3QKYA

Crystal structure of rhodothermus marinus bamd
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
251
structure length
251
Chain Sequence
RHSSPQEAFERAMEFYNQGKYDRAIEYFKAVFTYGRTHEWAADAQFYLARAYYQNKEYLLAASEYERFIQIYQIDPRVPQAEYERAMCYYKLSPPYELDQTDTRKAIEAFQLFIDRYPNHELVDDATQKIRELRAKLARKQYEAARLYERRELYEAAAVTYEAVFDAYPDTPWADDALVGAMRAYIAYAEQSVRARQPERYRRAVELYERLLQIFPDSPLLRTAEELYTRARQRLTELEGDASLAQGQRQN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Outer membrane assembly lipoprotein YfiO
publication title Crystal Structure of BamD. An Essential Component of the beta-Barrel Assembly Machinery of Gram Negative Bacteria
pubmed doi rcsb
source organism Rhodothermus marinus
total genus 103
structure length 251
sequence length 251
ec nomenclature
pdb deposition date 2011-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13174 TPR_6 Tetratricopeptide repeat
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3qkyA00
1IHGA 3S7JA 4N3AA 3PE4A 1XNFA 4IN3B 3FP3A 2FF4A 3OXLA 4JA7A 1P5QA 4GPKA 3MV2B 2FO7A 3TAXA 4JL0A 3ZGQA 2LSVA 4HOQA 4W9RA 3MV3B 2XPIA 3Q5MA 1Y8MA 3KAEA 1WAO1 4J8DA 4GZ5A 5FJYA 1OUVA 4N2QA 5CCLA 3ZHEB 2IFUA 1HXIA 4YNDA 4I1AA 4J0UA 5HQ8A 5A7DB 3CK7A 3CKBA 4BT8A 4ME2A 3KS2A 4Y6CA 1IYGA 5LCWJ 4GA0A 2MHKA 3LY9A 3ZPJA 3LY7A 4N3CA 3ULQA 2PQRA 5KJMA 4B94A 2C2LA 3ASDA 2C0MA 4AY5A 3R9AB 4U0SA 4I9EA 4GA2A 5EX3A 1E96B 2FBNA 3AS5A 2GW1A 2UY1A 3FWVA 5FZQA 4J8FA 4HOSA 3CKCA 2KCVA 4ABNA 2WPVA 4HORA 3CVLA 3ASHA 3HYMB 3BEEA 4N39A 4GYOA 4APOA 5D0QD 2YHCA 3U3WA 4Y6WA 1KLXA 2L6JA 4G24A 5G05C 2C0LA 1ZU2A 3RJVA 4CGWA 3TG4A 4U0UA 4J8EA 2KC7A 3O48A 3JYSA 3CVNA 2FI7A 4GYYA 3OXFA 3GW4A 3MEKA 3CV0A 3CVPA 3GZ1A 3RO3A 3QWVA 4GCOA 4N5CA 1QQEA 3PDNA 3S7BA 4I2WA 3ASFA 4I2ZA 4O6FA 4G23A 5KJLA 2VGXB 4N3BA 4WUYA 5BNWA 3Q15A 4UI9K 3WXXA 5DBKA 5LCWC 3RO2A 1PC2A 3TG5A 3GYZA 5JJ6A 3MKRA 3IEGA 4BWRA 3N71A 5FTPA 3QDNA 3E4BA 2UY1B 2UWJG 4I17A 3QWWA 1QZ2A 3LKUA 3KD7A 4G25A 4HOUA 3VTYA 4CDRA 1HZ4A 4UQZA 2XGSA 5FZRA 4A1SA 4UQXA 4AIFA 4GA1A 4LEUA 1TJCA 3ZN3A 3AS4A 1B89A 1ELRA 3LCAA 3LPZA 3PE3A 3LYAA 4GCNA 3U4TA 3CK8A 4XI9A 4N2SA 5G04J 2HYZA 4BTBA 2VYIA 4H7XA 3ESKA 1KT0A 1A17A 1NZNA 5JJTA 3CVQA 2KATA 3Q47B 2XGMA 2Q7FA 2VSYA 4G1TA 2LSUA 5KJKA 4HOTA 2IF4A 3K9IA 3S7FA 5HI7A 3ASGA 4GYWA 4JHRA 4NQ0A 2J9QA 2AVPA 3RKVA 2BUGA 4UI9J 5ARFA 2HR2A 1NA3A 5AYWD 5EX0A 5BT1A 4YVOA 2YQ8A 4GZ6A 3AS8A 4H7YA 2Y4UA 2KCLA 4AM9A 5KJNA 1NA0A 3QWPA 3UUXA 1HH8A 2PQNA 5CHEE 1ZBPA 3MA5A 3S7DA 4G26A 5D0OD 4JA9A 1WM5A 4WNGA 2I6HA 5G05J 5CCMA 5EKQD 2OOEA 4YVQC 3CK9A 2LNIA 3LY8A 2P58C 4G2VA 4BT9A 4F3VA 2XCCA 3UPVA 2FEZA 2VQ2A 4XI0A 3RU0A 3TGOA 3URZA 4KXKB 5G04C 3NF1A 3RIBA 1YA0A 4NRHB 2NC9A 3Q4AB 4WNFA 5M72A 2VGXA 4UQYA 4WNDA 2DBAA 5C1DA 3GZ2A 2VGYA 2V5FA 3QKYA 2VSNA 3FFLA 3UQ3A 5BW8C 3VTXA 3ZHEA 2Y4TA 5DIZA 4AY6A 4KYOB 1ELWA 5A6CA 4UI9C 2R5SA 2JLBA 3SZ7A 5JJ7A 4KBQA 4WNEA 3EDTB 3SF4A 3OXGA 4GZ3A 4I9CA 2E2EA 2XEVA 2KCKA 5ARGA 5FT9A 2QFCA 4RG9A 4CGVA 4U07A 4U0ZA 2XCBA 2ONDA 3Q49B 1KT1A 4U04A 2WQHA 3QOUA 4RG6A 3CEQA 2PZIA 1W3BA 1FCHA 4EQFA 5FZSA 2HO1A 2PL2A 4BTAA 4XIFA 3ZFWA 2XGOA
chains in the Genus database with same CATH superfamily
3E32A 3SO8A 5CBNA 1JCRA 1BPOA 3ZU7B 3CHOA 5KNHD 3HIZA 4FLHA 4JA7A 1P5QA 4X8QA 2I2OA 1QNFA 2L9BA 1TJFA 3FUKA 3TAXA 3ZGQA 2LSVA 3LEWA 3ONKA 4HOQA 4W9RA 4LG6A 3ESLA 2J07A 1BI8B 4GAAA 4U8HA 4CDNA 3KAEA 4MS6A 3DSVA 3NQPA 2ZXWE 1FT2A 3ZHEB 1EDUA 1HXIA 4J0UA 3CHMA 3EUVA 1H2VC 3NBNB 4ME2A 4Y6CA 4AJWA 2BF0X 1IYGA 5FQ8A 3L82A 2PNNA 4JEHA 1IXVA 2C2LA 3ASDA 4DLQA 4NIKA 4GB9A 4HI9A 4DI4A 2XZTG 5C2YA 2JABA 4PS7A 2R02A 1MZCA 1E96B 1NFIE 3AS5A 2DZNA 4HFGA 3SBTB 3IXEA 3FWVA 4LSZE 4HOSA 2WXQA 3VLDA 4EZLA 3ASHA 3KSLA 3ZKJA 4N39A 1HS6A 5D0QD 2EIKE 3MKQA 3PREA 1SA4A 4FJYA 3RRNB 2X6HA 1H6PA 5G05C 3BUAA 2C0LA 1ZU2A 3RJVA 2GRRB 3O48A 4B8AA 4I6GA 3PS6A 3ZYLA 1AWCB 3SQVA 3L6AA 2WXIA 3RO3A 1JCSA 2I1KA 1UJKA 4K5BA 5LOZA 5AQ7A 3ZYKA 2LXLA 2IEJA 3HXEA 1JCQA 3B95A 4G23A 4N3BA 3UX4A 3Q15A 2L6BA 4UI9K 2BTDA 3TG5A 2J4BA 1ELKA 1E8ZA 5FTPA 4L7TA 2J8SD 3QNKA 2UWJG 4HRNA 1GW6A 3NZSA 4LNGA 1QZ2A 1BI7B 3LKUA 3KD7A 3C72A 3U9WA 5B3SE 3DSUA 4K0RA 2DZOA 4U96D 2XGSA 4LUNU 2RFMA 2Y0BG 1HU3A 4A1SA 1DCQA 5AQAA 3MKQB 3ABLE 1TJCA 4I6JA 2CFZA 3JCKC 3CQGB 5G2NA 5JHAA 3SFZA 4U7EB 5ENRD 1MJ0A 3FEXA 4BTBA 3FUMA 1KT0A 1AP7A 4KZCA 4ILIA 3PZ2A 3I3NA 4U8VD 4WWPA 5ENNA 2XQ0A 3HXDA 2VGEA 3KEAA 4HOTA 2IF4A 1YCSB 2R59A 5HI7A 3ASGA 4JHRA 1PAQA 2AVPA 3L16A 3OAWA 4URKA 3CSFA 1NA3A 3L08A 3Q7AA 5AYWD 3C5RA 5BT1A 4DI3A 4FA6A 1K1AA 4GU5A 4GZ6A 4H7YA 2ETBA 1WY6A 1NA0A 2P9PG 2V8SE 4MBGA 5KNGA 4ATZD 5CHEE 1ZBPA 4GMRA 4JZYA 2IONA 4BESA 4CCAA 5J90A 2RD0A 4KZ0A 2I6HA 5BV0A 5CCMA 3FULA 4YVQC 3CK9A 3NOGD 1YYHA 1E8XA 2P58C 3HG0D 3EU5A 3UM2A 3D9MA 1E90A 4BT9A 4GZDA 4AEZC 4M3OA 4B8CB 3C3OA 1HF8A 2AWIA 5G04C 3RIBA 4WAFA 2GRNB 1YA0A 3Q4AB 5AQBA 3DPDA 2VGXA 3ZUVB 4C0MA 3QARA 3QKYA 4M7CA 1Z3YA 2IQCA 3Q9NC 3ASOE 2YNQA 3UQ3A 2DCPA 3VTXA 4KYOB 4RSYA 1ELWA 3AG1E 2ETCA 2KM4A 2JLBA 4TV3A 4GPMA 3NZUA 3SD5A 4GZ3A 3G2VA 2X6FA 3CVVA 5BXUA 5CMYA 5FT9A 2LAHA 1U3CA 1V55E 3HVEA 2XCBA 2GRMA 2ONDA 4EZKA 1KT1A 2WQHA 3MCXA 3TL5A 4RG6A 1FVFA 4JB8P 2LO6A 2F8XK 4U63A 3ZYQA 3Q78A 2PZIA 4EQFA 4DRXE 2PL2A 3PEUB 4OAUC 3T8MA 3TWUA 1HFAA 3JUIA 3I5PA 2V0PA 1IHGA 4BX8A 2EQXA 2P9SG 3MX3A 3OTNA 4K5AB 3I4GA 2KBXA 4F1SA 3FTSA 2OEVA 3J5PA 1HO8A 4GPKA 4FC8A 2FO7A 3UIPC 3ZXSA 3CHQA 5KBAA 2XPIA 4PUCA 3Q5MA 3IHVA 4U8YD 3O4ZA 4J8DA 5FJYA 3QC1A 4N2QA 5CCLA 1N9AA 2IFUA 1OCZE 3PVLA 4I1AA 3G2TA 4YNDA 4QQIA 5HQ8A 2OEWA 4LNUD 1N11A 3RAUA 2XENA 4MKTA 3U64A 5KWDA 5J08A 4A55A 4LERA 4HXIA 3DRAA 4A3TA 3CHRA 3ZPJA 4EZJA 4N3CA 3ULQA 4B0ZA 3D9HA 4DX2A 4FADA 2X6IA 3ML8A 3UT4A 1G3NB 4G8KA 3HXFA 2A5UA 4U0SA 4ILGA 4GA2A 5EX3A 4HVBA 3AU4A 3JUEA 3UKUG 2H6HA 2YINA 2I9CA 3FH8A 3F6QA 3EIQC 3CKCA 2IU1A 4ABNA 2X38A 3ONLA 2ZU6B 4YDWA 5FQ7A 4GTTA 3BEEA 1TNUA 4LRZA 3L22A 4B89A 2YHCA 1UG3A 2XEEA 1KLXA 3RRMB 4G24A 1HG2A 1K3ZD 4E6HA 1U3DA 3B7BA 4CGWA 4J8EA 4ILHB 4UUCA 2FI7A 4JVSA 4GYYA 3OXFA 3GW4A 3CV0A 5HKPA 1SVXA 5BXOA 1N0QA 3GZ1A 4V3IA 3ABKE 2XZDG 3QWVA 4GCOA 1QQEA 4DX5D 2F8YA 2XS1A 1DNPA 3S7BA 2OCCE 4O6FA 4HS2A 4CT4A 1IQUA 2RG8A 3UM1A 4ANVA 2LXMA 5DBKA 5LFAA 2ZISA 3FUNA 4Q96A 3GYZA 5ITZF 3CVXA 1MYOA 3FUHA 3APCA 4CRWA 2NSZA 3BG0B 5BPPA 2Y69E 5AN8A 4ANXA 5AENA 3SBSA 4DJAA 2GRLA 4HOUA 1MX2A 1HZ4A 3DSXA 3SNXA 3LVRE 2WVIA 1TN7A 4UQXA 5AQ9A 2VJ8A 5FQ4A 3RSEG 3ZN3A 4J8YA 3AS4A 5JA4D 3L17A 3UIOC 1S0PA 3FUFA 3PE3A 1N95A 4YDEA 5E75A 3D9IA 1OCCE 2B0OE 5G04J 2HYZA 4WWNA 3ESKA 1NZNA 4OVVA 1TEZA 4HLEA 4F7AA 3EHMA 3Q47B 2KATA 3R7QA 2XGMA 2Q7FA 4Q94A 2FO1E 1E7VA 5AARA 2VTBA 3S7FA 3SHFA 4GYWA 4CZ2D 2IJGX 4NQ0A 3FU3A 2BUGA 2H6IA 2HR2A 5CECB 4DPRA 3IV0A 1OWMA 5EX0A 4GTMA 1TYQG 2KCLA 4PDXA 5AIJA 3APFA 3QWPA 3UUXA 2ETAA 1IQRA 2PQNA 2A4ZA 3MA5A 3S7DA 3ENEA 5D0OD 3CVUA 4HBDA 2R17C 1WM5A 2R2LA 3DSSA 3UXGA 1JWGA 2LNIA 3T8KA 3FU0A 3LY8A 1N4RA 2XPYA 1Z6TA 1BLXB 2MRIA 4KVOA 3TWWA 1WG0A 4P29A 1H19A 2R05A 3UPVA 4GTQA 3ABME 4XI0A 1X81A 4ANWA 3URZA 1LD7A 4GZCA 3EU9A 3FHEA 3AG3E 4D10C 2WMNA 2NC9A 2VTBB 4ACLA 3R9MA 1BD8A 4WNDA 4Z68A 1DVPA 2DBAA 5C1DA 2VGYA 4L2YA 3D9NA 4BSXA 1HE8A 3FFLA 2WXHA 3V2OA 1SA5A 4NURA 5BUZA 4DX6D 3PEVB 3TWSA 1Q2ZA 5A6CA 1RZ4A 4BEPA 2GROB 4KBQA 2HM8A 4Q69A 1KPSB 3E30A 2E0IA 2L0IA 3D9KA 3C3QA 2AW6A 4I9CA 3QAQA 2XEVA 3PZ1A 4CGVA 2XPZA 3T9KA 3CVYA 5EYLA 4I43A 3CIAA 1ZB1A 3C3RA 3Q49B 4U04A 5EILA 4XZ4A 3FUEA 3ZRHA 5D66A 1N54A 2QZAA 1W3BA 3TJPA 3ZNGA 2BKKB 3UKRG 1H6OA 3DSTA 3SFXA 3S7JA 4N3AA 3PE4A 5EDSA 1XNFA 4IN3B 4KMOA 3FP3A 2F0YA 3OXLA 3MV2B 5ENQD 1UN8A 3G2SA 5HRYA 3RRUA 2WXOA 3MV3B 4FJZA 1Y8MA 1WAO1 2P9LG 4GZ5A 1OUVA 1K8KG 3LXUX 3TWTA 3DEOA 4DX1A 4BT8A 3IBEA 3ASNE 5FQ6A 4LCTA 3CLJA 4UWGA 3PUKA 2WXNA 3LY9A 3FU5A 4B94A 5KJMA 3FU6A 3KSQA 3V30A 4PH4B 3FTWA 4GMLA 2ILRA 5LP0A 3NAWA 4I9EA 1UW4B 3TWVA 4PS8A 2FBNA 3D9JA 2KZTA 2GW1A 2I1JA 4TRQA 3CSTA 3DPYA 5FZQA 2KCVA 1SQMA 3FTYA 2WPVA 1OWOA 3IHYA 3UTMA 4KT6B 2X6KA 1S63A 2WXFA 3HYMB 3CVWA 3CR3A 4NACA 1DCEA 1IHBA 3U3WA 4Y6WA 2WMOA 4UWLA 3BQOA 2L6JA 4A1GA 2IO2C 2IOLA 2P9UG 3CHPA 3TG4A 2KC7A 4TXRA 3JYSA 5CBOA 2QYUA 3IKOB 4YDOA 3MEKA 2WB2A 3JQ1A 3D9PA 1OCRE 4U95D 3JXIA 4K03A 3CVPA 5G55A 4UWFA 4N5CA 4I2WA 3LJ3A 1UOHA 2VGXB 4F53A 5AAOA 1SW6A 4BETA 5BNWA 4DX7D 5EIBE 5LCWC 3RO2A 2CHXA 5T4YA 4ZHBA 4ACKA 2BEDA 2QYJA 3IEGA 2IOSA 4OAVB 4BWRA 3MJWA 3L54A 2KZTB 1EYHA 5EYPF 3AJIA 3UI2A 4YDYA 1JPLA 1BU9A 3TWRA 4I17A 2DWZA 3QWWA 1Z5SC 1JWFA 3FTVA 4O1OA 4G25A 1KZPA 2EILE 3HVEB 4UQZA 1Y6IA 5FZRA 3FTZA 2WQ6A 4AIFA 5B1BE 4GA1A 4LEUA 4JC8A 1B89A 3LCAA 2J09A 3PZDA 4RQIA 4GCNA 1N4QA 1DC2A 2P9IG 2XEHA 3U4TA 4I1OB 2FULA 4XI9A 3Q73A 4N2SA 5JMND 3AU5A 4H7XA 5B1AE 2XHEA 5JJTA 4JHKA 2GRQB 1E8WA 3PRZA 3DEPA 3R7RA 1INZA 1TNBA 2B6CA 3UM0A 3FTUA 2LSUA 2XRZA 2H6GA 4TUMA 4RLYA 3K9IA 1SZAA 5D2MC 4DLOA 3RKVA 5ARFA 1N4SA 1TR4A 3D3MA 4C48B 1RW2A 2JEKA 3G2UA 4R7LA 1K1BA 3GZSA 4YVOA 3QK0A 4BSZB 2YQ8A 1O1SA 2Y4UA 4AM9A 3TXNA 5CEDB 3HRAA 1HH8A 2WXGA 2P9KG 3E33A 3DSWA 1D8EA 4JA9A 1D9SA 5EKQD 5BV1A 5CEAA 1N52A 4JD2G 5T3RA 2EIJE 2J49A 1D8DA 2ZGGA 3P1UA 4FP7A 4IULA 2GRPB 4GTVA 4CT0A 1NP7A 4F3VA 4EBAG 1WDYA 5CERB 1V54E 1FT1A 3NOCD 4MRUA 1TNZA 3SI5A 3TGOA 2OVBA 1QYMA 5HS0A 1OCOE 1MX6A 1OWPA 3TWQA 4J8SA 1H0AA 4HRMB 5AJDA 3V79K 2KXPC 3B13A 5M72A 4UQYA 2WXLA 4BX9A 2CG3A 3GZ2A 2DYSE 4QFVA 3ZVVA 3ML9A 5ENTD 2CHZA 2V5FA 2EINE 1KZOA 3ZXPA 5ENPD 3W9GA 2VSNA 2X3MA 1EPUA 2WXKA 5EN5D 3L13A 4L1BA 5H7PA 2J08A 4UI9C 2R5SA 2J4DA 3SZ7A 5FINA 2XRYA 4N5QA 3HDXA 2P2CP 3EDTB 3OXGA 2NYJA 3CGHA 2KCKA 4FHKA 5ARGA 2V4HC 2QFCA 4RG9A 4TUUA 3DXKG 2GGFA 4U0ZA 3LS8A 2X6JA 1TN8A 3AAAC 4O60A 3FUDA 3CEQA 2RFAA 3ZYMA 2ZGDA 3JQ0A 1FCHA 3MZLB 2HO1A 4BTAA 1SZ9A 4XIFA 4GTSA 3ZFWA 4C0EA 3T5VA 3NB2A 4CYMD 4IRUA 3E34A 4O1PA 2CG2A 3HXBA 3FDHA 2AJAA 1PY1A 2IY0C 2FF4A 1HX8A 3QB2A 1MX4A 4GMJA 4UWHA 4JL0A 3Q79A 4JPSA 1LTXA 4JHJA 2P9NG 1TN6A 3ULYA 4GTPA 5A7DB 3CK7A 3AG4E 4GTOA 4RVBA 3CKBA 3LDZA 3KS2A 4TXPA 3AG2E 4XKCA 3D9LA 5LCWJ 4L23A 4DK5A 4K5CA 4GA0A 2MHKA 3LY7A 3PZ4A 3V2XA 2PQRA 3SY2A 3PNTB 4CEMA 4L2LA 2C0MA 4AY5A 3ULEG 3PH0C 3R9AB 3PUJA 2IO3C 3X2QE 3FUIA 2L0TB 1OY3D 4FLBA 1S64A 3UT7A 5T8IA 4F6RD 2UY1A 3KEZA 4J8FA 1QBQA 2OV8A 3SGHA 3LVQE 2DYRE 4HORA 3EJNA 3CVLA 4WWOA 2RKKA 2VSOE 1NL4A 4GYOA 4APOA 2WXRA 5CMWA 4A63B 4XKBA 2M63A 2OVFA 4HB5A 1UJJA 4AVXA 3DBSA 3DXMG 1YMPA 5ANRA 1O5MA 4U0UA 3CVNA 3FH5A 2WQ7A 4I1MA 4TXQA 2WXJA 2NXPA 1UN9A 3ISMC 1JUQA 3B7SA 3B7UX 4AV7A 3TXMA 3PDNA 2PM6A 3ASFA 2EIME 4I2ZA 3LJNA 3UT8A 3ZW3A 3ZEFA 5KJLA 4WUYA 4AOFA 3EHNA 3VLEA 1OWNA 4OYSA 3WXXA 3FEYA 1HG5A 1PC2A 1LD8A 5ANLA 4FU3A 1Z3XA 4AP2A 1H2UA 1LF8A 4HQDA 4UWKA 5JJ6A 2AXUA 5E76A 3MKRA 4C9BB 4HLLA 2CHWA 3N71A 4G8LA 3QDNA 1E7UA 4JEUA 3E4BA 3APDA 2UY1B 2XS8A 4HRLA 4AXHA 3P2BA 2HE0A 4J7WA 3MYVA 3J5QB 4BERA 3VTYA 4CDRA 4A3VA 4IYPA 5CRUA 4EHMA 4ANUA 5ENOD 4E85A 1S70B 3WG7E 3V31A 3B7RL 1ELRA 4LNBA 3LPZA 5KCMA 3LYAA 3W9FA 4F1PA 3BG1B 4XX5A 3CK8A 2R03A 2LAIA 1NI1A 2H6FA 4JXTA 2VYIA 3B7TA 3HHMA 1A17A 4ZFHA 3ZIMA 3I4RB 3QJZA 5AJLA 1OT8A 3FUJA 4XEIG 1MHQA 2VSXE 3CVQA 5FWQA 2WXMA 3D9OA 2VSYA 3FY4A 4G1TA 5KJKA 4PS3A 3SFYA 1TNOA 3E37A 4CDMA 3EHRA 1XGWA 2J9QA 5LX8A 4XE0A 4UI9J 5EIDA 1OXJA 1MQSA 1EF1C 3AS8A 2V4LA 3FTXA 3S2AA 5KJNA 3UMVA 4APFA 2A5EA 3UM3A 1X5BA 2AXVA 1FPPA 1E8YA 3Q9UC 4OVUA 4G26A 2MYOA 3PNLB 2WXPA 1N0RA 4WNGA 5A23A 2WM9A 4HI8A 5G05J 4I6EA 5IY5E 2PM7A 2OOEA 3UINC 3EIJA 5FIOA 3C98A 3Q75A 3G2WA 1U2VG 2QY7A 2DIWA 2YHEA 4G2VA 3RK6A 2BKGA 2LUHA 3PZ3A 3Q7FA 2XCCA 3U66A 4J6IA 2FEZA 4EECA 1VDYA 2VQ2A 3FH7A 3RU0A 2Y3AA 1N4PA 1N94A 4KXKB 1OWLA 3NF1A 4EPZA 4NRHB 4WNFA 1IKND 4HNAD 3VLFA 3L9TA 5ENSD 1L5JA 2ZIRA 4B93B 4EBAA 2MOWA 4MLPA 4BY6A 5BW8C 2F37A 3ZHEA 3MGBA 2Y4TA 2V5QC 5DIZA 4AY6A 1O1RA 4L9PA 4KVMA 5JJ7A 1O1TA 4WNEA 2CFUA 3SF4A 3BU8A 4BFRA 2Y1LE 4GTRA 4G11A 4JW1A 2E2EA 2QC9A 3T5XA 5CRVA 2DVWA 1H6KA 4U07A 3JXJA 4DUIA 4FULA 3TWXA 1TNYA 3QOUA 1H2TC 4FHJA 3CQCB 1FVHA 1A5EA 3EHQA 3CHSA 5FZSA 2AXZA 3DWLG 3HXCA 4ATGA 5JHBA 2XGOA
chains in the Genus database with same CATH topology
3JUIA 3I5PA 4IRUA 2V0PA 1IHGA 4BX8A 2CG2A 3S7JA 4N3AA 2EQXA 3FDHA 3PE4A 5EDSA 3MX3A 3OTNA 1BPOA 1PY1A 1XNFA 3I4GA 3CHOA 4IN3B 4KMOA 4F1SA 3HIZA 3FP3A 3FTSA 2FF4A 4FLHA 1HX8A 3OXLA 4JA7A 1P5QA 3QB2A 2I2OA 1HO8A 1QNFA 3MV2B 1UN8A 4GPKA 4FC8A 4GMJA 2FO7A 2L9BA 4UWHA 3G2SA 1TJFA 3FUKA 4JL0A 3TAXA 2LSVA 3ZGQA 3ZXSA 3LEWA 3ONKA 3CHQA 3RRUA 2WXOA 4HOQA 4W9RA 4JPSA 3ESLA 3MV3B 2XPIA 4PUCA 2J07A 3Q5MA 4FJZA 1Y8MA 4GAAA 3IHVA 4U8HA 4CDNA 3KAEA 1WAO1 3O4ZA 4J8DA 4JHJA 4MS6A 4GZ5A 5FJYA 3NQPA 3QC1A 1OUVA 4N2QA 5CCLA 3ZHEB 1EDUA 2IFUA 1HXIA 3LXUX 3PVLA 4I1AA 3G2TA 4YNDA 4J0UA 5HQ8A 5A7DB 3CHMA 3CK7A 1H2VC 4RVBA 3CKBA 4BT8A 3LDZA 4ME2A 3KS2A 4Y6CA 3IBEA 4AJWA 4XKCA 5FQ6A 4MKTA 3D9LA 4LCTA 3U64A 3CLJA 2BF0X 1IYGA 5LCWJ 4L23A 5J08A 4DK5A 4UWGA 4A55A 3PUKA 4HXIA 4LERA 4GA0A 2MHKA 5FQ8A 2WXNA 4A3TA 3CHRA 3LY9A 3ZPJA 3LY7A 4EZJA 4N3CA 3ULQA 2PQRA 3FU5A 4B0ZA 4B94A 5KJMA 4FADA 3PNTB 2X6IA 3FU6A 3ML8A 4JEHA 3UT4A 2C2LA 3ASDA 4DLQA 4CEMA 4L2LA 4PH4B 3FTWA 2C0MA 4AY5A 4GB9A 3PH0C 3R9AB 4DI4A 2A5UA 2ILRA 4GMLA 4U0SA 4PS7A 4ILGA 5C2YA 5LP0A 3PUJA 3FUIA 4I9EA 1UW4B 4GA2A 2L0TB 5EX3A 4PS8A 4HVBA 1E96B 3AU4A 4FLBA 2FBNA 3D9JA 3AS5A 2KZTA 3UT7A 2GW1A 4HFGA 2I1JA 4TRQA 5T8IA 2YINA 3SBTB 2I9CA 2UY1A 3FWVA 3CSTA 3KEZA 3FH8A 5FZQA 4J8FA 3SGHA 2OV8A 3EIQC 4HOSA 3CKCA 2KCVA 2WXQA 1SQMA 3LVQE 3VLDA 2IU1A 4ABNA 3FTYA 2WPVA 2X38A 1OWOA 3IHYA 3EJNA 3CVLA 3ONLA 4KT6B 4WWOA 4HORA 2X6KA 4EZLA 2VSOE 2ZU6B 5FQ7A 2WXFA 3ASHA 3HYMB 3BEEA 3CVWA 3CR3A 4NACA 4N39A 4GYOA 4APOA 2WXRA 1HS6A 5CMWA 4LRZA 3L22A 4B89A 5D0QD 2YHCA 3U3WA 4Y6WA 2WMOA 1UG3A 4XKBA 3MKQA 4UWLA 3PREA 4FJYA 1KLXA 2M63A 2OVFA 3RRNB 2L6JA 2X6HA 3RRMB 4G24A 4A1GA 1HG2A 1UJJA 4AVXA 5G05C 3DBSA 2C0LA 4E6HA 1ZU2A 2IOLA 1U3DA 3RJVA 4CGWA 3CHPA 5ANRA 4U0UA 4J8EA 2KC7A 3TG4A 3O48A 4B8AA 3JYSA 3CVNA 4ILHB 4I6GA 2FI7A 4JVSA 3IKOB 4GYYA 3OXFA 3PS6A 3ZYLA 3GW4A 3MEKA 3CV0A 3FH5A 2WB2A 2WQ7A 3JQ1A 4I1MA 3D9PA 4K03A 2WXJA 3L6AA 2NXPA 1UN9A 2WXIA 3CVPA 3GZ1A 3RO3A 1JUQA 2I1KA 1UJKA 3B7SA 4V3IA 4UWFA 5G55A 5LOZA 3B7UX 3ZYKA 4AV7A 3TXMA 3QWVA 4GCOA 4N5CA 1QQEA 3PDNA 1DNPA 2PM6A 4I2WA 3ASFA 3S7BA 4I2ZA 4O6FA 4HS2A 3UT8A 4G23A 3ZW3A 3LJ3A 3ZEFA 5KJLA 2VGXB 4N3BA 4WUYA 4AOFA 4F53A 3EHNA 3UX4A 4CT4A 3VLEA 1OWNA 5BNWA 3Q15A 1IQUA 4OYSA 4UI9K 3WXXA 2RG8A 3FEYA 4ANVA 5DBKA 5LCWC 3RO2A 5LFAA 1HG5A 3FUNA 1PC2A 4Q96A 2CHXA 5ANLA 5T4YA 2BTDA 4ACKA 4FU3A 1Z3XA 3TG5A 3GYZA 4AP2A 2J4BA 1H2UA 1LF8A 1ELKA 1E8ZA 4UWKA 5JJ6A 2AXUA 3CVXA 5E76A 3MKRA 3FUHA 3IEGA 4C9BB 2IOSA 3APCA 2CHWA 4BWRA 3MJWA 3N71A 5FTPA 4CRWA 3L54A 1E7UA 1EYHA 2KZTB 3QDNA 4JEUA 3E4BA 2NSZA 1JPLA 4L7TA 3BG0B 3APDA 3QNKA 2UY1B 2UWJG 5BPPA 4I17A 3P2BA 4AXHA 1GW6A 3NZSA 3QWWA 1QZ2A 3LKUA 3KD7A 1JWFA 3FTVA 4ANXA 5AENA 3U9WA 4G25A 3SBSA 4DJAA 2GRLA 4HOUA 3MYVA 3VTYA 3HVEB 4CDRA 1HZ4A 4A3VA 4K0RA 4UQZA 3SNXA 1Y6IA 2XGSA 5FZRA 4LUNU 3LVRE 1HU3A 2WVIA 3FTZA 4IYPA 4A1SA 2WQ6A 4UQXA 4AIFA 4ANUA 3MKQB 4GA1A 4E85A 2VJ8A 5FQ4A 1TJCA 4LEUA 4JC8A 3ZN3A 4I6JA 3AS4A 1B89A 2CFZA 3B7RL 3L17A 1ELRA 3JCKC 2J09A 3LCAA 1S0PA 3PZDA 3FUFA 3LPZA 3CQGB 3PE3A 5G2NA 5KCMA 5JHAA 3LYAA 4GCNA 3SFZA 3BG1B 4XX5A 5E75A 3D9IA 3U4TA 3CK8A 2FULA 4I1OB 4XI9A 2LAIA 3FEXA 4N2SA 5G04J 2HYZA 4BTBA 3AU5A 4WWNA 4JXTA 2VYIA 4H7XA 3FUMA 3B7TA 1KT0A 3ESKA 1A17A 1NZNA 3HHMA 4OVVA 2XHEA 5JJTA 4KZCA 4ILIA 3ZIMA 3I4RB 3QJZA 5AJLA 1TEZA 4HLEA 3I3NA 3FUJA 4JHKA 1MHQA 4F7AA 3EHMA 2VSXE 1E8WA 3CVQA 2KATA 3Q47B 3PRZA 5FWQA 2WXMA 3R7QA 4WWPA 2XGMA 5ENNA 3D9OA 3R7RA 1INZA 2Q7FA 2VSYA 3FY4A 2XQ0A 4Q94A 3FTUA 1E7VA 2LSUA 4G1TA 2XRZA 5KJKA 4PS3A 4HOTA 2VTBA 2IF4A 3K9IA 1SZAA 4CDMA 3S7FA 2R59A 5HI7A 3ASGA 3SHFA 4GYWA 1XGWA 4DLOA 4JHRA 1PAQA 2IJGX 4NQ0A 2J9QA 5LX8A 2AVPA 3L16A 3OAWA 3RKVA 3FU3A 4URKA 4XE0A 2BUGA 4UI9J 5ARFA 2HR2A 3CSFA 1NA3A 3L08A 4DPRA 3IV0A 3D3MA 5AYWD 2JEKA 1OWMA 3G2UA 5EX0A 4R7LA 5BT1A 4DI3A 1MQSA 3GZSA 4YVOA 3QK0A 4FA6A 1EF1C 4GU5A 2YQ8A 4GZ6A 3AS8A 2V4LA 2Y4UA 4H7YA 3FTXA 2KCLA 4AM9A 3S2AA 5KJNA 1WY6A 3UMVA 1NA0A 4APFA 3TXNA 2V8SE 4PDXA 5AIJA 3APFA 3QWPA 3UUXA 1IQRA 1X5BA 1HH8A 2PQNA 2AXVA 2WXGA 5CHEE 1ZBPA 1E8YA 2A4ZA 3MA5A 4JZYA 4OVUA 4G26A 2IONA 3S7DA 3ENEA 4CCAA 5D0OD 5J90A 3CVUA 4JA9A 2R17C 1WM5A 2RD0A 2WXPA 3PNLB 4KZ0A 4WNGA 5A23A 2WM9A 2I6HA 5BV0A 5G05J 4I6EA 5CCMA 5EKQD 3FULA 5BV1A 2PM7A 2OOEA 1N52A 4YVQC 3CK9A 1JWGA 3EIJA 2LNIA 3C98A 3G2WA 2QY7A 5T3RA 3FU0A 2J49A 3LY8A 2DIWA 1E8XA 2YHEA 3P1UA 4FP7A 2XPYA 2P58C 4IULA 1Z6TA 4G2VA 3RK6A 2MRIA 4CT0A 4KVOA 3D9MA 1E90A 1NP7A 4P29A 4BT9A 4GZDA 4F3VA 1H19A 2XCCA 4EBAG 4AEZC 3U66A 4M3OA 4B8CB 3UPVA 4J6IA 2FEZA 4EECA 1VDYA 2VQ2A 3FH7A 4XI0A 3RU0A 1HF8A 4MRUA 2Y3AA 4ANWA 3SI5A 3TGOA 3URZA 2OVBA 2AWIA 4GZCA 4KXKB 3FHEA 4D10C 1OWLA 2WMNA 5G04C 3NF1A 3RIBA 4WAFA 1OWPA 4J8SA 1H0AA 1YA0A 5AJDA 4EPZA 4NRHB 2NC9A 3Q4AB 4WNFA 3B13A 3DPDA 5M72A 2VTBB 2VGXA 4UQYA 3VLFA 4ACLA 2WXLA 4BX9A 2CG3A 4WNDA 1DVPA 2DBAA 5C1DA 3GZ2A 3ZVVA 2VGYA 4L2YA 4QFVA 4C0MA 3ML9A 3QARA 3D9NA 2CHZA 2V5FA 1L5JA 3QKYA 4EBAA 2MOWA 1Z3YA 2IQCA 4MLPA 4BSXA 2VSNA 2X3MA 1EPUA 2WXKA 1HE8A 2YNQA 2WXHA 3FFLA 2DCPA 3UQ3A 4BY6A 5BW8C 3VTXA 3ZHEA 3MGBA 2Y4TA 4NURA 3L13A 4L1BA 3PEVB 5DIZA 5BUZA 4AY6A 4KYOB 4RSYA 1ELWA 5A6CA 2J08A 4UI9C 2KM4A 2R5SA 2J4DA 2JLBA 4TV3A 3SZ7A 2XRYA 4KVMA 5JJ7A 4KBQA 3NZUA 3HDXA 2HM8A 2CFUA 4WNEA 4Q69A 3SD5A 3EDTB 3SF4A 2E0IA 3OXGA 2L0IA 4GZ3A 3D9KA 4BFRA 2AW6A 3CGHA 3G2VA 4G11A 4I9CA 2X6FA 4JW1A 3QAQA 2E2EA 3CVVA 2XEVA 2KCKA 4FHKA 3T5XA 5CMYA 5ARGA 5FT9A 2QFCA 4RG9A 4TUUA 1H6KA 2XPZA 2GGFA 2LAHA 4U07A 4CGVA 3CVYA 1U3CA 4U0ZA 4I43A 3CIAA 3LS8A 3HVEA 2XCBA 2GRMA 2ONDA 2X6JA 4FULA 4EZKA 3Q49B 1KT1A 4U04A 2WQHA 4XZ4A 3QOUA 3MCXA 1H2TC 3FUDA 4RG6A 3TL5A 4FHJA 1FVFA 3CEQA 3FUEA 3CQCB 3ZRHA 1FVHA 2LO6A 4U63A 3ZYQA 1N54A 3CHSA 2PZIA 3ZYMA 1W3BA 1FCHA 3JQ0A 4EQFA 5FZSA 3MZLB 2HO1A 3TJPA 2AXZA 2PL2A 4BTAA 1SZ9A 3PEUB 4XIFA 3ZFWA 4ATGA 5JHBA 2XGOA 4C0EA 3T8MA 3T5VA 1HFAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IHG A;  3S7J A;  4N3A A;  3PE4 A;  1XNF A;  4IN3 B;  3FP3 A;  2FF4 A;  3OXL A;  4JA7 A;  1P5Q A;  4GPK A;  3MV2 B;  2FO7 A;  3TAX A;  4JL0 A;  3ZGQ A;  2LSV A;  4HOQ A;  4W9R A;  3MV3 B;  2XPI A;  3Q5M A;  1Y8M A;  3KAE A;  1WAO 1;  4J8D A;  4GZ5 A;  5FJY A;  1OUV A;  4N2Q A;  5CCL A;  3ZHE B;  2IFU A;  1HXI A;  4YND A;  4I1A A;  4J0U A;  5HQ8 A;  5A7D B;  3CK7 A;  3CKB A;  4BT8 A;  4ME2 A;  3KS2 A;  4Y6C A;  1IYG A;  5LCW J;  4GA0 A;  2MHK A;  3LY9 A;  3ZPJ A;  3LY7 A;  4N3C A;  3ULQ A;  2PQR A;  5KJM A;  4B94 A;  2C2L A;  3ASD A;  2C0M A;  4AY5 A;  3R9A B;  4U0S A;  4I9E A;  4GA2 A;  5EX3 A;  1E96 B;  2FBN A;  3AS5 A;  2GW1 A;  2UY1 A;  3FWV A;  5FZQ A;  4J8F A;  4HOS A;  3CKC A;  2KCV A;  4ABN A;  2WPV A;  4HOR A;  3CVL A;  3ASH A;  3HYM B;  3BEE A;  4N39 A;  4GYO A;  4APO A;  5D0Q D;  2YHC A;  3U3W A;  4Y6W A;  1KLX A;  2L6J A;  4G24 A;  5G05 C;  2C0L A;  1ZU2 A;  3RJV A;  4CGW A;  3TG4 A;  4U0U A;  4J8E A;  2KC7 A;  3O48 A;  3JYS A;  3CVN A;  2FI7 A;  4GYY A;  3OXF A;  3GW4 A;  3MEK A;  3CV0 A;  3CVP A;  3GZ1 A;  3RO3 A;  3QWV A;  4GCO A;  4N5C A;  1QQE A;  3PDN A;  3S7B A;  4I2W A;  3ASF A;  4I2Z A;  4O6F A;  4G23 A;  5KJL A;  2VGX B;  4N3B A;  4WUY A;  5BNW A;  3Q15 A;  4UI9 K;  3WXX A;  5DBK A;  5LCW C;  3RO2 A;  1PC2 A;  3TG5 A;  3GYZ A;  5JJ6 A;  3MKR A;  3IEG A;  4BWR A;  3N71 A;  5FTP A;  3QDN A;  3E4B A;  2UY1 B;  2UWJ G;  4I17 A;  3QWW A;  1QZ2 A;  3LKU A;  3KD7 A;  4G25 A;  4HOU A;  3VTY A;  4CDR A;  1HZ4 A;  4UQZ A;  2XGS A;  5FZR A;  4A1S A;  4UQX A;  4AIF A;  4GA1 A;  4LEU A;  1TJC A;  3ZN3 A;  3AS4 A;  1B89 A;  1ELR A;  3LCA A;  3LPZ A;  3PE3 A;  3LYA A;  4GCN A;  3U4T A;  3CK8 A;  4XI9 A;  4N2S A;  5G04 J;  2HYZ A;  4BTB A;  2VYI A;  4H7X A;  3ESK A;  1KT0 A;  1A17 A;  1NZN A;  5JJT A;  3CVQ A;  2KAT A;  3Q47 B;  2XGM A;  2Q7F A;  2VSY A;  4G1T A;  2LSU A;  5KJK A;  4HOT A;  2IF4 A;  3K9I A;  3S7F A;  5HI7 A;  3ASG A;  4GYW A;  4JHR A;  4NQ0 A;  2J9Q A;  2AVP A;  3RKV A;  2BUG A;  4UI9 J;  5ARF A;  2HR2 A;  1NA3 A;  5AYW D;  5EX0 A;  5BT1 A;  4YVO A;  2YQ8 A;  4GZ6 A;  3AS8 A;  4H7Y A;  2Y4U A;  2KCL A;  4AM9 A;  5KJN A;  1NA0 A;  3QWP A;  3UUX A;  1HH8 A;  2PQN A;  5CHE E;  1ZBP A;  3MA5 A;  3S7D A;  4G26 A;  5D0O D;  4JA9 A;  1WM5 A;  4WNG A;  2I6H A;  5G05 J;  5CCM A;  5EKQ D;  2OOE A;  4YVQ C;  3CK9 A;  2LNI A;  3LY8 A;  2P58 C;  4G2V A;  4BT9 A;  4F3V A;  2XCC A;  3UPV A;  2FEZ A;  2VQ2 A;  4XI0 A;  3RU0 A;  3TGO A;  3URZ A;  4KXK B;  5G04 C;  3NF1 A;  3RIB A;  1YA0 A;  4NRH B;  2NC9 A;  3Q4A B;  4WNF A;  5M72 A;  2VGX A;  4UQY A;  4WND A;  2DBA A;  5C1D A;  3GZ2 A;  2VGY A;  2V5F A;  3QKY A;  2VSN A;  3FFL A;  3UQ3 A;  5BW8 C;  3VTX A;  3ZHE A;  2Y4T A;  5DIZ A;  4AY6 A;  4KYO B;  1ELW A;  5A6C A;  4UI9 C;  2R5S A;  2JLB A;  3SZ7 A;  5JJ7 A;  4KBQ A;  4WNE A;  3EDT B;  3SF4 A;  3OXG A;  4GZ3 A;  4I9C A;  2E2E A;  2XEV A;  2KCK A;  5ARG A;  5FT9 A;  2QFC A;  4RG9 A;  4CGV A;  4U07 A;  4U0Z A;  2XCB A;  2OND A;  3Q49 B;  1KT1 A;  4U04 A;  2WQH A;  3QOU A;  4RG6 A;  3CEQ A;  2PZI A;  1W3B A;  1FCH A;  4EQF A;  5FZS A;  2HO1 A;  2PL2 A;  4BTA A;  4XIF A;  3ZFW A;  2XGO A; 
#chains in the Genus database with same CATH topology
 3E32 A;  3SO8 A;  5CBN A;  1JCR A;  1BPO A;  3ZU7 B;  3CHO A;  5KNH D;  3HIZ A;  4FLH A;  4JA7 A;  1P5Q A;  4X8Q A;  2I2O A;  1QNF A;  2L9B A;  1TJF A;  3FUK A;  3TAX A;  3ZGQ A;  2LSV A;  3LEW A;  3ONK A;  4HOQ A;  4W9R A;  4LG6 A;  3ESL A;  2J07 A;  1BI8 B;  4GAA A;  4U8H A;  4CDN A;  3KAE A;  4MS6 A;  3DSV A;  3NQP A;  2ZXW E;  1FT2 A;  3ZHE B;  1EDU A;  1HXI A;  4J0U A;  3CHM A;  3EUV A;  1H2V C;  3NBN B;  4ME2 A;  4Y6C A;  4AJW A;  2BF0 X;  1IYG A;  5FQ8 A;  3L82 A;  2PNN A;  4JEH A;  1IXV A;  2C2L A;  3ASD A;  4DLQ A;  4NIK A;  4GB9 A;  4HI9 A;  4DI4 A;  2XZT G;  5C2Y A;  2JAB A;  4PS7 A;  2R02 A;  1MZC A;  1E96 B;  1NFI E;  3AS5 A;  2DZN A;  4HFG A;  3SBT B;  3IXE A;  3FWV A;  4LSZ E;  4HOS A;  2WXQ A;  3VLD A;  4EZL A;  3ASH A;  3KSL A;  3ZKJ A;  4N39 A;  1HS6 A;  5D0Q D;  2EIK E;  3MKQ A;  3PRE A;  1SA4 A;  4FJY A;  3RRN B;  2X6H A;  1H6P A;  5G05 C;  3BUA A;  2C0L A;  1ZU2 A;  3RJV A;  2GRR B;  3O48 A;  4B8A A;  4I6G A;  3PS6 A;  3ZYL A;  1AWC B;  3SQV A;  3L6A A;  2WXI A;  3RO3 A;  1JCS A;  2I1K A;  1UJK A;  4K5B A;  5LOZ A;  5AQ7 A;  3ZYK A;  2LXL A;  2IEJ A;  3HXE A;  1JCQ A;  3B95 A;  4G23 A;  4N3B A;  3UX4 A;  3Q15 A;  2L6B A;  4UI9 K;  2BTD A;  3TG5 A;  2J4B A;  1ELK A;  1E8Z A;  5FTP A;  4L7T A;  2J8S D;  3QNK A;  2UWJ G;  4HRN A;  1GW6 A;  3NZS A;  4LNG A;  1QZ2 A;  1BI7 B;  3LKU A;  3KD7 A;  3C72 A;  3U9W A;  5B3S E;  3DSU A;  4K0R A;  2DZO A;  4U96 D;  2XGS A;  4LUN U;  2RFM A;  2Y0B G;  1HU3 A;  4A1S A;  1DCQ A;  5AQA A;  3MKQ B;  3ABL E;  1TJC A;  4I6J A;  2CFZ A;  3JCK C;  3CQG B;  5G2N A;  5JHA A;  3SFZ A;  4U7E B;  5ENR D;  1MJ0 A;  3FEX A;  4BTB A;  3FUM A;  1KT0 A;  1AP7 A;  4KZC A;  4ILI A;  3PZ2 A;  3I3N A;  4U8V D;  4WWP A;  5ENN A;  2XQ0 A;  3HXD A;  2VGE A;  3KEA A;  4HOT A;  2IF4 A;  1YCS B;  2R59 A;  5HI7 A;  3ASG A;  4JHR A;  1PAQ A;  2AVP A;  3L16 A;  3OAW A;  4URK A;  3CSF A;  1NA3 A;  3L08 A;  3Q7A A;  5AYW D;  3C5R A;  5BT1 A;  4DI3 A;  4FA6 A;  1K1A A;  4GU5 A;  4GZ6 A;  4H7Y A;  2ETB A;  1WY6 A;  1NA0 A;  2P9P G;  2V8S E;  4MBG A;  5KNG A;  4ATZ D;  5CHE E;  1ZBP A;  4GMR A;  4JZY A;  2ION A;  4BES A;  4CCA A;  5J90 A;  2RD0 A;  4KZ0 A;  2I6H A;  5BV0 A;  5CCM A;  3FUL A;  4YVQ C;  3CK9 A;  3NOG D;  1YYH A;  1E8X A;  2P58 C;  3HG0 D;  3EU5 A;  3UM2 A;  3D9M A;  1E90 A;  4BT9 A;  4GZD A;  4AEZ C;  4M3O A;  4B8C B;  3C3O A;  1HF8 A;  2AWI A;  5G04 C;  3RIB A;  4WAF A;  2GRN B;  1YA0 A;  3Q4A B;  5AQB A;  3DPD A;  2VGX A;  3ZUV B;  4C0M A;  3QAR A;  3QKY A;  4M7C A;  1Z3Y A;  2IQC A;  3Q9N C;  3ASO E;  2YNQ A;  3UQ3 A;  2DCP A;  3VTX A;  4KYO B;  4RSY A;  1ELW A;  3AG1 E;  2ETC A;  2KM4 A;  2JLB A;  4TV3 A;  4GPM A;  3NZU A;  3SD5 A;  4GZ3 A;  3G2V A;  2X6F A;  3CVV A;  5BXU A;  5CMY A;  5FT9 A;  2LAH A;  1U3C A;  1V55 E;  3HVE A;  2XCB A;  2GRM A;  2OND A;  4EZK A;  1KT1 A;  2WQH A;  3MCX A;  3TL5 A;  4RG6 A;  1FVF A;  4JB8 P;  2LO6 A;  2F8X K;  4U63 A;  3ZYQ A;  3Q78 A;  2PZI A;  4EQF A;  4DRX E;  2PL2 A;  3PEU B;  4OAU C;  3T8M A;  3TWU A;  1HFA A;  3JUI A;  3I5P A;  2V0P A;  1IHG A;  4BX8 A;  2EQX A;  2P9S G;  3MX3 A;  3OTN A;  4K5A B;  3I4G A;  2KBX A;  4F1S A;  3FTS A;  2OEV A;  3J5P A;  1HO8 A;  4GPK A;  4FC8 A;  2FO7 A;  3UIP C;  3ZXS A;  3CHQ A;  5KBA A;  2XPI A;  4PUC A;  3Q5M A;  3IHV A;  4U8Y D;  3O4Z A;  4J8D A;  5FJY A;  3QC1 A;  4N2Q A;  5CCL A;  1N9A A;  2IFU A;  1OCZ E;  3PVL A;  4I1A A;  3G2T A;  4YND A;  4QQI A;  5HQ8 A;  2OEW A;  4LNU D;  1N11 A;  3RAU A;  2XEN A;  4MKT A;  3U64 A;  5KWD A;  5J08 A;  4A55 A;  4LER A;  4HXI A;  3DRA A;  4A3T A;  3CHR A;  3ZPJ A;  4EZJ A;  4N3C A;  3ULQ A;  4B0Z A;  3D9H A;  4DX2 A;  4FAD A;  2X6I A;  3ML8 A;  3UT4 A;  1G3N B;  4G8K A;  3HXF A;  2A5U A;  4U0S A;  4ILG A;  4GA2 A;  5EX3 A;  4HVB A;  3AU4 A;  3JUE A;  3UKU G;  2H6H A;  2YIN A;  2I9C A;  3FH8 A;  3F6Q A;  3EIQ C;  3CKC A;  2IU1 A;  4ABN A;  2X38 A;  3ONL A;  2ZU6 B;  4YDW A;  5FQ7 A;  4GTT A;  3BEE A;  1TNU A;  4LRZ A;  3L22 A;  4B89 A;  2YHC A;  1UG3 A;  2XEE A;  1KLX A;  3RRM B;  4G24 A;  1HG2 A;  1K3Z D;  4E6H A;  1U3D A;  3B7B A;  4CGW A;  4J8E A;  4ILH B;  4UUC A;  2FI7 A;  4JVS A;  4GYY A;  3OXF A;  3GW4 A;  3CV0 A;  5HKP A;  1SVX A;  5BXO A;  1N0Q A;  3GZ1 A;  4V3I A;  3ABK E;  2XZD G;  3QWV A;  4GCO A;  1QQE A;  4DX5 D;  2F8Y A;  2XS1 A;  1DNP A;  3S7B A;  2OCC E;  4O6F A;  4HS2 A;  4CT4 A;  1IQU A;  2RG8 A;  3UM1 A;  4ANV A;  2LXM A;  5DBK A;  5LFA A;  2ZIS A;  3FUN A;  4Q96 A;  3GYZ A;  5ITZ F;  3CVX A;  1MYO A;  3FUH A;  3APC A;  4CRW A;  2NSZ A;  3BG0 B;  5BPP A;  2Y69 E;  5AN8 A;  4ANX A;  5AEN A;  3SBS A;  4DJA A;  2GRL A;  4HOU A;  1MX2 A;  1HZ4 A;  3DSX A;  3SNX A;  3LVR E;  2WVI A;  1TN7 A;  4UQX A;  5AQ9 A;  2VJ8 A;  5FQ4 A;  3RSE G;  3ZN3 A;  4J8Y A;  3AS4 A;  5JA4 D;  3L17 A;  3UIO C;  1S0P A;  3FUF A;  3PE3 A;  1N95 A;  4YDE A;  5E75 A;  3D9I A;  1OCC E;  2B0O E;  5G04 J;  2HYZ A;  4WWN A;  3ESK A;  1NZN A;  4OVV A;  1TEZ A;  4HLE A;  4F7A A;  3EHM A;  3Q47 B;  2KAT A;  3R7Q A;  2XGM A;  2Q7F A;  4Q94 A;  2FO1 E;  1E7V A;  5AAR A;  2VTB A;  3S7F A;  3SHF A;  4GYW A;  4CZ2 D;  2IJG X;  4NQ0 A;  3FU3 A;  2BUG A;  2H6I A;  2HR2 A;  5CEC B;  4DPR A;  3IV0 A;  1OWM A;  5EX0 A;  4GTM A;  1TYQ G;  2KCL A;  4PDX A;  5AIJ A;  3APF A;  3QWP A;  3UUX A;  2ETA A;  1IQR A;  2PQN A;  2A4Z A;  3MA5 A;  3S7D A;  3ENE A;  5D0O D;  3CVU A;  4HBD A;  2R17 C;  1WM5 A;  2R2L A;  3DSS A;  3UXG A;  1JWG A;  2LNI A;  3T8K A;  3FU0 A;  3LY8 A;  1N4R A;  2XPY A;  1Z6T A;  1BLX B;  2MRI A;  4KVO A;  3TWW A;  1WG0 A;  4P29 A;  1H19 A;  2R05 A;  3UPV A;  4GTQ A;  3ABM E;  4XI0 A;  1X81 A;  4ANW A;  3URZ A;  1LD7 A;  4GZC A;  3EU9 A;  3FHE A;  3AG3 E;  4D10 C;  2WMN A;  2NC9 A;  2VTB B;  4ACL A;  3R9M A;  1BD8 A;  4WND A;  4Z68 A;  1DVP A;  2DBA A;  5C1D A;  2VGY A;  4L2Y A;  3D9N A;  4BSX A;  1HE8 A;  3FFL A;  2WXH A;  3V2O A;  1SA5 A;  4NUR A;  5BUZ A;  4DX6 D;  3PEV B;  3TWS A;  1Q2Z A;  5A6C A;  1RZ4 A;  4BEP A;  2GRO B;  4KBQ A;  2HM8 A;  4Q69 A;  1KPS B;  3E30 A;  2E0I A;  2L0I A;  3D9K A;  3C3Q A;  2AW6 A;  4I9C A;  3QAQ A;  2XEV A;  3PZ1 A;  4CGV A;  2XPZ A;  3T9K A;  3CVY A;  5EYL A;  4I43 A;  3CIA A;  1ZB1 A;  3C3R A;  3Q49 B;  4U04 A;  5EIL A;  4XZ4 A;  3FUE A;  3ZRH A;  5D66 A;  1N54 A;  2QZA A;  1W3B A;  3TJP A;  3ZNG A;  2BKK B;  3UKR G;  1H6O A;  3DST A;  3SFX A;  3S7J A;  4N3A A;  3PE4 A;  5EDS A;  1XNF A;  4IN3 B;  4KMO A;  3FP3 A;  2F0Y A;  3OXL A;  3MV2 B;  5ENQ D;  1UN8 A;  3G2S A;  5HRY A;  3RRU A;  2WXO A;  3MV3 B;  4FJZ A;  1Y8M A;  1WAO 1;  2P9L G;  4GZ5 A;  1OUV A;  1K8K G;  3LXU X;  3TWT A;  3DEO A;  4DX1 A;  4BT8 A;  3IBE A;  3ASN E;  5FQ6 A;  4LCT A;  3CLJ A;  4UWG A;  3PUK A;  2WXN A;  3LY9 A;  3FU5 A;  4B94 A;  5KJM A;  3FU6 A;  3KSQ A;  3V30 A;  4PH4 B;  3FTW A;  4GML A;  2ILR A;  5LP0 A;  3NAW A;  4I9E A;  1UW4 B;  3TWV A;  4PS8 A;  2FBN A;  3D9J A;  2KZT A;  2GW1 A;  2I1J A;  4TRQ A;  3CST A;  3DPY A;  5FZQ A;  2KCV A;  1SQM A;  3FTY A;  2WPV A;  1OWO A;  3IHY A;  3UTM A;  4KT6 B;  2X6K A;  1S63 A;  2WXF A;  3HYM B;  3CVW A;  3CR3 A;  4NAC A;  1DCE A;  1IHB A;  3U3W A;  4Y6W A;  2WMO A;  4UWL A;  3BQO A;  2L6J A;  4A1G A;  2IO2 C;  2IOL A;  2P9U G;  3CHP A;  3TG4 A;  2KC7 A;  4TXR A;  3JYS A;  5CBO A;  2QYU A;  3IKO B;  4YDO A;  3MEK A;  2WB2 A;  3JQ1 A;  3D9P A;  1OCR E;  4U95 D;  3JXI A;  4K03 A;  3CVP A;  5G55 A;  4UWF A;  4N5C A;  4I2W A;  3LJ3 A;  1UOH A;  2VGX B;  4F53 A;  5AAO A;  1SW6 A;  4BET A;  5BNW A;  4DX7 D;  5EIB E;  5LCW C;  3RO2 A;  2CHX A;  5T4Y A;  4ZHB A;  4ACK A;  2BED A;  2QYJ A;  3IEG A;  2IOS A;  4OAV B;  4BWR A;  3MJW A;  3L54 A;  2KZT B;  1EYH A;  5EYP F;  3AJI A;  3UI2 A;  4YDY A;  1JPL A;  1BU9 A;  3TWR A;  4I17 A;  2DWZ A;  3QWW A;  1Z5S C;  1JWF A;  3FTV A;  4O1O A;  4G25 A;  1KZP A;  2EIL E;  3HVE B;  4UQZ A;  1Y6I A;  5FZR A;  3FTZ A;  2WQ6 A;  4AIF A;  5B1B E;  4GA1 A;  4LEU A;  4JC8 A;  1B89 A;  3LCA A;  2J09 A;  3PZD A;  4RQI A;  4GCN A;  1N4Q A;  1DC2 A;  2P9I G;  2XEH A;  3U4T A;  4I1O B;  2FUL A;  4XI9 A;  3Q73 A;  4N2S A;  5JMN D;  3AU5 A;  4H7X A;  5B1A E;  2XHE A;  5JJT A;  4JHK A;  2GRQ B;  1E8W A;  3PRZ A;  3DEP A;  3R7R A;  1INZ A;  1TNB A;  2B6C A;  3UM0 A;  3FTU A;  2LSU A;  2XRZ A;  2H6G A;  4TUM A;  4RLY A;  3K9I A;  1SZA A;  5D2M C;  4DLO A;  3RKV A;  5ARF A;  1N4S A;  1TR4 A;  3D3M A;  4C48 B;  1RW2 A;  2JEK A;  3G2U A;  4R7L A;  1K1B A;  3GZS A;  4YVO A;  3QK0 A;  4BSZ B;  2YQ8 A;  1O1S A;  2Y4U A;  4AM9 A;  3TXN A;  5CED B;  3HRA A;  1HH8 A;  2WXG A;  2P9K G;  3E33 A;  3DSW A;  1D8E A;  4JA9 A;  1D9S A;  5EKQ D;  5BV1 A;  5CEA A;  1N52 A;  4JD2 G;  5T3R A;  2EIJ E;  2J49 A;  1D8D A;  2ZGG A;  3P1U A;  4FP7 A;  4IUL A;  2GRP B;  4GTV A;  4CT0 A;  1NP7 A;  4F3V A;  4EBA G;  1WDY A;  5CER B;  1V54 E;  1FT1 A;  3NOC D;  4MRU A;  1TNZ A;  3SI5 A;  3TGO A;  2OVB A;  1QYM A;  5HS0 A;  1OCO E;  1MX6 A;  1OWP A;  3TWQ A;  4J8S A;  1H0A A;  4HRM B;  5AJD A;  3V79 K;  2KXP C;  3B13 A;  5M72 A;  4UQY A;  2WXL A;  4BX9 A;  2CG3 A;  3GZ2 A;  2DYS E;  4QFV A;  3ZVV A;  3ML9 A;  5ENT D;  2CHZ A;  2V5F A;  2EIN E;  1KZO A;  3ZXP A;  5ENP D;  3W9G A;  2VSN A;  2X3M A;  1EPU A;  2WXK A;  5EN5 D;  3L13 A;  4L1B A;  5H7P A;  2J08 A;  4UI9 C;  2R5S A;  2J4D A;  3SZ7 A;  5FIN A;  2XRY A;  4N5Q A;  3HDX A;  2P2C P;  3EDT B;  3OXG A;  2NYJ A;  3CGH A;  2KCK A;  4FHK A;  5ARG A;  2V4H C;  2QFC A;  4RG9 A;  4TUU A;  3DXK G;  2GGF A;  4U0Z A;  3LS8 A;  2X6J A;  1TN8 A;  3AAA C;  4O60 A;  3FUD A;  3CEQ A;  2RFA A;  3ZYM A;  2ZGD A;  3JQ0 A;  1FCH A;  3MZL B;  2HO1 A;  4BTA A;  1SZ9 A;  4XIF A;  4GTS A;  3ZFW A;  4C0E A;  3T5V A;  3NB2 A;  4CYM D;  4IRU A;  3E34 A;  4O1P A;  2CG2 A;  3HXB A;  3FDH A;  2AJA A;  1PY1 A;  2IY0 C;  2FF4 A;  1HX8 A;  3QB2 A;  1MX4 A;  4GMJ A;  4UWH A;  4JL0 A;  3Q79 A;  4JPS A;  1LTX A;  4JHJ A;  2P9N G;  1TN6 A;  3ULY A;  4GTP A;  5A7D B;  3CK7 A;  3AG4 E;  4GTO A;  4RVB A;  3CKB A;  3LDZ A;  3KS2 A;  4TXP A;  3AG2 E;  4XKC A;  3D9L A;  5LCW J;  4L23 A;  4DK5 A;  4K5C A;  4GA0 A;  2MHK A;  3LY7 A;  3PZ4 A;  3V2X A;  2PQR A;  3SY2 A;  3PNT B;  4CEM A;  4L2L A;  2C0M A;  4AY5 A;  3ULE G;  3PH0 C;  3R9A B;  3PUJ A;  2IO3 C;  3X2Q E;  3FUI A;  2L0T B;  1OY3 D;  4FLB A;  1S64 A;  3UT7 A;  5T8I A;  4F6R D;  2UY1 A;  3KEZ A;  4J8F A;  1QBQ A;  2OV8 A;  3SGH A;  3LVQ E;  2DYR E;  4HOR A;  3EJN A;  3CVL A;  4WWO A;  2RKK A;  2VSO E;  1NL4 A;  4GYO A;  4APO A;  2WXR A;  5CMW A;  4A63 B;  4XKB A;  2M63 A;  2OVF A;  4HB5 A;  1UJJ A;  4AVX A;  3DBS A;  3DXM G;  1YMP A;  5ANR A;  1O5M A;  4U0U A;  3CVN A;  3FH5 A;  2WQ7 A;  4I1M A;  4TXQ A;  2WXJ A;  2NXP A;  1UN9 A;  3ISM C;  1JUQ A;  3B7S A;  3B7U X;  4AV7 A;  3TXM A;  3PDN A;  2PM6 A;  3ASF A;  2EIM E;  4I2Z A;  3LJN A;  3UT8 A;  3ZW3 A;  3ZEF A;  5KJL A;  4WUY A;  4AOF A;  3EHN A;  3VLE A;  1OWN A;  4OYS A;  3WXX A;  3FEY A;  1HG5 A;  1PC2 A;  1LD8 A;  5ANL A;  4FU3 A;  1Z3X A;  4AP2 A;  1H2U A;  1LF8 A;  4HQD A;  4UWK A;  5JJ6 A;  2AXU A;  5E76 A;  3MKR A;  4C9B B;  4HLL A;  2CHW A;  3N71 A;  4G8L A;  3QDN A;  1E7U A;  4JEU A;  3E4B A;  3APD A;  2UY1 B;  2XS8 A;  4HRL A;  4AXH A;  3P2B A;  2HE0 A;  4J7W A;  3MYV A;  3J5Q B;  4BER A;  3VTY A;  4CDR A;  4A3V A;  4IYP A;  5CRU A;  4EHM A;  4ANU A;  5ENO D;  4E85 A;  1S70 B;  3WG7 E;  3V31 A;  3B7R L;  1ELR A;  4LNB A;  3LPZ A;  5KCM A;  3LYA A;  3W9F A;  4F1P A;  3BG1 B;  4XX5 A;  3CK8 A;  2R03 A;  2LAI A;  1NI1 A;  2H6F A;  4JXT A;  2VYI A;  3B7T A;  3HHM A;  1A17 A;  4ZFH A;  3ZIM A;  3I4R B;  3QJZ A;  5AJL A;  1OT8 A;  3FUJ A;  4XEI G;  1MHQ A;  2VSX E;  3CVQ A;  5FWQ A;  2WXM A;  3D9O A;  2VSY A;  3FY4 A;  4G1T A;  5KJK A;  4PS3 A;  3SFY A;  1TNO A;  3E37 A;  4CDM A;  3EHR A;  1XGW A;  2J9Q A;  5LX8 A;  4XE0 A;  4UI9 J;  5EID A;  1OXJ A;  1MQS A;  1EF1 C;  3AS8 A;  2V4L A;  3FTX A;  3S2A A;  5KJN A;  3UMV A;  4APF A;  2A5E A;  3UM3 A;  1X5B A;  2AXV A;  1FPP A;  1E8Y A;  3Q9U C;  4OVU A;  4G26 A;  2MYO A;  3PNL B;  2WXP A;  1N0R A;  4WNG A;  5A23 A;  2WM9 A;  4HI8 A;  5G05 J;  4I6E A;  5IY5 E;  2PM7 A;  2OOE A;  3UIN C;  3EIJ A;  5FIO A;  3C98 A;  3Q75 A;  3G2W A;  1U2V G;  2QY7 A;  2DIW A;  2YHE A;  4G2V A;  3RK6 A;  2BKG A;  2LUH A;  3PZ3 A;  3Q7F A;  2XCC A;  3U66 A;  4J6I A;  2FEZ A;  4EEC A;  1VDY A;  2VQ2 A;  3FH7 A;  3RU0 A;  2Y3A A;  1N4P A;  1N94 A;  4KXK B;  1OWL A;  3NF1 A;  4EPZ A;  4NRH B;  4WNF A;  1IKN D;  4HNA D;  3VLF A;  3L9T A;  5ENS D;  1L5J A;  2ZIR A;  4B93 B;  4EBA A;  2MOW A;  4MLP A;  4BY6 A;  5BW8 C;  2F37 A;  3ZHE A;  3MGB A;  2Y4T A;  2V5Q C;  5DIZ A;  4AY6 A;  1O1R A;  4L9P A;  4KVM A;  5JJ7 A;  1O1T A;  4WNE A;  2CFU A;  3SF4 A;  3BU8 A;  4BFR A;  2Y1L E;  4GTR A;  4G11 A;  4JW1 A;  2E2E A;  2QC9 A;  3T5X A;  5CRV A;  2DVW A;  1H6K A;  4U07 A;  3JXJ A;  4DUI A;  4FUL A;  3TWX A;  1TNY A;  3QOU A;  1H2T C;  4FHJ A;  3CQC B;  1FVH A;  1A5E A;  3EHQ A;  3CHS A;  5FZS A;  2AXZ A;  3DWL G;  3HXC A;  4ATG A;  5JHB A;  2XGO A; 
#chains in the Genus database with same CATH homology
 3JUI A;  3I5P A;  4IRU A;  2V0P A;  1IHG A;  4BX8 A;  2CG2 A;  3S7J A;  4N3A A;  2EQX A;  3FDH A;  3PE4 A;  5EDS A;  3MX3 A;  3OTN A;  1BPO A;  1PY1 A;  1XNF A;  3I4G A;  3CHO A;  4IN3 B;  4KMO A;  4F1S A;  3HIZ A;  3FP3 A;  3FTS A;  2FF4 A;  4FLH A;  1HX8 A;  3OXL A;  4JA7 A;  1P5Q A;  3QB2 A;  2I2O A;  1HO8 A;  1QNF A;  3MV2 B;  1UN8 A;  4GPK A;  4FC8 A;  4GMJ A;  2FO7 A;  2L9B A;  4UWH A;  3G2S A;  1TJF A;  3FUK A;  4JL0 A;  3TAX A;  2LSV A;  3ZGQ A;  3ZXS A;  3LEW A;  3ONK A;  3CHQ A;  3RRU A;  2WXO A;  4HOQ A;  4W9R A;  4JPS A;  3ESL A;  3MV3 B;  2XPI A;  4PUC A;  2J07 A;  3Q5M A;  4FJZ A;  1Y8M A;  4GAA A;  3IHV A;  4U8H A;  4CDN A;  3KAE A;  1WAO 1;  3O4Z A;  4J8D A;  4JHJ A;  4MS6 A;  4GZ5 A;  5FJY A;  3NQP A;  3QC1 A;  1OUV A;  4N2Q A;  5CCL A;  3ZHE B;  1EDU A;  2IFU A;  1HXI A;  3LXU X;  3PVL A;  4I1A A;  3G2T A;  4YND A;  4J0U A;  5HQ8 A;  5A7D B;  3CHM A;  3CK7 A;  1H2V C;  4RVB A;  3CKB A;  4BT8 A;  3LDZ A;  4ME2 A;  3KS2 A;  4Y6C A;  3IBE A;  4AJW A;  4XKC A;  5FQ6 A;  4MKT A;  3D9L A;  4LCT A;  3U64 A;  3CLJ A;  2BF0 X;  1IYG A;  5LCW J;  4L23 A;  5J08 A;  4DK5 A;  4UWG A;  4A55 A;  3PUK A;  4HXI A;  4LER A;  4GA0 A;  2MHK A;  5FQ8 A;  2WXN A;  4A3T A;  3CHR A;  3LY9 A;  3ZPJ A;  3LY7 A;  4EZJ A;  4N3C A;  3ULQ A;  2PQR A;  3FU5 A;  4B0Z A;  4B94 A;  5KJM A;  4FAD A;  3PNT B;  2X6I A;  3FU6 A;  3ML8 A;  4JEH A;  3UT4 A;  2C2L A;  3ASD A;  4DLQ A;  4CEM A;  4L2L A;  4PH4 B;  3FTW A;  2C0M A;  4AY5 A;  4GB9 A;  3PH0 C;  3R9A B;  4DI4 A;  2A5U A;  2ILR A;  4GML A;  4U0S A;  4PS7 A;  4ILG A;  5C2Y A;  5LP0 A;  3PUJ A;  3FUI A;  4I9E A;  1UW4 B;  4GA2 A;  2L0T B;  5EX3 A;  4PS8 A;  4HVB A;  1E96 B;  3AU4 A;  4FLB A;  2FBN A;  3D9J A;  3AS5 A;  2KZT A;  3UT7 A;  2GW1 A;  4HFG A;  2I1J A;  4TRQ A;  5T8I A;  2YIN A;  3SBT B;  2I9C A;  2UY1 A;  3FWV A;  3CST A;  3KEZ A;  3FH8 A;  5FZQ A;  4J8F A;  3SGH A;  2OV8 A;  3EIQ C;  4HOS A;  3CKC A;  2KCV A;  2WXQ A;  1SQM A;  3LVQ E;  3VLD A;  2IU1 A;  4ABN A;  3FTY A;  2WPV A;  2X38 A;  1OWO A;  3IHY A;  3EJN A;  3CVL A;  3ONL A;  4KT6 B;  4WWO A;  4HOR A;  2X6K A;  4EZL A;  2VSO E;  2ZU6 B;  5FQ7 A;  2WXF A;  3ASH A;  3HYM B;  3BEE A;  3CVW A;  3CR3 A;  4NAC A;  4N39 A;  4GYO A;  4APO A;  2WXR A;  1HS6 A;  5CMW A;  4LRZ A;  3L22 A;  4B89 A;  5D0Q D;  2YHC A;  3U3W A;  4Y6W A;  2WMO A;  1UG3 A;  4XKB A;  3MKQ A;  4UWL A;  3PRE A;  4FJY A;  1KLX A;  2M63 A;  2OVF A;  3RRN B;  2L6J A;  2X6H A;  3RRM B;  4G24 A;  4A1G A;  1HG2 A;  1UJJ A;  4AVX A;  5G05 C;  3DBS A;  2C0L A;  4E6H A;  1ZU2 A;  2IOL A;  1U3D A;  3RJV A;  4CGW A;  3CHP A;  5ANR A;  4U0U A;  4J8E A;  2KC7 A;  3TG4 A;  3O48 A;  4B8A A;  3JYS A;  3CVN A;  4ILH B;  4I6G A;  2FI7 A;  4JVS A;  3IKO B;  4GYY A;  3OXF A;  3PS6 A;  3ZYL A;  3GW4 A;  3MEK A;  3CV0 A;  3FH5 A;  2WB2 A;  2WQ7 A;  3JQ1 A;  4I1M A;  3D9P A;  4K03 A;  2WXJ A;  3L6A A;  2NXP A;  1UN9 A;  2WXI A;  3CVP A;  3GZ1 A;  3RO3 A;  1JUQ A;  2I1K A;  1UJK A;  3B7S A;  4V3I A;  4UWF A;  5G55 A;  5LOZ A;  3B7U X;  3ZYK A;  4AV7 A;  3TXM A;  3QWV A;  4GCO A;  4N5C A;  1QQE A;  3PDN A;  1DNP A;  2PM6 A;  4I2W A;  3ASF A;  3S7B A;  4I2Z A;  4O6F A;  4HS2 A;  3UT8 A;  4G23 A;  3ZW3 A;  3LJ3 A;  3ZEF A;  5KJL A;  2VGX B;  4N3B A;  4WUY A;  4AOF A;  4F53 A;  3EHN A;  3UX4 A;  4CT4 A;  3VLE A;  1OWN A;  5BNW A;  3Q15 A;  1IQU A;  4OYS A;  4UI9 K;  3WXX A;  2RG8 A;  3FEY A;  4ANV A;  5DBK A;  5LCW C;  3RO2 A;  5LFA A;  1HG5 A;  3FUN A;  1PC2 A;  4Q96 A;  2CHX A;  5ANL A;  5T4Y A;  2BTD A;  4ACK A;  4FU3 A;  1Z3X A;  3TG5 A;  3GYZ A;  4AP2 A;  2J4B A;  1H2U A;  1LF8 A;  1ELK A;  1E8Z A;  4UWK A;  5JJ6 A;  2AXU A;  3CVX A;  5E76 A;  3MKR A;  3FUH A;  3IEG A;  4C9B B;  2IOS A;  3APC A;  2CHW A;  4BWR A;  3MJW A;  3N71 A;  5FTP A;  4CRW A;  3L54 A;  1E7U A;  1EYH A;  2KZT B;  3QDN A;  4JEU A;  3E4B A;  2NSZ A;  1JPL A;  4L7T A;  3BG0 B;  3APD A;  3QNK A;  2UY1 B;  2UWJ G;  5BPP A;  4I17 A;  3P2B A;  4AXH A;  1GW6 A;  3NZS A;  3QWW A;  1QZ2 A;  3LKU A;  3KD7 A;  1JWF A;  3FTV A;  4ANX A;  5AEN A;  3U9W A;  4G25 A;  3SBS A;  4DJA A;  2GRL A;  4HOU A;  3MYV A;  3VTY A;  3HVE B;  4CDR A;  1HZ4 A;  4A3V A;  4K0R A;  4UQZ A;  3SNX A;  1Y6I A;  2XGS A;  5FZR A;  4LUN U;  3LVR E;  1HU3 A;  2WVI A;  3FTZ A;  4IYP A;  4A1S A;  2WQ6 A;  4UQX A;  4AIF A;  4ANU A;  3MKQ B;  4GA1 A;  4E85 A;  2VJ8 A;  5FQ4 A;  1TJC A;  4LEU A;  4JC8 A;  3ZN3 A;  4I6J A;  3AS4 A;  1B89 A;  2CFZ A;  3B7R L;  3L17 A;  1ELR A;  3JCK C;  2J09 A;  3LCA A;  1S0P A;  3PZD A;  3FUF A;  3LPZ A;  3CQG B;  3PE3 A;  5G2N A;  5KCM A;  5JHA A;  3LYA A;  4GCN A;  3SFZ A;  3BG1 B;  4XX5 A;  5E75 A;  3D9I A;  3U4T A;  3CK8 A;  2FUL A;  4I1O B;  4XI9 A;  2LAI A;  3FEX A;  4N2S A;  5G04 J;  2HYZ A;  4BTB A;  3AU5 A;  4WWN A;  4JXT A;  2VYI A;  4H7X A;  3FUM A;  3B7T A;  1KT0 A;  3ESK A;  1A17 A;  1NZN A;  3HHM A;  4OVV A;  2XHE A;  5JJT A;  4KZC A;  4ILI A;  3ZIM A;  3I4R B;  3QJZ A;  5AJL A;  1TEZ A;  4HLE A;  3I3N A;  3FUJ A;  4JHK A;  1MHQ A;  4F7A A;  3EHM A;  2VSX E;  1E8W A;  3CVQ A;  2KAT A;  3Q47 B;  3PRZ A;  5FWQ A;  2WXM A;  3R7Q A;  4WWP A;  2XGM A;  5ENN A;  3D9O A;  3R7R A;  1INZ A;  2Q7F A;  2VSY A;  3FY4 A;  2XQ0 A;  4Q94 A;  3FTU A;  1E7V A;  2LSU A;  4G1T A;  2XRZ A;  5KJK A;  4PS3 A;  4HOT A;  2VTB A;  2IF4 A;  3K9I A;  1SZA A;  4CDM A;  3S7F A;  2R59 A;  5HI7 A;  3ASG A;  3SHF A;  4GYW A;  1XGW A;  4DLO A;  4JHR A;  1PAQ A;  2IJG X;  4NQ0 A;  2J9Q A;  5LX8 A;  2AVP A;  3L16 A;  3OAW A;  3RKV A;  3FU3 A;  4URK A;  4XE0 A;  2BUG A;  4UI9 J;  5ARF A;  2HR2 A;  3CSF A;  1NA3 A;  3L08 A;  4DPR A;  3IV0 A;  3D3M A;  5AYW D;  2JEK A;  1OWM A;  3G2U A;  5EX0 A;  4R7L A;  5BT1 A;  4DI3 A;  1MQS A;  3GZS A;  4YVO A;  3QK0 A;  4FA6 A;  1EF1 C;  4GU5 A;  2YQ8 A;  4GZ6 A;  3AS8 A;  2V4L A;  2Y4U A;  4H7Y A;  3FTX A;  2KCL A;  4AM9 A;  3S2A A;  5KJN A;  1WY6 A;  3UMV A;  1NA0 A;  4APF A;  3TXN A;  2V8S E;  4PDX A;  5AIJ A;  3APF A;  3QWP A;  3UUX A;  1IQR A;  1X5B A;  1HH8 A;  2PQN A;  2AXV A;  2WXG A;  5CHE E;  1ZBP A;  1E8Y A;  2A4Z A;  3MA5 A;  4JZY A;  4OVU A;  4G26 A;  2ION A;  3S7D A;  3ENE A;  4CCA A;  5D0O D;  5J90 A;  3CVU A;  4JA9 A;  2R17 C;  1WM5 A;  2RD0 A;  2WXP A;  3PNL B;  4KZ0 A;  4WNG A;  5A23 A;  2WM9 A;  2I6H A;  5BV0 A;  5G05 J;  4I6E A;  5CCM A;  5EKQ D;  3FUL A;  5BV1 A;  2PM7 A;  2OOE A;  1N52 A;  4YVQ C;  3CK9 A;  1JWG A;  3EIJ A;  2LNI A;  3C98 A;  3G2W A;  2QY7 A;  5T3R A;  3FU0 A;  2J49 A;  3LY8 A;  2DIW A;  1E8X A;  2YHE A;  3P1U A;  4FP7 A;  2XPY A;  2P58 C;  4IUL A;  1Z6T A;  4G2V A;  3RK6 A;  2MRI A;  4CT0 A;  4KVO A;  3D9M A;  1E90 A;  1NP7 A;  4P29 A;  4BT9 A;  4GZD A;  4F3V A;  1H19 A;  2XCC A;  4EBA G;  4AEZ C;  3U66 A;  4M3O A;  4B8C B;  3UPV A;  4J6I A;  2FEZ A;  4EEC A;  1VDY A;  2VQ2 A;  3FH7 A;  4XI0 A;  3RU0 A;  1HF8 A;  4MRU A;  2Y3A A;  4ANW A;  3SI5 A;  3TGO A;  3URZ A;  2OVB A;  2AWI A;  4GZC A;  4KXK B;  3FHE A;  4D10 C;  1OWL A;  2WMN A;  5G04 C;  3NF1 A;  3RIB A;  4WAF A;  1OWP A;  4J8S A;  1H0A A;  1YA0 A;  5AJD A;  4EPZ A;  4NRH B;  2NC9 A;  3Q4A B;  4WNF A;  3B13 A;  3DPD A;  5M72 A;  2VTB B;  2VGX A;  4UQY A;  3VLF A;  4ACL A;  2WXL A;  4BX9 A;  2CG3 A;  4WND A;  1DVP A;  2DBA A;  5C1D A;  3GZ2 A;  3ZVV A;  2VGY A;  4L2Y A;  4QFV A;  4C0M A;  3ML9 A;  3QAR A;  3D9N A;  2CHZ A;  2V5F A;  1L5J A;  3QKY A;  4EBA A;  2MOW A;  1Z3Y A;  2IQC A;  4MLP A;  4BSX A;  2VSN A;  2X3M A;  1EPU A;  2WXK A;  1HE8 A;  2YNQ A;  2WXH A;  3FFL A;  2DCP A;  3UQ3 A;  4BY6 A;  5BW8 C;  3VTX A;  3ZHE A;  3MGB A;  2Y4T A;  4NUR A;  3L13 A;  4L1B A;  3PEV B;  5DIZ A;  5BUZ A;  4AY6 A;  4KYO B;  4RSY A;  1ELW A;  5A6C A;  2J08 A;  4UI9 C;  2KM4 A;  2R5S A;  2J4D A;  2JLB A;  4TV3 A;  3SZ7 A;  2XRY A;  4KVM A;  5JJ7 A;  4KBQ A;  3NZU A;  3HDX A;  2HM8 A;  2CFU A;  4WNE A;  4Q69 A;  3SD5 A;  3EDT B;  3SF4 A;  2E0I A;  3OXG A;  2L0I A;  4GZ3 A;  3D9K A;  4BFR A;  2AW6 A;  3CGH A;  3G2V A;  4G11 A;  4I9C A;  2X6F A;  4JW1 A;  3QAQ A;  2E2E A;  3CVV A;  2XEV A;  2KCK A;  4FHK A;  3T5X A;  5CMY A;  5ARG A;  5FT9 A;  2QFC A;  4RG9 A;  4TUU A;  1H6K A;  2XPZ A;  2GGF A;  2LAH A;  4U07 A;  4CGV A;  3CVY A;  1U3C A;  4U0Z A;  4I43 A;  3CIA A;  3LS8 A;  3HVE A;  2XCB A;  2GRM A;  2OND A;  2X6J A;  4FUL A;  4EZK A;  3Q49 B;  1KT1 A;  4U04 A;  2WQH A;  4XZ4 A;  3QOU A;  3MCX A;  1H2T C;  3FUD A;  4RG6 A;  3TL5 A;  4FHJ A;  1FVF A;  3CEQ A;  3FUE A;  3CQC B;  3ZRH A;  1FVH A;  2LO6 A;  4U63 A;  3ZYQ A;  1N54 A;  3CHS A;  2PZI A;  3ZYM A;  1W3B A;  1FCH A;  3JQ0 A;  4EQF A;  5FZS A;  3MZL B;  2HO1 A;  3TJP A;  2AXZ A;  2PL2 A;  4BTA A;  1SZ9 A;  3PEU B;  4XIF A;  3ZFW A;  4ATG A;  5JHB A;  2XGO A;  4C0E A;  3T8M A;  3T5V A;  1HFA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...