2LUHA

Nmr structure of the vta1-vps60 complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
167
structure length
167
Chain Sequence
MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSLYNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein VTA1
publication title Structural Basis of Molecular Recognition between ESCRT-III-like Protein Vps60 and AAA-ATPase Regulator Vta1 in the Multivesicular Body Pathway.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport, endocytosis
total genus 63
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 2luhA00
2LUHA 4TXQA 4TXRA 4U7EB 4TXPA 2RKKA 2LXLA 5H7PA 2LXMA
chains in the Genus database with same CATH superfamily
4J8DA 1HF8A 1ZU2A 1SA4A 4ANUA 1KZOA 1MX2A 2WXQA 3GZ1A 3AS5A 3EIQC 4U0UA 5CMYA 1BD8A 1BI7B 3DXMG 4AP2A 3MCXA 4UQXA 5FINA 1TNOA 5D0OD 3ABKE 3CSTA 1S70B 3PZ4A 1HX8A 2IOSA 2KXPC 4H7XA 4BERA 3HXCA 1KZPA 4XX5A 3B7BA 4NACA 2X6IA 4WAFA 1LD8A 4GZ3A 3LEWA 4N5CA 5FQ8A 4HLEA 4Q69A 5D2MC 4B0ZA 3TL5A 1E8YA 3BEEA 3OXLA 4A3VA 2PNNA 3ONLA 3DEPA 4WWOA 4ILIA 3KD7A 3TWSA 3QARA 1AP7A 1FCHA 4EBAA 3B7UX 2IO2C 3JCKC 2L9BA 3MA5A 2LNIA 3PE3A 2UWJG 3D3MA 4K03A 2VGXB 1ELRA 3ESKA 1IQRA 3MKQB 5FT9A 4M7CA 4B8CB 4CDMA 3SNXA 3UX4A 3PZ1A 3IHVA 2F37A 1N4PA 2R59A 3ZYLA 2XEEA 4I9CA 1FPPA 2PZIA 4GCOA 1NA0A 4GTSA 2I2OA 3K9IA 2IO3C 3DPDA 3DSVA 4GMRA 3B7TA 2UY1B 3UI2A 2CHWA 3JUIA 3CV0A 4AJWA 2FO7A 3O48A 2C2LA 1Q2ZA 2X6JA 3CSFA 2Y4TA 4B89A 5J08A 3QK0A 3TWTA 3AG2E 2R05A 4DI3A 3ASHA 2BEDA 1HU3A 3PUJA 3OXFA 3ZNGA 1MJ0A 3LYAA 4TXQA 3DSUA 3CKCA 3CHSA 4U8HA 2CHZA 4HFGA 3APDA 3GW4A 3SFXA 2GRPB 4KYOB 2WVIA 4U95D 5EYLA 3L54A 3N71A 2VSOE 4PS8A 1IKND 1SQMA 4GA0A 4JPSA 3L22A 3EHRA 4AM9A 2AJAA 1TNYA 3ZIMA 1X81A 3Q49B 4YVQC 3JYSA 1PAQA 4L2YA 3T5VA 2LSVA 1HZ4A 5C2YA 5CBOA 2XZDG 1E8WA 1UG3A 2XEHA 2R5SA 2B6CA 3SF4A 1S64A 3QC1A 4FADA 4URKA 1N9AA 2AW6A 1JPLA 2DZNA 2IONA 4JHKA 4PH4B 2OOEA 1JCSA 3IXEA 3VTXA 2QFCA 4DX2A 1TN7A 3SBSA 3HVEA 4MBGA 1QYMA 2J09A 4PDXA 1HE8A 2A4ZA 5CEDB 1RZ4A 4CRWA 1E8XA 4ILGA 5CERB 4GZ6A 1A17A 3FUHA 3LPZA 3NZUA 4AXHA 2DVWA 3RJVA 5KJKA 3DEOA 2V4LA 4XKBA 1SA5A 2VYIA 4GTTA 1OCCE 4GAAA 3ULYA 2P2CP 1FT2A 4U96D 2VTBB 3BG0B 1KT0A 1JCQA 4ME2A 2Y0BG 4A55A 5T4YA 1W3BA 3E30A 3UQ3A 1H6OA 2RKKA 4MKTA 4J7WA 3UMVA 3EUVA 5G55A 3NOCD 4G26A 5AQBA 4HNAD 4DLOA 3VLDA 2Y3AA 5D66A 5LCWJ 4JHRA 5CCLA 2LAIA 4N3BA 5JMND 3G2VA 3PUKA 3FTSA 2WMNA 5KNHD 3V79K 3SQVA 4BT9A 4F1PA 5ENRD 1BU9A 3FUKA 2BTDA 3WXXA 3FFLA 4F6RD 3LY7A 4FULA 5HKPA 2ZIRA 1N0QA 4KVMA 4O6FA 2VGEA 1LF8A 3LVQE 2WXNA 2KBXA 3U64A 1H6PA 1OCZE 3HDXA 1IHGA 4C0EA 3QB2A 2BUGA 3C3OA 3FDHA 3FUDA 2P9IG 3QWWA 4RSYA 1BI8B 5D0QD 1TYQG 2HM8A 3TGOA 4OAUC 3URZA 2EIJE 2QY7A 3CQGB 1YMPA 2AXZA 3PZDA 2JABA 3HRAA 3IBEA 2WXMA 4JW1A 4DK5A 2MHKA 4G11A 1WM5A 1JUQA 3Q78A 1Z3XA 2IOLA 2J49A 3AAAC 2EINE 2XGOA 3FH5A 4ANXA 5ENOD 3C3RA 3ZEFA 4K0RA 5EILA 3CIAA 3FUIA 2KM4A 3S7FA 5AENA 2HYZA 1X5BA 2YNQA 3W9GA 3CVYA 3FWVA 2YINA 2MRIA 1Z5SC 3VTYA 1G3NB 2A5UA 2OVBA 1OY3D 4CYMD 1Y8MA 4HOQA 4BY6A 3GZ2A 2XRYA 3ASOE 2R02A 2XS1A 3WG7E 5AIJA 4LCTA 3FUMA 4TXPA 2RFAA 1NA3A 3SZ7A 3EHMA 4AY5A 2F0YA 3ML9A 3T8KA 1UJKA 2X6KA 3ZYMA 4ABNA 4NIKA 2B0OE 1OWMA 2YHCA 5ENTD 2YHEA 5ENQD 2H6HA 1RW2A 4QFVA 3Q9NC 3B7SA 2OVFA 3QOUA 4LSZE 4NQ0A 2FBNA 3U3WA 4LNBA 3FULA 1LTXA 2VSXE 3EJNA 2WXGA 4OVVA 2DCPA 4M3OA 3TWQA 3MJWA 2P9UG 3LVRE 4BSXA 3G2SA 1K1AA 5JA4D 3NF1A 4RG9A 3MX3A 2WQHA 4G23A 1Z6TA 2FEZA 4KT6B 4GCNA 3B7RL 3FY4A 4FJYA 2QZAA 2DZOA 4G24A 4PUCA 4GA2A 3ZFWA 3UTMA 3NQPA 1FVFA 3ZYKA 2XPYA 3RK6A 2LUHA 4TXRA 4IRUA 1DCQA 4GMLA 3Q73A 4N2QA 2F8XK 3Q9UC 2CG2A 4AVXA 2J4DA 4U7EB 3SFYA 3S7BA 4MRUA 3EU9A 2WXJA 3PNTB 3C5RA 3LS8A 4LUNU 3QKYA 2X3MA 4KBQA 3RRMB 5BUZA 3EHNA 5BT1A 3OTNA 1U2VG 3CHRA 1MZCA 3LCAA 3CK7A 1FVHA 3E37A 3RRNB 4YDWA 4HI8A 5EKQD 1O5MA 1OWNA 3CVVA 3UKUG 3HIZA 4F3VA 4FA6A 4UWGA 3RIBA 4ANVA 3L9TA 1HO8A 5IY5E 1WDYA 2HO1A 1FT1A 3TXNA 2I9CA 5CCMA 3SI5A 5AARA 3C98A 2LXLA 2ZGGA 1KT1A 3GZSA 2V8SE 3G2TA 2V5QC 5LOZA 3QWVA 3B95A 3ZGQA 1UOHA 5LFAA 4CDRA 5ANRA 2CFUA 3J5QB 3FP3A 3E34A 3FTZA 4U63A 3E32A 5KBAA 3CHOA 4WUYA 1D8DA 2CHXA 3EIJA 2IY0C 3IV0A 3Q47B 3FUFA 3RO3A 4L9PA 4Q96A 2P58C 1JWGA 4APFA 1NZNA 4HRNA 3D9HA 4I6JA 2WPVA 3ASDA 2QC9A 2J4BA 3SD5A 1IYGA 1U3CA 2OEVA 4I1OB 2H6IA 2IFUA 3SGHA 4I1AA 3S7DA 1O1TA 4EHMA 2WXFA 5DBKA 2BF0X 4KZCA 3U66A 1HG2A 5FWQA 4EPZA 1H0AA 3V2OA 5G05J 2Q7FA 2ZGDA 1QZ2A 3I5PA 1UN9A 4HOTA 4F1SA 3AG1E 3TXMA 3UIPC 1MYOA 3BUAA 3AG4E 1ELWA 4WNEA 1NFIE 4BETA 3APCA 4GTOA 4GYOA 5EIBE 4ILHB 4GU5A 5BXOA 4J6IA 3HXFA 3QAQA 3FTUA 4C48B 4GMJA 1AWCB 2IQCA 4LG6A 2PQRA 2E0IA 4ANWA 4U04A 2I1JA 4JEUA 4WNDA 3PREA 1O1SA 5BV0A 4J8YA 3Q7FA 2VGXA 3V31A 2FULA 2XS8A 3ONKA 3DPYA 3MKQA 3SBTB 4KVOA 4G2VA 2CG3A 2J07A 1H19A 2KZTB 2F8YA 3C3QA 2AXUA 3ASGA 2WXIA 3UXGA 1A5EA 2R03A 3BU8A 2UY1A 4BEPA 4MS6A 4WWPA 4A1SA 5J90A 4O1OA 3ASNE 4BT8A 1DCEA 5A6CA 4PS3A 2ZISA 2RD0A 3HHMA 3NAWA 4JC8A 5EN5D 3L6AA 4UWHA 3MEKA 3Q7AA 3TG4A 5ANLA 5BW8C 3ZN3A 2PQNA 5FQ4A 3RSEG 1BPOA 4GTQA 3MV3B 4IULA 5G05C 2KCLA 4FJZA 4DX1A 5BV1A 4HS2A 3VLEA 2I1KA 1UW4B 3CLJA 2WXHA 2ZU6B 3RU0A 4BTBA 2EIME 1N0RA 3E33A 4DX6D 3CR3A 2LAHA 2XZTG 3G2UA 1V55E 1IQUA 1MHQA 4Z68A 2GRLA 3ULQA 1TJFA 4U8YD 1L5JA 5EIDA 4AEZC 3ZKJA 4BTAA 4KMOA 3ABME 2XGMA 4HQDA 2GRRB 3BQOA 3KSQA 3UM2A 1ZBPA 3KEZA 3PEVB 4A1GA 3APFA 3IKOB 1XGWA 4I2ZA 4ATGA 4O60A 4B8AA 1KPSB 2AWIA 4AY6A 3I3NA 3KAEA 2XGSA 2IF4A 1OCRE 1EYHA 3HXBA 3TWWA 1IXVA 4YDYA 4DX7D 4N2SA 1OXJA 4FHJA 5LP0A 2PM6A 4L1BA 3SFZA 3ZXSA 3OAWA 4U0ZA 3VLFA 1WAO1 4HRLA 2VSNA 2VTBA 1B89A 2ETAA 3D9NA 4JVSA 4E85A 4N3CA 2P9PG 4CGVA 3QWPA 3SO8A 4CZ2D 3CHPA 1QQEA 3ZVVA 3DBSA 3RAUA 4UWKA 4LNGA 5T8IA 2ILRA 3LKUA 1OCOE 5AQAA 5CEAA 1YCSB 3MYVA 5JHBA 5CRVA 3Q4AB 3UPVA 3U4TA 3DSTA 5FTPA 1E8ZA 3PE4A 4JA9A 3ZHEB 2IEJA 3PZ3A 3CVWA 2J9QA 4G8LA 3PH0C 4FLHA 3DSWA 1DNPA 4DJAA 1E96B 1EPUA 3DRAA 4JB8P 3UIOC 3ABLE 5AJLA 3UT4A 1BLXB 3FUJA 4ACLA 3LDZA 3ZU7B 2LXMA 4IN3B 4F7AA 3EHQA 2ETBA 3D9KA 4APOA 5DIZA 1JWFA 5CHEE 2CFZA 2L6BA 4BESA 4I6GA 5KJLA 3Q75A 4HB5A 3TWVA 3O4ZA 3F6QA 2P9NG 1H2UA 2V0PA 1E7UA 1ZB1A 3FUNA 4BWRA 4C9BB 2XEVA 1KLXA 4UWLA 2WXPA 3SY2A 4TUMA 3DWLG 2P9KG 2C0LA 2WMOA 5ENSD 1P5QA 1HG5A 4WNFA 1N11A 3CK9A 3JQ0A 3QDNA 2WXOA 4KXKB 3CVXA 4EZKA 2MYOA 3IEGA 4K5AB 1ELKA 4U07A 4XE0A 3ZHEA 2GROB 1D9SA 3ZPJA 5ITZF 5AQ9A 4GTPA 3I4GA 1OUVA 2QYUA 4GB9A 4CEMA 2DBAA 1N95A 1MX4A 2P9LG 5ENNA 1YA0A 3CVUA 2NXPA 2WXLA 1K1BA 2WB2A 4U0SA 1TEZA 3JUEA 3R9AB 3R7RA 2LO6A 3QJZA 4CGWA 3KEAA 4YDEA 5B1AE 3QNKA 5BNWA 4CT4A 2ONDA 4HI9A 1Y6IA 3S2AA 3AS4A 1H2VC 2MOWA 3NOGD 2XQ0A 1GW6A 4YDOA 4B94A 3OXGA 3KSLA 2GRQB 2GW1A 4NURA 3AS8A 4XI0A 2FO1E 4FLBA 5G2NA 4A3TA 2FF4A 5LX8A 1O1RA 2DWZA 3LY8A 3L16A 3FTVA 5EDSA 3UM3A 2ZXWE 4GYWA 1UN8A 3JQ1A 4HXIA 3P1UA 3HXEA 5FIOA 3B13A 4RVBA 3D9OA 2EIKE 4N3AA 2WXRA 4UWFA 3UUXA 4D10C 2L0IA 1OWOA 4I17A 4CT0A 2XCCA 2IJGX 1OT8A 3NBNB 4JEHA 2KCVA 1V54E 2J8SD 4V3IA 5KJNA 4HORA 1D8EA 4GPKA 1EF1C 4L7TA 4HVBA 3C72A 3TWRA 2Y69E 2BKGA 3V30A 2R2LA 2J08A 5E75A 2LSUA 5FQ6A 5HI7A 5CECB 3FH7A 3LJ3A 4C0MA 5A23A 3FU0A 2VQ2A 3ISMC 4FC8A 5JJ6A 2X6HA 3R9MA 3UINC 4W9RA 4B93B 3CQCB 4G8KA 4J8FA 3L08A 5FJYA 1MQSA 3S7JA 1IHBA 1QNFA 3FU6A 5HQ8A 3UT7A 4Y6CA 1TN6A 4DUIA 2I6HA 5JJTA 2NSZA 1NP7A 1N52A 1TNBA 2IU1A 4LRZA 4OVUA 2PL2A 4GPMA 3ML8A 4JXTA 5G04J 4X8QA 2ETCA 2L6JA 5B1BE 4YVOA 3R7QA 3HVEB 3CVPA 3TWXA 3PRZA 3HYMB 1N4QA 2E2EA 4DX5D 1OWPA 4OAVB 1SZ9A 3ESLA 1YYHA 3FTYA 5AQ7A 2P9SG 5KJMA 4JA7A 4DLQA 4IYPA 3SHFA 3NZSA 1H6KA 1XNFA 3LXUX 3ZUVB 3CGHA 2XENA 5EX3A 2DYSE 1S0PA 2X38A 1SW6A 4CDNA 1TNZA 5FZSA 3CVQA 3TG5A 4J0UA 4UI9K 2WQ6A 3FH8A 4JHJA 5HRYA 4XZ4A 3DSXA 4I6EA 3RO2A 1INZA 4RLYA 1SVXA 3E4BA 3AG3E 2DYRE 2XPZA 3AU5A 2FI7A 4RG6A 4DRXE 4I9EA 4AIFA 2V5FA 3FTXA 3PVLA 4O1PA 5CRUA 4E6HA 3J5PA 3HXDA 3CHQA 3Q79A 5ENPD 3D9JA 2OEWA 3FHEA 5KWDA 1H2TC 4TV3A 5KCMA 4YNDA 2KATA 4BSZB 3TWUA 1HS6A 3I4RB 3T8MA 2VJ8A 3AJIA 2Y4UA 4UUCA 3JXJA 1E90A 1PY1A 2WXKA 3D9PA 2VSYA 4QQIA 5G04C 4FP7A 2KZTA 2H6FA 4UI9J 1QBQA 4H7YA 3PDNA 3CEQA 1N4SA 4KZ0A 4EZLA 3FU3A 4Y6WA 5FZQA 5EYPF 1DVPA 5FZRA 1TR4A 2WM9A 4JD2G 3X2QE 4AOFA 4LNUD 2XHEA 4EQFA 3V2XA 5AAOA 4ATZD 2JLBA 4EECA 4I1MA 1PC2A 3FTWA 1N94A 1DC2A 1WY6A 1JCRA 3UM1A 3L82A 4PS7A 4EZJA 1TNUA 5KNGA 5A7DB 1NI1A 5T3RA 2OV8A 3DXKG 4GZCA 3CHMA 4HOUA 4JL0A 5B3SE 5M72A 4I2WA 1TJCA 2JEKA 4XI9A 4P29A 1E7VA 2EILE 2AXVA 4L23A 3LJNA 2A5EA 3RKVA 2OCCE 4ZFHA 4ZHBA 5JJ7A 1VDYA 5CBNA 5ARFA 5C1DA 1TN8A 2X6FA 4GTVA 4FU3A 3GYZA 3P2BA 4N5QA 2VGYA 3IHYA 3JXIA 4NRHB 2GRMA 1Z3YA 4BX9A 4WWNA 3ZW3A 3MGBA 5EX0A 4HBDA 4GYYA 3PZ2A 2H6GA 4CCAA 2R17C 1WG0A 3D9LA 4LEUA 3ZRHA 1U3DA 3PNLB 3ZYQA 4A63B 2C0MA 2Y1LE 4UQZA 3FEYA 4HOSA 5H7PA 2GGFA 3ZXPA 2DIWA 4RQIA 4L2LA 4UI9C 4MLPA 4GZDA 5AN8A 3TAXA 1LD7A 4XEIG 4N39A 1OWLA 4GA1A 3CK8A 2RFMA 1S63A 3NB2A 5ARGA 3RRUA 4K5BA 2QYJA 4G1TA 4WNGA 1UJJA 5AYWD 2BKKB 5JHAA 1NL4A 4ACKA 2RG8A 2AVPA 3PEUB 4K5CA 3CVLA 5AJDA 3L13A 4U8VD 5LCWC 3TJPA 3UKRG 4LERA 3EU5A 5E76A 4DI4A 4JZYA 4XIFA 3U9WA 4DPRA 4GTMA 2WQ7A 4G25A 3UM0A 4R7LA 2NYJA 4OYSA 3L17A 4EBAG 3FEXA 2V4HC 4TRQA 4Q94A 4I43A 4FHKA 3Q15A 3MV2B 2M63A 4TUUA 2YQ8A 1N4RA 3PS6A 1K8KG 3D9IA 4J8EA 3CKBA 3ENEA 4AV7A 5HS0A 1K3ZD 2KCKA 4GTRA 3MKRA 1MX6A 3AU4A 2EQXA 2L0TB 3EDTB 4GZ5A 3G2WA 4UQYA 3T5XA 5BXUA 4BFRA 2NC9A 3UT8A 3MZLB 5CMWA 4XKCA 2GRNB 3DSSA 3Q5MA 3HG0D 1HXIA 4HRMB 2HE0A 2XRZA 2PM7A 3ASFA 3LY9A 2HR2A 2KC7A 1SZAA 3KS2A 3ULEG 3T9KA 2XCBA 2XPIA 1N54A 5BPPA 3D9MA 3FUEA 5FQ7A 1EDUA 3FU5A 3BG1B 4J8SA 4BX8A 4F53A 3W9FA 4HLLA 1HH8A 1HFAA 3CVNA
chains in the Genus database with same CATH topology
2LUHA 4TXQA 4TXRA 4U7EB 4TXPA 2RKKA 2LXLA 5H7PA 2LXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LUH A;  4TXQ A;  4TXR A;  4U7E B;  4TXP A;  2RKK A;  2LXL A;  5H7P A;  2LXM A; 
#chains in the Genus database with same CATH topology
 4J8D A;  1HF8 A;  1ZU2 A;  1SA4 A;  4ANU A;  1KZO A;  1MX2 A;  2WXQ A;  3GZ1 A;  3AS5 A;  3EIQ C;  4U0U A;  5CMY A;  1BD8 A;  1BI7 B;  3DXM G;  4AP2 A;  3MCX A;  4UQX A;  5FIN A;  1TNO A;  5D0O D;  3ABK E;  3CST A;  1S70 B;  3PZ4 A;  1HX8 A;  2IOS A;  2KXP C;  4H7X A;  4BER A;  3HXC A;  1KZP A;  4XX5 A;  3B7B A;  4NAC A;  2X6I A;  4WAF A;  1LD8 A;  4GZ3 A;  3LEW A;  4N5C A;  5FQ8 A;  4HLE A;  4Q69 A;  5D2M C;  4B0Z A;  3TL5 A;  1E8Y A;  3BEE A;  3OXL A;  4A3V A;  2PNN A;  3ONL A;  3DEP A;  4WWO A;  4ILI A;  3KD7 A;  3TWS A;  3QAR A;  1AP7 A;  1FCH A;  4EBA A;  3B7U X;  2IO2 C;  3JCK C;  2L9B A;  3MA5 A;  2LNI A;  3PE3 A;  2UWJ G;  3D3M A;  4K03 A;  2VGX B;  1ELR A;  3ESK A;  1IQR A;  3MKQ B;  5FT9 A;  4M7C A;  4B8C B;  4CDM A;  3SNX A;  3UX4 A;  3PZ1 A;  3IHV A;  2F37 A;  1N4P A;  2R59 A;  3ZYL A;  2XEE A;  4I9C A;  1FPP A;  2PZI A;  4GCO A;  1NA0 A;  4GTS A;  2I2O A;  3K9I A;  2IO3 C;  3DPD A;  3DSV A;  4GMR A;  3B7T A;  2UY1 B;  3UI2 A;  2CHW A;  3JUI A;  3CV0 A;  4AJW A;  2FO7 A;  3O48 A;  2C2L A;  1Q2Z A;  2X6J A;  3CSF A;  2Y4T A;  4B89 A;  5J08 A;  3QK0 A;  3TWT A;  3AG2 E;  2R05 A;  4DI3 A;  3ASH A;  2BED A;  1HU3 A;  3PUJ A;  3OXF A;  3ZNG A;  1MJ0 A;  3LYA A;  4TXQ A;  3DSU A;  3CKC A;  3CHS A;  4U8H A;  2CHZ A;  4HFG A;  3APD A;  3GW4 A;  3SFX A;  2GRP B;  4KYO B;  2WVI A;  4U95 D;  5EYL A;  3L54 A;  3N71 A;  2VSO E;  4PS8 A;  1IKN D;  1SQM A;  4GA0 A;  4JPS A;  3L22 A;  3EHR A;  4AM9 A;  2AJA A;  1TNY A;  3ZIM A;  1X81 A;  3Q49 B;  4YVQ C;  3JYS A;  1PAQ A;  4L2Y A;  3T5V A;  2LSV A;  1HZ4 A;  5C2Y A;  5CBO A;  2XZD G;  1E8W A;  1UG3 A;  2XEH A;  2R5S A;  2B6C A;  3SF4 A;  1S64 A;  3QC1 A;  4FAD A;  4URK A;  1N9A A;  2AW6 A;  1JPL A;  2DZN A;  2ION A;  4JHK A;  4PH4 B;  2OOE A;  1JCS A;  3IXE A;  3VTX A;  2QFC A;  4DX2 A;  1TN7 A;  3SBS A;  3HVE A;  4MBG A;  1QYM A;  2J09 A;  4PDX A;  1HE8 A;  2A4Z A;  5CED B;  1RZ4 A;  4CRW A;  1E8X A;  4ILG A;  5CER B;  4GZ6 A;  1A17 A;  3FUH A;  3LPZ A;  3NZU A;  4AXH A;  2DVW A;  3RJV A;  5KJK A;  3DEO A;  2V4L A;  4XKB A;  1SA5 A;  2VYI A;  4GTT A;  1OCC E;  4GAA A;  3ULY A;  2P2C P;  1FT2 A;  4U96 D;  2VTB B;  3BG0 B;  1KT0 A;  1JCQ A;  4ME2 A;  2Y0B G;  4A55 A;  5T4Y A;  1W3B A;  3E30 A;  3UQ3 A;  1H6O A;  2RKK A;  4MKT A;  4J7W A;  3UMV A;  3EUV A;  5G55 A;  3NOC D;  4G26 A;  5AQB A;  4HNA D;  4DLO A;  3VLD A;  2Y3A A;  5D66 A;  5LCW J;  4JHR A;  5CCL A;  2LAI A;  4N3B A;  5JMN D;  3G2V A;  3PUK A;  3FTS A;  2WMN A;  5KNH D;  3V79 K;  3SQV A;  4BT9 A;  4F1P A;  5ENR D;  1BU9 A;  3FUK A;  2BTD A;  3WXX A;  3FFL A;  4F6R D;  3LY7 A;  4FUL A;  5HKP A;  2ZIR A;  1N0Q A;  4KVM A;  4O6F A;  2VGE A;  1LF8 A;  3LVQ E;  2WXN A;  2KBX A;  3U64 A;  1H6P A;  1OCZ E;  3HDX A;  1IHG A;  4C0E A;  3QB2 A;  2BUG A;  3C3O A;  3FDH A;  3FUD A;  2P9I G;  3QWW A;  4RSY A;  1BI8 B;  5D0Q D;  1TYQ G;  2HM8 A;  3TGO A;  4OAU C;  3URZ A;  2EIJ E;  2QY7 A;  3CQG B;  1YMP A;  2AXZ A;  3PZD A;  2JAB A;  3HRA A;  3IBE A;  2WXM A;  4JW1 A;  4DK5 A;  2MHK A;  4G11 A;  1WM5 A;  1JUQ A;  3Q78 A;  1Z3X A;  2IOL A;  2J49 A;  3AAA C;  2EIN E;  2XGO A;  3FH5 A;  4ANX A;  5ENO D;  3C3R A;  3ZEF A;  4K0R A;  5EIL A;  3CIA A;  3FUI A;  2KM4 A;  3S7F A;  5AEN A;  2HYZ A;  1X5B A;  2YNQ A;  3W9G A;  3CVY A;  3FWV A;  2YIN A;  2MRI A;  1Z5S C;  3VTY A;  1G3N B;  2A5U A;  2OVB A;  1OY3 D;  4CYM D;  1Y8M A;  4HOQ A;  4BY6 A;  3GZ2 A;  2XRY A;  3ASO E;  2R02 A;  2XS1 A;  3WG7 E;  5AIJ A;  4LCT A;  3FUM A;  4TXP A;  2RFA A;  1NA3 A;  3SZ7 A;  3EHM A;  4AY5 A;  2F0Y A;  3ML9 A;  3T8K A;  1UJK A;  2X6K A;  3ZYM A;  4ABN A;  4NIK A;  2B0O E;  1OWM A;  2YHC A;  5ENT D;  2YHE A;  5ENQ D;  2H6H A;  1RW2 A;  4QFV A;  3Q9N C;  3B7S A;  2OVF A;  3QOU A;  4LSZ E;  4NQ0 A;  2FBN A;  3U3W A;  4LNB A;  3FUL A;  1LTX A;  2VSX E;  3EJN A;  2WXG A;  4OVV A;  2DCP A;  4M3O A;  3TWQ A;  3MJW A;  2P9U G;  3LVR E;  4BSX A;  3G2S A;  1K1A A;  5JA4 D;  3NF1 A;  4RG9 A;  3MX3 A;  2WQH A;  4G23 A;  1Z6T A;  2FEZ A;  4KT6 B;  4GCN A;  3B7R L;  3FY4 A;  4FJY A;  2QZA A;  2DZO A;  4G24 A;  4PUC A;  4GA2 A;  3ZFW A;  3UTM A;  3NQP A;  1FVF A;  3ZYK A;  2XPY A;  3RK6 A;  2LUH A;  4TXR A;  4IRU A;  1DCQ A;  4GML A;  3Q73 A;  4N2Q A;  2F8X K;  3Q9U C;  2CG2 A;  4AVX A;  2J4D A;  4U7E B;  3SFY A;  3S7B A;  4MRU A;  3EU9 A;  2WXJ A;  3PNT B;  3C5R A;  3LS8 A;  4LUN U;  3QKY A;  2X3M A;  4KBQ A;  3RRM B;  5BUZ A;  3EHN A;  5BT1 A;  3OTN A;  1U2V G;  3CHR A;  1MZC A;  3LCA A;  3CK7 A;  1FVH A;  3E37 A;  3RRN B;  4YDW A;  4HI8 A;  5EKQ D;  1O5M A;  1OWN A;  3CVV A;  3UKU G;  3HIZ A;  4F3V A;  4FA6 A;  4UWG A;  3RIB A;  4ANV A;  3L9T A;  1HO8 A;  5IY5 E;  1WDY A;  2HO1 A;  1FT1 A;  3TXN A;  2I9C A;  5CCM A;  3SI5 A;  5AAR A;  3C98 A;  2LXL A;  2ZGG A;  1KT1 A;  3GZS A;  2V8S E;  3G2T A;  2V5Q C;  5LOZ A;  3QWV A;  3B95 A;  3ZGQ A;  1UOH A;  5LFA A;  4CDR A;  5ANR A;  2CFU A;  3J5Q B;  3FP3 A;  3E34 A;  3FTZ A;  4U63 A;  3E32 A;  5KBA A;  3CHO A;  4WUY A;  1D8D A;  2CHX A;  3EIJ A;  2IY0 C;  3IV0 A;  3Q47 B;  3FUF A;  3RO3 A;  4L9P A;  4Q96 A;  2P58 C;  1JWG A;  4APF A;  1NZN A;  4HRN A;  3D9H A;  4I6J A;  2WPV A;  3ASD A;  2QC9 A;  2J4B A;  3SD5 A;  1IYG A;  1U3C A;  2OEV A;  4I1O B;  2H6I A;  2IFU A;  3SGH A;  4I1A A;  3S7D A;  1O1T A;  4EHM A;  2WXF A;  5DBK A;  2BF0 X;  4KZC A;  3U66 A;  1HG2 A;  5FWQ A;  4EPZ A;  1H0A A;  3V2O A;  5G05 J;  2Q7F A;  2ZGD A;  1QZ2 A;  3I5P A;  1UN9 A;  4HOT A;  4F1S A;  3AG1 E;  3TXM A;  3UIP C;  1MYO A;  3BUA A;  3AG4 E;  1ELW A;  4WNE A;  1NFI E;  4BET A;  3APC A;  4GTO A;  4GYO A;  5EIB E;  4ILH B;  4GU5 A;  5BXO A;  4J6I A;  3HXF A;  3QAQ A;  3FTU A;  4C48 B;  4GMJ A;  1AWC B;  2IQC A;  4LG6 A;  2PQR A;  2E0I A;  4ANW A;  4U04 A;  2I1J A;  4JEU A;  4WND A;  3PRE A;  1O1S A;  5BV0 A;  4J8Y A;  3Q7F A;  2VGX A;  3V31 A;  2FUL A;  2XS8 A;  3ONK A;  3DPY A;  3MKQ A;  3SBT B;  4KVO A;  4G2V A;  2CG3 A;  2J07 A;  1H19 A;  2KZT B;  2F8Y A;  3C3Q A;  2AXU A;  3ASG A;  2WXI A;  3UXG A;  1A5E A;  2R03 A;  3BU8 A;  2UY1 A;  4BEP A;  4MS6 A;  4WWP A;  4A1S A;  5J90 A;  4O1O A;  3ASN E;  4BT8 A;  1DCE A;  5A6C A;  4PS3 A;  2ZIS A;  2RD0 A;  3HHM A;  3NAW A;  4JC8 A;  5EN5 D;  3L6A A;  4UWH A;  3MEK A;  3Q7A A;  3TG4 A;  5ANL A;  5BW8 C;  3ZN3 A;  2PQN A;  5FQ4 A;  3RSE G;  1BPO A;  4GTQ A;  3MV3 B;  4IUL A;  5G05 C;  2KCL A;  4FJZ A;  4DX1 A;  5BV1 A;  4HS2 A;  3VLE A;  2I1K A;  1UW4 B;  3CLJ A;  2WXH A;  2ZU6 B;  3RU0 A;  4BTB A;  2EIM E;  1N0R A;  3E33 A;  4DX6 D;  3CR3 A;  2LAH A;  2XZT G;  3G2U A;  1V55 E;  1IQU A;  1MHQ A;  4Z68 A;  2GRL A;  3ULQ A;  1TJF A;  4U8Y D;  1L5J A;  5EID A;  4AEZ C;  3ZKJ A;  4BTA A;  4KMO A;  3ABM E;  2XGM A;  4HQD A;  2GRR B;  3BQO A;  3KSQ A;  3UM2 A;  1ZBP A;  3KEZ A;  3PEV B;  4A1G A;  3APF A;  3IKO B;  1XGW A;  4I2Z A;  4ATG A;  4O60 A;  4B8A A;  1KPS B;  2AWI A;  4AY6 A;  3I3N A;  3KAE A;  2XGS A;  2IF4 A;  1OCR E;  1EYH A;  3HXB A;  3TWW A;  1IXV A;  4YDY A;  4DX7 D;  4N2S A;  1OXJ A;  4FHJ A;  5LP0 A;  2PM6 A;  4L1B A;  3SFZ A;  3ZXS A;  3OAW A;  4U0Z A;  3VLF A;  1WAO 1;  4HRL A;  2VSN A;  2VTB A;  1B89 A;  2ETA A;  3D9N A;  4JVS A;  4E85 A;  4N3C A;  2P9P G;  4CGV A;  3QWP A;  3SO8 A;  4CZ2 D;  3CHP A;  1QQE A;  3ZVV A;  3DBS A;  3RAU A;  4UWK A;  4LNG A;  5T8I A;  2ILR A;  3LKU A;  1OCO E;  5AQA A;  5CEA A;  1YCS B;  3MYV A;  5JHB A;  5CRV A;  3Q4A B;  3UPV A;  3U4T A;  3DST A;  5FTP A;  1E8Z A;  3PE4 A;  4JA9 A;  3ZHE B;  2IEJ A;  3PZ3 A;  3CVW A;  2J9Q A;  4G8L A;  3PH0 C;  4FLH A;  3DSW A;  1DNP A;  4DJA A;  1E96 B;  1EPU A;  3DRA A;  4JB8 P;  3UIO C;  3ABL E;  5AJL A;  3UT4 A;  1BLX B;  3FUJ A;  4ACL A;  3LDZ A;  3ZU7 B;  2LXM A;  4IN3 B;  4F7A A;  3EHQ A;  2ETB A;  3D9K A;  4APO A;  5DIZ A;  1JWF A;  5CHE E;  2CFZ A;  2L6B A;  4BES A;  4I6G A;  5KJL A;  3Q75 A;  4HB5 A;  3TWV A;  3O4Z A;  3F6Q A;  2P9N G;  1H2U A;  2V0P A;  1E7U A;  1ZB1 A;  3FUN A;  4BWR A;  4C9B B;  2XEV A;  1KLX A;  4UWL A;  2WXP A;  3SY2 A;  4TUM A;  3DWL G;  2P9K G;  2C0L A;  2WMO A;  5ENS D;  1P5Q A;  1HG5 A;  4WNF A;  1N11 A;  3CK9 A;  3JQ0 A;  3QDN A;  2WXO A;  4KXK B;  3CVX A;  4EZK A;  2MYO A;  3IEG A;  4K5A B;  1ELK A;  4U07 A;  4XE0 A;  3ZHE A;  2GRO B;  1D9S A;  3ZPJ A;  5ITZ F;  5AQ9 A;  4GTP A;  3I4G A;  1OUV A;  2QYU A;  4GB9 A;  4CEM A;  2DBA A;  1N95 A;  1MX4 A;  2P9L G;  5ENN A;  1YA0 A;  3CVU A;  2NXP A;  2WXL A;  1K1B A;  2WB2 A;  4U0S A;  1TEZ A;  3JUE A;  3R9A B;  3R7R A;  2LO6 A;  3QJZ A;  4CGW A;  3KEA A;  4YDE A;  5B1A E;  3QNK A;  5BNW A;  4CT4 A;  2OND A;  4HI9 A;  1Y6I A;  3S2A A;  3AS4 A;  1H2V C;  2MOW A;  3NOG D;  2XQ0 A;  1GW6 A;  4YDO A;  4B94 A;  3OXG A;  3KSL A;  2GRQ B;  2GW1 A;  4NUR A;  3AS8 A;  4XI0 A;  2FO1 E;  4FLB A;  5G2N A;  4A3T A;  2FF4 A;  5LX8 A;  1O1R A;  2DWZ A;  3LY8 A;  3L16 A;  3FTV A;  5EDS A;  3UM3 A;  2ZXW E;  4GYW A;  1UN8 A;  3JQ1 A;  4HXI A;  3P1U A;  3HXE A;  5FIO A;  3B13 A;  4RVB A;  3D9O A;  2EIK E;  4N3A A;  2WXR A;  4UWF A;  3UUX A;  4D10 C;  2L0I A;  1OWO A;  4I17 A;  4CT0 A;  2XCC A;  2IJG X;  1OT8 A;  3NBN B;  4JEH A;  2KCV A;  1V54 E;  2J8S D;  4V3I A;  5KJN A;  4HOR A;  1D8E A;  4GPK A;  1EF1 C;  4L7T A;  4HVB A;  3C72 A;  3TWR A;  2Y69 E;  2BKG A;  3V30 A;  2R2L A;  2J08 A;  5E75 A;  2LSU A;  5FQ6 A;  5HI7 A;  5CEC B;  3FH7 A;  3LJ3 A;  4C0M A;  5A23 A;  3FU0 A;  2VQ2 A;  3ISM C;  4FC8 A;  5JJ6 A;  2X6H A;  3R9M A;  3UIN C;  4W9R A;  4B93 B;  3CQC B;  4G8K A;  4J8F A;  3L08 A;  5FJY A;  1MQS A;  3S7J A;  1IHB A;  1QNF A;  3FU6 A;  5HQ8 A;  3UT7 A;  4Y6C A;  1TN6 A;  4DUI A;  2I6H A;  5JJT A;  2NSZ A;  1NP7 A;  1N52 A;  1TNB A;  2IU1 A;  4LRZ A;  4OVU A;  2PL2 A;  4GPM A;  3ML8 A;  4JXT A;  5G04 J;  4X8Q A;  2ETC A;  2L6J A;  5B1B E;  4YVO A;  3R7Q A;  3HVE B;  3CVP A;  3TWX A;  3PRZ A;  3HYM B;  1N4Q A;  2E2E A;  4DX5 D;  1OWP A;  4OAV B;  1SZ9 A;  3ESL A;  1YYH A;  3FTY A;  5AQ7 A;  2P9S G;  5KJM A;  4JA7 A;  4DLQ A;  4IYP A;  3SHF A;  3NZS A;  1H6K A;  1XNF A;  3LXU X;  3ZUV B;  3CGH A;  2XEN A;  5EX3 A;  2DYS E;  1S0P A;  2X38 A;  1SW6 A;  4CDN A;  1TNZ A;  5FZS A;  3CVQ A;  3TG5 A;  4J0U A;  4UI9 K;  2WQ6 A;  3FH8 A;  4JHJ A;  5HRY A;  4XZ4 A;  3DSX A;  4I6E A;  3RO2 A;  1INZ A;  4RLY A;  1SVX A;  3E4B A;  3AG3 E;  2DYR E;  2XPZ A;  3AU5 A;  2FI7 A;  4RG6 A;  4DRX E;  4I9E A;  4AIF A;  2V5F A;  3FTX A;  3PVL A;  4O1P A;  5CRU A;  4E6H A;  3J5P A;  3HXD A;  3CHQ A;  3Q79 A;  5ENP D;  3D9J A;  2OEW A;  3FHE A;  5KWD A;  1H2T C;  4TV3 A;  5KCM A;  4YND A;  2KAT A;  4BSZ B;  3TWU A;  1HS6 A;  3I4R B;  3T8M A;  2VJ8 A;  3AJI A;  2Y4U A;  4UUC A;  3JXJ A;  1E90 A;  1PY1 A;  2WXK A;  3D9P A;  2VSY A;  4QQI A;  5G04 C;  4FP7 A;  2KZT A;  2H6F A;  4UI9 J;  1QBQ A;  4H7Y A;  3PDN A;  3CEQ A;  1N4S A;  4KZ0 A;  4EZL A;  3FU3 A;  4Y6W A;  5FZQ A;  5EYP F;  1DVP A;  5FZR A;  1TR4 A;  2WM9 A;  4JD2 G;  3X2Q E;  4AOF A;  4LNU D;  2XHE A;  4EQF A;  3V2X A;  5AAO A;  4ATZ D;  2JLB A;  4EEC A;  4I1M A;  1PC2 A;  3FTW A;  1N94 A;  1DC2 A;  1WY6 A;  1JCR A;  3UM1 A;  3L82 A;  4PS7 A;  4EZJ A;  1TNU A;  5KNG A;  5A7D B;  1NI1 A;  5T3R A;  2OV8 A;  3DXK G;  4GZC A;  3CHM A;  4HOU A;  4JL0 A;  5B3S E;  5M72 A;  4I2W A;  1TJC A;  2JEK A;  4XI9 A;  4P29 A;  1E7V A;  2EIL E;  2AXV A;  4L23 A;  3LJN A;  2A5E A;  3RKV A;  2OCC E;  4ZFH A;  4ZHB A;  5JJ7 A;  1VDY A;  5CBN A;  5ARF A;  5C1D A;  1TN8 A;  2X6F A;  4GTV A;  4FU3 A;  3GYZ A;  3P2B A;  4N5Q A;  2VGY A;  3IHY A;  3JXI A;  4NRH B;  2GRM A;  1Z3Y A;  4BX9 A;  4WWN A;  3ZW3 A;  3MGB A;  5EX0 A;  4HBD A;  4GYY A;  3PZ2 A;  2H6G A;  4CCA A;  2R17 C;  1WG0 A;  3D9L A;  4LEU A;  3ZRH A;  1U3D A;  3PNL B;  3ZYQ A;  4A63 B;  2C0M A;  2Y1L E;  4UQZ A;  3FEY A;  4HOS A;  5H7P A;  2GGF A;  3ZXP A;  2DIW A;  4RQI A;  4L2L A;  4UI9 C;  4MLP A;  4GZD A;  5AN8 A;  3TAX A;  1LD7 A;  4XEI G;  4N39 A;  1OWL A;  4GA1 A;  3CK8 A;  2RFM A;  1S63 A;  3NB2 A;  5ARG A;  3RRU A;  4K5B A;  2QYJ A;  4G1T A;  4WNG A;  1UJJ A;  5AYW D;  2BKK B;  5JHA A;  1NL4 A;  4ACK A;  2RG8 A;  2AVP A;  3PEU B;  4K5C A;  3CVL A;  5AJD A;  3L13 A;  4U8V D;  5LCW C;  3TJP A;  3UKR G;  4LER A;  3EU5 A;  5E76 A;  4DI4 A;  4JZY A;  4XIF A;  3U9W A;  4DPR A;  4GTM A;  2WQ7 A;  4G25 A;  3UM0 A;  4R7L A;  2NYJ A;  4OYS A;  3L17 A;  4EBA G;  3FEX A;  2V4H C;  4TRQ A;  4Q94 A;  4I43 A;  4FHK A;  3Q15 A;  3MV2 B;  2M63 A;  4TUU A;  2YQ8 A;  1N4R A;  3PS6 A;  1K8K G;  3D9I A;  4J8E A;  3CKB A;  3ENE A;  4AV7 A;  5HS0 A;  1K3Z D;  2KCK A;  4GTR A;  3MKR A;  1MX6 A;  3AU4 A;  2EQX A;  2L0T B;  3EDT B;  4GZ5 A;  3G2W A;  4UQY A;  3T5X A;  5BXU A;  4BFR A;  2NC9 A;  3UT8 A;  3MZL B;  5CMW A;  4XKC A;  2GRN B;  3DSS A;  3Q5M A;  3HG0 D;  1HXI A;  4HRM B;  2HE0 A;  2XRZ A;  2PM7 A;  3ASF A;  3LY9 A;  2HR2 A;  2KC7 A;  1SZA A;  3KS2 A;  3ULE G;  3T9K A;  2XCB A;  2XPI A;  1N54 A;  5BPP A;  3D9M A;  3FUE A;  5FQ7 A;  1EDU A;  3FU5 A;  3BG1 B;  4J8S A;  4BX8 A;  4F53 A;  3W9F A;  4HLL A;  1HH8 A;  1HFA A;  3CVN A; 
#chains in the Genus database with same CATH homology
 2LUH A;  4TXQ A;  4TXR A;  4U7E B;  4TXP A;  2RKK A;  2LXL A;  5H7P A;  2LXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...