2J9QA

A novel conformation for the tpr domain of pex5p
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
328
structure length
300
Chain Sequence
GMGLTSATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
publication title A Previously Unobserved Conformation for the Human Pex5P Receptor Suggests Roles for Intrinsic Flexibility and Rigid Domain Motions in Ligand Binding
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 300
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2j9qA00
1W3BA 4AM9A 4HOUA 4CDRA 1ELWA 3LY7A 2OOEA 3PDNA 5HI7A 5LCWJ 4WUYA 2YQ8A 4WNFA 5D0OD 5KJNA 2Q7FA 2HYZA 2MHKA 4Y6WA 3OXLA 4G24A 4U0SA 5DBKA 5BW8C 3HYMB 3QDNA 1KT0A 4F3VA 5EKQD 3ASDA 3GW4A 3ESKA 5CHEE 3QWWA 4BT8A 3ULQA 2VGXB 3QWPA 1IYGA 1NA3A 3GZ2A 4ME2A 5KJKA 4GA0A 1HZ4A 3E4BA 3ZHEA 4JA7A 1HH8A 1B89A 4G26A 5FT9A 2VYIA 3ZFWA 3SF4A 2VSNA 1WM5A 5FTPA 4A1SA 3QWVA 3ASGA 2WQHA 2XGMA 4J8EA 3CK7A 4APOA 3S7DA 2KCKA 2XGSA 4H7XA 4KBQA 1NZNA 4GZ5A 3CEQA 3KAEA 4G25A 3MKRA 4HOTA 4UQZA 2PZIA 4GZ6A 2HO1A 1ZBPA 5EX0A 2UY1A 2FBNA 3TGOA 2FF4A 1TJCA 3U3WA 4KXKB 3CVQA 2E2EA 2QFCA 4I9CA 5C1DA 1E96B 1KLXA 1P5QA 2FEZA 4N3AA 3ASFA 3EDTB 3LYAA 4XIFA 5FJYA 4GPKA 5D0QD 4GYYA 3CVNA 3CVLA 5KJMA 2VSYA 2UWJG 2VGYA 2PL2A 2LSVA 5CCLA 2P58C 3MEKA 4BWRA 4G1TA 3CK8A 3MV3B 4O6FA 4H7YA 4GCNA 3VTYA 3CVPA 1ZU2A 4NRHB 4N3CA 5G04J 4HORA 2R5SA 4GA2A 3MV2B 1PC2A 1A17A 3RO3A 4BTAA 3UQ3A 1HXIA 2FO7A 2J9QA 3RJVA 4WNEA 3RU0A 2JLBA 2XPIA 4UI9J 2XCBA 4XI9A 1QQEA 4HOSA 3GZ1A 4I2ZA 3BEEA 3S7FA 4IN3B 3PE3A 5FZQA 3CKBA 4KYOB 4N5CA 4UI9K 1FCHA 5JJTA 3LY9A 2I6HA 1IHGA 3JYSA 4YVQC 4N39A 1OUVA 3RKVA 4HOQA 3R9AB 3ZN3A 4JHRA 4N2QA 4I17A 2KCLA 4NQ0A 4GZ3A 5LCWC 2DBAA 3Q5MA 2VGXA 3N71A 3Q15A 3LKUA 4J0UA 4YVOA 1Y8MA 5BNWA 5BT1A 3S7BA 4EQFA 5JJ7A 4ABNA 4J8FA 4CGWA 2PQNA 5A6CA 3TG4A 3LPZA 3U4TA 2PQRA 5KJLA 4AIFA 5A7DB 3FFLA 2KATA 4GYWA 3ZGQA 3K9IA 3TAXA 5AYWD 2XGOA 1YA0A 4U04A 5DIZA 4I1AA 4YNDA 4N3BA 4BTBA 4JA9A 3UPVA 2YHCA 3QOUA 4Y6CA 3KD7A 2BUGA 2LSUA 3Q49B 3ZPJA 4RG6A 2GW1A 2AVPA 3QKYA 5CCMA 5JJ6A 4N2SA 5G05C 1KT1A 3ZHEB 5FZRA 2ONDA 4B94A 1ELRA 3RO2A 2LNIA 4LEUA 4JL0A 3ASHA 3KS2A 4WNDA 4GYOA 4AY5A 3LY8A 4G23A 3AS8A 5M72A 3AS4A 4UQYA 4J8DA 5FZSA 3OXFA 5EX3A 4GCOA 2KCVA 3CKCA 4I9EA 2V5FA 4XI0A 3MA5A 1WAO1 2IF4A 4I2WA 3CV0A 1XNFA 1QZ2A 4GA1A 2UY1B 2IFUA 2Y4TA 4W9RA 2NC9A 3IEGA 3VTXA 4U0UA 4G2VA 2VQ2A 3WXXA 3URZA 4AY6A 5G04C 4WNGA 2XCCA 3RIBA 2XEVA 5G05J 2Y4UA 4CGVA 3CK9A 2HR2A 3S7JA 2C0LA 3O48A 4RG9A 2C2LA 5ARGA 4UQXA 2L6JA 4U07A 4UI9C 3LCAA 4BT9A 5HQ8A 2FI7A 3UUXA 3OXGA 3PE4A 5ARFA 3SZ7A 3FWVA 1NA0A 3Q47B 3AS5A 3GYZA 2WPVA 2KC7A 3TG5A 3NF1A 4U0ZA 2C0MA 3FP3A 3Q4AB
chains in the Genus database with same CATH superfamily
2DIWA 3R7RA 4AOFA 1MHQA 4HRNA 3ZW3A 3ZYLA 4CDRA 2IOSA 4FJYA 4U8VD 3PDNA 1N4SA 3LXUX 1S0PA 5ENPD 4NACA 3MJWA 4Y6WA 4L2YA 4HS2A 1JCSA 1TNZA 3QDNA 4FC8A 5EKQD 4OVVA 2BKGA 2CFZA 4LERA 2DZOA 2F8YA 3QWPA 1N11A 1FPPA 2IO3C 3ZXSA 4ME2A 3SFZA 3TWVA 3ONLA 4GA0A 3E4BA 4FULA 2WXLA 1NFIE 1KZPA 4Z68A 1HH8A 2J4DA 5FT9A 5AAOA 1E8XA 3SF4A 2X6IA 1WM5A 4RLYA 3V2XA 2WQHA 2OCCE 5AJLA 3CLJA 1LD7A 2GRNB 4APOA 4DX6D 3S7DA 3APCA 2XRYA 3FUEA 2IQCA 3FEYA 3ZUVB 3FUJA 4E6HA 3D9IA 3KAEA 2X6JA 3FU6A 4FLBA 4WWPA 4BERA 1H6PA 4GZ6A 1H2TC 4OVUA 3G2TA 2HO1A 2UY1A 4FHJA 4BEPA 3TGOA 2FF4A 3D9PA 3NBNB 3W9GA 4KXKB 4DUIA 3UMVA 3CVQA 4MLPA 2QFCA 3T5XA 4I9CA 4R7LA 1EPUA 3W9FA 3ZRHA 3HVEA 2I9CA 4YDOA 2FEZA 3ABLE 4BX9A 5KCMA 2XHEA 4XIFA 1MX6A 1BI8B 3LVRE 2A5UA 4A3TA 2AXUA 3CVNA 3FTSA 3PNTB 3QJZA 2ZGDA 4JHKA 2DYRE 2PNNA 3FUNA 3Q75A 2LSVA 3T9KA 3MEKA 4BWRA 4G1TA 1LTXA 4BESA 1INZA 3EIJA 3ISMC 3MKQA 5CMWA 1ZU2A 4NRHB 3ZVVA 5G2NA 2R05A 3JQ1A 1K3ZD 3AU5A 1N4QA 3L6AA 1UG3A 1SZAA 4XI9A 4UI9J 4HOSA 4HVBA 3I3NA 4CT4A 1LF8A 3CKBA 4UI9K 3C98A 5T4YA 5KWDA 2XENA 1IHGA 1MJ0A 4TUUA 2EIKE 3ZKJA 3JYSA 3L13A 4C48B 3TXMA 1N4PA 2KCLA 5LCWC 2CFUA 3TWSA 3Q15A 3E32A 2OVFA 3IHVA 4YVOA 2RFAA 5C2YA 4ATZD 1OWNA 1TN8A 4L9PA 1FT1A 3CVWA 3ML8A 2P9KG 1BD8A 2P9UG 2YNQA 5EYPF 1N0RA 1XGWA 5ENNA 3Q7AA 3JXJA 4Q94A 4GYWA 4FP7A 3J5PA 3L08A 4B0ZA 5AYWD 2WXNA 4A63B 4IYPA 1Q2ZA 4E85A 4Q96A 3ZYKA 1O1RA 4XEIG 2A4ZA 3OTNA 3Q49B 2WXRA 4O1OA 3RSEG 1VDYA 4PUCA 5FWQA 3PEVB 4CT0A 3HHMA 4C9BB 5CRVA 1E7UA 3PUJA 3ZHEB 4B94A 1ELRA 1E7VA 3NQPA 4LEUA 1JPLA 4AVXA 2WXFA 3KS2A 3SFXA 1X81A 3FUHA 3PZ2A 4L23A 3AS8A 5ENSD 5AQ9A 2L6BA 1QYMA 1OCRE 4J8DA 3OXFA 3HXEA 5EX3A 3E30A 1O1SA 4GCOA 4EZJA 2BEDA 4JEUA 3CKCA 2GRQB 2V5FA 3ULYA 5EN5D 5CBOA 4I6JA 4AXHA 3SBSA 2OEWA 4GZDA 3CVUA 5FQ8A 4IRUA 2IFUA 2Y4TA 1FT2A 3FTWA 3G2UA 4RQIA 3NZSA 1O5MA 3AG3E 4HRLA 5AQAA 4GMRA 4U0UA 4GAAA 2VQ2A 4ATGA 2FO1E 3URZA 3I4GA 2I1JA 3L16A 3UM0A 4WNGA 2XCCA 3IBEA 3PNLB 4CGVA 3BG1B 2C0LA 3O48A 2JEKA 4RG9A 5G55A 4UQXA 4A55A 4BT9A 2IJGX 2ZU6B 2FI7A 4AEZC 2VGEA 2DYSE 1N95A 4DJAA 4G11A 4GZCA 3SZ7A 3ABKE 3UXGA 2IONA 3KSLA 3T8MA 2V0PA 1S63A 3GYZA 2KC7A 1JWFA 1JCQA 3TG5A 4U0ZA 2C0MA 2WVIA 1OT8A 5AENA 3MCXA 5FQ7A 1W3BA 4L1BA 4HOUA 3C3RA 1ELWA 3LY7A 2OOEA 3EHNA 4K5BA 3FUKA 1K8KG 4WUYA 1S64A 3NOGD 5KJNA 3V79K 2MHKA 5JHAA 3TWUA 2XPYA 5BW8C 2ETBA 3HYMB 2OV8A 3F6QA 2XZDG 3ASDA 3ONKA 2KM4A 3CHOA 3FH8A 3ESKA 2NYJA 3QWWA 1EYHA 3FTZA 3ZYQA 1IYGA 4EBAA 3GZ2A 4XKBA 2R59A 5CRUA 4GTMA 4X8QA 3ZHEA 1GW6A 3PS6A 3SGHA 3FU3A 3Q79A 4TV3A 3UINC 3PEUB 2VSNA 2WMNA 1YYHA 5ENOD 5FTPA 1O1TA 3T5VA 1OWLA 3QWVA 3CHMA 3NAWA 1BU9A 4GTVA 4G8KA 5FIOA 2OVBA 4O60A 3I4RB 1N54A 1WY6A 1L5JA 2ZGGA 2H6GA 3PVLA 2EIJE 2XGSA 4MRUA 3FU0A 4JZYA 2B6CA 5D2MC 4G25A 4HOTA 4ACKA 3L22A 5D66A 5BUZA 4UQZA 2RFMA 4DLQA 2L0TB 2QY7A 2QYUA 3ZYMA 3D9HA 2FBNA 4BETA 3U64A 1HG5A 1H6OA 4U8HA 3U3WA 5KNHD 4J6IA 3EUVA 2P9IG 2H6IA 4XX5A 3D9OA 2V4HC 4DI4A 1D9SA 4KT6B 2VTBA 1P5QA 2X6HA 4LSZE 5ANLA 3EDTB 4F1PA 5ENRD 5FJYA 4GPKA 4RSYA 4PH4B 3IXEA 1K1AA 3VLDA 2VGYA 4HBDA 2EQXA 5CCLA 3CVXA 4O1PA 3CK8A 3G2SA 1TJFA 4MS6A 4CZ2D 4O6FA 3VTYA 5T8IA 5G04J 4GTTA 3RRUA 4HORA 2R5SA 4GA2A 1N0QA 3RO3A 1A17A 4BTAA 1BI7B 2VJ8A 1HXIA 2J9QA 4WNEA 3E37A 2E0IA 2JLBA 3NOCD 3AG1E 2XPIA 1QQEA 4I1MA 3B95A 3Q7FA 4U7EB 4I2ZA 2EILE 4PS7A 4IN3B 2XRZA 4LG6A 4N5CA 5J90A 3Q78A 4TXRA 1FCHA 5CEDB 1H19A 5AQBA 2LXMA 3PH0C 4PS3A 2BF0X 2X6FA 4WWNA 2Y3AA 3RKVA 4RVBA 3UKUG 3ZN3A 3HRAA 3R7QA 3SD5A 2CHWA 1KPSB 3KSQA 3N71A 4OAUC 2DVWA 4YDWA 1DC2A 4LUNU 5CBNA 3S7BA 3QNKA 2YHEA 4A3VA 4ABNA 2VSXE 4CGWA 3CSTA 4DRXE 4B8CB 1H6KA 4XKCA 3LPZA 1ZB1A 2PQRA 1N52A 2L9BA 3FFLA 3ASOE 2KATA 2M63A 2XZTG 2IU1A 3ZGQA 4U04A 2Y1LE 3X2QE 3B7RL 4YNDA 4JA9A 3I5PA 3EHMA 1BPOA 2YHCA 2V8SE 3FHEA 2HM8A 3QOUA 2LSUA 4HNAD 3G2WA 3PUKA 1JWGA 4N2SA 4CDNA 3MX3A 2I2OA 1SZ9A 4FU3A 5G05C 1AP7A 3APDA 5AARA 4UUCA 4JD2G 2LNIA 2R2LA 2J09A 3TWTA 1H2VC 1WG0A 1QNFA 3O4ZA 3PZDA 4JL0A 3ASHA 1TNOA 1OWPA 4WNDA 4AY5A 3D9NA 2WQ6A 1TN7A 3LY8A 1E8ZA 2P9LG 5CERB 4UQYA 3UM2A 2KCVA 2V5QC 1UN9A 5ANRA 1DNPA 3MA5A 4LNUD 2WXPA 2LAHA 3FTVA 1QZ2A 4F53A 4M3OA 3QC1A 3UT4A 4UWFA 5AIJA 3D9LA 4BFRA 4GTRA 3IEGA 3Q73A 3RAUA 3VTXA 3DPDA 2CG3A 4G2VA 4BY6A 3CIAA 4UWHA 3HDXA 3FH7A 2R03A 5J08A 3MGBA 4GMJA 2XEVA 5G05J 2Y4UA 3ABME 2HR2A 4KZ0A 3JUIA 2C2LA 3DSUA 3FTXA 2R17C 2L6JA 4U07A 4HLLA 3OXGA 3DRAA 3PE4A 4LNGA 3PRZA 1HF8A 4UWKA 4MKTA 1ELKA 3EJNA 3Q47B 5IY5E 5B1BE 1Z6TA 4WAFA 3FP3A 3EHRA 4ANXA 2AWIA 4AM9A 3RRNB 3DXMG 4I6GA 5HI7A 5LCWJ 5LFAA 4EHMA 4UWLA 4B89A 2YQ8A 2Q7FA 2HYZA 3IHYA 3OXLA 4G24A 4U0SA 2LO6A 4HXIA 1KT0A 1IHBA 5HKPA 2L0IA 4F3VA 3JXIA 2ILRA 4BT8A 3ULQA 3ZEFA 2VGXB 3CVYA 2WXGA 1HU3A 4TUMA 4APFA 1D8DA 3CR3A 4JA7A 3RRMB 4EECA 3LJNA 4LCTA 4L7TA 5BPPA 5EIDA 2VYIA 3D9KA 4HQDA 3CQCB 4A1SA 3ASGA 2WQ7A 3B7UX 2XGMA 4J8EA 3OAWA 3CK7A 5BV0A 2KZTB 3MYVA 3EHQA 2KCKA 4H7XA 4I1OB 1NZNA 2PM7A 3DEPA 3U9WA 3QARA 4GZ5A 3FUFA 4NURA 4DX1A 2PZIA 3DEOA 4TRQA 5EX0A 2J49A 3AAAC 4F1SA 4LRZA 4F7AA 3D9MA 3FUMA 2LAIA 3JUEA 1UJJA 4HB5A 4C0MA 5ITZF 3EU5A 3DPYA 2WXIA 1KLXA 2AXZA 2MRIA 4FJZA 1OY3D 4TXPA 3FTYA 4JPSA 5EIBE 4ANUA 3ML9A 5D0QD 1YCSB 3HXFA 5KJMA 3CVLA 5BXOA 2VSYA 3TXNA 2UWJG 4GB9A 3FUIA 4B93B 2P58C 3DSXA 3UM1A 5JHBA 4QFVA 3MV3B 3B7TA 1SW6A 2DWZA 4IULA 4H7YA 4AP2A 2YINA 4AJWA 3CVPA 4N3CA 4GPMA 2WXMA 3MV2B 5LP0A 1EF1C 4CEMA 1UN8A 3SNXA 1Y6IA 2FO7A 3RJVA 3CSFA 4YDEA 4GMLA 5EYLA 2X3MA 1IQRA 1PAQA 2J4BA 3DSVA 1QBQA 4K5AB 4GTPA 3BEEA 3S7FA 3S2AA 3B7SA 5KNGA 1IKND 4HI8A 4BSZB 3J5QB 2CHZA 5JJTA 3LY9A 2LUHA 4WWOA 2GROB 4YVQC 1JCRA 4N39A 5H7PA 1OUVA 1MZCA 1E8WA 2AJAA 3CHPA 4HOQA 1N9AA 3R9AB 4N2QA 3SO8A 1TNUA 3ZNGA 4I17A 4NQ0A 3SY2A 2DBAA 3Q5MA 2VGXA 3AG2E 4U96D 3BU8A 3LKUA 3CGHA 1Y8MA 4FA6A 3SQVA 4U8YD 2XEHA 5BT1A 1NP7A 3TJPA 4GTSA 4EQFA 1TN6A 3UT7A 4J8FA 1TR4A 5A6CA 3AJIA 5EDSA 2DCPA 2JABA 4GU5A 2IO2C 2P9PG 2HE0A 4BX8A 3LEWA 4J8SA 2IY0C 4DK5A 1OCZE 5ENQD 3DXKG 3ZIMA 3TAXA 1YA0A 2KZTA 5DIZA 4D10C 3TWRA 4YDYA 4BTBA 3AG4E 5E75A 3AU4A 2P9SG 4A1GA 4ACLA 2BUGA 2X38A 3PZ4A 2X6KA 5BV1A 4RG6A 4JVSA 1H0AA 2CG2A 2AVPA 3QKYA 5CCMA 5JJ6A 3U66A 3B7BA 2P9NG 1HE8A 5B3SE 4BSXA 1KT1A 5FZRA 2ONDA 3RO2A 2OEVA 5A23A 2Y0BG 3FU5A 1MX2A 4GYOA 1DCQA 4PDXA 3JCKC 4EZKA 2P2CP 3UI2A 4G23A 1Z5SC 5FZSA 4ZFHA 1RW2A 3UM3A 5E76A 1HS6A 3CHQA 2B0OE 4XI0A 3HIZA 3E33A 3TWWA 1G3NB 1DVPA 2WXJA 2IF4A 3Q9UC 1A5EA 2XS1A 3C3OA 4W9RA 4K03A 1TNYA 1FVHA 3SFYA 4G8LA 3WXXA 5LX8A 4ANWA 4AY6A 5CECB 1E8YA 4N5QA 1FVFA 5EILA 3C72A 5B1AE 3CK9A 3EIQC 3HXCA 5ARGA 1TNBA 1HFAA 4UI9C 3LCAA 2KXPC 5HQ8A 3LVQE 3LJ3A 4KVMA 4M7CA 2WXKA 1OWMA 4DI3A 3FWVA 3UT8A 4V3IA 3APFA 4URKA 1HX8A 2J8SD 3SBTB 1N94A 3AS5A 2WPVA 3WG7E 1MYOA 3NF1A 3ESLA 1X5BA 4TXQA 4DX7D 3UTMA 1V54E 4WNFA 5D0OD 2Y69E 2FULA 2IOLA 5DBKA 1EDUA 4CDMA 2A5EA 1UOHA 2RD0A 3ULEG 3GW4A 2WXOA 5CHEE 4JC8A 3BG0B 5AN8A 4KMOA 1OXJA 1NA3A 1V55E 3FDHA 4HI9A 1IQUA 3VLEA 5KJKA 1HZ4A 1UW4B 3ENEA 3V31A 3CQGB 4L2LA 1H2UA 4HFGA 3D3MA 1PY1A 4ZHBA 4FHKA 3UKRG 1B89A 3QK0A 2WXHA 4G26A 3ZU7B 3TWXA 3ZFWA 1OWOA 1MQSA 1OCCE 2H6HA 2ZISA 3QB2A 3UIOC 4EZLA 4DX5D 2XEEA 1D8EA 4FADA 4OAVB 4K0RA 3FULA 3DSWA 3TWQA 2ZXWE 4KBQA 3DSSA 3ZXPA 3CEQA 3MKRA 4OYSA 1KZOA 1WDYA 2V4LA 1U2VG 3FTUA 1ZBPA 4P29A 2F8XK 4U95D 1TJCA 4GTQA 1JUQA 2E2EA 1SQMA 2J07A 5C1DA 1E96B 4J8YA 2EINE 2XPZA 3G2VA 3LDZA 4N3AA 3ASFA 2WXQA 1SA4A 3LYAA 4JW1A 4GYYA 3CVVA 1U3CA 3EU9A 1OCOE 4ILIA 2PL2A 2R02A 2RKKA 5KBAA 4F6RD 3BUAA 4EBAG 2QZAA 5AJDA 4ILGA 3R9MA 3CHRA 4GCNA 4HRMB 4UWGA 3FY4A 3UIPC 4KVOA 1PC2A 3UQ3A 3ASNE 3L17A 3RU0A 1BLXB 2XQ0A 3QAQA 1HO8A 4C0EA 3C3QA 2XCBA 1N4RA 3GZ1A 3LS8A 1TEZA 4DLOA 2WMOA 3HXDA 3L9TA 1SA5A 5CEAA 3PE3A 5FZQA 4KYOB 5FQ4A 4J7WA 4U63A 2I6HA 2GRMA 3B13A 4DX2A 1IXVA 2GRPB 1SVXA 3HG0D 4JHRA 2ETAA 2WM9A 2KBXA 3C5RA 4GZ3A 4XE0A 5FQ6A 2EIME 4J0UA 1E90A 2GRLA 1Z3XA 5BNWA 3MZLB 3NB2A 1TYQG 2AW6A 2BKKB 5BXUA 5JJ7A 3SI5A 2VTBB 2PQNA 2F0YA 4PS8A 3T8KA 3L82A 3TG4A 3TL5A 4K5CA 3U4TA 4JB8P 5KJLA 4AIFA 5A7DB 1S70B 3IKOB 3K9IA 2XGOA 3V2OA 4I1AA 1AWCB 2F37A 4N3BA 5HRYA 3Q9NC 3KEAA 4HLEA 1MX4A 4CRWA 3UPVA 1YMPA 2VSOE 3NZUA 2I1KA 4I6EA 4Y6CA 3KD7A 4ILHB 3ZPJA 4B8AA 2GW1A 2LXLA 1U3DA 3IV0A 3PZ3A 5CMYA 2MOWA 2ZIRA 3HXBA 2NSZA 4KZCA 3V30A 3PREA 2NXPA 4QQIA 3SHFA 3D9JA 1LD8A 3PZ1A 3P1UA 1UJKA 5HS0A 5JMND 5M72A 3FH5A 3AS4A 4FLHA 3UX4A 3FUDA 4I9EA 2IEJA 4XZ4A 2QYJA 4AV7A 3RK6A 5FINA 4LNBA 1WAO1 2GRRB 4CYMD 4I2WA 3CV0A 1XNFA 3DSTA 4GA1A 1HG2A 2UY1B 4CCAA 4ANVA 1DCEA 2NC9A 2BTDA 3BQOA 4JXTA 4MBGA 3DWLG 2QC9A 2GGFA 4EPZA 3HVEB 2XS8A 3KEZA 5G04C 1NL4A 3RIBA 2MYOA 5LOZA 5AQ7A 2CHXA 3S7JA 2J08A 4JHJA 3FEXA 1Z3YA 2RG8A 3L54A 4DPRA 2ETCA 3UUXA 5T3RA 5ARFA 2DZNA 4Q69A 5JA4D 4GTOA 2PM6A 5ENTD 1K1BA 3DBSA 1NI1A 3P2BA 3GZSA 1NA0A 3MKQB 2WB2A 4NIKA 2H6FA 3VLFA 4JEHA 4I43A 3JQ0A 3E34A 3CHSA 2AXVA 3Q4AB 1RZ4A
chains in the Genus database with same CATH topology
2DIWA 1W3BA 3R7RA 4AOFA 1MHQA 4L1BA 4AM9A 4HOUA 3ZW3A 3ZYLA 4CDRA 2IOSA 4FJYA 1ELWA 3LY7A 3RRNB 2OOEA 3PDNA 4I6GA 3EHNA 5HI7A 5LCWJ 5LFAA 3LXUX 4UWLA 3FUKA 4B89A 4WUYA 2YQ8A 4WNFA 1S0PA 5D0OD 4NACA 5KJNA 2Q7FA 2HYZA 3MJWA 3IHYA 2MHKA 2FULA 4L2YA 2IOLA 3OXLA 4Y6WA 4G24A 5JHAA 4U0SA 5DBKA 2XPYA 5BW8C 4HS2A 2LO6A 1EDUA 4HXIA 4CDMA 3HYMB 3QDNA 4FC8A 2OV8A 1KT0A 2L0IA 4F3VA 5EKQD 2RD0A 3ASDA 4OVVA 3GW4A 2KM4A 3ONKA 3CHOA 3FH8A 2WXOA 3ESKA 5CHEE 2ILRA 4JC8A 3QWWA 4BT8A 1EYHA 2CFZA 3ULQA 3BG0B 4LERA 3ZEFA 2VGXB 3FTZA 3QWPA 4KMOA 3ZYQA 3CVYA 1IYGA 1NA3A 3ZXSA 2WXGA 4EBAA 3GZ2A 1HU3A 4ME2A 4XKBA 2R59A 3FDHA 3SFZA 4APFA 1IQUA 3VLEA 3ONLA 4GA0A 5KJKA 1HZ4A 1UW4B 3ENEA 3E4BA 4FULA 3CQGB 4L2LA 2WXLA 1H2UA 4HFGA 3ZHEA 1GW6A 3CR3A 3D3MA 1PY1A 4FHKA 4JA7A 3RRMB 4EECA 1HH8A 4LCTA 4L7TA 3PS6A 1B89A 3SGHA 2J4DA 3QK0A 2WXHA 4G26A 5FT9A 5BPPA 3FU3A 2VYIA 3D9KA 3ZFWA 4TV3A 1E8XA 1OWOA 1MQSA 3SF4A 3PEUB 2VSNA 2X6IA 2WMNA 1WM5A 3QB2A 3CQCB 5FTPA 4A1SA 3T5VA 1OWLA 3QWVA 3ASGA 3CHMA 4EZLA 2WQ7A 3B7UX 2WQHA 5AJLA 2XGMA 4J8EA 2OVBA 3OAWA 3CLJA 3I4RB 1N54A 3CK7A 4FADA 4APOA 5BV0A 2KZTB 3MYVA 4K0RA 1WY6A 3FULA 1L5JA 3S7DA 3APCA 2XRYA 2KCKA 3PVLA 3FUEA 2XGSA 4H7XA 4I1OB 2IQCA 1NZNA 2PM7A 3FEYA 4KBQA 4MRUA 3FU0A 3FUJA 3U9WA 3QARA 3D9IA 4GZ5A 4E6HA 3CEQA 3KAEA 3FUFA 4NURA 4JZYA 2X6JA 4G25A 3MKRA 4ACKA 3L22A 4OYSA 4HOTA 5BUZA 3FU6A 4UQZA 2PZIA 4FLBA 4WWPA 4DLQA 4GZ6A 4TRQA 1H2TC 2V4LA 4OVUA 2L0TB 3G2TA 2HO1A 2QY7A 3FTUA 3ZYMA 1ZBPA 5EX0A 4P29A 2J49A 2UY1A 4FHJA 2FBNA 4F1SA 4LRZA 4F7AA 3D9MA 3TGOA 3FUMA 3U64A 1HG5A 2FF4A 3D9PA 2LAIA 1TJCA 4U8HA 3U3WA 4KXKB 1UJJA 3UMVA 1JUQA 3CVQA 4C0MA 2E2EA 4MLPA 2QFCA 3T5XA 4I9CA 4J6IA 4R7LA 1SQMA 2J07A 5C1DA 1E96B 1EPUA 2WXIA 3ZRHA 4XX5A 1KLXA 3HVEA 3D9OA 2I9CA 2XPZA 4DI4A 3G2VA 3LDZA 4KT6B 1P5QA 2FEZA 2X6HA 2AXZA 2MRIA 4N3AA 2VTBA 3ASFA 5ANLA 2WXQA 4BX9A 4FJZA 5KCMA 3EDTB 3FTYA 2XHEA 3LYAA 4JPSA 4XIFA 4JW1A 5FJYA 4ANUA 4GPKA 3ML9A 5D0QD 4RSYA 3LVRE 2A5UA 4A3TA 4GYYA 2AXUA 4PH4B 3CVVA 3CVNA 3CVLA 5KJMA 1U3CA 2VSYA 3FTSA 3PNTB 2UWJG 3QJZA 4GB9A 3TXNA 3VLDA 2VGYA 3FUIA 4JHKA 4ILIA 2PL2A 2EQXA 3FUNA 4CT0A 2LSVA 5CCLA 2P58C 3MEKA 4BWRA 3CVXA 4G1TA 4EBAG 5JHBA 4QFVA 3CK8A 3MV3B 3G2SA 5AJDA 1TJFA 3B7TA 4MS6A 4ILGA 1INZA 4IULA 3EIJA 3CHRA 4H7YA 4GCNA 4O6FA 4AP2A 2YINA 3VTYA 3MKQA 5T8IA 4AJWA 3CVPA 4UWGA 1ZU2A 5CMWA 4NRHB 4N3CA 3ZVVA 5G04J 3FY4A 5G2NA 3RRUA 4HORA 4KVOA 2WXMA 2R5SA 4GA2A 3MV2B 1PC2A 1A17A 3RO3A 4BTAA 3JQ1A 5LP0A 1EF1C 3UQ3A 4CEMA 1UN8A 1HXIA 2VJ8A 3L17A 1Y6IA 3SNXA 2FO7A 2J9QA 3AU5A 3RJVA 3CSFA 4WNEA 3L6AA 4GMLA 3RU0A 3QAQA 2XQ0A 1UG3A 2E0IA 2X3MA 2JLBA 1IQRA 1PAQA 2J4BA 1HO8A 4C0EA 1SZAA 2XPIA 4UI9J 2XCBA 4XI9A 1QQEA 4I1MA 4HOSA 3GZ1A 3I3NA 4HVBA 4CT4A 4I2ZA 3LS8A 1TEZA 3BEEA 4PS7A 4DLOA 2WMOA 3S7FA 4IN3B 1LF8A 2XRZA 3PE3A 5FZQA 3CKBA 4KYOB 3S2AA 4N5CA 5J90A 3B7SA 5FQ4A 4UI9K 3C98A 5T4YA 1FCHA 2CHZA 5JJTA 3LY9A 4U63A 1H19A 2I6HA 2GRMA 3PH0C 1IHGA 4TUUA 3B13A 4PS3A 2BF0X 4WWOA 3JYSA 4YVQC 2X6FA 4N39A 4WWNA 1OUVA 2Y3AA 3RKVA 1E8WA 3CHPA 3L13A 4RVBA 4HOQA 3TXMA 3R9AB 3ZN3A 4JHRA 2WM9A 4N2QA 4I17A 2KCLA 4NQ0A 4GZ3A 5LCWC 3R7QA 2CFUA 2DBAA 3Q5MA 3SD5A 2CHWA 2VGXA 4XE0A 3N71A 5FQ6A 3Q15A 3LKUA 4J0UA 1E90A 2OVFA 2GRLA 3IHVA 4YVOA 3CGHA 1Y8MA 1Z3XA 4FA6A 3MZLB 5BNWA 5C2YA 5BT1A 2AW6A 1NP7A 4LUNU 3TJPA 1OWNA 3S7BA 3QNKA 2YHEA 4A3VA 4EQFA 3UT7A 5JJ7A 3SI5A 4ABNA 2VSXE 4J8FA 4CGWA 2VTBB 2PQNA 3CSTA 4PS8A 5A6CA 4B8CB 3TG4A 5EDSA 2DCPA 3CVWA 1H6KA 4GU5A 3TL5A 3ML8A 4XKCA 3LPZA 3U4TA 2PQRA 4BX8A 2YNQA 3LEWA 5KJLA 4J8SA 4AIFA 1N52A 2L9BA 5A7DB 3FFLA 2KATA 2M63A 4DK5A 2IU1A 1XGWA 5ENNA 4Q94A 4GYWA 4FP7A 3IKOB 3ZIMA 3ZGQA 3L08A 3K9IA 3TAXA 4B0ZA 5AYWD 2XGOA 1YA0A 2WXNA 4U04A 2KZTA 4IYPA 5DIZA 4I1AA 3B7RL 4D10C 4YNDA 4N3BA 3S7JA 4BTBA 5E75A 4E85A 4Q96A 3AU4A 4JA9A 3ZYKA 4HLEA 3I5PA 4CRWA 3UPVA 4A1GA 3EHMA 1BPOA 2VSOE 3NZUA 4ACLA 2I1KA 2YHCA 2V8SE 3FHEA 2HM8A 4I6EA 3QOUA 4Y6CA 2A4ZA 3KD7A 2BUGA 2LSUA 3OTNA 2X38A 3Q49B 2WXRA 3G2WA 4ILHB 3PUKA 3ZPJA 2X6KA 5BV1A 4RG6A 4B8AA 1VDYA 2GW1A 4JVSA 1H0AA 2CG2A 2AVPA 3QKYA 5CCMA 4PUCA 1JWGA 1U3DA 5FWQA 5JJ6A 3U66A 3IV0A 5CMYA 4N2SA 3PEVB 1HE8A 3MX3A 4CDNA 3HHMA 2I2OA 1SZ9A 2MOWA 4FU3A 4BSXA 5G05C 4C9BB 3APDA 2NSZA 1KT1A 1E7UA 3PUJA 3ZHEB 5FZRA 4KZCA 2ONDA 4B94A 1ELRA 3RO2A 1E7VA 3NQPA 3PREA 2LNIA 4LEUA 5A23A 2NXPA 2J09A 1H2VC 1QNFA 3O4ZA 3SHFA 1JPLA 3D9JA 3PZDA 4AVXA 4JL0A 3ASHA 3FU5A 2WXFA 1OWPA 3KS2A 4WNDA 4GYOA 4AY5A 4PDXA 3D9NA 1UJKA 3P1UA 2WQ6A 3JCKC 3FUHA 3LY8A 4EZKA 4L23A 1E8ZA 4G23A 3AS8A 5M72A 3FH5A 3AS4A 4FLHA 4UQYA 4J8DA 5FZSA 3OXFA 5EX3A 3UX4A 4GCOA 2KCVA 4EZJA 4JEUA 3CKCA 5E76A 1HS6A 3FUDA 4I9EA 2V5FA 4XZ4A 3CHQA 4XI0A 1UN9A 3HIZA 5ANRA 4AV7A 1DNPA 4I6JA 3RK6A 3MA5A 4AXHA 1DVPA 3SBSA 1WAO1 2WXJA 2IF4A 4GZDA 2WXPA 3CVUA 2LAHA 3FTVA 4I2WA 3CV0A 1XNFA 1QZ2A 4F53A 4GA1A 4M3OA 5FQ8A 1HG2A 2UY1B 3QC1A 4IRUA 2IFUA 4CCAA 2Y4TA 4ANVA 3UT4A 4UWFA 3FTWA 3G2UA 4W9RA 5AIJA 3D9LA 3NZSA 4K03A 2NC9A 1FVHA 2BTDA 4BFRA 3IEGA 4JXTA 3VTXA 3DPDA 4U0UA 2CG3A 4G2VA 4GAAA 2VQ2A 3WXXA 4ATGA 4BY6A 2GGFA 5LX8A 4ANWA 3URZA 4EPZA 3CIAA 3I4GA 4AY6A 4UWHA 3HDXA 1E8YA 3FH7A 2I1JA 3HVEB 3KEZA 1FVFA 3L16A 5G04C 5J08A 3MGBA 4WNGA 2XCCA 3IBEA 4GMJA 3RIBA 2XEVA 5LOZA 5G05J 2Y4UA 3PNLB 2CHXA 4CGVA 3CK9A 2HR2A 3BG1B 3EIQC 4KZ0A 2C0LA 3O48A 2JEKA 3JUIA 2J08A 4JHJA 2C2LA 3FEXA 1Z3YA 2RG8A 4RG9A 5ARGA 5G55A 4UQXA 3FTXA 4A55A 1HFAA 2L6JA 2R17C 3L54A 4U07A 4UI9C 3LCAA 4DPRA 4BT9A 2ZU6B 2IJGX 5HQ8A 3LVQE 2FI7A 3LJ3A 4KVMA 3UUXA 3OXGA 2WXKA 5T3RA 1OWMA 3PE4A 4AEZC 5ARFA 4Q69A 3PRZA 4DI3A 4DJAA 4G11A 2PM6A 1HF8A 4UWKA 3DBSA 4GZCA 3SZ7A 3FWVA 4MKTA 1ELKA 3UT8A 3P2BA 3GZSA 4V3IA 2IONA 3EJNA 3APFA 4URKA 1NA0A 1HX8A 3T8MA 3Q47B 3MKQB 3SBTB 2V0PA 2WB2A 3AS5A 3GYZA 2WPVA 1Z6TA 3VLFA 4JEHA 2KC7A 1JWFA 4I43A 3TG5A 3NF1A 3JQ0A 4U0ZA 4WAFA 2C0MA 3FP3A 2WVIA 3ESLA 4ANXA 1X5BA 3CHSA 2AXVA 5AENA 3MCXA 3Q4AB 5FQ7A 2AWIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3B A;  4AM9 A;  4HOU A;  4CDR A;  1ELW A;  3LY7 A;  2OOE A;  3PDN A;  5HI7 A;  5LCW J;  4WUY A;  2YQ8 A;  4WNF A;  5D0O D;  5KJN A;  2Q7F A;  2HYZ A;  2MHK A;  4Y6W A;  3OXL A;  4G24 A;  4U0S A;  5DBK A;  5BW8 C;  3HYM B;  3QDN A;  1KT0 A;  4F3V A;  5EKQ D;  3ASD A;  3GW4 A;  3ESK A;  5CHE E;  3QWW A;  4BT8 A;  3ULQ A;  2VGX B;  3QWP A;  1IYG A;  1NA3 A;  3GZ2 A;  4ME2 A;  5KJK A;  4GA0 A;  1HZ4 A;  3E4B A;  3ZHE A;  4JA7 A;  1HH8 A;  1B89 A;  4G26 A;  5FT9 A;  2VYI A;  3ZFW A;  3SF4 A;  2VSN A;  1WM5 A;  5FTP A;  4A1S A;  3QWV A;  3ASG A;  2WQH A;  2XGM A;  4J8E A;  3CK7 A;  4APO A;  3S7D A;  2KCK A;  2XGS A;  4H7X A;  4KBQ A;  1NZN A;  4GZ5 A;  3CEQ A;  3KAE A;  4G25 A;  3MKR A;  4HOT A;  4UQZ A;  2PZI A;  4GZ6 A;  2HO1 A;  1ZBP A;  5EX0 A;  2UY1 A;  2FBN A;  3TGO A;  2FF4 A;  1TJC A;  3U3W A;  4KXK B;  3CVQ A;  2E2E A;  2QFC A;  4I9C A;  5C1D A;  1E96 B;  1KLX A;  1P5Q A;  2FEZ A;  4N3A A;  3ASF A;  3EDT B;  3LYA A;  4XIF A;  5FJY A;  4GPK A;  5D0Q D;  4GYY A;  3CVN A;  3CVL A;  5KJM A;  2VSY A;  2UWJ G;  2VGY A;  2PL2 A;  2LSV A;  5CCL A;  2P58 C;  3MEK A;  4BWR A;  4G1T A;  3CK8 A;  3MV3 B;  4O6F A;  4H7Y A;  4GCN A;  3VTY A;  3CVP A;  1ZU2 A;  4NRH B;  4N3C A;  5G04 J;  4HOR A;  2R5S A;  4GA2 A;  3MV2 B;  1PC2 A;  1A17 A;  3RO3 A;  4BTA A;  3UQ3 A;  1HXI A;  2FO7 A;  2J9Q A;  3RJV A;  4WNE A;  3RU0 A;  2JLB A;  2XPI A;  4UI9 J;  2XCB A;  4XI9 A;  1QQE A;  4HOS A;  3GZ1 A;  4I2Z A;  3BEE A;  3S7F A;  4IN3 B;  3PE3 A;  5FZQ A;  3CKB A;  4KYO B;  4N5C A;  4UI9 K;  1FCH A;  5JJT A;  3LY9 A;  2I6H A;  1IHG A;  3JYS A;  4YVQ C;  4N39 A;  1OUV A;  3RKV A;  4HOQ A;  3R9A B;  3ZN3 A;  4JHR A;  4N2Q A;  4I17 A;  2KCL A;  4NQ0 A;  4GZ3 A;  5LCW C;  2DBA A;  3Q5M A;  2VGX A;  3N71 A;  3Q15 A;  3LKU A;  4J0U A;  4YVO A;  1Y8M A;  5BNW A;  5BT1 A;  3S7B A;  4EQF A;  5JJ7 A;  4ABN A;  4J8F A;  4CGW A;  2PQN A;  5A6C A;  3TG4 A;  3LPZ A;  3U4T A;  2PQR A;  5KJL A;  4AIF A;  5A7D B;  3FFL A;  2KAT A;  4GYW A;  3ZGQ A;  3K9I A;  3TAX A;  5AYW D;  2XGO A;  1YA0 A;  4U04 A;  5DIZ A;  4I1A A;  4YND A;  4N3B A;  4BTB A;  4JA9 A;  3UPV A;  2YHC A;  3QOU A;  4Y6C A;  3KD7 A;  2BUG A;  2LSU A;  3Q49 B;  3ZPJ A;  4RG6 A;  2GW1 A;  2AVP A;  3QKY A;  5CCM A;  5JJ6 A;  4N2S A;  5G05 C;  1KT1 A;  3ZHE B;  5FZR A;  2OND A;  4B94 A;  1ELR A;  3RO2 A;  2LNI A;  4LEU A;  4JL0 A;  3ASH A;  3KS2 A;  4WND A;  4GYO A;  4AY5 A;  3LY8 A;  4G23 A;  3AS8 A;  5M72 A;  3AS4 A;  4UQY A;  4J8D A;  5FZS A;  3OXF A;  5EX3 A;  4GCO A;  2KCV A;  3CKC A;  4I9E A;  2V5F A;  4XI0 A;  3MA5 A;  1WAO 1;  2IF4 A;  4I2W A;  3CV0 A;  1XNF A;  1QZ2 A;  4GA1 A;  2UY1 B;  2IFU A;  2Y4T A;  4W9R A;  2NC9 A;  3IEG A;  3VTX A;  4U0U A;  4G2V A;  2VQ2 A;  3WXX A;  3URZ A;  4AY6 A;  5G04 C;  4WNG A;  2XCC A;  3RIB A;  2XEV A;  5G05 J;  2Y4U A;  4CGV A;  3CK9 A;  2HR2 A;  3S7J A;  2C0L A;  3O48 A;  4RG9 A;  2C2L A;  5ARG A;  4UQX A;  2L6J A;  4U07 A;  4UI9 C;  3LCA A;  4BT9 A;  5HQ8 A;  2FI7 A;  3UUX A;  3OXG A;  3PE4 A;  5ARF A;  3SZ7 A;  3FWV A;  1NA0 A;  3Q47 B;  3AS5 A;  3GYZ A;  2WPV A;  2KC7 A;  3TG5 A;  3NF1 A;  4U0Z A;  2C0M A;  3FP3 A;  3Q4A B; 
#chains in the Genus database with same CATH topology
 2DIW A;  3R7R A;  4AOF A;  1MHQ A;  4HRN A;  3ZW3 A;  3ZYL A;  4CDR A;  2IOS A;  4FJY A;  4U8V D;  3PDN A;  1N4S A;  3LXU X;  1S0P A;  5ENP D;  4NAC A;  3MJW A;  4Y6W A;  4L2Y A;  4HS2 A;  1JCS A;  1TNZ A;  3QDN A;  4FC8 A;  5EKQ D;  4OVV A;  2BKG A;  2CFZ A;  4LER A;  2DZO A;  2F8Y A;  3QWP A;  1N11 A;  1FPP A;  2IO3 C;  3ZXS A;  4ME2 A;  3SFZ A;  3TWV A;  3ONL A;  4GA0 A;  3E4B A;  4FUL A;  2WXL A;  1NFI E;  1KZP A;  4Z68 A;  1HH8 A;  2J4D A;  5FT9 A;  5AAO A;  1E8X A;  3SF4 A;  2X6I A;  1WM5 A;  4RLY A;  3V2X A;  2WQH A;  2OCC E;  5AJL A;  3CLJ A;  1LD7 A;  2GRN B;  4APO A;  4DX6 D;  3S7D A;  3APC A;  2XRY A;  3FUE A;  2IQC A;  3FEY A;  3ZUV B;  3FUJ A;  4E6H A;  3D9I A;  3KAE A;  2X6J A;  3FU6 A;  4FLB A;  4WWP A;  4BER A;  1H6P A;  4GZ6 A;  1H2T C;  4OVU A;  3G2T A;  2HO1 A;  2UY1 A;  4FHJ A;  4BEP A;  3TGO A;  2FF4 A;  3D9P A;  3NBN B;  3W9G A;  4KXK B;  4DUI A;  3UMV A;  3CVQ A;  4MLP A;  2QFC A;  3T5X A;  4I9C A;  4R7L A;  1EPU A;  3W9F A;  3ZRH A;  3HVE A;  2I9C A;  4YDO A;  2FEZ A;  3ABL E;  4BX9 A;  5KCM A;  2XHE A;  4XIF A;  1MX6 A;  1BI8 B;  3LVR E;  2A5U A;  4A3T A;  2AXU A;  3CVN A;  3FTS A;  3PNT B;  3QJZ A;  2ZGD A;  4JHK A;  2DYR E;  2PNN A;  3FUN A;  3Q75 A;  2LSV A;  3T9K A;  3MEK A;  4BWR A;  4G1T A;  1LTX A;  4BES A;  1INZ A;  3EIJ A;  3ISM C;  3MKQ A;  5CMW A;  1ZU2 A;  4NRH B;  3ZVV A;  5G2N A;  2R05 A;  3JQ1 A;  1K3Z D;  3AU5 A;  1N4Q A;  3L6A A;  1UG3 A;  1SZA A;  4XI9 A;  4UI9 J;  4HOS A;  4HVB A;  3I3N A;  4CT4 A;  1LF8 A;  3CKB A;  4UI9 K;  3C98 A;  5T4Y A;  5KWD A;  2XEN A;  1IHG A;  1MJ0 A;  4TUU A;  2EIK E;  3ZKJ A;  3JYS A;  3L13 A;  4C48 B;  3TXM A;  1N4P A;  2KCL A;  5LCW C;  2CFU A;  3TWS A;  3Q15 A;  3E32 A;  2OVF A;  3IHV A;  4YVO A;  2RFA A;  5C2Y A;  4ATZ D;  1OWN A;  1TN8 A;  4L9P A;  1FT1 A;  3CVW A;  3ML8 A;  2P9K G;  1BD8 A;  2P9U G;  2YNQ A;  5EYP F;  1N0R A;  1XGW A;  5ENN A;  3Q7A A;  3JXJ A;  4Q94 A;  4GYW A;  4FP7 A;  3J5P A;  3L08 A;  4B0Z A;  5AYW D;  2WXN A;  4A63 B;  4IYP A;  1Q2Z A;  4E85 A;  4Q96 A;  3ZYK A;  1O1R A;  4XEI G;  2A4Z A;  3OTN A;  3Q49 B;  2WXR A;  4O1O A;  3RSE G;  1VDY A;  4PUC A;  5FWQ A;  3PEV B;  4CT0 A;  3HHM A;  4C9B B;  5CRV A;  1E7U A;  3PUJ A;  3ZHE B;  4B94 A;  1ELR A;  1E7V A;  3NQP A;  4LEU A;  1JPL A;  4AVX A;  2WXF A;  3KS2 A;  3SFX A;  1X81 A;  3FUH A;  3PZ2 A;  4L23 A;  3AS8 A;  5ENS D;  5AQ9 A;  2L6B A;  1QYM A;  1OCR E;  4J8D A;  3OXF A;  3HXE A;  5EX3 A;  3E30 A;  1O1S A;  4GCO A;  4EZJ A;  2BED A;  4JEU A;  3CKC A;  2GRQ B;  2V5F A;  3ULY A;  5EN5 D;  5CBO A;  4I6J A;  4AXH A;  3SBS A;  2OEW A;  4GZD A;  3CVU A;  5FQ8 A;  4IRU A;  2IFU A;  2Y4T A;  1FT2 A;  3FTW A;  3G2U A;  4RQI A;  3NZS A;  1O5M A;  3AG3 E;  4HRL A;  5AQA A;  4GMR A;  4U0U A;  4GAA A;  2VQ2 A;  4ATG A;  2FO1 E;  3URZ A;  3I4G A;  2I1J A;  3L16 A;  3UM0 A;  4WNG A;  2XCC A;  3IBE A;  3PNL B;  4CGV A;  3BG1 B;  2C0L A;  3O48 A;  2JEK A;  4RG9 A;  5G55 A;  4UQX A;  4A55 A;  4BT9 A;  2IJG X;  2ZU6 B;  2FI7 A;  4AEZ C;  2VGE A;  2DYS E;  1N95 A;  4DJA A;  4G11 A;  4GZC A;  3SZ7 A;  3ABK E;  3UXG A;  2ION A;  3KSL A;  3T8M A;  2V0P A;  1S63 A;  3GYZ A;  2KC7 A;  1JWF A;  1JCQ A;  3TG5 A;  4U0Z A;  2C0M A;  2WVI A;  1OT8 A;  5AEN A;  3MCX A;  5FQ7 A;  1W3B A;  4L1B A;  4HOU A;  3C3R A;  1ELW A;  3LY7 A;  2OOE A;  3EHN A;  4K5B A;  3FUK A;  1K8K G;  4WUY A;  1S64 A;  3NOG D;  5KJN A;  3V79 K;  2MHK A;  5JHA A;  3TWU A;  2XPY A;  5BW8 C;  2ETB A;  3HYM B;  2OV8 A;  3F6Q A;  2XZD G;  3ASD A;  3ONK A;  2KM4 A;  3CHO A;  3FH8 A;  3ESK A;  2NYJ A;  3QWW A;  1EYH A;  3FTZ A;  3ZYQ A;  1IYG A;  4EBA A;  3GZ2 A;  4XKB A;  2R59 A;  5CRU A;  4GTM A;  4X8Q A;  3ZHE A;  1GW6 A;  3PS6 A;  3SGH A;  3FU3 A;  3Q79 A;  4TV3 A;  3UIN C;  3PEU B;  2VSN A;  2WMN A;  1YYH A;  5ENO D;  5FTP A;  1O1T A;  3T5V A;  1OWL A;  3QWV A;  3CHM A;  3NAW A;  1BU9 A;  4GTV A;  4G8K A;  5FIO A;  2OVB A;  4O60 A;  3I4R B;  1N54 A;  1WY6 A;  1L5J A;  2ZGG A;  2H6G A;  3PVL A;  2EIJ E;  2XGS A;  4MRU A;  3FU0 A;  4JZY A;  2B6C A;  5D2M C;  4G25 A;  4HOT A;  4ACK A;  3L22 A;  5D66 A;  5BUZ A;  4UQZ A;  2RFM A;  4DLQ A;  2L0T B;  2QY7 A;  2QYU A;  3ZYM A;  3D9H A;  2FBN A;  4BET A;  3U64 A;  1HG5 A;  1H6O A;  4U8H A;  3U3W A;  5KNH D;  4J6I A;  3EUV A;  2P9I G;  2H6I A;  4XX5 A;  3D9O A;  2V4H C;  4DI4 A;  1D9S A;  4KT6 B;  2VTB A;  1P5Q A;  2X6H A;  4LSZ E;  5ANL A;  3EDT B;  4F1P A;  5ENR D;  5FJY A;  4GPK A;  4RSY A;  4PH4 B;  3IXE A;  1K1A A;  3VLD A;  2VGY A;  4HBD A;  2EQX A;  5CCL A;  3CVX A;  4O1P A;  3CK8 A;  3G2S A;  1TJF A;  4MS6 A;  4CZ2 D;  4O6F A;  3VTY A;  5T8I A;  5G04 J;  4GTT A;  3RRU A;  4HOR A;  2R5S A;  4GA2 A;  1N0Q A;  3RO3 A;  1A17 A;  4BTA A;  1BI7 B;  2VJ8 A;  1HXI A;  2J9Q A;  4WNE A;  3E37 A;  2E0I A;  2JLB A;  3NOC D;  3AG1 E;  2XPI A;  1QQE A;  4I1M A;  3B95 A;  3Q7F A;  4U7E B;  4I2Z A;  2EIL E;  4PS7 A;  4IN3 B;  2XRZ A;  4LG6 A;  4N5C A;  5J90 A;  3Q78 A;  4TXR A;  1FCH A;  5CED B;  1H19 A;  5AQB A;  2LXM A;  3PH0 C;  4PS3 A;  2BF0 X;  2X6F A;  4WWN A;  2Y3A A;  3RKV A;  4RVB A;  3UKU G;  3ZN3 A;  3HRA A;  3R7Q A;  3SD5 A;  2CHW A;  1KPS B;  3KSQ A;  3N71 A;  4OAU C;  2DVW A;  4YDW A;  1DC2 A;  4LUN U;  5CBN A;  3S7B A;  3QNK A;  2YHE A;  4A3V A;  4ABN A;  2VSX E;  4CGW A;  3CST A;  4DRX E;  4B8C B;  1H6K A;  4XKC A;  3LPZ A;  1ZB1 A;  2PQR A;  1N52 A;  2L9B A;  3FFL A;  3ASO E;  2KAT A;  2M63 A;  2XZT G;  2IU1 A;  3ZGQ A;  4U04 A;  2Y1L E;  3X2Q E;  3B7R L;  4YND A;  4JA9 A;  3I5P A;  3EHM A;  1BPO A;  2YHC A;  2V8S E;  3FHE A;  2HM8 A;  3QOU A;  2LSU A;  4HNA D;  3G2W A;  3PUK A;  1JWG A;  4N2S A;  4CDN A;  3MX3 A;  2I2O A;  1SZ9 A;  4FU3 A;  5G05 C;  1AP7 A;  3APD A;  5AAR A;  4UUC A;  4JD2 G;  2LNI A;  2R2L A;  2J09 A;  3TWT A;  1H2V C;  1WG0 A;  1QNF A;  3O4Z A;  3PZD A;  4JL0 A;  3ASH A;  1TNO A;  1OWP A;  4WND A;  4AY5 A;  3D9N A;  2WQ6 A;  1TN7 A;  3LY8 A;  1E8Z A;  2P9L G;  5CER B;  4UQY A;  3UM2 A;  2KCV A;  2V5Q C;  1UN9 A;  5ANR A;  1DNP A;  3MA5 A;  4LNU D;  2WXP A;  2LAH A;  3FTV A;  1QZ2 A;  4F53 A;  4M3O A;  3QC1 A;  3UT4 A;  4UWF A;  5AIJ A;  3D9L A;  4BFR A;  4GTR A;  3IEG A;  3Q73 A;  3RAU A;  3VTX A;  3DPD A;  2CG3 A;  4G2V A;  4BY6 A;  3CIA A;  4UWH A;  3HDX A;  3FH7 A;  2R03 A;  5J08 A;  3MGB A;  4GMJ A;  2XEV A;  5G05 J;  2Y4U A;  3ABM E;  2HR2 A;  4KZ0 A;  3JUI A;  2C2L A;  3DSU A;  3FTX A;  2R17 C;  2L6J A;  4U07 A;  4HLL A;  3OXG A;  3DRA A;  3PE4 A;  4LNG A;  3PRZ A;  1HF8 A;  4UWK A;  4MKT A;  1ELK A;  3EJN A;  3Q47 B;  5IY5 E;  5B1B E;  1Z6T A;  4WAF A;  3FP3 A;  3EHR A;  4ANX A;  2AWI A;  4AM9 A;  3RRN B;  3DXM G;  4I6G A;  5HI7 A;  5LCW J;  5LFA A;  4EHM A;  4UWL A;  4B89 A;  2YQ8 A;  2Q7F A;  2HYZ A;  3IHY A;  3OXL A;  4G24 A;  4U0S A;  2LO6 A;  4HXI A;  1KT0 A;  1IHB A;  5HKP A;  2L0I A;  4F3V A;  3JXI A;  2ILR A;  4BT8 A;  3ULQ A;  3ZEF A;  2VGX B;  3CVY A;  2WXG A;  1HU3 A;  4TUM A;  4APF A;  1D8D A;  3CR3 A;  4JA7 A;  3RRM B;  4EEC A;  3LJN A;  4LCT A;  4L7T A;  5BPP A;  5EID A;  2VYI A;  3D9K A;  4HQD A;  3CQC B;  4A1S A;  3ASG A;  2WQ7 A;  3B7U X;  2XGM A;  4J8E A;  3OAW A;  3CK7 A;  5BV0 A;  2KZT B;  3MYV A;  3EHQ A;  2KCK A;  4H7X A;  4I1O B;  1NZN A;  2PM7 A;  3DEP A;  3U9W A;  3QAR A;  4GZ5 A;  3FUF A;  4NUR A;  4DX1 A;  2PZI A;  3DEO A;  4TRQ A;  5EX0 A;  2J49 A;  3AAA C;  4F1S A;  4LRZ A;  4F7A A;  3D9M A;  3FUM A;  2LAI A;  3JUE A;  1UJJ A;  4HB5 A;  4C0M A;  5ITZ F;  3EU5 A;  3DPY A;  2WXI A;  1KLX A;  2AXZ A;  2MRI A;  4FJZ A;  1OY3 D;  4TXP A;  3FTY A;  4JPS A;  5EIB E;  4ANU A;  3ML9 A;  5D0Q D;  1YCS B;  3HXF A;  5KJM A;  3CVL A;  5BXO A;  2VSY A;  3TXN A;  2UWJ G;  4GB9 A;  3FUI A;  4B93 B;  2P58 C;  3DSX A;  3UM1 A;  5JHB A;  4QFV A;  3MV3 B;  3B7T A;  1SW6 A;  2DWZ A;  4IUL A;  4H7Y A;  4AP2 A;  2YIN A;  4AJW A;  3CVP A;  4N3C A;  4GPM A;  2WXM A;  3MV2 B;  5LP0 A;  1EF1 C;  4CEM A;  1UN8 A;  3SNX A;  1Y6I A;  2FO7 A;  3RJV A;  3CSF A;  4YDE A;  4GML A;  5EYL A;  2X3M A;  1IQR A;  1PAQ A;  2J4B A;  3DSV A;  1QBQ A;  4K5A B;  4GTP A;  3BEE A;  3S7F A;  3S2A A;  3B7S A;  5KNG A;  1IKN D;  4HI8 A;  4BSZ B;  3J5Q B;  2CHZ A;  5JJT A;  3LY9 A;  2LUH A;  4WWO A;  2GRO B;  4YVQ C;  1JCR A;  4N39 A;  5H7P A;  1OUV A;  1MZC A;  1E8W A;  2AJA A;  3CHP A;  4HOQ A;  1N9A A;  3R9A B;  4N2Q A;  3SO8 A;  1TNU A;  3ZNG A;  4I17 A;  4NQ0 A;  3SY2 A;  2DBA A;  3Q5M A;  2VGX A;  3AG2 E;  4U96 D;  3BU8 A;  3LKU A;  3CGH A;  1Y8M A;  4FA6 A;  3SQV A;  4U8Y D;  2XEH A;  5BT1 A;  1NP7 A;  3TJP A;  4GTS A;  4EQF A;  1TN6 A;  3UT7 A;  4J8F A;  1TR4 A;  5A6C A;  3AJI A;  5EDS A;  2DCP A;  2JAB A;  4GU5 A;  2IO2 C;  2P9P G;  2HE0 A;  4BX8 A;  3LEW A;  4J8S A;  2IY0 C;  4DK5 A;  1OCZ E;  5ENQ D;  3DXK G;  3ZIM A;  3TAX A;  1YA0 A;  2KZT A;  5DIZ A;  4D10 C;  3TWR A;  4YDY A;  4BTB A;  3AG4 E;  5E75 A;  3AU4 A;  2P9S G;  4A1G A;  4ACL A;  2BUG A;  2X38 A;  3PZ4 A;  2X6K A;  5BV1 A;  4RG6 A;  4JVS A;  1H0A A;  2CG2 A;  2AVP A;  3QKY A;  5CCM A;  5JJ6 A;  3U66 A;  3B7B A;  2P9N G;  1HE8 A;  5B3S E;  4BSX A;  1KT1 A;  5FZR A;  2OND A;  3RO2 A;  2OEV A;  5A23 A;  2Y0B G;  3FU5 A;  1MX2 A;  4GYO A;  1DCQ A;  4PDX A;  3JCK C;  4EZK A;  2P2C P;  3UI2 A;  4G23 A;  1Z5S C;  5FZS A;  4ZFH A;  1RW2 A;  3UM3 A;  5E76 A;  1HS6 A;  3CHQ A;  2B0O E;  4XI0 A;  3HIZ A;  3E33 A;  3TWW A;  1G3N B;  1DVP A;  2WXJ A;  2IF4 A;  3Q9U C;  1A5E A;  2XS1 A;  3C3O A;  4W9R A;  4K03 A;  1TNY A;  1FVH A;  3SFY A;  4G8L A;  3WXX A;  5LX8 A;  4ANW A;  4AY6 A;  5CEC B;  1E8Y A;  4N5Q A;  1FVF A;  5EIL A;  3C72 A;  5B1A E;  3CK9 A;  3EIQ C;  3HXC A;  5ARG A;  1TNB A;  1HFA A;  4UI9 C;  3LCA A;  2KXP C;  5HQ8 A;  3LVQ E;  3LJ3 A;  4KVM A;  4M7C A;  2WXK A;  1OWM A;  4DI3 A;  3FWV A;  3UT8 A;  4V3I A;  3APF A;  4URK A;  1HX8 A;  2J8S D;  3SBT B;  1N94 A;  3AS5 A;  2WPV A;  3WG7 E;  1MYO A;  3NF1 A;  3ESL A;  1X5B A;  4TXQ A;  4DX7 D;  3UTM A;  1V54 E;  4WNF A;  5D0O D;  2Y69 E;  2FUL A;  2IOL A;  5DBK A;  1EDU A;  4CDM A;  2A5E A;  1UOH A;  2RD0 A;  3ULE G;  3GW4 A;  2WXO A;  5CHE E;  4JC8 A;  3BG0 B;  5AN8 A;  4KMO A;  1OXJ A;  1NA3 A;  1V55 E;  3FDH A;  4HI9 A;  1IQU A;  3VLE A;  5KJK A;  1HZ4 A;  1UW4 B;  3ENE A;  3V31 A;  3CQG B;  4L2L A;  1H2U A;  4HFG A;  3D3M A;  1PY1 A;  4ZHB A;  4FHK A;  3UKR G;  1B89 A;  3QK0 A;  2WXH A;  4G26 A;  3ZU7 B;  3TWX A;  3ZFW A;  1OWO A;  1MQS A;  1OCC E;  2H6H A;  2ZIS A;  3QB2 A;  3UIO C;  4EZL A;  4DX5 D;  2XEE A;  1D8E A;  4FAD A;  4OAV B;  4K0R A;  3FUL A;  3DSW A;  3TWQ A;  2ZXW E;  4KBQ A;  3DSS A;  3ZXP A;  3CEQ A;  3MKR A;  4OYS A;  1KZO A;  1WDY A;  2V4L A;  1U2V G;  3FTU A;  1ZBP A;  4P29 A;  2F8X K;  4U95 D;  1TJC A;  4GTQ A;  1JUQ A;  2E2E A;  1SQM A;  2J07 A;  5C1D A;  1E96 B;  4J8Y A;  2EIN E;  2XPZ A;  3G2V A;  3LDZ A;  4N3A A;  3ASF A;  2WXQ A;  1SA4 A;  3LYA A;  4JW1 A;  4GYY A;  3CVV A;  1U3C A;  3EU9 A;  1OCO E;  4ILI A;  2PL2 A;  2R02 A;  2RKK A;  5KBA A;  4F6R D;  3BUA A;  4EBA G;  2QZA A;  5AJD A;  4ILG A;  3R9M A;  3CHR A;  4GCN A;  4HRM B;  4UWG A;  3FY4 A;  3UIP C;  4KVO A;  1PC2 A;  3UQ3 A;  3ASN E;  3L17 A;  3RU0 A;  1BLX B;  2XQ0 A;  3QAQ A;  1HO8 A;  4C0E A;  3C3Q A;  2XCB A;  1N4R A;  3GZ1 A;  3LS8 A;  1TEZ A;  4DLO A;  2WMO A;  3HXD A;  3L9T A;  1SA5 A;  5CEA A;  3PE3 A;  5FZQ A;  4KYO B;  5FQ4 A;  4J7W A;  4U63 A;  2I6H A;  2GRM A;  3B13 A;  4DX2 A;  1IXV A;  2GRP B;  1SVX A;  3HG0 D;  4JHR A;  2ETA A;  2WM9 A;  2KBX A;  3C5R A;  4GZ3 A;  4XE0 A;  5FQ6 A;  2EIM E;  4J0U A;  1E90 A;  2GRL A;  1Z3X A;  5BNW A;  3MZL B;  3NB2 A;  1TYQ G;  2AW6 A;  2BKK B;  5BXU A;  5JJ7 A;  3SI5 A;  2VTB B;  2PQN A;  2F0Y A;  4PS8 A;  3T8K A;  3L82 A;  3TG4 A;  3TL5 A;  4K5C A;  3U4T A;  4JB8 P;  5KJL A;  4AIF A;  5A7D B;  1S70 B;  3IKO B;  3K9I A;  2XGO A;  3V2O A;  4I1A A;  1AWC B;  2F37 A;  4N3B A;  5HRY A;  3Q9N C;  3KEA A;  4HLE A;  1MX4 A;  4CRW A;  3UPV A;  1YMP A;  2VSO E;  3NZU A;  2I1K A;  4I6E A;  4Y6C A;  3KD7 A;  4ILH B;  3ZPJ A;  4B8A A;  2GW1 A;  2LXL A;  1U3D A;  3IV0 A;  3PZ3 A;  5CMY A;  2MOW A;  2ZIR A;  3HXB A;  2NSZ A;  4KZC A;  3V30 A;  3PRE A;  2NXP A;  4QQI A;  3SHF A;  3D9J A;  1LD8 A;  3PZ1 A;  3P1U A;  1UJK A;  5HS0 A;  5JMN D;  5M72 A;  3FH5 A;  3AS4 A;  4FLH A;  3UX4 A;  3FUD A;  4I9E A;  2IEJ A;  4XZ4 A;  2QYJ A;  4AV7 A;  3RK6 A;  5FIN A;  4LNB A;  1WAO 1;  2GRR B;  4CYM D;  4I2W A;  3CV0 A;  1XNF A;  3DST A;  4GA1 A;  1HG2 A;  2UY1 B;  4CCA A;  4ANV A;  1DCE A;  2NC9 A;  2BTD A;  3BQO A;  4JXT A;  4MBG A;  3DWL G;  2QC9 A;  2GGF A;  4EPZ A;  3HVE B;  2XS8 A;  3KEZ A;  5G04 C;  1NL4 A;  3RIB A;  2MYO A;  5LOZ A;  5AQ7 A;  2CHX A;  3S7J A;  2J08 A;  4JHJ A;  3FEX A;  1Z3Y A;  2RG8 A;  3L54 A;  4DPR A;  2ETC A;  3UUX A;  5T3R A;  5ARF A;  2DZN A;  4Q69 A;  5JA4 D;  4GTO A;  2PM6 A;  5ENT D;  1K1B A;  3DBS A;  1NI1 A;  3P2B A;  3GZS A;  1NA0 A;  3MKQ B;  2WB2 A;  4NIK A;  2H6F A;  3VLF A;  4JEH A;  4I43 A;  3JQ0 A;  3E34 A;  3CHS A;  2AXV A;  3Q4A B;  1RZ4 A; 
#chains in the Genus database with same CATH homology
 2DIW A;  1W3B A;  3R7R A;  4AOF A;  1MHQ A;  4L1B A;  4AM9 A;  4HOU A;  3ZW3 A;  3ZYL A;  4CDR A;  2IOS A;  4FJY A;  1ELW A;  3LY7 A;  3RRN B;  2OOE A;  3PDN A;  4I6G A;  3EHN A;  5HI7 A;  5LCW J;  5LFA A;  3LXU X;  4UWL A;  3FUK A;  4B89 A;  4WUY A;  2YQ8 A;  4WNF A;  1S0P A;  5D0O D;  4NAC A;  5KJN A;  2Q7F A;  2HYZ A;  3MJW A;  3IHY A;  2MHK A;  2FUL A;  4L2Y A;  2IOL A;  3OXL A;  4Y6W A;  4G24 A;  5JHA A;  4U0S A;  5DBK A;  2XPY A;  5BW8 C;  4HS2 A;  2LO6 A;  1EDU A;  4HXI A;  4CDM A;  3HYM B;  3QDN A;  4FC8 A;  2OV8 A;  1KT0 A;  2L0I A;  4F3V A;  5EKQ D;  2RD0 A;  3ASD A;  4OVV A;  3GW4 A;  2KM4 A;  3ONK A;  3CHO A;  3FH8 A;  2WXO A;  3ESK A;  5CHE E;  2ILR A;  4JC8 A;  3QWW A;  4BT8 A;  1EYH A;  2CFZ A;  3ULQ A;  3BG0 B;  4LER A;  3ZEF A;  2VGX B;  3FTZ A;  3QWP A;  4KMO A;  3ZYQ A;  3CVY A;  1IYG A;  1NA3 A;  3ZXS A;  2WXG A;  4EBA A;  3GZ2 A;  1HU3 A;  4ME2 A;  4XKB A;  2R59 A;  3FDH A;  3SFZ A;  4APF A;  1IQU A;  3VLE A;  3ONL A;  4GA0 A;  5KJK A;  1HZ4 A;  1UW4 B;  3ENE A;  3E4B A;  4FUL A;  3CQG B;  4L2L A;  2WXL A;  1H2U A;  4HFG A;  3ZHE A;  1GW6 A;  3CR3 A;  3D3M A;  1PY1 A;  4FHK A;  4JA7 A;  3RRM B;  4EEC A;  1HH8 A;  4LCT A;  4L7T A;  3PS6 A;  1B89 A;  3SGH A;  2J4D A;  3QK0 A;  2WXH A;  4G26 A;  5FT9 A;  5BPP A;  3FU3 A;  2VYI A;  3D9K A;  3ZFW A;  4TV3 A;  1E8X A;  1OWO A;  1MQS A;  3SF4 A;  3PEU B;  2VSN A;  2X6I A;  2WMN A;  1WM5 A;  3QB2 A;  3CQC B;  5FTP A;  4A1S A;  3T5V A;  1OWL A;  3QWV A;  3ASG A;  3CHM A;  4EZL A;  2WQ7 A;  3B7U X;  2WQH A;  5AJL A;  2XGM A;  4J8E A;  2OVB A;  3OAW A;  3CLJ A;  3I4R B;  1N54 A;  3CK7 A;  4FAD A;  4APO A;  5BV0 A;  2KZT B;  3MYV A;  4K0R A;  1WY6 A;  3FUL A;  1L5J A;  3S7D A;  3APC A;  2XRY A;  2KCK A;  3PVL A;  3FUE A;  2XGS A;  4H7X A;  4I1O B;  2IQC A;  1NZN A;  2PM7 A;  3FEY A;  4KBQ A;  4MRU A;  3FU0 A;  3FUJ A;  3U9W A;  3QAR A;  3D9I A;  4GZ5 A;  4E6H A;  3CEQ A;  3KAE A;  3FUF A;  4NUR A;  4JZY A;  2X6J A;  4G25 A;  3MKR A;  4ACK A;  3L22 A;  4OYS A;  4HOT A;  5BUZ A;  3FU6 A;  4UQZ A;  2PZI A;  4FLB A;  4WWP A;  4DLQ A;  4GZ6 A;  4TRQ A;  1H2T C;  2V4L A;  4OVU A;  2L0T B;  3G2T A;  2HO1 A;  2QY7 A;  3FTU A;  3ZYM A;  1ZBP A;  5EX0 A;  4P29 A;  2J49 A;  2UY1 A;  4FHJ A;  2FBN A;  4F1S A;  4LRZ A;  4F7A A;  3D9M A;  3TGO A;  3FUM A;  3U64 A;  1HG5 A;  2FF4 A;  3D9P A;  2LAI A;  1TJC A;  4U8H A;  3U3W A;  4KXK B;  1UJJ A;  3UMV A;  1JUQ A;  3CVQ A;  4C0M A;  2E2E A;  4MLP A;  2QFC A;  3T5X A;  4I9C A;  4J6I A;  4R7L A;  1SQM A;  2J07 A;  5C1D A;  1E96 B;  1EPU A;  2WXI A;  3ZRH A;  4XX5 A;  1KLX A;  3HVE A;  3D9O A;  2I9C A;  2XPZ A;  4DI4 A;  3G2V A;  3LDZ A;  4KT6 B;  1P5Q A;  2FEZ A;  2X6H A;  2AXZ A;  2MRI A;  4N3A A;  2VTB A;  3ASF A;  5ANL A;  2WXQ A;  4BX9 A;  4FJZ A;  5KCM A;  3EDT B;  3FTY A;  2XHE A;  3LYA A;  4JPS A;  4XIF A;  4JW1 A;  5FJY A;  4ANU A;  4GPK A;  3ML9 A;  5D0Q D;  4RSY A;  3LVR E;  2A5U A;  4A3T A;  4GYY A;  2AXU A;  4PH4 B;  3CVV A;  3CVN A;  3CVL A;  5KJM A;  1U3C A;  2VSY A;  3FTS A;  3PNT B;  2UWJ G;  3QJZ A;  4GB9 A;  3TXN A;  3VLD A;  2VGY A;  3FUI A;  4JHK A;  4ILI A;  2PL2 A;  2EQX A;  3FUN A;  4CT0 A;  2LSV A;  5CCL A;  2P58 C;  3MEK A;  4BWR A;  3CVX A;  4G1T A;  4EBA G;  5JHB A;  4QFV A;  3CK8 A;  3MV3 B;  3G2S A;  5AJD A;  1TJF A;  3B7T A;  4MS6 A;  4ILG A;  1INZ A;  4IUL A;  3EIJ A;  3CHR A;  4H7Y A;  4GCN A;  4O6F A;  4AP2 A;  2YIN A;  3VTY A;  3MKQ A;  5T8I A;  4AJW A;  3CVP A;  4UWG A;  1ZU2 A;  5CMW A;  4NRH B;  4N3C A;  3ZVV A;  5G04 J;  3FY4 A;  5G2N A;  3RRU A;  4HOR A;  4KVO A;  2WXM A;  2R5S A;  4GA2 A;  3MV2 B;  1PC2 A;  1A17 A;  3RO3 A;  4BTA A;  3JQ1 A;  5LP0 A;  1EF1 C;  3UQ3 A;  4CEM A;  1UN8 A;  1HXI A;  2VJ8 A;  3L17 A;  1Y6I A;  3SNX A;  2FO7 A;  2J9Q A;  3AU5 A;  3RJV A;  3CSF A;  4WNE A;  3L6A A;  4GML A;  3RU0 A;  3QAQ A;  2XQ0 A;  1UG3 A;  2E0I A;  2X3M A;  2JLB A;  1IQR A;  1PAQ A;  2J4B A;  1HO8 A;  4C0E A;  1SZA A;  2XPI A;  4UI9 J;  2XCB A;  4XI9 A;  1QQE A;  4I1M A;  4HOS A;  3GZ1 A;  3I3N A;  4HVB A;  4CT4 A;  4I2Z A;  3LS8 A;  1TEZ A;  3BEE A;  4PS7 A;  4DLO A;  2WMO A;  3S7F A;  4IN3 B;  1LF8 A;  2XRZ A;  3PE3 A;  5FZQ A;  3CKB A;  4KYO B;  3S2A A;  4N5C A;  5J90 A;  3B7S A;  5FQ4 A;  4UI9 K;  3C98 A;  5T4Y A;  1FCH A;  2CHZ A;  5JJT A;  3LY9 A;  4U63 A;  1H19 A;  2I6H A;  2GRM A;  3PH0 C;  1IHG A;  4TUU A;  3B13 A;  4PS3 A;  2BF0 X;  4WWO A;  3JYS A;  4YVQ C;  2X6F A;  4N39 A;  4WWN A;  1OUV A;  2Y3A A;  3RKV A;  1E8W A;  3CHP A;  3L13 A;  4RVB A;  4HOQ A;  3TXM A;  3R9A B;  3ZN3 A;  4JHR A;  2WM9 A;  4N2Q A;  4I17 A;  2KCL A;  4NQ0 A;  4GZ3 A;  5LCW C;  3R7Q A;  2CFU A;  2DBA A;  3Q5M A;  3SD5 A;  2CHW A;  2VGX A;  4XE0 A;  3N71 A;  5FQ6 A;  3Q15 A;  3LKU A;  4J0U A;  1E90 A;  2OVF A;  2GRL A;  3IHV A;  4YVO A;  3CGH A;  1Y8M A;  1Z3X A;  4FA6 A;  3MZL B;  5BNW A;  5C2Y A;  5BT1 A;  2AW6 A;  1NP7 A;  4LUN U;  3TJP A;  1OWN A;  3S7B A;  3QNK A;  2YHE A;  4A3V A;  4EQF A;  3UT7 A;  5JJ7 A;  3SI5 A;  4ABN A;  2VSX E;  4J8F A;  4CGW A;  2VTB B;  2PQN A;  3CST A;  4PS8 A;  5A6C A;  4B8C B;  3TG4 A;  5EDS A;  2DCP A;  3CVW A;  1H6K A;  4GU5 A;  3TL5 A;  3ML8 A;  4XKC A;  3LPZ A;  3U4T A;  2PQR A;  4BX8 A;  2YNQ A;  3LEW A;  5KJL A;  4J8S A;  4AIF A;  1N52 A;  2L9B A;  5A7D B;  3FFL A;  2KAT A;  2M63 A;  4DK5 A;  2IU1 A;  1XGW A;  5ENN A;  4Q94 A;  4GYW A;  4FP7 A;  3IKO B;  3ZIM A;  3ZGQ A;  3L08 A;  3K9I A;  3TAX A;  4B0Z A;  5AYW D;  2XGO A;  1YA0 A;  2WXN A;  4U04 A;  2KZT A;  4IYP A;  5DIZ A;  4I1A A;  3B7R L;  4D10 C;  4YND A;  4N3B A;  3S7J A;  4BTB A;  5E75 A;  4E85 A;  4Q96 A;  3AU4 A;  4JA9 A;  3ZYK A;  4HLE A;  3I5P A;  4CRW A;  3UPV A;  4A1G A;  3EHM A;  1BPO A;  2VSO E;  3NZU A;  4ACL A;  2I1K A;  2YHC A;  2V8S E;  3FHE A;  2HM8 A;  4I6E A;  3QOU A;  4Y6C A;  2A4Z A;  3KD7 A;  2BUG A;  2LSU A;  3OTN A;  2X38 A;  3Q49 B;  2WXR A;  3G2W A;  4ILH B;  3PUK A;  3ZPJ A;  2X6K A;  5BV1 A;  4RG6 A;  4B8A A;  1VDY A;  2GW1 A;  4JVS A;  1H0A A;  2CG2 A;  2AVP A;  3QKY A;  5CCM A;  4PUC A;  1JWG A;  1U3D A;  5FWQ A;  5JJ6 A;  3U66 A;  3IV0 A;  5CMY A;  4N2S A;  3PEV B;  1HE8 A;  3MX3 A;  4CDN A;  3HHM A;  2I2O A;  1SZ9 A;  2MOW A;  4FU3 A;  4BSX A;  5G05 C;  4C9B B;  3APD A;  2NSZ A;  1KT1 A;  1E7U A;  3PUJ A;  3ZHE B;  5FZR A;  4KZC A;  2OND A;  4B94 A;  1ELR A;  3RO2 A;  1E7V A;  3NQP A;  3PRE A;  2LNI A;  4LEU A;  5A23 A;  2NXP A;  2J09 A;  1H2V C;  1QNF A;  3O4Z A;  3SHF A;  1JPL A;  3D9J A;  3PZD A;  4AVX A;  4JL0 A;  3ASH A;  3FU5 A;  2WXF A;  1OWP A;  3KS2 A;  4WND A;  4GYO A;  4AY5 A;  4PDX A;  3D9N A;  1UJK A;  3P1U A;  2WQ6 A;  3JCK C;  3FUH A;  3LY8 A;  4EZK A;  4L23 A;  1E8Z A;  4G23 A;  3AS8 A;  5M72 A;  3FH5 A;  3AS4 A;  4FLH A;  4UQY A;  4J8D A;  5FZS A;  3OXF A;  5EX3 A;  3UX4 A;  4GCO A;  2KCV A;  4EZJ A;  4JEU A;  3CKC A;  5E76 A;  1HS6 A;  3FUD A;  4I9E A;  2V5F A;  4XZ4 A;  3CHQ A;  4XI0 A;  1UN9 A;  3HIZ A;  5ANR A;  4AV7 A;  1DNP A;  4I6J A;  3RK6 A;  3MA5 A;  4AXH A;  1DVP A;  3SBS A;  1WAO 1;  2WXJ A;  2IF4 A;  4GZD A;  2WXP A;  3CVU A;  2LAH A;  3FTV A;  4I2W A;  3CV0 A;  1XNF A;  1QZ2 A;  4F53 A;  4GA1 A;  4M3O A;  5FQ8 A;  1HG2 A;  2UY1 B;  3QC1 A;  4IRU A;  2IFU A;  4CCA A;  2Y4T A;  4ANV A;  3UT4 A;  4UWF A;  3FTW A;  3G2U A;  4W9R A;  5AIJ A;  3D9L A;  3NZS A;  4K03 A;  2NC9 A;  1FVH A;  2BTD A;  4BFR A;  3IEG A;  4JXT A;  3VTX A;  3DPD A;  4U0U A;  2CG3 A;  4G2V A;  4GAA A;  2VQ2 A;  3WXX A;  4ATG A;  4BY6 A;  2GGF A;  5LX8 A;  4ANW A;  3URZ A;  4EPZ A;  3CIA A;  3I4G A;  4AY6 A;  4UWH A;  3HDX A;  1E8Y A;  3FH7 A;  2I1J A;  3HVE B;  3KEZ A;  1FVF A;  3L16 A;  5G04 C;  5J08 A;  3MGB A;  4WNG A;  2XCC A;  3IBE A;  4GMJ A;  3RIB A;  2XEV A;  5LOZ A;  5G05 J;  2Y4U A;  3PNL B;  2CHX A;  4CGV A;  3CK9 A;  2HR2 A;  3BG1 B;  3EIQ C;  4KZ0 A;  2C0L A;  3O48 A;  2JEK A;  3JUI A;  2J08 A;  4JHJ A;  2C2L A;  3FEX A;  1Z3Y A;  2RG8 A;  4RG9 A;  5ARG A;  5G55 A;  4UQX A;  3FTX A;  4A55 A;  1HFA A;  2L6J A;  2R17 C;  3L54 A;  4U07 A;  4UI9 C;  3LCA A;  4DPR A;  4BT9 A;  2ZU6 B;  2IJG X;  5HQ8 A;  3LVQ E;  2FI7 A;  3LJ3 A;  4KVM A;  3UUX A;  3OXG A;  2WXK A;  5T3R A;  1OWM A;  3PE4 A;  4AEZ C;  5ARF A;  4Q69 A;  3PRZ A;  4DI3 A;  4DJA A;  4G11 A;  2PM6 A;  1HF8 A;  4UWK A;  3DBS A;  4GZC A;  3SZ7 A;  3FWV A;  4MKT A;  1ELK A;  3UT8 A;  3P2B A;  3GZS A;  4V3I A;  2ION A;  3EJN A;  3APF A;  4URK A;  1NA0 A;  1HX8 A;  3T8M A;  3Q47 B;  3MKQ B;  3SBT B;  2V0P A;  2WB2 A;  3AS5 A;  3GYZ A;  2WPV A;  1Z6T A;  3VLF A;  4JEH A;  2KC7 A;  1JWF A;  4I43 A;  3TG5 A;  3NF1 A;  3JQ0 A;  4U0Z A;  4WAF A;  2C0M A;  3FP3 A;  2WVI A;  3ESL A;  4ANX A;  1X5B A;  3CHS A;  2AXV A;  5AEN A;  3MCX A;  3Q4A B;  5FQ7 A;  2AWI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...