1E96B

Structure of the rac/p67phox complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
185
structure length
185
Chain Sequence
SLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title Structure of the Tpr Domain of P67Phox in Complex with Rac.GTP
pubmed rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 71
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1e96B00
3K9IA 5FZSA 4B94A 2LSVA 1TJCA 2UY1A 3LPZA 3CVNA 1WAO1 3BEEA 4J8FA 4GCOA 4I9CA 3ESKA 1KT0A 3QWWA 2XCBA 2PL2A 3QWVA 4IN3B 3ULQA 1ZBPA 3TAXA 2XGSA 4EQFA 2KCVA 3RO3A 4I9EA 3S7BA 2UWJG 5KJLA 2P58C 4AY6A 3Q15A 5FJYA 1PC2A 3CK8A 2VQ2A 4GA2A 2V5FA 4UI9J 3GZ1A 2IFUA 4U0UA 2JLBA 5EKQD 2HO1A 3MV2B 3FFLA 2MHKA 2FF4A 3Q49B 2QFCA 5DBKA 1P5QA 1ELWA 4ME2A 4Y6CA 3CVPA 2XCCA 5CCMA 3WXXA 3NF1A 1ELRA 4HOQA 2C0MA 2YHCA 4XI0A 4U04A 5JJ7A 3LKUA 3CKCA 1KT1A 3CK9A 3FWVA 3VTYA 3UPVA 5ARFA 3AS5A 4U0SA 4G26A 1IHGA 5HI7A 4CDRA 4N39A 4BT8A 3HYMB 3S7DA 4G2VA 3ZHEA 2PZIA 3N71A 4UQXA 4N3CA 5LCWC 2NC9A 5M72A 4UI9C 2FBNA 1IYGA 3ZHEB 2XGOA 5FZRA 5C1DA 2LSUA 2BUGA 2HR2A 4H7YA 4J0UA 4GZ5A 3GZ2A 2Q7FA 2KCKA 3LY9A 4A1SA 2UY1B 3LY8A 1Y8MA 5G05C 4GYOA 4BT9A 1XNFA 4ABNA 3Q4AB 2J9QA 3ZGQA 4N2QA 3OXLA 4G1TA 2OOEA 3ZN3A 4H7XA 3MEKA 1OUVA 4NRHB 4RG9A 3CVQA 4KYOB 3QDNA 3EDTB 3PE3A 3MKRA 3FP3A 2VGYA 4J8EA 5JJTA 4JL0A 1HH8A 5D0QD 4GYYA 3CK7A 4BTAA 4U07A 4KBQA 5A6CA 3RIBA 4WNFA 2C0LA 4YVOA 2VSNA 3U3WA 2XGMA 1FCHA 4HOTA 4JHRA 5G04J 3S7JA 4I1AA 4GYWA 3CKBA 4HOUA 2GW1A 4WNEA 3KS2A 4N3BA 3E4BA 2E2EA 1HZ4A 3GW4A 4WNGA 2FI7A 1QZ2A 3QWPA 5FTPA 2VGXA 3KD7A 3JYSA 3LCAA 4U0ZA 4I2ZA 4UQYA 1NA0A 1NA3A 2VGXB 4GCNA 3SZ7A 5CCLA 5CHEE 4APOA 3TG5A 1E96B 2LNIA 4N5CA 4W9RA 4YVQC 1W3BA 3URZA 4AM9A 3AS8A 4GPKA 2C2LA 2VYIA 3RU0A 2L6JA 2VSYA 4HOSA 4RG6A 3ASHA 4WUYA 3TGOA 3RKVA 3IEGA 4AY5A 4JA9A 4JA7A 2PQNA 5A7DB 5EX3A 3MA5A 1QQEA 3GYZA 4XIFA 3LYAA 4I2WA 4N2SA 3OXFA 2WQHA 3QOUA 5EX0A 3RJVA 3PE4A 4NQ0A 3MV3B 3ASFA 4BWRA 2Y4TA 2R5SA 2WPVA 4WNDA 3Q5MA 4AIFA 4J8DA 4G24A 2ONDA 2FO7A 5HQ8A 5BW8C 5FZQA 4N3AA 1B89A 5LCWJ 4XI9A 4GZ6A 5FT9A 2YQ8A 4GA1A 4BTBA 3AS4A 3UUXA 2IF4A 3CEQA 3Q47B 4Y6WA 4LEUA 3SF4A 3U4TA 4HORA 4UQZA 2PQRA 5BT1A 1A17A 3CVLA 3O48A 3ASDA 2I6HA 5G05J 3PDNA 4GA0A 3KAEA 5ARGA 4CGVA 4O6FA 4G25A 5D0OD 5AYWD 2DBAA 4YNDA 3QKYA 5JJ6A 3OXGA 3CV0A 1ZU2A 4GZ3A 1YA0A 2HYZA 1NZNA 2KCLA 3TG4A 2AVPA 4CGWA 2XEVA 3R9AB 5KJNA 3ZFWA 3LY7A 5KJMA 3ASGA 3UQ3A 5BNWA 4UI9K 5DIZA 4F3VA 2KC7A 2KATA 2XPIA 3ZPJA 1KLXA 1WM5A 3VTXA 5G04C 1HXIA 4G23A 2Y4UA 4KXKB 5KJKA 3RO2A 2FEZA 4I17A 3S7FA
chains in the Genus database with same CATH superfamily
3K9IA 4HRNA 4JEHA 3JQ1A 5AJLA 1Z3YA 2X6HA 3IHYA 3MKQA 3JUEA 4ILIA 2J08A 4RSYA 1JPLA 4WWPA 1LD8A 1QYMA 3MKQB 4IN3B 3B95A 3IBEA 2LXMA 3TXNA 3D9OA 1L5JA 1ZBPA 3TAXA 3G2WA 3AG2E 2KCVA 3ONKA 1O1TA 3S7BA 4I9EA 1SA5A 2UWJG 3IHVA 4HLLA 2P58C 4HLEA 4ATGA 3FUEA 5FJYA 3CK8A 4UWLA 2J4BA 3NOGD 4C0EA 4DLQA 2VQ2A 2WVIA 4GA2A 4ANWA 3DXKG 3NB2A 2JLBA 5EKQD 3IV0A 3CQCB 3FFLA 4GTVA 4GU5A 4MS6A 5FQ8A 4U7EB 3U64A 5DBKA 3ZU7B 1KZPA 1UOHA 3C5RA 5ENRD 1K1BA 3E37A 4GAAA 3ISMC 3J5QB 1V54E 3CVPA 1OWMA 1DNPA 5FIOA 3UMVA 3PNLB 2NSZA 1ELRA 1OCZE 3UM2A 4HOQA 3CHOA 2YHCA 5JJ7A 3D9LA 5EN5D 2WXPA 3DSUA 2LAIA 3VTYA 3AS5A 4G26A 4I6JA 3SNXA 4DJAA 3SI5A 5CEAA 1TN6A 1DC2A 3U9WA 3ZHEA 1LTXA 3S2AA 3SBTB 4WAFA 5AARA 3QNKA 5HKPA 3UT7A 3ZHEB 1TJFA 5LP0A 4RQIA 4CRWA 4FC8A 2LSUA 1N95A 4I6GA 4B8CB 4XX5A 2HR2A 4H7YA 3CVUA 3MYVA 3CR3A 3DXMG 4A55A 1D8DA 2H6HA 4IYPA 4ANXA 3E33A 4GZDA 1ELKA 3ASOE 2V4HC 3ZGQA 3ESLA 4N2QA 3OXLA 2XENA 5ENTD 1MJ0A 3ONLA 4RG9A 4JEUA 2BTDA 4TRQA 4LG6A 1X81A 3UM3A 4JL0A 2NYJA 2LXLA 2OVBA 5FQ7A 3FULA 3RIBA 2C0LA 3QARA 4CYMD 2CHXA 4KZ0A 5CBNA 4JHJA 4EPZA 2VSNA 2ETCA 5CERB 3U3WA 2XGMA 3EIJA 4MKTA 3R7QA 3TWTA 3S7JA 1PY1A 4GYWA 2OCCE 3JXIA 3EUVA 4L9PA 3RRNB 3I5PA 4DX1A 3SD5A 3KS2A 2E2EA 3GW4A 3T8MA 4KMOA 1FVHA 1AWCB 1NL4A 3CLJA 4KZCA 2GRPB 2RKKA 2AXVA 4FHJA 4A1GA 4I6EA 5LX8A 3TG5A 2LNIA 1FT1A 4YVQC 4EBAA 3AS8A 4ILHB 1U2VG 3ULYA 2J49A 5KNHD 4GPKA 1IKND 3I4RB 4J8YA 2EQXA 3AG1E 2I1KA 5BUZA 2VSYA 1S70B 5AQAA 3QC1A 4WUYA 1E7VA 4J8SA 1MX4A 3UX4A 4ACLA 3PUJA 4KT6B 3CVWA 3NBNB 4JA7A 2PQNA 2H6IA 4TUUA 3GYZA 5LOZA 3L82A 2QY7A 3LYAA 2DVWA 2DCPA 4I43A 2VJ8A 2GGFA 3PH0C 1AP7A 3PE4A 4URKA 5KBAA 1E8ZA 3MV3B 3UIOC 3ASFA 3P2BA 2B0OE 3D9MA 3FEXA 3SFYA 3I3NA 2R5SA 1S0PA 2QZAA 4HFGA 4C9BB 3ZEFA 2Y69E 3NOCD 2KM4A 1N4QA 2P9PG 3SBSA 1EPUA 1N52A 2FO7A 3FTWA 3HIZA 1QNFA 5HS0A 4CDNA 1B89A 3TWQA 5FT9A 4NIKA 4GA1A 4FULA 1K8KG 2GROB 3ABKE 4YDEA 4M3OA 4WWNA 2RD0A 2CHZA 2DZOA 2F37A 5BPPA 3RRUA 1V55E 3DSWA 4O60A 3R7RA 3PZ3A 2IJGX 2ZISA 3ML9A 3FUMA 3CVLA 5G55A 3ASDA 2I6HA 3D9HA 1BI7B 1MYOA 4X8QA 4KVOA 4MRUA 5JMND 4G25A 2P9IG 3FUIA 3UT4A 4YNDA 2WQ7A 2V4LA 2R03A 3ZW3A 2HYZA 3T5VA 1NZNA 5B3SE 1HF8A 3TG4A 4CGWA 3R9AB 4CEMA 3HXEA 3ZFWA 1TYQG 2V5QC 3UQ3A 4U95D 3B7SA 3FTUA 2XPIA 3Q73A 1EYHA 2L0TB 3Q75A 3VTXA 2X6JA 3CGHA 3EIQC 5KJKA 4XE0A 3JCKC 1TNOA 3EU5A 5AQ7A 1QBQA 3CSTA 1MZCA 3CVNA 3L6AA 3IXEA 4J8FA 4GCOA 1Z5SC 4TUMA 4FADA 4I9CA 4Q94A 1U3CA 1KT0A 3DPDA 4K5BA 1E8YA 2XCBA 2PL2A 2RFAA 1G3NB 2XGSA 4UWFA 4AXHA 3V79K 2PNNA 1JCQA 3PNTB 5KJLA 2P9SG 4ATZD 4D10C 3W9FA 2WXOA 5KNGA 3TWWA 4BETA 2V5FA 2RG8A 2GRLA 2IFUA 4U0UA 3MV2B 4EHMA 3Q49B 3PZ1A 2I9CA 2WM9A 1P5QA 1BPOA 2F0YA 1HFAA 3B7UX 2XCCA 5CCMA 2QYUA 4A63B 2NXPA 5CBOA 4YDOA 3PRZA 3HXFA 3MX3A 2DYSE 4L23A 3SQVA 3CKCA 4FHKA 5ENOD 3V2XA 3E30A 4HI9A 3LJ3A 1HG5A 4NACA 2P9NG 3FTVA 5HI7A 4B8AA 2CFZA 4E6HA 3GZSA 4F1SA 4DUIA 3NQPA 5M72A 2FBNA 2XGOA 5KWDA 3I4GA 4U96D 5FINA 4LSZE 1H19A 2L6BA 4J0UA 4GZ5A 3GZ2A 2Q7FA 4BX9A 1OWPA 4L1BA 4K5CA 3J5PA 3LY9A 3ABLE 2DWZA 4RLYA 1Y8MA 1E8WA 3B7RL 3L16A 4GYOA 1E8XA 1YMPA 4ABNA 3CQGB 2KBXA 2J9QA 5JHBA 4G1TA 3FH7A 2OOEA 3EHRA 3MEKA 3HXBA 5JA4D 1O1SA 4NRHB 3D9JA 3ZRHA 5BV1A 1N94A 3PE3A 4J8EA 1H2TC 5JJTA 1BLXB 1HH8A 5D0QD 1XGWA 4GYYA 5FQ6A 3ZUVB 4FLBA 4OAVB 4WNFA 3PVLA 4JHRA 2E0IA 2VSOE 5ANRA 3AG3E 1JUQA 4JW1A 4R7LA 4N3BA 4LRZA 4O1PA 4DI4A 4LNGA 5H7PA 3KSQA 1QZ2A 2EINE 3LEWA 5ENPD 3Q7AA 2VGXA 4AVXA 3KD7A 4EZKA 3CSFA 3LCAA 3MGBA 3KEZA 4HNAD 2VGXB 4GCNA 5D2MC 3SZ7A 4UWGA 5CHEE 4APOA 1O5MA 4I1MA 2Y0BG 4N5CA 1JWGA 1LD7A 1W3BA 2IOSA 3URZA 3LDZA 3HXCA 2ZXWE 3UXGA 5J90A 4OYSA 2DIWA 3RU0A 1OWOA 2L6JA 3ASHA 4F6RD 3MJWA 3IEGA 2AW6A 4OVUA 3UI2A 2GRNB 3MA5A 4U8YD 3ZYQA 1D8EA 4XIFA 2X6KA 4N2SA 1HG2A 1NFIE 4P29A 5EX0A 1TEZA 1VDYA 2ILRA 3DSVA 4G8KA 4I1OB 4NQ0A 3UM0A 2GRMA 2X6FA 2LUHA 3AJIA 3UINC 4L2LA 2WPVA 4WNDA 2GRRB 4GB9A 1HX8A 3APFA 4ACKA 3Q5MA 3CHPA 3P1UA 4DX6D 2ONDA 5CECB 3L17A 4JPSA 3NZUA 5FWQA 1MX6A 3B7BA 1N11A 4N3AA 4FA6A 4XI9A 1SVXA 3Q9NC 3QAQA 2YQ8A 2X38A 2IF4A 3Q47B 4MBGA 4EECA 4HORA 2MYOA 5E75A 1DCEA 3DRAA 2FULA 2A5UA 1H0AA 4O1OA 3O48A 3PDNA 4A3VA 1K3ZD 3OTNA 2WXKA 4CGVA 4AEZC 4Q69A 2IO2C 3B13A 3QKYA 3APDA 4BEPA 3NZSA 3NAWA 2WXQA 4RVBA 2KCLA 1O1RA 3HRAA 3ASNE 3X2QE 3CHSA 4C0MA 3BG0B 4UI9K 3JXJA 5DIZA 2KC7A 1H6KA 3SY2A 3ZPJA 3HDXA 3ZYMA 4JB8P 1PAQA 1NP7A 1WM5A 1SW6A 5G04C 2J07A 4KXKB 2OEWA 5AAOA 4NURA 2IY0C 1OXJA 2J8SD 1FVFA 2I2OA 5FZSA 3T8KA 2UY1A 1OWNA 1H6PA 1WAO1 4JVSA 1OCCE 3BEEA 3DEPA 3FU0A 3Q79A 3HG0D 1UG3A 2XS1A 3TWXA 4Z68A 1IHBA 3TXMA 2PM7A 5AENA 2F8YA 1HU3A 4J6IA 4IRUA 4UI9J 4HB5A 4QQIA 1UJKA 3GZ1A 1DCQA 2HO1A 2MHKA 2FF4A 4JC8A 5A23A 3Q7FA 4BSXA 5J08A 1ELWA 3ABME 4OVVA 4Y6CA 2Y1LE 3FUFA 3WXXA 2X6IA 4LERA 3L22A 4XI0A 4U04A 1INZA 2M63A 1SZAA 3BU8A 4GMRA 5ANLA 4G11A 5HRYA 4UWHA 2AXUA 4KVMA 2MRIA 1KT1A 3CK9A 4GTMA 1WG0A 3FWVA 3KEAA 3UPVA 1MX2A 4U0SA 1KZOA 3DSSA 3OAWA 4G8LA 2F8XK 1IHGA 4HXIA 3W9GA 3FEYA 2RFMA 4BFRA 4N39A 4N5QA 2J09A 3HYMB 3S7DA 4F1PA 1X5BA 1D9SA 2PZIA 3CVXA 4N3CA 4U8VD 2XQ0A 4J7WA 1UJJA 5LCWC 2NC9A 1YYHA 2L0IA 3ZKJA 4FU3A 1IYGA 3ZNGA 4APFA 3FU5A 2BUGA 2R17C 4LUNU 2IQCA 2KCKA 1IXVA 4A1SA 4FJZA 3LY8A 3SFZA 2WXLA 2IO3C 5G05C 4HQDA 4GTSA 5AQ9A 4DX7D 3Q4AB 3UT8A 3V30A 2DZNA 4H7XA 2WXFA 3CIAA 2WQ6A 5EILA 3MKRA 2ZGGA 3FP3A 4PS3A 2VGYA 4AJWA 2OV8A 3SGHA 3WG7E 3G2VA 2AXZA 5IY5E 4BTAA 3MCXA 4YVOA 2WXGA 4HI8A 3PZ4A 4TV3A 1GW6A 1TNYA 3ZIMA 3G2TA 3DPYA 1N4PA 4HOUA 2IOLA 2GW1A 1TNUA 4ZFHA 3LXUX 3FUJA 3T5XA 2WB2A 2WXMA 2XHEA 1HZ4A 3EHNA 1EF1C 2R05A 2FI7A 1SZ9A 2L9BA 4JD2G 5T8IA 3D9KA 4UQYA 1NA3A 2HM8A 5ENNA 5CCLA 2H6GA 3FTZA 3EHMA 3G2SA 4DPRA 1H6OA 1S64A 4ANVA 1H2VC 2WMNA 4XZ4A 1Y6IA 4AM9A 5E76A 2ZGDA 4C48B 3PZ2A 2B6CA 4HOSA 2XPYA 2Y3AA 5EIBE 4MLPA 2P9KG 3TGOA 2CG3A 3RKVA 4AY5A 2V0PA 4GPMA 4JA9A 4CT4A 2R59A 5A7DB 2IONA 5EX3A 2XZTG 3APCA 5ENQD 1K1AA 4L2YA 4I2WA 3OXFA 2WQHA 3QOUA 4DX2A 3CHMA 4GTPA 4BY6A 1HO8A 1OT8A 1HS6A 4A3TA 3BQOA 3ULEG 3ZXSA 4F7AA 1IQRA 4G24A 2YINA 4GZCA 1U3DA 3UIPC 4WWOA 3HXDA 2GRQB 3PEUB 3KSLA 5HQ8A 5BW8C 3ZYKA 3FTYA 5FZQA 4LCTA 4DX5D 5B1AE 1TNBA 4OAUC 2P9UG 4UWKA 4GZ6A 3ZYLA 3AS4A 3UTMA 3UUXA 3CEQA 4Y6WA 5FQ4A 4HVBA 2EIKE 2WXNA 4DLOA 1OWLA 3SF4A 3U4TA 3D9NA 4UQZA 5EYLA 1JWFA 4TXPA 4PUCA 2VTBA 4GA0A 5ARGA 2A5EA 2VTBB 3OXGA 4UUCA 1ZU2A 4GZ3A 5JHAA 3CHQA 1N0RA 3ASGA 2WXJA 4PDXA 2R2LA 3FDHA 2OEVA 2KATA 2QYJA 5G2NA 1KLXA 4K5AB 1NI1A 1HXIA 4G23A 4B89A 3PEVB 2FEZA 4I17A 3CVVA 2I1JA 4IULA 4FP7A 4JXTA 4B94A 2LSVA 3UKRG 1E90A 1TJCA 3PZDA 4DRXE 3LPZA 5D66A 1WY6A 3FTSA 3QB2A 2HE0A 3QK0A 4GMLA 3ESKA 3FY4A 4LNBA 3CVYA 3FU3A 3QWWA 3D9IA 3QWVA 1TNZA 3TWVA 1Z3XA 2WXRA 4AOFA 3ULQA 4EQFA 1EDUA 2P2CP 4CCAA 3RO3A 3SHFA 3ML8A 4AY6A 3Q15A 3RSEG 3L54A 3IKOB 4GMJA 1PC2A 3L08A 1BI8B 3HHMA 5EYPF 4B93B 5CMYA 4DK5A 2BF0X 1E7UA 2QFCA 5T3RA 3C98A 5AIJA 5AJDA 3PUKA 4ME2A 4GTTA 2J4DA 5BV0A 2ETBA 3NF1A 2C0MA 4E85A 3FHEA 4CDMA 3E34A 4YDWA 4EZLA 3LKUA 2JABA 2X3MA 2BEDA 2WXIA 4HRLA 1UW4B 1MHQA 3LJNA 5ARFA 4HS2A 1N9AA 5BXUA 2MOWA 2XRYA 5CRUA 4CDRA 4BT8A 3LVRE 4G2VA 4XKBA 3N71A 1TR4A 4UQXA 4BX8A 3DSXA 3R9MA 4GTRA 4UI9C 4PS7A 4L7TA 5FZRA 5C1DA 3C3QA 5BXOA 2H6FA 3TWSA 5ITZF 4BERA 4F53A 1N4SA 1OCOE 1S63A 3E32A 3LS8A 3TWRA 5C2YA 4BSZB 2UY1B 4TXQA 3C3OA 4BT9A 4JZYA 1XNFA 3EHQA 2AWIA 3AU4A 2PM6A 3ZN3A 1SQMA 3JQ0A 1OUVA 2YHEA 3FUDA 2R02A 3UM1A 3CVQA 4KYOB 3QDNA 3EDTB 3FTXA 3D9PA 1TN8A 1Z6TA 1N4RA 2DYRE 4K03A 5CEDB 3CK7A 5T4YA 4U07A 4KBQA 5A6CA 2XEHA 3VLDA 3ENEA 4HBDA 1HE8A 1FCHA 2V8SE 4HOTA 5G04J 2BKGA 3SFXA 4I1AA 2YNQA 1RZ4A 3CKBA 2LO6A 4QFVA 3JUIA 4EBAG 3B7TA 4WNEA 2OVFA 3BUAA 1MQSA 2VSXE 1JCRA 3E4BA 3PS6A 2P9LG 3AG4E 4WNGA 5KCMA 3QWPA 5FTPA 1ZB1A 2EILE 2KXPC 3JYSA 4U63A 2CHWA 5AN8A 1LF8A 4U0ZA 4I2ZA 2VGEA 2EIJE 4GTQA 1NA0A 4V3IA 3G2UA 3PREA 2XRZA 3U66A 4PS8A 4YDYA 2WMOA 4CT0A 1E96B 3F6QA 3CHRA 3VLFA 4W9RA 3SO8A 3TJPA 4ILGA 2XZDG 3L9TA 3TL5A 4Q96A 3FH8A 2ETAA 3V31A 4ZHBA 3FH5A 2C2LA 2VYIA 3LVQE 4K0RA 4RG6A 3EJNA 4AP2A 2A4ZA 4U8HA 2QC9A 2IU1A 3L13A 3HVEA 3DEOA 1QQEA 2IEJA 3FUKA 3FU6A 4XKCA 3HVEB 2JEKA 3ZVVA 1OY3D 2LAHA 2XS8A 4BESA 3RJVA 1N54A 4M7CA 5EDSA 1IQUA 3D3MA 4BWRA 1OCRE 2Y4TA 4LNUD 5LFAA 3C72A 4ANUA 2XPZA 4AIFA 4J8DA 1BD8A 2WXHA 1N0QA 2CFUA 2ZU6B 3FUHA 1SA4A 3AU5A 1WDYA 2KZTA 3UKUG 3ZXPA 1FT2A 1A5EA 1UN8A 5LCWJ 2KZTB 4BTBA 3Q78A 3FUNA 4AV7A 2AJAA 4LEUA 1KPSB 1UN9A 5ENSD 3EU9A 5AQBA 3RAUA 4XEIG 1YCSB 4EZJA 2PQRA 1BU9A 5BT1A 3T9KA 2ZIRA 3AAAC 5CRVA 4FJYA 1A17A 1FPPA 3QJZA 5CMWA 5G05J 3VLEA 1JCSA 3V2OA 3KAEA 4O6FA 3DSTA 5D0OD 5AYWD 2DBAA 1RW2A 1DVPA 5JJ6A 2FO1E 4TXRA 1H2UA 2EIME 3CV0A 4FLHA 3TWUA 3C3RA 4HRMB 1YA0A 2XEEA 4JHKA 2AVPA 2CG2A 2XEVA 5KJNA 5KJMA 3LY7A 4PH4B 3BG1B 3DBSA 5BNWA 5B1BE 3Q9UC 4F3VA 5EIDA 4DI3A 4CZ2D 4GTOA 3RRMB 2Y4UA 4B0ZA 3DWLG 3RK6A 3RO2A 1Q2ZA 3MZLB 3S7FA 1TN7A 3O4ZA 2BKKB
chains in the Genus database with same CATH topology
4FP7A 3K9IA 4JEHA 4JXTA 3JQ1A 5FZSA 4B94A 2LSVA 5AJLA 1E90A 1Z3YA 1TJCA 1OWNA 2UY1A 2X6HA 3CSTA 3IHYA 3CVNA 3LPZA 1WAO1 3MKQA 3PZDA 4JVSA 3L6AA 3BEEA 1WY6A 4J8FA 3FTSA 4GCOA 3QB2A 3FU0A 3QK0A 2J08A 4I9CA 4ILIA 4Q94A 4GMLA 1JPLA 4RSYA 1U3CA 3ESKA 4WWPA 1KT0A 3FY4A 3DPDA 3CVYA 3FU3A 3QWWA 1E8YA 2XCBA 3D9IA 2PL2A 3MKQB 3QWVA 4IN3B 3IBEA 3TXNA 3D9OA 1Z3XA 2WXRA 4AOFA 1UG3A 3ULQA 1L5JA 1ZBPA 3TAXA 2XGSA 4UWFA 4EQFA 3G2WA 1EDUA 4CCAA 2KCVA 3ONKA 4AXHA 3RO3A 4I9EA 3S7BA 2UWJG 3SHFA 5KJLA 3PNTB 3IHVA 2P58C 3ML8A 4HLEA 4ATGA 4AY6A 3FUEA 3TXMA 2PM7A 3Q15A 3L54A 5FJYA 4D10C 3IKOB 4GMJA 1PC2A 3L08A 3CK8A 5AENA 4UWLA 2J4BA 4C0EA 4DLQA 1HU3A 2VQ2A 2WXOA 2WVIA 4J6IA 4GA2A 4ANWA 2V5FA 3HHMA 2RG8A 4IRUA 4UI9J 1UJKA 2GRLA 3GZ1A 2IFUA 5CMYA 4U0UA 2JLBA 2HO1A 5EKQD 3IV0A 3MV2B 3CQCB 3FFLA 4GU5A 4MS6A 2BF0X 2MHKA 5FQ8A 4DK5A 1E7UA 2FF4A 3Q49B 2QFCA 3U64A 5T3RA 4JC8A 5A23A 3C98A 5J08A 4BSXA 5AIJA 5AJDA 2I9CA 2WM9A 3PUKA 5DBKA 1P5QA 1ELWA 4OVVA 4ME2A 4Y6CA 1BPOA 4GAAA 1HFAA 3B7UX 3FUFA 2J4DA 3CVPA 2XCCA 5CCMA 3WXXA 5BV0A 1OWMA 1DNPA 2X6IA 3NF1A 3UMVA 3PNLB 2NSZA 4LERA 1ELRA 4HOQA 2NXPA 3L22A 2C0MA 3CHOA 2YHCA 3PRZA 4E85A 3MX3A 3FHEA 4XI0A 4U04A 4CDMA 5JJ7A 4L23A 1INZA 2M63A 3D9LA 1SZAA 2WXPA 5ANLA 4EZLA 4G11A 3LKUA 4UWHA 3CKCA 2AXUA 4KVMA 2MRIA 3CK9A 1KT1A 2X3MA 4FHKA 2LAIA 2WXIA 3FWVA 3VTYA 3UPVA 1UW4B 1MHQA 5ARFA 3AS5A 3LJ3A 4U0SA 1HG5A 4NACA 3OAWA 3FTVA 1IHGA 4G26A 4HS2A 4HXIA 4I6JA 5HI7A 3FEYA 4B8AA 2MOWA 4BFRA 2CFZA 2XRYA 4CDRA 3SNXA 4E6HA 4N39A 4BT8A 2J09A 3LVRE 3SI5A 3HYMB 4DJAA 3U9WA 3S7DA 3GZSA 1X5BA 4G2VA 3ZHEA 4XKBA 2PZIA 3N71A 3CVXA 3S2AA 3SBTB 4UQXA 4BX8A 4WAFA 4F1SA 4N3CA 2XQ0A 5LCWC 1UJJA 3QNKA 3UT7A 2NC9A 3NQPA 2L0IA 5M72A 4UI9C 2FBNA 4FU3A 4PS7A 4L7TA 1IYGA 3ZHEB 1TJFA 2XGOA 3I4GA 5FZRA 5LP0A 5C1DA 4CRWA 4FC8A 2LSUA 4I6GA 4B8CB 4APFA 3FU5A 2BUGA 4XX5A 1H19A 2HR2A 4H7YA 3CVUA 4J0UA 4F53A 2R17C 3CR3A 3MYVA 4GZ5A 3GZ2A 4LUNU 2IQCA 2Q7FA 1OWPA 4BX9A 3LS8A 4L1BA 2KCKA 3LY9A 4A55A 4IYPA 4A1SA 5C2YA 2UY1B 4FJZA 3LY8A 3SFZA 4ANXA 2WXLA 4GZDA 1Y8MA 5G05C 1E8WA 3B7RL 3L16A 4GYOA 4BT9A 4JZYA 1E8XA 1XNFA 4ABNA 1ELKA 3CQGB 3Q4AB 3UT8A 2AWIA 2J9QA 5JHBA 3ZGQA 3AU4A 3ESLA 4N2QA 3OXLA 2PM6A 3FH7A 2OOEA 4G1TA 3ZN3A 4H7XA 1SQMA 3MEKA 2WXFA 3JQ0A 1OUVA 2YHEA 3FUDA 3CIAA 2WQ6A 3ONLA 4NRHB 4RG9A 4JEUA 3CVQA 4KYOB 2BTDA 3D9JA 3ZRHA 5BV1A 3QDNA 4TRQA 3EDTB 3PE3A 3MKRA 3FP3A 4PS3A 2VGYA 3FTXA 4AJWA 4J8EA 3D9PA 1H2TC 5JJTA 1Z6TA 4JL0A 1HH8A 2OV8A 4K03A 3SGHA 5D0QD 1XGWA 4GYYA 5FQ6A 2OVBA 3G2VA 2AXZA 3CK7A 5T4YA 4BTAA 4U07A 5FQ7A 4FLBA 4KBQA 5A6CA 3FULA 4WNFA 3RIBA 2C0LA 3QARA 2CHXA 4KZ0A 3ENEA 3MCXA 4JHJA 2VSNA 2WXGA 4YVOA 3VLDA 4EPZA 3U3WA 2XGMA 1HE8A 1FCHA 2V8SE 3EIJA 3PVLA 1GW6A 4JHRA 4MKTA 4TV3A 5G04J 3R7QA 4HOTA 2E0IA 2VSOE 4I1AA 2YNQA 3S7JA 1PY1A 4GYWA 5ANRA 3CKBA 3ZIMA 2LO6A 4QFVA 3G2TA 1JUQA 3JUIA 4HOUA 2IOLA 3RRNB 4EBAG 3B7TA 2GW1A 3I5PA 4JW1A 4WNEA 3LXUX 3FUJA 4R7LA 3SD5A 3T5XA 3KS2A 2OVFA 2WXMA 2WB2A 1MQSA 4N3BA 2VSXE 4LRZA 3E4BA 2E2EA 1HZ4A 2XHEA 3EHNA 1EF1C 3GW4A 3PS6A 5KCMA 4DI4A 4WNGA 3T8MA 2FI7A 1SZ9A 4KMOA 2L9BA 1FVHA 1QZ2A 3QWPA 3LEWA 3CLJA 4FADA 5FTPA 4KZCA 5T8IA 3D9KA 2VGXA 4AVXA 3KD7A 3JYSA 4U63A 2CHWA 4EZKA 3CSFA 3LCAA 1LF8A 4U0ZA 4I2ZA 2AXVA 4UQYA 1NA0A 3MGBA 3KEZA 4V3IA 1NA3A 2HM8A 3G2UA 4FHJA 3PREA 5ENNA 2XRZA 2VGXB 3U66A 4GCNA 3SZ7A 5CCLA 4UWGA 4A1GA 4I6EA 5CHEE 4APOA 4PS8A 5LX8A 4I1MA 2WMOA 3FTZA 3TG5A 4CT0A 1E96B 3EHMA 2LNIA 3G2SA 4N5CA 3CHRA 4DPRA 3VLFA 1JWGA 4W9RA 4YVQC 4ANVA 1H2VC 2WMNA 3TJPA 4ILGA 4XZ4A 1W3BA 2IOSA 4EBAA 3TL5A 3URZA 4Q96A 1Y6IA 3FH8A 3LDZA 4AM9A 3AS8A 4ILHB 5E76A 5J90A 2J49A 4OYSA 4GPKA 2DIWA 3FH5A 2C2LA 2VYIA 3RU0A 3I4RB 3LVQE 4K0RA 2EQXA 1OWOA 2L6JA 2I1KA 5BUZA 2VSYA 4HOSA 2XPYA 4RG6A 2Y3AA 3ASHA 3EJNA 4MLPA 4AP2A 2A4ZA 3QC1A 4WUYA 1E7VA 3TGOA 4J8SA 3MJWA 4U8HA 2CG3A 3RKVA 3IEGA 2V0PA 4AY5A 3UX4A 4ACLA 3PUJA 4JA9A 4KT6B 3CVWA 2AW6A 2IU1A 3L13A 4JA7A 2PQNA 2R59A 4CT4A 4OVUA 3HVEA 5A7DB 2IONA 4TUUA 5EX3A 3APCA 3MA5A 1QQEA 3GYZA 5LOZA 3ZYQA 3FUKA 3FU6A 2QY7A 4L2YA 4XIFA 3LYAA 2X6KA 4XKCA 4I2WA 3HVEB 2DCPA 4N2SA 1HG2A 2JEKA 2WQHA 3OXFA 3QOUA 4I43A 2VJ8A 4P29A 2GGFA 3ZVVA 5EX0A 3PH0C 2LAHA 1TEZA 1VDYA 3RJVA 3PE4A 3CHMA 4URKA 1N54A 1E8ZA 4BY6A 2ILRA 1HO8A 4NQ0A 4I1OB 5EDSA 1IQUA 3MV3B 2GRMA 3ASFA 1HS6A 3D3MA 3P2BA 2X6FA 4BWRA 3D9MA 2Y4TA 3FEXA 4L2LA 4A3TA 5LFAA 3I3NA 2R5SA 2WPVA 4WNDA 1S0PA 4ANUA 3ZXSA 4GB9A 1HX8A 3APFA 2XPZA 4ACKA 3Q5MA 4AIFA 4HFGA 4F7AA 4C9BB 3ZEFA 4J8DA 3CHPA 2KM4A 2WXHA 3P1UA 1IQRA 2CFUA 2ZU6B 3FUHA 4G24A 2YINA 2ONDA 4GZCA 1U3DA 3SBSA 3L17A 4WWOA 4JPSA 1EPUA 3AU5A 1N52A 2FO7A 3NZUA 3PEUB 5FWQA 2KZTA 3FTWA 3HIZA 1QNFA 5HQ8A 5BW8C 3ZYKA 3FTYA 5FZQA 4LCTA 4N3AA 4CDNA 1B89A 1UN8A 4FA6A 4UWKA 5LCWJ 4XI9A 4GZ6A 2KZTB 5FT9A 3QAQA 2YQ8A 2X38A 3ZYLA 4GA1A 4BTBA 4FULA 3AS4A 3UUXA 2IF4A 3CEQA 3Q47B 4Y6WA 3FUNA 5FQ4A 4AV7A 4HVBA 2WXNA 4DLOA 4M3OA 4WWNA 2RD0A 4LEUA 1OWLA 2CHZA 3SF4A 4EECA 3U4TA 5BPPA 4HORA 3D9NA 4UQZA 3RRUA 1UN9A 5E75A 4EZJA 2PQRA 1JWFA 5BT1A 2FULA 2A5UA 3R7RA 2IJGX 4FJYA 1A17A 1H0AA 3ML9A 3QJZA 3FUMA 3CVLA 4PUCA 3O48A 5CMWA 5G55A 3ASDA 2I6HA 5G05J 3PDNA 3VLEA 4A3VA 2VTBA 4GA0A 3KAEA 5ARGA 4KVOA 4MRUA 3OTNA 2WXKA 4O6FA 4CGVA 4G25A 4AEZC 5D0OD 3FUIA 5AYWD 2DBAA 3UT4A 4Q69A 1DVPA 4YNDA 3B13A 3QKYA 5JJ6A 3APDA 1H2UA 2VTBB 3OXGA 2WQ7A 2V4LA 3NZSA 2WXQA 3CV0A 4FLHA 1ZU2A 3ZW3A 4GZ3A 1YA0A 2HYZA 4RVBA 3T5VA 5JHAA 1NZNA 2KCLA 1HF8A 4JHKA 3TG4A 2AVPA 2CG2A 4CGWA 2XEVA 3R9AB 3CHQA 5KJNA 3CHSA 4C0MA 3ZFWA 3LY7A 4PH4B 4CEMA 5KJMA 3ASGA 3BG0B 3UQ3A 3BG1B 2WXJA 3DBSA 4PDXA 5BNWA 4UI9K 3FDHA 5DIZA 4F3VA 2KC7A 2KATA 1H6KA 3B7SA 2XPIA 3FTUA 3ZPJA 5G2NA 1KLXA 3HDXA 3ZYMA 4DI3A 1PAQA 1NP7A 1EYHA 1WM5A 4IULA 2L0TB 3RRMB 3VTXA 5G04C 2X6JA 1HXIA 4G23A 4B89A 2J07A 2Y4UA 3CGHA 4KXKB 4B0ZA 3EIQC 5KJKA 3RO2A 4NURA 3RK6A 3PEVB 4XE0A 2FEZA 3JCKC 4I17A 3MZLB 3CVVA 3S7FA 2I1JA 3O4ZA 1FVFA 2I2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K9I A;  5FZS A;  4B94 A;  2LSV A;  1TJC A;  2UY1 A;  3LPZ A;  3CVN A;  1WAO 1;  3BEE A;  4J8F A;  4GCO A;  4I9C A;  3ESK A;  1KT0 A;  3QWW A;  2XCB A;  2PL2 A;  3QWV A;  4IN3 B;  3ULQ A;  1ZBP A;  3TAX A;  2XGS A;  4EQF A;  2KCV A;  3RO3 A;  4I9E A;  3S7B A;  2UWJ G;  5KJL A;  2P58 C;  4AY6 A;  3Q15 A;  5FJY A;  1PC2 A;  3CK8 A;  2VQ2 A;  4GA2 A;  2V5F A;  4UI9 J;  3GZ1 A;  2IFU A;  4U0U A;  2JLB A;  5EKQ D;  2HO1 A;  3MV2 B;  3FFL A;  2MHK A;  2FF4 A;  3Q49 B;  2QFC A;  5DBK A;  1P5Q A;  1ELW A;  4ME2 A;  4Y6C A;  3CVP A;  2XCC A;  5CCM A;  3WXX A;  3NF1 A;  1ELR A;  4HOQ A;  2C0M A;  2YHC A;  4XI0 A;  4U04 A;  5JJ7 A;  3LKU A;  3CKC A;  1KT1 A;  3CK9 A;  3FWV A;  3VTY A;  3UPV A;  5ARF A;  3AS5 A;  4U0S A;  4G26 A;  1IHG A;  5HI7 A;  4CDR A;  4N39 A;  4BT8 A;  3HYM B;  3S7D A;  4G2V A;  3ZHE A;  2PZI A;  3N71 A;  4UQX A;  4N3C A;  5LCW C;  2NC9 A;  5M72 A;  4UI9 C;  2FBN A;  1IYG A;  3ZHE B;  2XGO A;  5FZR A;  5C1D A;  2LSU A;  2BUG A;  2HR2 A;  4H7Y A;  4J0U A;  4GZ5 A;  3GZ2 A;  2Q7F A;  2KCK A;  3LY9 A;  4A1S A;  2UY1 B;  3LY8 A;  1Y8M A;  5G05 C;  4GYO A;  4BT9 A;  1XNF A;  4ABN A;  3Q4A B;  2J9Q A;  3ZGQ A;  4N2Q A;  3OXL A;  4G1T A;  2OOE A;  3ZN3 A;  4H7X A;  3MEK A;  1OUV A;  4NRH B;  4RG9 A;  3CVQ A;  4KYO B;  3QDN A;  3EDT B;  3PE3 A;  3MKR A;  3FP3 A;  2VGY A;  4J8E A;  5JJT A;  4JL0 A;  1HH8 A;  5D0Q D;  4GYY A;  3CK7 A;  4BTA A;  4U07 A;  4KBQ A;  5A6C A;  3RIB A;  4WNF A;  2C0L A;  4YVO A;  2VSN A;  3U3W A;  2XGM A;  1FCH A;  4HOT A;  4JHR A;  5G04 J;  3S7J A;  4I1A A;  4GYW A;  3CKB A;  4HOU A;  2GW1 A;  4WNE A;  3KS2 A;  4N3B A;  3E4B A;  2E2E A;  1HZ4 A;  3GW4 A;  4WNG A;  2FI7 A;  1QZ2 A;  3QWP A;  5FTP A;  2VGX A;  3KD7 A;  3JYS A;  3LCA A;  4U0Z A;  4I2Z A;  4UQY A;  1NA0 A;  1NA3 A;  2VGX B;  4GCN A;  3SZ7 A;  5CCL A;  5CHE E;  4APO A;  3TG5 A;  1E96 B;  2LNI A;  4N5C A;  4W9R A;  4YVQ C;  1W3B A;  3URZ A;  4AM9 A;  3AS8 A;  4GPK A;  2C2L A;  2VYI A;  3RU0 A;  2L6J A;  2VSY A;  4HOS A;  4RG6 A;  3ASH A;  4WUY A;  3TGO A;  3RKV A;  3IEG A;  4AY5 A;  4JA9 A;  4JA7 A;  2PQN A;  5A7D B;  5EX3 A;  3MA5 A;  1QQE A;  3GYZ A;  4XIF A;  3LYA A;  4I2W A;  4N2S A;  3OXF A;  2WQH A;  3QOU A;  5EX0 A;  3RJV A;  3PE4 A;  4NQ0 A;  3MV3 B;  3ASF A;  4BWR A;  2Y4T A;  2R5S A;  2WPV A;  4WND A;  3Q5M A;  4AIF A;  4J8D A;  4G24 A;  2OND A;  2FO7 A;  5HQ8 A;  5BW8 C;  5FZQ A;  4N3A A;  1B89 A;  5LCW J;  4XI9 A;  4GZ6 A;  5FT9 A;  2YQ8 A;  4GA1 A;  4BTB A;  3AS4 A;  3UUX A;  2IF4 A;  3CEQ A;  3Q47 B;  4Y6W A;  4LEU A;  3SF4 A;  3U4T A;  4HOR A;  4UQZ A;  2PQR A;  5BT1 A;  1A17 A;  3CVL A;  3O48 A;  3ASD A;  2I6H A;  5G05 J;  3PDN A;  4GA0 A;  3KAE A;  5ARG A;  4CGV A;  4O6F A;  4G25 A;  5D0O D;  5AYW D;  2DBA A;  4YND A;  3QKY A;  5JJ6 A;  3OXG A;  3CV0 A;  1ZU2 A;  4GZ3 A;  1YA0 A;  2HYZ A;  1NZN A;  2KCL A;  3TG4 A;  2AVP A;  4CGW A;  2XEV A;  3R9A B;  5KJN A;  3ZFW A;  3LY7 A;  5KJM A;  3ASG A;  3UQ3 A;  5BNW A;  4UI9 K;  5DIZ A;  4F3V A;  2KC7 A;  2KAT A;  2XPI A;  3ZPJ A;  1KLX A;  1WM5 A;  3VTX A;  5G04 C;  1HXI A;  4G23 A;  2Y4U A;  4KXK B;  5KJK A;  3RO2 A;  2FEZ A;  4I17 A;  3S7F A; 
#chains in the Genus database with same CATH topology
 3K9I A;  4HRN A;  4JEH A;  3JQ1 A;  5AJL A;  1Z3Y A;  2X6H A;  3IHY A;  3MKQ A;  3JUE A;  4ILI A;  2J08 A;  4RSY A;  1JPL A;  4WWP A;  1LD8 A;  1QYM A;  3MKQ B;  4IN3 B;  3B95 A;  3IBE A;  2LXM A;  3TXN A;  3D9O A;  1L5J A;  1ZBP A;  3TAX A;  3G2W A;  3AG2 E;  2KCV A;  3ONK A;  1O1T A;  3S7B A;  4I9E A;  1SA5 A;  2UWJ G;  3IHV A;  4HLL A;  2P58 C;  4HLE A;  4ATG A;  3FUE A;  5FJY A;  3CK8 A;  4UWL A;  2J4B A;  3NOG D;  4C0E A;  4DLQ A;  2VQ2 A;  2WVI A;  4GA2 A;  4ANW A;  3DXK G;  3NB2 A;  2JLB A;  5EKQ D;  3IV0 A;  3CQC B;  3FFL A;  4GTV A;  4GU5 A;  4MS6 A;  5FQ8 A;  4U7E B;  3U64 A;  5DBK A;  3ZU7 B;  1KZP A;  1UOH A;  3C5R A;  5ENR D;  1K1B A;  3E37 A;  4GAA A;  3ISM C;  3J5Q B;  1V54 E;  3CVP A;  1OWM A;  1DNP A;  5FIO A;  3UMV A;  3PNL B;  2NSZ A;  1ELR A;  1OCZ E;  3UM2 A;  4HOQ A;  3CHO A;  2YHC A;  5JJ7 A;  3D9L A;  5EN5 D;  2WXP A;  3DSU A;  2LAI A;  3VTY A;  3AS5 A;  4G26 A;  4I6J A;  3SNX A;  4DJA A;  3SI5 A;  5CEA A;  1TN6 A;  1DC2 A;  3U9W A;  3ZHE A;  1LTX A;  3S2A A;  3SBT B;  4WAF A;  5AAR A;  3QNK A;  5HKP A;  3UT7 A;  3ZHE B;  1TJF A;  5LP0 A;  4RQI A;  4CRW A;  4FC8 A;  2LSU A;  1N95 A;  4I6G A;  4B8C B;  4XX5 A;  2HR2 A;  4H7Y A;  3CVU A;  3MYV A;  3CR3 A;  3DXM G;  4A55 A;  1D8D A;  2H6H A;  4IYP A;  4ANX A;  3E33 A;  4GZD A;  1ELK A;  3ASO E;  2V4H C;  3ZGQ A;  3ESL A;  4N2Q A;  3OXL A;  2XEN A;  5ENT D;  1MJ0 A;  3ONL A;  4RG9 A;  4JEU A;  2BTD A;  4TRQ A;  4LG6 A;  1X81 A;  3UM3 A;  4JL0 A;  2NYJ A;  2LXL A;  2OVB A;  5FQ7 A;  3FUL A;  3RIB A;  2C0L A;  3QAR A;  4CYM D;  2CHX A;  4KZ0 A;  5CBN A;  4JHJ A;  4EPZ A;  2VSN A;  2ETC A;  5CER B;  3U3W A;  2XGM A;  3EIJ A;  4MKT A;  3R7Q A;  3TWT A;  3S7J A;  1PY1 A;  4GYW A;  2OCC E;  3JXI A;  3EUV A;  4L9P A;  3RRN B;  3I5P A;  4DX1 A;  3SD5 A;  3KS2 A;  2E2E A;  3GW4 A;  3T8M A;  4KMO A;  1FVH A;  1AWC B;  1NL4 A;  3CLJ A;  4KZC A;  2GRP B;  2RKK A;  2AXV A;  4FHJ A;  4A1G A;  4I6E A;  5LX8 A;  3TG5 A;  2LNI A;  1FT1 A;  4YVQ C;  4EBA A;  3AS8 A;  4ILH B;  1U2V G;  3ULY A;  2J49 A;  5KNH D;  4GPK A;  1IKN D;  3I4R B;  4J8Y A;  2EQX A;  3AG1 E;  2I1K A;  5BUZ A;  2VSY A;  1S70 B;  5AQA A;  3QC1 A;  4WUY A;  1E7V A;  4J8S A;  1MX4 A;  3UX4 A;  4ACL A;  3PUJ A;  4KT6 B;  3CVW A;  3NBN B;  4JA7 A;  2PQN A;  2H6I A;  4TUU A;  3GYZ A;  5LOZ A;  3L82 A;  2QY7 A;  3LYA A;  2DVW A;  2DCP A;  4I43 A;  2VJ8 A;  2GGF A;  3PH0 C;  1AP7 A;  3PE4 A;  4URK A;  5KBA A;  1E8Z A;  3MV3 B;  3UIO C;  3ASF A;  3P2B A;  2B0O E;  3D9M A;  3FEX A;  3SFY A;  3I3N A;  2R5S A;  1S0P A;  2QZA A;  4HFG A;  4C9B B;  3ZEF A;  2Y69 E;  3NOC D;  2KM4 A;  1N4Q A;  2P9P G;  3SBS A;  1EPU A;  1N52 A;  2FO7 A;  3FTW A;  3HIZ A;  1QNF A;  5HS0 A;  4CDN A;  1B89 A;  3TWQ A;  5FT9 A;  4NIK A;  4GA1 A;  4FUL A;  1K8K G;  2GRO B;  3ABK E;  4YDE A;  4M3O A;  4WWN A;  2RD0 A;  2CHZ A;  2DZO A;  2F37 A;  5BPP A;  3RRU A;  1V55 E;  3DSW A;  4O60 A;  3R7R A;  3PZ3 A;  2IJG X;  2ZIS A;  3ML9 A;  3FUM A;  3CVL A;  5G55 A;  3ASD A;  2I6H A;  3D9H A;  1BI7 B;  1MYO A;  4X8Q A;  4KVO A;  4MRU A;  5JMN D;  4G25 A;  2P9I G;  3FUI A;  3UT4 A;  4YND A;  2WQ7 A;  2V4L A;  2R03 A;  3ZW3 A;  2HYZ A;  3T5V A;  1NZN A;  5B3S E;  1HF8 A;  3TG4 A;  4CGW A;  3R9A B;  4CEM A;  3HXE A;  3ZFW A;  1TYQ G;  2V5Q C;  3UQ3 A;  4U95 D;  3B7S A;  3FTU A;  2XPI A;  3Q73 A;  1EYH A;  2L0T B;  3Q75 A;  3VTX A;  2X6J A;  3CGH A;  3EIQ C;  5KJK A;  4XE0 A;  3JCK C;  1TNO A;  3EU5 A;  5AQ7 A;  1QBQ A;  3CST A;  1MZC A;  3CVN A;  3L6A A;  3IXE A;  4J8F A;  4GCO A;  1Z5S C;  4TUM A;  4FAD A;  4I9C A;  4Q94 A;  1U3C A;  1KT0 A;  3DPD A;  4K5B A;  1E8Y A;  2XCB A;  2PL2 A;  2RFA A;  1G3N B;  2XGS A;  4UWF A;  4AXH A;  3V79 K;  2PNN A;  1JCQ A;  3PNT B;  5KJL A;  2P9S G;  4ATZ D;  4D10 C;  3W9F A;  2WXO A;  5KNG A;  3TWW A;  4BET A;  2V5F A;  2RG8 A;  2GRL A;  2IFU A;  4U0U A;  3MV2 B;  4EHM A;  3Q49 B;  3PZ1 A;  2I9C A;  2WM9 A;  1P5Q A;  1BPO A;  2F0Y A;  1HFA A;  3B7U X;  2XCC A;  5CCM A;  2QYU A;  4A63 B;  2NXP A;  5CBO A;  4YDO A;  3PRZ A;  3HXF A;  3MX3 A;  2DYS E;  4L23 A;  3SQV A;  3CKC A;  4FHK A;  5ENO D;  3V2X A;  3E30 A;  4HI9 A;  3LJ3 A;  1HG5 A;  4NAC A;  2P9N G;  3FTV A;  5HI7 A;  4B8A A;  2CFZ A;  4E6H A;  3GZS A;  4F1S A;  4DUI A;  3NQP A;  5M72 A;  2FBN A;  2XGO A;  5KWD A;  3I4G A;  4U96 D;  5FIN A;  4LSZ E;  1H19 A;  2L6B A;  4J0U A;  4GZ5 A;  3GZ2 A;  2Q7F A;  4BX9 A;  1OWP A;  4L1B A;  4K5C A;  3J5P A;  3LY9 A;  3ABL E;  2DWZ A;  4RLY A;  1Y8M A;  1E8W A;  3B7R L;  3L16 A;  4GYO A;  1E8X A;  1YMP A;  4ABN A;  3CQG B;  2KBX A;  2J9Q A;  5JHB A;  4G1T A;  3FH7 A;  2OOE A;  3EHR A;  3MEK A;  3HXB A;  5JA4 D;  1O1S A;  4NRH B;  3D9J A;  3ZRH A;  5BV1 A;  1N94 A;  3PE3 A;  4J8E A;  1H2T C;  5JJT A;  1BLX B;  1HH8 A;  5D0Q D;  1XGW A;  4GYY A;  5FQ6 A;  3ZUV B;  4FLB A;  4OAV B;  4WNF A;  3PVL A;  4JHR A;  2E0I A;  2VSO E;  5ANR A;  3AG3 E;  1JUQ A;  4JW1 A;  4R7L A;  4N3B A;  4LRZ A;  4O1P A;  4DI4 A;  4LNG A;  5H7P A;  3KSQ A;  1QZ2 A;  2EIN E;  3LEW A;  5ENP D;  3Q7A A;  2VGX A;  4AVX A;  3KD7 A;  4EZK A;  3CSF A;  3LCA A;  3MGB A;  3KEZ A;  4HNA D;  2VGX B;  4GCN A;  5D2M C;  3SZ7 A;  4UWG A;  5CHE E;  4APO A;  1O5M A;  4I1M A;  2Y0B G;  4N5C A;  1JWG A;  1LD7 A;  1W3B A;  2IOS A;  3URZ A;  3LDZ A;  3HXC A;  2ZXW E;  3UXG A;  5J90 A;  4OYS A;  2DIW A;  3RU0 A;  1OWO A;  2L6J A;  3ASH A;  4F6R D;  3MJW A;  3IEG A;  2AW6 A;  4OVU A;  3UI2 A;  2GRN B;  3MA5 A;  4U8Y D;  3ZYQ A;  1D8E A;  4XIF A;  2X6K A;  4N2S A;  1HG2 A;  1NFI E;  4P29 A;  5EX0 A;  1TEZ A;  1VDY A;  2ILR A;  3DSV A;  4G8K A;  4I1O B;  4NQ0 A;  3UM0 A;  2GRM A;  2X6F A;  2LUH A;  3AJI A;  3UIN C;  4L2L A;  2WPV A;  4WND A;  2GRR B;  4GB9 A;  1HX8 A;  3APF A;  4ACK A;  3Q5M A;  3CHP A;  3P1U A;  4DX6 D;  2OND A;  5CEC B;  3L17 A;  4JPS A;  3NZU A;  5FWQ A;  1MX6 A;  3B7B A;  1N11 A;  4N3A A;  4FA6 A;  4XI9 A;  1SVX A;  3Q9N C;  3QAQ A;  2YQ8 A;  2X38 A;  2IF4 A;  3Q47 B;  4MBG A;  4EEC A;  4HOR A;  2MYO A;  5E75 A;  1DCE A;  3DRA A;  2FUL A;  2A5U A;  1H0A A;  4O1O A;  3O48 A;  3PDN A;  4A3V A;  1K3Z D;  3OTN A;  2WXK A;  4CGV A;  4AEZ C;  4Q69 A;  2IO2 C;  3B13 A;  3QKY A;  3APD A;  4BEP A;  3NZS A;  3NAW A;  2WXQ A;  4RVB A;  2KCL A;  1O1R A;  3HRA A;  3ASN E;  3X2Q E;  3CHS A;  4C0M A;  3BG0 B;  4UI9 K;  3JXJ A;  5DIZ A;  2KC7 A;  1H6K A;  3SY2 A;  3ZPJ A;  3HDX A;  3ZYM A;  4JB8 P;  1PAQ A;  1NP7 A;  1WM5 A;  1SW6 A;  5G04 C;  2J07 A;  4KXK B;  2OEW A;  5AAO A;  4NUR A;  2IY0 C;  1OXJ A;  2J8S D;  1FVF A;  2I2O A;  5FZS A;  3T8K A;  2UY1 A;  1OWN A;  1H6P A;  1WAO 1;  4JVS A;  1OCC E;  3BEE A;  3DEP A;  3FU0 A;  3Q79 A;  3HG0 D;  1UG3 A;  2XS1 A;  3TWX A;  4Z68 A;  1IHB A;  3TXM A;  2PM7 A;  5AEN A;  2F8Y A;  1HU3 A;  4J6I A;  4IRU A;  4UI9 J;  4HB5 A;  4QQI A;  1UJK A;  3GZ1 A;  1DCQ A;  2HO1 A;  2MHK A;  2FF4 A;  4JC8 A;  5A23 A;  3Q7F A;  4BSX A;  5J08 A;  1ELW A;  3ABM E;  4OVV A;  4Y6C A;  2Y1L E;  3FUF A;  3WXX A;  2X6I A;  4LER A;  3L22 A;  4XI0 A;  4U04 A;  1INZ A;  2M63 A;  1SZA A;  3BU8 A;  4GMR A;  5ANL A;  4G11 A;  5HRY A;  4UWH A;  2AXU A;  4KVM A;  2MRI A;  1KT1 A;  3CK9 A;  4GTM A;  1WG0 A;  3FWV A;  3KEA A;  3UPV A;  1MX2 A;  4U0S A;  1KZO A;  3DSS A;  3OAW A;  4G8L A;  2F8X K;  1IHG A;  4HXI A;  3W9G A;  3FEY A;  2RFM A;  4BFR A;  4N39 A;  4N5Q A;  2J09 A;  3HYM B;  3S7D A;  4F1P A;  1X5B A;  1D9S A;  2PZI A;  3CVX A;  4N3C A;  4U8V D;  2XQ0 A;  4J7W A;  1UJJ A;  5LCW C;  2NC9 A;  1YYH A;  2L0I A;  3ZKJ A;  4FU3 A;  1IYG A;  3ZNG A;  4APF A;  3FU5 A;  2BUG A;  2R17 C;  4LUN U;  2IQC A;  2KCK A;  1IXV A;  4A1S A;  4FJZ A;  3LY8 A;  3SFZ A;  2WXL A;  2IO3 C;  5G05 C;  4HQD A;  4GTS A;  5AQ9 A;  4DX7 D;  3Q4A B;  3UT8 A;  3V30 A;  2DZN A;  4H7X A;  2WXF A;  3CIA A;  2WQ6 A;  5EIL A;  3MKR A;  2ZGG A;  3FP3 A;  4PS3 A;  2VGY A;  4AJW A;  2OV8 A;  3SGH A;  3WG7 E;  3G2V A;  2AXZ A;  5IY5 E;  4BTA A;  3MCX A;  4YVO A;  2WXG A;  4HI8 A;  3PZ4 A;  4TV3 A;  1GW6 A;  1TNY A;  3ZIM A;  3G2T A;  3DPY A;  1N4P A;  4HOU A;  2IOL A;  2GW1 A;  1TNU A;  4ZFH A;  3LXU X;  3FUJ A;  3T5X A;  2WB2 A;  2WXM A;  2XHE A;  1HZ4 A;  3EHN A;  1EF1 C;  2R05 A;  2FI7 A;  1SZ9 A;  2L9B A;  4JD2 G;  5T8I A;  3D9K A;  4UQY A;  1NA3 A;  2HM8 A;  5ENN A;  5CCL A;  2H6G A;  3FTZ A;  3EHM A;  3G2S A;  4DPR A;  1H6O A;  1S64 A;  4ANV A;  1H2V C;  2WMN A;  4XZ4 A;  1Y6I A;  4AM9 A;  5E76 A;  2ZGD A;  4C48 B;  3PZ2 A;  2B6C A;  4HOS A;  2XPY A;  2Y3A A;  5EIB E;  4MLP A;  2P9K G;  3TGO A;  2CG3 A;  3RKV A;  4AY5 A;  2V0P A;  4GPM A;  4JA9 A;  4CT4 A;  2R59 A;  5A7D B;  2ION A;  5EX3 A;  2XZT G;  3APC A;  5ENQ D;  1K1A A;  4L2Y A;  4I2W A;  3OXF A;  2WQH A;  3QOU A;  4DX2 A;  3CHM A;  4GTP A;  4BY6 A;  1HO8 A;  1OT8 A;  1HS6 A;  4A3T A;  3BQO A;  3ULE G;  3ZXS A;  4F7A A;  1IQR A;  4G24 A;  2YIN A;  4GZC A;  1U3D A;  3UIP C;  4WWO A;  3HXD A;  2GRQ B;  3PEU B;  3KSL A;  5HQ8 A;  5BW8 C;  3ZYK A;  3FTY A;  5FZQ A;  4LCT A;  4DX5 D;  5B1A E;  1TNB A;  4OAU C;  2P9U G;  4UWK A;  4GZ6 A;  3ZYL A;  3AS4 A;  3UTM A;  3UUX A;  3CEQ A;  4Y6W A;  5FQ4 A;  4HVB A;  2EIK E;  2WXN A;  4DLO A;  1OWL A;  3SF4 A;  3U4T A;  3D9N A;  4UQZ A;  5EYL A;  1JWF A;  4TXP A;  4PUC A;  2VTB A;  4GA0 A;  5ARG A;  2A5E A;  2VTB B;  3OXG A;  4UUC A;  1ZU2 A;  4GZ3 A;  5JHA A;  3CHQ A;  1N0R A;  3ASG A;  2WXJ A;  4PDX A;  2R2L A;  3FDH A;  2OEV A;  2KAT A;  2QYJ A;  5G2N A;  1KLX A;  4K5A B;  1NI1 A;  1HXI A;  4G23 A;  4B89 A;  3PEV B;  2FEZ A;  4I17 A;  3CVV A;  2I1J A;  4IUL A;  4FP7 A;  4JXT A;  4B94 A;  2LSV A;  3UKR G;  1E90 A;  1TJC A;  3PZD A;  4DRX E;  3LPZ A;  5D66 A;  1WY6 A;  3FTS A;  3QB2 A;  2HE0 A;  3QK0 A;  4GML A;  3ESK A;  3FY4 A;  4LNB A;  3CVY A;  3FU3 A;  3QWW A;  3D9I A;  3QWV A;  1TNZ A;  3TWV A;  1Z3X A;  2WXR A;  4AOF A;  3ULQ A;  4EQF A;  1EDU A;  2P2C P;  4CCA A;  3RO3 A;  3SHF A;  3ML8 A;  4AY6 A;  3Q15 A;  3RSE G;  3L54 A;  3IKO B;  4GMJ A;  1PC2 A;  3L08 A;  1BI8 B;  3HHM A;  5EYP F;  4B93 B;  5CMY A;  4DK5 A;  2BF0 X;  1E7U A;  2QFC A;  5T3R A;  3C98 A;  5AIJ A;  5AJD A;  3PUK A;  4ME2 A;  4GTT A;  2J4D A;  5BV0 A;  2ETB A;  3NF1 A;  2C0M A;  4E85 A;  3FHE A;  4CDM A;  3E34 A;  4YDW A;  4EZL A;  3LKU A;  2JAB A;  2X3M A;  2BED A;  2WXI A;  4HRL A;  1UW4 B;  1MHQ A;  3LJN A;  5ARF A;  4HS2 A;  1N9A A;  5BXU A;  2MOW A;  2XRY A;  5CRU A;  4CDR A;  4BT8 A;  3LVR E;  4G2V A;  4XKB A;  3N71 A;  1TR4 A;  4UQX A;  4BX8 A;  3DSX A;  3R9M A;  4GTR A;  4UI9 C;  4PS7 A;  4L7T A;  5FZR A;  5C1D A;  3C3Q A;  5BXO A;  2H6F A;  3TWS A;  5ITZ F;  4BER A;  4F53 A;  1N4S A;  1OCO E;  1S63 A;  3E32 A;  3LS8 A;  3TWR A;  5C2Y A;  4BSZ B;  2UY1 B;  4TXQ A;  3C3O A;  4BT9 A;  4JZY A;  1XNF A;  3EHQ A;  2AWI A;  3AU4 A;  2PM6 A;  3ZN3 A;  1SQM A;  3JQ0 A;  1OUV A;  2YHE A;  3FUD A;  2R02 A;  3UM1 A;  3CVQ A;  4KYO B;  3QDN A;  3EDT B;  3FTX A;  3D9P A;  1TN8 A;  1Z6T A;  1N4R A;  2DYR E;  4K03 A;  5CED B;  3CK7 A;  5T4Y A;  4U07 A;  4KBQ A;  5A6C A;  2XEH A;  3VLD A;  3ENE A;  4HBD A;  1HE8 A;  1FCH A;  2V8S E;  4HOT A;  5G04 J;  2BKG A;  3SFX A;  4I1A A;  2YNQ A;  1RZ4 A;  3CKB A;  2LO6 A;  4QFV A;  3JUI A;  4EBA G;  3B7T A;  4WNE A;  2OVF A;  3BUA A;  1MQS A;  2VSX E;  1JCR A;  3E4B A;  3PS6 A;  2P9L G;  3AG4 E;  4WNG A;  5KCM A;  3QWP A;  5FTP A;  1ZB1 A;  2EIL E;  2KXP C;  3JYS A;  4U63 A;  2CHW A;  5AN8 A;  1LF8 A;  4U0Z A;  4I2Z A;  2VGE A;  2EIJ E;  4GTQ A;  1NA0 A;  4V3I A;  3G2U A;  3PRE A;  2XRZ A;  3U66 A;  4PS8 A;  4YDY A;  2WMO A;  4CT0 A;  1E96 B;  3F6Q A;  3CHR A;  3VLF A;  4W9R A;  3SO8 A;  3TJP A;  4ILG A;  2XZD G;  3L9T A;  3TL5 A;  4Q96 A;  3FH8 A;  2ETA A;  3V31 A;  4ZHB A;  3FH5 A;  2C2L A;  2VYI A;  3LVQ E;  4K0R A;  4RG6 A;  3EJN A;  4AP2 A;  2A4Z A;  4U8H A;  2QC9 A;  2IU1 A;  3L13 A;  3HVE A;  3DEO A;  1QQE A;  2IEJ A;  3FUK A;  3FU6 A;  4XKC A;  3HVE B;  2JEK A;  3ZVV A;  1OY3 D;  2LAH A;  2XS8 A;  4BES A;  3RJV A;  1N54 A;  4M7C A;  5EDS A;  1IQU A;  3D3M A;  4BWR A;  1OCR E;  2Y4T A;  4LNU D;  5LFA A;  3C72 A;  4ANU A;  2XPZ A;  4AIF A;  4J8D A;  1BD8 A;  2WXH A;  1N0Q A;  2CFU A;  2ZU6 B;  3FUH A;  1SA4 A;  3AU5 A;  1WDY A;  2KZT A;  3UKU G;  3ZXP A;  1FT2 A;  1A5E A;  1UN8 A;  5LCW J;  2KZT B;  4BTB A;  3Q78 A;  3FUN A;  4AV7 A;  2AJA A;  4LEU A;  1KPS B;  1UN9 A;  5ENS D;  3EU9 A;  5AQB A;  3RAU A;  4XEI G;  1YCS B;  4EZJ A;  2PQR A;  1BU9 A;  5BT1 A;  3T9K A;  2ZIR A;  3AAA C;  5CRV A;  4FJY A;  1A17 A;  1FPP A;  3QJZ A;  5CMW A;  5G05 J;  3VLE A;  1JCS A;  3V2O A;  3KAE A;  4O6F A;  3DST A;  5D0O D;  5AYW D;  2DBA A;  1RW2 A;  1DVP A;  5JJ6 A;  2FO1 E;  4TXR A;  1H2U A;  2EIM E;  3CV0 A;  4FLH A;  3TWU A;  3C3R A;  4HRM B;  1YA0 A;  2XEE A;  4JHK A;  2AVP A;  2CG2 A;  2XEV A;  5KJN A;  5KJM A;  3LY7 A;  4PH4 B;  3BG1 B;  3DBS A;  5BNW A;  5B1B E;  3Q9U C;  4F3V A;  5EID A;  4DI3 A;  4CZ2 D;  4GTO A;  3RRM B;  2Y4U A;  4B0Z A;  3DWL G;  3RK6 A;  3RO2 A;  1Q2Z A;  3MZL B;  3S7F A;  1TN7 A;  3O4Z A;  2BKK B; 
#chains in the Genus database with same CATH homology
 4FP7 A;  3K9I A;  4JEH A;  4JXT A;  3JQ1 A;  5FZS A;  4B94 A;  2LSV A;  5AJL A;  1E90 A;  1Z3Y A;  1TJC A;  1OWN A;  2UY1 A;  2X6H A;  3CST A;  3IHY A;  3CVN A;  3LPZ A;  1WAO 1;  3MKQ A;  3PZD A;  4JVS A;  3L6A A;  3BEE A;  1WY6 A;  4J8F A;  3FTS A;  4GCO A;  3QB2 A;  3FU0 A;  3QK0 A;  2J08 A;  4I9C A;  4ILI A;  4Q94 A;  4GML A;  1JPL A;  4RSY A;  1U3C A;  3ESK A;  4WWP A;  1KT0 A;  3FY4 A;  3DPD A;  3CVY A;  3FU3 A;  3QWW A;  1E8Y A;  2XCB A;  3D9I A;  2PL2 A;  3MKQ B;  3QWV A;  4IN3 B;  3IBE A;  3TXN A;  3D9O A;  1Z3X A;  2WXR A;  4AOF A;  1UG3 A;  3ULQ A;  1L5J A;  1ZBP A;  3TAX A;  2XGS A;  4UWF A;  4EQF A;  3G2W A;  1EDU A;  4CCA A;  2KCV A;  3ONK A;  4AXH A;  3RO3 A;  4I9E A;  3S7B A;  2UWJ G;  3SHF A;  5KJL A;  3PNT B;  3IHV A;  2P58 C;  3ML8 A;  4HLE A;  4ATG A;  4AY6 A;  3FUE A;  3TXM A;  2PM7 A;  3Q15 A;  3L54 A;  5FJY A;  4D10 C;  3IKO B;  4GMJ A;  1PC2 A;  3L08 A;  3CK8 A;  5AEN A;  4UWL A;  2J4B A;  4C0E A;  4DLQ A;  1HU3 A;  2VQ2 A;  2WXO A;  2WVI A;  4J6I A;  4GA2 A;  4ANW A;  2V5F A;  3HHM A;  2RG8 A;  4IRU A;  4UI9 J;  1UJK A;  2GRL A;  3GZ1 A;  2IFU A;  5CMY A;  4U0U A;  2JLB A;  2HO1 A;  5EKQ D;  3IV0 A;  3MV2 B;  3CQC B;  3FFL A;  4GU5 A;  4MS6 A;  2BF0 X;  2MHK A;  5FQ8 A;  4DK5 A;  1E7U A;  2FF4 A;  3Q49 B;  2QFC A;  3U64 A;  5T3R A;  4JC8 A;  5A23 A;  3C98 A;  5J08 A;  4BSX A;  5AIJ A;  5AJD A;  2I9C A;  2WM9 A;  3PUK A;  5DBK A;  1P5Q A;  1ELW A;  4OVV A;  4ME2 A;  4Y6C A;  1BPO A;  4GAA A;  1HFA A;  3B7U X;  3FUF A;  2J4D A;  3CVP A;  2XCC A;  5CCM A;  3WXX A;  5BV0 A;  1OWM A;  1DNP A;  2X6I A;  3NF1 A;  3UMV A;  3PNL B;  2NSZ A;  4LER A;  1ELR A;  4HOQ A;  2NXP A;  3L22 A;  2C0M A;  3CHO A;  2YHC A;  3PRZ A;  4E85 A;  3MX3 A;  3FHE A;  4XI0 A;  4U04 A;  4CDM A;  5JJ7 A;  4L23 A;  1INZ A;  2M63 A;  3D9L A;  1SZA A;  2WXP A;  5ANL A;  4EZL A;  4G11 A;  3LKU A;  4UWH A;  3CKC A;  2AXU A;  4KVM A;  2MRI A;  3CK9 A;  1KT1 A;  2X3M A;  4FHK A;  2LAI A;  2WXI A;  3FWV A;  3VTY A;  3UPV A;  1UW4 B;  1MHQ A;  5ARF A;  3AS5 A;  3LJ3 A;  4U0S A;  1HG5 A;  4NAC A;  3OAW A;  3FTV A;  1IHG A;  4G26 A;  4HS2 A;  4HXI A;  4I6J A;  5HI7 A;  3FEY A;  4B8A A;  2MOW A;  4BFR A;  2CFZ A;  2XRY A;  4CDR A;  3SNX A;  4E6H A;  4N39 A;  4BT8 A;  2J09 A;  3LVR E;  3SI5 A;  3HYM B;  4DJA A;  3U9W A;  3S7D A;  3GZS A;  1X5B A;  4G2V A;  3ZHE A;  4XKB A;  2PZI A;  3N71 A;  3CVX A;  3S2A A;  3SBT B;  4UQX A;  4BX8 A;  4WAF A;  4F1S A;  4N3C A;  2XQ0 A;  5LCW C;  1UJJ A;  3QNK A;  3UT7 A;  2NC9 A;  3NQP A;  2L0I A;  5M72 A;  4UI9 C;  2FBN A;  4FU3 A;  4PS7 A;  4L7T A;  1IYG A;  3ZHE B;  1TJF A;  2XGO A;  3I4G A;  5FZR A;  5LP0 A;  5C1D A;  4CRW A;  4FC8 A;  2LSU A;  4I6G A;  4B8C B;  4APF A;  3FU5 A;  2BUG A;  4XX5 A;  1H19 A;  2HR2 A;  4H7Y A;  3CVU A;  4J0U A;  4F53 A;  2R17 C;  3CR3 A;  3MYV A;  4GZ5 A;  3GZ2 A;  4LUN U;  2IQC A;  2Q7F A;  1OWP A;  4BX9 A;  3LS8 A;  4L1B A;  2KCK A;  3LY9 A;  4A55 A;  4IYP A;  4A1S A;  5C2Y A;  2UY1 B;  4FJZ A;  3LY8 A;  3SFZ A;  4ANX A;  2WXL A;  4GZD A;  1Y8M A;  5G05 C;  1E8W A;  3B7R L;  3L16 A;  4GYO A;  4BT9 A;  4JZY A;  1E8X A;  1XNF A;  4ABN A;  1ELK A;  3CQG B;  3Q4A B;  3UT8 A;  2AWI A;  2J9Q A;  5JHB A;  3ZGQ A;  3AU4 A;  3ESL A;  4N2Q A;  3OXL A;  2PM6 A;  3FH7 A;  2OOE A;  4G1T A;  3ZN3 A;  4H7X A;  1SQM A;  3MEK A;  2WXF A;  3JQ0 A;  1OUV A;  2YHE A;  3FUD A;  3CIA A;  2WQ6 A;  3ONL A;  4NRH B;  4RG9 A;  4JEU A;  3CVQ A;  4KYO B;  2BTD A;  3D9J A;  3ZRH A;  5BV1 A;  3QDN A;  4TRQ A;  3EDT B;  3PE3 A;  3MKR A;  3FP3 A;  4PS3 A;  2VGY A;  3FTX A;  4AJW A;  4J8E A;  3D9P A;  1H2T C;  5JJT A;  1Z6T A;  4JL0 A;  1HH8 A;  2OV8 A;  4K03 A;  3SGH A;  5D0Q D;  1XGW A;  4GYY A;  5FQ6 A;  2OVB A;  3G2V A;  2AXZ A;  3CK7 A;  5T4Y A;  4BTA A;  4U07 A;  5FQ7 A;  4FLB A;  4KBQ A;  5A6C A;  3FUL A;  4WNF A;  3RIB A;  2C0L A;  3QAR A;  2CHX A;  4KZ0 A;  3ENE A;  3MCX A;  4JHJ A;  2VSN A;  2WXG A;  4YVO A;  3VLD A;  4EPZ A;  3U3W A;  2XGM A;  1HE8 A;  1FCH A;  2V8S E;  3EIJ A;  3PVL A;  1GW6 A;  4JHR A;  4MKT A;  4TV3 A;  5G04 J;  3R7Q A;  4HOT A;  2E0I A;  2VSO E;  4I1A A;  2YNQ A;  3S7J A;  1PY1 A;  4GYW A;  5ANR A;  3CKB A;  3ZIM A;  2LO6 A;  4QFV A;  3G2T A;  1JUQ A;  3JUI A;  4HOU A;  2IOL A;  3RRN B;  4EBA G;  3B7T A;  2GW1 A;  3I5P A;  4JW1 A;  4WNE A;  3LXU X;  3FUJ A;  4R7L A;  3SD5 A;  3T5X A;  3KS2 A;  2OVF A;  2WXM A;  2WB2 A;  1MQS A;  4N3B A;  2VSX E;  4LRZ A;  3E4B A;  2E2E A;  1HZ4 A;  2XHE A;  3EHN A;  1EF1 C;  3GW4 A;  3PS6 A;  5KCM A;  4DI4 A;  4WNG A;  3T8M A;  2FI7 A;  1SZ9 A;  4KMO A;  2L9B A;  1FVH A;  1QZ2 A;  3QWP A;  3LEW A;  3CLJ A;  4FAD A;  5FTP A;  4KZC A;  5T8I A;  3D9K A;  2VGX A;  4AVX A;  3KD7 A;  3JYS A;  4U63 A;  2CHW A;  4EZK A;  3CSF A;  3LCA A;  1LF8 A;  4U0Z A;  4I2Z A;  2AXV A;  4UQY A;  1NA0 A;  3MGB A;  3KEZ A;  4V3I A;  1NA3 A;  2HM8 A;  3G2U A;  4FHJ A;  3PRE A;  5ENN A;  2XRZ A;  2VGX B;  3U66 A;  4GCN A;  3SZ7 A;  5CCL A;  4UWG A;  4A1G A;  4I6E A;  5CHE E;  4APO A;  4PS8 A;  5LX8 A;  4I1M A;  2WMO A;  3FTZ A;  3TG5 A;  4CT0 A;  1E96 B;  3EHM A;  2LNI A;  3G2S A;  4N5C A;  3CHR A;  4DPR A;  3VLF A;  1JWG A;  4W9R A;  4YVQ C;  4ANV A;  1H2V C;  2WMN A;  3TJP A;  4ILG A;  4XZ4 A;  1W3B A;  2IOS A;  4EBA A;  3TL5 A;  3URZ A;  4Q96 A;  1Y6I A;  3FH8 A;  3LDZ A;  4AM9 A;  3AS8 A;  4ILH B;  5E76 A;  5J90 A;  2J49 A;  4OYS A;  4GPK A;  2DIW A;  3FH5 A;  2C2L A;  2VYI A;  3RU0 A;  3I4R B;  3LVQ E;  4K0R A;  2EQX A;  1OWO A;  2L6J A;  2I1K A;  5BUZ A;  2VSY A;  4HOS A;  2XPY A;  4RG6 A;  2Y3A A;  3ASH A;  3EJN A;  4MLP A;  4AP2 A;  2A4Z A;  3QC1 A;  4WUY A;  1E7V A;  3TGO A;  4J8S A;  3MJW A;  4U8H A;  2CG3 A;  3RKV A;  3IEG A;  2V0P A;  4AY5 A;  3UX4 A;  4ACL A;  3PUJ A;  4JA9 A;  4KT6 B;  3CVW A;  2AW6 A;  2IU1 A;  3L13 A;  4JA7 A;  2PQN A;  2R59 A;  4CT4 A;  4OVU A;  3HVE A;  5A7D B;  2ION A;  4TUU A;  5EX3 A;  3APC A;  3MA5 A;  1QQE A;  3GYZ A;  5LOZ A;  3ZYQ A;  3FUK A;  3FU6 A;  2QY7 A;  4L2Y A;  4XIF A;  3LYA A;  2X6K A;  4XKC A;  4I2W A;  3HVE B;  2DCP A;  4N2S A;  1HG2 A;  2JEK A;  2WQH A;  3OXF A;  3QOU A;  4I43 A;  2VJ8 A;  4P29 A;  2GGF A;  3ZVV A;  5EX0 A;  3PH0 C;  2LAH A;  1TEZ A;  1VDY A;  3RJV A;  3PE4 A;  3CHM A;  4URK A;  1N54 A;  1E8Z A;  4BY6 A;  2ILR A;  1HO8 A;  4NQ0 A;  4I1O B;  5EDS A;  1IQU A;  3MV3 B;  2GRM A;  3ASF A;  1HS6 A;  3D3M A;  3P2B A;  2X6F A;  4BWR A;  3D9M A;  2Y4T A;  3FEX A;  4L2L A;  4A3T A;  5LFA A;  3I3N A;  2R5S A;  2WPV A;  4WND A;  1S0P A;  4ANU A;  3ZXS A;  4GB9 A;  1HX8 A;  3APF A;  2XPZ A;  4ACK A;  3Q5M A;  4AIF A;  4HFG A;  4F7A A;  4C9B B;  3ZEF A;  4J8D A;  3CHP A;  2KM4 A;  2WXH A;  3P1U A;  1IQR A;  2CFU A;  2ZU6 B;  3FUH A;  4G24 A;  2YIN A;  2OND A;  4GZC A;  1U3D A;  3SBS A;  3L17 A;  4WWO A;  4JPS A;  1EPU A;  3AU5 A;  1N52 A;  2FO7 A;  3NZU A;  3PEU B;  5FWQ A;  2KZT A;  3FTW A;  3HIZ A;  1QNF A;  5HQ8 A;  5BW8 C;  3ZYK A;  3FTY A;  5FZQ A;  4LCT A;  4N3A A;  4CDN A;  1B89 A;  1UN8 A;  4FA6 A;  4UWK A;  5LCW J;  4XI9 A;  4GZ6 A;  2KZT B;  5FT9 A;  3QAQ A;  2YQ8 A;  2X38 A;  3ZYL A;  4GA1 A;  4BTB A;  4FUL A;  3AS4 A;  3UUX A;  2IF4 A;  3CEQ A;  3Q47 B;  4Y6W A;  3FUN A;  5FQ4 A;  4AV7 A;  4HVB A;  2WXN A;  4DLO A;  4M3O A;  4WWN A;  2RD0 A;  4LEU A;  1OWL A;  2CHZ A;  3SF4 A;  4EEC A;  3U4T A;  5BPP A;  4HOR A;  3D9N A;  4UQZ A;  3RRU A;  1UN9 A;  5E75 A;  4EZJ A;  2PQR A;  1JWF A;  5BT1 A;  2FUL A;  2A5U A;  3R7R A;  2IJG X;  4FJY A;  1A17 A;  1H0A A;  3ML9 A;  3QJZ A;  3FUM A;  3CVL A;  4PUC A;  3O48 A;  5CMW A;  5G55 A;  3ASD A;  2I6H A;  5G05 J;  3PDN A;  3VLE A;  4A3V A;  2VTB A;  4GA0 A;  3KAE A;  5ARG A;  4KVO A;  4MRU A;  3OTN A;  2WXK A;  4O6F A;  4CGV A;  4G25 A;  4AEZ C;  5D0O D;  3FUI A;  5AYW D;  2DBA A;  3UT4 A;  4Q69 A;  1DVP A;  4YND A;  3B13 A;  3QKY A;  5JJ6 A;  3APD A;  1H2U A;  2VTB B;  3OXG A;  2WQ7 A;  2V4L A;  3NZS A;  2WXQ A;  3CV0 A;  4FLH A;  1ZU2 A;  3ZW3 A;  4GZ3 A;  1YA0 A;  2HYZ A;  4RVB A;  3T5V A;  5JHA A;  1NZN A;  2KCL A;  1HF8 A;  4JHK A;  3TG4 A;  2AVP A;  2CG2 A;  4CGW A;  2XEV A;  3R9A B;  3CHQ A;  5KJN A;  3CHS A;  4C0M A;  3ZFW A;  3LY7 A;  4PH4 B;  4CEM A;  5KJM A;  3ASG A;  3BG0 B;  3UQ3 A;  3BG1 B;  2WXJ A;  3DBS A;  4PDX A;  5BNW A;  4UI9 K;  3FDH A;  5DIZ A;  4F3V A;  2KC7 A;  2KAT A;  1H6K A;  3B7S A;  2XPI A;  3FTU A;  3ZPJ A;  5G2N A;  1KLX A;  3HDX A;  3ZYM A;  4DI3 A;  1PAQ A;  1NP7 A;  1EYH A;  1WM5 A;  4IUL A;  2L0T B;  3RRM B;  3VTX A;  5G04 C;  2X6J A;  1HXI A;  4G23 A;  4B89 A;  2J07 A;  2Y4U A;  3CGH A;  4KXK B;  4B0Z A;  3EIQ C;  5KJK A;  3RO2 A;  4NUR A;  3RK6 A;  3PEV B;  4XE0 A;  2FEZ A;  3JCK C;  4I17 A;  3MZL B;  3CVV A;  3S7F A;  2I1J A;  3O4Z A;  1FVF A;  2I2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...