2J9QA

A novel conformation for the tpr domain of pex5p
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
328
structure length
300
Chain Sequence
GMGLTSATYDKGYQFEEENPLRDHPQPFEEGLRRLQEGDLPNAVLLFEAAVQQDPKHMEAWQYLGTTQAENEQELLAISALRRCLELKPDNQTALMALAVSFTNESLQRQACEILRDWLRYTPAYAHLVTPSLFLEVKELFLAAVRLDPTSIDPDVQCGLGVLFNLSGEYDKAVDCFTAALSVRPNDYLLWNKLGATLANGNQSEEAVAAYRRALELQPGYIRSRYNLGISCINLGAHREAVEHFLEALNMQRKSRGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLLTMFGLPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Previously Unobserved Conformation for the Human Pex5P Receptor Suggests Roles for Intrinsic Flexibility and Rigid Domain Motions in Ligand Binding
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords PEROXISOMAL TARGETING SIGNAL 1 RECEPTOR
total genus 111
structure length 300
sequence length 328
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13181 TPR_8 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2j9qA00
2ONDA 4GA0A 4GCOA 4N3BA 5FTPA 5AYWD 3ASGA 4N5CA 3TAXA 3JYSA 4APOA 5FJYA 2DBAA 5BT1A 4I1AA 2WPVA 2C0LA 2IFUA 4HOUA 4U0SA 2KATA 2LNIA 4NRHB 4WNFA 5ARFA 4RG9A 2KCKA 2PZIA 2PQNA 1HH8A 1KT1A 3CKBA 3ESKA 3GYZA 3Q5MA 4UQZA 3ZFWA 1KT0A 3ASDA 3OXLA 3K9IA 1XNFA 2FI7A 4GZ6A 3SZ7A 2XCCA 2FBNA 4GZ3A 4I2ZA 3TG5A 4AY5A 4HOTA 2I6HA 4ABNA 2NC9A 4RG6A 3S7FA 3OXFA 4YVQC 1KLXA 2VSNA 4KBQA 3GZ2A 4LEUA 5ARGA 4KXKB 4G2VA 3QDNA 5FZRA 2UWJG 2XGMA 4G1TA 4G26A 1ZBPA 3RIBA 3RO2A 4EQFA 2XGSA 4N2QA 4YVOA 3ZHEA 5CCLA 4N2SA 2KCLA 4JA9A 4N39A 2OOEA 3PE3A 3QOUA 3UUXA 2WQHA 3O48A 3TGOA 1PC2A 4Y6CA 3BEEA 5FT9A 4BTBA 1NZNA 3CK9A 4G23A 5LCWJ 3Q49B 4O6FA 5A6CA 2XEVA 4G24A 3KAEA 2R5SA 4J8FA 4N3AA 2VYIA 3VTYA 5KJNA 1ELWA 3IEGA 3U4TA 5CCMA 3PE4A 2PQRA 2LSVA 2VGXB 2Y4UA 3CK7A 3CVLA 3HYMB 4AIFA 1IHGA 4UQYA 3AS8A 4BT8A 2AVPA 5KJKA 3U3WA 3EDTB 1W3BA 5CHEE 4W9RA 4CGWA 4HORA 2V5FA 4N3CA 4UI9J 3FP3A 4GPKA 4GA1A 4GYWA 5JJ6A 2L6JA 3UQ3A 4GCNA 1HXIA 2FF4A 3E4BA 2VGYA 4U07A 3CVQA 4WNGA 4I9EA 1QQEA 2FEZA 5EX0A 4AY6A 2KC7A 4J8DA 3LY7A 3S7DA 1NA0A 3FWVA 1NA3A 2PL2A 3LKUA 3N71A 3PDNA 4NQ0A 4B94A 3MV3B 4H7XA 3RKVA 4H7YA 3Q4AB 4XI9A 3MV2B 4J8EA 5EKQD 5JJTA 3GW4A 2Y4TA 1P5QA 2C2LA 3LY8A 2E2EA 3QWVA 5D0QD 3CKCA 2GW1A 2HR2A 3FFLA 4F3VA 2HYZA 4IN3B 3RO3A 2QFCA 1IYGA 2UY1A 5G04C 5BNWA 2IF4A 1ZU2A 4U04A 5HI7A 2XGOA 2LSUA 3ZGQA 4HOSA 3ZPJA 3QWWA 3LCAA 4HOQA 3RJVA 2VQ2A 3RU0A 3SF4A 5A7DB 4BT9A 5KJLA 2JLBA 4BTAA 2VGXA 5G05C 4J0UA 5KJMA 1YA0A 2KCVA 3LPZA 3MA5A 4G25A 4WNEA 3ZHEB 3ZN3A 4CGVA 1TJCA 1ELRA 4GA2A 3LYAA 4A1SA 5DIZA 5DBKA 5FZQA 2BUGA 4I17A 3LY9A 4XI0A 4YNDA 3KS2A 5FZSA 1E96B 2XPIA 3AS4A 4ME2A 5M72A 3MEKA 2HO1A 2P58C 3NF1A 5EX3A 5G04J 3CVPA 3R9AB 1OUVA 4I9CA 1B89A 1FCHA 2Q7FA 4I2WA 3CEQA 4GYYA 3CVNA 5JJ7A 3ASHA 4WUYA 2J9QA 4UQXA 3UPVA 2VSYA 3ASFA 1A17A 4U0ZA 4GYOA 3VTXA 3OXGA 4AM9A 4JHRA 3S7BA 1QZ2A 2YHCA 3QWPA 2FO7A 4XIFA 4CDRA 1WAO1 3Q15A 3QKYA 2MHKA 5HQ8A 3MKRA 4JL0A 2UY1B 4U0UA 4Y6WA 5G05J 3S7JA 4UI9K 3ULQA 3WXXA 1WM5A 4BWRA 5C1DA 3AS5A 3CK8A 4GZ5A 5D0OD 3GZ1A 1Y8MA 3KD7A 5LCWC 2C0MA 3CV0A 4UI9C 4KYOB 4WNDA 2YQ8A 3Q47B 5BW8C 3TG4A 2XCBA 4JA7A 3URZA 1HZ4A
chains in the Genus database with same CATH superfamily
4GA0A 3FEXA 1YCSB 2PM7A 2GRMA 2RFAA 4JHJA 1K8KG 2XHEA 4DX7D 3GZ2A 3TWWA 4G2VA 2GRNB 4NACA 2YHEA 4N2QA 4U8YD 3UT4A 5B3SE 3UM0A 2KCLA 5D2MC 4JEHA 3B7UX 3E37A 1TNZA 3KEZA 4GTTA 4JB8P 2VTBB 3IEGA 3PE4A 3CVLA 4TRQA 3TWQA 3T8MA 4K5AB 1Z5SC 2CFZA 3E4BA 4HNAD 4O60A 1NA0A 5ENTD 2XEEA 4EBAA 1TN8A 4EZLA 1VDYA 2HYZA 3T8KA 2XS8A 1D9SA 4DJAA 3ZPJA 3QWWA 4M3OA 3LCAA 4L1BA 5KWDA 4J0UA 3MZLB 5AQAA 2WXIA 3ML8A 3ONLA 3UT8A 3TWTA 2RD0A 3MEKA 2P58C 5KNHD 1DNPA 3FTSA 3Q73A 3QK0A 3R7RA 2QZAA 3PZ3A 2J9QA 1DVPA 3ASFA 4PUCA 4XIFA 1E7VA 2IOSA 4IRUA 4ILGA 3C3QA 1OCOE 1MZCA 5AYWD 3FUIA 1K1AA 5CEAA 2MOWA 5ITZF 2RG8A 1KT1A 4O1PA 1WY6A 4PS8A 3T5VA 2FI7A 3SZ7A 4KBQA 4RSYA 4FP7A 3ABME 4EQFA 1N11A 5BV1A 3UXGA 4JA9A 3QOUA 2WQHA 2P9PG 4Y6CA 3PNLB 4GMJA 3RRMB 4G23A 5BUZA 3UMVA 1HS6A 5FIOA 1UG3A 1Z6TA 1E90A 3LS8A 4CZ2D 4LSZE 2Y69E 5HS0A 5KJKA 3ZU7B 3UIPC 2HE0A 5CHEE 3PZDA 4N5QA 3VLDA 4UI9J 4Q96A 4GPKA 4PS7A 2PL2A 3LKUA 2DZOA 3ZEFA 4FLHA 4JHKA 3HXEA 4MRUA 3GW4A 4CYMD 5D0QD 3I4GA 4CEMA 2HR2A 4DX1A 3NB2A 3CQGB 4HOSA 3QARA 5J08A 2FO1E 4BT9A 4FADA 3BUAA 4GB9A 3CSTA 4GTPA 4XI0A 4ATZD 5B1AE 3C5RA 4MLPA 3UPVA 1E8YA 2VSYA 5JA4D 4AM9A 4JHRA 4U0UA 1UN8A 2IQCA 3P2BA 2RFMA 5LX8A 2ONDA 4GCOA 4XX5A 1LTXA 2KATA 3CKBA 5BXUA 5CBOA 3FY4A 1N0RA 4O1OA 3JUEA 2UWJG 2Y3AA 3X2QE 2ETCA 3B7BA 2GRLA 1A5EA 4B8AA 3AG3E 3HYMB 4G11A 3CVWA 3FTWA 4HORA 4DI4A 1BPOA 1IXVA 1N54A 4U07A 3HXBA 2X38A 4AY6A 4X8QA 2KC7A 3LY7A 4XKBA 1NA3A 4ATGA 2DIWA 2V8SE 4E85A 2XPYA 4HXIA 3L9TA 3I3NA 1FPPA 1N94A 2LXLA 5JHAA 3C3RA 4BSXA 3JQ0A 4HRLA 2BUGA 4BERA 1EPUA 4ILHB 4WUYA 2X6IA 3V2OA 3OXGA 3RRNB 2BKGA 2YHCA 4I1MA 4UWFA 3WXXA 4GZ5A 3CR3A 3HRAA 4GAAA 2R03A 5LCWC 4WNDA 4BESA 4TUUA 3G2TA 4KZCA 2KZTB 4N5CA 5BT1A 4BETA 3JYSA 3CHOA 3NQPA 5AJDA 3CIAA 4NRHB 1TNBA 2DWZA 3VLEA 3BG1B 3SD5A 4WWNA 2WXHA 2MRIA 3LVRE 3ABKE 3CHSA 1HE8A 1H0AA 4RVBA 3B13A 2V4HC 5FT9A 3SQVA 3CGHA 2XENA 2L6BA 3DXKG 3JQ1A 2PQRA 3HHMA 3JXIA 4GCNA 2F0YA 3RRUA 3RSEG 3CVVA 4B8CB 1OXJA 4L9PA 5HRYA 2EIJE 4K03A 5JJTA 3CVYA 1P5QA 3CKCA 3D9NA 2I1KA 3ULYA 1G3NB 3DSTA 2DYRE 4HOQA 3SF4A 2XRZA 5J90A 3FUKA 4OAVB 2R2LA 5FZQA 2WXMA 2XS1A 3MGBA 4M7CA 3ABLE 3FHEA 4BX9A 4JXTA 2WXLA 3FU5A 4Q69A 4C9BB 3HG0D 4CDRA 4UI9K 4BWRA 1RW2A 4J7WA 1ELKA 1EDUA 2IONA 3L17A 3URZA 2WXJA 5CBNA 3L22A 3GYZA 1S0PA 3FUHA 4APFA 4EHMA 2R17C 3FTVA 3DPDA 5ENNA 3LJ3A 2V4LA 4YDYA 4GTMA 1U3DA 4KZ0A 3FUEA 1TNYA 1OCZE 5CCLA 4OVUA 3PE3A 4EZKA 2IO2C 2CHZA 4O6FA 1QYMA 1O1SA 3DBSA 2PNNA 3FH7A 3UINC 4XKCA 4MKTA 4RQIA 4DRXE 2JABA 1BD8A 4HFGA 3G2VA 1MYOA 1DCEA 3TWXA 4CRWA 5ANLA 3D9PA 4LNGA 3ISMC 2J49A 4L2LA 4ANUA 3DPYA 3PUJA 3UTMA 2WXFA 3DSWA 3EU5A 2QFCA 2WB2A 4MBGA 2X3MA 4CDNA 3RJVA 4YDWA 1YA0A 4ILIA 3U64A 3S2AA 4I17A 3FUMA 3W9GA 2FULA 3EHRA 2H6HA 3CQCB 3CVPA 4GTQA 4U0ZA 3QWPA 3CSFA 2I9CA 2J09A 2NYJA 4L7TA 3CV0A 3UKRG 3FTUA 3Q47B 1H2VC 1LF8A 1D8EA 3EU9A 3TAXA 2LNIA 2GGFA 3BG0B 5AN8A 2XCCA 3DXMG 3Q9UC 3S7FA 1KPSB 4FU3A 4HVBA 2PM6A 1ZBPA 1MX2A 4U8VD 2IJGX 3O48A 1X5BA 2A5EA 2Y0BG 5AQ9A 4N3AA 3ZNGA 2P9IG 3UX4A 5EDSA 3J5QB 4AXHA 4UQYA 1HO8A 5FWQA 1E8WA 4JW1A 3AU4A 4A55A 3MV2B 4HRMB 4E6HA 5HKPA 4XEIG 1IYGA 5A23A 2YNQA 4V3IA 1L5JA 2KCVA 2F8YA 2HO1A 5G04J 1UJKA 1WDYA 2LUHA 4I9CA 4HQDA 4FA6A 4BSZB 2AXVA 2FO7A 2LAHA 3Q15A 1MJ0A 2I2OA 4KVMA 2NSZA 4BX8A 5D0OD 1NFIE 1E8ZA 2ZGGA 2XCBA 4FLBA 5FQ6A 4GU5A 3CHMA 2OV8A 4HLEA 3L16A 2OEVA 3DWLG 1AP7A 4B0ZA 4GZ6A 2J8SD 2HM8A 4YVQC 2XPZA 3DSXA 4ZFHA 2XZDG 2AXUA 3Q7FA 4BFRA 5LCWJ 2WM9A 2BTDA 3VTYA 4J8FA 5CCMA 4URKA 3EHNA 2VGXB 2EIME 2OVFA 1SA5A 1OCCE 3IHYA 4GYWA 3QAQA 4I1OB 4YDEA 3TL5A 5KNGA 3V79K 3S7DA 4B94A 5FQ8A 4DUIA 3Q4AB 1OWNA 3EUVA 3RO3A 3RAUA 2IF4A 1ZU2A 5HI7A 2XGOA 2CHWA 3J5PA 3V30A 3ASOE 1K3ZD 4AOFA 4OAUC 1N95A 1FCHA 3CVNA 4DPRA 2EILE 3C98A 4F1PA 3VTXA 4PS3A 3D9KA 1QZ2A 5IY5E 5G2NA 1D8DA 2V0PA 3FU6A 5BW8C 4Q94A 4JA7A 4LNUD 4I1AA 2CG2A 3ESKA 2WXRA 4GZDA 3APDA 3UKUG 3ZUVB 1KT0A 4U96D 5ENPD 1MX4A 3TG5A 1YYHA 4C0EA 3QDNA 1FT1A 1FVHA 4B89A 4DK5A 3Q7AA 3TGOA 4A63B 1NZNA 3SHFA 3HXDA 1ELWA 3CK7A 1IQRA 2AVPA 1W3BA 3Q79A 2XZTG 4FC8A 1AWCB 1FT2A 2VSOE 2JEKA 3R9MA 2Y1LE 2EINE 1BI8B 3PREA 3ZRHA 3RKVA 4GTOA 2B0OE 1DC2A 3D9IA 2R05A 2P9LG 3B7TA 4CT4A 3V31A 1YMPA 4EZJA 3ZVVA 1BLXB 2J07A 3JCKC 2CHXA 5EN5D 4ANVA 4DX2A 1SW6A 3MA5A 3ZHEB 4CGVA 4GA2A 1ZB1A 4HB5A 1OWPA 5M72A 2IO3C 4DLOA 2J4BA 3PVLA 2YINA 2ZGDA 3G2SA 3EIQC 3JXJA 4GYOA 3SGHA 5AQBA 2NXPA 3SBSA 4D10C 1XGWA 3QB2A 4WAFA 5T4YA 2CG3A 3I5PA 5B1BE 1TEZA 4N3BA 3ASGA 2C0LA 4UUCA 2A5UA 3SY2A 2KCKA 3U9WA 1HH8A 1N4SA 1N9AA 3C3OA 2IEJA 1O1TA 1N0QA 1U3CA 5ARGA 3Q78A 4LEUA 1U2VG 2XGSA 4N39A 1PC2A 3B7SA 4A3VA 3BEEA 4JPSA 3Q49B 4AEZC 3KAEA 5CRVA 4J6IA 2Y4UA 3AS8A 1S64A 5AARA 1N4RA 5JHBA 3FTYA 2KBXA 4LERA 2P9KG 4AP2A 2L6JA 4R7LA 2KM4A 3PDNA 4NQ0A 3UM2A 4H7XA 3ULEG 1Z3YA 3WG7E 4DX6D 1TN7A 4UWGA 3B95A 5G04C 2XEHA 4U04A 3ZGQA 2F37A 3OTNA 2VGXA 4ACLA 4G25A 1SZAA 1SQMA 1UOHA 4U95D 2WMNA 3CLJA 1E96B 1FVFA 1MX6A 1LD8A 3EIJA 1OUVA 4GYYA 3L82A 3NOCD 1OWMA 3FH8A 3QKYA 4FJZA 5HQ8A 3SI5A 3D9HA 1HF8A 2IU1A 2QY7A 2L9BA 3F6QA 1HZ4A 1JUQA 1LD7A 4AVXA 5BXOA 2IFUA 2AJAA 1Z3XA 3IKOB 5ENSD 2J08A 4LRZA 3BQOA 1N4PA 4AY5A 3FTXA 5CMWA 2FBNA 4GZ3A 2I6HA 3MX3A 3TXMA 4GZCA 3PH0C 5EIDA 4MS6A 1E8XA 3SO8A 3UUXA 4DI3A 4K5BA 3CVUA 3G2UA 3AG2E 3LEWA 4Z68A 4WWOA 3B7RL 3EDTB 4W9RA 3MJWA 2V5FA 5JJ6A 2GRRB 2FEZA 4FHKA 2LO6A 2J4DA 3LY8A 3QWVA 3ZXSA 1H2TC 1EYHA 3KSQA 3NZSA 2QYUA 4J8YA 2CFUA 2UY1A 5BNWA 1NI1A 4K0RA 4TXRA 2XRYA 3FTZA 3SFZA 3ZN3A 5DIZA 5DBKA 1WG0A 4TXPA 4YNDA 2OEWA 4ME2A 5EX3A 2WXNA 2XQ0A 3CEQA 2BEDA 3HXFA 2P9NG 3RK6A 3TWRA 3MKRA 4GTVA 1N4QA 3AS5A 3CK8A 1S70B 1QNFA 3E34A 3O4ZA 3HVEA 5FJYA 3DSUA 1H2UA 1H19A 2PZIA 4UQZA 3LDZA 3OXFA 2VSNA 3TWSA 5C2YA 5FZRA 2MYOA 3FUDA 4WWPA 3HDXA 2ETBA 2ZIRA 4LG6A 4QFVA 2EQXA 2AWIA 4I6JA 2LAIA 5FQ4A 5T8IA 4JEUA 3APFA 3CK9A 3JUIA 5A6CA 2WXGA 3ZIMA 2QYJA 3DRAA 4BT8A 4FHJA 2WQ6A 2P2CP 3AAAC 4L23A 4J8DA 2IOLA 5E76A 2B6CA 3AJIA 2L0TB 1TJFA 1KZPA 1SA4A 1HFAA 1HX8A 3U66A 3OAWA 3D9MA 5LOZA 3TWUA 4TUMA 3FU3A 3P1UA 3D9LA 4HOTA 5FZSA 1IHBA 3R9AB 5CRUA 3L54A 4EPZA 1QBQA 2MHKA 4GMLA 3ZYQA 3KD7A 3C72A 4UI9C 4NIKA 1JPLA 1TYQG 2F8XK 3T5XA 3W9FA 3LVQE 3NAWA 4HOUA 3TXNA 1Y6IA 3Q5MA 2DVWA 3ASDA 2DZNA 4EECA 3E30A 3D9OA 4G1TA 4G26A 4G8KA 5EILA 3RO2A 4KMOA 4I43A 1MQSA 2ZISA 4G24A 5JMND 1JCQA 4U8HA 2RKKA 5EIBE 4DLQA 3FP3A 4DX5D 1HXIA 3CVQA 1QQEA 4HS2A 5EX0A 4TXQA 2ETAA 1TNUA 1OY3D 1TN6A 3LJNA 4XI9A 2Y4TA 3QC1A 3Q75A 1H6PA 3ONKA 5G55A 3NBNB 5BPPA 4ACKA 3ML9A 3ASNE 4F7AA 1TJCA 3CHPA 3R7QA 1EF1C 2R59A 3KS2A 3AS4A 4G8LA 1KZOA 1TR4A 2Q7FA 3FULA 3EJNA 1JCRA 4OYSA 3FUJA 4JC8A 1SZ9A 4Y6WA 3IV0A 4JL0A 1H6OA 4B93B 3IBEA 1UW4B 3L08A 5FTPA 2DBAA 5CMYA 2P9SG 4WNFA 4RG9A 5H7PA 3TJPA 2AW6A 2X6KA 3NZUA 4C48B 5LP0A 1H6KA 4K5CA 5KBAA 3FUFA 4KXKB 2WXPA 3MKQA 5ENQD 3ZHEA 3SFYA 4GTRA 3ZKJA 3QNKA 5AJLA 1INZA 4U63A 2LSVA 1RZ4A 2VTBA 3HXCA 4TV3A 4N3CA 1V55E 1BI7B 2VGYA 3CHQA 4HI8A 4HLLA 3MV3B 2GRPB 5EKQD 4J8EA 1N52A 4JD2G 2C2LA 2E2EA 1BU9A 3PZ1A 3I4RB 3SFXA 5KJMA 3DSVA 4UWLA 1TNOA 4KT6B 4HBDA 3LY9A 2XPIA 2L0IA 3SBTB 5CECB 5EYLA 4I2WA 2M63A 4UQXA 2WVIA 2WXQA 1WAO1 3S7JA 3PS6A 5C1DA 4I6EA 3TG4A 3KEAA 3PNTB 1SVXA 3DEOA 4APOA 5CERB 2PQNA 1GW6A 2VGEA 3AG4E 3ZYLA 1PY1A 3PEUB 2NC9A 4RG6A 1KLXA 3VLFA 4JZYA 4UWKA 3FH5A 4YVOA 5T3RA 2WMOA 1UJJA 4AV7A 3ESLA 2BKKB 2XEVA 3MYVA 5KJNA 2VYIA 3FUNA 3PRZA 2H6FA 3PUKA 2WXOA 3V2XA 4I6GA 1S63A 3ZW3A 5E75A 3UQ3A 2FF4A 2QC9A 1OT8A 2IY0C 1PAQA 3MKQB 3N71A 4H7YA 5D66A 3FFLA 4CDMA 1O1RA 3RU0A 2VQ2A 3SNXA 5A7DB 3KSLA 4FULA 4BTAA 4PH4B 4RLYA 3UI2A 2I1JA 3G2WA 4XZ4A 1HG2A 4AJWA 3LYAA 4A1SA 4N2SA 2A4ZA 2WQ7A 2P9UG 4F6RD 4A1GA 1A17A 2VJ8A 5G05J 3ULQA 1WM5A 3GZ1A 3UM3A 4KYOB 2GROB 3D3MA 3PZ2A 4LUNU 4LNBA 3ZYMA 5ARFA 5ANRA 3FEYA 2R02A 4U7EB 2OCCE 3D9JA 3OXLA 3K9IA 2GRQB 4ABNA 2WXKA 5BV0A 5ENRD 4BY6A 2XGMA 3UT7A 4F53A 1JWGA 4UWHA 4ZHBA 3UIOC 1HG5A 2R5SA 3U4TA 4HRNA 3ENEA 3AU5A 4AIFA 4NURA 2X6HA 5FQ7A 3U3WA 5AAOA 2X6JA 2AXZA 4I9EA 1HU3A 5ENOD 1Q2ZA 3FWVA 2H6GA 4ANWA 2ZU6B 3HVEB 3CHRA 1JWFA 4C0MA 1UN9A 4GMRA 4FJYA 4F3VA 4QQIA 3DSSA 4L2YA 2KZTA 3BU8A 3E33A 3ZYKA 4WNEA 2VSXE 1ELRA 1IKND 3CVXA 3PEVB 3UM1A 2H6IA 1JCSA 5LFAA 4F1SA 4KVOA 5EYPF 5JJ7A 3EHQA 4GTSA 5FINA 3AG1E 2V5QC 2UY1B 4YDOA 1Y8MA 2C0MA 2KXPC 4CCAA 5AENA 4BEPA 3FDHA 3EHMA 2WPVA 4U0SA 1OWLA 1V54E 2E0IA 4HI9A 3ZFWA 3GZSA 3LXUX 3QJZA 1XNFA 4I2ZA 1OCRE 3DEPA 3E32A 3IXEA 4IULA 3RIBA 3MCXA 2OOEA 2X6FA 4GPMA 4PDXA 2BF0X 3TWVA 1E7UA 3Q9NC 2ZXWE 4ANXA 4P29A 2DYSE 1IHGA 3PZ4A 2ILRA 3L13A 4CGWA 4JVSA 4EBAG 3APCA 4GA1A 4WNGA 3FU0A 4J8SA 3NOGD 5AIJA 4XE0A 1IQUA 1NP7A 2GW1A 4IN3B 1OWOA 3IHVA 2OVBA 4IYPA 2LSUA 5KJLA 5KCMA 2JLBA 5G05C 3LPZA 1K1BA 5CEDB 5AQ7A 3T9KA 4A3TA 4BTBA 2EIKE 1DCQA 1O5MA 3NF1A 4OVVA 4LCTA 2LXMA 1B89A 3ASHA 1NL4A 4CT0A 2DCPA 3S7BA 1MHQA 3ZXPA 3L6AA 1X81A 2YQ8A 3HIZA
chains in the Genus database with same CATH topology
4GA0A 4N3BA 5FTPA 3FEXA 3ASGA 2WXJA 2DBAA 2C0LA 5CMYA 3L22A 4WNFA 2A5UA 4RG9A 2KCKA 3U9WA 1HH8A 3GYZA 3TJPA 1S0PA 2AW6A 2X6KA 3NZUA 3FUHA 2PM7A 4APFA 2GRMA 4JHJA 5LP0A 1H6KA 2R17C 3FTVA 3DPDA 1U3CA 2XHEA 5ENNA 3LJ3A 2V4LA 3I5PA 3FUFA 5ARGA 3GZ2A 1U3DA 4LEUA 4KXKB 4KZ0A 3FUEA 4G2VA 2WXPA 2YHEA 3MKQA 4NACA 4N2QA 2XGSA 3UT4A 5CCLA 3ZHEA 2KCLA 4N39A 4OVUA 3PE3A 4EZKA 1PC2A 3B7SA 4JEHA 4A3VA 3BEEA 2CHZA 4JPSA 3B7UX 3Q49B 4O6FA 3KEZA 3QNKA 4AEZC 5AJLA 2VTBB 3KAEA 1INZA 4J6IA 4U63A 3IEGA 3DBSA 3FH7A 3PE4A 2LSVA 4XKCA 2Y4UA 3CVLA 4MKTA 3AS8A 2VTBA 4TRQA 4HFGA 4TV3A 3T8MA 5JHBA 3FTYA 4N3CA 4LERA 2CFZA 3G2VA 4AP2A 2L6JA 4R7LA 3E4BA 2VGYA 3CHQA 4CRWA 5ANLA 2KM4A 3D9PA 1NA0A 3PDNA 4NQ0A 3MV3B 4H7XA 4EBAA 2J49A 5EKQD 4J8EA 1N52A 1Z3YA 4L2LA 2C2LA 4EZLA 2E2EA 4UWGA 4ANUA 3PUJA 2WXFA 1VDYA 2HYZA 2QFCA 2WB2A 5G04C 4U04A 4DJAA 3ZGQA 2X3MA 3I4RB 3OTNA 3QWWA 4M3OA 3ZPJA 4CDNA 3LCAA 3RJVA 4L1BA 2VGXA 4J0UA 3MZLB 5KJMA 2WXIA 4ACLA 1YA0A 4ILIA 3ML8A 4G25A 1SZAA 1SQMA 4UWLA 3ONLA 3U64A 3S2AA 4KT6B 4I17A 3UT8A 3LY9A 3FUMA 2WMNA 3CLJA 1E96B 1FVFA 2XPIA 2FULA 2RD0A 3MEKA 2L0IA 2P58C 3SBTB 1DNPA 3FTSA 3CQCB 3QK0A 3CVPA 3EIJA 3R7RA 1OUVA 4I2WA 2M63A 4GYYA 2J9QA 4UQXA 2WVIA 1DVPA 3ASFA 4PUCA 4U0ZA 1OWMA 2WXQA 3FH8A 3QWPA 4XIFA 3CSFA 1WAO1 3QKYA 1E7VA 4FJZA 2I9CA 2J09A 3S7JA 3SI5A 1HF8A 2IU1A 2IOSA 3PS6A 2QY7A 4IRUA 5C1DA 4I6EA 4ILGA 4L7TA 3CV0A 2L9BA 3FTUA 3Q47B 3TG4A 1H2VC 1LF8A 3PNTB 1HZ4A 1JUQA 5AYWD 3FUIA 4APOA 3TAXA 4AVXA 2MOWA 2IFUA 2LNIA 2GGFA 3BG0B 1Z3XA 3IKOB 2PQNA 2RG8A 1GW6A 1KT1A 3URZA 2J08A 4LRZA 1WY6A 4PS8A 3T5VA 2FI7A 3FTXA 3SZ7A 2XCCA 2FBNA 4GZ3A 1PY1A 3ZYLA 3PEUB 4AY5A 2I6HA 5CMWA 3MX3A 3TXMA 2NC9A 4GZCA 4RG6A 3S7FA 1KLXA 4KBQA 4RSYA 4JZYA 3VLFA 4FP7A 4UWKA 3PH0C 4FU3A 4HVBA 4MS6A 1TEZA 2PM6A 4EQFA 1ZBPA 1E8XA 3FH5A 4YVOA 5BV1A 4JA9A 3UUXA 2IJGX 4DI3A 3QOUA 5T3RA 2WQHA 2WMOA 3O48A 1UJJA 3CVUA 4Y6CA 4AV7A 3PNLB 4GMJA 3G2UA 3ESLA 3RRMB 4G23A 5BUZA 1X5BA 2XEVA 3MYVA 1HS6A 4N3AA 2VYIA 3UMVA 3UX4A 5KJNA 3FUNA 5EDSA 3PRZA 1UG3A 1Z6TA 1E90A 3LEWA 3LS8A 3PUKA 4AXHA 4UQYA 2WXOA 1HO8A 4WWOA 3B7RL 4I6GA 5FWQA 5KJKA 3EDTB 5CHEE 3PZDA 4W9RA 3MJWA 2V5FA 3ZW3A 3VLDA 4UI9J 1E8WA 4JW1A 4Q96A 4GPKA 5E75A 5JJ6A 3UQ3A 2FF4A 4PS7A 2FEZA 1PAQA 3AU4A 3MKQB 3N71A 2PL2A 3LKUA 4FHKA 3ZEFA 4FLHA 2LO6A 4JHKA 4H7YA 4A55A 2J4DA 3MV2B 4MRUA 3GW4A 3LY8A 3QWVA 4E6HA 3ZXSA 5D0QD 1H2TC 3I4GA 4CEMA 1EYHA 3NZSA 2HR2A 3FFLA 4CDMA 2CFUA 2UY1A 1IYGA 5BNWA 5A23A 2YNQA 3CQGB 4HOSA 3QARA 4K0RA 4V3IA 3RU0A 1L5JA 2VQ2A 2XRYA 5A7DB 3SNXA 4BT9A 5J08A 4FULA 3FTZA 4BTAA 4PH4B 2I1JA 3SFZA 2KCVA 4FADA 4GB9A 3ZN3A 3G2WA 4XZ4A 1HG2A 4AJWA 3LYAA 4A1SA 3CSTA 5DBKA 5DIZA 4XI0A 4N2SA 4YNDA 4ME2A 2HO1A 2A4ZA 2WXNA 5EX3A 5G04J 2WQ7A 1UJKA 4A1GA 2XQ0A 4I9CA 5HQ8A 3CEQA 4MLPA 3UPVA 1E8YA 2VSYA 1A17A 4FA6A 4AM9A 4JHRA 3RK6A 2AXVA 2FO7A 2LAHA 3Q15A 2VJ8A 2I2OA 3MKRA 4U0UA 5G05J 4KVMA 2NSZA 3ULQA 1UN8A 1WM5A 4BX8A 3AS5A 3CK8A 5D0OD 1E8ZA 2IQCA 3GZ1A 1QNFA 3P2BA 4KYOB 5LX8A 2XCBA 4FLBA 5FQ6A 3D3MA 3O4ZA 4LUNU 2ONDA 4GCOA 3HVEA 4GU5A 3CHMA 2OV8A 5FJYA 4HLEA 1H2UA 3L16A 4XX5A 1H19A 2KATA 3ZYMA 5ARFA 5ANRA 3FEYA 3CKBA 2PZIA 4B0ZA 4UQZA 3D9JA 3LDZA 3OXLA 3K9IA 4GZ6A 3FY4A 4ABNA 2HM8A 3OXFA 4YVQC 2VSNA 2WXKA 2XPZA 5BV0A 5C2YA 5FZRA 4BY6A 2UWJG 2XGMA 3UT7A 2Y3AA 3FUDA 4WWPA 3HDXA 4F53A 4QFVA 2EQXA 2AWIA 1JWGA 2LAIA 2AXUA 4I6JA 4UWHA 5FQ4A 5T8IA 4JEUA 2GRLA 3APFA 3CK9A 3JUIA 4BFRA 2WM9A 5A6CA 5LCWJ 2BTDA 1HG5A 2WXGA 3VTYA 2R5SA 4J8FA 3ZIMA 5CCMA 3U4TA 4URKA 4B8AA 3EHNA 3ENEA 2VGXB 4BT8A 3AU5A 3HYMB 4FHJA 4NURA 2X6HA 2OVFA 4AIFA 4G11A 5FQ7A 3CVWA 3U3WA 3FTWA 2WQ6A 4HORA 4DI4A 2X6JA 3IHYA 1BPOA 2AXZA 3QAQA 4GYWA 4I1OB 3TL5A 1N54A 4U07A 4I9EA 4L23A 1HU3A 2X38A 4AY6A 2KC7A 4J8DA 3LY7A 3S7DA 4XKBA 3FWVA 1NA3A 4B94A 4ANWA 2IOLA 2ZU6B 5FQ8A 4ATGA 5E76A 2DIWA 3HVEB 3Q4AB 3CHRA 1OWNA 2V8SE 1JWFA 4E85A 2L0TB 1TJFA 4C0MA 1UN9A 4FJYA 4F3VA 2XPYA 4HXIA 3RO3A 1HFAA 3I3NA 2IF4A 1ZU2A 5HI7A 2XGOA 2CHWA 1HX8A 5JHAA 3U66A 3OAWA 3D9MA 4L2YA 5LOZA 2KZTA 4BSXA 3ZYKA 4WNEA 3JQ0A 2VSXE 3FU3A 1ELRA 3CVXA 3PEVB 3P1UA 4AOFA 2BUGA 3D9LA 4HOTA 5FZSA 5LFAA 4F1SA 1EPUA 4KVOA 3R9AB 4ILHB 1FCHA 5JJ7A 3CVNA 4DPRA 4WUYA 2X6IA 3C98A 3L54A 3OXGA 3RRNB 3VTXA 4PS3A 4EPZA 3D9KA 1QZ2A 2YHCA 2MHKA 4GMLA 5G2NA 2UY1B 4I1MA 4UWFA 2V0PA 3WXXA 4GZ5A 3CR3A 4GAAA 1Y8MA 3KD7A 3FU6A 3ZYQA 2C0MA 4UI9C 5LCWC 4WNDA 4Q94A 1JPLA 5BW8C 4CCAA 4JA7A 4TUUA 3T5XA 3G2TA 4KZCA 2KZTB 4N5CA 5AENA 5BT1A 3JYSA 3CHOA 3FDHA 3NQPA 3EHMA 4I1AA 2WPVA 5AJDA 3CIAA 3LVQE 4HOUA 4U0SA 4NRHB 3TXNA 1OWLA 2CG2A 1Y6IA 3VLEA 3BG1B 2E0IA 3ESKA 3Q5MA 3SD5A 2WXRA 4GZDA 3APDA 3ZFWA 3GZSA 3LXUX 1KT0A 3ASDA 3QJZA 1XNFA 3TG5A 4WWNA 4I2ZA 2WXHA 2MRIA 4C0EA 4EECA 3LVRE 3D9OA 4IULA 3CHSA 3QDNA 1HE8A 4G1TA 4G26A 1H0AA 3RIBA 3RO2A 4KMOA 4I43A 3MCXA 1FVHA 4B89A 4DK5A 2OOEA 2X6FA 3TGOA 4PDXA 4RVBA 2BF0X 3B13A 5FT9A 1MQSA 3CGHA 1NZNA 1E7UA 3SHFA 4ANXA 4G24A 1ELWA 4P29A 3JQ1A 2PQRA 4U8HA 3CK7A 1IQRA 1IHGA 2AVPA 2ILRA 3HHMA 4DLQA 1W3BA 3L13A 4CGWA 4JVSA 4FC8A 3FP3A 4EBAG 3APCA 4GA1A 4GCNA 1HXIA 2VSOE 2JEKA 3CVQA 4WNGA 3RRUA 1QQEA 4HS2A 5EX0A 4B8CB 3CVVA 3PREA 3FU0A 4J8SA 3ZRHA 3RKVA 4XI9A 4K03A 5AIJA 5JJTA 3CVYA 3D9IA 4XE0A 2Y4TA 1P5QA 3B7TA 4CT4A 3CKCA 1IQUA 1NP7A 2GW1A 3D9NA 3QC1A 4EZJA 3ZVVA 3ONKA 4IN3B 1OWOA 3IHVA 2J07A 2I1KA 2OVBA 5G55A 3JCKC 2CHXA 4IYPA 2LSUA 4HOQA 3SF4A 5KJLA 2XRZA 5KCMA 4ANVA 5BPPA 5J90A 4ACKA 2JLBA 3FUKA 5G05C 3ML9A 3LPZA 3MA5A 3ZHEB 4CGVA 4F7AA 1TJCA 3CHPA 4GA2A 3R7QA 4A3TA 5FZQA 1EF1C 2R59A 2WXMA 4BTBA 3KS2A 1OWPA 3AS4A 5M72A 3MGBA 3NF1A 4DLOA 2J4BA 3PVLA 2YINA 3FHEA 4OVVA 4LCTA 4BX9A 1B89A 4JXTA 2Q7FA 3G2SA 3ASHA 2WXLA 3EIQC 3FU5A 3FULA 4CT0A 3EJNA 4GYOA 4OYSA 3SGHA 2DCPA 4C9BB 4Q69A 3FUJA 2NXPA 3S7BA 1MHQA 4JC8A 4CDRA 3SBSA 4D10C 1SZ9A 4Y6WA 3IV0A 4JL0A 4UI9K 1XGWA 4BWRA 3L6AA 3QB2A 4WAFA 5T4YA 1ELKA 2YQ8A 3IBEA 2CG3A 3HIZA 1EDUA 2IONA 3L17A 1UW4B 3L08A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OND A;  4GA0 A;  4GCO A;  4N3B A;  5FTP A;  5AYW D;  3ASG A;  4N5C A;  3TAX A;  3JYS A;  4APO A;  5FJY A;  2DBA A;  5BT1 A;  4I1A A;  2WPV A;  2C0L A;  2IFU A;  4HOU A;  4U0S A;  2KAT A;  2LNI A;  4NRH B;  4WNF A;  5ARF A;  4RG9 A;  2KCK A;  2PZI A;  2PQN A;  1HH8 A;  1KT1 A;  3CKB A;  3ESK A;  3GYZ A;  3Q5M A;  4UQZ A;  3ZFW A;  1KT0 A;  3ASD A;  3OXL A;  3K9I A;  1XNF A;  2FI7 A;  4GZ6 A;  3SZ7 A;  2XCC A;  2FBN A;  4GZ3 A;  4I2Z A;  3TG5 A;  4AY5 A;  4HOT A;  2I6H A;  4ABN A;  2NC9 A;  4RG6 A;  3S7F A;  3OXF A;  4YVQ C;  1KLX A;  2VSN A;  4KBQ A;  3GZ2 A;  4LEU A;  5ARG A;  4KXK B;  4G2V A;  3QDN A;  5FZR A;  2UWJ G;  2XGM A;  4G1T A;  4G26 A;  1ZBP A;  3RIB A;  3RO2 A;  4EQF A;  2XGS A;  4N2Q A;  4YVO A;  3ZHE A;  5CCL A;  4N2S A;  2KCL A;  4JA9 A;  4N39 A;  2OOE A;  3PE3 A;  3QOU A;  3UUX A;  2WQH A;  3O48 A;  3TGO A;  1PC2 A;  4Y6C A;  3BEE A;  5FT9 A;  4BTB A;  1NZN A;  3CK9 A;  4G23 A;  5LCW J;  3Q49 B;  4O6F A;  5A6C A;  2XEV A;  4G24 A;  3KAE A;  2R5S A;  4J8F A;  4N3A A;  2VYI A;  3VTY A;  5KJN A;  1ELW A;  3IEG A;  3U4T A;  5CCM A;  3PE4 A;  2PQR A;  2LSV A;  2VGX B;  2Y4U A;  3CK7 A;  3CVL A;  3HYM B;  4AIF A;  1IHG A;  4UQY A;  3AS8 A;  4BT8 A;  2AVP A;  5KJK A;  3U3W A;  3EDT B;  1W3B A;  5CHE E;  4W9R A;  4CGW A;  4HOR A;  2V5F A;  4N3C A;  4UI9 J;  3FP3 A;  4GPK A;  4GA1 A;  4GYW A;  5JJ6 A;  2L6J A;  3UQ3 A;  4GCN A;  1HXI A;  2FF4 A;  3E4B A;  2VGY A;  4U07 A;  3CVQ A;  4WNG A;  4I9E A;  1QQE A;  2FEZ A;  5EX0 A;  4AY6 A;  2KC7 A;  4J8D A;  3LY7 A;  3S7D A;  1NA0 A;  3FWV A;  1NA3 A;  2PL2 A;  3LKU A;  3N71 A;  3PDN A;  4NQ0 A;  4B94 A;  3MV3 B;  4H7X A;  3RKV A;  4H7Y A;  3Q4A B;  4XI9 A;  3MV2 B;  4J8E A;  5EKQ D;  5JJT A;  3GW4 A;  2Y4T A;  1P5Q A;  2C2L A;  3LY8 A;  2E2E A;  3QWV A;  5D0Q D;  3CKC A;  2GW1 A;  2HR2 A;  3FFL A;  4F3V A;  2HYZ A;  4IN3 B;  3RO3 A;  2QFC A;  1IYG A;  2UY1 A;  5G04 C;  5BNW A;  2IF4 A;  1ZU2 A;  4U04 A;  5HI7 A;  2XGO A;  2LSU A;  3ZGQ A;  4HOS A;  3ZPJ A;  3QWW A;  3LCA A;  4HOQ A;  3RJV A;  2VQ2 A;  3RU0 A;  3SF4 A;  5A7D B;  4BT9 A;  5KJL A;  2JLB A;  4BTA A;  2VGX A;  5G05 C;  4J0U A;  5KJM A;  1YA0 A;  2KCV A;  3LPZ A;  3MA5 A;  4G25 A;  4WNE A;  3ZHE B;  3ZN3 A;  4CGV A;  1TJC A;  1ELR A;  4GA2 A;  3LYA A;  4A1S A;  5DIZ A;  5DBK A;  5FZQ A;  2BUG A;  4I17 A;  3LY9 A;  4XI0 A;  4YND A;  3KS2 A;  5FZS A;  1E96 B;  2XPI A;  3AS4 A;  4ME2 A;  5M72 A;  3MEK A;  2HO1 A;  2P58 C;  3NF1 A;  5EX3 A;  5G04 J;  3CVP A;  3R9A B;  1OUV A;  4I9C A;  1B89 A;  1FCH A;  2Q7F A;  4I2W A;  3CEQ A;  4GYY A;  3CVN A;  5JJ7 A;  3ASH A;  4WUY A;  2J9Q A;  4UQX A;  3UPV A;  2VSY A;  3ASF A;  1A17 A;  4U0Z A;  4GYO A;  3VTX A;  3OXG A;  4AM9 A;  4JHR A;  3S7B A;  1QZ2 A;  2YHC A;  3QWP A;  2FO7 A;  4XIF A;  4CDR A;  1WAO 1;  3Q15 A;  3QKY A;  2MHK A;  5HQ8 A;  3MKR A;  4JL0 A;  2UY1 B;  4U0U A;  4Y6W A;  5G05 J;  3S7J A;  4UI9 K;  3ULQ A;  3WXX A;  1WM5 A;  4BWR A;  5C1D A;  3AS5 A;  3CK8 A;  4GZ5 A;  5D0O D;  3GZ1 A;  1Y8M A;  3KD7 A;  5LCW C;  2C0M A;  3CV0 A;  4UI9 C;  4KYO B;  4WND A;  2YQ8 A;  3Q47 B;  5BW8 C;  3TG4 A;  2XCB A;  4JA7 A;  3URZ A;  1HZ4 A; 
#chains in the Genus database with same CATH topology
 4GA0 A;  3FEX A;  1YCS B;  2PM7 A;  2GRM A;  2RFA A;  4JHJ A;  1K8K G;  2XHE A;  4DX7 D;  3GZ2 A;  3TWW A;  4G2V A;  2GRN B;  4NAC A;  2YHE A;  4N2Q A;  4U8Y D;  3UT4 A;  5B3S E;  3UM0 A;  2KCL A;  5D2M C;  4JEH A;  3B7U X;  3E37 A;  1TNZ A;  3KEZ A;  4GTT A;  4JB8 P;  2VTB B;  3IEG A;  3PE4 A;  3CVL A;  4TRQ A;  3TWQ A;  3T8M A;  4K5A B;  1Z5S C;  2CFZ A;  3E4B A;  4HNA D;  4O60 A;  1NA0 A;  5ENT D;  2XEE A;  4EBA A;  1TN8 A;  4EZL A;  1VDY A;  2HYZ A;  3T8K A;  2XS8 A;  1D9S A;  4DJA A;  3ZPJ A;  3QWW A;  4M3O A;  3LCA A;  4L1B A;  5KWD A;  4J0U A;  3MZL B;  5AQA A;  2WXI A;  3ML8 A;  3ONL A;  3UT8 A;  3TWT A;  2RD0 A;  3MEK A;  2P58 C;  5KNH D;  1DNP A;  3FTS A;  3Q73 A;  3QK0 A;  3R7R A;  2QZA A;  3PZ3 A;  2J9Q A;  1DVP A;  3ASF A;  4PUC A;  4XIF A;  1E7V A;  2IOS A;  4IRU A;  4ILG A;  3C3Q A;  1OCO E;  1MZC A;  5AYW D;  3FUI A;  1K1A A;  5CEA A;  2MOW A;  5ITZ F;  2RG8 A;  1KT1 A;  4O1P A;  1WY6 A;  4PS8 A;  3T5V A;  2FI7 A;  3SZ7 A;  4KBQ A;  4RSY A;  4FP7 A;  3ABM E;  4EQF A;  1N11 A;  5BV1 A;  3UXG A;  4JA9 A;  3QOU A;  2WQH A;  2P9P G;  4Y6C A;  3PNL B;  4GMJ A;  3RRM B;  4G23 A;  5BUZ A;  3UMV A;  1HS6 A;  5FIO A;  1UG3 A;  1Z6T A;  1E90 A;  3LS8 A;  4CZ2 D;  4LSZ E;  2Y69 E;  5HS0 A;  5KJK A;  3ZU7 B;  3UIP C;  2HE0 A;  5CHE E;  3PZD A;  4N5Q A;  3VLD A;  4UI9 J;  4Q96 A;  4GPK A;  4PS7 A;  2PL2 A;  3LKU A;  2DZO A;  3ZEF A;  4FLH A;  4JHK A;  3HXE A;  4MRU A;  3GW4 A;  4CYM D;  5D0Q D;  3I4G A;  4CEM A;  2HR2 A;  4DX1 A;  3NB2 A;  3CQG B;  4HOS A;  3QAR A;  5J08 A;  2FO1 E;  4BT9 A;  4FAD A;  3BUA A;  4GB9 A;  3CST A;  4GTP A;  4XI0 A;  4ATZ D;  5B1A E;  3C5R A;  4MLP A;  3UPV A;  1E8Y A;  2VSY A;  5JA4 D;  4AM9 A;  4JHR A;  4U0U A;  1UN8 A;  2IQC A;  3P2B A;  2RFM A;  5LX8 A;  2OND A;  4GCO A;  4XX5 A;  1LTX A;  2KAT A;  3CKB A;  5BXU A;  5CBO A;  3FY4 A;  1N0R A;  4O1O A;  3JUE A;  2UWJ G;  2Y3A A;  3X2Q E;  2ETC A;  3B7B A;  2GRL A;  1A5E A;  4B8A A;  3AG3 E;  3HYM B;  4G11 A;  3CVW A;  3FTW A;  4HOR A;  4DI4 A;  1BPO A;  1IXV A;  1N54 A;  4U07 A;  3HXB A;  2X38 A;  4AY6 A;  4X8Q A;  2KC7 A;  3LY7 A;  4XKB A;  1NA3 A;  4ATG A;  2DIW A;  2V8S E;  4E85 A;  2XPY A;  4HXI A;  3L9T A;  3I3N A;  1FPP A;  1N94 A;  2LXL A;  5JHA A;  3C3R A;  4BSX A;  3JQ0 A;  4HRL A;  2BUG A;  4BER A;  1EPU A;  4ILH B;  4WUY A;  2X6I A;  3V2O A;  3OXG A;  3RRN B;  2BKG A;  2YHC A;  4I1M A;  4UWF A;  3WXX A;  4GZ5 A;  3CR3 A;  3HRA A;  4GAA A;  2R03 A;  5LCW C;  4WND A;  4BES A;  4TUU A;  3G2T A;  4KZC A;  2KZT B;  4N5C A;  5BT1 A;  4BET A;  3JYS A;  3CHO A;  3NQP A;  5AJD A;  3CIA A;  4NRH B;  1TNB A;  2DWZ A;  3VLE A;  3BG1 B;  3SD5 A;  4WWN A;  2WXH A;  2MRI A;  3LVR E;  3ABK E;  3CHS A;  1HE8 A;  1H0A A;  4RVB A;  3B13 A;  2V4H C;  5FT9 A;  3SQV A;  3CGH A;  2XEN A;  2L6B A;  3DXK G;  3JQ1 A;  2PQR A;  3HHM A;  3JXI A;  4GCN A;  2F0Y A;  3RRU A;  3RSE G;  3CVV A;  4B8C B;  1OXJ A;  4L9P A;  5HRY A;  2EIJ E;  4K03 A;  5JJT A;  3CVY A;  1P5Q A;  3CKC A;  3D9N A;  2I1K A;  3ULY A;  1G3N B;  3DST A;  2DYR E;  4HOQ A;  3SF4 A;  2XRZ A;  5J90 A;  3FUK A;  4OAV B;  2R2L A;  5FZQ A;  2WXM A;  2XS1 A;  3MGB A;  4M7C A;  3ABL E;  3FHE A;  4BX9 A;  4JXT A;  2WXL A;  3FU5 A;  4Q69 A;  4C9B B;  3HG0 D;  4CDR A;  4UI9 K;  4BWR A;  1RW2 A;  4J7W A;  1ELK A;  1EDU A;  2ION A;  3L17 A;  3URZ A;  2WXJ A;  5CBN A;  3L22 A;  3GYZ A;  1S0P A;  3FUH A;  4APF A;  4EHM A;  2R17 C;  3FTV A;  3DPD A;  5ENN A;  3LJ3 A;  2V4L A;  4YDY A;  4GTM A;  1U3D A;  4KZ0 A;  3FUE A;  1TNY A;  1OCZ E;  5CCL A;  4OVU A;  3PE3 A;  4EZK A;  2IO2 C;  2CHZ A;  4O6F A;  1QYM A;  1O1S A;  3DBS A;  2PNN A;  3FH7 A;  3UIN C;  4XKC A;  4MKT A;  4RQI A;  4DRX E;  2JAB A;  1BD8 A;  4HFG A;  3G2V A;  1MYO A;  1DCE A;  3TWX A;  4CRW A;  5ANL A;  3D9P A;  4LNG A;  3ISM C;  2J49 A;  4L2L A;  4ANU A;  3DPY A;  3PUJ A;  3UTM A;  2WXF A;  3DSW A;  3EU5 A;  2QFC A;  2WB2 A;  4MBG A;  2X3M A;  4CDN A;  3RJV A;  4YDW A;  1YA0 A;  4ILI A;  3U64 A;  3S2A A;  4I17 A;  3FUM A;  3W9G A;  2FUL A;  3EHR A;  2H6H A;  3CQC B;  3CVP A;  4GTQ A;  4U0Z A;  3QWP A;  3CSF A;  2I9C A;  2J09 A;  2NYJ A;  4L7T A;  3CV0 A;  3UKR G;  3FTU A;  3Q47 B;  1H2V C;  1LF8 A;  1D8E A;  3EU9 A;  3TAX A;  2LNI A;  2GGF A;  3BG0 B;  5AN8 A;  2XCC A;  3DXM G;  3Q9U C;  3S7F A;  1KPS B;  4FU3 A;  4HVB A;  2PM6 A;  1ZBP A;  1MX2 A;  4U8V D;  2IJG X;  3O48 A;  1X5B A;  2A5E A;  2Y0B G;  5AQ9 A;  4N3A A;  3ZNG A;  2P9I G;  3UX4 A;  5EDS A;  3J5Q B;  4AXH A;  4UQY A;  1HO8 A;  5FWQ A;  1E8W A;  4JW1 A;  3AU4 A;  4A55 A;  3MV2 B;  4HRM B;  4E6H A;  5HKP A;  4XEI G;  1IYG A;  5A23 A;  2YNQ A;  4V3I A;  1L5J A;  2KCV A;  2F8Y A;  2HO1 A;  5G04 J;  1UJK A;  1WDY A;  2LUH A;  4I9C A;  4HQD A;  4FA6 A;  4BSZ B;  2AXV A;  2FO7 A;  2LAH A;  3Q15 A;  1MJ0 A;  2I2O A;  4KVM A;  2NSZ A;  4BX8 A;  5D0O D;  1NFI E;  1E8Z A;  2ZGG A;  2XCB A;  4FLB A;  5FQ6 A;  4GU5 A;  3CHM A;  2OV8 A;  4HLE A;  3L16 A;  2OEV A;  3DWL G;  1AP7 A;  4B0Z A;  4GZ6 A;  2J8S D;  2HM8 A;  4YVQ C;  2XPZ A;  3DSX A;  4ZFH A;  2XZD G;  2AXU A;  3Q7F A;  4BFR A;  5LCW J;  2WM9 A;  2BTD A;  3VTY A;  4J8F A;  5CCM A;  4URK A;  3EHN A;  2VGX B;  2EIM E;  2OVF A;  1SA5 A;  1OCC E;  3IHY A;  4GYW A;  3QAQ A;  4I1O B;  4YDE A;  3TL5 A;  5KNG A;  3V79 K;  3S7D A;  4B94 A;  5FQ8 A;  4DUI A;  3Q4A B;  1OWN A;  3EUV A;  3RO3 A;  3RAU A;  2IF4 A;  1ZU2 A;  5HI7 A;  2XGO A;  2CHW A;  3J5P A;  3V30 A;  3ASO E;  1K3Z D;  4AOF A;  4OAU C;  1N95 A;  1FCH A;  3CVN A;  4DPR A;  2EIL E;  3C98 A;  4F1P A;  3VTX A;  4PS3 A;  3D9K A;  1QZ2 A;  5IY5 E;  5G2N A;  1D8D A;  2V0P A;  3FU6 A;  5BW8 C;  4Q94 A;  4JA7 A;  4LNU D;  4I1A A;  2CG2 A;  3ESK A;  2WXR A;  4GZD A;  3APD A;  3UKU G;  3ZUV B;  1KT0 A;  4U96 D;  5ENP D;  1MX4 A;  3TG5 A;  1YYH A;  4C0E A;  3QDN A;  1FT1 A;  1FVH A;  4B89 A;  4DK5 A;  3Q7A A;  3TGO A;  4A63 B;  1NZN A;  3SHF A;  3HXD A;  1ELW A;  3CK7 A;  1IQR A;  2AVP A;  1W3B A;  3Q79 A;  2XZT G;  4FC8 A;  1AWC B;  1FT2 A;  2VSO E;  2JEK A;  3R9M A;  2Y1L E;  2EIN E;  1BI8 B;  3PRE A;  3ZRH A;  3RKV A;  4GTO A;  2B0O E;  1DC2 A;  3D9I A;  2R05 A;  2P9L G;  3B7T A;  4CT4 A;  3V31 A;  1YMP A;  4EZJ A;  3ZVV A;  1BLX B;  2J07 A;  3JCK C;  2CHX A;  5EN5 D;  4ANV A;  4DX2 A;  1SW6 A;  3MA5 A;  3ZHE B;  4CGV A;  4GA2 A;  1ZB1 A;  4HB5 A;  1OWP A;  5M72 A;  2IO3 C;  4DLO A;  2J4B A;  3PVL A;  2YIN A;  2ZGD A;  3G2S A;  3EIQ C;  3JXJ A;  4GYO A;  3SGH A;  5AQB A;  2NXP A;  3SBS A;  4D10 C;  1XGW A;  3QB2 A;  4WAF A;  5T4Y A;  2CG3 A;  3I5P A;  5B1B E;  1TEZ A;  4N3B A;  3ASG A;  2C0L A;  4UUC A;  2A5U A;  3SY2 A;  2KCK A;  3U9W A;  1HH8 A;  1N4S A;  1N9A A;  3C3O A;  2IEJ A;  1O1T A;  1N0Q A;  1U3C A;  5ARG A;  3Q78 A;  4LEU A;  1U2V G;  2XGS A;  4N39 A;  1PC2 A;  3B7S A;  4A3V A;  3BEE A;  4JPS A;  3Q49 B;  4AEZ C;  3KAE A;  5CRV A;  4J6I A;  2Y4U A;  3AS8 A;  1S64 A;  5AAR A;  1N4R A;  5JHB A;  3FTY A;  2KBX A;  4LER A;  2P9K G;  4AP2 A;  2L6J A;  4R7L A;  2KM4 A;  3PDN A;  4NQ0 A;  3UM2 A;  4H7X A;  3ULE G;  1Z3Y A;  3WG7 E;  4DX6 D;  1TN7 A;  4UWG A;  3B95 A;  5G04 C;  2XEH A;  4U04 A;  3ZGQ A;  2F37 A;  3OTN A;  2VGX A;  4ACL A;  4G25 A;  1SZA A;  1SQM A;  1UOH A;  4U95 D;  2WMN A;  3CLJ A;  1E96 B;  1FVF A;  1MX6 A;  1LD8 A;  3EIJ A;  1OUV A;  4GYY A;  3L82 A;  3NOC D;  1OWM A;  3FH8 A;  3QKY A;  4FJZ A;  5HQ8 A;  3SI5 A;  3D9H A;  1HF8 A;  2IU1 A;  2QY7 A;  2L9B A;  3F6Q A;  1HZ4 A;  1JUQ A;  1LD7 A;  4AVX A;  5BXO A;  2IFU A;  2AJA A;  1Z3X A;  3IKO B;  5ENS D;  2J08 A;  4LRZ A;  3BQO A;  1N4P A;  4AY5 A;  3FTX A;  5CMW A;  2FBN A;  4GZ3 A;  2I6H A;  3MX3 A;  3TXM A;  4GZC A;  3PH0 C;  5EID A;  4MS6 A;  1E8X A;  3SO8 A;  3UUX A;  4DI3 A;  4K5B A;  3CVU A;  3G2U A;  3AG2 E;  3LEW A;  4Z68 A;  4WWO A;  3B7R L;  3EDT B;  4W9R A;  3MJW A;  2V5F A;  5JJ6 A;  2GRR B;  2FEZ A;  4FHK A;  2LO6 A;  2J4D A;  3LY8 A;  3QWV A;  3ZXS A;  1H2T C;  1EYH A;  3KSQ A;  3NZS A;  2QYU A;  4J8Y A;  2CFU A;  2UY1 A;  5BNW A;  1NI1 A;  4K0R A;  4TXR A;  2XRY A;  3FTZ A;  3SFZ A;  3ZN3 A;  5DIZ A;  5DBK A;  1WG0 A;  4TXP A;  4YND A;  2OEW A;  4ME2 A;  5EX3 A;  2WXN A;  2XQ0 A;  3CEQ A;  2BED A;  3HXF A;  2P9N G;  3RK6 A;  3TWR A;  3MKR A;  4GTV A;  1N4Q A;  3AS5 A;  3CK8 A;  1S70 B;  1QNF A;  3E34 A;  3O4Z A;  3HVE A;  5FJY A;  3DSU A;  1H2U A;  1H19 A;  2PZI A;  4UQZ A;  3LDZ A;  3OXF A;  2VSN A;  3TWS A;  5C2Y A;  5FZR A;  2MYO A;  3FUD A;  4WWP A;  3HDX A;  2ETB A;  2ZIR A;  4LG6 A;  4QFV A;  2EQX A;  2AWI A;  4I6J A;  2LAI A;  5FQ4 A;  5T8I A;  4JEU A;  3APF A;  3CK9 A;  3JUI A;  5A6C A;  2WXG A;  3ZIM A;  2QYJ A;  3DRA A;  4BT8 A;  4FHJ A;  2WQ6 A;  2P2C P;  3AAA C;  4L23 A;  4J8D A;  2IOL A;  5E76 A;  2B6C A;  3AJI A;  2L0T B;  1TJF A;  1KZP A;  1SA4 A;  1HFA A;  1HX8 A;  3U66 A;  3OAW A;  3D9M A;  5LOZ A;  3TWU A;  4TUM A;  3FU3 A;  3P1U A;  3D9L A;  4HOT A;  5FZS A;  1IHB A;  3R9A B;  5CRU A;  3L54 A;  4EPZ A;  1QBQ A;  2MHK A;  4GML A;  3ZYQ A;  3KD7 A;  3C72 A;  4UI9 C;  4NIK A;  1JPL A;  1TYQ G;  2F8X K;  3T5X A;  3W9F A;  3LVQ E;  3NAW A;  4HOU A;  3TXN A;  1Y6I A;  3Q5M A;  2DVW A;  3ASD A;  2DZN A;  4EEC A;  3E30 A;  3D9O A;  4G1T A;  4G26 A;  4G8K A;  5EIL A;  3RO2 A;  4KMO A;  4I43 A;  1MQS A;  2ZIS A;  4G24 A;  5JMN D;  1JCQ A;  4U8H A;  2RKK A;  5EIB E;  4DLQ A;  3FP3 A;  4DX5 D;  1HXI A;  3CVQ A;  1QQE A;  4HS2 A;  5EX0 A;  4TXQ A;  2ETA A;  1TNU A;  1OY3 D;  1TN6 A;  3LJN A;  4XI9 A;  2Y4T A;  3QC1 A;  3Q75 A;  1H6P A;  3ONK A;  5G55 A;  3NBN B;  5BPP A;  4ACK A;  3ML9 A;  3ASN E;  4F7A A;  1TJC A;  3CHP A;  3R7Q A;  1EF1 C;  2R59 A;  3KS2 A;  3AS4 A;  4G8L A;  1KZO A;  1TR4 A;  2Q7F A;  3FUL A;  3EJN A;  1JCR A;  4OYS A;  3FUJ A;  4JC8 A;  1SZ9 A;  4Y6W A;  3IV0 A;  4JL0 A;  1H6O A;  4B93 B;  3IBE A;  1UW4 B;  3L08 A;  5FTP A;  2DBA A;  5CMY A;  2P9S G;  4WNF A;  4RG9 A;  5H7P A;  3TJP A;  2AW6 A;  2X6K A;  3NZU A;  4C48 B;  5LP0 A;  1H6K A;  4K5C A;  5KBA A;  3FUF A;  4KXK B;  2WXP A;  3MKQ A;  5ENQ D;  3ZHE A;  3SFY A;  4GTR A;  3ZKJ A;  3QNK A;  5AJL A;  1INZ A;  4U63 A;  2LSV A;  1RZ4 A;  2VTB A;  3HXC A;  4TV3 A;  4N3C A;  1V55 E;  1BI7 B;  2VGY A;  3CHQ A;  4HI8 A;  4HLL A;  3MV3 B;  2GRP B;  5EKQ D;  4J8E A;  1N52 A;  4JD2 G;  2C2L A;  2E2E A;  1BU9 A;  3PZ1 A;  3I4R B;  3SFX A;  5KJM A;  3DSV A;  4UWL A;  1TNO A;  4KT6 B;  4HBD A;  3LY9 A;  2XPI A;  2L0I A;  3SBT B;  5CEC B;  5EYL A;  4I2W A;  2M63 A;  4UQX A;  2WVI A;  2WXQ A;  1WAO 1;  3S7J A;  3PS6 A;  5C1D A;  4I6E A;  3TG4 A;  3KEA A;  3PNT B;  1SVX A;  3DEO A;  4APO A;  5CER B;  2PQN A;  1GW6 A;  2VGE A;  3AG4 E;  3ZYL A;  1PY1 A;  3PEU B;  2NC9 A;  4RG6 A;  1KLX A;  3VLF A;  4JZY A;  4UWK A;  3FH5 A;  4YVO A;  5T3R A;  2WMO A;  1UJJ A;  4AV7 A;  3ESL A;  2BKK B;  2XEV A;  3MYV A;  5KJN A;  2VYI A;  3FUN A;  3PRZ A;  2H6F A;  3PUK A;  2WXO A;  3V2X A;  4I6G A;  1S63 A;  3ZW3 A;  5E75 A;  3UQ3 A;  2FF4 A;  2QC9 A;  1OT8 A;  2IY0 C;  1PAQ A;  3MKQ B;  3N71 A;  4H7Y A;  5D66 A;  3FFL A;  4CDM A;  1O1R A;  3RU0 A;  2VQ2 A;  3SNX A;  5A7D B;  3KSL A;  4FUL A;  4BTA A;  4PH4 B;  4RLY A;  3UI2 A;  2I1J A;  3G2W A;  4XZ4 A;  1HG2 A;  4AJW A;  3LYA A;  4A1S A;  4N2S A;  2A4Z A;  2WQ7 A;  2P9U G;  4F6R D;  4A1G A;  1A17 A;  2VJ8 A;  5G05 J;  3ULQ A;  1WM5 A;  3GZ1 A;  3UM3 A;  4KYO B;  2GRO B;  3D3M A;  3PZ2 A;  4LUN U;  4LNB A;  3ZYM A;  5ARF A;  5ANR A;  3FEY A;  2R02 A;  4U7E B;  2OCC E;  3D9J A;  3OXL A;  3K9I A;  2GRQ B;  4ABN A;  2WXK A;  5BV0 A;  5ENR D;  4BY6 A;  2XGM A;  3UT7 A;  4F53 A;  1JWG A;  4UWH A;  4ZHB A;  3UIO C;  1HG5 A;  2R5S A;  3U4T A;  4HRN A;  3ENE A;  3AU5 A;  4AIF A;  4NUR A;  2X6H A;  5FQ7 A;  3U3W A;  5AAO A;  2X6J A;  2AXZ A;  4I9E A;  1HU3 A;  5ENO D;  1Q2Z A;  3FWV A;  2H6G A;  4ANW A;  2ZU6 B;  3HVE B;  3CHR A;  1JWF A;  4C0M A;  1UN9 A;  4GMR A;  4FJY A;  4F3V A;  4QQI A;  3DSS A;  4L2Y A;  2KZT A;  3BU8 A;  3E33 A;  3ZYK A;  4WNE A;  2VSX E;  1ELR A;  1IKN D;  3CVX A;  3PEV B;  3UM1 A;  2H6I A;  1JCS A;  5LFA A;  4F1S A;  4KVO A;  5EYP F;  5JJ7 A;  3EHQ A;  4GTS A;  5FIN A;  3AG1 E;  2V5Q C;  2UY1 B;  4YDO A;  1Y8M A;  2C0M A;  2KXP C;  4CCA A;  5AEN A;  4BEP A;  3FDH A;  3EHM A;  2WPV A;  4U0S A;  1OWL A;  1V54 E;  2E0I A;  4HI9 A;  3ZFW A;  3GZS A;  3LXU X;  3QJZ A;  1XNF A;  4I2Z A;  1OCR E;  3DEP A;  3E32 A;  3IXE A;  4IUL A;  3RIB A;  3MCX A;  2OOE A;  2X6F A;  4GPM A;  4PDX A;  2BF0 X;  3TWV A;  1E7U A;  3Q9N C;  2ZXW E;  4ANX A;  4P29 A;  2DYS E;  1IHG A;  3PZ4 A;  2ILR A;  3L13 A;  4CGW A;  4JVS A;  4EBA G;  3APC A;  4GA1 A;  4WNG A;  3FU0 A;  4J8S A;  3NOG D;  5AIJ A;  4XE0 A;  1IQU A;  1NP7 A;  2GW1 A;  4IN3 B;  1OWO A;  3IHV A;  2OVB A;  4IYP A;  2LSU A;  5KJL A;  5KCM A;  2JLB A;  5G05 C;  3LPZ A;  1K1B A;  5CED B;  5AQ7 A;  3T9K A;  4A3T A;  4BTB A;  2EIK E;  1DCQ A;  1O5M A;  3NF1 A;  4OVV A;  4LCT A;  2LXM A;  1B89 A;  3ASH A;  1NL4 A;  4CT0 A;  2DCP A;  3S7B A;  1MHQ A;  3ZXP A;  3L6A A;  1X81 A;  2YQ8 A;  3HIZ A; 
#chains in the Genus database with same CATH homology
 4GA0 A;  4N3B A;  5FTP A;  3FEX A;  3ASG A;  2WXJ A;  2DBA A;  2C0L A;  5CMY A;  3L22 A;  4WNF A;  2A5U A;  4RG9 A;  2KCK A;  3U9W A;  1HH8 A;  3GYZ A;  3TJP A;  1S0P A;  2AW6 A;  2X6K A;  3NZU A;  3FUH A;  2PM7 A;  4APF A;  2GRM A;  4JHJ A;  5LP0 A;  1H6K A;  2R17 C;  3FTV A;  3DPD A;  1U3C A;  2XHE A;  5ENN A;  3LJ3 A;  2V4L A;  3I5P A;  3FUF A;  5ARG A;  3GZ2 A;  1U3D A;  4LEU A;  4KXK B;  4KZ0 A;  3FUE A;  4G2V A;  2WXP A;  2YHE A;  3MKQ A;  4NAC A;  4N2Q A;  2XGS A;  3UT4 A;  5CCL A;  3ZHE A;  2KCL A;  4N39 A;  4OVU A;  3PE3 A;  4EZK A;  1PC2 A;  3B7S A;  4JEH A;  4A3V A;  3BEE A;  2CHZ A;  4JPS A;  3B7U X;  3Q49 B;  4O6F A;  3KEZ A;  3QNK A;  4AEZ C;  5AJL A;  2VTB B;  3KAE A;  1INZ A;  4J6I A;  4U63 A;  3IEG A;  3DBS A;  3FH7 A;  3PE4 A;  2LSV A;  4XKC A;  2Y4U A;  3CVL A;  4MKT A;  3AS8 A;  2VTB A;  4TRQ A;  4HFG A;  4TV3 A;  3T8M A;  5JHB A;  3FTY A;  4N3C A;  4LER A;  2CFZ A;  3G2V A;  4AP2 A;  2L6J A;  4R7L A;  3E4B A;  2VGY A;  3CHQ A;  4CRW A;  5ANL A;  2KM4 A;  3D9P A;  1NA0 A;  3PDN A;  4NQ0 A;  3MV3 B;  4H7X A;  4EBA A;  2J49 A;  5EKQ D;  4J8E A;  1N52 A;  1Z3Y A;  4L2L A;  2C2L A;  4EZL A;  2E2E A;  4UWG A;  4ANU A;  3PUJ A;  2WXF A;  1VDY A;  2HYZ A;  2QFC A;  2WB2 A;  5G04 C;  4U04 A;  4DJA A;  3ZGQ A;  2X3M A;  3I4R B;  3OTN A;  3QWW A;  4M3O A;  3ZPJ A;  4CDN A;  3LCA A;  3RJV A;  4L1B A;  2VGX A;  4J0U A;  3MZL B;  5KJM A;  2WXI A;  4ACL A;  1YA0 A;  4ILI A;  3ML8 A;  4G25 A;  1SZA A;  1SQM A;  4UWL A;  3ONL A;  3U64 A;  3S2A A;  4KT6 B;  4I17 A;  3UT8 A;  3LY9 A;  3FUM A;  2WMN A;  3CLJ A;  1E96 B;  1FVF A;  2XPI A;  2FUL A;  2RD0 A;  3MEK A;  2L0I A;  2P58 C;  3SBT B;  1DNP A;  3FTS A;  3CQC B;  3QK0 A;  3CVP A;  3EIJ A;  3R7R A;  1OUV A;  4I2W A;  2M63 A;  4GYY A;  2J9Q A;  4UQX A;  2WVI A;  1DVP A;  3ASF A;  4PUC A;  4U0Z A;  1OWM A;  2WXQ A;  3FH8 A;  3QWP A;  4XIF A;  3CSF A;  1WAO 1;  3QKY A;  1E7V A;  4FJZ A;  2I9C A;  2J09 A;  3S7J A;  3SI5 A;  1HF8 A;  2IU1 A;  2IOS A;  3PS6 A;  2QY7 A;  4IRU A;  5C1D A;  4I6E A;  4ILG A;  4L7T A;  3CV0 A;  2L9B A;  3FTU A;  3Q47 B;  3TG4 A;  1H2V C;  1LF8 A;  3PNT B;  1HZ4 A;  1JUQ A;  5AYW D;  3FUI A;  4APO A;  3TAX A;  4AVX A;  2MOW A;  2IFU A;  2LNI A;  2GGF A;  3BG0 B;  1Z3X A;  3IKO B;  2PQN A;  2RG8 A;  1GW6 A;  1KT1 A;  3URZ A;  2J08 A;  4LRZ A;  1WY6 A;  4PS8 A;  3T5V A;  2FI7 A;  3FTX A;  3SZ7 A;  2XCC A;  2FBN A;  4GZ3 A;  1PY1 A;  3ZYL A;  3PEU B;  4AY5 A;  2I6H A;  5CMW A;  3MX3 A;  3TXM A;  2NC9 A;  4GZC A;  4RG6 A;  3S7F A;  1KLX A;  4KBQ A;  4RSY A;  4JZY A;  3VLF A;  4FP7 A;  4UWK A;  3PH0 C;  4FU3 A;  4HVB A;  4MS6 A;  1TEZ A;  2PM6 A;  4EQF A;  1ZBP A;  1E8X A;  3FH5 A;  4YVO A;  5BV1 A;  4JA9 A;  3UUX A;  2IJG X;  4DI3 A;  3QOU A;  5T3R A;  2WQH A;  2WMO A;  3O48 A;  1UJJ A;  3CVU A;  4Y6C A;  4AV7 A;  3PNL B;  4GMJ A;  3G2U A;  3ESL A;  3RRM B;  4G23 A;  5BUZ A;  1X5B A;  2XEV A;  3MYV A;  1HS6 A;  4N3A A;  2VYI A;  3UMV A;  3UX4 A;  5KJN A;  3FUN A;  5EDS A;  3PRZ A;  1UG3 A;  1Z6T A;  1E90 A;  3LEW A;  3LS8 A;  3PUK A;  4AXH A;  4UQY A;  2WXO A;  1HO8 A;  4WWO A;  3B7R L;  4I6G A;  5FWQ A;  5KJK A;  3EDT B;  5CHE E;  3PZD A;  4W9R A;  3MJW A;  2V5F A;  3ZW3 A;  3VLD A;  4UI9 J;  1E8W A;  4JW1 A;  4Q96 A;  4GPK A;  5E75 A;  5JJ6 A;  3UQ3 A;  2FF4 A;  4PS7 A;  2FEZ A;  1PAQ A;  3AU4 A;  3MKQ B;  3N71 A;  2PL2 A;  3LKU A;  4FHK A;  3ZEF A;  4FLH A;  2LO6 A;  4JHK A;  4H7Y A;  4A55 A;  2J4D A;  3MV2 B;  4MRU A;  3GW4 A;  3LY8 A;  3QWV A;  4E6H A;  3ZXS A;  5D0Q D;  1H2T C;  3I4G A;  4CEM A;  1EYH A;  3NZS A;  2HR2 A;  3FFL A;  4CDM A;  2CFU A;  2UY1 A;  1IYG A;  5BNW A;  5A23 A;  2YNQ A;  3CQG B;  4HOS A;  3QAR A;  4K0R A;  4V3I A;  3RU0 A;  1L5J A;  2VQ2 A;  2XRY A;  5A7D B;  3SNX A;  4BT9 A;  5J08 A;  4FUL A;  3FTZ A;  4BTA A;  4PH4 B;  2I1J A;  3SFZ A;  2KCV A;  4FAD A;  4GB9 A;  3ZN3 A;  3G2W A;  4XZ4 A;  1HG2 A;  4AJW A;  3LYA A;  4A1S A;  3CST A;  5DBK A;  5DIZ A;  4XI0 A;  4N2S A;  4YND A;  4ME2 A;  2HO1 A;  2A4Z A;  2WXN A;  5EX3 A;  5G04 J;  2WQ7 A;  1UJK A;  4A1G A;  2XQ0 A;  4I9C A;  5HQ8 A;  3CEQ A;  4MLP A;  3UPV A;  1E8Y A;  2VSY A;  1A17 A;  4FA6 A;  4AM9 A;  4JHR A;  3RK6 A;  2AXV A;  2FO7 A;  2LAH A;  3Q15 A;  2VJ8 A;  2I2O A;  3MKR A;  4U0U A;  5G05 J;  4KVM A;  2NSZ A;  3ULQ A;  1UN8 A;  1WM5 A;  4BX8 A;  3AS5 A;  3CK8 A;  5D0O D;  1E8Z A;  2IQC A;  3GZ1 A;  1QNF A;  3P2B A;  4KYO B;  5LX8 A;  2XCB A;  4FLB A;  5FQ6 A;  3D3M A;  3O4Z A;  4LUN U;  2OND A;  4GCO A;  3HVE A;  4GU5 A;  3CHM A;  2OV8 A;  5FJY A;  4HLE A;  1H2U A;  3L16 A;  4XX5 A;  1H19 A;  2KAT A;  3ZYM A;  5ARF A;  5ANR A;  3FEY A;  3CKB A;  2PZI A;  4B0Z A;  4UQZ A;  3D9J A;  3LDZ A;  3OXL A;  3K9I A;  4GZ6 A;  3FY4 A;  4ABN A;  2HM8 A;  3OXF A;  4YVQ C;  2VSN A;  2WXK A;  2XPZ A;  5BV0 A;  5C2Y A;  5FZR A;  4BY6 A;  2UWJ G;  2XGM A;  3UT7 A;  2Y3A A;  3FUD A;  4WWP A;  3HDX A;  4F53 A;  4QFV A;  2EQX A;  2AWI A;  1JWG A;  2LAI A;  2AXU A;  4I6J A;  4UWH A;  5FQ4 A;  5T8I A;  4JEU A;  2GRL A;  3APF A;  3CK9 A;  3JUI A;  4BFR A;  2WM9 A;  5A6C A;  5LCW J;  2BTD A;  1HG5 A;  2WXG A;  3VTY A;  2R5S A;  4J8F A;  3ZIM A;  5CCM A;  3U4T A;  4URK A;  4B8A A;  3EHN A;  3ENE A;  2VGX B;  4BT8 A;  3AU5 A;  3HYM B;  4FHJ A;  4NUR A;  2X6H A;  2OVF A;  4AIF A;  4G11 A;  5FQ7 A;  3CVW A;  3U3W A;  3FTW A;  2WQ6 A;  4HOR A;  4DI4 A;  2X6J A;  3IHY A;  1BPO A;  2AXZ A;  3QAQ A;  4GYW A;  4I1O B;  3TL5 A;  1N54 A;  4U07 A;  4I9E A;  4L23 A;  1HU3 A;  2X38 A;  4AY6 A;  2KC7 A;  4J8D A;  3LY7 A;  3S7D A;  4XKB A;  3FWV A;  1NA3 A;  4B94 A;  4ANW A;  2IOL A;  2ZU6 B;  5FQ8 A;  4ATG A;  5E76 A;  2DIW A;  3HVE B;  3Q4A B;  3CHR A;  1OWN A;  2V8S E;  1JWF A;  4E85 A;  2L0T B;  1TJF A;  4C0M A;  1UN9 A;  4FJY A;  4F3V A;  2XPY A;  4HXI A;  3RO3 A;  1HFA A;  3I3N A;  2IF4 A;  1ZU2 A;  5HI7 A;  2XGO A;  2CHW A;  1HX8 A;  5JHA A;  3U66 A;  3OAW A;  3D9M A;  4L2Y A;  5LOZ A;  2KZT A;  4BSX A;  3ZYK A;  4WNE A;  3JQ0 A;  2VSX E;  3FU3 A;  1ELR A;  3CVX A;  3PEV B;  3P1U A;  4AOF A;  2BUG A;  3D9L A;  4HOT A;  5FZS A;  5LFA A;  4F1S A;  1EPU A;  4KVO A;  3R9A B;  4ILH B;  1FCH A;  5JJ7 A;  3CVN A;  4DPR A;  4WUY A;  2X6I A;  3C98 A;  3L54 A;  3OXG A;  3RRN B;  3VTX A;  4PS3 A;  4EPZ A;  3D9K A;  1QZ2 A;  2YHC A;  2MHK A;  4GML A;  5G2N A;  2UY1 B;  4I1M A;  4UWF A;  2V0P A;  3WXX A;  4GZ5 A;  3CR3 A;  4GAA A;  1Y8M A;  3KD7 A;  3FU6 A;  3ZYQ A;  2C0M A;  4UI9 C;  5LCW C;  4WND A;  4Q94 A;  1JPL A;  5BW8 C;  4CCA A;  4JA7 A;  4TUU A;  3T5X A;  3G2T A;  4KZC A;  2KZT B;  4N5C A;  5AEN A;  5BT1 A;  3JYS A;  3CHO A;  3FDH A;  3NQP A;  3EHM A;  4I1A A;  2WPV A;  5AJD A;  3CIA A;  3LVQ E;  4HOU A;  4U0S A;  4NRH B;  3TXN A;  1OWL A;  2CG2 A;  1Y6I A;  3VLE A;  3BG1 B;  2E0I A;  3ESK A;  3Q5M A;  3SD5 A;  2WXR A;  4GZD A;  3APD A;  3ZFW A;  3GZS A;  3LXU X;  1KT0 A;  3ASD A;  3QJZ A;  1XNF A;  3TG5 A;  4WWN A;  4I2Z A;  2WXH A;  2MRI A;  4C0E A;  4EEC A;  3LVR E;  3D9O A;  4IUL A;  3CHS A;  3QDN A;  1HE8 A;  4G1T A;  4G26 A;  1H0A A;  3RIB A;  3RO2 A;  4KMO A;  4I43 A;  3MCX A;  1FVH A;  4B89 A;  4DK5 A;  2OOE A;  2X6F A;  3TGO A;  4PDX A;  4RVB A;  2BF0 X;  3B13 A;  5FT9 A;  1MQS A;  3CGH A;  1NZN A;  1E7U A;  3SHF A;  4ANX A;  4G24 A;  1ELW A;  4P29 A;  3JQ1 A;  2PQR A;  4U8H A;  3CK7 A;  1IQR A;  1IHG A;  2AVP A;  2ILR A;  3HHM A;  4DLQ A;  1W3B A;  3L13 A;  4CGW A;  4JVS A;  4FC8 A;  3FP3 A;  4EBA G;  3APC A;  4GA1 A;  4GCN A;  1HXI A;  2VSO E;  2JEK A;  3CVQ A;  4WNG A;  3RRU A;  1QQE A;  4HS2 A;  5EX0 A;  4B8C B;  3CVV A;  3PRE A;  3FU0 A;  4J8S A;  3ZRH A;  3RKV A;  4XI9 A;  4K03 A;  5AIJ A;  5JJT A;  3CVY A;  3D9I A;  4XE0 A;  2Y4T A;  1P5Q A;  3B7T A;  4CT4 A;  3CKC A;  1IQU A;  1NP7 A;  2GW1 A;  3D9N A;  3QC1 A;  4EZJ A;  3ZVV A;  3ONK A;  4IN3 B;  1OWO A;  3IHV A;  2J07 A;  2I1K A;  2OVB A;  5G55 A;  3JCK C;  2CHX A;  4IYP A;  2LSU A;  4HOQ A;  3SF4 A;  5KJL A;  2XRZ A;  5KCM A;  4ANV A;  5BPP A;  5J90 A;  4ACK A;  2JLB A;  3FUK A;  5G05 C;  3ML9 A;  3LPZ A;  3MA5 A;  3ZHE B;  4CGV A;  4F7A A;  1TJC A;  3CHP A;  4GA2 A;  3R7Q A;  4A3T A;  5FZQ A;  1EF1 C;  2R59 A;  2WXM A;  4BTB A;  3KS2 A;  1OWP A;  3AS4 A;  5M72 A;  3MGB A;  3NF1 A;  4DLO A;  2J4B A;  3PVL A;  2YIN A;  3FHE A;  4OVV A;  4LCT A;  4BX9 A;  1B89 A;  4JXT A;  2Q7F A;  3G2S A;  3ASH A;  2WXL A;  3EIQ C;  3FU5 A;  3FUL A;  4CT0 A;  3EJN A;  4GYO A;  4OYS A;  3SGH A;  2DCP A;  4C9B B;  4Q69 A;  3FUJ A;  2NXP A;  3S7B A;  1MHQ A;  4JC8 A;  4CDR A;  3SBS A;  4D10 C;  1SZ9 A;  4Y6W A;  3IV0 A;  4JL0 A;  4UI9 K;  1XGW A;  4BWR A;  3L6A A;  3QB2 A;  4WAF A;  5T4Y A;  1ELK A;  2YQ8 A;  3IBE A;  2CG3 A;  3HIZ A;  1EDU A;  2ION A;  3L17 A;  1UW4 B;  3L08 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...