GA2A 3AS8A 1ZBPA 3K9IA 2VSYA 5HI7A 5A7DB 2Q7FA 2FI7A 3CKCA 4GA0A 4GCNA 4O6FA 3N71A 4HOTA 1WM5A 3CVNA 2C2LA 3O48A 2ONDA 2FBNA 4J8DA 1E96B 1YA0A 4GZ3A 5G05J 4GYOA 4XIFA 4U0ZA 5DIZA 4J8EA 3S7FA 2XPIA 2VQ2A 2VYIA 1ZU2A 5G05C 4I17A 4GPKA 3MEKA 4RG9A 3QWPA 4BTBA 5A6CA 4ABNA 4I9CA 1IHGA 4Y6CA 4I1AA 4N3AA 3FFLA 3AS5A 1HH8A 4G2VA 2VGXB 4IN3B 1B89A 2L6JA 3LCAA 3OXGA 4XI9A 2XCBA 2LSVA 4UQXA 4WNEA 4G26A 1KLXA 2MHKA 2KCKA 4BWRA 1QZ2A 3LY8A 2PL2A 3RIBA 3S7JA 2VSNA 5JJTA 2FEZA 3OXLA 2DBAA 4A1SA 2IFUA 5ARGA 4WNGA 3ZHEB 3MKRA 3RKVA 4UQZA 3TGOA 5FJYA 4I2WA 3VTYA 3IEGA 2IF4A 4H7YA 3ULQA 3ASHA 2XGMA 2XGOA 4U04A 3NF1A 3QDNA 5KJMA 5EX0A 2KC7A 4HOUA 4N5CA 3RU0A 4I9EA 2R5SA 3U3WA 3CV0A 5FZSA 5KJNA 4CDRA 2WPVA 3Q4AB 1P5QA 2UY1A 5FTPA 3ESKA 2Y4TA 4HORA 4J8FA 1TJCA 1NA0A 3CK9A 2HO1A 4UI9C 5LCWJ 3URZA 5EX3A 5BT1A 2KCVA 4GZ5A 4GA1A 4NRHB 4U0SA 4JA9A 5LCWC 1WAO1 1ELRA 2PQNA 2OOEA 3LPZA 3CVQA 3KAEA 4J0UA 5BNWA 3CK8A 4JL0A 1Y8MA 2P58C 3MV2B 4BTAA 3FWVA 3QOUA 4GYWA 2FO7A 3UPVA 4HOSA 4B94A 3UUXA 4KBQA 3AS4A 3FP3A 3ZPJA 1IYGA 5AYWD 2YQ8A 4AY5A 3SZ7A 4RG6A 2KCLA 3JYSA 2V5FA 4KYOB 2JLBA 5D0OD 3QWVA 3GW4A 3GZ1A 4WNFA 5ARFA 3TG5A 4EQFA 4HOQA 3CEQA 3OXFA 2J9QA 5KJKA 4BT8A 1W3BA 2VGXA 2C0LA 3Q5MA 5D0QD 4LEUA 3VTXA 4G24A 3U4TA 4CGVA 1KT1A 2I6HA 4UI9K 4NQ0A 2KATA 3HYMB 3TG4A 4WNDA 4KXKB 2AVPA 4W9RA 3TAXA 2GW1A 2HYZA 5FZRA 5CCLA 3ZHEA 2UWJG 3E4BA 5JJ6A 3MA5A 5BW8C 3RO3A 4UQYA 4G1TA 2NC9A 4U0UA 4AIFA 3RJVA
chains in the Genus database with same CATH superfamily
4WUYA 2OV8A 2UY1B 3T9KA 4HB5A 3APFA 5FZQA 3LKUA 1AWCB 1E7VA 4APFA 1INZA 3LEWA 2IOLA 5B1AE 1VDYA 1HXIA 3ZN3A 4PUCA 5HKPA 1FVHA 5CMYA 1V54E 4JZYA 2CG3A 3DBSA 4KMOA 1IKND 4YNDA 2P9KG 1NZNA 3FUHA 1TN7A 3ASNE 4CEMA 2XGSA 3BEEA 1TNUA 3UKRG 4N2SA 2Y4UA 3D9NA 4EECA 2YHCA 3ML9A 2XZTG 3I4RB 3NZUA 1D8EA 2QFCA 5BXOA 4AY6A 2WXQA 1MHQA 4JHKA 4JEUA 3EDTB 1JPLA 3QWWA 3EIJA 4ACKA 2WXJA 4GTRA 2VGEA 2XHEA 2PQRA 3FU0A 4DLQA 4L2YA 2XEVA 4XX5A 3ZVVA 4N39A 1D8DA 1FCHA 3VLDA 3UQ3A 5HRYA 4OAVB 4O60A 3V79K 3D9IA 5CBNA 5FT9A 2J49A 1SZAA 3B7TA 3ASOE 1HG5A 5LFAA 3HXBA 1HS6A 3DXMG 3BU8A 1DC2A 1OWPA 2KM4A 2CHWA 3SNXA 4UWFA 1G3NB 2I1JA 1N4RA 1SW6A 2NYJA 1Z3YA 1MZCA 3IXEA 3ZU7B 4U7EB 2R02A 4I2ZA 4N2QA 3Q15A 1SA5A 4GMRA 5AIJA 3MJWA 4NIKA 4XI0A 1S0PA 5KBAA 3QNKA 3I5PA 5CMWA 3CHOA 1OWLA 2Q7FA 4Q94A 3R7RA 4EZKA 4GA0A 4X8QA 2V5QC 4MLPA 5G2NA 4O6FA 3L08A 3PS6A 3N71A 3QAQA 5LP0A 4YDEA 3AG4E 4U8HA 3CVNA 2C2LA 3ZNGA 4DI4A 1JWGA 1Z6TA 1E96B 3ZYMA 3U9WA 1OWNA 1JUQA 3UIPC 4BSZB 3CLJA 4ATGA 4TRQA 5ENSD 5DIZA 4J8EA 3S7FA 1QBQA 2XPIA 4OVUA 1ZU2A 4FADA 2H6IA 3ZIMA 1DNPA 5A6CA 4ABNA 2PM7A 4Y6CA 3UIOC 3SFXA 4G8KA 3W9GA 1OWMA 3FDHA 3FH5A 4B0ZA 4GB9A 1N0QA 1MX2A 5ENNA 2R05A 2WB2A 3FTXA 4HRMB 4M3OA 4BEPA 1IHBA 3DXKG 3G2UA 4G8LA 4WNEA 4BWRA 1TJFA 2J4DA 1YYHA 5IY5E 4PS8A 4L2LA 2WQ6A 2IJGX 4DI3A 4JPSA 2EIME 1UN9A 3FTUA 4CZ2D 4U8YD 3MKRA 3RSEG 4WWPA 5EYLA 2DZNA 3ZXSA 4IRUA 2LXMA 5EX0A 2Y3AA 4I6JA 1N9AA 3D9KA 3CQGB 1K1AA 3PRZA 4I9EA 1RZ4A 4E85A 3VLEA 1N4PA 4L23A 4CDRA 3Q4AB 1P5QA 4K5AB 4J8FA 5A23A 3NOCD 3PREA 2HO1A 4UI9C 1Q2ZA 5LCWJ 3ZXPA 5T8IA 3URZA 5EX3A 4GZ5A 3PNLB 3DEPA 3FTVA 5LCWC 4C48B 2R2LA 2XS8A 1HFAA 4JVSA 3CVUA 2XRZA 3KAEA 2Y0BG 3ULYA 1IQUA 4JL0A 3QB2A 3SY2A 1Y8MA 5B1BE 3FWVA 2E0IA 4CT4A 4Q96A 5D2MC 4HOSA 2WQ7A 1MQSA 4B94A 3RRNB 3KEAA 1E8WA 2MYOA 4BSXA 2YQ8A 4KZ0A 4EZJA 5FQ6A 1WDYA 2NSZA 4WNFA 4XZ4A 4CDNA 4CDMA 4GPMA 4EQFA 1E8ZA 4HOQA 4QQIA 1W3BA 2NXPA 3C3RA 3DWLG 1K1BA 5ANRA 1MX6A 5BPPA 2J07A 5JMND 5BV0A 1OY3D 1WY6A 4G24A 4GTSA 3U4TA 4CGVA 1X81A 4U95D 2X6FA 2ZIRA 2I6HA 5AQBA 4TXRA 1N11A 4FHJA 3B13A 4ILGA 3C5RA 3TXMA 2BF0X 5CCLA 3E4BA 3MA5A 3E34A 4G1TA 1OCCE 4DK5A 3RAUA 3DSVA 4P29A 1TNOA 3CK7A 1EPUA 5KCMA 4ZHBA 4B8CB 3AAAC 4LCTA 4PS3A 4UWKA 4GCOA 3O4ZA 3Q49B 2EINE 4G11A 2OCCE 4FLHA 2GRQB 1E7UA 2M63A 3CVPA 3ZUVB 4C0MA 1O1RA 4K0RA 3CVXA 4FP7A 2VGYA 3KD7A 3UINC 4NACA 4I6GA 3LYAA 1BLXB 5ENRD 4BT9A 3TWWA 1TNYA 4XKBA 4U96D 3E32A 2QZAA 1Y6IA 3B7BA 4GZ6A 4LNBA 3NAWA 2DYSE 3FTYA 4GMJA 2GRPB 1PC2A 1H0AA 3L16A 3HVEB 4HBDA 1TN8A 3C3OA 2CFZA 4N3BA 3Q7AA 5ENPD 2QC9A 4GTQA 5FQ7A 4I43A 5CERB 4JA7A 4GTMA 5AQAA 4QFVA 4UWLA 4N3CA 2BUGA 3EIQC 3FUEA 5KJLA 1H2VC 2DYRE 1KZOA 2VTBB 3LVRE 3L9TA 5JHBA 1H6OA 2V0PA 1SA4A 2BKGA 3LY7A 3KSLA 1D9SA 3ASFA 3CHQA 2QYUA 4RVBA 2VSXE 5T3RA 4Q69A 3PEUB 5EKQD 3FUFA 3AG2E 3ISMC 3ZGQA 1MYOA 2I9CA 2HE0A 3RO2A 3PEVB 3ESLA 4PDXA 3CKBA 3TJPA 3NB2A 1UJKA 4WAFA 4F53A 4AM9A 2LAHA 3SBTB 1ZBPA 1OCRE 4NURA 4JW1A 1U2VG 2X3MA 3SFYA 1MJ0A 2VSYA 5HI7A 3B7RL 3UI2A 5ENTD 3CKCA 3PH0C 4GCNA 3V30A 3CHPA 4BETA 3P2BA 2ONDA 3UKUG 4B8AA 3CSFA 2DZOA 2IO2C 4GYOA 3DSTA 4K5CA 5T4YA 2VQ2A 4I1OB 4F7AA 4CYMD 3D9JA 4GPKA 4EBAG 3MEKA 3PZ1A 4BTBA 3FU5A 4F1PA 3TWVA 4I9CA 4I1AA 4N3AA 4O1OA 3CSTA 4K5BA 1HH8A 4V3IA 5AJDA 2VGXB 5HS0A 1EYHA 2RFAA 4XI9A 2LSVA 2V4HC 5ITZF 4UQXA 4G26A 3NBNB 3KSQA 2PL2A 1XGWA 1NP7A 2L6BA 4OYSA 3RIBA 4DRXE 5JJTA 2FEZA 3X2QE 1H19A 3OXLA 3RK6A 1HU3A 3V2XA 1BD8A 4A1SA 3OTNA 4GZDA 4EHMA 3ZHEB 1IXVA 2P9PG 5AJLA 5JHAA 3RKVA 3LXUX 2YHEA 5FQ4A 2IO3C 3RRMB 1LTXA 3AG3E 5AQ7A 3Q73A 1O1TA 4HXIA 2WXPA 1QNFA 3HIZA 2B6CA 3QDNA 5KJMA 2X6HA 2KBXA 1TR4A 4DX7D 3LVQE 4JEHA 4N5CA 1S63A 5ANLA 1SQMA 3B95A 5EILA 5G55A 3G2SA 4XE0A 3NQPA 4XEIG 2R59A 3D9OA 2F8XK 1TEZA 5FTPA 1N54A 3ESKA 4CT0A 1TJCA 3R7QA 2H6GA 5EYPF 1K3ZD 5AQ9A 2B0OE 2AW6A 2WMNA 2DIWA 3RRUA 4GA1A 1E90A 4U0SA 3FEXA 3VLFA 3EHRA 4DPRA 1WAO1 1ELRA 2X6IA 4LNUD 1OCZE 5BNWA 2KXPC 2P9LG 3MV2B 4TUUA 4AJWA 2GROB 1N4QA 5CEAA 3UPVA 1DCEA 4XKCA 3UUXA 3Q75A 3JUEA 1DVPA 4KBQA 3AS4A 4GAAA 3V2OA 3ZPJA 4J8SA 3E30A 1IYGA 4DJAA 2YNQA 2LO6A 4AY5A 2AXUA 3SZ7A 4HS2A 3ZW3A 1YMPA 2KCLA 2P2CP 4KYOB 3UM3A 3UT8A 3PUJA 2LAIA 1N0RA 2AXVA 5J08A 2A5EA 2KZTA 3J5PA 3FUMA 1O5MA 3I4GA 3FEYA 4J6IA 5D0QD 3JQ0A 3I3NA 1WG0A 1NL4A 3IHYA 3P1UA 5AN8A 1KT1A 3T8MA 4TV3A 4DUIA 3L6AA 2WXGA 3Q9UC 3D9LA 3TG4A 1O1SA 3U66A 1Z5SC 2AVPA 4W9RA 3TAXA 1H2TC 3B7SA 2DWZA 2WXMA 2BKKB 3HHMA 2NC9A 1N4SA 2XS1A 3FH7A 3EUVA 3Q47B 2AXZA 1LF8A 4FC8A 4UI9J 3PE4A 2A4ZA 5KNGA 3SGHA 4BX9A 1NI1A 2XENA 2E2EA 4G25A 2LXLA 3GYZA 1QQEA 4AEZC 2ZGGA 1TNZA 2J8SD 4F3VA 3G2WA 3ASDA 3AG1E 1ELKA 4H7XA 5JJ7A 5CEDB 4G23A 3APDA 3TWTA 4A1GA 4IYPA 2CFUA 5CHEE 3IBEA 4HQDA 5AENA 2VJ8A 4CGWA 4U63A 1S70B 4F1SA 1NA3A 2QY7A 4DX6D 3AJIA 3DSSA 2J09A 3PZ3A 3ZYQA 2FF4A 2L0IA 3CHMA 3FTZA 3EU9A 1YCSB 4A3TA 4HFGA 5DBKA 3LY9A 3QC1A 2BTDA 3MZLB 3GZSA 3GZ2A 3WG7E 3ASGA 4TXPA 3TWUA 3MYVA 3JXIA 3MV3B 3ML8A 4DLOA 3U64A 1JCSA 3PDNA 3ZFWA 4HRNA 4U07A 1OCOE 3TWQA 4YVOA 3L54A 4FHKA 2IU1A 3G2TA 3MKQA 4GMLA 3HXFA 3AU4A 2I2OA 2WQHA 3KS2A 2F8YA 4K03A 4UWHA 4ANXA 2CHZA 4MRUA 4HI8A 4JC8A 3R9AB 1XNFA 3CGHA 2C0MA 1MX4A 2J08A 3D3MA 2F37A 3DSXA 5CCMA 1UN8A 4ACLA 3FUDA 2X38A 1TN6A 1V55E 2RD0A 5EDSA 2XCCA 3PE3A 4ILHB 3ENEA 1DCQA 3DPDA 1OXJA 3B7UX 1S64A 5E76A 3K9IA 3ZRHA 3G2VA 3APCA 1UJJA 2RFMA 2WXIA 2IY0C 4EPZA 2FI7A 4E6HA 2JEKA 4HOTA 4OAUC 1HX8A 3O48A 3PZ4A 1UW4B 3ABLE 2FBNA 1N95A 1YA0A 3PNTB 4GZ3A 5G05J 4XIFA 3CVVA 2IONA 1N94A 2FULA 4I6EA 1BU9A 4OVVA 5D66A 5G05C 4I17A 1BPOA 1PAQA 5KWDA 3UTMA 5LOZA 2WXKA 4RG9A 2DVWA 3MCXA 3JQ1A 3IHVA 2GRMA 2WXRA 3C72A 3PUKA 2P9SG 4AOFA 4G2VA 4IN3B 5E75A 1B89A 1A5EA 2L6JA 3LCAA 3ZKJA 4N5QA 2XCBA 3QARA 4C9BB 3KEZA 4KVOA 4UWGA 3MKQB 4JHJA 1KLXA 1U3DA 2MHKA 2KCKA 1QZ2A 3LY8A 1H6PA 4Z68A 2GGFA 3FULA 4A55A 2VSNA 4GU5A 1TYQG 5ENQD 1U3CA 2CG2A 2DBAA 2IFUA 2I1KA 5ARGA 4WNGA 3SFZA 4ILIA 2F0YA 1E8YA 3HDXA 4UQZA 3ABME 5JA4D 5FJYA 4I2WA 3LS8A 2IQCA 3IEGA 3UM2A 1PY1A 2IF4A 4A63B 4H7YA 2WXHA 4YDOA 2WXLA 4IULA 3ASHA 2XGOA 4U04A 3NF1A 3TL5A 2AWIA 4CRWA 2KC7A 2BEDA 3RU0A 4J8YA 3HXDA 2R5SA 4AV7A 1HG2A 1AP7A 3U3WA 3LJNA 1X5BA 4BX8A 5FZSA 3NZSA 4FJYA 2WM9A 3DSWA 5CBOA 3TWXA 2Y4TA 5J90A 2X6JA 4URKA 4FA6A 3IV0A 4HI9A 2KCVA 4YDWA 3EJNA 2ILRA 2PQNA 2IOSA 3EHQA 3LPZA 4D10C 3CVQA 4B93B 2V4LA 2XPYA 3CK8A 4BTAA 3QOUA 5BUZA 4PH4B 4GYWA 2FO7A 3UX4A 5LX8A 2L0TB 3FP3A 2ETCA 4B89A 5AYWD 3MGBA 1FPPA 3SD5A 4GTOA 2JABA 2FO1E 4F6RD 4RG6A 3UM0A 3CIAA 3TXNA 2IEJA 1ZB1A 2JLBA 4EZLA 3GZ1A 3BQOA 3LJ3A 1KPSB 5ENOD 2XZDG 3BG0B 3CEQA 2J9QA 3CHSA 2P9NG 3CQCB 4BT8A 3Q79A 3SI5A 3T5VA 4LEUA 3C3QA 3MX3A 4UI9K 3LDZA 4NQ0A 4LNGA 2XPZA 5EIDA 2EQXA 3HYMB 3HXEA 4BESA 4ZFHA 3FTSA 4HNAD 2V8SE 4HLEA 4PS7A 5FZRA 5BW8C 3TWSA 4AVXA 4AIFA 2J4BA 4TUMA 3W9FA 3BUAA 2Y69E 3S7DA 1HZ4A 4L9PA 3FU3A 2H6FA 5M72A 1Z3XA 1EDUA 4L7TA 3EU5A 3QK0A 4O1PA 1EF1C 3SF4A 4ME2A 4APOA 2RKKA 2QYJA 2CHXA 4GTPA 5FIOA 2WMOA 2HR2A 3C98A 2PZIA 1A17A 3QKYA 1KZPA 3CVLA 4JD2G 2YINA 3S7BA 3PVLA 4GYYA 3SQVA 3QJZA 3ULEG 4BY6A 2X6KA 4DX5D 3JCKC 1OUVA 3WXXA 4WWNA 4JHRA 2R03A 3PZ2A 4FU3A 2PNNA 1IQRA 4Y6WA 2LNIA 3E33A 2LSUA 3UXGA 4MS6A 5FQ8A 3CVYA 4LUNU 4DX2A 3UM1A 2XQ0A 4WWOA 5C1DA 1KT0A 4GZCA 4M7CA 5EIBE 4LERA 2WXNA 1FT1A 5G04J 4YVQC 4I1MA 5CECB 5HQ8A 1N52A 2AJAA 4KT6B 2EIKE 3EHNA 4DX1A 5G04C 3ONKA 1L5JA 3FTWA 1BI8B 1ELWA 2LUHA 5AAOA 1JWFA 1E8XA 4GA2A 2OEWA 3AS8A 3S2AA 2H6HA 4JB8P 5H7PA 3SBSA 3PZDA 5A7DB 4TXQA 2MRIA 3UT7A 5CRUA 3JUIA 3Q9NC 4KVMA 1WM5A 4J8DA 4LG6A 4U0ZA 1JCRA 5EN5D 2VYIA 5CRVA 1H6KA 3QWPA 3D9PA 3T5XA 4EBAA 1IHGA 1LD8A 3FFLA 3CR3A 4KZCA 3AS5A 3DSUA 4YDYA 4CCAA 2KZTB 3NOGD 4ANUA 5BXUA 3OXGA 4HLLA 2PM6A 1NFIE 5C2YA 2OEVA 3FH8A 2ETAA 2MOWA 2WXOA 3UMVA 2R17C 3HG0D 3HVEA 3CHRA 4ANWA 3S7JA 1JCQA 3ZEFA 5BV1A 2VSOE 4LSZE 3DRAA 5B3SE 4FJZA 2GRLA 3D9MA 3ZYKA 3TGOA 4R7LA 3E37A 3VTYA 1FVFA 1K8KG 3FU6A 4AP2A 2WXFA 3JXJA 5AARA 3ULQA 2VTBA 2A5UA 2XGMA 2ZGDA 2ZXWE 3IKOB 4RQIA 4RSYA 1OWOA 4HOUA 3OAWA 3SO8A 2ZU6B 3D9HA 4J7WA 3SHFA 3FHEA 3L17A 3CV0A 4GTTA 1SVXA 5KJNA 3EHMA 3ZYLA 1OT8A 2WPVA 1HO8A 2P9IG 2UY1A 3Q7FA 2RG8A 4HORA 1NA0A 3F6QA 3CK9A 2OVFA 3L22A 3TWRA 5BT1A 3ABKE 3FUJA 4NRHB 4JA9A 2XEEA 2EIJE 4BERA 3Q78A 2OOEA 4BFRA 3DPYA 4ATZD 4HVBA 4FULA 3FUIA 2P9UG 4MBGA 3ONLA 4J0UA 1GW6A 2P58C 4LRZA 4L1BA 3BG1B 1H2UA 3DEOA 3AU5A 2XRYA 2GRNB 4JXTA 4HRLA 3R9MA 4A3VA 2ETBA 1UOHA 1FT2A 5FWQA 1HE8A 3JYSA 2L9BA 2V5FA 2GRRB 1SZ9A 5D0OD 3QWVA 3GW4A 4UUCA 1UG3A 5ARFA 3TG5A 1QYMA 4U8VD 4RLYA 3OXFA 3FY4A 5KJKA 3CVWA 1BI7B 4ANVA 4FLBA 2HM8A 3V31A 3UT4A 4C0EA 2DCPA 2VGXA 2Y1LE 2C0LA 3Q5MA 4GTVA 4MKTA 3HRAA 2WVIA 3FUKA 3VTXA 4AXHA 3L13A 3J5QB 2KATA 2ZISA 1TNBA 1RW2A 3L82A 2EILE 1LD7A 4WNDA 5KNHD 4KXKB 2XEHA 2GW1A 2HYZA 5FINA 3HXCA 3ZHEA 2UWJG 5JJ6A 3RO3A 4UQYA 1HF8A 4U0UA 2OVBA 3FUNA 3T8KA 3RJVA
chains in the Genus database with same CATH topology
3CK7A 2J4BA 3FH7A 4WUYA 1EPUA 2OV8A 2UY1B 5KCMA 3APFA 3Q47B 4B8CB 5FZQA 3LKUA 2AXZA 1LF8A 4FC8A 4UI9J 3S7DA 1E7VA 3PE4A 4LCTA 4PS3A 1HZ4A 4UWKA 4APFA 2A4ZA 3FU3A 1INZA 3LEWA 4GCOA 3SGHA 3O4ZA 3Q49B 4BX9A 2IOLA 5M72A 1VDYA 1Z3XA 2E2EA 1HXIA 4G25A 3ZN3A 3GYZA 4PUCA 1QQEA 4G11A 4AEZC 1EDUA 4F3VA 1FVHA 5CMYA 3G2WA 4FLHA 3ASDA 4JZYA 2CG3A 4L7TA 3DBSA 1ELKA 4H7XA 5JJ7A 4KMOA 4YNDA 3QK0A 1E7UA 2M63A 4G23A 1NZNA 3FUHA 3CVPA 1EF1C 4CEMA 2XGSA 3APDA 3BEEA 4A1GA 3SF4A 4ME2A 4IYPA 4APOA 4C0MA 2CFUA 5CHEE 4N2SA 2Y4UA 3IBEA 5AENA 2VJ8A 3D9NA 4CGWA 2CHXA 4U63A 4K0RA 2WMOA 2HR2A 3C98A 2PZIA 4F1SA 3CVXA 4EECA 2YHCA 4FP7A 2VGYA 1NA3A 2QY7A 3KD7A 3ML9A 4NACA 4I6GA 3LYAA 2J09A 1A17A 3QKYA 2FF4A 3ZYQA 4BT9A 3I4RB 3NZUA 2L0IA 3CHMA 3FTZA 3CVLA 2QFCA 4AY6A 2WXQA 4XKBA 2YINA 3S7BA 3PVLA 4A3TA 1MHQA 4JHKA 4HFGA 3EDTB 4JEUA 1JPLA 5DBKA 1Y6IA 4GYYA 3QWWA 3EIJA 3LY9A 4GZ6A 3QC1A 4ACKA 2WXJA 2BTDA 3FTYA 3MZLB 1PC2A 4GMJA 1H0AA 3GZSA 3GZ2A 3L16A 3HVEB 3ASGA 2XHEA 2PQRA 3FU0A 4DLQA 3MYVA 3MV3B 2CFZA 4N3BA 4L2YA 3QJZA 2XEVA 4XX5A 3ZVVA 4BY6A 4N39A 2X6KA 3ML8A 4DLOA 1FCHA 3JCKC 5FQ7A 3U64A 3VLDA 4I43A 3UQ3A 1OUVA 4JA7A 3WXXA 3PDNA 3ZFWA 4WWNA 3D9IA 4JHRA 4U07A 5FT9A 2J49A 1SZAA 4QFVA 4FU3A 4YVOA 3L54A 3B7TA 4FHKA 1IQRA 4UWLA 4Y6WA 2LNIA 2IU1A 2LSUA 3G2TA 1HG5A 5LFAA 1HS6A 4MS6A 5FQ8A 3MKQA 3CVYA 4N3CA 2BUGA 3EIQC 3FUEA 4GMLA 4LUNU 3AU4A 2I2OA 2XQ0A 5KJLA 1OWPA 1H2VC 2WQHA 3KS2A 2KM4A 4K03A 2VTBB 3LVRE 4UWHA 4WWOA 4ANXA 5JHBA 5C1DA 2CHWA 2V0PA 2CHZA 4MRUA 3SNXA 1KT0A 4JC8A 4UWFA 3R9AB 2I1JA 4GZCA 3LY7A 1XNFA 1Z3YA 3CGHA 2C0MA 2J08A 3D3MA 3ASFA 3CHQA 4LERA 2WXNA 5G04J 4YVQC 4RVBA 2VSXE 4I1MA 5CCMA 1UN8A 5T3RA 4Q69A 5HQ8A 1N52A 3PEUB 4KT6B 3FUFA 5EKQD 3FUDA 4ACLA 2X38A 4I2ZA 3EHNA 4N2QA 5G04C 3Q15A 3ZGQA 3ONKA 1L5JA 3FTWA 2I9CA 3RO2A 3PEVB 3ESLA 2RD0A 5AIJA 3MJWA 5EDSA 1ELWA 2XCCA 4PDXA 3CKBA 3TJPA 3PE3A 4XI0A 4ILHB 3ENEA 1S0PA 3DPDA 1UJKA 4WAFA 4F53A 1JWFA 4AM9A 2LAHA 3QNKA 1E8XA 4GA2A 3B7UX 3SBTB 3I5PA 3AS8A 5CMWA 1ZBPA 3S2AA 4NURA 4JW1A 3CHOA 2X3MA 5E76A 3K9IA 1OWLA 2VSYA 5HI7A 3PZDA 3SBSA 3ZRHA 3B7RL 3G2VA 5A7DB 3APCA 1UJJA 2WXIA 4EPZA 2MRIA 2Q7FA 4Q94A 3UT7A 3R7RA 2FI7A 3CKCA 4EZKA 4GA0A 4MLPA 3PH0C 4GCNA 4E6HA 5G2NA 3JUIA 4KVMA 4O6FA 3L08A 3PS6A 2JEKA 3N71A 3QAQA 1WM5A 5LP0A 4HOTA 4U8HA 3CHPA 3CVNA 1HX8A 2C2LA 3O48A 3P2BA 1UW4B 4DI4A 2ONDA 1JWGA 1Z6TA 2FBNA 4J8DA 1E96B 3ZYMA 4B8AA 3U9WA 1YA0A 1OWNA 3CSFA 3PNTB 1JUQA 4GZ3A 5G05J 3CLJA 4GYOA 4XIFA 4U0ZA 3CVVA 4ATGA 4TRQA 2IONA 5DIZA 4J8EA 3S7FA 5T4YA 2FULA 2VQ2A 2XPIA 2VYIA 4I6EA 4OVVA 4I1OB 1ZU2A 4OVUA 4F7AA 5G05C 4FADA 4I17A 1BPOA 1H6KA 1PAQA 3D9JA 4GPKA 5LOZA 4EBAG 3MEKA 2WXKA 4RG9A 3QWPA 3ZIMA 1DNPA 3D9PA 3T5XA 4BTBA 5A6CA 3FU5A 4ABNA 4EBAA 3MCXA 3JQ1A 3IHVA 2GRMA 4I9CA 1IHGA 2PM7A 4Y6CA 2WXRA 4I1AA 4N3AA 3FFLA 3CR3A 3CSTA 3PUKA 4KZCA 3AS5A 1OWMA 1HH8A 3FDHA 4AOFA 3FH5A 4V3IA 5AJDA 4B0ZA 4G2VA 4GB9A 2KZTB 4CCAA 2VGXB 4IN3B 5E75A 1B89A 5ENNA 1EYHA 2L6JA 3LCAA 4ANUA 3OXGA 2WB2A 4XI9A 2PM6A 2XCBA 3FTXA 3QARA 2LSVA 4M3OA 4C9BB 3KEZA 4KVOA 5C2YA 4UQXA 4UWGA 3FH8A 3G2UA 3MKQB 4JHJA 4WNEA 4G26A 1KLXA 1U3DA 2MHKA 2KCKA 2MOWA 4BWRA 2WXOA 1TJFA 3UMVA 2R17C 2J4DA 1QZ2A 3LY8A 3HVEA 3CHRA 2PL2A 4ANWA 1XGWA 2GGFA 1NP7A 3FULA 4PS8A 4L2LA 4OYSA 3RIBA 3S7JA 2WQ6A 4A55A 2VSNA 4GU5A 5JJTA 2FEZA 1H19A 1U3CA 2IJGX 3OXLA 4DI3A 3ZEFA 5BV1A 2CG2A 4JPSA 3RK6A 1HU3A 2VSOE 1UN9A 2DBAA 3FTUA 4A1SA 2IFUA 3OTNA 2I1KA 5ARGA 4GZDA 4WNGA 3SFZA 4ILIA 3ZHEB 1E8YA 3HDXA 3MKRA 5AJLA 5JHAA 4WWPA 3RKVA 4UQZA 4FJZA 2GRLA 3D9MA 3LXUX 2YHEA 5FQ4A 3ZYKA 3ZXSA 3TGOA 4R7LA 5FJYA 3RRMB 4I2WA 3LS8A 3VTYA 1FVFA 4IRUA 2IQCA 3FU6A 3IEGA 1PY1A 2IF4A 4AP2A 4HXIA 2WXPA 4H7YA 2WXFA 2WXHA 2WXLA 1QNFA 3ULQA 2VTBA 4IULA 2A5UA 3ASHA 3HIZA 2XGMA 2XGOA 4U04A 3NF1A 3QDNA 3TL5A 5KJMA 3IKOB 4RSYA 2X6HA 2AWIA 4CRWA 5EX0A 2Y3AA 1OWOA 2KC7A 3LVQE 3OAWA 4HOUA 4I6JA 4JEHA 4N5CA 2ZU6B 3CQGB 3D9KA 5ANLA 3RU0A 1SQMA 3PRZA 4I9EA 3SHFA 5G55A 2R5SA 4AV7A 1HG2A 3FHEA 3G2SA 3VLEA 4E85A 4XE0A 3U3WA 3L17A 1X5BA 3CV0A 4BX8A 3NQPA 4L23A 5FZSA 3NZSA 2R59A 4FJYA 3D9OA 2WM9A 5KJNA 3EHMA 3ZYLA 4CDRA 2WPVA 1HO8A 3Q4AB 1P5QA 1TEZA 2UY1A 5FTPA 1N54A 2RG8A 2Y4TA 3ESKA 4CT0A 5J90A 4HORA 4J8FA 1TJCA 1NA0A 5A23A 2X6JA 3CK9A 3PREA 3R7QA 2HO1A 4UI9C 4FA6A 4URKA 5LCWJ 2OVFA 3IV0A 3L22A 5T8IA 3URZA 5EX3A 2AW6A 2WMNA 2KCVA 4GZ5A 5BT1A 2DIWA 3PNLB 3RRUA 4GA1A 3FUJA 1E90A 4NRHB 4U0SA 3FTVA 4JA9A 3FEXA 5LCWC 3EJNA 3VLFA 4DPRA 1WAO1 1HFAA 1ELRA 2ILRA 2PQNA 2IOSA 2OOEA 4BFRA 4JVSA 2X6IA 3LPZA 4D10C 4HVBA 4FULA 3CVUA 3CVQA 2XRZA 3FUIA 3KAEA 2V4LA 3ONLA 4J0UA 5BNWA 2XPYA 1GW6A 1IQUA 3CK8A 4JL0A 3QB2A 1Y8MA 2P58C 3MV2B 4BTAA 3FWVA 3QOUA 4TUUA 4LRZA 4L1BA 4AJWA 5BUZA 3BG1B 2E0IA 1H2UA 4CT4A 4PH4B 4GYWA 2FO7A 4Q96A 3UPVA 4HOSA 3UX4A 3AU5A 5LX8A 2XRYA 2WQ7A 4XKCA 1MQSA 4B94A 3UUXA 2L0TB 1DVPA 3RRNB 4JXTA 4KBQA 1E8WA 3AS4A 4GAAA 3FP3A 4A3VA 3ZPJA 4BSXA 4J8SA 4B89A 1IYGA 4DJAA 2YNQA 3MGBA 5AYWD 2LO6A 2YQ8A 4KZ0A 4AY5A 3SD5A 2AXUA 5FWQA 1HE8A 3SZ7A 4HS2A 3ZW3A 4EZJA 4RG6A 3CIAA 3TXNA 5FQ6A 2KCLA 3JYSA 2L9BA 2V5FA 4KYOB 2JLBA 1SZ9A 5D0OD 3UT8A 2NSZA 3GW4A 3QWVA 4EZLA 1UG3A 3GZ1A 3LJ3A 4WNFA 4XZ4A 3PUJA 5ARFA 4CDNA 4CDMA 3TG5A 4EQFA 1E8ZA 3BG0B 4HOQA 3CEQA 3FY4A 2J9QA 3OXFA 5KJKA 3CVWA 3CHSA 4ANVA 2LAIA 2HM8A 3CQCB 4FLBA 1W3BA 3UT4A 2AXVA 2NXPA 4BT8A 4C0EA 5J08A 2KZTA 2DCPA 2VGXA 3SI5A 5ANRA 2C0LA 3FUMA 3Q5MA 3T5VA 3I4GA 3FEYA 4MKTA 4J6IA 5BPPA 2J07A 5D0QD 3JQ0A 2WVIA 3FUKA 1WY6A 4LEUA 3VTXA 4AXHA 5BV0A 3I3NA 4G24A 3U4TA 3IHYA 3L13A 4CGVA 2X6FA 3MX3A 3P1UA 1KT1A 2I6HA 4UI9K 3T8MA 3LDZA 4TV3A 4NQ0A 3L6AA 2KATA 2XPZA 2WXGA 2EQXA 4FHJA 3D9LA 3HYMB 3TG4A 3B13A 4WNDA 4ILGA 3U66A 3FTSA 4KXKB 2AVPA 4W9RA 3TAXA 1H2TC 2GW1A 2HYZA 2V8SE 4HLEA 3TXMA 2BF0X 3B7SA 4PS7A 5FZRA 5CCLA 2WXMA 3ZHEA 2UWJG 3E4BA 5JJ6A 3HHMA 3MA5A 5BW8C 4UQYA 3RO3A 4G1TA 2NC9A 4DK5A 1HF8A 4U0UA 2OVBA 4AVXA 4AIFA 4P29A 3FUNA 3RJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK7 A;  4WUY A;  2UY1 B;  3Q47 B;  5FZQ A;  3LKU A;  4UI9 J;  3S7D A;  3PE4 A;  1HZ4 A;  4GCO A;  3Q49 B;  5M72 A;  2E2E A;  1HXI A;  4G25 A;  3ZN3 A;  3GYZ A;  1QQE A;  4F3V A;  3ASD A;  4H7X A;  5JJ7 A;  4YND A;  4G23 A;  1NZN A;  3CVP A;  2XGS A;  3BEE A;  3SF4 A;  4ME2 A;  4APO A;  5CHE E;  4N2S A;  2Y4U A;  4CGW A;  2HR2 A;  2PZI A;  2YHC A;  2VGY A;  1NA3 A;  3KD7 A;  3LYA A;  1A17 A;  3QKY A;  2FF4 A;  4BT9 A;  3CVL A;  2QFC A;  4AY6 A;  3S7B A;  3EDT B;  5DBK A;  4GYY A;  3QWW A;  3LY9 A;  4GZ6 A;  1PC2 A;  3GZ2 A;  3ASG A;  2PQR A;  3MV3 B;  4N3B A;  2XEV A;  4N39 A;  1FCH A;  3UQ3 A;  1OUV A;  4JA7 A;  3WXX A;  3PDN A;  3ZFW A;  4JHR A;  4U07 A;  5FT9 A;  4YVO A;  4Y6W A;  2LNI A;  2LSU A;  4N3C A;  2BUG A;  5KJL A;  3KS2 A;  2WQH A;  5C1D A;  1KT0 A;  3R9A B;  3LY7 A;  1XNF A;  2C0M A;  3ASF A;  5G04 J;  4YVQ C;  5CCM A;  5HQ8 A;  5EKQ D;  4I2Z A;  4N2Q A;  5G04 C;  3Q15 A;  3ZGQ A;  3RO2 A;  1ELW A;  2XCC A;  3CKB A;  3PE3 A;  4XI0 A;  4AM9 A;  4GA2 A;  3AS8 A;  1ZBP A;  3K9I A;  2VSY A;  5HI7 A;  5A7D B;  2Q7F A;  2FI7 A;  3CKC A;  4GA0 A;  4GCN A;  4O6F A;  3N71 A;  4HOT A;  1WM5 A;  3CVN A;  2C2L A;  3O48 A;  2OND A;  2FBN A;  4J8D A;  1E96 B;  1YA0 A;  4GZ3 A;  5G05 J;  4GYO A;  4XIF A;  4U0Z A;  5DIZ A;  4J8E A;  3S7F A;  2XPI A;  2VQ2 A;  2VYI A;  1ZU2 A;  5G05 C;  4I17 A;  4GPK A;  3MEK A;  4RG9 A;  3QWP A;  4BTB A;  5A6C A;  4ABN A;  4I9C A;  1IHG A;  4Y6C A;  4I1A A;  4N3A A;  3FFL A;  3AS5 A;  1HH8 A;  4G2V A;  2VGX B;  4IN3 B;  1B89 A;  2L6J A;  3LCA A;  3OXG A;  4XI9 A;  2XCB A;  2LSV A;  4UQX A;  4WNE A;  4G26 A;  1KLX A;  2MHK A;  2KCK A;  4BWR A;  1QZ2 A;  3LY8 A;  2PL2 A;  3RIB A;  3S7J A;  2VSN A;  5JJT A;  2FEZ A;  3OXL A;  2DBA A;  4A1S A;  2IFU A;  5ARG A;  4WNG A;  3ZHE B;  3MKR A;  3RKV A;  4UQZ A;  3TGO A;  5FJY A;  4I2W A;  3VTY A;  3IEG A;  2IF4 A;  4H7Y A;  3ULQ A;  3ASH A;  2XGM A;  2XGO A;  4U04 A;  3NF1 A;  3QDN A;  5KJM A;  5EX0 A;  2KC7 A;  4HOU A;  4N5C A;  3RU0 A;  4I9E A;  2R5S A;  3U3W A;  3CV0 A;  5FZS A;  5KJN A;  4CDR A;  2WPV A;  3Q4A B;  1P5Q A;  2UY1 A;  5FTP A;  3ESK A;  2Y4T A;  4HOR A;  4J8F A;  1TJC A;  1NA0 A;  3CK9 A;  2HO1 A;  4UI9 C;  5LCW J;  3URZ A;  5EX3 A;  5BT1 A;  2KCV A;  4GZ5 A;  4GA1 A;  4NRH B;  4U0S A;  4JA9 A;  5LCW C;  1WAO 1;  1ELR A;  2PQN A;  2OOE A;  3LPZ A;  3CVQ A;  3KAE A;  4J0U A;  5BNW A;  3CK8 A;  4JL0 A;  1Y8M A;  2P58 C;  3MV2 B;  4BTA A;  3FWV A;  3QOU A;  4GYW A;  2FO7 A;  3UPV A;  4HOS A;  4B94 A;  3UUX A;  4KBQ A;  3AS4 A;  3FP3 A;  3ZPJ A;  1IYG A;  5AYW D;  2YQ8 A;  4AY5 A;  3SZ7 A;  4RG6 A;  2KCL A;  3JYS A;  2V5F A;  4KYO B;  2JLB A;  5D0O D;  3QWV A;  3GW4 A;  3GZ1 A;  4WNF A;  5ARF A;  3TG5 A;  4EQF A;  4HOQ A;  3CEQ A;  3OXF A;  2J9Q A;  5KJK A;  4BT8 A;  1W3B A;  2VGX A;  2C0L A;  3Q5M A;  5D0Q D;  4LEU A;  3VTX A;  4G24 A;  3U4T A;  4CGV A;  1KT1 A;  2I6H A;  4UI9 K;  4NQ0 A;  2KAT A;  3HYM B;  3TG4 A;  4WND A;  4KXK B;  2AVP A;  4W9R A;  3TAX A;  2GW1 A;  2HYZ A;  5FZR A;  5CCL A;  3ZHE A;  2UWJ G;  3E4B A;  5JJ6 A;  3MA5 A;  5BW8 C;  3RO3 A;  4UQY A;  4G1T A;  2NC9 A;  4U0U A;  4AIF A;  3RJV A; 
#chains in the Genus database with same CATH topology
 4WUY A;  2OV8 A;  2UY1 B;  3T9K A;  4HB5 A;  3APF A;  5FZQ A;  3LKU A;  1AWC B;  1E7V A;  4APF A;  1INZ A;  3LEW A;  2IOL A;  5B1A E;  1VDY A;  1HXI A;  3ZN3 A;  4PUC A;  5HKP A;  1FVH A;  5CMY A;  1V54 E;  4JZY A;  2CG3 A;  3DBS A;  4KMO A;  1IKN D;  4YND A;  2P9K G;  1NZN A;  3FUH A;  1TN7 A;  3ASN E;  4CEM A;  2XGS A;  3BEE A;  1TNU A;  3UKR G;  4N2S A;  2Y4U A;  3D9N A;  4EEC A;  2YHC A;  3ML9 A;  2XZT G;  3I4R B;  3NZU A;  1D8E A;  2QFC A;  5BXO A;  4AY6 A;  2WXQ A;  1MHQ A;  4JHK A;  4JEU A;  3EDT B;  1JPL A;  3QWW A;  3EIJ A;  4ACK A;  2WXJ A;  4GTR A;  2VGE A;  2XHE A;  2PQR A;  3FU0 A;  4DLQ A;  4L2Y A;  2XEV A;  4XX5 A;  3ZVV A;  4N39 A;  1D8D A;  1FCH A;  3VLD A;  3UQ3 A;  5HRY A;  4OAV B;  4O60 A;  3V79 K;  3D9I A;  5CBN A;  5FT9 A;  2J49 A;  1SZA A;  3B7T A;  3ASO E;  1HG5 A;  5LFA A;  3HXB A;  1HS6 A;  3DXM G;  3BU8 A;  1DC2 A;  1OWP A;  2KM4 A;  2CHW A;  3SNX A;  4UWF A;  1G3N B;  2I1J A;  1N4R A;  1SW6 A;  2NYJ A;  1Z3Y A;  1MZC A;  3IXE A;  3ZU7 B;  4U7E B;  2R02 A;  4I2Z A;  4N2Q A;  3Q15 A;  1SA5 A;  4GMR A;  5AIJ A;  3MJW A;  4NIK A;  4XI0 A;  1S0P A;  5KBA A;  3QNK A;  3I5P A;  5CMW A;  3CHO A;  1OWL A;  2Q7F A;  4Q94 A;  3R7R A;  4EZK A;  4GA0 A;  4X8Q A;  2V5Q C;  4MLP A;  5G2N A;  4O6F A;  3L08 A;  3PS6 A;  3N71 A;  3QAQ A;  5LP0 A;  4YDE A;  3AG4 E;  4U8H A;  3CVN A;  2C2L A;  3ZNG A;  4DI4 A;  1JWG A;  1Z6T A;  1E96 B;  3ZYM A;  3U9W A;  1OWN A;  1JUQ A;  3UIP C;  4BSZ B;  3CLJ A;  4ATG A;  4TRQ A;  5ENS D;  5DIZ A;  4J8E A;  3S7F A;  1QBQ A;  2XPI A;  4OVU A;  1ZU2 A;  4FAD A;  2H6I A;  3ZIM A;  1DNP A;  5A6C A;  4ABN A;  2PM7 A;  4Y6C A;  3UIO C;  3SFX A;  4G8K A;  3W9G A;  1OWM A;  3FDH A;  3FH5 A;  4B0Z A;  4GB9 A;  1N0Q A;  1MX2 A;  5ENN A;  2R05 A;  2WB2 A;  3FTX A;  4HRM B;  4M3O A;  4BEP A;  1IHB A;  3DXK G;  3G2U A;  4G8L A;  4WNE A;  4BWR A;  1TJF A;  2J4D A;  1YYH A;  5IY5 E;  4PS8 A;  4L2L A;  2WQ6 A;  2IJG X;  4DI3 A;  4JPS A;  2EIM E;  1UN9 A;  3FTU A;  4CZ2 D;  4U8Y D;  3MKR A;  3RSE G;  4WWP A;  5EYL A;  2DZN A;  3ZXS A;  4IRU A;  2LXM A;  5EX0 A;  2Y3A A;  4I6J A;  1N9A A;  3D9K A;  3CQG B;  1K1A A;  3PRZ A;  4I9E A;  1RZ4 A;  4E85 A;  3VLE A;  1N4P A;  4L23 A;  4CDR A;  3Q4A B;  1P5Q A;  4K5A B;  4J8F A;  5A23 A;  3NOC D;  3PRE A;  2HO1 A;  4UI9 C;  1Q2Z A;  5LCW J;  3ZXP A;  5T8I A;  3URZ A;  5EX3 A;  4GZ5 A;  3PNL B;  3DEP A;  3FTV A;  5LCW C;  4C48 B;  2R2L A;  2XS8 A;  1HFA A;  4JVS A;  3CVU A;  2XRZ A;  3KAE A;  2Y0B G;  3ULY A;  1IQU A;  4JL0 A;  3QB2 A;  3SY2 A;  1Y8M A;  5B1B E;  3FWV A;  2E0I A;  4CT4 A;  4Q96 A;  5D2M C;  4HOS A;  2WQ7 A;  1MQS A;  4B94 A;  3RRN B;  3KEA A;  1E8W A;  2MYO A;  4BSX A;  2YQ8 A;  4KZ0 A;  4EZJ A;  5FQ6 A;  1WDY A;  2NSZ A;  4WNF A;  4XZ4 A;  4CDN A;  4CDM A;  4GPM A;  4EQF A;  1E8Z A;  4HOQ A;  4QQI A;  1W3B A;  2NXP A;  3C3R A;  3DWL G;  1K1B A;  5ANR A;  1MX6 A;  5BPP A;  2J07 A;  5JMN D;  5BV0 A;  1OY3 D;  1WY6 A;  4G24 A;  4GTS A;  3U4T A;  4CGV A;  1X81 A;  4U95 D;  2X6F A;  2ZIR A;  2I6H A;  5AQB A;  4TXR A;  1N11 A;  4FHJ A;  3B13 A;  4ILG A;  3C5R A;  3TXM A;  2BF0 X;  5CCL A;  3E4B A;  3MA5 A;  3E34 A;  4G1T A;  1OCC E;  4DK5 A;  3RAU A;  3DSV A;  4P29 A;  1TNO A;  3CK7 A;  1EPU A;  5KCM A;  4ZHB A;  4B8C B;  3AAA C;  4LCT A;  4PS3 A;  4UWK A;  4GCO A;  3O4Z A;  3Q49 B;  2EIN E;  4G11 A;  2OCC E;  4FLH A;  2GRQ B;  1E7U A;  2M63 A;  3CVP A;  3ZUV B;  4C0M A;  1O1R A;  4K0R A;  3CVX A;  4FP7 A;  2VGY A;  3KD7 A;  3UIN C;  4NAC A;  4I6G A;  3LYA A;  1BLX B;  5ENR D;  4BT9 A;  3TWW A;  1TNY A;  4XKB A;  4U96 D;  3E32 A;  2QZA A;  1Y6I A;  3B7B A;  4GZ6 A;  4LNB A;  3NAW A;  2DYS E;  3FTY A;  4GMJ A;  2GRP B;  1PC2 A;  1H0A A;  3L16 A;  3HVE B;  4HBD A;  1TN8 A;  3C3O A;  2CFZ A;  4N3B A;  3Q7A A;  5ENP D;  2QC9 A;  4GTQ A;  5FQ7 A;  4I43 A;  5CER B;  4JA7 A;  4GTM A;  5AQA A;  4QFV A;  4UWL A;  4N3C A;  2BUG A;  3EIQ C;  3FUE A;  5KJL A;  1H2V C;  2DYR E;  1KZO A;  2VTB B;  3LVR E;  3L9T A;  5JHB A;  1H6O A;  2V0P A;  1SA4 A;  2BKG A;  3LY7 A;  3KSL A;  1D9S A;  3ASF A;  3CHQ A;  2QYU A;  4RVB A;  2VSX E;  5T3R A;  4Q69 A;  3PEU B;  5EKQ D;  3FUF A;  3AG2 E;  3ISM C;  3ZGQ A;  1MYO A;  2I9C A;  2HE0 A;  3RO2 A;  3PEV B;  3ESL A;  4PDX A;  3CKB A;  3TJP A;  3NB2 A;  1UJK A;  4WAF A;  4F53 A;  4AM9 A;  2LAH A;  3SBT B;  1ZBP A;  1OCR E;  4NUR A;  4JW1 A;  1U2V G;  2X3M A;  3SFY A;  1MJ0 A;  2VSY A;  5HI7 A;  3B7R L;  3UI2 A;  5ENT D;  3CKC A;  3PH0 C;  4GCN A;  3V30 A;  3CHP A;  4BET A;  3P2B A;  2OND A;  3UKU G;  4B8A A;  3CSF A;  2DZO A;  2IO2 C;  4GYO A;  3DST A;  4K5C A;  5T4Y A;  2VQ2 A;  4I1O B;  4F7A A;  4CYM D;  3D9J A;  4GPK A;  4EBA G;  3MEK A;  3PZ1 A;  4BTB A;  3FU5 A;  4F1P A;  3TWV A;  4I9C A;  4I1A A;  4N3A A;  4O1O A;  3CST A;  4K5B A;  1HH8 A;  4V3I A;  5AJD A;  2VGX B;  5HS0 A;  1EYH A;  2RFA A;  4XI9 A;  2LSV A;  2V4H C;  5ITZ F;  4UQX A;  4G26 A;  3NBN B;  3KSQ A;  2PL2 A;  1XGW A;  1NP7 A;  2L6B A;  4OYS A;  3RIB A;  4DRX E;  5JJT A;  2FEZ A;  3X2Q E;  1H19 A;  3OXL A;  3RK6 A;  1HU3 A;  3V2X A;  1BD8 A;  4A1S A;  3OTN A;  4GZD A;  4EHM A;  3ZHE B;  1IXV A;  2P9P G;  5AJL A;  5JHA A;  3RKV A;  3LXU X;  2YHE A;  5FQ4 A;  2IO3 C;  3RRM B;  1LTX A;  3AG3 E;  5AQ7 A;  3Q73 A;  1O1T A;  4HXI A;  2WXP A;  1QNF A;  3HIZ A;  2B6C A;  3QDN A;  5KJM A;  2X6H A;  2KBX A;  1TR4 A;  4DX7 D;  3LVQ E;  4JEH A;  4N5C A;  1S63 A;  5ANL A;  1SQM A;  3B95 A;  5EIL A;  5G55 A;  3G2S A;  4XE0 A;  3NQP A;  4XEI G;  2R59 A;  3D9O A;  2F8X K;  1TEZ A;  5FTP A;  1N54 A;  3ESK A;  4CT0 A;  1TJC A;  3R7Q A;  2H6G A;  5EYP F;  1K3Z D;  5AQ9 A;  2B0O E;  2AW6 A;  2WMN A;  2DIW A;  3RRU A;  4GA1 A;  1E90 A;  4U0S A;  3FEX A;  3VLF A;  3EHR A;  4DPR A;  1WAO 1;  1ELR A;  2X6I A;  4LNU D;  1OCZ E;  5BNW A;  2KXP C;  2P9L G;  3MV2 B;  4TUU A;  4AJW A;  2GRO B;  1N4Q A;  5CEA A;  3UPV A;  1DCE A;  4XKC A;  3UUX A;  3Q75 A;  3JUE A;  1DVP A;  4KBQ A;  3AS4 A;  4GAA A;  3V2O A;  3ZPJ A;  4J8S A;  3E30 A;  1IYG A;  4DJA A;  2YNQ A;  2LO6 A;  4AY5 A;  2AXU A;  3SZ7 A;  4HS2 A;  3ZW3 A;  1YMP A;  2KCL A;  2P2C P;  4KYO B;  3UM3 A;  3UT8 A;  3PUJ A;  2LAI A;  1N0R A;  2AXV A;  5J08 A;  2A5E A;  2KZT A;  3J5P A;  3FUM A;  1O5M A;  3I4G A;  3FEY A;  4J6I A;  5D0Q D;  3JQ0 A;  3I3N A;  1WG0 A;  1NL4 A;  3IHY A;  3P1U A;  5AN8 A;  1KT1 A;  3T8M A;  4TV3 A;  4DUI A;  3L6A A;  2WXG A;  3Q9U C;  3D9L A;  3TG4 A;  1O1S A;  3U66 A;  1Z5S C;  2AVP A;  4W9R A;  3TAX A;  1H2T C;  3B7S A;  2DWZ A;  2WXM A;  2BKK B;  3HHM A;  2NC9 A;  1N4S A;  2XS1 A;  3FH7 A;  3EUV A;  3Q47 B;  2AXZ A;  1LF8 A;  4FC8 A;  4UI9 J;  3PE4 A;  2A4Z A;  5KNG A;  3SGH A;  4BX9 A;  1NI1 A;  2XEN A;  2E2E A;  4G25 A;  2LXL A;  3GYZ A;  1QQE A;  4AEZ C;  2ZGG A;  1TNZ A;  2J8S D;  4F3V A;  3G2W A;  3ASD A;  3AG1 E;  1ELK A;  4H7X A;  5JJ7 A;  5CED B;  4G23 A;  3APD A;  3TWT A;  4A1G A;  4IYP A;  2CFU A;  5CHE E;  3IBE A;  4HQD A;  5AEN A;  2VJ8 A;  4CGW A;  4U63 A;  1S70 B;  4F1S A;  1NA3 A;  2QY7 A;  4DX6 D;  3AJI A;  3DSS A;  2J09 A;  3PZ3 A;  3ZYQ A;  2FF4 A;  2L0I A;  3CHM A;  3FTZ A;  3EU9 A;  1YCS B;  4A3T A;  4HFG A;  5DBK A;  3LY9 A;  3QC1 A;  2BTD A;  3MZL B;  3GZS A;  3GZ2 A;  3WG7 E;  3ASG A;  4TXP A;  3TWU A;  3MYV A;  3JXI A;  3MV3 B;  3ML8 A;  4DLO A;  3U64 A;  1JCS A;  3PDN A;  3ZFW A;  4HRN A;  4U07 A;  1OCO E;  3TWQ A;  4YVO A;  3L54 A;  4FHK A;  2IU1 A;  3G2T A;  3MKQ A;  4GML A;  3HXF A;  3AU4 A;  2I2O A;  2WQH A;  3KS2 A;  2F8Y A;  4K03 A;  4UWH A;  4ANX A;  2CHZ A;  4MRU A;  4HI8 A;  4JC8 A;  3R9A B;  1XNF A;  3CGH A;  2C0M A;  1MX4 A;  2J08 A;  3D3M A;  2F37 A;  3DSX A;  5CCM A;  1UN8 A;  4ACL A;  3FUD A;  2X38 A;  1TN6 A;  1V55 E;  2RD0 A;  5EDS A;  2XCC A;  3PE3 A;  4ILH B;  3ENE A;  1DCQ A;  3DPD A;  1OXJ A;  3B7U X;  1S64 A;  5E76 A;  3K9I A;  3ZRH A;  3G2V A;  3APC A;  1UJJ A;  2RFM A;  2WXI A;  2IY0 C;  4EPZ A;  2FI7 A;  4E6H A;  2JEK A;  4HOT A;  4OAU C;  1HX8 A;  3O48 A;  3PZ4 A;  1UW4 B;  3ABL E;  2FBN A;  1N95 A;  1YA0 A;  3PNT B;  4GZ3 A;  5G05 J;  4XIF A;  3CVV A;  2ION A;  1N94 A;  2FUL A;  4I6E A;  1BU9 A;  4OVV A;  5D66 A;  5G05 C;  4I17 A;  1BPO A;  1PAQ A;  5KWD A;  3UTM A;  5LOZ A;  2WXK A;  4RG9 A;  2DVW A;  3MCX A;  3JQ1 A;  3IHV A;  2GRM A;  2WXR A;  3C72 A;  3PUK A;  2P9S G;  4AOF A;  4G2V A;  4IN3 B;  5E75 A;  1B89 A;  1A5E A;  2L6J A;  3LCA A;  3ZKJ A;  4N5Q A;  2XCB A;  3QAR A;  4C9B B;  3KEZ A;  4KVO A;  4UWG A;  3MKQ B;  4JHJ A;  1KLX A;  1U3D A;  2MHK A;  2KCK A;  1QZ2 A;  3LY8 A;  1H6P A;  4Z68 A;  2GGF A;  3FUL A;  4A55 A;  2VSN A;  4GU5 A;  1TYQ G;  5ENQ D;  1U3C A;  2CG2 A;  2DBA A;  2IFU A;  2I1K A;  5ARG A;  4WNG A;  3SFZ A;  4ILI A;  2F0Y A;  1E8Y A;  3HDX A;  4UQZ A;  3ABM E;  5JA4 D;  5FJY A;  4I2W A;  3LS8 A;  2IQC A;  3IEG A;  3UM2 A;  1PY1 A;  2IF4 A;  4A63 B;  4H7Y A;  2WXH A;  4YDO A;  2WXL A;  4IUL A;  3ASH A;  2XGO A;  4U04 A;  3NF1 A;  3TL5 A;  2AWI A;  4CRW A;  2KC7 A;  2BED A;  3RU0 A;  4J8Y A;  3HXD A;  2R5S A;  4AV7 A;  1HG2 A;  1AP7 A;  3U3W A;  3LJN A;  1X5B A;  4BX8 A;  5FZS A;  3NZS A;  4FJY A;  2WM9 A;  3DSW A;  5CBO A;  3TWX A;  2Y4T A;  5J90 A;  2X6J A;  4URK A;  4FA6 A;  3IV0 A;  4HI9 A;  2KCV A;  4YDW A;  3EJN A;  2ILR A;  2PQN A;  2IOS A;  3EHQ A;  3LPZ A;  4D10 C;  3CVQ A;  4B93 B;  2V4L A;  2XPY A;  3CK8 A;  4BTA A;  3QOU A;  5BUZ A;  4PH4 B;  4GYW A;  2FO7 A;  3UX4 A;  5LX8 A;  2L0T B;  3FP3 A;  2ETC A;  4B89 A;  5AYW D;  3MGB A;  1FPP A;  3SD5 A;  4GTO A;  2JAB A;  2FO1 E;  4F6R D;  4RG6 A;  3UM0 A;  3CIA A;  3TXN A;  2IEJ A;  1ZB1 A;  2JLB A;  4EZL A;  3GZ1 A;  3BQO A;  3LJ3 A;  1KPS B;  5ENO D;  2XZD G;  3BG0 B;  3CEQ A;  2J9Q A;  3CHS A;  2P9N G;  3CQC B;  4BT8 A;  3Q79 A;  3SI5 A;  3T5V A;  4LEU A;  3C3Q A;  3MX3 A;  4UI9 K;  3LDZ A;  4NQ0 A;  4LNG A;  2XPZ A;  5EID A;  2EQX A;  3HYM B;  3HXE A;  4BES A;  4ZFH A;  3FTS A;  4HNA D;  2V8S E;  4HLE A;  4PS7 A;  5FZR A;  5BW8 C;  3TWS A;  4AVX A;  4AIF A;  2J4B A;  4TUM A;  3W9F A;  3BUA A;  2Y69 E;  3S7D A;  1HZ4 A;  4L9P A;  3FU3 A;  2H6F A;  5M72 A;  1Z3X A;  1EDU A;  4L7T A;  3EU5 A;  3QK0 A;  4O1P A;  1EF1 C;  3SF4 A;  4ME2 A;  4APO A;  2RKK A;  2QYJ A;  2CHX A;  4GTP A;  5FIO A;  2WMO A;  2HR2 A;  3C98 A;  2PZI A;  1A17 A;  3QKY A;  1KZP A;  3CVL A;  4JD2 G;  2YIN A;  3S7B A;  3PVL A;  4GYY A;  3SQV A;  3QJZ A;  3ULE G;  4BY6 A;  2X6K A;  4DX5 D;  3JCK C;  1OUV A;  3WXX A;  4WWN A;  4JHR A;  2R03 A;  3PZ2 A;  4FU3 A;  2PNN A;  1IQR A;  4Y6W A;  2LNI A;  3E33 A;  2LSU A;  3UXG A;  4MS6 A;  5FQ8 A;  3CVY A;  4LUN U;  4DX2 A;  3UM1 A;  2XQ0 A;  4WWO A;  5C1D A;  1KT0 A;  4GZC A;  4M7C A;  5EIB E;  4LER A;  2WXN A;  1FT1 A;  5G04 J;  4YVQ C;  4I1M A;  5CEC B;  5HQ8 A;  1N52 A;  2AJA A;  4KT6 B;  2EIK E;  3EHN A;  4DX1 A;  5G04 C;  3ONK A;  1L5J A;  3FTW A;  1BI8 B;  1ELW A;  2LUH A;  5AAO A;  1JWF A;  1E8X A;  4GA2 A;  2OEW A;  3AS8 A;  3S2A A;  2H6H A;  4JB8 P;  5H7P A;  3SBS A;  3PZD A;  5A7D B;  4TXQ A;  2MRI A;  3UT7 A;  5CRU A;  3JUI A;  3Q9N C;  4KVM A;  1WM5 A;  4J8D A;  4LG6 A;  4U0Z A;  1JCR A;  5EN5 D;  2VYI A;  5CRV A;  1H6K A;  3QWP A;  3D9P A;  3T5X A;  4EBA A;  1IHG A;  1LD8 A;  3FFL A;  3CR3 A;  4KZC A;  3AS5 A;  3DSU A;  4YDY A;  4CCA A;  2KZT B;  3NOG D;  4ANU A;  5BXU A;  3OXG A;  4HLL A;  2PM6 A;  1NFI E;  5C2Y A;  2OEV A;  3FH8 A;  2ETA A;  2MOW A;  2WXO A;  3UMV A;  2R17 C;  3HG0 D;  3HVE A;  3CHR A;  4ANW A;  3S7J A;  1JCQ A;  3ZEF A;  5BV1 A;  2VSO E;  4LSZ E;  3DRA A;  5B3S E;  4FJZ A;  2GRL A;  3D9M A;  3ZYK A;  3TGO A;  4R7L A;  3E37 A;  3VTY A;  1FVF A;  1K8K G;  3FU6 A;  4AP2 A;  2WXF A;  3JXJ A;  5AAR A;  3ULQ A;  2VTB A;  2A5U A;  2XGM A;  2ZGD A;  2ZXW E;  3IKO B;  4RQI A;  4RSY A;  1OWO A;  4HOU A;  3OAW A;  3SO8 A;  2ZU6 B;  3D9H A;  4J7W A;  3SHF A;  3FHE A;  3L17 A;  3CV0 A;  4GTT A;  1SVX A;  5KJN A;  3EHM A;  3ZYL A;  1OT8 A;  2WPV A;  1HO8 A;  2P9I G;  2UY1 A;  3Q7F A;  2RG8 A;  4HOR A;  1NA0 A;  3F6Q A;  3CK9 A;  2OVF A;  3L22 A;  3TWR A;  5BT1 A;  3ABK E;  3FUJ A;  4NRH B;  4JA9 A;  2XEE A;  2EIJ E;  4BER A;  3Q78 A;  2OOE A;  4BFR A;  3DPY A;  4ATZ D;  4HVB A;  4FUL A;  3FUI A;  2P9U G;  4MBG A;  3ONL A;  4J0U A;  1GW6 A;  2P58 C;  4LRZ A;  4L1B A;  3BG1 B;  1H2U A;  3DEO A;  3AU5 A;  2XRY A;  2GRN B;  4JXT A;  4HRL A;  3R9M A;  4A3V A;  2ETB A;  1UOH A;  1FT2 A;  5FWQ A;  1HE8 A;  3JYS A;  2L9B A;  2V5F A;  2GRR B;  1SZ9 A;  5D0O D;  3QWV A;  3GW4 A;  4UUC A;  1UG3 A;  5ARF A;  3TG5 A;  1QYM A;  4U8V D;  4RLY A;  3OXF A;  3FY4 A;  5KJK A;  3CVW A;  1BI7 B;  4ANV A;  4FLB A;  2HM8 A;  3V31 A;  3UT4 A;  4C0E A;  2DCP A;  2VGX A;  2Y1L E;  2C0L A;  3Q5M A;  4GTV A;  4MKT A;  3HRA A;  2WVI A;  3FUK A;  3VTX A;  4AXH A;  3L13 A;  3J5Q B;  2KAT A;  2ZIS A;  1TNB A;  1RW2 A;  3L82 A;  2EIL E;  1LD7 A;  4WND A;  5KNH D;  4KXK B;  2XEH A;  2GW1 A;  2HYZ A;  5FIN A;  3HXC A;  3ZHE A;  2UWJ G;  5JJ6 A;  3RO3 A;  4UQY A;  1HF8 A;  4U0U A;  2OVB A;  3FUN A;  3T8K A;  3RJV A; 
#chains in the Genus database with same CATH homology
 3CK7 A;  2J4B A;  3FH7 A;  4WUY A;  1EPU A;  2OV8 A;  2UY1 B;  5KCM A;  3APF A;  3Q47 B;  4B8C B;  5FZQ A;  3LKU A;  2AXZ A;  1LF8 A;  4FC8 A;  4UI9 J;  3S7D A;  1E7V A;  3PE4 A;  4LCT A;  4PS3 A;  1HZ4 A;  4UWK A;  4APF A;  2A4Z A;  3FU3 A;  1INZ A;  3LEW A;  4GCO A;  3SGH A;  3O4Z A;  3Q49 B;  4BX9 A;  2IOL A;  5M72 A;  1VDY A;  1Z3X A;  2E2E A;  1HXI A;  4G25 A;  3ZN3 A;  3GYZ A;  4PUC A;  1QQE A;  4G11 A;  4AEZ C;  1EDU A;  4F3V A;  1FVH A;  5CMY A;  3G2W A;  4FLH A;  3ASD A;  4JZY A;  2CG3 A;  4L7T A;  3DBS A;  1ELK A;  4H7X A;  5JJ7 A;  4KMO A;  4YND A;  3QK0 A;  1E7U A;  2M63 A;  4G23 A;  1NZN A;  3FUH A;  3CVP A;  1EF1 C;  4CEM A;  2XGS A;  3APD A;  3BEE A;  4A1G A;  3SF4 A;  4ME2 A;  4IYP A;  4APO A;  4C0M A;  2CFU A;  5CHE E;  4N2S A;  2Y4U A;  3IBE A;  5AEN A;  2VJ8 A;  3D9N A;  4CGW A;  2CHX A;  4U63 A;  4K0R A;  2WMO A;  2HR2 A;  3C98 A;  2PZI A;  4F1S A;  3CVX A;  4EEC A;  2YHC A;  4FP7 A;  2VGY A;  1NA3 A;  2QY7 A;  3KD7 A;  3ML9 A;  4NAC A;  4I6G A;  3LYA A;  2J09 A;  1A17 A;  3QKY A;  2FF4 A;  3ZYQ A;  4BT9 A;  3I4R B;  3NZU A;  2L0I A;  3CHM A;  3FTZ A;  3CVL A;  2QFC A;  4AY6 A;  2WXQ A;  4XKB A;  2YIN A;  3S7B A;  3PVL A;  4A3T A;  1MHQ A;  4JHK A;  4HFG A;  3EDT B;  4JEU A;  1JPL A;  5DBK A;  1Y6I A;  4GYY A;  3QWW A;  3EIJ A;  3LY9 A;  4GZ6 A;  3QC1 A;  4ACK A;  2WXJ A;  2BTD A;  3FTY A;  3MZL B;  1PC2 A;  4GMJ A;  1H0A A;  3GZS A;  3GZ2 A;  3L16 A;  3HVE B;  3ASG A;  2XHE A;  2PQR A;  3FU0 A;  4DLQ A;  3MYV A;  3MV3 B;  2CFZ A;  4N3B A;  4L2Y A;  3QJZ A;  2XEV A;  4XX5 A;  3ZVV A;  4BY6 A;  4N39 A;  2X6K A;  3ML8 A;  4DLO A;  1FCH A;  3JCK C;  5FQ7 A;  3U64 A;  3VLD A;  4I43 A;  3UQ3 A;  1OUV A;  4JA7 A;  3WXX A;  3PDN A;  3ZFW A;  4WWN A;  3D9I A;  4JHR A;  4U07 A;  5FT9 A;  2J49 A;  1SZA A;  4QFV A;  4FU3 A;  4YVO A;  3L54 A;  3B7T A;  4FHK A;  1IQR A;  4UWL A;  4Y6W A;  2LNI A;  2IU1 A;  2LSU A;  3G2T A;  1HG5 A;  5LFA A;  1HS6 A;  4MS6 A;  5FQ8 A;  3MKQ A;  3CVY A;  4N3C A;  2BUG A;  3EIQ C;  3FUE A;  4GML A;  4LUN U;  3AU4 A;  2I2O A;  2XQ0 A;  5KJL A;  1OWP A;  1H2V C;  2WQH A;  3KS2 A;  2KM4 A;  4K03 A;  2VTB B;  3LVR E;  4UWH A;  4WWO A;  4ANX A;  5JHB A;  5C1D A;  2CHW A;  2V0P A;  2CHZ A;  4MRU A;  3SNX A;  1KT0 A;  4JC8 A;  4UWF A;  3R9A B;  2I1J A;  4GZC A;  3LY7 A;  1XNF A;  1Z3Y A;  3CGH A;  2C0M A;  2J08 A;  3D3M A;  3ASF A;  3CHQ A;  4LER A;  2WXN A;  5G04 J;  4YVQ C;  4RVB A;  2VSX E;  4I1M A;  5CCM A;  1UN8 A;  5T3R A;  4Q69 A;  5HQ8 A;  1N52 A;  3PEU B;  4KT6 B;  3FUF A;  5EKQ D;  3FUD A;  4ACL A;  2X38 A;  4I2Z A;  3EHN A;  4N2Q A;  5G04 C;  3Q15 A;  3ZGQ A;  3ONK A;  1L5J A;  3FTW A;  2I9C A;  3RO2 A;  3PEV B;  3ESL A;  2RD0 A;  5AIJ A;  3MJW A;  5EDS A;  1ELW A;  2XCC A;  4PDX A;  3CKB A;  3TJP A;  3PE3 A;  4XI0 A;  4ILH B;  3ENE A;  1S0P A;  3DPD A;  1UJK A;  4WAF A;  4F53 A;  1JWF A;  4AM9 A;  2LAH A;  3QNK A;  1E8X A;  4GA2 A;  3B7U X;  3SBT B;  3I5P A;  3AS8 A;  5CMW A;  1ZBP A;  3S2A A;  4NUR A;  4JW1 A;  3CHO A;  2X3M A;  5E76 A;  3K9I A;  1OWL A;  2VSY A;  5HI7 A;  3PZD A;  3SBS A;  3ZRH A;  3B7R L;  3G2V A;  5A7D B;  3APC A;  1UJJ A;  2WXI A;  4EPZ A;  2MRI A;  2Q7F A;  4Q94 A;  3UT7 A;  3R7R A;  2FI7 A;  3CKC A;  4EZK A;  4GA0 A;  4MLP A;  3PH0 C;  4GCN A;  4E6H A;  5G2N A;  3JUI A;  4KVM A;  4O6F A;  3L08 A;  3PS6 A;  2JEK A;  3N71 A;  3QAQ A;  1WM5 A;  5LP0 A;  4HOT A;  4U8H A;  3CHP A;  3CVN A;  1HX8 A;  2C2L A;  3O48 A;  3P2B A;  1UW4 B;  4DI4 A;  2OND A;  1JWG A;  1Z6T A;  2FBN A;  4J8D A;  1E96 B;  3ZYM A;  4B8A A;  3U9W A;  1YA0 A;  1OWN A;  3CSF A;  3PNT B;  1JUQ A;  4GZ3 A;  5G05 J;  3CLJ A;  4GYO A;  4XIF A;  4U0Z A;  3CVV A;  4ATG A;  4TRQ A;  2ION A;  5DIZ A;  4J8E A;  3S7F A;  5T4Y A;  2FUL A;  2VQ2 A;  2XPI A;  2VYI A;  4I6E A;  4OVV A;  4I1O B;  1ZU2 A;  4OVU A;  4F7A A;  5G05 C;  4FAD A;  4I17 A;  1BPO A;  1H6K A;  1PAQ A;  3D9J A;  4GPK A;  5LOZ A;  4EBA G;  3MEK A;  2WXK A;  4RG9 A;  3QWP A;  3ZIM A;  1DNP A;  3D9P A;  3T5X A;  4BTB A;  5A6C A;  3FU5 A;  4ABN A;  4EBA A;  3MCX A;  3JQ1 A;  3IHV A;  2GRM A;  4I9C A;  1IHG A;  2PM7 A;  4Y6C A;  2WXR A;  4I1A A;  4N3A A;  3FFL A;  3CR3 A;  3CST A;  3PUK A;  4KZC A;  3AS5 A;  1OWM A;  1HH8 A;  3FDH A;  4AOF A;  3FH5 A;  4V3I A;  5AJD A;  4B0Z A;  4G2V A;  4GB9 A;  2KZT B;  4CCA A;  2VGX B;  4IN3 B;  5E75 A;  1B89 A;  5ENN A;  1EYH A;  2L6J A;  3LCA A;  4ANU A;  3OXG A;  2WB2 A;  4XI9 A;  2PM6 A;  2XCB A;  3FTX A;  3QAR A;  2LSV A;  4M3O A;  4C9B B;  3KEZ A;  4KVO A;  5C2Y A;  4UQX A;  4UWG A;  3FH8 A;  3G2U A;  3MKQ B;  4JHJ A;  4WNE A;  4G26 A;  1KLX A;  1U3D A;  2MHK A;  2KCK A;  2MOW A;  4BWR A;  2WXO A;  1TJF A;  3UMV A;  2R17 C;  2J4D A;  1QZ2 A;  3LY8 A;  3HVE A;  3CHR A;  2PL2 A;  4ANW A;  1XGW A;  2GGF A;  1NP7 A;  3FUL A;  4PS8 A;  4L2L A;  4OYS A;  3RIB A;  3S7J A;  2WQ6 A;  4A55 A;  2VSN A;  4GU5 A;  5JJT A;  2FEZ A;  1H19 A;  1U3C A;  2IJG X;  3OXL A;  4DI3 A;  3ZEF A;  5BV1 A;  2CG2 A;  4JPS A;  3RK6 A;  1HU3 A;  2VSO E;  1UN9 A;  2DBA A;  3FTU A;  4A1S A;  2IFU A;  3OTN A;  2I1K A;  5ARG A;  4GZD A;  4WNG A;  3SFZ A;  4ILI A;  3ZHE B;  1E8Y A;  3HDX A;  3MKR A;  5AJL A;  5JHA A;  4WWP A;  3RKV A;  4UQZ A;  4FJZ A;  2GRL A;  3D9M A;  3LXU X;  2YHE A;  5FQ4 A;  3ZYK A;  3ZXS A;  3TGO A;  4R7L A;  5FJY A;  3RRM B;  4I2W A;  3LS8 A;  3VTY A;  1FVF A;  4IRU A;  2IQC A;  3FU6 A;  3IEG A;  1PY1 A;  2IF4 A;  4AP2 A;  4HXI A;  2WXP A;  4H7Y A;  2WXF A;  2WXH A;  2WXL A;  1QNF A;  3ULQ A;  2VTB A;  4IUL A;  2A5U A;  3ASH A;  3HIZ A;  2XGM A;  2XGO A;  4U04 A;  3NF1 A;  3QDN A;  3TL5 A;  5KJM A;  3IKO B;  4RSY A;  2X6H A;  2AWI A;  4CRW A;  5EX0 A;  2Y3A A;  1OWO A;  2KC7 A;  3LVQ E;  3OAW A;  4HOU A;  4I6J A;  4JEH A;  4N5C A;  2ZU6 B;  3CQG B;  3D9K A;  5ANL A;  3RU0 A;  1SQM A;  3PRZ A;  4I9E A;  3SHF A;  5G55 A;  2R5S A;  4AV7 A;  1HG2 A;  3FHE A;  3G2S A;  3VLE A;  4E85 A;  4XE0 A;  3U3W A;  3L17 A;  1X5B A;  3CV0 A;  4BX8 A;  3NQP A;  4L23 A;  5FZS A;  3NZS A;  2R59 A;  4FJY A;  3D9O A;  2WM9 A;  5KJN A;  3EHM A;  3ZYL A;  4CDR A;  2WPV A;  1HO8 A;  3Q4A B;  1P5Q A;  1TEZ A;  2UY1 A;  5FTP A;  1N54 A;  2RG8 A;  2Y4T A;  3ESK A;  4CT0 A;  5J90 A;  4HOR A;  4J8F A;  1TJC A;  1NA0 A;  5A23 A;  2X6J A;  3CK9 A;  3PRE A;  3R7Q A;  2HO1 A;  4UI9 C;  4FA6 A;  4URK A;  5LCW J;  2OVF A;  3IV0 A;  3L22 A;  5T8I A;  3URZ A;  5EX3 A;  2AW6 A;  2WMN A;  2KCV A;  4GZ5 A;  5BT1 A;  2DIW A;  3PNL B;  3RRU A;  4GA1 A;  3FUJ A;  1E90 A;  4NRH B;  4U0S A;  3FTV A;  4JA9 A;  3FEX A;  5LCW C;  3EJN A;  3VLF A;  4DPR A;  1WAO 1;  1HFA A;  1ELR A;  2ILR A;  2PQN A;  2IOS A;  2OOE A;  4BFR A;  4JVS A;  2X6I A;  3LPZ A;  4D10 C;  4HVB A;  4FUL A;  3CVU A;  3CVQ A;  2XRZ A;  3FUI A;  3KAE A;  2V4L A;  3ONL A;  4J0U A;  5BNW A;  2XPY A;  1GW6 A;  1IQU A;  3CK8 A;  4JL0 A;  3QB2 A;  1Y8M A;  2P58 C;  3MV2 B;  4BTA A;  3FWV A;  3QOU A;  4TUU A;  4LRZ A;  4L1B A;  4AJW A;  5BUZ A;  3BG1 B;  2E0I A;  1H2U A;  4CT4 A;  4PH4 B;  4GYW A;  2FO7 A;  4Q96 A;  3UPV A;  4HOS A;  3UX4 A;  3AU5 A;  5LX8 A;  2XRY A;  2WQ7 A;  4XKC A;  1MQS A;  4B94 A;  3UUX A;  2L0T B;  1DVP A;  3RRN B;  4JXT A;  4KBQ A;  1E8W A;  3AS4 A;  4GAA A;  3FP3 A;  4A3V A;  3ZPJ A;  4BSX A;  4J8S A;  4B89 A;  1IYG A;  4DJA A;  2YNQ A;  3MGB A;  5AYW D;  2LO6 A;  2YQ8 A;  4KZ0 A;  4AY5 A;  3SD5 A;  2AXU A;  5FWQ A;  1HE8 A;  3SZ7 A;  4HS2 A;  3ZW3 A;  4EZJ A;  4RG6 A;  3CIA A;  3TXN A;  5FQ6 A;  2KCL A;  3JYS A;  2L9B A;  2V5F A;  4KYO B;  2JLB A;  1SZ9 A;  5D0O D;  3UT8 A;  2NSZ A;  3GW4 A;  3QWV A;  4EZL A;  1UG3 A;  3GZ1 A;  3LJ3 A;  4WNF A;  4XZ4 A;  3PUJ A;  5ARF A;  4CDN A;  4CDM A;  3TG5 A;  4EQF A;  1E8Z A;  3BG0 B;  4HOQ A;  3CEQ A;  3FY4 A;  2J9Q A;  3OXF A;  5KJK A;  3CVW A;  3CHS A;  4ANV A;  2LAI A;  2HM8 A;  3CQC B;  4FLB A;  1W3B A;  3UT4 A;  2AXV A;  2NXP A;  4BT8 A;  4C0E A;  5J08 A;  2KZT A;  2DCP A;  2VGX A;  3SI5 A;  5ANR A;  2C0L A;  3FUM A;  3Q5M A;  3T5V A;  3I4G A;  3FEY A;  4MKT A;  4J6I A;  5BPP A;  2J07 A;  5D0Q D;  3JQ0 A;  2WVI A;  3FUK A;  1WY6 A;  4LEU A;  3VTX A;  4AXH A;  5BV0 A;  3I3N A;  4G24 A;  3U4T A;  3IHY A;  3L13 A;  4CGV A;  2X6F A;  3MX3 A;  3P1U A;  1KT1 A;  2I6H A;  4UI9 K;  3T8M A;  3LDZ A;  4TV3 A;  4NQ0 A;  3L6A A;  2KAT A;  2XPZ A;  2WXG A;  2EQX A;  4FHJ A;  3D9L A;  3HYM B;  3TG4 A;  3B13 A;  4WND A;  4ILG A;  3U66 A;  3FTS A;  4KXK B;  2AVP A;  4W9R A;  3TAX A;  1H2T C;  2GW1 A;  2HYZ A;  2V8S E;  4HLE A;  3TXM A;  2BF0 X;  3B7S A;  4PS7 A;  5FZR A;  5CCL A;  2WXM A;  3ZHE A;  2UWJ G;  3E4B A;  5JJ6 A;  3HHM A;  3MA5 A;  5BW8 C;  4UQY A;  3RO3 A;  4G1T A;  2NC9 A;  4DK5 A;  1HF8 A;  4U0U A;  2OVB A;  4AVX A;  4AIF A;  4P29 A;  3FUN A;  3RJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...