3Q7AA

Cryptococcus neoformans protein farnesyltransferase in complex with fpp and l-778,123
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
330
structure length
315
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase/transferase inhibitor
total genus 131
structure length 315
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q7aA00
3PZ2A 1SA5A 2ZISA 1O5MA 3Q79A 4GTQA 3DSXA 1TNZA 3Q75A 1JCQA 4YDOA 4LNBA 2H6HA 1N4PA 1TN7A 2R2LA 2ZIRA 2F0YA 4YDEA 4GTMA 3DSVA 1TNOA 1N4RA 3E34A 3E37A 3Q7AA 1MZCA 1FT2A 3HXBA 1O1TA 3DSTA 3HXCA 1LTXA 2H6IA 1S63A 3EUVA 3Q78A 1DCEA 3KSQA 2BEDA 4GTRA 1FT1A 2IEJA 4EHMA 1NL4A 3PZ3A 2H6GA 2H6FA 1KZPA 1KZOA 4LNGA 3PZ4A 1TN8A 1N9AA 3Q7FA 1FPPA 4GTVA 1D8EA 1O1RA 3KSLA 1TN6A 1JCRA 4L9PA 1NI1A 1O1SA 1X81A 3DRAA 1JCSA 3DSUA 3HXFA 1LD8A 1TNBA 3E33A 3SFYA 1N94A 1TNYA 4GTSA 4MBGA 1N95A 3E32A 4GTOA 3HXEA 3DSWA 3SFXA 3E30A 4GTTA 3Q73A 1QBQA 3DSSA 1TNUA 1LD7A 3HXDA 1SA4A 3PZ1A 3EU5A 1S64A 4GTPA 1N4QA 1N4SA 1D8DA 3DPYA 3C72A
chains in the Genus database with same CATH superfamily
2ETAA 3K9IA 1OWOA 4D10C 3B13A 2PM6A 4B93B 3B7BA 3G2SA 3OAWA 1NFIE 4CT0A 3MZLB 3B7RL 3E34A 3TJPA 3Q7AA 1G3NB 4FJYA 3ASGA 3V2OA 2DYSE 2VTBA 2LAHA 4AVXA 3IKOB 2WXJA 2I1JA 1FT1A 1GW6A 4L2LA 1Z6TA 4G25A 4XKCA 1H19A 3CVPA 4LNGA 3CVYA 2XRZA 5EN5D 4LSZE 4R7LA 1N9AA 2V5FA 3T8KA 4GMRA 3AU5A 3L6AA 3HG0D 2VSYA 5LP0A 5FIOA 3LJNA 5BPPA 3E33A 3F6QA 2AWIA 5AENA 3U64A 3PE4A 1MX6A 4BY6A 2J09A 3ABME 3APFA 1SW6A 1SQMA 3U3WA 4PS3A 5ENSD 3C5RA 2WXMA 4MLPA 4FHJA 5D0OD 2WXLA 4UI9J 4GA1A 4JW1A 4WNEA 4URKA 4DUIA 3BQOA 4HOQA 1UG3A 1SA5A 4KT6B 4CZ2D 1H0AA 4N3AA 3ABKE 3D9HA 1NP7A 2RKKA 3JQ1A 4GPMA 5AQ7A 3Q9NC 2Y0BG 4J8EA 4U7EB 4A1SA 4WWPA 3SI5A 4Q96A 2KCKA 2AVPA 3D9MA 3LVRE 2KXPC 1IHBA 4BESA 3E37A 3HIZA 1PY1A 4I6JA 3Q9UC 2LSUA 2OV8A 2J49A 3RAUA 2JLBA 3PNTB 2QYJA 4U8HA 2LNIA 2XCBA 3CVWA 5FQ8A 4GMJA 5CEAA 2P58C 4GB9A 1N54A 1KZOA 4BSXA 3CK7A 2WXPA 1TEZA 4BX8A 3U9WA 5JA4D 4HRLA 4K03A 3AU4A 3FUDA 4BETA 2LUHA 1N94A 2EIJE 1MX2A 3FTYA 4C48B 3RJVA 4JHJA 4DPRA 4L7TA 4L1BA 1OWMA 3EIJA 3MV2B 3LVQE 3FU5A 2VGXA 2GRRB 4U0ZA 2CFUA 3TWQA 4X8QA 1V54E 2BKKB 1N4SA 3LPZA 4I2WA 1DNPA 2ONDA 4CCAA 2PL2A 5T8IA 4XX5A 4TV3A 2EILE 5M72A 2HR2A 2YHEA 3VLFA 2IF4A 2RFAA 3AG1E 2Y4TA 3ONLA 3J5PA 1E8WA 4J8DA 5C2YA 4LCTA 4AY6A 2WXGA 1TR4A 3U66A 3AS5A 4Q94A 3ASNE 5LCWC 3QOUA 2NXPA 3MA5A 3G2UA 4CEMA 3V2XA 1UN8A 4YVOA 3RU0A 3SF4A 3DPDA 3ESKA 2V0PA 1H2VC 3HDXA 4U04A 3VTXA 3FTXA 3EUVA 3Q78A 4WWOA 3X2QE 4I9CA 3EHMA 3QB2A 4A55A 5T4YA 3RO2A 4ATZD 1JWFA 3MCXA 4LNUD 2Q7FA 4E85A 2VQ2A 2Y1LE 2WXRA 4CRWA 2F8YA 3HYMB 4AP2A 4CGVA 3CVXA 1OCOE 3DRAA 4OAVB 1LD8A 3L9TA 3I5PA 2E2EA 2BTDA 4NACA 4J6IA 3NZSA 2RD0A 1XGWA 2ZGDA 2UWJG 5B3SE 2IO3C 3FUHA 4CDNA 4MS6A 1AWCB 4EQFA 3FTUA 4JHKA 2GRQB 1Q2ZA 1SVXA 3ZEFA 5J90A 4OVVA 5ENQD 2M63A 1N4QA 4FA6A 3WG7E 3TGOA 3CVUA 5G05J 1YCSB 2CHWA 2JABA 3LDZA 3Q79A 1E7VA 1KT1A 2NC9A 4G23A 4AM9A 2R03A 3CQGB 2XGMA 3FWVA 5AQ9A 4I1AA 4IRUA 2R59A 4GTMA 4ABNA 1ELKA 3JXJA 2J4DA 1U2VG 3DSTA 2P9IG 5AIJA 2J07A 3ZHEA 3PNLB 3T8MA 3G2WA 1IYGA 4GTRA 2QY7A 4PS7A 4ANVA 1DVPA 4G26A 2YNQA 5JJ6A 3L82A 3CK9A 2Y4UA 4RVBA 3VTYA 3PZ4A 3Q47B 2V5QC 2IQCA 2FEZA 2WMNA 3T5VA 5CBNA 1JWGA 1JCRA 3ABLE 5J08A 3CR3A 3UINC 3UKRG 3UI2A 2X6HA 2J9QA 2LO6A 2XEEA 4J0UA 5KNGA 1K3ZD 3E30A 4F6RD 3CHQA 4N2QA 4KMOA 2XENA 4WNFA 3TL5A 1X5BA 4CT4A 2NYJA 4J8FA 4LUNU 3QJZA 4H7YA 1Z5SC 1HU3A 2ETBA 4L2YA 2KM4A 4G2VA 3ZFWA 2XEVA 4XZ4A 3DPYA 4GA0A 5EIDA 2WVIA 3RIBA 5FZSA 1OT8A 3FUKA 3LJ3A 3ULQA 3CVNA 2A5UA 1TNZA 2DWZA 1E96B 2ILRA 4HOUA 1FCHA 3L13A 2F0YA 2A5EA 3NOCD 3DSVA 1N0RA 1N4RA 1E8XA 5BW8C 5G2NA 3CIAA 3LY9A 4FULA 4L23A 2H6FA 2P9LG 3EJNA 3ZN3A 4UI9K 4JD2G 3SO8A 4HS2A 2DZNA 2QZAA 5EX0A 3FDHA 2V4HC 5FT9A 4WNGA 4N3CA 3ASHA 5ENTD 3SHFA 4JPSA 4FADA 3NF1A 4C0EA 3GW4A 2VYIA 3CKBA 4C9BB 5HS0A 4WWNA 4DX5D 3DSSA 4N3BA 3FULA 4APFA 2Y3AA 3D3MA 5AARA 1OCZE 5BXUA 1E90A 3JXIA 5ITZF 5D66A 4O60A 3FEXA 3E4BA 3PUJA 2MOWA 2ZISA 1JUQA 2VSXE 3B95A 4TXRA 5FZQA 4PS8A 2IOSA 3TG4A 3TWVA 5CMWA 5JJTA 2LSVA 3CSFA 1OWPA 4LERA 3FU0A 2IJGX 3ASOE 3FFLA 5ENOD 5CRUA 2EIME 2DIWA 3D9PA 5FQ7A 4EZJA 2B0OE 2OEVA 3HXCA 1LTXA 1S63A 4U8YD 3CVVA 3PZDA 4V3IA 4JHRA 4LRZA 4RLYA 2CHZA 4BX9A 2GRPB 4U07A 2EQXA 4W9RA 2X6JA 1FPPA 3PRZA 1O1RA 2GRLA 3DWLG 4GPKA 3L54A 3D9LA 3ZUVB 1BU9A 3ZXSA 3QDNA 2VTBB 1WG0A 4QQIA 3FH5A 4GTOA 2IFUA 3SFXA 3SD5A 4A63B 2P9UG 3FTZA 3ONKA 5BV1A 1JPLA 4I1OB 4NRHB 4AEZC 3CKCA 5FQ4A 4N5CA 3C3RA 1WDYA 4B94A 1BI7B 4UI9C 5EDSA 2J08A 3R9AB 4E6HA 2DZOA 3QC1A 4XI0A 4DLQA 4ANUA 3RRMB 1FVFA 4NQ0A 3SNXA 1E8YA 4QFVA 3AAAC 3EHNA 4APOA 3KS2A 2LXLA 4LNBA 4ANWA 4BTAA 1OWLA 4Z68A 2ZGGA 1UJKA 2E0IA 1UOHA 2OEWA 4HB5A 5A7DB 2L6BA 2AW6A 2P2CP 3CHSA 5BNWA 2BEDA 2WM9A 3OXFA 2QFCA 4UQYA 4U0UA 1KZPA 3ZVVA 4ACKA 5FJYA 2LAIA 3D9KA 4XI9A 1KPSB 1PC2A 2DBAA 5A23A 4XE0A 3SBSA 4N2SA 2XS8A 5CBOA 4BT9A 1TNYA 3B7TA 2XGSA 3UKUG 4UWHA 1E8ZA 4ANXA 1U3CA 5EKQD 2VGYA 3IHVA 2XZDG 2I6HA 2ETCA 1HG5A 5FWQA 4UWLA 2NSZA 5AYWD 5JHBA 1EPUA 2V4LA 3ML8A 2VJ8A 2HO1A 5HQ8A 4DJAA 4YDOA 5FQ6A 1NA3A 3L08A 2H6HA 2XQ0A 3SQVA 2ZIRA 5EYPF 3S7FA 2KZTA 1TJCA 2VGXB 2UY1A 3FTVA 4UWKA 3ZNGA 4UUCA 2CHXA 4K5AB 3ZRHA 5CMYA 4YDYA 5FINA 2EIKE 2ZXWE 2AJAA 2PQRA 4Y6CA 4KYOB 1DCQA 4CYMD 5E75A 4DX2A 4ZFHA 2FO1E 4TXPA 2WPVA 1IHGA 1MYOA 3FUEA 5DBKA 3CHOA 2IONA 4G1TA 3TWWA 1X81A 4O6FA 3DXMG 3HXFA 1N0QA 1AP7A 1HXIA 2R5SA 5AAOA 3PVLA 3ZGQA 4DRXE 1KT0A 3QWVA 4ACLA 4BWRA 3TXMA 3JYSA 4UQXA 1YMPA 3ASFA 1QBQA 3SZ7A 3C3QA 1OCRE 2J8SD 3LY7A 3JCKC 5EX3A 5HKPA 4A3TA 2F8XK 4J8SA 3UM1A 3R9MA 4HORA 3UTMA 3BUAA 2QYUA 5G05C 1E7UA 4JEUA 4FLBA 3ENEA 2VSOE 4O1PA 3DSXA 3GYZA 1QQEA 4K5BA 5KCMA 5EILA 3LEWA 4GZ5A 3RRUA 3P1UA 1EYHA 1HH8A 5KNHD 2P9KG 4F7AA 4GYWA 4JZYA 3AG3E 1EF1C 1DCEA 3KSQA 4XKBA 4YNDA 2IEJA 2FI7A 2HE0A 2P9PG 3PEUB 4ILHB 4Y6WA 3IXEA 4HRMB 3NB2A 3QK0A 4RG9A 4GZCA 3ZYKA 5DIZA 3V31A 3PDNA 1B89A 2JEKA 4HRNA 2GRMA 2YHCA 5KBAA 2GROB 2WXFA 4DI4A 1HX8A 1QYMA 3OXGA 4DK5A 1W3BA 4GTSA 1WM5A 4GZDA 3AG2E 3BG1B 3ZHEB 1ZBPA 1WY6A 4N5QA 4GTTA 5B1BE 3Q73A 1NZNA 2EINE 4EBAG 1Z3XA 5ENRD 5CCLA 2IY0C 3EU5A 3MKQA 4GCNA 3ULEG 5JHAA 3ZYQA 3ESLA 4IULA 4JL0A 5AN8A 3R7RA 4FJZA 3OXLA 5AJLA 3AG4E 3ISMC 3FUIA 4ZHBA 5FTPA 3FEYA 4I17A 1TYQG 4U95D 4M3OA 2BKGA 3Q75A 5HRYA 5BV0A 1TN7A 2KBXA 4HQDA 4YDEA 3R7QA 1BI8B 1BD8A 2OVBA 3S7BA 4DX1A 3HXBA 4HOSA 4B0ZA 3IEGA 5B1AE 1N52A 3VLEA 1OUVA 4BEPA 3DXKG 4EHMA 3P2BA 3ZIMA 1D9SA 3FUMA 3QKYA 1S0PA 3B7SA 1HO8A 2V8SE 2XPZA 4I2ZA 2XCCA 2XS1A 3L16A 2KATA 1SZ9A 4K0RA 3IV0A 3U4TA 4GYOA 4GYYA 4TXQA 2GW1A 3CEQA 2AXUA 4DX6D 2Y69E 2R02A 1HE8A 3BU8A 2YINA 2WXQA 2WQHA 1YYHA 1UN9A 3KD7A 4NURA 3UQ3A 3BEEA 4GMLA 1BLXB 1LD7A 1SA4A 2WXKA 3ULYA 3UT8A 4AJWA 2WXIA 1H6OA 1PAQA 4HFGA 3AJIA 2VGEA 4J8YA 5H7PA 4HI8A 1JCQA 3C98A 4I6GA 3V30A 3CVLA 3FY4A 2L9BA 3MX3A 2C0MA 4UQZA 4BSZB 3D9NA 1A5EA 5ENPD 5A6CA 3D9IA 2AXZA 4FP7A 2WQ6A 3NQPA 4IYPA 1MX4A 2C0LA 4G11A 5D2MC 4J7WA 5G55A 4KBQA 5KJLA 3EHQA 3Q7FA 3J5QB 1Y8MA 4HOTA 3LS8A 3UIPC 1TN6A 1INZA 3APDA 1O1SA 3L17A 2X6IA 3UM3A 2MHKA 3DSUA 3CSTA 2FULA 3EHRA 1ZU2A 2IU1A 4YDWA 2DVWA 2WMOA 2CG2A 1H2TC 3FH8A 4JA7A 3SGHA 3FUJA 4B8AA 3OTNA 3AS4A 4JC8A 1D8DA 2CG3A 4MRUA 4AV7A 2KCLA 3PEVB 4KZCA 2XPYA 2PNNA 4DI3A 4C0MA 3FUFA 3QWWA 3JQ0A 4GTQA 2XPIA 3CQCB 1RW2A 4MKTA 4GA2A 2WB2A 1HZ4A 1TNOA 2WXNA 2F37A 3IHYA 5HI7A 4KZ0A 5LOZA 4BERA 3W9GA 1KLXA 4O1OA 3MJWA 3ZU7B 4GAAA 2R17C 4AXHA 5IY5E 2XZTG 2P9NG 3FP3A 4EPZA 3NZUA 4OAUC 3KEAA 5CECB 2PM7A 2HM8A 3CHRA 4IN3B 3MYVA 3PE3A 1Z3YA 4GTVA 2ZU6B 4AY5A 1OWNA 3CK8A 4GZ3A 3TXNA 3LXUX 2VSNA 3FU6A 3O4ZA 2FF4A 3MKRA 4G24A 3SFYA 1UW4B 3FTWA 5ARGA 5CRVA 1IQUA 3RO3A 2FO7A 4JEHA 4I1MA 4M7CA 3PS6A 3DBSA 4HLEA 3DSWA 3UT4A 3UT7A 3JUIA 3RKVA 3MEKA 3VLDA 4F3VA 1TNUA 3TWXA 4PDXA 1L5JA 4TUMA 4GTPA 3NOGD 2XRYA 3DEOA 1HF8A 1IQRA 1Y6IA 5G04C 1H6KA 3LCAA 2GRNB 1O5MA 2C2LA 3RSEG 2YQ8A 2IOLA 4G8LA 1FVHA 2AXVA 4WNDA 1V55E 3TAXA 5ANRA 3SY2A 1TJFA 4PH4B 1MZCA 3ASDA 4HXIA 1FT2A 2GGFA 3HHMA 3NBNB 2J4BA 2I1KA 5G04J 1K1BA 2CFZA 3GZ2A 5E76A 2I2OA 4U96D 2BUGA 4BT8A 1OCCE 3TWSA 5CCMA 3PZ3A 2H6GA 3UPVA 1HG2A 2WXHA 1HS6A 4EECA 4PUCA 4JXTA 3URZA 3O48A 4P29A 3WXXA 1K8KG 3Q15A 1YA0A 2X6KA 4L9PA 2KZTB 5KJKA 3LKUA 3I3NA 1TNBA 2UY1B 5ARFA 3QNKA 1VDYA 2IO2C 2XGOA 4A1GA 3HXEA 4Q69A 5KJNA 3MGBA 4FHKA 4HI9A 3FH7A 3KAEA 2WXOA 1K1AA 3CHMA 3QWPA 3TWRA 3ML9A 1ZB1A 2A4ZA 1MJ0A 4I43A 3PZ2A 4AIFA 3TWTA 1S70B 4RQIA 3TWUA 3ZYLA 2L0IA 3PREA 3UM2A 3DEPA 4HBDA 3HRAA 5LCWJ 1QNFA 5JMND 2PQNA 1NA0A 1QZ2A 1O1TA 3B7UX 2X38A 5EIBE 5BT1A 4EZLA 5EYLA 1NL4A 1OXJA 1IKND 3I4GA 2DCPA 5FZRA 3ZKJA 2PZIA 2RG8A 1U3DA 2BF0X 3KSLA 2HYZA 4YVQC 2FBNA 3ZYMA 3CLJA 3UM0A 4G8KA 5KWDA 3FUNA 5CHEE 3S2AA 3D9JA 4ILGA 2OOEA 1N95A 4RG6A 5CERB 1H6PA 5ANLA 4H7XA 4I6EA 3RK6A 3S7DA 3ZW3A 3G2VA 3I4RB 4CDMA 3GZ1A 4UWFA 3PZ1A 4FLHA 4UWGA 4XIFA 4TUUA 1DC2A 1S64A 4F1SA 3PH0C 5BXOA 3N71A 4U63A 3APCA 4K5CA 1P5QA 4GU5A 1BPOA 2X3MA 3V79K 2DYRE 4KVOA 5D0QD 4U8VD 1LF8A 1ELRA 3L22A 5LFAA 1SZAA 3FHEA 3UMVA 2MYOA 3MKQB 4CDRA 2H6IA 1RZ4A 4HLLA 5JJ7A 3G2TA 4F53A 1ELWA 2B6CA 4KVMA 4KXKB 3S7JA 3TG5A 3FTSA 4WUYA 1A17A 4B89A 2XEHA 1TN8A 3Q4AB 4GZ6A 4NIKA 3CVQA 4EZKA 3CGHA 5T3RA 3UIOC 2OVFA 3AS8A 1NI1A 3SBTB 1JCSA 4HVBA 3E32A 1WAO1 3FU3A 3QARA 3HVEA 4JA9A 4AOFA 3JUEA 2P9SG 3Q49B 1MQSA 3UUXA 3LY8A 2RFMA 5AJDA 5AQBA 1UJJA 3CHPA 5KJMA 4B8CB 4ATGA 3HVEB 2LXMA 4ILIA 4N39A 3C72A 4DLOA 1H2UA 3C3OA 4HNAD 3PUKA 2X6FA 4I9EA 4LEUA 3T5XA 5BUZA 4U0SA 1N4PA 2R2LA 3KEZA 2R05A 1MHQA 4FU3A 3GZSA 3SFZA 1XNFA 3NAWA 1HFAA 4CGWA 3QAQA 4ME2A 1OY3D 4LG6A 3T9KA 2WQ7A 1IXVA 2I9CA 3EDTB 4TRQA 4JVSA 3BG0B 3W9FA 3UXGA 5LX8A 2KC7A 4EBAA 5ENNA 3MV3B 4WAFA 1D8EA 1N11A 3D9OA 4OYSA 3UX4A 4F1PA 4FC8A 5C1DA 5AQAA 3LYAA 3EU9A 2MRIA 4MBGA 1EDUA 3ZPJA 4OVUA 5CEDB 4GCOA 2L0TB 4RSYA 3EIQC 4JB8P 2XHEA 4BFRA 3ZXPA 3Q5MA 2QC9A 3IBEA 4BTBA 3HXDA 2KCVA 2L6JA 4XEIG 4DX7D 4A3VA 3RRNB 3CV0A 2OCCE
chains in the Genus database with same CATH topology
3PZ2A 1SA5A 2ZISA 1O5MA 3Q79A 4GTQA 3DSXA 1TNZA 3Q75A 1JCQA 4YDOA 4LNBA 2H6HA 1N4PA 1TN7A 2R2LA 2ZIRA 2F0YA 4YDEA 4GTMA 3DSVA 1TNOA 1N4RA 3E34A 3E37A 3Q7AA 1MZCA 1FT2A 3HXBA 1O1TA 3DSTA 3HXCA 1LTXA 2H6IA 1S63A 3EUVA 3Q78A 1DCEA 3KSQA 2BEDA 4GTRA 1FT1A 2IEJA 4EHMA 1NL4A 3PZ3A 2H6GA 2H6FA 1KZPA 1KZOA 4LNGA 3PZ4A 1TN8A 1N9AA 3Q7FA 1FPPA 4GTVA 1D8EA 1O1RA 3KSLA 1TN6A 1JCRA 4L9PA 1NI1A 1O1SA 1X81A 3DRAA 1JCSA 3DSUA 3HXFA 1LD8A 1TNBA 3E33A 3SFYA 1N94A 1TNYA 4GTSA 4MBGA 1N95A 3E32A 4GTOA 3HXEA 3DSWA 3SFXA 3E30A 4GTTA 3Q73A 1QBQA 3DSSA 1TNUA 1LD7A 3HXDA 1SA4A 3PZ1A 3EU5A 1S64A 4GTPA 1N4QA 1N4SA 1D8DA 3DPYA 3C72A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PZ2 A;  1SA5 A;  2ZIS A;  1O5M A;  3Q79 A;  4GTQ A;  3DSX A;  1TNZ A;  3Q75 A;  1JCQ A;  4YDO A;  4LNB A;  2H6H A;  1N4P A;  1TN7 A;  2R2L A;  2ZIR A;  2F0Y A;  4YDE A;  4GTM A;  3DSV A;  1TNO A;  1N4R A;  3E34 A;  3E37 A;  3Q7A A;  1MZC A;  1FT2 A;  3HXB A;  1O1T A;  3DST A;  3HXC A;  1LTX A;  2H6I A;  1S63 A;  3EUV A;  3Q78 A;  1DCE A;  3KSQ A;  2BED A;  4GTR A;  1FT1 A;  2IEJ A;  4EHM A;  1NL4 A;  3PZ3 A;  2H6G A;  2H6F A;  1KZP A;  1KZO A;  4LNG A;  3PZ4 A;  1TN8 A;  1N9A A;  3Q7F A;  1FPP A;  4GTV A;  1D8E A;  1O1R A;  3KSL A;  1TN6 A;  1JCR A;  4L9P A;  1NI1 A;  1O1S A;  1X81 A;  3DRA A;  1JCS A;  3DSU A;  3HXF A;  1LD8 A;  1TNB A;  3E33 A;  3SFY A;  1N94 A;  1TNY A;  4GTS A;  4MBG A;  1N95 A;  3E32 A;  4GTO A;  3HXE A;  3DSW A;  3SFX A;  3E30 A;  4GTT A;  3Q73 A;  1QBQ A;  3DSS A;  1TNU A;  1LD7 A;  3HXD A;  1SA4 A;  3PZ1 A;  3EU5 A;  1S64 A;  4GTP A;  1N4Q A;  1N4S A;  1D8D A;  3DPY A;  3C72 A; 
#chains in the Genus database with same CATH topology
 2ETA A;  3K9I A;  1OWO A;  4D10 C;  3B13 A;  2PM6 A;  4B93 B;  3B7B A;  3G2S A;  3OAW A;  1NFI E;  4CT0 A;  3MZL B;  3B7R L;  3E34 A;  3TJP A;  3Q7A A;  1G3N B;  4FJY A;  3ASG A;  3V2O A;  2DYS E;  2VTB A;  2LAH A;  4AVX A;  3IKO B;  2WXJ A;  2I1J A;  1FT1 A;  1GW6 A;  4L2L A;  1Z6T A;  4G25 A;  4XKC A;  1H19 A;  3CVP A;  4LNG A;  3CVY A;  2XRZ A;  5EN5 D;  4LSZ E;  4R7L A;  1N9A A;  2V5F A;  3T8K A;  4GMR A;  3AU5 A;  3L6A A;  3HG0 D;  2VSY A;  5LP0 A;  5FIO A;  3LJN A;  5BPP A;  3E33 A;  3F6Q A;  2AWI A;  5AEN A;  3U64 A;  3PE4 A;  1MX6 A;  4BY6 A;  2J09 A;  3ABM E;  3APF A;  1SW6 A;  1SQM A;  3U3W A;  4PS3 A;  5ENS D;  3C5R A;  2WXM A;  4MLP A;  4FHJ A;  5D0O D;  2WXL A;  4UI9 J;  4GA1 A;  4JW1 A;  4WNE A;  4URK A;  4DUI A;  3BQO A;  4HOQ A;  1UG3 A;  1SA5 A;  4KT6 B;  4CZ2 D;  1H0A A;  4N3A A;  3ABK E;  3D9H A;  1NP7 A;  2RKK A;  3JQ1 A;  4GPM A;  5AQ7 A;  3Q9N C;  2Y0B G;  4J8E A;  4U7E B;  4A1S A;  4WWP A;  3SI5 A;  4Q96 A;  2KCK A;  2AVP A;  3D9M A;  3LVR E;  2KXP C;  1IHB A;  4BES A;  3E37 A;  3HIZ A;  1PY1 A;  4I6J A;  3Q9U C;  2LSU A;  2OV8 A;  2J49 A;  3RAU A;  2JLB A;  3PNT B;  2QYJ A;  4U8H A;  2LNI A;  2XCB A;  3CVW A;  5FQ8 A;  4GMJ A;  5CEA A;  2P58 C;  4GB9 A;  1N54 A;  1KZO A;  4BSX A;  3CK7 A;  2WXP A;  1TEZ A;  4BX8 A;  3U9W A;  5JA4 D;  4HRL A;  4K03 A;  3AU4 A;  3FUD A;  4BET A;  2LUH A;  1N94 A;  2EIJ E;  1MX2 A;  3FTY A;  4C48 B;  3RJV A;  4JHJ A;  4DPR A;  4L7T A;  4L1B A;  1OWM A;  3EIJ A;  3MV2 B;  3LVQ E;  3FU5 A;  2VGX A;  2GRR B;  4U0Z A;  2CFU A;  3TWQ A;  4X8Q A;  1V54 E;  2BKK B;  1N4S A;  3LPZ A;  4I2W A;  1DNP A;  2OND A;  4CCA A;  2PL2 A;  5T8I A;  4XX5 A;  4TV3 A;  2EIL E;  5M72 A;  2HR2 A;  2YHE A;  3VLF A;  2IF4 A;  2RFA A;  3AG1 E;  2Y4T A;  3ONL A;  3J5P A;  1E8W A;  4J8D A;  5C2Y A;  4LCT A;  4AY6 A;  2WXG A;  1TR4 A;  3U66 A;  3AS5 A;  4Q94 A;  3ASN E;  5LCW C;  3QOU A;  2NXP A;  3MA5 A;  3G2U A;  4CEM A;  3V2X A;  1UN8 A;  4YVO A;  3RU0 A;  3SF4 A;  3DPD A;  3ESK A;  2V0P A;  1H2V C;  3HDX A;  4U04 A;  3VTX A;  3FTX A;  3EUV A;  3Q78 A;  4WWO A;  3X2Q E;  4I9C A;  3EHM A;  3QB2 A;  4A55 A;  5T4Y A;  3RO2 A;  4ATZ D;  1JWF A;  3MCX A;  4LNU D;  2Q7F A;  4E85 A;  2VQ2 A;  2Y1L E;  2WXR A;  4CRW A;  2F8Y A;  3HYM B;  4AP2 A;  4CGV A;  3CVX A;  1OCO E;  3DRA A;  4OAV B;  1LD8 A;  3L9T A;  3I5P A;  2E2E A;  2BTD A;  4NAC A;  4J6I A;  3NZS A;  2RD0 A;  1XGW A;  2ZGD A;  2UWJ G;  5B3S E;  2IO3 C;  3FUH A;  4CDN A;  4MS6 A;  1AWC B;  4EQF A;  3FTU A;  4JHK A;  2GRQ B;  1Q2Z A;  1SVX A;  3ZEF A;  5J90 A;  4OVV A;  5ENQ D;  2M63 A;  1N4Q A;  4FA6 A;  3WG7 E;  3TGO A;  3CVU A;  5G05 J;  1YCS B;  2CHW A;  2JAB A;  3LDZ A;  3Q79 A;  1E7V A;  1KT1 A;  2NC9 A;  4G23 A;  4AM9 A;  2R03 A;  3CQG B;  2XGM A;  3FWV A;  5AQ9 A;  4I1A A;  4IRU A;  2R59 A;  4GTM A;  4ABN A;  1ELK A;  3JXJ A;  2J4D A;  1U2V G;  3DST A;  2P9I G;  5AIJ A;  2J07 A;  3ZHE A;  3PNL B;  3T8M A;  3G2W A;  1IYG A;  4GTR A;  2QY7 A;  4PS7 A;  4ANV A;  1DVP A;  4G26 A;  2YNQ A;  5JJ6 A;  3L82 A;  3CK9 A;  2Y4U A;  4RVB A;  3VTY A;  3PZ4 A;  3Q47 B;  2V5Q C;  2IQC A;  2FEZ A;  2WMN A;  3T5V A;  5CBN A;  1JWG A;  1JCR A;  3ABL E;  5J08 A;  3CR3 A;  3UIN C;  3UKR G;  3UI2 A;  2X6H A;  2J9Q A;  2LO6 A;  2XEE A;  4J0U A;  5KNG A;  1K3Z D;  3E30 A;  4F6R D;  3CHQ A;  4N2Q A;  4KMO A;  2XEN A;  4WNF A;  3TL5 A;  1X5B A;  4CT4 A;  2NYJ A;  4J8F A;  4LUN U;  3QJZ A;  4H7Y A;  1Z5S C;  1HU3 A;  2ETB A;  4L2Y A;  2KM4 A;  4G2V A;  3ZFW A;  2XEV A;  4XZ4 A;  3DPY A;  4GA0 A;  5EID A;  2WVI A;  3RIB A;  5FZS A;  1OT8 A;  3FUK A;  3LJ3 A;  3ULQ A;  3CVN A;  2A5U A;  1TNZ A;  2DWZ A;  1E96 B;  2ILR A;  4HOU A;  1FCH A;  3L13 A;  2F0Y A;  2A5E A;  3NOC D;  3DSV A;  1N0R A;  1N4R A;  1E8X A;  5BW8 C;  5G2N A;  3CIA A;  3LY9 A;  4FUL A;  4L23 A;  2H6F A;  2P9L G;  3EJN A;  3ZN3 A;  4UI9 K;  4JD2 G;  3SO8 A;  4HS2 A;  2DZN A;  2QZA A;  5EX0 A;  3FDH A;  2V4H C;  5FT9 A;  4WNG A;  4N3C A;  3ASH A;  5ENT D;  3SHF A;  4JPS A;  4FAD A;  3NF1 A;  4C0E A;  3GW4 A;  2VYI A;  3CKB A;  4C9B B;  5HS0 A;  4WWN A;  4DX5 D;  3DSS A;  4N3B A;  3FUL A;  4APF A;  2Y3A A;  3D3M A;  5AAR A;  1OCZ E;  5BXU A;  1E90 A;  3JXI A;  5ITZ F;  5D66 A;  4O60 A;  3FEX A;  3E4B A;  3PUJ A;  2MOW A;  2ZIS A;  1JUQ A;  2VSX E;  3B95 A;  4TXR A;  5FZQ A;  4PS8 A;  2IOS A;  3TG4 A;  3TWV A;  5CMW A;  5JJT A;  2LSV A;  3CSF A;  1OWP A;  4LER A;  3FU0 A;  2IJG X;  3ASO E;  3FFL A;  5ENO D;  5CRU A;  2EIM E;  2DIW A;  3D9P A;  5FQ7 A;  4EZJ A;  2B0O E;  2OEV A;  3HXC A;  1LTX A;  1S63 A;  4U8Y D;  3CVV A;  3PZD A;  4V3I A;  4JHR A;  4LRZ A;  4RLY A;  2CHZ A;  4BX9 A;  2GRP B;  4U07 A;  2EQX A;  4W9R A;  2X6J A;  1FPP A;  3PRZ A;  1O1R A;  2GRL A;  3DWL G;  4GPK A;  3L54 A;  3D9L A;  3ZUV B;  1BU9 A;  3ZXS A;  3QDN A;  2VTB B;  1WG0 A;  4QQI A;  3FH5 A;  4GTO A;  2IFU A;  3SFX A;  3SD5 A;  4A63 B;  2P9U G;  3FTZ A;  3ONK A;  5BV1 A;  1JPL A;  4I1O B;  4NRH B;  4AEZ C;  3CKC A;  5FQ4 A;  4N5C A;  3C3R A;  1WDY A;  4B94 A;  1BI7 B;  4UI9 C;  5EDS A;  2J08 A;  3R9A B;  4E6H A;  2DZO A;  3QC1 A;  4XI0 A;  4DLQ A;  4ANU A;  3RRM B;  1FVF A;  4NQ0 A;  3SNX A;  1E8Y A;  4QFV A;  3AAA C;  3EHN A;  4APO A;  3KS2 A;  2LXL A;  4LNB A;  4ANW A;  4BTA A;  1OWL A;  4Z68 A;  2ZGG A;  1UJK A;  2E0I A;  1UOH A;  2OEW A;  4HB5 A;  5A7D B;  2L6B A;  2AW6 A;  2P2C P;  3CHS A;  5BNW A;  2BED A;  2WM9 A;  3OXF A;  2QFC A;  4UQY A;  4U0U A;  1KZP A;  3ZVV A;  4ACK A;  5FJY A;  2LAI A;  3D9K A;  4XI9 A;  1KPS B;  1PC2 A;  2DBA A;  5A23 A;  4XE0 A;  3SBS A;  4N2S A;  2XS8 A;  5CBO A;  4BT9 A;  1TNY A;  3B7T A;  2XGS A;  3UKU G;  4UWH A;  1E8Z A;  4ANX A;  1U3C A;  5EKQ D;  2VGY A;  3IHV A;  2XZD G;  2I6H A;  2ETC A;  1HG5 A;  5FWQ A;  4UWL A;  2NSZ A;  5AYW D;  5JHB A;  1EPU A;  2V4L A;  3ML8 A;  2VJ8 A;  2HO1 A;  5HQ8 A;  4DJA A;  4YDO A;  5FQ6 A;  1NA3 A;  3L08 A;  2H6H A;  2XQ0 A;  3SQV A;  2ZIR A;  5EYP F;  3S7F A;  2KZT A;  1TJC A;  2VGX B;  2UY1 A;  3FTV A;  4UWK A;  3ZNG A;  4UUC A;  2CHX A;  4K5A B;  3ZRH A;  5CMY A;  4YDY A;  5FIN A;  2EIK E;  2ZXW E;  2AJA A;  2PQR A;  4Y6C A;  4KYO B;  1DCQ A;  4CYM D;  5E75 A;  4DX2 A;  4ZFH A;  2FO1 E;  4TXP A;  2WPV A;  1IHG A;  1MYO A;  3FUE A;  5DBK A;  3CHO A;  2ION A;  4G1T A;  3TWW A;  1X81 A;  4O6F A;  3DXM G;  3HXF A;  1N0Q A;  1AP7 A;  1HXI A;  2R5S A;  5AAO A;  3PVL A;  3ZGQ A;  4DRX E;  1KT0 A;  3QWV A;  4ACL A;  4BWR A;  3TXM A;  3JYS A;  4UQX A;  1YMP A;  3ASF A;  1QBQ A;  3SZ7 A;  3C3Q A;  1OCR E;  2J8S D;  3LY7 A;  3JCK C;  5EX3 A;  5HKP A;  4A3T A;  2F8X K;  4J8S A;  3UM1 A;  3R9M A;  4HOR A;  3UTM A;  3BUA A;  2QYU A;  5G05 C;  1E7U A;  4JEU A;  4FLB A;  3ENE A;  2VSO E;  4O1P A;  3DSX A;  3GYZ A;  1QQE A;  4K5B A;  5KCM A;  5EIL A;  3LEW A;  4GZ5 A;  3RRU A;  3P1U A;  1EYH A;  1HH8 A;  5KNH D;  2P9K G;  4F7A A;  4GYW A;  4JZY A;  3AG3 E;  1EF1 C;  1DCE A;  3KSQ A;  4XKB A;  4YND A;  2IEJ A;  2FI7 A;  2HE0 A;  2P9P G;  3PEU B;  4ILH B;  4Y6W A;  3IXE A;  4HRM B;  3NB2 A;  3QK0 A;  4RG9 A;  4GZC A;  3ZYK A;  5DIZ A;  3V31 A;  3PDN A;  1B89 A;  2JEK A;  4HRN A;  2GRM A;  2YHC A;  5KBA A;  2GRO B;  2WXF A;  4DI4 A;  1HX8 A;  1QYM A;  3OXG A;  4DK5 A;  1W3B A;  4GTS A;  1WM5 A;  4GZD A;  3AG2 E;  3BG1 B;  3ZHE B;  1ZBP A;  1WY6 A;  4N5Q A;  4GTT A;  5B1B E;  3Q73 A;  1NZN A;  2EIN E;  4EBA G;  1Z3X A;  5ENR D;  5CCL A;  2IY0 C;  3EU5 A;  3MKQ A;  4GCN A;  3ULE G;  5JHA A;  3ZYQ A;  3ESL A;  4IUL A;  4JL0 A;  5AN8 A;  3R7R A;  4FJZ A;  3OXL A;  5AJL A;  3AG4 E;  3ISM C;  3FUI A;  4ZHB A;  5FTP A;  3FEY A;  4I17 A;  1TYQ G;  4U95 D;  4M3O A;  2BKG A;  3Q75 A;  5HRY A;  5BV0 A;  1TN7 A;  2KBX A;  4HQD A;  4YDE A;  3R7Q A;  1BI8 B;  1BD8 A;  2OVB A;  3S7B A;  4DX1 A;  3HXB A;  4HOS A;  4B0Z A;  3IEG A;  5B1A E;  1N52 A;  3VLE A;  1OUV A;  4BEP A;  3DXK G;  4EHM A;  3P2B A;  3ZIM A;  1D9S A;  3FUM A;  3QKY A;  1S0P A;  3B7S A;  1HO8 A;  2V8S E;  2XPZ A;  4I2Z A;  2XCC A;  2XS1 A;  3L16 A;  2KAT A;  1SZ9 A;  4K0R A;  3IV0 A;  3U4T A;  4GYO A;  4GYY A;  4TXQ A;  2GW1 A;  3CEQ A;  2AXU A;  4DX6 D;  2Y69 E;  2R02 A;  1HE8 A;  3BU8 A;  2YIN A;  2WXQ A;  2WQH A;  1YYH A;  1UN9 A;  3KD7 A;  4NUR A;  3UQ3 A;  3BEE A;  4GML A;  1BLX B;  1LD7 A;  1SA4 A;  2WXK A;  3ULY A;  3UT8 A;  4AJW A;  2WXI A;  1H6O A;  1PAQ A;  4HFG A;  3AJI A;  2VGE A;  4J8Y A;  5H7P A;  4HI8 A;  1JCQ A;  3C98 A;  4I6G A;  3V30 A;  3CVL A;  3FY4 A;  2L9B A;  3MX3 A;  2C0M A;  4UQZ A;  4BSZ B;  3D9N A;  1A5E A;  5ENP D;  5A6C A;  3D9I A;  2AXZ A;  4FP7 A;  2WQ6 A;  3NQP A;  4IYP A;  1MX4 A;  2C0L A;  4G11 A;  5D2M C;  4J7W A;  5G55 A;  4KBQ A;  5KJL A;  3EHQ A;  3Q7F A;  3J5Q B;  1Y8M A;  4HOT A;  3LS8 A;  3UIP C;  1TN6 A;  1INZ A;  3APD A;  1O1S A;  3L17 A;  2X6I A;  3UM3 A;  2MHK A;  3DSU A;  3CST A;  2FUL A;  3EHR A;  1ZU2 A;  2IU1 A;  4YDW A;  2DVW A;  2WMO A;  2CG2 A;  1H2T C;  3FH8 A;  4JA7 A;  3SGH A;  3FUJ A;  4B8A A;  3OTN A;  3AS4 A;  4JC8 A;  1D8D A;  2CG3 A;  4MRU A;  4AV7 A;  2KCL A;  3PEV B;  4KZC A;  2XPY A;  2PNN A;  4DI3 A;  4C0M A;  3FUF A;  3QWW A;  3JQ0 A;  4GTQ A;  2XPI A;  3CQC B;  1RW2 A;  4MKT A;  4GA2 A;  2WB2 A;  1HZ4 A;  1TNO A;  2WXN A;  2F37 A;  3IHY A;  5HI7 A;  4KZ0 A;  5LOZ A;  4BER A;  3W9G A;  1KLX A;  4O1O A;  3MJW A;  3ZU7 B;  4GAA A;  2R17 C;  4AXH A;  5IY5 E;  2XZT G;  2P9N G;  3FP3 A;  4EPZ A;  3NZU A;  4OAU C;  3KEA A;  5CEC B;  2PM7 A;  2HM8 A;  3CHR A;  4IN3 B;  3MYV A;  3PE3 A;  1Z3Y A;  4GTV A;  2ZU6 B;  4AY5 A;  1OWN A;  3CK8 A;  4GZ3 A;  3TXN A;  3LXU X;  2VSN A;  3FU6 A;  3O4Z A;  2FF4 A;  3MKR A;  4G24 A;  3SFY A;  1UW4 B;  3FTW A;  5ARG A;  5CRV A;  1IQU A;  3RO3 A;  2FO7 A;  4JEH A;  4I1M A;  4M7C A;  3PS6 A;  3DBS A;  4HLE A;  3DSW A;  3UT4 A;  3UT7 A;  3JUI A;  3RKV A;  3MEK A;  3VLD A;  4F3V A;  1TNU A;  3TWX A;  4PDX A;  1L5J A;  4TUM A;  4GTP A;  3NOG D;  2XRY A;  3DEO A;  1HF8 A;  1IQR A;  1Y6I A;  5G04 C;  1H6K A;  3LCA A;  2GRN B;  1O5M A;  2C2L A;  3RSE G;  2YQ8 A;  2IOL A;  4G8L A;  1FVH A;  2AXV A;  4WND A;  1V55 E;  3TAX A;  5ANR A;  3SY2 A;  1TJF A;  4PH4 B;  1MZC A;  3ASD A;  4HXI A;  1FT2 A;  2GGF A;  3HHM A;  3NBN B;  2J4B A;  2I1K A;  5G04 J;  1K1B A;  2CFZ A;  3GZ2 A;  5E76 A;  2I2O A;  4U96 D;  2BUG A;  4BT8 A;  1OCC E;  3TWS A;  5CCM A;  3PZ3 A;  2H6G A;  3UPV A;  1HG2 A;  2WXH A;  1HS6 A;  4EEC A;  4PUC A;  4JXT A;  3URZ A;  3O48 A;  4P29 A;  3WXX A;  1K8K G;  3Q15 A;  1YA0 A;  2X6K A;  4L9P A;  2KZT B;  5KJK A;  3LKU A;  3I3N A;  1TNB A;  2UY1 B;  5ARF A;  3QNK A;  1VDY A;  2IO2 C;  2XGO A;  4A1G A;  3HXE A;  4Q69 A;  5KJN A;  3MGB A;  4FHK A;  4HI9 A;  3FH7 A;  3KAE A;  2WXO A;  1K1A A;  3CHM A;  3QWP A;  3TWR A;  3ML9 A;  1ZB1 A;  2A4Z A;  1MJ0 A;  4I43 A;  3PZ2 A;  4AIF A;  3TWT A;  1S70 B;  4RQI A;  3TWU A;  3ZYL A;  2L0I A;  3PRE A;  3UM2 A;  3DEP A;  4HBD A;  3HRA A;  5LCW J;  1QNF A;  5JMN D;  2PQN A;  1NA0 A;  1QZ2 A;  1O1T A;  3B7U X;  2X38 A;  5EIB E;  5BT1 A;  4EZL A;  5EYL A;  1NL4 A;  1OXJ A;  1IKN D;  3I4G A;  2DCP A;  5FZR A;  3ZKJ A;  2PZI A;  2RG8 A;  1U3D A;  2BF0 X;  3KSL A;  2HYZ A;  4YVQ C;  2FBN A;  3ZYM A;  3CLJ A;  3UM0 A;  4G8K A;  5KWD A;  3FUN A;  5CHE E;  3S2A A;  3D9J A;  4ILG A;  2OOE A;  1N95 A;  4RG6 A;  5CER B;  1H6P A;  5ANL A;  4H7X A;  4I6E A;  3RK6 A;  3S7D A;  3ZW3 A;  3G2V A;  3I4R B;  4CDM A;  3GZ1 A;  4UWF A;  3PZ1 A;  4FLH A;  4UWG A;  4XIF A;  4TUU A;  1DC2 A;  1S64 A;  4F1S A;  3PH0 C;  5BXO A;  3N71 A;  4U63 A;  3APC A;  4K5C A;  1P5Q A;  4GU5 A;  1BPO A;  2X3M A;  3V79 K;  2DYR E;  4KVO A;  5D0Q D;  4U8V D;  1LF8 A;  1ELR A;  3L22 A;  5LFA A;  1SZA A;  3FHE A;  3UMV A;  2MYO A;  3MKQ B;  4CDR A;  2H6I A;  1RZ4 A;  4HLL A;  5JJ7 A;  3G2T A;  4F53 A;  1ELW A;  2B6C A;  4KVM A;  4KXK B;  3S7J A;  3TG5 A;  3FTS A;  4WUY A;  1A17 A;  4B89 A;  2XEH A;  1TN8 A;  3Q4A B;  4GZ6 A;  4NIK A;  3CVQ A;  4EZK A;  3CGH A;  5T3R A;  3UIO C;  2OVF A;  3AS8 A;  1NI1 A;  3SBT B;  1JCS A;  4HVB A;  3E32 A;  1WAO 1;  3FU3 A;  3QAR A;  3HVE A;  4JA9 A;  4AOF A;  3JUE A;  2P9S G;  3Q49 B;  1MQS A;  3UUX A;  3LY8 A;  2RFM A;  5AJD A;  5AQB A;  1UJJ A;  3CHP A;  5KJM A;  4B8C B;  4ATG A;  3HVE B;  2LXM A;  4ILI A;  4N39 A;  3C72 A;  4DLO A;  1H2U A;  3C3O A;  4HNA D;  3PUK A;  2X6F A;  4I9E A;  4LEU A;  3T5X A;  5BUZ A;  4U0S A;  1N4P A;  2R2L A;  3KEZ A;  2R05 A;  1MHQ A;  4FU3 A;  3GZS A;  3SFZ A;  1XNF A;  3NAW A;  1HFA A;  4CGW A;  3QAQ A;  4ME2 A;  1OY3 D;  4LG6 A;  3T9K A;  2WQ7 A;  1IXV A;  2I9C A;  3EDT B;  4TRQ A;  4JVS A;  3BG0 B;  3W9F A;  3UXG A;  5LX8 A;  2KC7 A;  4EBA A;  5ENN A;  3MV3 B;  4WAF A;  1D8E A;  1N11 A;  3D9O A;  4OYS A;  3UX4 A;  4F1P A;  4FC8 A;  5C1D A;  5AQA A;  3LYA A;  3EU9 A;  2MRI A;  4MBG A;  1EDU A;  3ZPJ A;  4OVU A;  5CED B;  4GCO A;  2L0T B;  4RSY A;  3EIQ C;  4JB8 P;  2XHE A;  4BFR A;  3ZXP A;  3Q5M A;  2QC9 A;  3IBE A;  4BTB A;  3HXD A;  2KCV A;  2L6J A;  4XEI G;  4DX7 D;  4A3V A;  3RRN B;  3CV0 A;  2OCC E; 
#chains in the Genus database with same CATH homology
 3PZ2 A;  1SA5 A;  2ZIS A;  1O5M A;  3Q79 A;  4GTQ A;  3DSX A;  1TNZ A;  3Q75 A;  1JCQ A;  4YDO A;  4LNB A;  2H6H A;  1N4P A;  1TN7 A;  2R2L A;  2ZIR A;  2F0Y A;  4YDE A;  4GTM A;  3DSV A;  1TNO A;  1N4R A;  3E34 A;  3E37 A;  3Q7A A;  1MZC A;  1FT2 A;  3HXB A;  1O1T A;  3DST A;  3HXC A;  1LTX A;  2H6I A;  1S63 A;  3EUV A;  3Q78 A;  1DCE A;  3KSQ A;  2BED A;  4GTR A;  1FT1 A;  2IEJ A;  4EHM A;  1NL4 A;  3PZ3 A;  2H6G A;  2H6F A;  1KZP A;  1KZO A;  4LNG A;  3PZ4 A;  1TN8 A;  1N9A A;  3Q7F A;  1FPP A;  4GTV A;  1D8E A;  1O1R A;  3KSL A;  1TN6 A;  1JCR A;  4L9P A;  1NI1 A;  1O1S A;  1X81 A;  3DRA A;  1JCS A;  3DSU A;  3HXF A;  1LD8 A;  1TNB A;  3E33 A;  3SFY A;  1N94 A;  1TNY A;  4GTS A;  4MBG A;  1N95 A;  3E32 A;  4GTO A;  3HXE A;  3DSW A;  3SFX A;  3E30 A;  4GTT A;  3Q73 A;  1QBQ A;  3DSS A;  1TNU A;  1LD7 A;  3HXD A;  1SA4 A;  3PZ1 A;  3EU5 A;  1S64 A;  4GTP A;  1N4Q A;  1N4S A;  1D8D A;  3DPY A;  3C72 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...