2LUHA

Nmr structure of the vta1-vps60 complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
167
structure length
167
Chain Sequence
MASNAARVVATAKDFDKVGLGIIGYYLQLYAVELILSEEDRSQEMTALATELLDTIEAFKKEIGGESEAEDSDKSLHVMNTLIHDQEKAKIYMLNFTMSLYNEKLKQLKDGPWDVMLKRSLWCCIDLFSCILHLWKENISETSTNSLQKRIKYCKIYLSKLAKGEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Molecular Recognition between ESCRT-III-like Protein Vps60 and AAA-ATPase Regulator Vta1 in the Multivesicular Body Pathway.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport, endocytosis
molecule keywords Vacuolar protein sorting-associated protein VTA1
total genus 63
structure length 167
sequence length 167
ec nomenclature
pdb deposition date 2012-06-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04652 Vta1 Vta1 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.270 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Vacuolar protein sorting-associated protein vta1 2luhA00
2RKKA 4TXQA 4TXRA 4U7EB 2LUHA 2LXLA 4TXPA 5H7PA 2LXMA
chains in the Genus database with same CATH superfamily
5JA4D 4DI4A 1IQUA 4AV7A 3FFLA 3ZNGA 3B7SA 1QNFA 3UKRG 4YDYA 5EX3A 1O5MA 4NQ0A 2QYJA 2VTBB 4ILGA 4FHKA 4DK5A 4G26A 3O4ZA 2Y4TA 3NAWA 1O1RA 3S7DA 3B7UX 1E8YA 4AY6A 5AAOA 2NSZA 3FTZA 4QQIA 2BKGA 3AG3E 2DBAA 4K5CA 2F0YA 3EHMA 3HG0D 2GRQB 4BFRA 2XRZA 4CDNA 1EYHA 5BXOA 4H7XA 4HNAD 4O60A 3ZYMA 2WXFA 3GW4A 2CFZA 5EKQD 3HRAA 1HE8A 5AJDA 2XGSA 4UWKA 1Z5SC 3ZYKA 4EZLA 3CSFA 4F1PA 1BI8B 2V5FA 4Y6CA 2OOEA 1PC2A 4L7TA 3MKRA 3RIBA 3I4RB 3TWUA 4Z68A 5ENPD 2J9QA 3L17A 3LS8A 4XIFA 5ENQD 3HXEA 2LAHA 1H19A 2JABA 3MZLB 1X81A 4GA0A 4E85A 4IYPA 2VGYA 3CR3A 3TGOA 3KS2A 3Q47B 1N9AA 3AJIA 3HXDA 3MX3A 4TUUA 3MJWA 3SD5A 4EQFA 2XGOA 2HM8A 2BKKB 2DYSE 3QAQA 3T5XA 2KC7A 4U8VD 4OYSA 3MV2B 1U3CA 3LY7A 4A3VA 1ZU2A 2MOWA 5HS0A 5AJLA 3B7BA 2IFUA 1BD8A 4UWFA 3OTNA 1TJFA 5EILA 2J4BA 4B94A 3PEUB 2ILRA 4EZJA 4JVSA 4L2YA 4V3IA 3TWQA 3UMVA 3RO2A 3ZPJA 4GPMA 3SO8A 1OWMA 2CFUA 4WNDA 4GTPA 2BTDA 2YHCA 5CERB 2J49A 4J6IA 3HHMA 3G2UA 1QYMA 1TN6A 3FTVA 1TNYA 2WXKA 5BV0A 4HORA 4LERA 1KPSB 3VLFA 4KYOB 2Y0BG 3TXNA 2XQ0A 3Q9UC 3ASFA 2GW1A 4JA7A 4GYOA 3ZFWA 3UM1A 1HX8A 2F8XK 1YA0A 2WPVA 5ARGA 1X5BA 5ENTD 3GZSA 5JHBA 5FT9A 5ANLA 5KBAA 3IV0A 1V54E 1OWOA 1HO8A 3VTYA 4AIFA 3ULQA 2WQHA 1JCQA 2UY1A 4GAAA 4HFGA 2ZGGA 3QB2A 3AS4A 4N3BA 5D66A 3U3WA 3FEXA 3KEZA 2KXPC 1N4SA 1SVXA 5IY5E 2XCCA 5KJNA 3UT7A 3X2QE 4HB5A 1L5JA 2FBNA 3QJZA 2XHEA 1MX2A 5EX0A 4JW1A 3L6AA 2KM4A 3CLJA 1KLXA 1V55E 2MYOA 3BUAA 5FIOA 3C3OA 3TWTA 2LNIA 2DCPA 4DLOA 1EDUA 4K0RA 2QZAA 2V5QC 4L9PA 5FQ4A 3TG5A 4FJYA 2WMOA 5LCWC 4DX7D 3DXKG 3W9GA 2BF0X 1E7UA 3NBNB 3DEPA 1WDYA 5G04C 1N52A 1IKND 5T4YA 4WAFA 4YNDA 4RSYA 3ESKA 3DXMG 5JJ6A 2I1JA 3CHMA 3LDZA 1N54A 2QFCA 2C2LA 3UUXA 4LUNU 2DYRE 4RLYA 5LP0A 4U07A 3L9TA 1K3ZD 5CEAA 3D9PA 4JB8P 4JC8A 1N0QA 3EU9A 4TXRA 3FTUA 3ZEFA 3I5PA 4W9RA 4P29A 4WWPA 3QOUA 5KJKA 3FWVA 5A6CA 5E76A 4FJZA 1FPPA 2EILE 2L9BA 3B7TA 4GPKA 5AQ9A 4K5AB 2F37A 2X38A 4G8LA 3LCAA 4U0UA 2VQ2A 4B89A 4C0MA 3DSSA 1DNPA 3CHPA 4N5QA 1SZ9A 4CDMA 4G1TA 3CVLA 4C48B 2R2LA 2ETCA 2EIME 3UIPC 4XI9A 1EPUA 4YDEA 3PH0C 1HF8A 3S7FA 1H6OA 2KCKA 2J09A 3RRUA 3JCKC 3RJVA 3PNLB 3FTSA 5B1AE 4XKBA 3W9FA 3ISMC 5HI7A 1OXJA 1LTXA 2RD0A 4I43A 5CECB 4R7LA 3LJ3A 1A17A 4D10C 3DBSA 2MHKA 1YYHA 3QDNA 3AG2E 2PZIA 4DJAA 3RO3A 5KJLA 4CYMD 1IHGA 3UX4A 3Q49B 2DVWA 3JQ0A 4PH4B 2WQ6A 3CEQA 2DZOA 1IXVA 4G2VA 3FU0A 4AY5A 2VSOE 1AP7A 4HI9A 3R7QA 4LG6A 2X6FA 2AVPA 4ACLA 1PAQA 2WXQA 1ELKA 2EINE 4HVBA 4ANWA 5AENA 3APDA 3TWXA 4MKTA 2LSVA 3IBEA 4U96D 3ZU7B 1K8KG 2VSXE 1QBQA 3B95A 4PS3A 3FEYA 1DCQA 3ABME 4NRHB 3FH5A 3FH7A 3LY9A 3UQ3A 4G23A 4JHKA 3D9LA 5HQ8A 4B0ZA 3RU0A 2EQXA 3RAUA 1TNUA 3OAWA 2VGXB 4FP7A 3URZA 2PL2A 4G24A 4KMOA 1MHQA 1FVHA 2L0TB 2MRIA 1HU3A 3G2VA 3BG0B 3K9IA 2IU1A 2Y3AA 3C5RA 3RRNB 5ANRA 4ME2A 4YDOA 4F6RD 3C98A 4HLLA 3VLDA 1LF8A 4UQZA 2WMNA 4FADA 3CK7A 5ENNA 3UM3A 3SFXA 3ZUVB 4BETA 5EIBE 3CK8A 1E7VA 4LNBA 4FU3A 4WWOA 4JZYA 4N3CA 3C3RA 3MEKA 2VGXA 3Q73A 2NC9A 4JPSA 3HXBA 3LY8A 3EU5A 1ELWA 3DRAA 1HXIA 4A55A 5G05J 4U0ZA 4KXKB 2AW6A 2GROB 4UWGA 2YNQA 2LUHA 1MX6A 4WUYA 1MZCA 4ILIA 3FUDA 5LOZA 4KBQA 2C0LA 3CVWA 2P9KG 2IOSA 5D0QD 3PRZA 1FT1A 2CHZA 4ANXA 1KZPA 2BEDA 3J5PA 2JLBA 5H7PA 3D9JA 4BSXA 2HR2A 3LJNA 2X6IA 1TNOA 3L82A 3VTXA 3CKCA 4CDRA 3FU5A 4JA9A 4ANUA 2LXMA 5CBNA 1KZOA 2L6BA 1TYQG 3ASHA 4IRUA 4UI9J 1HFAA 4KVMA 3UXGA 5BPPA 3DPYA 2IEJA 3Q5MA 4J7WA 2XCBA 2YINA 2XZTG 4GYWA 4U04A 1RW2A 5JHAA 4APFA 4U0SA 3R9AB 4CT0A 4GYYA 3L13A 5DIZA 1HG5A 4HOQA 3ABKE 2GRMA 2EIKE 1S0PA 2UY1B 1INZA 2H6FA 4AP2A 3CHQA 2I2OA 1QZ2A 4EHMA 3J5QB 4FHJA 3UM2A 3CVPA 2P9NG 1BI7B 3DSXA 3SBTB 5G2NA 2RG8A 1SZAA 1TNBA 2H6IA 4KT6B 1K1BA 1U2VG 4GTTA 4OVVA 4DRXE 3CVUA 1KT1A 1JPLA 3T8KA 3LEWA 1IYGA 1Q2ZA 1N11A 1WY6A 2J4DA 4GZCA 4NIKA 3CVYA 3HVEB 3JQ1A 2IOLA 5ITZF 1UN8A 5A7DB 5FQ8A 3ZKJA 1NZNA 3E34A 3PE4A 3ZXSA 4A3TA 2AXUA 4WNEA 1PY1A 4M7CA 5FQ6A 3DSWA 4HI8A 3FUHA 1GW6A 2XPYA 1VDYA 3EDTB 2RFMA 3UPVA 4GMRA 5ENSD 2B6CA 4CRWA 5JMND 3CHRA 3I3NA 5CRVA 5C1DA 3JUEA 4GTQA 4B8CB 5EDSA 3PEVB 3P2BA 3TWWA 2DWZA 2RFAA 4AJWA 5FZRA 4WNFA 5FZQA 3AS5A 2ZISA 3BEEA 1AWCB 1Y8MA 4Q69A 3EIJA 2NXPA 2V4LA 3KEAA 4GMLA 4LNUD 3Q4AB 5B3SE 3SF4A 4JHRA 3FP3A 3SNXA 3SZ7A 2WXOA 2A5EA 4OVUA 4EECA 3NZSA 4PUCA 2OCCE 4FLBA 3CVNA 4U8HA 2NYJA 4NACA 4MRUA 1OUVA 4G25A 3PZ3A 2AXZA 4M3OA 4I6GA 1ZB1A 2JEKA 1SA5A 4ZHBA 1WAO1 2WVIA 3HIZA 2CG3A 3CVVA 3Q75A 2R05A 1N0RA 3E30A 3LYAA 1HH8A 2KZTB 1BPOA 2FO7A 4I1OB 3EJNA 3T8MA 4JEHA 4GMJA 4UUCA 4DI3A 1A5EA 3DPDA 5FINA 3D3MA 2CHXA 4KZ0A 3ZVVA 3R7RA 4ATZD 1FVFA 3JUIA 2L6JA 4O1PA 4QFVA 2FEZA 5KCMA 4F3VA 4K5BA 3UT4A 1MX4A 2GRRB 5G04J 3UKUG 5G05C 4TRQA 1UJKA 4J8DA 3GYZA 2FF4A 1SA4A 5EN5D 2FO1E 4N39A 4G8KA 2WXRA 4U95D 3LKUA 3ASNE 5CMWA 2V4HC 2ONDA 4I2WA 1G3NB 4F53A 4BT8A 3CK9A 2YQ8A 3PS6A 3CV0A 3S7JA 1B89A 2WB2A 4I9EA 5CRUA 4JD2G 3EUVA 2J07A 4LNGA 1NL4A 4ZFHA 3SBSA 2XENA 4UI9C 5FTPA 4UQXA 4BWRA 3Q78A 2GRNB 3CGHA 3SI5A 2IY0C 1OCCE 1E8WA 2GRLA 3KD7A 1TN8A 1TEZA 5AYWD 4HOUA 4WWNA 4G11A 3QNKA 4I6EA 5AN8A 2HE0A 2KCVA 2R5SA 2H6HA 2R17C 4MS6A 1NFIE 3DEOA 4U7EB 1WG0A 4OAUC 3TL5A 3OXGA 4AVXA 3SY2A 3FUNA 3U9WA 4LCTA 1SW6A 4I9CA 2P9LG 5FZSA 2WM9A 5FJYA 3FULA 4J8SA 1JWFA 3R9MA 4GTRA 3FUFA 3OXLA 3CIAA 1MJ0A 2BUGA 4FLHA 2LAIA 3ZYQA 2I6HA 3AG4E 4XKCA 2QC9A 3QK0A 4I1AA 4NURA 1K1AA 1Z3YA 2LSUA 2KZTA 4J8YA 2VYIA 3Q9NC 3WG7E 3TXMA 2XRYA 4LEUA 3MCXA 3NOGD 4K03A 4AEZC 1W3BA 2PQNA 3PREA 2XEHA 2PNNA 3D9KA 2OV8A 5CBOA 3E32A 2WXJA 1H6KA 4Q94A 4EBAA 3HVEA 4XX5A 2J8SD 5T3RA 3EIQC 2XPZA 2V8SE 4IN3B 1YMPA 1Z6TA 1WM5A 2ZIRA 4TXPA 4MBGA 3RKVA 1XNFA 4CEMA 3QWPA 4ACKA 1D9SA 5EIDA 3I4GA 1H2TC 4JEUA 5D2MC 1IQRA 5ENOD 4GTMA 3AU4A 4C9BB 1JCRA 2R59A 3MYVA 1E8ZA 5AARA 2CG2A 4CCAA 3BQOA 3U4TA 1FT2A 4GB9A 2AXVA 1HS6A 4BESA 5EYLA 2WQ7A 3D9NA 4GZ5A 3L16A 2GRPB 3CQGB 3B7RL 4XZ4A 3D9IA 1UOHA 2X6JA 4I17A 3T9KA 3CSTA 2IO3C 4HRMB 5LX8A 4N5CA 3SQVA 4O6FA 1N4PA 3D9OA 2XZDG 5HKPA 3UM0A 4U63A 3FUEA 3SFZA 3FUIA 4WNGA 1DVPA 1OT8A 4H7YA 4A1SA 5BV1A 3GZ1A 4GZ6A 3PZDA 4RG6A 2PQRA 3Q7FA 3L08A 3FUJA 1E8XA 3ZXPA 3OXFA 4L1BA 2ETBA 1ELRA 3BU8A 3AS8A 2H6GA 2WXGA 4AXHA 1JWGA 5LFAA 5BT1A 1HG2A 1H2UA 2IO2C 4GZDA 2RKKA 2GGFA 3C72A 3RRMB 4GZ3A 1E90A 5A23A 1O1SA 3MKQA 2VJ8A 3ENEA 5EYPF 3LVRE 3PZ1A 2AWIA 3ASGA 4HQDA 3S2AA 3ML9A 2KATA 4DX6D 3ONKA 4ILHB 3U64A 2DZNA 4JXTA 2X6HA 3NOCD 4UQYA 4CT4A 3FUKA 4B8AA 1NP7A 3ASDA 2P9IG 1OCRE 3ZHEB 5T8IA 1ZBPA 4FA6A 2FI7A 3C3QA 5FWQA 3UINC 3EHRA 3WXXA 2L0IA 3PDNA 1MQSA 5AQBA 4F1SA 4XEIG 3KAEA 3V79K 5BXUA 3P1UA 4LRZA 4HXIA 1E96B 1N94A 5AQAA 2IQCA 4N3AA 1TJCA 2OVBA 3TAXA 1D8EA 3Q79A 2WXNA 1DCEA 3ZIMA 1H0AA 1S64A 1UN9A 5E75A 4BY6A 1FCHA 3FH8A 4DX1A 4BT9A 1S70B 2EIJE 3TG4A 1NI1A 1P5QA 2I9CA 3S7BA 3ZN3A 3TWSA 4UI9K 5ARFA 3RSEG 3DWLG 3HXCA 4EZKA 3L54A 3PZ2A 4BX8A 4BX9A 4GCOA 3DSUA 2HO1A 2LO6A 3VLEA 5J08A 5J90A 3CHOA 3APFA 2ETAA 4GTVA 4APOA 3UTMA 3KSLA 3E33A 4EPZA 4Q96A 2X3MA 3DSVA 1TN7A 3Q7AA 4AOFA 4TXQA 3AG1E 4FULA 3FTYA 2VGEA 2VTBA 2Y1LE 1SQMA 4BSZB 1O1TA 1U3DA 3APCA 2CHWA 1N4RA 4GTSA 2KCLA 2IJGX 3T5VA 4AM9A 2QYUA 4ANVA 2XPIA 4URKA 3ABLE 1N4QA 1NA3A 4N2QA 3ZGQA 3N71A 1DC2A 2ZGDA 1HZ4A 5C2YA 4CGWA 4GA1A 5CCLA 2Y4UA 5CMYA 2C0MA 3IHYA 1RZ4A 1BLXB 1OY3D 2FULA 4ABNA 4BTBA 5CHEE 3GZ2A 1JUQA 4RG9A 3TWVA 4X8QA 2Q7FA 2V0PA 4J8FA 1YCSB 3FTWA 2ZXWE 3ESLA 5LCWJ 4TV3A 1TNZA 3LVQE 2R03A 2VSYA 2P2CP 5FQ7A 1TR4A 4L23A 4BEPA 3SGHA 2DIWA 3FDHA 3QKYA 4L2LA 1OCZE 4HOTA 1BU9A 2WXHA 3FUMA 3U66A 3HDXA 4DLQA 2OVFA 5AQ7A 2XEEA 1XGWA 1OWNA 2J08A 2M63A 3DSTA 5M72A 2OEWA 3PVLA 1H2VC 4E6HA 3MGBA 3HXFA 3LPZA 2P9PG 1JCSA 2I1KA 3PNTB 4I6JA 5BNWA 3NZUA 3IXEA 3PUJA 2B0OE 5BW8C 3G2TA 2QY7A 1S63A 3D9MA 2UWJG 4GCNA 4KZCA 2VSNA 2AJAA 4N2SA 2X6KA 3JYSA 3LXUX 2KBXA 5KNGA 4GU5A 4GA2A 4IULA 3ASOE 2PM7A 4RQIA 2R02A 2E0IA 3F6QA 4DX5D 3JXJA 3HYMB 2P9UG 4DPRA 4HRNA 1OWPA 2WXIA 3V31A 3PZ4A 3D9HA 2WXPA 4I2ZA 4YVOA 2XS1A 1KT0A 4KVOA 3FTXA 3TWRA 3QWWA 2F8YA 5AIJA 5KJMA 4DX2A 3TJPA 1UJJA 4CZ2D 3ULYA 3E37A 2P9SG 3CHSA 2XGMA 5JJ7A 5G55A 3PUKA 4RVBA 3CVXA 2IONA 4PS8A 2OEVA 2P58C 3NQPA 3PE3A 3UT8A 3EHNA 4HS2A 4O1OA 1NA0A 4A63B 1IHBA 3RK6A 4JHJA 4HRLA 3FU6A 3ZHEA 4HBDA 3G2SA 1N95A 2Y69E 4UWLA 4JL0A 3SFYA 4UWHA 4EBAG 3ML8A 4TUMA 2PM6A 4C0EA 3V2XA 2WXLA 3CQCB 4DUIA 4A1GA 3AAAC 2LXLA 4HOSA 2A4ZA 3UI2A 2A5UA 3O48A 2HYZA 4LSZE 3Q15A 3NF1A 3IKOB 5CEDB 4YDWA 1H6PA 3JXIA 4BTAA 3V30A 4BERA 3EHQA 3FHEA 4J8EA 3ZRHA 4F7AA 5BUZA 5B1BE 4B93B 1MYOA 5JJTA 2E2EA 3CKBA 1QQEA 3IEGA 4I1MA 4Y6WA 4XE0A 3MA5A 4YVQC 3V2OA 3FY4A 3NB2A 3QC1A 3CVQA 5KNHD 1EF1C 3G2WA 3IHVA 1Y6IA 3ONLA 3QARA 3ULEG 1UW4B 1D8DA 2XEVA 3KSQA 4PS7A 4FC8A 3BG1B 5KWDA 3ZW3A 4MLPA 4J0UA 1LD8A 3L22A 1OWLA 5ENRD 4PDXA 2WXMA 4ATGA 4GTOA 4XI0A 5DBKA 4HLEA 3MV3B 1Z3XA 5CCMA 5D0OD 3UIOC 3SHFA 2ZU6B 3ZYLA 2XS8A 3E4BA 3B13A 4U8YD 5HRYA 1OCOE 2YHEA 4CGVA 1LD7A 3QWVA 2IF4A 3FU3A 4OAVB 3MKQB 1UG3A 3AU5A
chains in the Genus database with same CATH topology
2RKKA 4TXQA 4TXRA 4U7EB 2LUHA 2LXLA 4TXPA 5H7PA 2LXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RKK A;  4TXQ A;  4TXR A;  4U7E B;  2LUH A;  2LXL A;  4TXP A;  5H7P A;  2LXM A; 
#chains in the Genus database with same CATH topology
 5JA4 D;  4DI4 A;  1IQU A;  4AV7 A;  3FFL A;  3ZNG A;  3B7S A;  1QNF A;  3UKR G;  4YDY A;  5EX3 A;  1O5M A;  4NQ0 A;  2QYJ A;  2VTB B;  4ILG A;  4FHK A;  4DK5 A;  4G26 A;  3O4Z A;  2Y4T A;  3NAW A;  1O1R A;  3S7D A;  3B7U X;  1E8Y A;  4AY6 A;  5AAO A;  2NSZ A;  3FTZ A;  4QQI A;  2BKG A;  3AG3 E;  2DBA A;  4K5C A;  2F0Y A;  3EHM A;  3HG0 D;  2GRQ B;  4BFR A;  2XRZ A;  4CDN A;  1EYH A;  5BXO A;  4H7X A;  4HNA D;  4O60 A;  3ZYM A;  2WXF A;  3GW4 A;  2CFZ A;  5EKQ D;  3HRA A;  1HE8 A;  5AJD A;  2XGS A;  4UWK A;  1Z5S C;  3ZYK A;  4EZL A;  3CSF A;  4F1P A;  1BI8 B;  2V5F A;  4Y6C A;  2OOE A;  1PC2 A;  4L7T A;  3MKR A;  3RIB A;  3I4R B;  3TWU A;  4Z68 A;  5ENP D;  2J9Q A;  3L17 A;  3LS8 A;  4XIF A;  5ENQ D;  3HXE A;  2LAH A;  1H19 A;  2JAB A;  3MZL B;  1X81 A;  4GA0 A;  4E85 A;  4IYP A;  2VGY A;  3CR3 A;  3TGO A;  3KS2 A;  3Q47 B;  1N9A A;  3AJI A;  3HXD A;  3MX3 A;  4TUU A;  3MJW A;  3SD5 A;  4EQF A;  2XGO A;  2HM8 A;  2BKK B;  2DYS E;  3QAQ A;  3T5X A;  2KC7 A;  4U8V D;  4OYS A;  3MV2 B;  1U3C A;  3LY7 A;  4A3V A;  1ZU2 A;  2MOW A;  5HS0 A;  5AJL A;  3B7B A;  2IFU A;  1BD8 A;  4UWF A;  3OTN A;  1TJF A;  5EIL A;  2J4B A;  4B94 A;  3PEU B;  2ILR A;  4EZJ A;  4JVS A;  4L2Y A;  4V3I A;  3TWQ A;  3UMV A;  3RO2 A;  3ZPJ A;  4GPM A;  3SO8 A;  1OWM A;  2CFU A;  4WND A;  4GTP A;  2BTD A;  2YHC A;  5CER B;  2J49 A;  4J6I A;  3HHM A;  3G2U A;  1QYM A;  1TN6 A;  3FTV A;  1TNY A;  2WXK A;  5BV0 A;  4HOR A;  4LER A;  1KPS B;  3VLF A;  4KYO B;  2Y0B G;  3TXN A;  2XQ0 A;  3Q9U C;  3ASF A;  2GW1 A;  4JA7 A;  4GYO A;  3ZFW A;  3UM1 A;  1HX8 A;  2F8X K;  1YA0 A;  2WPV A;  5ARG A;  1X5B A;  5ENT D;  3GZS A;  5JHB A;  5FT9 A;  5ANL A;  5KBA A;  3IV0 A;  1V54 E;  1OWO A;  1HO8 A;  3VTY A;  4AIF A;  3ULQ A;  2WQH A;  1JCQ A;  2UY1 A;  4GAA A;  4HFG A;  2ZGG A;  3QB2 A;  3AS4 A;  4N3B A;  5D66 A;  3U3W A;  3FEX A;  3KEZ A;  2KXP C;  1N4S A;  1SVX A;  5IY5 E;  2XCC A;  5KJN A;  3UT7 A;  3X2Q E;  4HB5 A;  1L5J A;  2FBN A;  3QJZ A;  2XHE A;  1MX2 A;  5EX0 A;  4JW1 A;  3L6A A;  2KM4 A;  3CLJ A;  1KLX A;  1V55 E;  2MYO A;  3BUA A;  5FIO A;  3C3O A;  3TWT A;  2LNI A;  2DCP A;  4DLO A;  1EDU A;  4K0R A;  2QZA A;  2V5Q C;  4L9P A;  5FQ4 A;  3TG5 A;  4FJY A;  2WMO A;  5LCW C;  4DX7 D;  3DXK G;  3W9G A;  2BF0 X;  1E7U A;  3NBN B;  3DEP A;  1WDY A;  5G04 C;  1N52 A;  1IKN D;  5T4Y A;  4WAF A;  4YND A;  4RSY A;  3ESK A;  3DXM G;  5JJ6 A;  2I1J A;  3CHM A;  3LDZ A;  1N54 A;  2QFC A;  2C2L A;  3UUX A;  4LUN U;  2DYR E;  4RLY A;  5LP0 A;  4U07 A;  3L9T A;  1K3Z D;  5CEA A;  3D9P A;  4JB8 P;  4JC8 A;  1N0Q A;  3EU9 A;  4TXR A;  3FTU A;  3ZEF A;  3I5P A;  4W9R A;  4P29 A;  4WWP A;  3QOU A;  5KJK A;  3FWV A;  5A6C A;  5E76 A;  4FJZ A;  1FPP A;  2EIL E;  2L9B A;  3B7T A;  4GPK A;  5AQ9 A;  4K5A B;  2F37 A;  2X38 A;  4G8L A;  3LCA A;  4U0U A;  2VQ2 A;  4B89 A;  4C0M A;  3DSS A;  1DNP A;  3CHP A;  4N5Q A;  1SZ9 A;  4CDM A;  4G1T A;  3CVL A;  4C48 B;  2R2L A;  2ETC A;  2EIM E;  3UIP C;  4XI9 A;  1EPU A;  4YDE A;  3PH0 C;  1HF8 A;  3S7F A;  1H6O A;  2KCK A;  2J09 A;  3RRU A;  3JCK C;  3RJV A;  3PNL B;  3FTS A;  5B1A E;  4XKB A;  3W9F A;  3ISM C;  5HI7 A;  1OXJ A;  1LTX A;  2RD0 A;  4I43 A;  5CEC B;  4R7L A;  3LJ3 A;  1A17 A;  4D10 C;  3DBS A;  2MHK A;  1YYH A;  3QDN A;  3AG2 E;  2PZI A;  4DJA A;  3RO3 A;  5KJL A;  4CYM D;  1IHG A;  3UX4 A;  3Q49 B;  2DVW A;  3JQ0 A;  4PH4 B;  2WQ6 A;  3CEQ A;  2DZO A;  1IXV A;  4G2V A;  3FU0 A;  4AY5 A;  2VSO E;  1AP7 A;  4HI9 A;  3R7Q A;  4LG6 A;  2X6F A;  2AVP A;  4ACL A;  1PAQ A;  2WXQ A;  1ELK A;  2EIN E;  4HVB A;  4ANW A;  5AEN A;  3APD A;  3TWX A;  4MKT A;  2LSV A;  3IBE A;  4U96 D;  3ZU7 B;  1K8K G;  2VSX E;  1QBQ A;  3B95 A;  4PS3 A;  3FEY A;  1DCQ A;  3ABM E;  4NRH B;  3FH5 A;  3FH7 A;  3LY9 A;  3UQ3 A;  4G23 A;  4JHK A;  3D9L A;  5HQ8 A;  4B0Z A;  3RU0 A;  2EQX A;  3RAU A;  1TNU A;  3OAW A;  2VGX B;  4FP7 A;  3URZ A;  2PL2 A;  4G24 A;  4KMO A;  1MHQ A;  1FVH A;  2L0T B;  2MRI A;  1HU3 A;  3G2V A;  3BG0 B;  3K9I A;  2IU1 A;  2Y3A A;  3C5R A;  3RRN B;  5ANR A;  4ME2 A;  4YDO A;  4F6R D;  3C98 A;  4HLL A;  3VLD A;  1LF8 A;  4UQZ A;  2WMN A;  4FAD A;  3CK7 A;  5ENN A;  3UM3 A;  3SFX A;  3ZUV B;  4BET A;  5EIB E;  3CK8 A;  1E7V A;  4LNB A;  4FU3 A;  4WWO A;  4JZY A;  4N3C A;  3C3R A;  3MEK A;  2VGX A;  3Q73 A;  2NC9 A;  4JPS A;  3HXB A;  3LY8 A;  3EU5 A;  1ELW A;  3DRA A;  1HXI A;  4A55 A;  5G05 J;  4U0Z A;  4KXK B;  2AW6 A;  2GRO B;  4UWG A;  2YNQ A;  2LUH A;  1MX6 A;  4WUY A;  1MZC A;  4ILI A;  3FUD A;  5LOZ A;  4KBQ A;  2C0L A;  3CVW A;  2P9K G;  2IOS A;  5D0Q D;  3PRZ A;  1FT1 A;  2CHZ A;  4ANX A;  1KZP A;  2BED A;  3J5P A;  2JLB A;  5H7P A;  3D9J A;  4BSX A;  2HR2 A;  3LJN A;  2X6I A;  1TNO A;  3L82 A;  3VTX A;  3CKC A;  4CDR A;  3FU5 A;  4JA9 A;  4ANU A;  2LXM A;  5CBN A;  1KZO A;  2L6B A;  1TYQ G;  3ASH A;  4IRU A;  4UI9 J;  1HFA A;  4KVM A;  3UXG A;  5BPP A;  3DPY A;  2IEJ A;  3Q5M A;  4J7W A;  2XCB A;  2YIN A;  2XZT G;  4GYW A;  4U04 A;  1RW2 A;  5JHA A;  4APF A;  4U0S A;  3R9A B;  4CT0 A;  4GYY A;  3L13 A;  5DIZ A;  1HG5 A;  4HOQ A;  3ABK E;  2GRM A;  2EIK E;  1S0P A;  2UY1 B;  1INZ A;  2H6F A;  4AP2 A;  3CHQ A;  2I2O A;  1QZ2 A;  4EHM A;  3J5Q B;  4FHJ A;  3UM2 A;  3CVP A;  2P9N G;  1BI7 B;  3DSX A;  3SBT B;  5G2N A;  2RG8 A;  1SZA A;  1TNB A;  2H6I A;  4KT6 B;  1K1B A;  1U2V G;  4GTT A;  4OVV A;  4DRX E;  3CVU A;  1KT1 A;  1JPL A;  3T8K A;  3LEW A;  1IYG A;  1Q2Z A;  1N11 A;  1WY6 A;  2J4D A;  4GZC A;  4NIK A;  3CVY A;  3HVE B;  3JQ1 A;  2IOL A;  5ITZ F;  1UN8 A;  5A7D B;  5FQ8 A;  3ZKJ A;  1NZN A;  3E34 A;  3PE4 A;  3ZXS A;  4A3T A;  2AXU A;  4WNE A;  1PY1 A;  4M7C A;  5FQ6 A;  3DSW A;  4HI8 A;  3FUH A;  1GW6 A;  2XPY A;  1VDY A;  3EDT B;  2RFM A;  3UPV A;  4GMR A;  5ENS D;  2B6C A;  4CRW A;  5JMN D;  3CHR A;  3I3N A;  5CRV A;  5C1D A;  3JUE A;  4GTQ A;  4B8C B;  5EDS A;  3PEV B;  3P2B A;  3TWW A;  2DWZ A;  2RFA A;  4AJW A;  5FZR A;  4WNF A;  5FZQ A;  3AS5 A;  2ZIS A;  3BEE A;  1AWC B;  1Y8M A;  4Q69 A;  3EIJ A;  2NXP A;  2V4L A;  3KEA A;  4GML A;  4LNU D;  3Q4A B;  5B3S E;  3SF4 A;  4JHR A;  3FP3 A;  3SNX A;  3SZ7 A;  2WXO A;  2A5E A;  4OVU A;  4EEC A;  3NZS A;  4PUC A;  2OCC E;  4FLB A;  3CVN A;  4U8H A;  2NYJ A;  4NAC A;  4MRU A;  1OUV A;  4G25 A;  3PZ3 A;  2AXZ A;  4M3O A;  4I6G A;  1ZB1 A;  2JEK A;  1SA5 A;  4ZHB A;  1WAO 1;  2WVI A;  3HIZ A;  2CG3 A;  3CVV A;  3Q75 A;  2R05 A;  1N0R A;  3E30 A;  3LYA A;  1HH8 A;  2KZT B;  1BPO A;  2FO7 A;  4I1O B;  3EJN A;  3T8M A;  4JEH A;  4GMJ A;  4UUC A;  4DI3 A;  1A5E A;  3DPD A;  5FIN A;  3D3M A;  2CHX A;  4KZ0 A;  3ZVV A;  3R7R A;  4ATZ D;  1FVF A;  3JUI A;  2L6J A;  4O1P A;  4QFV A;  2FEZ A;  5KCM A;  4F3V A;  4K5B A;  3UT4 A;  1MX4 A;  2GRR B;  5G04 J;  3UKU G;  5G05 C;  4TRQ A;  1UJK A;  4J8D A;  3GYZ A;  2FF4 A;  1SA4 A;  5EN5 D;  2FO1 E;  4N39 A;  4G8K A;  2WXR A;  4U95 D;  3LKU A;  3ASN E;  5CMW A;  2V4H C;  2OND A;  4I2W A;  1G3N B;  4F53 A;  4BT8 A;  3CK9 A;  2YQ8 A;  3PS6 A;  3CV0 A;  3S7J A;  1B89 A;  2WB2 A;  4I9E A;  5CRU A;  4JD2 G;  3EUV A;  2J07 A;  4LNG A;  1NL4 A;  4ZFH A;  3SBS A;  2XEN A;  4UI9 C;  5FTP A;  4UQX A;  4BWR A;  3Q78 A;  2GRN B;  3CGH A;  3SI5 A;  2IY0 C;  1OCC E;  1E8W A;  2GRL A;  3KD7 A;  1TN8 A;  1TEZ A;  5AYW D;  4HOU A;  4WWN A;  4G11 A;  3QNK A;  4I6E A;  5AN8 A;  2HE0 A;  2KCV A;  2R5S A;  2H6H A;  2R17 C;  4MS6 A;  1NFI E;  3DEO A;  4U7E B;  1WG0 A;  4OAU C;  3TL5 A;  3OXG A;  4AVX A;  3SY2 A;  3FUN A;  3U9W A;  4LCT A;  1SW6 A;  4I9C A;  2P9L G;  5FZS A;  2WM9 A;  5FJY A;  3FUL A;  4J8S A;  1JWF A;  3R9M A;  4GTR A;  3FUF A;  3OXL A;  3CIA A;  1MJ0 A;  2BUG A;  4FLH A;  2LAI A;  3ZYQ A;  2I6H A;  3AG4 E;  4XKC A;  2QC9 A;  3QK0 A;  4I1A A;  4NUR A;  1K1A A;  1Z3Y A;  2LSU A;  2KZT A;  4J8Y A;  2VYI A;  3Q9N C;  3WG7 E;  3TXM A;  2XRY A;  4LEU A;  3MCX A;  3NOG D;  4K03 A;  4AEZ C;  1W3B A;  2PQN A;  3PRE A;  2XEH A;  2PNN A;  3D9K A;  2OV8 A;  5CBO A;  3E32 A;  2WXJ A;  1H6K A;  4Q94 A;  4EBA A;  3HVE A;  4XX5 A;  2J8S D;  5T3R A;  3EIQ C;  2XPZ A;  2V8S E;  4IN3 B;  1YMP A;  1Z6T A;  1WM5 A;  2ZIR A;  4TXP A;  4MBG A;  3RKV A;  1XNF A;  4CEM A;  3QWP A;  4ACK A;  1D9S A;  5EID A;  3I4G A;  1H2T C;  4JEU A;  5D2M C;  1IQR A;  5ENO D;  4GTM A;  3AU4 A;  4C9B B;  1JCR A;  2R59 A;  3MYV A;  1E8Z A;  5AAR A;  2CG2 A;  4CCA A;  3BQO A;  3U4T A;  1FT2 A;  4GB9 A;  2AXV A;  1HS6 A;  4BES A;  5EYL A;  2WQ7 A;  3D9N A;  4GZ5 A;  3L16 A;  2GRP B;  3CQG B;  3B7R L;  4XZ4 A;  3D9I A;  1UOH A;  2X6J A;  4I17 A;  3T9K A;  3CST A;  2IO3 C;  4HRM B;  5LX8 A;  4N5C A;  3SQV A;  4O6F A;  1N4P A;  3D9O A;  2XZD G;  5HKP A;  3UM0 A;  4U63 A;  3FUE A;  3SFZ A;  3FUI A;  4WNG A;  1DVP A;  1OT8 A;  4H7Y A;  4A1S A;  5BV1 A;  3GZ1 A;  4GZ6 A;  3PZD A;  4RG6 A;  2PQR A;  3Q7F A;  3L08 A;  3FUJ A;  1E8X A;  3ZXP A;  3OXF A;  4L1B A;  2ETB A;  1ELR A;  3BU8 A;  3AS8 A;  2H6G A;  2WXG A;  4AXH A;  1JWG A;  5LFA A;  5BT1 A;  1HG2 A;  1H2U A;  2IO2 C;  4GZD A;  2RKK A;  2GGF A;  3C72 A;  3RRM B;  4GZ3 A;  1E90 A;  5A23 A;  1O1S A;  3MKQ A;  2VJ8 A;  3ENE A;  5EYP F;  3LVR E;  3PZ1 A;  2AWI A;  3ASG A;  4HQD A;  3S2A A;  3ML9 A;  2KAT A;  4DX6 D;  3ONK A;  4ILH B;  3U64 A;  2DZN A;  4JXT A;  2X6H A;  3NOC D;  4UQY A;  4CT4 A;  3FUK A;  4B8A A;  1NP7 A;  3ASD A;  2P9I G;  1OCR E;  3ZHE B;  5T8I A;  1ZBP A;  4FA6 A;  2FI7 A;  3C3Q A;  5FWQ A;  3UIN C;  3EHR A;  3WXX A;  2L0I A;  3PDN A;  1MQS A;  5AQB A;  4F1S A;  4XEI G;  3KAE A;  3V79 K;  5BXU A;  3P1U A;  4LRZ A;  4HXI A;  1E96 B;  1N94 A;  5AQA A;  2IQC A;  4N3A A;  1TJC A;  2OVB A;  3TAX A;  1D8E A;  3Q79 A;  2WXN A;  1DCE A;  3ZIM A;  1H0A A;  1S64 A;  1UN9 A;  5E75 A;  4BY6 A;  1FCH A;  3FH8 A;  4DX1 A;  4BT9 A;  1S70 B;  2EIJ E;  3TG4 A;  1NI1 A;  1P5Q A;  2I9C A;  3S7B A;  3ZN3 A;  3TWS A;  4UI9 K;  5ARF A;  3RSE G;  3DWL G;  3HXC A;  4EZK A;  3L54 A;  3PZ2 A;  4BX8 A;  4BX9 A;  4GCO A;  3DSU A;  2HO1 A;  2LO6 A;  3VLE A;  5J08 A;  5J90 A;  3CHO A;  3APF A;  2ETA A;  4GTV A;  4APO A;  3UTM A;  3KSL A;  3E33 A;  4EPZ A;  4Q96 A;  2X3M A;  3DSV A;  1TN7 A;  3Q7A A;  4AOF A;  4TXQ A;  3AG1 E;  4FUL A;  3FTY A;  2VGE A;  2VTB A;  2Y1L E;  1SQM A;  4BSZ B;  1O1T A;  1U3D A;  3APC A;  2CHW A;  1N4R A;  4GTS A;  2KCL A;  2IJG X;  3T5V A;  4AM9 A;  2QYU A;  4ANV A;  2XPI A;  4URK A;  3ABL E;  1N4Q A;  1NA3 A;  4N2Q A;  3ZGQ A;  3N71 A;  1DC2 A;  2ZGD A;  1HZ4 A;  5C2Y A;  4CGW A;  4GA1 A;  5CCL A;  2Y4U A;  5CMY A;  2C0M A;  3IHY A;  1RZ4 A;  1BLX B;  1OY3 D;  2FUL A;  4ABN A;  4BTB A;  5CHE E;  3GZ2 A;  1JUQ A;  4RG9 A;  3TWV A;  4X8Q A;  2Q7F A;  2V0P A;  4J8F A;  1YCS B;  3FTW A;  2ZXW E;  3ESL A;  5LCW J;  4TV3 A;  1TNZ A;  3LVQ E;  2R03 A;  2VSY A;  2P2C P;  5FQ7 A;  1TR4 A;  4L23 A;  4BEP A;  3SGH A;  2DIW A;  3FDH A;  3QKY A;  4L2L A;  1OCZ E;  4HOT A;  1BU9 A;  2WXH A;  3FUM A;  3U66 A;  3HDX A;  4DLQ A;  2OVF A;  5AQ7 A;  2XEE A;  1XGW A;  1OWN A;  2J08 A;  2M63 A;  3DST A;  5M72 A;  2OEW A;  3PVL A;  1H2V C;  4E6H A;  3MGB A;  3HXF A;  3LPZ A;  2P9P G;  1JCS A;  2I1K A;  3PNT B;  4I6J A;  5BNW A;  3NZU A;  3IXE A;  3PUJ A;  2B0O E;  5BW8 C;  3G2T A;  2QY7 A;  1S63 A;  3D9M A;  2UWJ G;  4GCN A;  4KZC A;  2VSN A;  2AJA A;  4N2S A;  2X6K A;  3JYS A;  3LXU X;  2KBX A;  5KNG A;  4GU5 A;  4GA2 A;  4IUL A;  3ASO E;  2PM7 A;  4RQI A;  2R02 A;  2E0I A;  3F6Q A;  4DX5 D;  3JXJ A;  3HYM B;  2P9U G;  4DPR A;  4HRN A;  1OWP A;  2WXI A;  3V31 A;  3PZ4 A;  3D9H A;  2WXP A;  4I2Z A;  4YVO A;  2XS1 A;  1KT0 A;  4KVO A;  3FTX A;  3TWR A;  3QWW A;  2F8Y A;  5AIJ A;  5KJM A;  4DX2 A;  3TJP A;  1UJJ A;  4CZ2 D;  3ULY A;  3E37 A;  2P9S G;  3CHS A;  2XGM A;  5JJ7 A;  5G55 A;  3PUK A;  4RVB A;  3CVX A;  2ION A;  4PS8 A;  2OEV A;  2P58 C;  3NQP A;  3PE3 A;  3UT8 A;  3EHN A;  4HS2 A;  4O1O A;  1NA0 A;  4A63 B;  1IHB A;  3RK6 A;  4JHJ A;  4HRL A;  3FU6 A;  3ZHE A;  4HBD A;  3G2S A;  1N95 A;  2Y69 E;  4UWL A;  4JL0 A;  3SFY A;  4UWH A;  4EBA G;  3ML8 A;  4TUM A;  2PM6 A;  4C0E A;  3V2X A;  2WXL A;  3CQC B;  4DUI A;  4A1G A;  3AAA C;  2LXL A;  4HOS A;  2A4Z A;  3UI2 A;  2A5U A;  3O48 A;  2HYZ A;  4LSZ E;  3Q15 A;  3NF1 A;  3IKO B;  5CED B;  4YDW A;  1H6P A;  3JXI A;  4BTA A;  3V30 A;  4BER A;  3EHQ A;  3FHE A;  4J8E A;  3ZRH A;  4F7A A;  5BUZ A;  5B1B E;  4B93 B;  1MYO A;  5JJT A;  2E2E A;  3CKB A;  1QQE A;  3IEG A;  4I1M A;  4Y6W A;  4XE0 A;  3MA5 A;  4YVQ C;  3V2O A;  3FY4 A;  3NB2 A;  3QC1 A;  3CVQ A;  5KNH D;  1EF1 C;  3G2W A;  3IHV A;  1Y6I A;  3ONL A;  3QAR A;  3ULE G;  1UW4 B;  1D8D A;  2XEV A;  3KSQ A;  4PS7 A;  4FC8 A;  3BG1 B;  5KWD A;  3ZW3 A;  4MLP A;  4J0U A;  1LD8 A;  3L22 A;  1OWL A;  5ENR D;  4PDX A;  2WXM A;  4ATG A;  4GTO A;  4XI0 A;  5DBK A;  4HLE A;  3MV3 B;  1Z3X A;  5CCM A;  5D0O D;  3UIO C;  3SHF A;  2ZU6 B;  3ZYL A;  2XS8 A;  3E4B A;  3B13 A;  4U8Y D;  5HRY A;  1OCO E;  2YHE A;  4CGV A;  1LD7 A;  3QWV A;  2IF4 A;  3FU3 A;  4OAV B;  3MKQ B;  1UG3 A;  3AU5 A; 
#chains in the Genus database with same CATH homology
 2RKK A;  4TXQ A;  4TXR A;  4U7E B;  2LUH A;  2LXL A;  4TXP A;  5H7P A;  2LXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...