3Q7AA

Cryptococcus neoformans protein farnesyltransferase in complex with fpp and l-778,123
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
330
structure length
315
Chain Sequence
b'TYIPMSQRRSWADVKPIMQDDGPNPVVPIMYSEEYKDAMDYFRAIAAKEEKSERALELTEIIVRMNPAHYTVWQYRFSLLTSLNKSLEDELRLMNEFAVQNLKSYQVWHHRLLLLDRISPQDPVSEIEYIHGSLLPDPKNYHTWAYLHWLYSHFSTLGRISEAQWGSELDWCNEMLRVDGRNNSAWGWRWYLRVSRPGAETSSRSLQDELIYILKSIHLIPHNVSAWNYLRGFLKHFSLPLVPILPAILPYTAFPMPSPLPEDTPLPVPLALEYLADSFIEQNRVDDAAKVFEKLSSEYDQMRAGYWEFRRRECA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyltransferase alpha subunit
publication title Structures of Cryptococcus neoformans Protein Farnesyltransferase Reveal Strategies for Developing Inhibitors That Target Fungal Pathogens.
pubmed doi rcsb
source organism Cryptococcus neoformans
molecule tags Transferase/transferase inhibitor
total genus 131
structure length 315
sequence length 330
ec nomenclature
pdb deposition date 2011-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3q7aA00
1O5MA 1O1TA 3E33A 3HXFA 3E34A 3DSUA 3PZ4A 1JCRA 2IEJA 3DRAA 4L9PA 1S64A 3DSTA 3DSVA 4MBGA 4GTQA 4GTMA 3SFXA 1MZCA 1N94A 1N4QA 3KSQA 2BEDA 1SA5A 1LTXA 1FPPA 2ZIRA 2H6IA 4GTOA 4YDOA 1O1RA 3DPYA 3E32A 1TNBA 3HXEA 3E37A 1N4RA 1NI1A 3HXCA 4LNGA 2F0YA 3PZ2A 3HXBA 2H6HA 3Q7FA 4GTRA 2R2LA 1TNZA 4GTVA 2H6FA 1TNYA 3EU5A 3KSLA 3C72A 1SA4A 3PZ1A 3Q78A 4GTPA 3DSSA 3Q7AA 1JCQA 4YDEA 1DCEA 1N4SA 1X81A 3E30A 1FT2A 1JCSA 1N9AA 1TNUA 4LNBA 3EUVA 1TN6A 1FT1A 2ZISA 3PZ3A 1D8DA 2H6GA 1LD7A 3DSWA 1LD8A 3SFYA 3Q79A 1O1SA 1KZOA 4EHMA 1NL4A 1TN7A 1S63A 3DSXA 1D8EA 3HXDA 3Q75A 1N4PA 3Q73A 1TN8A 4GTSA 1KZPA 1QBQA 1N95A 1TNOA 4GTTA
chains in the Genus database with same CATH superfamily
2R17C 2J4BA 4N2QA 3ZRHA 5HQ8A 4GZDA 4JHKA 4RLYA 3UQ3A 4JVSA 4J7WA 3TWSA 3L08A 4N2SA 3NOGD 4V3IA 2MOWA 1Z6TA 4IULA 3UT8A 3UM3A 2BEDA 3PE3A 2HYZA 3OXFA 4TV3A 4G2VA 4KZCA 4UQXA 2X6IA 2XEVA 5CCLA 3PEUB 1N4RA 3FHEA 2WXMA 5HS0A 3V30A 3FY4A 4I1AA 3UKRG 3HXBA 2H6HA 2AXVA 1WY6A 4HRLA 2GGFA 1TR4A 3L9TA 3D9LA 3MYVA 3CVVA 2AXZA 1OWPA 2UWJG 3MEKA 5LP0A 2QY7A 4YDEA 4G8LA 4JPSA 1X81A 4URKA 4TXPA 2P9KG 2ZGDA 3FEYA 1XGWA 3X2QE 2VTBB 2V5QC 4Q94A 1U2VG 3B7RL 4P29A 4O1PA 2GROB 3S7FA 5CMWA 3ZYMA 3UUXA 2H6GA 5AJDA 3AU4A 1FCHA 2IO2C 1N54A 4IN3B 3NB2A 2VSYA 3ABLE 1NL4A 3SBTB 2NYJA 5KCMA 1K1BA 3QWWA 2YHEA 3HXDA 2L0TB 4GTSA 4Q69A 4Y6WA 4RQIA 1TNOA 3FTVA 4FHJA 3G2WA 1UOHA 4C9BB 3D3MA 3FTZA 3NBNB 3EDTB 1PAQA 2EIME 3FULA 2FF4A 2WXKA 4EZLA 4MBGA 3HYMB 4EZJA 5LX8A 1ZU2A 5CERB 3CEQA 2NC9A 3L6AA 4G26A 4A3TA 4BFRA 5KJLA 4JXTA 3T8MA 2IOLA 3ISMC 1OUVA 5ENQD 2L9BA 2MHKA 3O4ZA 2JEKA 3AS8A 2XGSA 3Q7FA 1KLXA 3CKCA 1N11A 4F7AA 3CVWA 3K9IA 4KT6B 4HOUA 2EINE 1OCRE 3T5VA 4AJWA 1S70B 3GW4A 4GTPA 1UJKA 5EX0A 5FQ6A 4H7XA 5AARA 4E6HA 4BWRA 3UT7A 5D0OD 4TRQA 3PZDA 2XCCA 4AXHA 4RSYA 3ML9A 4N3BA 1E96B 3D9MA 1MHQA 5CECB 2WXQA 3LDZA 4BT8A 1NZNA 3CSTA 4I2WA 4BSXA 4LERA 2GRLA 1JWGA 4L7TA 3QC1A 2Q7FA 3CHOA 4A3VA 1IYGA 4JZYA 2XS8A 3KD7A 4EQFA 3UXGA 3HDXA 1O5MA 3E34A 4GA1A 1UN8A 5KWDA 2WVIA 3QNKA 4HLLA 3DPDA 3QWPA 2FI7A 4B93B 4KVOA 3ASDA 4ACLA 4UWKA 4OVUA 2AVPA 4AY5A 4G8KA 1U3DA 2WMOA 4ANUA 3FU6A 1VDYA 1P5QA 5AAOA 4J8EA 2B6CA 2Y4TA 3FU3A 3BUAA 3E32A 3FTXA 1YA0A 2UY1B 2KATA 3B7UX 3D9OA 3TWWA 5ANLA 3U3WA 3RJVA 5ENTD 3O48A 4PS7A 3Q4AB 3P1UA 3SGHA 3HIZA 4KYOB 4DI3A 1OCZE 4U0ZA 5C1DA 3VTYA 3EU5A 4F53A 1SZ9A 4U96D 3QAQA 3FTYA 1JCQA 4JHJA 5BT1A 1PY1A 1E7VA 1DCEA 4TXRA 5CEAA 3KEZA 3PS6A 2X3MA 4DRXE 3CQGB 3TXNA 4WNFA 3FH5A 2J4DA 4MRUA 4C48B 3MV3B 5CRVA 3ZU7B 5ENPD 2P9IG 4FLBA 4AIFA 4RG6A 2DCPA 2DZOA 4FU3A 3APCA 2GRNB 4CDNA 2CFZA 4UQYA 5EYLA 3ULEG 1N0QA 4XI9A 5KNGA 3JQ0A 1TN8A 4I1MA 3PNLB 2DWZA 3QB2A 4MLPA 5FWQA 4HOQA 4LNUD 1IQUA 2IEJA 3CVPA 2IO3C 2J09A 4GTMA 1V55E 3V2OA 3AJIA 3RO2A 1MZCA 3B7BA 1SA5A 1TEZA 4B0ZA 5FT9A 4L2YA 2WXGA 2H6IA 4U04A 2WMNA 3Q5MA 5KJKA 3V2XA 2V8SE 5G05J 1BU9A 3G2VA 2R2LA 1INZA 2CG3A 3UTMA 4GYYA 2BKGA 2CHWA 3MKQA 3PNTB 4K5AB 3RK6A 3LY9A 4DLQA 3D9NA 3L13A 3ZVVA 1YMPA 4QFVA 1A17A 3DXKG 1NP7A 1OWMA 1E8YA 4R7LA 3EHNA 2WQ7A 5T3RA 3FUNA 2R02A 2VJ8A 2XRYA 3SFYA 4I43A 1UN9A 3LJNA 3QARA 2J49A 4G23A 2YINA 3Q75A 5BNWA 2DYSE 3AS5A 1K1AA 3PZ4A 3ZPJA 2OCCE 3UINC 4DI4A 1JCRA 5G2NA 4UWLA 4CT4A 4JD2G 2OVFA 3LXUX 1MYOA 2OEWA 1V54E 5G04C 3OXGA 2F37A 2CHXA 1AP7A 1WDYA 2WXHA 1K8KG 3CVQA 1NI1A 5B1BE 3RO3A 4ME2A 5ITZF 3ML8A 1HG2A 3VLEA 1EPUA 3B7TA 5DIZA 3MGBA 3VTXA 1TNZA 4K5BA 3ENEA 2J9QA 3C72A 3R7QA 2FULA 2GRMA 4E85A 4O6FA 1N4SA 1Z3YA 4XZ4A 1TN6A 2R59A 5AQ9A 4I17A 3CLJA 4I2ZA 1MX4A 3LVRE 3IXEA 4U8YD 1OXJA 2X6JA 3EIJA 3URZA 2P9PG 1N52A 3D9HA 4N3AA 4BERA 2P9UG 2VYIA 3CHMA 2VQ2A 3GZ1A 3G2SA 4HS2A 3RAUA 4AM9A 2I9CA 1KPSB 1A5EA 2FO1E 1DC2A 4B8CB 2P2CP 2DZNA 3KSQA 3L16A 5AN8A 4GZ6A 3D9PA 3LY8A 3VLDA 3CR3A 3WXXA 3DPYA 3C5RA 2Y3AA 3CVUA 5HKPA 4PH4B 4L2LA 3HXCA 4LNGA 2EIKE 3T9KA 2VTBA 2KCLA 2PM7A 2R03A 4DX6D 3D9JA 1SW6A 5E76A 3KEAA 2XGMA 1TNYA 5A7DB 2F8YA 3PZ1A 4XE0A 4G24A 4DX1A 2LAIA 4FC8A 4U0UA 4B8AA 4N5QA 4UWFA 2WXNA 1HFAA 4RVBA 4CCAA 3FH7A 5CRUA 3ZGQA 4OVVA 3CVLA 3ONLA 4ATZD 2AJAA 4J8YA 4F1PA 3RSEG 4GZ5A 2AXUA 4HRNA 3ASHA 4BTBA 4FULA 4HB5A 2BTDA 1TN7A 3AG3E 4YVQC 4C0EA 1QQEA 2HE0A 2WB2A 5AENA 4HRMB 5J08A 4H7YA 2J07A 3TL5A 4ABNA 2X6KA 1GW6A 1H2UA 5KNHD 5AYWD 5EX3A 3SNXA 3U9WA 3C3OA 3SFXA 4B94A 1Q2ZA 1N4QA 4U7EB 1MX2A 2DBAA 2ZIRA 1E8XA 2ETBA 2NXPA 4WNGA 4Z68A 2HR2A 2JABA 1IQRA 2X6HA 4J8FA 3LPZA 4CZ2D 3EHQA 2ZXWE 4EPZA 3MZLB 4GPMA 4JHRA 3PRZA 4UI9C 2E0IA 3ZEFA 4BTAA 1HG5A 3APDA 3PREA 4GPKA 3ZXSA 4JB8P 5EILA 5JJ6A 4GMLA 4LNBA 4JEHA 2WXRA 4RG9A 2RG8A 2ZISA 5EIDA 4GZ3A 1LD8A 3TG5A 2WXJA 3ULQA 4GCNA 3B13A 4EHMA 3UX4A 1H2TC 2LXMA 4APOA 3Q73A 1RW2A 4DPRA 2A5UA 1DCQA 4OYSA 3DSUA 2IFUA 4XKBA 3W9FA 5AJLA 3UMVA 2UY1A 4DUIA 2F8XK 3LS8A 3TWRA 1XNFA 1DNPA 3G2UA 3W9GA 3IHVA 3IEGA 3FUFA 3LYAA 3Q9UC 3N71A 1SQMA 1FPPA 3FUJA 4LG6A 3TJPA 2WXLA 3PVLA 1L5JA 4HI8A 2L6JA 2AW6A 4NRHB 3JXIA 3V31A 3PE4A 1QNFA 3UI2A 2LSUA 4GA0A 3NZSA 1Y8MA 1K3ZD 2VGYA 4PS3A 2WQ6A 4LUNU 3R9AB 2QYUA 2CHZA 2WXOA 3AS4A 5T4YA 4GAAA 4Y6CA 3DSWA 1H6KA 1BI8B 1PC2A 3ABME 2L0IA 3RRMB 3I5PA 3TWTA 5A23A 3UT4A 3ABKE 3NOCD 3S7BA 3G2TA 4BEPA 1U3CA 3Q15A 1N0RA 3QKYA 3SI5A 2BKKB 5ENOD 2VGEA 1AWCB 1ELWA 2PL2A 2LUHA 4TXQA 2L6BA 4U0SA 1UW4B 4HNAD 1Z3XA 2A4ZA 2C2LA 1ELRA 5ENNA 2GRQB 4AOFA 3D9KA 2VGXB 4TUUA 2QYJA 5LOZA 1O1RA 2P9LG 3HHMA 1SVXA 1X5BA 1JUQA 1QYMA 3CKBA 5EIBE 4I1OB 2FO7A 3CVXA 2I6HA 4GTVA 4GCOA 3KSLA 3Q7AA 3HG0D 5HI7A 4DX2A 2YQ8A 2DVWA 3EJNA 5D0QD 5KBAA 1ELKA 2VSNA 4N39A 4WAFA 4NURA 4KZ0A 1E7UA 4HOSA 4M3OA 3AU5A 4JW1A 2PZIA 3I4GA 3ZN3A 1D8DA 3MX3A 1UG3A 3ASOE 5G04J 3Q79A 2KXPC 3WG7E 1NA0A 1E8WA 4WUYA 5AQBA 4XIFA 3JXJA 5D66A 1N4PA 4F1SA 1N95A 5D2MC 3SZ7A 3TWQA 4N5CA 1H0AA 3ASNE 3OAWA 1BD8A 3FFLA 3IBEA 1LF8A 5E75A 3DXMG 1HH8A 1E8ZA 4OAVB 4CT0A 3QK0A 4X8QA 5ARGA 2XZDG 2OOEA 1JWFA 5C2YA 3C3RA 4PS8A 1TNBA 1IHBA 5CHEE 3CSFA 2XPYA 2EILE 4GB9A 3LVQE 2I1JA 4BT9A 3ZYQA 5JHAA 3AAAC 5CBOA 4KXKB 2B0OE 2H6FA 4FLHA 3L82A 5G05C 4UI9K 1SA4A 5BXUA 2OVBA 2PQNA 4K03A 2WPVA 3P2BA 3L17A 2BF0X 4PDXA 2XPZA 3JUIA 2P9NG 4CDRA 3MCXA 2C0LA 3ZHEB 4HVBA 3DBSA 2OV8A 3PUJA 3I3NA 2HM8A 3C98A 3CK7A 3C3QA 3FTSA 3SO8A 3CV0A 2XS1A 1S63A 2V4HC 4U07A 3QJZA 1Y6IA 3E4BA 3FTWA 4UWHA 4U8HA 1W3BA 1QBQA 1HZ4A 1D9SA 3SY2A 4EECA 5JJTA 4YDWA 3BG0B 3VLFA 4EBAA 3FP3A 2ZGGA 4BSZB 3CHQA 4JC8A 2HO1A 3EIQC 3UIPC 3UM0A 3LKUA 3PUKA 4UWGA 1LTXA 2J08A 3DEPA 3LEWA 3GZ2A 4FJZA 5BXOA 3HXEA 3U64A 5ARFA 5ENSD 2F0YA 1HS6A 2MRIA 1WAO1 3MV2B 2KZTB 4NIKA 1H6OA 3FU5A 4A1SA 3NAWA 2R05A 2IOSA 1TYQG 3J5PA 4IRUA 3NF1A 1OT8A 3ZYKA 1FT2A 1JCSA 4A1GA 4ZFHA 2XENA 4IYPA 3EUVA 2PM6A 4ANWA 3TWXA 5LCWC 4BETA 3S7DA 5EYPF 3HVEB 3APFA 1FT1A 4ACKA 2QFCA 1KZOA 4WNDA 5G55A 4MKTA 4FADA 2EQXA 4I6GA 3NZUA 5CMYA 4HLEA 1KT0A 5M72A 4NQ0A 2V0PA 2I2OA 5FTPA 5IY5E 3RKVA 4UI9J 1HE8A 4J8DA 3FEXA 2PQRA 4DX5D 3CHSA 4A63B 2ONDA 3JQ1A 2XQ0A 4GTOA 4O60A 4I9EA 1NA3A 1SZAA 3ZW3A 5T8IA 5CCMA 5EKQD 2MYOA 4L1BA 3FUMA 2FBNA 5FQ8A 3R7RA 3ZYLA 1YYHA 1FVHA 3CHPA 4GMJA 3TAXA 3BU8A 2XCBA 3Q78A 2IY0C 2LAHA 4ATGA 3FH8A 5CEDB 3ASGA 1E90A 1NFIE 3EHRA 3UKUG 3ZNGA 3T5XA 3ZKJA 1TJFA 2ILRA 1OWLA 5KJNA 4O1OA 3D9IA 3LCAA 5ANRA 1UJJA 1G3NB 3RIBA 4CGVA 3U66A 4XX5A 5JHBA 4YDYA 3CVNA 4ANVA 3PDNA 4KVMA 3I4RB 4AV7A 4AY6A 3ZFWA 3DRAA 3CIAA 3AG4E 4HFGA 1OWNA 3UM1A 3DSVA 2RFMA 4BX8A 4WNEA 5FQ7A 4BX9A 2XPIA 4DLOA 4DX7D 3L22A 4YDOA 2P9SG 4I6EA 3DWLG 4GYWA 3ZXPA 3V79K 5ENRD 3E37A 4MS6A 3FWVA 4APFA 4JL0A 4ANXA 1EYHA 3RRNB 1H6PA 4PUCA 3OTNA 2DIWA 4XEIG 3F6QA 3SD5A 4CYMD 4YVOA 3SQVA 3CHRA 3DSSA 2J8SD 2FEZA 3RRUA 4ILHB 4FHKA 2Y1LE 2KCVA 3PZ3A 4J0UA 4BESA 2RD0A 2KCKA 1OCOE 2ETAA 1H2VC 2KM4A 4CEMA 3DSXA 4OAUC 3BG1B 3MA5A 1BLXB 1KZPA 2VGXA 4N3CA 2RFAA 2CFUA 4I6JA 4M7CA 3ULYA 3HXFA 3TGOA 5BUZA 4Q96A 5FQ4A 3IKOB 2DYRE 1WM5A 1S64A 4KBQA 3TWUA 5JMND 4CGWA 3EHMA 4AP2A 2WQHA 3R9MA 3B7SA 4DK5A 1FVFA 1DVPA 3UIOC 2QC9A 3SFZA 4LCTA 1ZB1A 3EU9A 4HQDA 5BV1A 2EIJE 2IJGX 3TXMA 5A6CA 2VSOE 5LFAA 1OCCE 4JA9A 3L54A 4EZKA 1Z5SC 5FJYA 5KJMA 2AWIA 3KS2A 3ASFA 4HI9A 5FINA 4UQZA 3NQPA 1HX8A 1HF8A 4GTRA 4TUMA 4G11A 2WXPA 3FUKA 3TWVA 4K0RA 5AQ7A 5JA4D 4FA6A 4WWOA 4G1TA 1BPOA 2LXLA 5FZSA 3BQOA 3S2AA 5AIJA 4ILIA 2IQCA 1JPLA 1TNUA 3IV0A 2NSZA 2Y4UA 3MKRA 4CDMA 5J90A 4XI0A 3AG1E 2KBXA 4ZHBA 4HOTA 3OXLA 3SF4A 2P58C 3KAEA 3Q47B 1IHGA 4J8SA 5B3SE 3S7JA 4CRWA 3FUEA 3BEEA 4FJYA 1D8EA 1BI7B 2V4LA 2GRRB 4K5CA 2LSVA 3PEVB 2LO6A 5FIOA 3SHFA 4U63A 3PH0C 5BV0A 4L9PA 4GU5A 3DSTA 3U4TA 4GMRA 3LY7A 5EN5D 4GTQA 5FZRA 1S0PA 5JJ7A 4KMOA 1RZ4A 4HXIA 4BY6A 3Q49B 2KC7A 2XEHA 1N94A 4YNDA 2XEEA 1OWOA 3ZIMA 4F6RD 4AVXA 4C0MA 2WXIA 1EDUA 4JA7A 3PZ2A 4WWNA 2LNIA 2IF4A 4HBDA 3MJWA 3JUEA 4I9CA 3T8KA 3UM2A 3UPVA 1WG0A 3ZHEA 1KT1A 1QZ2A 4UUCA 3DEOA 5H7PA 3TG4A 4U8VD 2ETCA 3FU0A 3QDNA 2R5SA 4NACA 2RKKA 1N9AA 2V5FA 2WM9A 2YHCA 3ONKA 4WWPA 3QOUA 4ILGA 4XKCA 4L23A 3JCKC 4EBAG 4W9RA 1MX6A 1LD7A 2I1KA 3MKQB 2YNQA 3J5QB 4HORA 3CK9A 3QWVA 3FUHA 1IXVA 3RU0A 2BUGA 4G25A 4F3VA 4AEZC 3IHYA 1ZBPA 4GTTA 3ZUVB 1O1TA 3E33A 2QZAA 2XZTG 2JLBA 3FTUA 2X6FA 5HRYA 3FDHA 5B1AE 4FP7A 5EDSA 1HU3A 2KZTA 4GZCA 3JYSA 3CGHA 4D10C 2PNNA 4LEUA 4GA2A 1IKND 2ZU6B 1OY3D 3CK8A 1HXIA 2Y0BG 3Q9NC 1HO8A 2XRZA 2Y69E 4A55A 5LCWJ 4JEUA 3CVYA 4LSZE 3GZSA 1TJCA 2XGOA 5BPPA 3HRAA 5BW8C 3HVEA 3GYZA 4GYOA 4U95D 3FUDA 3SBSA 3B95A 4LRZA 2OEVA 1EF1C 2CG2A 2XHEA 3E30A 2GW1A 5FZQA 4QQIA 1MJ0A 1H19A 3LJ3A 2GRPB 3AG2E 2C0MA 2VSXE 3FUIA 4J6IA 5CBNA 2IONA 2A5EA 1O1SA 3ESLA 4B89A 3CQCB 3ESKA 5AQAA 1YCSB 2X38A 2IU1A 2WXFA 1MQSA 1B89A 2E2EA 2M63A 4DJAA 5DBKA
chains in the Genus database with same CATH topology
1O5MA 1O1TA 3E33A 3HXFA 3E34A 3DSUA 3PZ4A 1JCRA 2IEJA 3DRAA 4L9PA 1S64A 3DSTA 3DSVA 4MBGA 4GTQA 4GTMA 3SFXA 1MZCA 1N94A 1N4QA 3KSQA 2BEDA 1SA5A 1LTXA 1FPPA 2ZIRA 2H6IA 4GTOA 4YDOA 1O1RA 3DPYA 3E32A 1TNBA 3HXEA 3E37A 1N4RA 1NI1A 3HXCA 4LNGA 2F0YA 3PZ2A 3HXBA 2H6HA 3Q7FA 4GTRA 2R2LA 1TNZA 4GTVA 2H6FA 1TNYA 3EU5A 3KSLA 3C72A 1SA4A 3PZ1A 3Q78A 4GTPA 3DSSA 3Q7AA 1JCQA 4YDEA 1DCEA 1N4SA 1X81A 3E30A 1FT2A 1JCSA 1N9AA 1TNUA 4LNBA 3EUVA 1TN6A 1FT1A 2ZISA 3PZ3A 1D8DA 2H6GA 1LD7A 3DSWA 1LD8A 3SFYA 3Q79A 1O1SA 1KZOA 4EHMA 1NL4A 1TN7A 1S63A 3DSXA 1D8EA 3HXDA 3Q75A 1N4PA 3Q73A 1TN8A 4GTSA 1KZPA 1QBQA 1N95A 1TNOA 4GTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O5M A;  1O1T A;  3E33 A;  3HXF A;  3E34 A;  3DSU A;  3PZ4 A;  1JCR A;  2IEJ A;  3DRA A;  4L9P A;  1S64 A;  3DST A;  3DSV A;  4MBG A;  4GTQ A;  4GTM A;  3SFX A;  1MZC A;  1N94 A;  1N4Q A;  3KSQ A;  2BED A;  1SA5 A;  1LTX A;  1FPP A;  2ZIR A;  2H6I A;  4GTO A;  4YDO A;  1O1R A;  3DPY A;  3E32 A;  1TNB A;  3HXE A;  3E37 A;  1N4R A;  1NI1 A;  3HXC A;  4LNG A;  2F0Y A;  3PZ2 A;  3HXB A;  2H6H A;  3Q7F A;  4GTR A;  2R2L A;  1TNZ A;  4GTV A;  2H6F A;  1TNY A;  3EU5 A;  3KSL A;  3C72 A;  1SA4 A;  3PZ1 A;  3Q78 A;  4GTP A;  3DSS A;  3Q7A A;  1JCQ A;  4YDE A;  1DCE A;  1N4S A;  1X81 A;  3E30 A;  1FT2 A;  1JCS A;  1N9A A;  1TNU A;  4LNB A;  3EUV A;  1TN6 A;  1FT1 A;  2ZIS A;  3PZ3 A;  1D8D A;  2H6G A;  1LD7 A;  3DSW A;  1LD8 A;  3SFY A;  3Q79 A;  1O1S A;  1KZO A;  4EHM A;  1NL4 A;  1TN7 A;  1S63 A;  3DSX A;  1D8E A;  3HXD A;  3Q75 A;  1N4P A;  3Q73 A;  1TN8 A;  4GTS A;  1KZP A;  1QBQ A;  1N95 A;  1TNO A;  4GTT A; 
#chains in the Genus database with same CATH topology
 2R17 C;  2J4B A;  4N2Q A;  3ZRH A;  5HQ8 A;  4GZD A;  4JHK A;  4RLY A;  3UQ3 A;  4JVS A;  4J7W A;  3TWS A;  3L08 A;  4N2S A;  3NOG D;  4V3I A;  2MOW A;  1Z6T A;  4IUL A;  3UT8 A;  3UM3 A;  2BED A;  3PE3 A;  2HYZ A;  3OXF A;  4TV3 A;  4G2V A;  4KZC A;  4UQX A;  2X6I A;  2XEV A;  5CCL A;  3PEU B;  1N4R A;  3FHE A;  2WXM A;  5HS0 A;  3V30 A;  3FY4 A;  4I1A A;  3UKR G;  3HXB A;  2H6H A;  2AXV A;  1WY6 A;  4HRL A;  2GGF A;  1TR4 A;  3L9T A;  3D9L A;  3MYV A;  3CVV A;  2AXZ A;  1OWP A;  2UWJ G;  3MEK A;  5LP0 A;  2QY7 A;  4YDE A;  4G8L A;  4JPS A;  1X81 A;  4URK A;  4TXP A;  2P9K G;  2ZGD A;  3FEY A;  1XGW A;  3X2Q E;  2VTB B;  2V5Q C;  4Q94 A;  1U2V G;  3B7R L;  4P29 A;  4O1P A;  2GRO B;  3S7F A;  5CMW A;  3ZYM A;  3UUX A;  2H6G A;  5AJD A;  3AU4 A;  1FCH A;  2IO2 C;  1N54 A;  4IN3 B;  3NB2 A;  2VSY A;  3ABL E;  1NL4 A;  3SBT B;  2NYJ A;  5KCM A;  1K1B A;  3QWW A;  2YHE A;  3HXD A;  2L0T B;  4GTS A;  4Q69 A;  4Y6W A;  4RQI A;  1TNO A;  3FTV A;  4FHJ A;  3G2W A;  1UOH A;  4C9B B;  3D3M A;  3FTZ A;  3NBN B;  3EDT B;  1PAQ A;  2EIM E;  3FUL A;  2FF4 A;  2WXK A;  4EZL A;  4MBG A;  3HYM B;  4EZJ A;  5LX8 A;  1ZU2 A;  5CER B;  3CEQ A;  2NC9 A;  3L6A A;  4G26 A;  4A3T A;  4BFR A;  5KJL A;  4JXT A;  3T8M A;  2IOL A;  3ISM C;  1OUV A;  5ENQ D;  2L9B A;  2MHK A;  3O4Z A;  2JEK A;  3AS8 A;  2XGS A;  3Q7F A;  1KLX A;  3CKC A;  1N11 A;  4F7A A;  3CVW A;  3K9I A;  4KT6 B;  4HOU A;  2EIN E;  1OCR E;  3T5V A;  4AJW A;  1S70 B;  3GW4 A;  4GTP A;  1UJK A;  5EX0 A;  5FQ6 A;  4H7X A;  5AAR A;  4E6H A;  4BWR A;  3UT7 A;  5D0O D;  4TRQ A;  3PZD A;  2XCC A;  4AXH A;  4RSY A;  3ML9 A;  4N3B A;  1E96 B;  3D9M A;  1MHQ A;  5CEC B;  2WXQ A;  3LDZ A;  4BT8 A;  1NZN A;  3CST A;  4I2W A;  4BSX A;  4LER A;  2GRL A;  1JWG A;  4L7T A;  3QC1 A;  2Q7F A;  3CHO A;  4A3V A;  1IYG A;  4JZY A;  2XS8 A;  3KD7 A;  4EQF A;  3UXG A;  3HDX A;  1O5M A;  3E34 A;  4GA1 A;  1UN8 A;  5KWD A;  2WVI A;  3QNK A;  4HLL A;  3DPD A;  3QWP A;  2FI7 A;  4B93 B;  4KVO A;  3ASD A;  4ACL A;  4UWK A;  4OVU A;  2AVP A;  4AY5 A;  4G8K A;  1U3D A;  2WMO A;  4ANU A;  3FU6 A;  1VDY A;  1P5Q A;  5AAO A;  4J8E A;  2B6C A;  2Y4T A;  3FU3 A;  3BUA A;  3E32 A;  3FTX A;  1YA0 A;  2UY1 B;  2KAT A;  3B7U X;  3D9O A;  3TWW A;  5ANL A;  3U3W A;  3RJV A;  5ENT D;  3O48 A;  4PS7 A;  3Q4A B;  3P1U A;  3SGH A;  3HIZ A;  4KYO B;  4DI3 A;  1OCZ E;  4U0Z A;  5C1D A;  3VTY A;  3EU5 A;  4F53 A;  1SZ9 A;  4U96 D;  3QAQ A;  3FTY A;  1JCQ A;  4JHJ A;  5BT1 A;  1PY1 A;  1E7V A;  1DCE A;  4TXR A;  5CEA A;  3KEZ A;  3PS6 A;  2X3M A;  4DRX E;  3CQG B;  3TXN A;  4WNF A;  3FH5 A;  2J4D A;  4MRU A;  4C48 B;  3MV3 B;  5CRV A;  3ZU7 B;  5ENP D;  2P9I G;  4FLB A;  4AIF A;  4RG6 A;  2DCP A;  2DZO A;  4FU3 A;  3APC A;  2GRN B;  4CDN A;  2CFZ A;  4UQY A;  5EYL A;  3ULE G;  1N0Q A;  4XI9 A;  5KNG A;  3JQ0 A;  1TN8 A;  4I1M A;  3PNL B;  2DWZ A;  3QB2 A;  4MLP A;  5FWQ A;  4HOQ A;  4LNU D;  1IQU A;  2IEJ A;  3CVP A;  2IO3 C;  2J09 A;  4GTM A;  1V55 E;  3V2O A;  3AJI A;  3RO2 A;  1MZC A;  3B7B A;  1SA5 A;  1TEZ A;  4B0Z A;  5FT9 A;  4L2Y A;  2WXG A;  2H6I A;  4U04 A;  2WMN A;  3Q5M A;  5KJK A;  3V2X A;  2V8S E;  5G05 J;  1BU9 A;  3G2V A;  2R2L A;  1INZ A;  2CG3 A;  3UTM A;  4GYY A;  2BKG A;  2CHW A;  3MKQ A;  3PNT B;  4K5A B;  3RK6 A;  3LY9 A;  4DLQ A;  3D9N A;  3L13 A;  3ZVV A;  1YMP A;  4QFV A;  1A17 A;  3DXK G;  1NP7 A;  1OWM A;  1E8Y A;  4R7L A;  3EHN A;  2WQ7 A;  5T3R A;  3FUN A;  2R02 A;  2VJ8 A;  2XRY A;  3SFY A;  4I43 A;  1UN9 A;  3LJN A;  3QAR A;  2J49 A;  4G23 A;  2YIN A;  3Q75 A;  5BNW A;  2DYS E;  3AS5 A;  1K1A A;  3PZ4 A;  3ZPJ A;  2OCC E;  3UIN C;  4DI4 A;  1JCR A;  5G2N A;  4UWL A;  4CT4 A;  4JD2 G;  2OVF A;  3LXU X;  1MYO A;  2OEW A;  1V54 E;  5G04 C;  3OXG A;  2F37 A;  2CHX A;  1AP7 A;  1WDY A;  2WXH A;  1K8K G;  3CVQ A;  1NI1 A;  5B1B E;  3RO3 A;  4ME2 A;  5ITZ F;  3ML8 A;  1HG2 A;  3VLE A;  1EPU A;  3B7T A;  5DIZ A;  3MGB A;  3VTX A;  1TNZ A;  4K5B A;  3ENE A;  2J9Q A;  3C72 A;  3R7Q A;  2FUL A;  2GRM A;  4E85 A;  4O6F A;  1N4S A;  1Z3Y A;  4XZ4 A;  1TN6 A;  2R59 A;  5AQ9 A;  4I17 A;  3CLJ A;  4I2Z A;  1MX4 A;  3LVR E;  3IXE A;  4U8Y D;  1OXJ A;  2X6J A;  3EIJ A;  3URZ A;  2P9P G;  1N52 A;  3D9H A;  4N3A A;  4BER A;  2P9U G;  2VYI A;  3CHM A;  2VQ2 A;  3GZ1 A;  3G2S A;  4HS2 A;  3RAU A;  4AM9 A;  2I9C A;  1KPS B;  1A5E A;  2FO1 E;  1DC2 A;  4B8C B;  2P2C P;  2DZN A;  3KSQ A;  3L16 A;  5AN8 A;  4GZ6 A;  3D9P A;  3LY8 A;  3VLD A;  3CR3 A;  3WXX A;  3DPY A;  3C5R A;  2Y3A A;  3CVU A;  5HKP A;  4PH4 B;  4L2L A;  3HXC A;  4LNG A;  2EIK E;  3T9K A;  2VTB A;  2KCL A;  2PM7 A;  2R03 A;  4DX6 D;  3D9J A;  1SW6 A;  5E76 A;  3KEA A;  2XGM A;  1TNY A;  5A7D B;  2F8Y A;  3PZ1 A;  4XE0 A;  4G24 A;  4DX1 A;  2LAI A;  4FC8 A;  4U0U A;  4B8A A;  4N5Q A;  4UWF A;  2WXN A;  1HFA A;  4RVB A;  4CCA A;  3FH7 A;  5CRU A;  3ZGQ A;  4OVV A;  3CVL A;  3ONL A;  4ATZ D;  2AJA A;  4J8Y A;  4F1P A;  3RSE G;  4GZ5 A;  2AXU A;  4HRN A;  3ASH A;  4BTB A;  4FUL A;  4HB5 A;  2BTD A;  1TN7 A;  3AG3 E;  4YVQ C;  4C0E A;  1QQE A;  2HE0 A;  2WB2 A;  5AEN A;  4HRM B;  5J08 A;  4H7Y A;  2J07 A;  3TL5 A;  4ABN A;  2X6K A;  1GW6 A;  1H2U A;  5KNH D;  5AYW D;  5EX3 A;  3SNX A;  3U9W A;  3C3O A;  3SFX A;  4B94 A;  1Q2Z A;  1N4Q A;  4U7E B;  1MX2 A;  2DBA A;  2ZIR A;  1E8X A;  2ETB A;  2NXP A;  4WNG A;  4Z68 A;  2HR2 A;  2JAB A;  1IQR A;  2X6H A;  4J8F A;  3LPZ A;  4CZ2 D;  3EHQ A;  2ZXW E;  4EPZ A;  3MZL B;  4GPM A;  4JHR A;  3PRZ A;  4UI9 C;  2E0I A;  3ZEF A;  4BTA A;  1HG5 A;  3APD A;  3PRE A;  4GPK A;  3ZXS A;  4JB8 P;  5EIL A;  5JJ6 A;  4GML A;  4LNB A;  4JEH A;  2WXR A;  4RG9 A;  2RG8 A;  2ZIS A;  5EID A;  4GZ3 A;  1LD8 A;  3TG5 A;  2WXJ A;  3ULQ A;  4GCN A;  3B13 A;  4EHM A;  3UX4 A;  1H2T C;  2LXM A;  4APO A;  3Q73 A;  1RW2 A;  4DPR A;  2A5U A;  1DCQ A;  4OYS A;  3DSU A;  2IFU A;  4XKB A;  3W9F A;  5AJL A;  3UMV A;  2UY1 A;  4DUI A;  2F8X K;  3LS8 A;  3TWR A;  1XNF A;  1DNP A;  3G2U A;  3W9G A;  3IHV A;  3IEG A;  3FUF A;  3LYA A;  3Q9U C;  3N71 A;  1SQM A;  1FPP A;  3FUJ A;  4LG6 A;  3TJP A;  2WXL A;  3PVL A;  1L5J A;  4HI8 A;  2L6J A;  2AW6 A;  4NRH B;  3JXI A;  3V31 A;  3PE4 A;  1QNF A;  3UI2 A;  2LSU A;  4GA0 A;  3NZS A;  1Y8M A;  1K3Z D;  2VGY A;  4PS3 A;  2WQ6 A;  4LUN U;  3R9A B;  2QYU A;  2CHZ A;  2WXO A;  3AS4 A;  5T4Y A;  4GAA A;  4Y6C A;  3DSW A;  1H6K A;  1BI8 B;  1PC2 A;  3ABM E;  2L0I A;  3RRM B;  3I5P A;  3TWT A;  5A23 A;  3UT4 A;  3ABK E;  3NOC D;  3S7B A;  3G2T A;  4BEP A;  1U3C A;  3Q15 A;  1N0R A;  3QKY A;  3SI5 A;  2BKK B;  5ENO D;  2VGE A;  1AWC B;  1ELW A;  2PL2 A;  2LUH A;  4TXQ A;  2L6B A;  4U0S A;  1UW4 B;  4HNA D;  1Z3X A;  2A4Z A;  2C2L A;  1ELR A;  5ENN A;  2GRQ B;  4AOF A;  3D9K A;  2VGX B;  4TUU A;  2QYJ A;  5LOZ A;  1O1R A;  2P9L G;  3HHM A;  1SVX A;  1X5B A;  1JUQ A;  1QYM A;  3CKB A;  5EIB E;  4I1O B;  2FO7 A;  3CVX A;  2I6H A;  4GTV A;  4GCO A;  3KSL A;  3Q7A A;  3HG0 D;  5HI7 A;  4DX2 A;  2YQ8 A;  2DVW A;  3EJN A;  5D0Q D;  5KBA A;  1ELK A;  2VSN A;  4N39 A;  4WAF A;  4NUR A;  4KZ0 A;  1E7U A;  4HOS A;  4M3O A;  3AU5 A;  4JW1 A;  2PZI A;  3I4G A;  3ZN3 A;  1D8D A;  3MX3 A;  1UG3 A;  3ASO E;  5G04 J;  3Q79 A;  2KXP C;  3WG7 E;  1NA0 A;  1E8W A;  4WUY A;  5AQB A;  4XIF A;  3JXJ A;  5D66 A;  1N4P A;  4F1S A;  1N95 A;  5D2M C;  3SZ7 A;  3TWQ A;  4N5C A;  1H0A A;  3ASN E;  3OAW A;  1BD8 A;  3FFL A;  3IBE A;  1LF8 A;  5E75 A;  3DXM G;  1HH8 A;  1E8Z A;  4OAV B;  4CT0 A;  3QK0 A;  4X8Q A;  5ARG A;  2XZD G;  2OOE A;  1JWF A;  5C2Y A;  3C3R A;  4PS8 A;  1TNB A;  1IHB A;  5CHE E;  3CSF A;  2XPY A;  2EIL E;  4GB9 A;  3LVQ E;  2I1J A;  4BT9 A;  3ZYQ A;  5JHA A;  3AAA C;  5CBO A;  4KXK B;  2B0O E;  2H6F A;  4FLH A;  3L82 A;  5G05 C;  4UI9 K;  1SA4 A;  5BXU A;  2OVB A;  2PQN A;  4K03 A;  2WPV A;  3P2B A;  3L17 A;  2BF0 X;  4PDX A;  2XPZ A;  3JUI A;  2P9N G;  4CDR A;  3MCX A;  2C0L A;  3ZHE B;  4HVB A;  3DBS A;  2OV8 A;  3PUJ A;  3I3N A;  2HM8 A;  3C98 A;  3CK7 A;  3C3Q A;  3FTS A;  3SO8 A;  3CV0 A;  2XS1 A;  1S63 A;  2V4H C;  4U07 A;  3QJZ A;  1Y6I A;  3E4B A;  3FTW A;  4UWH A;  4U8H A;  1W3B A;  1QBQ A;  1HZ4 A;  1D9S A;  3SY2 A;  4EEC A;  5JJT A;  4YDW A;  3BG0 B;  3VLF A;  4EBA A;  3FP3 A;  2ZGG A;  4BSZ B;  3CHQ A;  4JC8 A;  2HO1 A;  3EIQ C;  3UIP C;  3UM0 A;  3LKU A;  3PUK A;  4UWG A;  1LTX A;  2J08 A;  3DEP A;  3LEW A;  3GZ2 A;  4FJZ A;  5BXO A;  3HXE A;  3U64 A;  5ARF A;  5ENS D;  2F0Y A;  1HS6 A;  2MRI A;  1WAO 1;  3MV2 B;  2KZT B;  4NIK A;  1H6O A;  3FU5 A;  4A1S A;  3NAW A;  2R05 A;  2IOS A;  1TYQ G;  3J5P A;  4IRU A;  3NF1 A;  1OT8 A;  3ZYK A;  1FT2 A;  1JCS A;  4A1G A;  4ZFH A;  2XEN A;  4IYP A;  3EUV A;  2PM6 A;  4ANW A;  3TWX A;  5LCW C;  4BET A;  3S7D A;  5EYP F;  3HVE B;  3APF A;  1FT1 A;  4ACK A;  2QFC A;  1KZO A;  4WND A;  5G55 A;  4MKT A;  4FAD A;  2EQX A;  4I6G A;  3NZU A;  5CMY A;  4HLE A;  1KT0 A;  5M72 A;  4NQ0 A;  2V0P A;  2I2O A;  5FTP A;  5IY5 E;  3RKV A;  4UI9 J;  1HE8 A;  4J8D A;  3FEX A;  2PQR A;  4DX5 D;  3CHS A;  4A63 B;  2OND A;  3JQ1 A;  2XQ0 A;  4GTO A;  4O60 A;  4I9E A;  1NA3 A;  1SZA A;  3ZW3 A;  5T8I A;  5CCM A;  5EKQ D;  2MYO A;  4L1B A;  3FUM A;  2FBN A;  5FQ8 A;  3R7R A;  3ZYL A;  1YYH A;  1FVH A;  3CHP A;  4GMJ A;  3TAX A;  3BU8 A;  2XCB A;  3Q78 A;  2IY0 C;  2LAH A;  4ATG A;  3FH8 A;  5CED B;  3ASG A;  1E90 A;  1NFI E;  3EHR A;  3UKU G;  3ZNG A;  3T5X A;  3ZKJ A;  1TJF A;  2ILR A;  1OWL A;  5KJN A;  4O1O A;  3D9I A;  3LCA A;  5ANR A;  1UJJ A;  1G3N B;  3RIB A;  4CGV A;  3U66 A;  4XX5 A;  5JHB A;  4YDY A;  3CVN A;  4ANV A;  3PDN A;  4KVM A;  3I4R B;  4AV7 A;  4AY6 A;  3ZFW A;  3DRA A;  3CIA A;  3AG4 E;  4HFG A;  1OWN A;  3UM1 A;  3DSV A;  2RFM A;  4BX8 A;  4WNE A;  5FQ7 A;  4BX9 A;  2XPI A;  4DLO A;  4DX7 D;  3L22 A;  4YDO A;  2P9S G;  4I6E A;  3DWL G;  4GYW A;  3ZXP A;  3V79 K;  5ENR D;  3E37 A;  4MS6 A;  3FWV A;  4APF A;  4JL0 A;  4ANX A;  1EYH A;  3RRN B;  1H6P A;  4PUC A;  3OTN A;  2DIW A;  4XEI G;  3F6Q A;  3SD5 A;  4CYM D;  4YVO A;  3SQV A;  3CHR A;  3DSS A;  2J8S D;  2FEZ A;  3RRU A;  4ILH B;  4FHK A;  2Y1L E;  2KCV A;  3PZ3 A;  4J0U A;  4BES A;  2RD0 A;  2KCK A;  1OCO E;  2ETA A;  1H2V C;  2KM4 A;  4CEM A;  3DSX A;  4OAU C;  3BG1 B;  3MA5 A;  1BLX B;  1KZP A;  2VGX A;  4N3C A;  2RFA A;  2CFU A;  4I6J A;  4M7C A;  3ULY A;  3HXF A;  3TGO A;  5BUZ A;  4Q96 A;  5FQ4 A;  3IKO B;  2DYR E;  1WM5 A;  1S64 A;  4KBQ A;  3TWU A;  5JMN D;  4CGW A;  3EHM A;  4AP2 A;  2WQH A;  3R9M A;  3B7S A;  4DK5 A;  1FVF A;  1DVP A;  3UIO C;  2QC9 A;  3SFZ A;  4LCT A;  1ZB1 A;  3EU9 A;  4HQD A;  5BV1 A;  2EIJ E;  2IJG X;  3TXM A;  5A6C A;  2VSO E;  5LFA A;  1OCC E;  4JA9 A;  3L54 A;  4EZK A;  1Z5S C;  5FJY A;  5KJM A;  2AWI A;  3KS2 A;  3ASF A;  4HI9 A;  5FIN A;  4UQZ A;  3NQP A;  1HX8 A;  1HF8 A;  4GTR A;  4TUM A;  4G11 A;  2WXP A;  3FUK A;  3TWV A;  4K0R A;  5AQ7 A;  5JA4 D;  4FA6 A;  4WWO A;  4G1T A;  1BPO A;  2LXL A;  5FZS A;  3BQO A;  3S2A A;  5AIJ A;  4ILI A;  2IQC A;  1JPL A;  1TNU A;  3IV0 A;  2NSZ A;  2Y4U A;  3MKR A;  4CDM A;  5J90 A;  4XI0 A;  3AG1 E;  2KBX A;  4ZHB A;  4HOT A;  3OXL A;  3SF4 A;  2P58 C;  3KAE A;  3Q47 B;  1IHG A;  4J8S A;  5B3S E;  3S7J A;  4CRW A;  3FUE A;  3BEE A;  4FJY A;  1D8E A;  1BI7 B;  2V4L A;  2GRR B;  4K5C A;  2LSV A;  3PEV B;  2LO6 A;  5FIO A;  3SHF A;  4U63 A;  3PH0 C;  5BV0 A;  4L9P A;  4GU5 A;  3DST A;  3U4T A;  4GMR A;  3LY7 A;  5EN5 D;  4GTQ A;  5FZR A;  1S0P A;  5JJ7 A;  4KMO A;  1RZ4 A;  4HXI A;  4BY6 A;  3Q49 B;  2KC7 A;  2XEH A;  1N94 A;  4YND A;  2XEE A;  1OWO A;  3ZIM A;  4F6R D;  4AVX A;  4C0M A;  2WXI A;  1EDU A;  4JA7 A;  3PZ2 A;  4WWN A;  2LNI A;  2IF4 A;  4HBD A;  3MJW A;  3JUE A;  4I9C A;  3T8K A;  3UM2 A;  3UPV A;  1WG0 A;  3ZHE A;  1KT1 A;  1QZ2 A;  4UUC A;  3DEO A;  5H7P A;  3TG4 A;  4U8V D;  2ETC A;  3FU0 A;  3QDN A;  2R5S A;  4NAC A;  2RKK A;  1N9A A;  2V5F A;  2WM9 A;  2YHC A;  3ONK A;  4WWP A;  3QOU A;  4ILG A;  4XKC A;  4L23 A;  3JCK C;  4EBA G;  4W9R A;  1MX6 A;  1LD7 A;  2I1K A;  3MKQ B;  2YNQ A;  3J5Q B;  4HOR A;  3CK9 A;  3QWV A;  3FUH A;  1IXV A;  3RU0 A;  2BUG A;  4G25 A;  4F3V A;  4AEZ C;  3IHY A;  1ZBP A;  4GTT A;  3ZUV B;  1O1T A;  3E33 A;  2QZA A;  2XZT G;  2JLB A;  3FTU A;  2X6F A;  5HRY A;  3FDH A;  5B1A E;  4FP7 A;  5EDS A;  1HU3 A;  2KZT A;  4GZC A;  3JYS A;  3CGH A;  4D10 C;  2PNN A;  4LEU A;  4GA2 A;  1IKN D;  2ZU6 B;  1OY3 D;  3CK8 A;  1HXI A;  2Y0B G;  3Q9N C;  1HO8 A;  2XRZ A;  2Y69 E;  4A55 A;  5LCW J;  4JEU A;  3CVY A;  4LSZ E;  3GZS A;  1TJC A;  2XGO A;  5BPP A;  3HRA A;  5BW8 C;  3HVE A;  3GYZ A;  4GYO A;  4U95 D;  3FUD A;  3SBS A;  3B95 A;  4LRZ A;  2OEV A;  1EF1 C;  2CG2 A;  2XHE A;  3E30 A;  2GW1 A;  5FZQ A;  4QQI A;  1MJ0 A;  1H19 A;  3LJ3 A;  2GRP B;  3AG2 E;  2C0M A;  2VSX E;  3FUI A;  4J6I A;  5CBN A;  2ION A;  2A5E A;  1O1S A;  3ESL A;  4B89 A;  3CQC B;  3ESK A;  5AQA A;  1YCS B;  2X38 A;  2IU1 A;  2WXF A;  1MQS A;  1B89 A;  2E2E A;  2M63 A;  4DJA A;  5DBK A; 
#chains in the Genus database with same CATH homology
 1O5M A;  1O1T A;  3E33 A;  3HXF A;  3E34 A;  3DSU A;  3PZ4 A;  1JCR A;  2IEJ A;  3DRA A;  4L9P A;  1S64 A;  3DST A;  3DSV A;  4MBG A;  4GTQ A;  4GTM A;  3SFX A;  1MZC A;  1N94 A;  1N4Q A;  3KSQ A;  2BED A;  1SA5 A;  1LTX A;  1FPP A;  2ZIR A;  2H6I A;  4GTO A;  4YDO A;  1O1R A;  3DPY A;  3E32 A;  1TNB A;  3HXE A;  3E37 A;  1N4R A;  1NI1 A;  3HXC A;  4LNG A;  2F0Y A;  3PZ2 A;  3HXB A;  2H6H A;  3Q7F A;  4GTR A;  2R2L A;  1TNZ A;  4GTV A;  2H6F A;  1TNY A;  3EU5 A;  3KSL A;  3C72 A;  1SA4 A;  3PZ1 A;  3Q78 A;  4GTP A;  3DSS A;  3Q7A A;  1JCQ A;  4YDE A;  1DCE A;  1N4S A;  1X81 A;  3E30 A;  1FT2 A;  1JCS A;  1N9A A;  1TNU A;  4LNB A;  3EUV A;  1TN6 A;  1FT1 A;  2ZIS A;  3PZ3 A;  1D8D A;  2H6G A;  1LD7 A;  3DSW A;  1LD8 A;  3SFY A;  3Q79 A;  1O1S A;  1KZO A;  4EHM A;  1NL4 A;  1TN7 A;  1S63 A;  3DSX A;  1D8E A;  3HXD A;  3Q75 A;  1N4P A;  3Q73 A;  1TN8 A;  4GTS A;  1KZP A;  1QBQ A;  1N95 A;  1TNO A;  4GTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...