3Q7AA

Cryptococcus neoformans protein farnesyltransferase in complex with fpp and l-778,123
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
330
structure length
315
Chain Sequence
TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
total genus 131
structure length 315
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q7aA00
1N4SA 4GTVA 1TN8A 3SFXA 2BEDA 1MZCA 4GTOA 1JCQA 2ZIRA 1N9AA 1LD7A 3DRAA 1JCRA 3EU5A 2H6GA 3DSSA 1TN6A 1LD8A 1N4RA 4GTMA 1N94A 4GTPA 1TNYA 3DSTA 1O1TA 3DPYA 3Q79A 1X81A 3E33A 1N4QA 3E32A 1KZOA 3E30A 3C72A 4GTRA 1NI1A 1SA5A 3HXEA 1TN7A 3PZ4A 3PZ2A 4YDOA 3SFYA 3DSUA 3Q7FA 2H6HA 4GTSA 3KSQA 2F0YA 1JCSA 1S64A 3E37A 3Q75A 3Q7AA 1O5MA 3DSVA 1SA4A 4YDEA 1QBQA 1KZPA 3EUVA 4MBGA 3E34A 1N4PA 1O1SA 3DSWA 1LTXA 2R2LA 1TNUA 3KSLA 4GTTA 1D8EA 1FPPA 3HXDA 1FT1A 1FT2A 2IEJA 3Q78A 3DSXA 1DCEA 1S63A 2H6IA 1N95A 3PZ1A 4LNBA 4EHMA 2H6FA 1D8DA 3HXCA 3HXBA 2ZISA 1NL4A 4GTQA 1TNOA 4LNGA 3PZ3A 1TNBA 3HXFA 1O1RA 3Q73A 1TNZA 4L9PA
chains in the Genus database with same CATH superfamily
4GU5A 1S0PA 4XI0A 1TYQG 3EHQA 4J8FA 1HG5A 1NA0A 4U0UA 1H6PA 4N5CA 4GMLA 5DBKA 4HOTA 5H7PA 2L0TB 3G2SA 3GW4A 2WXGA 2OVFA 4JA9A 5D0OD 3FUJA 3JYSA 3NOGD 3CK9A 3APCA 2PQRA 3EHMA 3HIZA 4G26A 3FTZA 3UM1A 3SQVA 3KS2A 3GZ2A 3HXEA 3B7TA 3PZ4A 2EIME 1XGWA 2XEEA 3E37A 3QARA 3FTWA 2IO3C 3ZIMA 4N2SA 3CR3A 2HYZA 3PRZA 2ZGDA 4UWFA 4QQIA 5G55A 3FTYA 3SI5A 1PAQA 1FPPA 2KZTB 1WDYA 1FT1A 4UQXA 3FTXA 3RIBA 4DJAA 2KM4A 1Z6TA 2I2OA 1LF8A 4EZJA 1D9SA 1E8WA 4QFVA 2JLBA 5ENQD 3URZA 3EHRA 1D8DA 2XRZA 1V54E 5ANLA 2YHEA 4ATZD 3Q73A 3CVNA 1TNZA 4OAUC 3DPDA 5LP0A 4KYOB 3L6AA 4UI9C 2ZIRA 2C0MA 3ASOE 2KC7A 3LY9A 3CHSA 3JXIA 2LUHA 2AW6A 4FULA 1YMPA 4J8SA 2GROB 1OCOE 5CERB 5JJTA 2X38A 2XCCA 5BUZA 3GZSA 3CQGB 5ITZF 4AV7A 4JA7A 3P2BA 1TEZA 4FLBA 2V0PA 5C2YA 3SBSA 3SFYA 4GYOA 5CEAA 4XZ4A 4FADA 3UPVA 4GA1A 2QY7A 3UXGA 5KJNA 4GZDA 5LCWC 3MZLB 3B7BA 2V5FA 3MCXA 3TWRA 4B8CB 5AQ9A 4GCOA 4JHJA 2X6JA 2DIWA 4G2VA 3L82A 2WXKA 3KSLA 4CYMD 3TWQA 3EIQC 3C3RA 2XENA 1GW6A 5BV0A 4ZHBA 5EKQD 1EPUA 2HM8A 4ILGA 2ZXWE 2GRLA 3JQ0A 3VLFA 1NFIE 3D3MA 2KZTA 1UN9A 4GZ6A 3QAQA 2BUGA 3CK8A 1N9AA 2WXMA 2Y0BG 3G2VA 4CGVA 3G2UA 4BX8A 5G05J 3LCAA 3OXLA 4DLOA 5EYLA 5KNGA 2ZU6B 2R02A 4ANUA 2GRPB 4GTPA 4YDYA 5A6CA 3L17A 2FBNA 5ANRA 2XHEA 4EBAG 4NQ0A 2ONDA 1O1TA 2X6IA 3DPYA 4C0EA 3FFLA 4PDXA 4E85A 3ABLE 3UQ3A 1UW4B 2WQ6A 4CRWA 3ZN3A 1HO8A 4WNDA 4UQZA 2VGXA 4FA6A 3FUEA 1NZNA 1Y8MA 3LVRE 5EDSA 5A23A 3O4ZA 2LSVA 3E4BA 4A63B 3D9HA 4AXHA 2AVPA 5FQ7A 4Q94A 2CHWA 2FF4A 5KCMA 4HOSA 2I9CA 2WXFA 4BSXA 2NXPA 2WXLA 4F53A 3S7FA 2GW1A 2WXIA 4ILHB 3ZGQA 5G04C 2QZAA 5FINA 3ASGA 3IBEA 5KJMA 4I43A 2AJAA 5T8IA 2YHCA 2IO2C 4UWKA 5FZQA 5FQ8A 4BTBA 1O1RA 5AAOA 2QFCA 4HOUA 4IYPA 4C9BB 2EINE 3LY8A 3ONLA 3UIOC 2GRRB 2P9NG 4L7TA 1E8ZA 4LCTA 2KCLA 1E90A 4U95D 1TN6A 3TWUA 4BESA 2KBXA 2V5QC 4BY6A 3NAWA 2KCVA 5EILA 3QOUA 3CKCA 3WXXA 3KEAA 1E8YA 1NA3A 2AXUA 4U8VD 5LFAA 5ENRD 2OCCE 3PDNA 1UJJA 4GZ3A 4RSYA 2BF0X 4CEMA 2BKKB 3LVQE 3C5RA 3L13A 2L6BA 3LXUX 3CEQA 1OWNA 3U9WA 3HVEB 3ZYLA 3TXMA 4GTTA 1SQMA 1VDYA 1HFAA 4HVBA 5LX8A 3Q49B 4J7WA 1WM5A 4AIFA 3P1UA 2H6FA 2FO1E 5FT9A 2DWZA 3BUAA 4G24A 1H2UA 3T9KA 2KCKA 2HE0A 1JUQA 4YDWA 3ISMC 3EU9A 1JCQA 1LD7A 3FWVA 3ZHEA 1JCRA 4OVVA 3EU5A 2Y1LE 3RO3A 1INZA 1ZU2A 2GGFA 3CVPA 1N94A 2RD0A 3ZVVA 4HQDA 3ABKE 2CHXA 3LJ3A 5B1AE 4G1TA 1BLXB 4APOA 4DI3A 4J8EA 1E7VA 3D9PA 3C98A 3FULA 3OTNA 5FQ6A 5JHAA 5CRUA 1DC2A 1K3ZD 4EZLA 5AN8A 3PUJA 4N3AA 3MYVA 5KNHD 4O1OA 2LXLA 4CCAA 2EIKE 2IU1A 2CG3A 5A7DB 3NZUA 2IOSA 3NBNB 2H6IA 4EZKA 1N95A 3HVEA 3DEOA 5FJYA 4C0MA 3HXFA 5ARFA 3N71A 2ZGGA 4DUIA 5CMYA 4FHJA 1JPLA 4YVQC 2L6JA 2XPZA 5D2MC 3ASFA 5C1DA 1HE8A 3WG7E 4BTAA 4GAAA 3D9OA 4FHKA 4CDRA 1N0QA 4B0ZA 1N4QA 2J4BA 5T3RA 2WXQA 2XGSA 3AS8A 2CFUA 3AU5A 2LXMA 1X5BA 4V3IA 2BKGA 3LDZA 5AQ7A 1YYHA 1JWFA 1TR4A 4HFGA 4G8KA 4UI9K 2F0YA 3QWPA 2OOEA 2P9UG 3AU4A 3Q75A 4N39A 4PS8A 1O5MA 2XPYA 3JUIA 5EX0A 3FP3A 2JABA 3UKRG 2L0IA 3J5QB 2WXPA 4JEHA 4GA2A 4DX6D 3ULQA 1OCCE 3U66A 4CT4A 4KXKB 4I9EA 2I1JA 3FUNA 2AXVA 2BTDA 4N3CA 4EBAA 4Q69A 4I1MA 3Q5MA 2MRIA 3FEXA 4CDNA 1WAO1 2Y3AA 1QQEA 4BFRA 3PS6A 3BEEA 4OYSA 4UWHA 1HU3A 4BT9A 4G25A 1E8XA 4WAFA 3QKYA 4JZYA 2XGMA 3HDXA 2DYSE 4KBQA 3R7QA 3ML9A 2MHKA 4M3OA 2WB2A 3UX4A 2VSOE 3LYAA 3ESLA 5IY5E 5B1BE 2FULA 3FUMA 2A4ZA 4M7CA 4DI4A 4AJWA 2QYUA 2VGXB 2H6HA 2X3MA 3RJVA 3HRAA 3KSQA 2XZTG 1B89A 3DSVA 2YINA 4MKTA 4I1AA 4K5CA 2VJ8A 1QNFA 3DSWA 1LTXA 4TV3A 4HRLA 3CHOA 1N54A 2X6KA 3IKOB 5ENOD 3ZU7B 4DX5D 3MV3B 4URKA 3G2WA 4LNBA 3S7JA 2J09A 3UIPC 1H19A 3V79K 4R7LA 1NL4A 5HQ8A 4AEZC 3DEPA 4GTVA 1QYMA 3V2OA 1FCHA 3NF1A 3SGHA 1S70B 4I17A 4WNEA 2DCPA 1HF8A 3G2TA 3PEUB 4HS2A 3CVUA 3ZXPA 4TXRA 3MEKA 3T5VA 1N4RA 4WWOA 1L5JA 4HI8A 3PNLB 4JL0A 3QJZA 2XCBA 1Z3XA 3K9IA 3ZUVB 5KWDA 3E32A 1OCRE 3D9IA 1KZOA 1SW6A 3C72A 2LAIA 4BT8A 3ZKJA 4XKCA 4JD2G 4ACLA 4DX1A 4H7XA 4JW1A 4JB8P 2Q7FA 1IHBA 4I2ZA 4DK5A 4LRZA 4Y6CA 5DIZA 4KZ0A 4A3TA 4HRMB 2VSNA 4AY5A 2NSZA 4GZ5A 4RQIA 2XPIA 3S2AA 1U2VG 1H2TC 4K0RA 5J08A 2PL2A 4U7EB 2AWIA 2QYJA 1TJCA 3ZPJA 3ZFWA 5HS0A 3PE4A 4I9CA 2J8SD 3VTXA 4BWRA 4L1BA 3MJWA 2L9BA 4BERA 2XEVA 5E75A 2X6FA 3OAWA 4Y6WA 3CVXA 3QNKA 3L54A 1N4SA 2NC9A 5KJLA 3LEWA 5CCMA 4FLHA 4CT0A 2V4HC 3ZHEB 1IXVA 2ETAA 3DSSA 3TWXA 5EYPF 2WQ7A 1LD8A 3C3OA 4TXPA 3LY7A 3FTVA 4HBDA 3NZSA 2VQ2A 3B95A 3BG1B 4N5QA 3UM2A 3S7BA 2CFZA 1IYGA 3B7SA 2GRQB 4OAVB 4TUMA 3E30A 3FUDA 2FO7A 1UJKA 2RFAA 3RRNB 3FTSA 3RKVA 3AG2E 4FJZA 4K03A 4XX5A 2B0OE 1JCSA 2FI7A 3AG1E 2J08A 3Q7AA 4HNAD 3FU3A 3B7RL 2IY0C 3DXKG 3EIJA 3LPZA 3PE3A 3CHMA 1TNUA 4O60A 4RG9A 4RG6A 3L22A 4LSZE 4WNFA 4A3VA 1SZAA 3JUEA 1WG0A 3I4RB 4F1PA 3MV2B 2EQXA 2ZISA 4TXQA 4UI9J 3V30A 4U07A 5ENNA 2NYJA 3KEZA 3QK0A 2XS1A 4JHRA 3UI2A 3APDA 1KT1A 1DCQA 5AIJA 4GCNA 4AM9A 1HH8A 4ACKA 5ENTD 4GMRA 3RAUA 2WXOA 4B89A 3VLEA 5CBOA 1K1BA 3AS5A 3SO8A 2R5SA 2V8SE 5G2NA 3Q4AB 2DZNA 2P9KG 3TL5A 1OWLA 5FZRA 3PREA 4L23A 3T8MA 4TUUA 4GYYA 5FZSA 4G8LA 4E6HA 1SA5A 3X2QE 4KVMA 2J9QA 3W9FA 5LCWJ 3D9LA 4GTSA 1N52A 3CIAA 3VTYA 3CVYA 2VGEA 2J07A 3L9TA 1QBQA 4GYWA 4XI9A 4L2LA 4U8HA 5AYWD 1ELRA 2M63A 5LOZA 5AQBA 1FVHA 4G11A 3ULEG 4CZ2D 2DYRE 4O1PA 3B7UX 1SVXA 4ILIA 3TWWA 3V31A 3QB2A 3D9JA 1OWMA 4MLPA 1NP7A 4EHMA 3HXCA 4UQYA 2OEVA 1EYHA 3UT8A 4LERA 1Y6IA 3MKRA 2YQ8A 4Z68A 4D10C 3SFXA 1TN8A 3FDHA 4U0SA 5BXUA 3OXFA 4BSZB 4J8DA 4F7AA 2I6HA 3UM3A 3BU8A 5AJDA 5FWQA 2OEWA 4HORA 1H0AA 4IRUA 5CCLA 4EPZA 2P9SG 4WWNA 5G05C 2DBAA 3PUKA 1TJFA 4N3BA 3U64A 3RU0A 5CMWA 5D66A 4CGWA 2P9LG 2Y4TA 1AP7A 3I3NA 1E7UA 1X81A 1H6KA 2R03A 1BI7B 4DRXE 4X8QA 5JHBA 1ZBPA 5HRYA 2EILE 4G23A 4APFA 5B3SE 3GZ1A 4JPSA 1OWOA 3AG4E 4H7YA 2YNQA 2XEHA 4MS6A 4LUNU 3DSUA 3Q47B 2P2CP 3IHYA 4F1SA 3Q15A 1S64A 1XNFA 4HRNA 4DLQA 3D9KA 4IULA 3UUXA 4FC8A 2RKKA 5G04J 3E34A 3UT4A 1U3DA 4ANVA 1O1SA 5FQ4A 3NOCD 3SZ7A 1OWPA 3ABME 2C0LA 1MX6A 3DWLG 3PH0C 3I4GA 1HX8A 3SF4A 1RW2A 4HXIA 5M72A 4JC8A 1PC2A 3EDTB 2IQCA 2XQ0A 4B8AA 1DNPA 4RVBA 1MX2A 4UUCA 1MZCA 4K5BA 3DRAA 5T4YA 3CVWA 1KLXA 1G3NB 2WXHA 1OY3D 2WXNA 3IV0A 2F8XK 2WXJA 2P9PG 3ZEFA 1A17A 3QC1A 1H2VC 3QWWA 1N0RA 1Z3YA 5D0QD 3LJNA 1IKND 4A1GA 4GTRA 1NI1A 4GZCA 1MQSA 4JEUA 2WMNA 3PVLA 1WY6A 1MJ0A 3JQ1A 4ME2A 2GRNB 3CSFA 2PNNA 4XIFA 2LSUA 3KAEA 5EX3A 5AARA 4BX9A 1OCZE 3BQOA 2I1KA 2PZIA 3EHNA 3SY2A 5BV1A 4CDMA 4F3VA 4NURA 1SA4A 1KZPA 1HG2A 4WNGA 1UOHA 4HLLA 4KVOA 2R2LA 1JWGA 3TWSA 5EIDA 3AAAC 2E0IA 3FU0A 3SBTB 3O48A 3PZDA 2JEKA 4B94A 5JJ7A 2R17C 4WWPA 2PQNA 5HKPA 4KT6B 4GMJA 1K8KG 5KJKA 3L16A 2WQHA 4WUYA 3D9NA 4GTOA 3R9AB 4L2YA 3B13A 4LNUD 1MHQA 5CEDB 3R7RA 3KD7A 3DSTA 5CRVA 5BW8C 4GPMA 4HLEA 4UWLA 3Q79A 4XEIG 1IQRA 1P5QA 3UT7A 2WMOA 1K1AA 3CVVA 3D9MA 2XRYA 2A5UA 4J0UA 3ASDA 1TN7A 1UG3A 2LNIA 5CECB 4YDOA 1BU9A 1EDUA 2A5EA 2P9IG 1OUVA 4I6JA 1H6OA 3SD5A 4YVOA 4K5AB 5BT1A 4LEUA 5JJ6A 2KXPC 3FUHA 1Q2ZA 1D8EA 3FUKA 1HXIA 3J5PA 3Q78A 3DSXA 3VLDA 1DCEA 1OT8A 1S63A 2KATA 4IN3B 2GRMA 3PZ1A 3CSTA 4MRUA 1UN8A 2VTBB 1V55E 4EECA 2P58C 4PS7A 3CHRA 1TNOA 4FJYA 4BETA 1TNBA 3GYZA 5BPPA 5FIOA 2VSXE 3TG5A 3BG0B 1EF1C 4A55A 2F37A 3NQPA 2HR2A 4PS3A 3AG3E 4HB5A 4OVUA 1IQUA 3MGBA 4GTMA 4JVSA 3MX3A 1A5EA 3ESKA 2Y4UA 5E76A 3IXEA 1RZ4A 5AJLA 4I1OB 3FU5A 2MYOA 3TXNA 4PH4B 1DVPA 2IOLA 3CHQA 2E2EA 4PUCA 3E33A 4GB9A 5JA4D 5FTPA 2DZOA 4TRQA 2OVBA 3ZXSA 1W3BA 2PM6A 3UINC 4ANXA 4GPKA 5CHEE 3PZ2A 2DVWA 4BEPA 4KZCA 4ATGA 2UY1B 3UKUG 4U04A 1ZB1A 1HZ4A 2IJGX 4O6FA 4P29A 1PY1A 1N4PA 3L08A 3QDNA 3JCKC 4DX7D 4HI9A 3CLJA 4A1SA 2ETBA 1HS6A 4AOFA 4U8YD 1AWCB 3CVQA 2Y69E 3FU6A 4I6EA 5JMND 3IEGA 2VGYA 4FU3A 3U3WA 2AXZA 3LKUA 4GTQA 5CBNA 2X6HA 4I6GA 4L9PA 3TWTA 4RLYA 1BPOA 4EQFA 4GA0A 5BNWA 3RSEG 3Q9NC 5AQAA 5EIBE 3ASNE 3TJPA 3ZNGA 1OXJA 2RFMA 2VTBA 2H6GA 4NIKA 1KPSB 5J90A 3FHEA 3HG0D 2CHZA 2V4LA 4N2QA 2J49A 3ONKA 3RO2A 3I5PA 3SFZA 1MYOA 3MKQB 3TWVA 3C3QA 3RK6A 4AP2A 3CHPA 3HHMA 3AS4A 3SNXA 4ABNA 1ELWA 1BD8A 5EN5D 1E96B 3FUIA 1YCSB 5ARGA 3EJNA 3Q7FA 2ETCA 2CG2A 3TGOA 2WXRA 3TAXA 4U63A 4YDEA 5BXOA 3RRUA 3EUVA 5ENSD 1BI8B 4MBGA 3TG4A 3F6QA 3MA5A 2UY1A 4C48B 3V2XA 2C2LA 2MOWA 3T5XA 3T8KA 4KMOA 5KBAA 4NRHB 2EIJE 3ULYA 3PNTB 2WM9A 4U96D 3OXGA 3ML8A 4UWGA 4LNGA 4AVXA 3FUFA 2XZDG 3CQCB 2XGOA 3ZW3A 2F8YA 2BEDA 4W9RA 3FH7A 1MX4A 3FY4A 4FP7A 3CK7A 2ILRA 3NB2A 2HO1A 3LS8A 4ANWA 3HYMB 3FTUA 1FVFA 2XS8A 1TNYA 3ZYMA 5AENA 4LG6A 4U0ZA 3DBSA 4B93B 2FEZA 3RRMB 4J6IA 2IFUA 3W9GA 4I2WA 4J8YA 3ZYKA 3IHVA 3UTMA 3CKBA 2R59A 3PEVB 4XE0A 2VYIA 4Q96A 4XKBA 2B6CA 3CV0A 1SZ9A 3MKQA 3ZYQA 5ENPD 3FEYA 2R05A 4YNDA 2VSYA 3S7DA 5HI7A 4NACA 3U4TA 3UMVA 1N11A 1ELKA 2OV8A 1QZ2A 3FH5A 3QWVA 3APFA 4ZFHA 2IF4A 4DPRA 4JXTA 4AY6A 4JHKA 4HOQA 3UM0A 1Z5SC 3SHFA 3HXDA 2J4DA 1FT2A 2IEJA 2LO6A 3JXJA 1YA0A 3Q9UC 1KT0A 2WPVA 2UWJG 3FH8A 3CGHA 3HXBA 1U3CA 3R9MA 2WVIA 3ZRHA 2PM7A 4F6RD 2RG8A 3ASHA 2LAHA 3ENEA 3PZ3A 2QC9A 3DXMG 1IHGA 2IONA 4DX2A 3CVLA 3AJIA
chains in the Genus database with same CATH topology
1N4SA 4GTVA 1TN8A 3SFXA 2BEDA 1MZCA 4GTOA 1JCQA 2ZIRA 1N9AA 1LD7A 3DRAA 1JCRA 3EU5A 2H6GA 3DSSA 1TN6A 1LD8A 1N4RA 4GTMA 1N94A 4GTPA 1TNYA 3DSTA 1O1TA 3DPYA 3Q79A 1X81A 3E33A 1N4QA 3E32A 1KZOA 3E30A 3C72A 4GTRA 1NI1A 1SA5A 3HXEA 1TN7A 3PZ4A 3PZ2A 4YDOA 3SFYA 3DSUA 3Q7FA 2H6HA 4GTSA 3KSQA 2F0YA 1JCSA 1S64A 3E37A 3Q75A 3Q7AA 1O5MA 3DSVA 1SA4A 4YDEA 1QBQA 1KZPA 3EUVA 4MBGA 3E34A 1N4PA 1O1SA 3DSWA 1LTXA 2R2LA 1TNUA 3KSLA 4GTTA 1D8EA 1FPPA 3HXDA 1FT1A 1FT2A 2IEJA 3Q78A 3DSXA 1DCEA 1S63A 2H6IA 1N95A 3PZ1A 4LNBA 4EHMA 2H6FA 1D8DA 3HXCA 3HXBA 2ZISA 1NL4A 4GTQA 1TNOA 4LNGA 3PZ3A 1TNBA 3HXFA 1O1RA 3Q73A 1TNZA 4L9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4S A;  4GTV A;  1TN8 A;  3SFX A;  2BED A;  1MZC A;  4GTO A;  1JCQ A;  2ZIR A;  1N9A A;  1LD7 A;  3DRA A;  1JCR A;  3EU5 A;  2H6G A;  3DSS A;  1TN6 A;  1LD8 A;  1N4R A;  4GTM A;  1N94 A;  4GTP A;  1TNY A;  3DST A;  1O1T A;  3DPY A;  3Q79 A;  1X81 A;  3E33 A;  1N4Q A;  3E32 A;  1KZO A;  3E30 A;  3C72 A;  4GTR A;  1NI1 A;  1SA5 A;  3HXE A;  1TN7 A;  3PZ4 A;  3PZ2 A;  4YDO A;  3SFY A;  3DSU A;  3Q7F A;  2H6H A;  4GTS A;  3KSQ A;  2F0Y A;  1JCS A;  1S64 A;  3E37 A;  3Q75 A;  3Q7A A;  1O5M A;  3DSV A;  1SA4 A;  4YDE A;  1QBQ A;  1KZP A;  3EUV A;  4MBG A;  3E34 A;  1N4P A;  1O1S A;  3DSW A;  1LTX A;  2R2L A;  1TNU A;  3KSL A;  4GTT A;  1D8E A;  1FPP A;  3HXD A;  1FT1 A;  1FT2 A;  2IEJ A;  3Q78 A;  3DSX A;  1DCE A;  1S63 A;  2H6I A;  1N95 A;  3PZ1 A;  4LNB A;  4EHM A;  2H6F A;  1D8D A;  3HXC A;  3HXB A;  2ZIS A;  1NL4 A;  4GTQ A;  1TNO A;  4LNG A;  3PZ3 A;  1TNB A;  3HXF A;  1O1R A;  3Q73 A;  1TNZ A;  4L9P A; 
#chains in the Genus database with same CATH topology
 4GU5 A;  1S0P A;  4XI0 A;  1TYQ G;  3EHQ A;  4J8F A;  1HG5 A;  1NA0 A;  4U0U A;  1H6P A;  4N5C A;  4GML A;  5DBK A;  4HOT A;  5H7P A;  2L0T B;  3G2S A;  3GW4 A;  2WXG A;  2OVF A;  4JA9 A;  5D0O D;  3FUJ A;  3JYS A;  3NOG D;  3CK9 A;  3APC A;  2PQR A;  3EHM A;  3HIZ A;  4G26 A;  3FTZ A;  3UM1 A;  3SQV A;  3KS2 A;  3GZ2 A;  3HXE A;  3B7T A;  3PZ4 A;  2EIM E;  1XGW A;  2XEE A;  3E37 A;  3QAR A;  3FTW A;  2IO3 C;  3ZIM A;  4N2S A;  3CR3 A;  2HYZ A;  3PRZ A;  2ZGD A;  4UWF A;  4QQI A;  5G55 A;  3FTY A;  3SI5 A;  1PAQ A;  1FPP A;  2KZT B;  1WDY A;  1FT1 A;  4UQX A;  3FTX A;  3RIB A;  4DJA A;  2KM4 A;  1Z6T A;  2I2O A;  1LF8 A;  4EZJ A;  1D9S A;  1E8W A;  4QFV A;  2JLB A;  5ENQ D;  3URZ A;  3EHR A;  1D8D A;  2XRZ A;  1V54 E;  5ANL A;  2YHE A;  4ATZ D;  3Q73 A;  3CVN A;  1TNZ A;  4OAU C;  3DPD A;  5LP0 A;  4KYO B;  3L6A A;  4UI9 C;  2ZIR A;  2C0M A;  3ASO E;  2KC7 A;  3LY9 A;  3CHS A;  3JXI A;  2LUH A;  2AW6 A;  4FUL A;  1YMP A;  4J8S A;  2GRO B;  1OCO E;  5CER B;  5JJT A;  2X38 A;  2XCC A;  5BUZ A;  3GZS A;  3CQG B;  5ITZ F;  4AV7 A;  4JA7 A;  3P2B A;  1TEZ A;  4FLB A;  2V0P A;  5C2Y A;  3SBS A;  3SFY A;  4GYO A;  5CEA A;  4XZ4 A;  4FAD A;  3UPV A;  4GA1 A;  2QY7 A;  3UXG A;  5KJN A;  4GZD A;  5LCW C;  3MZL B;  3B7B A;  2V5F A;  3MCX A;  3TWR A;  4B8C B;  5AQ9 A;  4GCO A;  4JHJ A;  2X6J A;  2DIW A;  4G2V A;  3L82 A;  2WXK A;  3KSL A;  4CYM D;  3TWQ A;  3EIQ C;  3C3R A;  2XEN A;  1GW6 A;  5BV0 A;  4ZHB A;  5EKQ D;  1EPU A;  2HM8 A;  4ILG A;  2ZXW E;  2GRL A;  3JQ0 A;  3VLF A;  1NFI E;  3D3M A;  2KZT A;  1UN9 A;  4GZ6 A;  3QAQ A;  2BUG A;  3CK8 A;  1N9A A;  2WXM A;  2Y0B G;  3G2V A;  4CGV A;  3G2U A;  4BX8 A;  5G05 J;  3LCA A;  3OXL A;  4DLO A;  5EYL A;  5KNG A;  2ZU6 B;  2R02 A;  4ANU A;  2GRP B;  4GTP A;  4YDY A;  5A6C A;  3L17 A;  2FBN A;  5ANR A;  2XHE A;  4EBA G;  4NQ0 A;  2OND A;  1O1T A;  2X6I A;  3DPY A;  4C0E A;  3FFL A;  4PDX A;  4E85 A;  3ABL E;  3UQ3 A;  1UW4 B;  2WQ6 A;  4CRW A;  3ZN3 A;  1HO8 A;  4WND A;  4UQZ A;  2VGX A;  4FA6 A;  3FUE A;  1NZN A;  1Y8M A;  3LVR E;  5EDS A;  5A23 A;  3O4Z A;  2LSV A;  3E4B A;  4A63 B;  3D9H A;  4AXH A;  2AVP A;  5FQ7 A;  4Q94 A;  2CHW A;  2FF4 A;  5KCM A;  4HOS A;  2I9C A;  2WXF A;  4BSX A;  2NXP A;  2WXL A;  4F53 A;  3S7F A;  2GW1 A;  2WXI A;  4ILH B;  3ZGQ A;  5G04 C;  2QZA A;  5FIN A;  3ASG A;  3IBE A;  5KJM A;  4I43 A;  2AJA A;  5T8I A;  2YHC A;  2IO2 C;  4UWK A;  5FZQ A;  5FQ8 A;  4BTB A;  1O1R A;  5AAO A;  2QFC A;  4HOU A;  4IYP A;  4C9B B;  2EIN E;  3LY8 A;  3ONL A;  3UIO C;  2GRR B;  2P9N G;  4L7T A;  1E8Z A;  4LCT A;  2KCL A;  1E90 A;  4U95 D;  1TN6 A;  3TWU A;  4BES A;  2KBX A;  2V5Q C;  4BY6 A;  3NAW A;  2KCV A;  5EIL A;  3QOU A;  3CKC A;  3WXX A;  3KEA A;  1E8Y A;  1NA3 A;  2AXU A;  4U8V D;  5LFA A;  5ENR D;  2OCC E;  3PDN A;  1UJJ A;  4GZ3 A;  4RSY A;  2BF0 X;  4CEM A;  2BKK B;  3LVQ E;  3C5R A;  3L13 A;  2L6B A;  3LXU X;  3CEQ A;  1OWN A;  3U9W A;  3HVE B;  3ZYL A;  3TXM A;  4GTT A;  1SQM A;  1VDY A;  1HFA A;  4HVB A;  5LX8 A;  3Q49 B;  4J7W A;  1WM5 A;  4AIF A;  3P1U A;  2H6F A;  2FO1 E;  5FT9 A;  2DWZ A;  3BUA A;  4G24 A;  1H2U A;  3T9K A;  2KCK A;  2HE0 A;  1JUQ A;  4YDW A;  3ISM C;  3EU9 A;  1JCQ A;  1LD7 A;  3FWV A;  3ZHE A;  1JCR A;  4OVV A;  3EU5 A;  2Y1L E;  3RO3 A;  1INZ A;  1ZU2 A;  2GGF A;  3CVP A;  1N94 A;  2RD0 A;  3ZVV A;  4HQD A;  3ABK E;  2CHX A;  3LJ3 A;  5B1A E;  4G1T A;  1BLX B;  4APO A;  4DI3 A;  4J8E A;  1E7V A;  3D9P A;  3C98 A;  3FUL A;  3OTN A;  5FQ6 A;  5JHA A;  5CRU A;  1DC2 A;  1K3Z D;  4EZL A;  5AN8 A;  3PUJ A;  4N3A A;  3MYV A;  5KNH D;  4O1O A;  2LXL A;  4CCA A;  2EIK E;  2IU1 A;  2CG3 A;  5A7D B;  3NZU A;  2IOS A;  3NBN B;  2H6I A;  4EZK A;  1N95 A;  3HVE A;  3DEO A;  5FJY A;  4C0M A;  3HXF A;  5ARF A;  3N71 A;  2ZGG A;  4DUI A;  5CMY A;  4FHJ A;  1JPL A;  4YVQ C;  2L6J A;  2XPZ A;  5D2M C;  3ASF A;  5C1D A;  1HE8 A;  3WG7 E;  4BTA A;  4GAA A;  3D9O A;  4FHK A;  4CDR A;  1N0Q A;  4B0Z A;  1N4Q A;  2J4B A;  5T3R A;  2WXQ A;  2XGS A;  3AS8 A;  2CFU A;  3AU5 A;  2LXM A;  1X5B A;  4V3I A;  2BKG A;  3LDZ A;  5AQ7 A;  1YYH A;  1JWF A;  1TR4 A;  4HFG A;  4G8K A;  4UI9 K;  2F0Y A;  3QWP A;  2OOE A;  2P9U G;  3AU4 A;  3Q75 A;  4N39 A;  4PS8 A;  1O5M A;  2XPY A;  3JUI A;  5EX0 A;  3FP3 A;  2JAB A;  3UKR G;  2L0I A;  3J5Q B;  2WXP A;  4JEH A;  4GA2 A;  4DX6 D;  3ULQ A;  1OCC E;  3U66 A;  4CT4 A;  4KXK B;  4I9E A;  2I1J A;  3FUN A;  2AXV A;  2BTD A;  4N3C A;  4EBA A;  4Q69 A;  4I1M A;  3Q5M A;  2MRI A;  3FEX A;  4CDN A;  1WAO 1;  2Y3A A;  1QQE A;  4BFR A;  3PS6 A;  3BEE A;  4OYS A;  4UWH A;  1HU3 A;  4BT9 A;  4G25 A;  1E8X A;  4WAF A;  3QKY A;  4JZY A;  2XGM A;  3HDX A;  2DYS E;  4KBQ A;  3R7Q A;  3ML9 A;  2MHK A;  4M3O A;  2WB2 A;  3UX4 A;  2VSO E;  3LYA A;  3ESL A;  5IY5 E;  5B1B E;  2FUL A;  3FUM A;  2A4Z A;  4M7C A;  4DI4 A;  4AJW A;  2QYU A;  2VGX B;  2H6H A;  2X3M A;  3RJV A;  3HRA A;  3KSQ A;  2XZT G;  1B89 A;  3DSV A;  2YIN A;  4MKT A;  4I1A A;  4K5C A;  2VJ8 A;  1QNF A;  3DSW A;  1LTX A;  4TV3 A;  4HRL A;  3CHO A;  1N54 A;  2X6K A;  3IKO B;  5ENO D;  3ZU7 B;  4DX5 D;  3MV3 B;  4URK A;  3G2W A;  4LNB A;  3S7J A;  2J09 A;  3UIP C;  1H19 A;  3V79 K;  4R7L A;  1NL4 A;  5HQ8 A;  4AEZ C;  3DEP A;  4GTV A;  1QYM A;  3V2O A;  1FCH A;  3NF1 A;  3SGH A;  1S70 B;  4I17 A;  4WNE A;  2DCP A;  1HF8 A;  3G2T A;  3PEU B;  4HS2 A;  3CVU A;  3ZXP A;  4TXR A;  3MEK A;  3T5V A;  1N4R A;  4WWO A;  1L5J A;  4HI8 A;  3PNL B;  4JL0 A;  3QJZ A;  2XCB A;  1Z3X A;  3K9I A;  3ZUV B;  5KWD A;  3E32 A;  1OCR E;  3D9I A;  1KZO A;  1SW6 A;  3C72 A;  2LAI A;  4BT8 A;  3ZKJ A;  4XKC A;  4JD2 G;  4ACL A;  4DX1 A;  4H7X A;  4JW1 A;  4JB8 P;  2Q7F A;  1IHB A;  4I2Z A;  4DK5 A;  4LRZ A;  4Y6C A;  5DIZ A;  4KZ0 A;  4A3T A;  4HRM B;  2VSN A;  4AY5 A;  2NSZ A;  4GZ5 A;  4RQI A;  2XPI A;  3S2A A;  1U2V G;  1H2T C;  4K0R A;  5J08 A;  2PL2 A;  4U7E B;  2AWI A;  2QYJ A;  1TJC A;  3ZPJ A;  3ZFW A;  5HS0 A;  3PE4 A;  4I9C A;  2J8S D;  3VTX A;  4BWR A;  4L1B A;  3MJW A;  2L9B A;  4BER A;  2XEV A;  5E75 A;  2X6F A;  3OAW A;  4Y6W A;  3CVX A;  3QNK A;  3L54 A;  1N4S A;  2NC9 A;  5KJL A;  3LEW A;  5CCM A;  4FLH A;  4CT0 A;  2V4H C;  3ZHE B;  1IXV A;  2ETA A;  3DSS A;  3TWX A;  5EYP F;  2WQ7 A;  1LD8 A;  3C3O A;  4TXP A;  3LY7 A;  3FTV A;  4HBD A;  3NZS A;  2VQ2 A;  3B95 A;  3BG1 B;  4N5Q A;  3UM2 A;  3S7B A;  2CFZ A;  1IYG A;  3B7S A;  2GRQ B;  4OAV B;  4TUM A;  3E30 A;  3FUD A;  2FO7 A;  1UJK A;  2RFA A;  3RRN B;  3FTS A;  3RKV A;  3AG2 E;  4FJZ A;  4K03 A;  4XX5 A;  2B0O E;  1JCS A;  2FI7 A;  3AG1 E;  2J08 A;  3Q7A A;  4HNA D;  3FU3 A;  3B7R L;  2IY0 C;  3DXK G;  3EIJ A;  3LPZ A;  3PE3 A;  3CHM A;  1TNU A;  4O60 A;  4RG9 A;  4RG6 A;  3L22 A;  4LSZ E;  4WNF A;  4A3V A;  1SZA A;  3JUE A;  1WG0 A;  3I4R B;  4F1P A;  3MV2 B;  2EQX A;  2ZIS A;  4TXQ A;  4UI9 J;  3V30 A;  4U07 A;  5ENN A;  2NYJ A;  3KEZ A;  3QK0 A;  2XS1 A;  4JHR A;  3UI2 A;  3APD A;  1KT1 A;  1DCQ A;  5AIJ A;  4GCN A;  4AM9 A;  1HH8 A;  4ACK A;  5ENT D;  4GMR A;  3RAU A;  2WXO A;  4B89 A;  3VLE A;  5CBO A;  1K1B A;  3AS5 A;  3SO8 A;  2R5S A;  2V8S E;  5G2N A;  3Q4A B;  2DZN A;  2P9K G;  3TL5 A;  1OWL A;  5FZR A;  3PRE A;  4L23 A;  3T8M A;  4TUU A;  4GYY A;  5FZS A;  4G8L A;  4E6H A;  1SA5 A;  3X2Q E;  4KVM A;  2J9Q A;  3W9F A;  5LCW J;  3D9L A;  4GTS A;  1N52 A;  3CIA A;  3VTY A;  3CVY A;  2VGE A;  2J07 A;  3L9T A;  1QBQ A;  4GYW A;  4XI9 A;  4L2L A;  4U8H A;  5AYW D;  1ELR A;  2M63 A;  5LOZ A;  5AQB A;  1FVH A;  4G11 A;  3ULE G;  4CZ2 D;  2DYR E;  4O1P A;  3B7U X;  1SVX A;  4ILI A;  3TWW A;  3V31 A;  3QB2 A;  3D9J A;  1OWM A;  4MLP A;  1NP7 A;  4EHM A;  3HXC A;  4UQY A;  2OEV A;  1EYH A;  3UT8 A;  4LER A;  1Y6I A;  3MKR A;  2YQ8 A;  4Z68 A;  4D10 C;  3SFX A;  1TN8 A;  3FDH A;  4U0S A;  5BXU A;  3OXF A;  4BSZ B;  4J8D A;  4F7A A;  2I6H A;  3UM3 A;  3BU8 A;  5AJD A;  5FWQ A;  2OEW A;  4HOR A;  1H0A A;  4IRU A;  5CCL A;  4EPZ A;  2P9S G;  4WWN A;  5G05 C;  2DBA A;  3PUK A;  1TJF A;  4N3B A;  3U64 A;  3RU0 A;  5CMW A;  5D66 A;  4CGW A;  2P9L G;  2Y4T A;  1AP7 A;  3I3N A;  1E7U A;  1X81 A;  1H6K A;  2R03 A;  1BI7 B;  4DRX E;  4X8Q A;  5JHB A;  1ZBP A;  5HRY A;  2EIL E;  4G23 A;  4APF A;  5B3S E;  3GZ1 A;  4JPS A;  1OWO A;  3AG4 E;  4H7Y A;  2YNQ A;  2XEH A;  4MS6 A;  4LUN U;  3DSU A;  3Q47 B;  2P2C P;  3IHY A;  4F1S A;  3Q15 A;  1S64 A;  1XNF A;  4HRN A;  4DLQ A;  3D9K A;  4IUL A;  3UUX A;  4FC8 A;  2RKK A;  5G04 J;  3E34 A;  3UT4 A;  1U3D A;  4ANV A;  1O1S A;  5FQ4 A;  3NOC D;  3SZ7 A;  1OWP A;  3ABM E;  2C0L A;  1MX6 A;  3DWL G;  3PH0 C;  3I4G A;  1HX8 A;  3SF4 A;  1RW2 A;  4HXI A;  5M72 A;  4JC8 A;  1PC2 A;  3EDT B;  2IQC A;  2XQ0 A;  4B8A A;  1DNP A;  4RVB A;  1MX2 A;  4UUC A;  1MZC A;  4K5B A;  3DRA A;  5T4Y A;  3CVW A;  1KLX A;  1G3N B;  2WXH A;  1OY3 D;  2WXN A;  3IV0 A;  2F8X K;  2WXJ A;  2P9P G;  3ZEF A;  1A17 A;  3QC1 A;  1H2V C;  3QWW A;  1N0R A;  1Z3Y A;  5D0Q D;  3LJN A;  1IKN D;  4A1G A;  4GTR A;  1NI1 A;  4GZC A;  1MQS A;  4JEU A;  2WMN A;  3PVL A;  1WY6 A;  1MJ0 A;  3JQ1 A;  4ME2 A;  2GRN B;  3CSF A;  2PNN A;  4XIF A;  2LSU A;  3KAE A;  5EX3 A;  5AAR A;  4BX9 A;  1OCZ E;  3BQO A;  2I1K A;  2PZI A;  3EHN A;  3SY2 A;  5BV1 A;  4CDM A;  4F3V A;  4NUR A;  1SA4 A;  1KZP A;  1HG2 A;  4WNG A;  1UOH A;  4HLL A;  4KVO A;  2R2L A;  1JWG A;  3TWS A;  5EID A;  3AAA C;  2E0I A;  3FU0 A;  3SBT B;  3O48 A;  3PZD A;  2JEK A;  4B94 A;  5JJ7 A;  2R17 C;  4WWP A;  2PQN A;  5HKP A;  4KT6 B;  4GMJ A;  1K8K G;  5KJK A;  3L16 A;  2WQH A;  4WUY A;  3D9N A;  4GTO A;  3R9A B;  4L2Y A;  3B13 A;  4LNU D;  1MHQ A;  5CED B;  3R7R A;  3KD7 A;  3DST A;  5CRV A;  5BW8 C;  4GPM A;  4HLE A;  4UWL A;  3Q79 A;  4XEI G;  1IQR A;  1P5Q A;  3UT7 A;  2WMO A;  1K1A A;  3CVV A;  3D9M A;  2XRY A;  2A5U A;  4J0U A;  3ASD A;  1TN7 A;  1UG3 A;  2LNI A;  5CEC B;  4YDO A;  1BU9 A;  1EDU A;  2A5E A;  2P9I G;  1OUV A;  4I6J A;  1H6O A;  3SD5 A;  4YVO A;  4K5A B;  5BT1 A;  4LEU A;  5JJ6 A;  2KXP C;  3FUH A;  1Q2Z A;  1D8E A;  3FUK A;  1HXI A;  3J5P A;  3Q78 A;  3DSX A;  3VLD A;  1DCE A;  1OT8 A;  1S63 A;  2KAT A;  4IN3 B;  2GRM A;  3PZ1 A;  3CST A;  4MRU A;  1UN8 A;  2VTB B;  1V55 E;  4EEC A;  2P58 C;  4PS7 A;  3CHR A;  1TNO A;  4FJY A;  4BET A;  1TNB A;  3GYZ A;  5BPP A;  5FIO A;  2VSX E;  3TG5 A;  3BG0 B;  1EF1 C;  4A55 A;  2F37 A;  3NQP A;  2HR2 A;  4PS3 A;  3AG3 E;  4HB5 A;  4OVU A;  1IQU A;  3MGB A;  4GTM A;  4JVS A;  3MX3 A;  1A5E A;  3ESK A;  2Y4U A;  5E76 A;  3IXE A;  1RZ4 A;  5AJL A;  4I1O B;  3FU5 A;  2MYO A;  3TXN A;  4PH4 B;  1DVP A;  2IOL A;  3CHQ A;  2E2E A;  4PUC A;  3E33 A;  4GB9 A;  5JA4 D;  5FTP A;  2DZO A;  4TRQ A;  2OVB A;  3ZXS A;  1W3B A;  2PM6 A;  3UIN C;  4ANX A;  4GPK A;  5CHE E;  3PZ2 A;  2DVW A;  4BEP A;  4KZC A;  4ATG A;  2UY1 B;  3UKU G;  4U04 A;  1ZB1 A;  1HZ4 A;  2IJG X;  4O6F A;  4P29 A;  1PY1 A;  1N4P A;  3L08 A;  3QDN A;  3JCK C;  4DX7 D;  4HI9 A;  3CLJ A;  4A1S A;  2ETB A;  1HS6 A;  4AOF A;  4U8Y D;  1AWC B;  3CVQ A;  2Y69 E;  3FU6 A;  4I6E A;  5JMN D;  3IEG A;  2VGY A;  4FU3 A;  3U3W A;  2AXZ A;  3LKU A;  4GTQ A;  5CBN A;  2X6H A;  4I6G A;  4L9P A;  3TWT A;  4RLY A;  1BPO A;  4EQF A;  4GA0 A;  5BNW A;  3RSE G;  3Q9N C;  5AQA A;  5EIB E;  3ASN E;  3TJP A;  3ZNG A;  1OXJ A;  2RFM A;  2VTB A;  2H6G A;  4NIK A;  1KPS B;  5J90 A;  3FHE A;  3HG0 D;  2CHZ A;  2V4L A;  4N2Q A;  2J49 A;  3ONK A;  3RO2 A;  3I5P A;  3SFZ A;  1MYO A;  3MKQ B;  3TWV A;  3C3Q A;  3RK6 A;  4AP2 A;  3CHP A;  3HHM A;  3AS4 A;  3SNX A;  4ABN A;  1ELW A;  1BD8 A;  5EN5 D;  1E96 B;  3FUI A;  1YCS B;  5ARG A;  3EJN A;  3Q7F A;  2ETC A;  2CG2 A;  3TGO A;  2WXR A;  3TAX A;  4U63 A;  4YDE A;  5BXO A;  3RRU A;  3EUV A;  5ENS D;  1BI8 B;  4MBG A;  3TG4 A;  3F6Q A;  3MA5 A;  2UY1 A;  4C48 B;  3V2X A;  2C2L A;  2MOW A;  3T5X A;  3T8K A;  4KMO A;  5KBA A;  4NRH B;  2EIJ E;  3ULY A;  3PNT B;  2WM9 A;  4U96 D;  3OXG A;  3ML8 A;  4UWG A;  4LNG A;  4AVX A;  3FUF A;  2XZD G;  3CQC B;  2XGO A;  3ZW3 A;  2F8Y A;  2BED A;  4W9R A;  3FH7 A;  1MX4 A;  3FY4 A;  4FP7 A;  3CK7 A;  2ILR A;  3NB2 A;  2HO1 A;  3LS8 A;  4ANW A;  3HYM B;  3FTU A;  1FVF A;  2XS8 A;  1TNY A;  3ZYM A;  5AEN A;  4LG6 A;  4U0Z A;  3DBS A;  4B93 B;  2FEZ A;  3RRM B;  4J6I A;  2IFU A;  3W9G A;  4I2W A;  4J8Y A;  3ZYK A;  3IHV A;  3UTM A;  3CKB A;  2R59 A;  3PEV B;  4XE0 A;  2VYI A;  4Q96 A;  4XKB A;  2B6C A;  3CV0 A;  1SZ9 A;  3MKQ A;  3ZYQ A;  5ENP D;  3FEY A;  2R05 A;  4YND A;  2VSY A;  3S7D A;  5HI7 A;  4NAC A;  3U4T A;  3UMV A;  1N11 A;  1ELK A;  2OV8 A;  1QZ2 A;  3FH5 A;  3QWV A;  3APF A;  4ZFH A;  2IF4 A;  4DPR A;  4JXT A;  4AY6 A;  4JHK A;  4HOQ A;  3UM0 A;  1Z5S C;  3SHF A;  3HXD A;  2J4D A;  1FT2 A;  2IEJ A;  2LO6 A;  3JXJ A;  1YA0 A;  3Q9U C;  1KT0 A;  2WPV A;  2UWJ G;  3FH8 A;  3CGH A;  3HXB A;  1U3C A;  3R9M A;  2WVI A;  3ZRH A;  2PM7 A;  4F6R D;  2RG8 A;  3ASH A;  2LAH A;  3ENE A;  3PZ3 A;  2QC9 A;  3DXM G;  1IHG A;  2ION A;  4DX2 A;  3CVL A;  3AJI A; 
#chains in the Genus database with same CATH homology
 1N4S A;  4GTV A;  1TN8 A;  3SFX A;  2BED A;  1MZC A;  4GTO A;  1JCQ A;  2ZIR A;  1N9A A;  1LD7 A;  3DRA A;  1JCR A;  3EU5 A;  2H6G A;  3DSS A;  1TN6 A;  1LD8 A;  1N4R A;  4GTM A;  1N94 A;  4GTP A;  1TNY A;  3DST A;  1O1T A;  3DPY A;  3Q79 A;  1X81 A;  3E33 A;  1N4Q A;  3E32 A;  1KZO A;  3E30 A;  3C72 A;  4GTR A;  1NI1 A;  1SA5 A;  3HXE A;  1TN7 A;  3PZ4 A;  3PZ2 A;  4YDO A;  3SFY A;  3DSU A;  3Q7F A;  2H6H A;  4GTS A;  3KSQ A;  2F0Y A;  1JCS A;  1S64 A;  3E37 A;  3Q75 A;  3Q7A A;  1O5M A;  3DSV A;  1SA4 A;  4YDE A;  1QBQ A;  1KZP A;  3EUV A;  4MBG A;  3E34 A;  1N4P A;  1O1S A;  3DSW A;  1LTX A;  2R2L A;  1TNU A;  3KSL A;  4GTT A;  1D8E A;  1FPP A;  3HXD A;  1FT1 A;  1FT2 A;  2IEJ A;  3Q78 A;  3DSX A;  1DCE A;  1S63 A;  2H6I A;  1N95 A;  3PZ1 A;  4LNB A;  4EHM A;  2H6F A;  1D8D A;  3HXC A;  3HXB A;  2ZIS A;  1NL4 A;  4GTQ A;  1TNO A;  4LNG A;  3PZ3 A;  1TNB A;  3HXF A;  1O1R A;  3Q73 A;  1TNZ A;  4L9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...