1E96B

Structure of the rac/p67phox complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
185
structure length
185
Chain Sequence
SLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Tpr Domain of P67Phox in Complex with Rac.GTP
pubmed rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
total genus 71
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1e96B00
2WPVA 4CDRA 1B89A 2FEZA 3QKYA 4J8EA 2Y4UA 3WXXA 2I6HA 3Q47B 2HO1A 3CK7A 3K9IA 3GW4A 3ULQA 5CCMA 4AY5A 4GCNA 2PQNA 3CVNA 1A17A 5JJ7A 3TAXA 3FFLA 4AY6A 4BWRA 4BTAA 3CK9A 5LCWC 2E2EA 4IN3B 2IF4A 2UWJG 4KYOB 4O6FA 3MEKA 3U4TA 3S7BA 2P58C 2UY1A 3TGOA 1E96B 2HR2A 3NF1A 4G24A 3OXFA 4UQZA 3Q49B 4W9RA 4WNFA 5EX0A 3RKVA 5KJLA 3MV2B 5G05C 1PC2A 2Y4TA 2BUGA 2VGYA 4Y6WA 2FF4A 1XNFA 4I9EA 4B94A 3UPVA 4KXKB 1NZNA 4U0ZA 3CVLA 4GZ3A 5CHEE 2VQ2A 2VGXA 4UI9C 3RU0A 5M72A 4GPKA 4GZ6A 3CK8A 4GYOA 3ASHA 5EKQD 3CKBA 3SF4A 5G05J 3VTYA 4AM9A 4EQFA 4ABNA 2XPIA 4XIFA 3FP3A 4H7XA 4H7YA 5FZQA 3N71A 4GYWA 4HORA 4G26A 4Y6CA 5G04J 5KJNA 1ELRA 3Q15A 5D0OD 5HQ8A 3MKRA 5C1DA 2PZIA 3MV3B 4WNEA 4U0UA 4AIFA 2R5SA 4GA2A 2MHKA 3ASDA 4N3BA 3GYZA 2Q7FA 3KAEA 4G2VA 3CEQA 4N5CA 3ASFA 5CCLA 2PQRA 4KBQA 4RG9A 4UQXA 3MA5A 3PE3A 5EX3A 1HXIA 3PDNA 3AS5A 3TG5A 3ESKA 1FCHA 4NQ0A 1YA0A 5A7DB 5FZRA 5AYWD 4XI9A 3E4BA 4U04A 5KJKA 2C2LA 1TJCA 1WM5A 5FJYA 2AVPA 4JL0A 5BT1A 3UQ3A 4F3VA 2LSUA 2XGMA 3TG4A 4APOA 3LCAA 3RO3A 3RO2A 3LYAA 4CGWA 2ONDA 2HYZA 4A1SA 4YVOA 3EDTB 3Q5MA 2KCVA 2XCCA 2FBNA 3JYSA 4GA1A 4I2WA 3AS8A 3RIBA 2IFUA 3ZFWA 2UY1B 3BEEA 1KLXA 4J8FA 1WAO1 3S7JA 3SZ7A 4HOTA 4CGVA 2YQ8A 3FWVA 3QDNA 2JLBA 2WQHA 3AS4A 1IYGA 1Y8MA 5DBKA 3ZPJA 3CVQA 5BNWA 5DIZA 2C0MA 4GYYA 4WNDA 4YVQC 3ZHEB 4J0UA 4BTBA 2J9QA 2KCLA 1NA0A 1ZBPA 1W3BA 2LSVA 3QWVA 3LY7A 2C0LA 2VSYA 3QWWA 3LY8A 4HOUA 2XGSA 5D0QD 2V5FA 4HOQA 2L6JA 3S7FA 5FTPA 3KD7A 2YHCA 1HZ4A 1KT0A 5ARFA 5FZSA 3R9AB 3ZGQA 4BT8A 4N2SA 1HH8A 4ME2A 4BT9A 3U3WA 3VTXA 3LY9A 3LKUA 3O48A 4WNGA 3UUXA 4I17A 2NC9A 3S7DA 1KT1A 4JA7A 5ARGA 3PE4A 2XGOA 2KC7A 1IHGA 1QQEA 4I1AA 4G23A 3CKCA 4GA0A 4NRHB 5A6CA 4N3AA 5LCWJ 1ELWA 3IEGA 2DBAA 2LNIA 3CVPA 3QOUA 2VSNA 5HI7A 4LEUA 4HOSA 1QZ2A 1P5QA 4N39A 4WUYA 5BW8C 3URZA 5G04C 5JJTA 4N2QA 5KJMA 2OOEA 4UI9K 4JA9A 3ZHEA 2VGXB 2KATA 1NA3A 3CV0A 3LPZA 2FI7A 3Q4AB 3QWPA 4I2ZA 4RG6A 4U07A 3GZ2A 4UQYA 4G1TA 5JJ6A 2KCKA 1ZU2A 3GZ1A 4YNDA 5FT9A 2XEVA 2QFCA 4U0SA 4N3CA 4UI9J 4XI0A 3ASGA 3KS2A 3OXGA 2XCBA 4GZ5A 4I9CA 4JHRA 2GW1A 3RJVA 2FO7A 3OXLA 2VYIA 1OUVA 3HYMB 3ZN3A 4J8DA 2PL2A 4GCOA 4G25A
chains in the Genus database with same CATH superfamily
4CDRA 3RSEG 1H6KA 1DNPA 3FUDA 4BWRA 4BTAA 4JB8P 1E8WA 2UWJG 3EJNA 2DWZA 1EPUA 2MYOA 2L0TB 3D9KA 3MV2B 5FINA 1N52A 1U3DA 5KWDA 1TYQG 4I9EA 3CHSA 5CHEE 4CZ2D 2VGXA 2MOWA 3CK8A 1UJKA 2I1KA 5ENSD 3SF4A 2ZGGA 3SBSA 3FEYA 3OTNA 4GTTA 4HORA 4XZ4A 3CVXA 3S2AA 4C48B 1OWMA 2PZIA 4N3BA 2WXOA 1UW4B 3KEZA 5ENQD 1LD8A 1IHBA 1YYHA 1YA0A 3PEVB 4JL0A 3ZYMA 1QBQA 1BPOA 2KZTB 2XCCA 3HRAA 4URKA 2C0LA 2WXGA 5D0QD 4BX9A 4U96D 2BKKB 2DYRE 3CVUA 3ZGQA 3IBEA 4AV7A 4NRHB 1X5BA 3B7RL 3UX4A 1JCSA 3ENEA 4TUUA 4UI9K 5BW8C 3Q4AB 5HQ8A 4RG6A 5LOZA 3D3MA 3FY4A 4GZ5A 3AJIA 2KBXA 3LJNA 1A5EA 4HS2A 2WXKA 3HIZA 4ACLA 1NL4A 4M7CA 4O1OA 5T3RA 3VLFA 3TGOA 3TWXA 4X8QA 4DX7D 5T8IA 2NSZA 2CG3A 3W9FA 3FUIA 3V79K 2VQ2A 3CVVA 2DIWA 4IRUA 2AXZA 3AG3E 3ZYLA 5JMND 3D9LA 3QC1A 3L9TA 1K1AA 2I1JA 3ASDA 3PVLA 5CCLA 4ANXA 4RG9A 4AP2A 1FCHA 3I5PA 4FLBA 4NQ0A 2X38A 4B8CB 3NZUA 1MX4A 2GRLA 4GMLA 4XEIG 3LYAA 2KCVA 3BG1B 5KNGA 5JA4D 1OY3D 1D9SA 2V4LA 2VTBB 4J0UA 3U66A 4I6GA 2VSYA 4JVSA 2V5QC 4N5QA 3MX3A 2XHEA 3TWRA 1Z6TA 3O48A 3U9WA 4GA0A 4HRLA 3ASOE 3FTZA 5ANLA 3SFZA 2P9UG 5FQ7A 1MX2A 5CRUA 2EINE 5FQ4A 1E90A 1BI8B 3GZ1A 3KS2A 3TXNA 1TNZA 1N9AA 3Q47B 5T4YA 5CCMA 4KVOA 3NZSA 4G24A 5EX0A 5G05C 2OEWA 4HI8A 3PZ1A 2L9BA 1TEZA 1UN9A 4XIFA 1K1BA 1ELRA 4G8KA 1OXJA 2J07A 2R17C 2L6BA 1TJFA 4JHJA 4JW1A 5BPPA 2Y0BG 4J6IA 2XGMA 4APOA 3E33A 5ENNA 4JEHA 5FWQA 3P2BA 3QDNA 3PZ4A 4WNDA 4UUCA 4BTBA 2ETAA 2QY7A 4DI3A 4ZFHA 5FTPA 3SO8A 1YMPA 2AJAA 4G23A 2XS1A 3CVPA 1QZ2A 1S63A 3CV0A 4G8LA 3C3RA 5J08A 2KCKA 2QYJA 4YNDA 3AG2E 3OXGA 3APDA 3V2OA 3AG4E 1OCOE 2KXPC 2RFAA 3JXIA 3UM3A 3MYVA 3MCXA 5AQ9A 3CLJA 2UY1A 2P9IG 1E96B 1N4PA 3CIAA 4B94A 2H6GA 3EU9A 3HHMA 4HXIA 2CHWA 1S64A 2XENA 5G05J 1O5MA 2ZIRA 3HXBA 2P9PG 3KAEA 4FU3A 5D2MC 4UQXA 1Z3XA 4U7EB 4DX5D 2AVPA 4HLEA 2Y3AA 4OAUC 4PS8A 2R05A 3BEEA 3ABLE 3V2XA 2V8SE 5DBKA 4JHKA 2J9QA 2LSVA 2ILRA 3L82A 2L6JA 3S7FA 4N2SA 4BT9A 2R2LA 3VTXA 4HRNA 3L17A 5ARGA 3G2SA 3IHYA 5A6CA 4N3AA 4UWFA 3HG0D 4LEUA 3ONLA 5JJTA 2VJ8A 2BEDA 4FULA 3RJVA 5BXUA 3X2QE 2PNNA 1V54E 3ZEFA 4Q94A 4Q96A 4V3IA 4UWGA 2XEHA 4YDYA 1OCZE 3UT4A 3UMVA 4MKTA 2V4HC 4YDWA 3MEKA 3E30A 3BU8A 3Q49B 4DJAA 5KJLA 1S0PA 3EHQA 2KM4A 2FF4A 1U3CA 4GZ3A 4AM9A 4EQFA 3UIPC 4D10C 2YINA 2DYSE 3FU0A 5D0OD 3TWTA 4WNEA 3PZ2A 2IU1A 1SQMA 3W9GA 3ZUVB 4GTMA 3E34A 2BTDA 4L2LA 4EZJA 1GW6A 4OAVB 1HU3A 3ESLA 3NOGD 4XI9A 5AYWD 4PS7A 4IULA 3FTWA 3LCAA 4HVBA 4L2YA 2PM7A 2A5UA 4I2WA 3ZFWA 5ENRD 1WAO1 3CHRA 4K5CA 2WQHA 2H6HA 2OVBA 4HOUA 3CSTA 3FU3A 4PH4B 2M63A 3PZ3A 4K5AB 3P1UA 4BERA 4BSXA 3LKUA 1PAQA 4LCTA 3J5QB 2NC9A 2R03A 1IHGA 2IO3C 1O1TA 3QOUA 3U64A 4ILHB 4HOSA 1P5QA 5CMWA 5KJMA 1DC2A 2FI7A 3VLEA 3GZ2A 4JHRA 1WDYA 2LXLA 1E8ZA 2QYUA 3JUIA 2OVFA 4CCAA 1BI7B 3R9MA 1KPSB 3QJZA 1E8YA 4HI9A 4U8VD 4XKBA 1ZB1A 2LAHA 4I43A 3L22A 4M3OA 4Q69A 2H6FA 3VTYA 3FUKA 3FP3A 1SW6A 2F8XK 2JEKA 5ENOD 1H0AA 3PZDA 1TN8A 1SA5A 2Y1LE 2LO6A 2XPYA 1HO8A 1FVFA 4J8SA 1YCSB 4Z68A 4AVXA 3TWQA 4AXHA 3L16A 2LSUA 5H7PA 1EDUA 2ZXWE 5ENPD 2J4DA 4JPSA 4EBAA 3LVQE 1OWLA 4DRXE 4GTVA 3TWWA 3CVWA 4J7WA 4ATZD 1H2UA 5FZSA 4A3VA 4BEPA 1D8EA 2LXMA 2ETCA 1ELKA 1OWPA 5A23A 1ELWA 3CHOA 3FH5A 1WG0A 2DBAA 4I1MA 3G2TA 3HVEB 2KATA 4U07A 3DBSA 1HE8A 1TNYA 3QK0A 3D9OA 2VSOE 3QB2A 3ONKA 4I9CA 1D8DA 4TXPA 2AWIA 2WPVA 5CEDB 4U8HA 2Y4UA 2DVWA 2HO1A 2XZTG 4AY5A 4GCNA 3SY2A 4F7AA 4WWOA 4U95D 4O6FA 2IONA 2P58C 2HR2A 3SFXA 5EYLA 3RAUA 3FTSA 1NZNA 2YHEA 3APFA 4U0ZA 4GPKA 2H6IA 3SHFA 1Z5SC 4JC8A 4JEUA 1S70B 5D66A 3CVYA 5LFAA 4U0UA 3CSFA 3FUHA 2BF0X 3ZIMA 2WXIA 1IQUA 5KJKA 3PREA 1H2VC 4XKCA 3Q5MA 2PM6A 3EIJA 4L1BA 3RIBA 3LXUX 4HBDA 3ZVVA 1IKND 5DIZA 4GYYA 5AARA 4U0SA 3QWWA 3LY8A 3LDZA 2Y69E 4C9BB 1JWFA 2I9CA 3KD7A 1HH8A 4ZHBA 4JA7A 2J8SD 2XRYA 4LG6A 5HI7A 3LJ3A 2P9LG 3FTVA 2ETBA 3D9HA 4UWLA 3FU5A 4LRZA 1KZOA 2EQXA 4DLOA 3T8MA 4BETA 3HYMB 4G25A 3FTXA 3FUJA 3MKQA 1IQRA 2GRRB 4FADA 4PS3A 2PQNA 3UM2A 1A17A 2XQ0A 1N11A 3EUVA 3DXMG 4IN3B 3C72A 5E76A 3U4TA 1EYHA 4GTSA 4HLLA 3RKVA 1N0QA 3D9JA 4APFA 3G2UA 4F1SA 2VGYA 4DX6D 4OVUA 1N0RA 4AJWA 3QNKA 2X3MA 4UWKA 3ZYKA 5FZQA 3L54A 1UG3A 3Q15A 4F1PA 3MV3B 4GA2A 1TN7A 4L9PA 4KBQA 3ESKA 4CT0A 4NURA 5A7DB 4RVBA 3T5XA 2MRIA 3ML9A 4EZLA 2GRPB 2ONDA 3EDTB 3JYSA 3EHRA 3AS8A 1DCQA 3LVRE 3ZPJA 1ZBPA 4BSZB 3NBNB 2XGSA 2WM9A 3SI5A 1HZ4A 2P9SG 1FPPA 1OT8A 3PE4A 3IEGA 2QZAA 2VSNA 5G04C 4A63B 2OOEA 2VGXB 3DSVA 4G1TA 1UOHA 3R7RA 4UI9J 3L08A 4MLPA 1N4SA 3BG0B 4BESA 4YDOA 2IO2C 2VTBA 3RRMB 1Z3YA 3IV0A 3FTUA 3RRUA 3CVNA 4AY6A 1FT1A 1SZ9A 3EIQC 3B7UX 5M72A 5JHBA 2IJGX 2B0OE 4WAFA 4MBGA 4JD2G 3AU5A 4HQDA 2NXPA 4FLHA 3SGHA 3MA5A 3B7BA 3E4BA 3IXEA 2QC9A 4CDNA 4F3VA 2WQ7A 3RO3A 3FULA 2X6IA 2UY1B 3UTMA 3AS4A 3UM1A 4DLQA 3LY7A 4EHMA 3TJPA 2GRMA 2WXHA 2KZTA 3SFYA 5AIJA 1SA4A 5BV0A 1QQEA 3CKCA 1OCCE 4NACA 4FJYA 3UI2A 4TRQA 4WUYA 3JQ1A 5AQAA 2YNQA 2HM8A 2F0YA 3PEUB 5HRYA 2XEVA 1H6OA 3ASGA 3I3NA 1FVHA 2PL2A 5CERB 2FEZA 3QKYA 4HB5A 5B1BE 2ZGDA 2XS8A 5CECB 4B0ZA 1AWCB 4CDMA 2WMNA 3S7BA 3SBTB 5B1AE 4F6RD 1TNBA 4ILGA 4PUCA 1XNFA 3ULEG 3ZXPA 2J49A 2R02A 1MJ0A 4DPRA 3PS6A 3DSWA 3CHMA 2A4ZA 4EPZA 4G2VA 4GTOA 2PQRA 3ASNE 4KMOA 2EILE 3ABKE 3B13A 3NAWA 2X6KA 4K03A 1DVPA 2EIME 2XPZA 3O4ZA 3RO2A 4QFVA 5JJ7A 4J8FA 3SZ7A 3DPYA 1Y8MA 5C2YA 4GB9A 1MZCA 3LEWA 5FQ6A 2YHCA 4ACKA 4CRWA 3LY9A 1JCQA 1X81A 5CMYA 4NIKA 4EZKA 2V0PA 4GTPA 1JWGA 1ZU2A 2WXLA 5KNHD 1NFIE 3NOCD 5CBNA 3C98A 2GRNB 4RLYA 3HXDA 5AN8A 3WXXA 2I6HA 4L23A 4TXQA 3FFLA 4KZ0A 3Q73A 4KYOB 1UJJA 3TWVA 1BU9A 3SNXA 3OXFA 4AOFA 5BUZA 3UPVA 5EDSA 2WVIA 5EKQD 2VGEA 4FHKA 3CHQA 3CKBA 4K5BA 5E75A 3UKRG 4ABNA 2XPIA 3DXKG 3C3QA 1LD7A 2R59A 2MHKA 3Q9UC 5FIOA 2RKKA 4GZDA 3PE3A 3OAWA 1TJCA 1WM5A 4GZCA 5FJYA 4BFRA 2RD0A 3TWSA 1O1SA 2DCPA 2P9KG 1IXVA 1L5JA 3L13A 3V30A 2IEJA 3S7JA 2YQ8A 3FWVA 3MKQB 2C0MA 4E6HA 4WWNA 2IQCA 3HXEA 2ZISA 2XRZA 4HFGA 4BX8A 4BT8A 3BUAA 4WNGA 3D9MA 4LUNU 1KT1A 4C0EA 3Q75A 2JABA 3ML8A 4ANWA 1V55E 1FT2A 4R7LA 4JA9A 2AXVA 3ZHEB 1NA3A 3T8KA 3LPZA 3ZU7B 5AAOA 2J09A 4LERA 1N94A 3TL5A 2VYIA 5BXOA 3I4RB 3DEPA 4GU5A 4J8EA 3JQ0A 3HXFA 5G2NA 2WXRA 1N95A 5B3SE 3DEOA 3TAXA 3CK9A 2E2EA 1JCRA 2RFMA 3NF1A 4W9RA 1DCEA 3VLDA 3PUKA 3Q79A 4GYOA 2VSXE 5AQ7A 4O1PA 5AENA 2RG8A 4G26A 3UM0A 4J8YA 3MKRA 5C1DA 3V31A 2F37A 3F6QA 2OCCE 2WXMA 3ASFA 1H6PA 3DSUA 3PNTB 1HXIA 1E7VA 3PDNA 2FO1E 3SQVA 4JXTA 1MYOA 4U04A 4AEZC 2C2LA 1O1RA 5BT1A 3TG4A 3UT7A 1QYMA 1HFAA 3T5VA 4CGVA 3ULYA 3PNLB 4YVQC 2KCLA 1K3ZD 3IKOB 3Q9NC 1PY1A 4HRMB 4I6EA 4KZCA 5BV1A 3DSSA 3R9AB 2WXFA 3ZW3A 3D9NA 2BKGA 3L6AA 4UWHA 3LS8A 4DUIA 1AP7A 3C3OA 3URZA 3DPDA 3HDXA 4I1OB 1LTXA 2QFCA 5EYPF 2XCBA 2GW1A 3G2VA 3RK6A 3FUNA 3ZN3A 5LCWJ 4LNGA 1B89A 3FU6A 4GMRA 3TXMA 3I4GA 4HNAD 5IY5E 3B7SA 4WWPA 4WNFA 4U63A 3UKUG 1TN6A 4Y6WA 4KXKB 3ZNGA 1SZAA 2WXPA 3TWUA 1SVXA 4FP7A 4A1GA 3WG7E 4GYWA 4Y6CA 5G04J 2J4BA 1JPLA 1INZA 3D9IA 2GGFA 3CEQA 4FHJA 3ABME 3PH0C 1OWOA 4LNBA 1G3NB 3AS5A 5CEAA 3JUEA 5FZRA 2WXQA 4TUMA 3HXCA 2CHZA 3DRAA 3FTYA 2LAIA 4A1SA 2X6JA 4RSYA 3DSXA 4BY6A 3QAQA 1IYGA 3BQOA 1NI1A 3FEXA 4ANVA 5ANRA 3EU5A 2HE0A 2P9NG 1OCRE 3ZXSA 4E85A 5KCMA 4HOQA 4XX5A 1KT0A 4GTRA 2EIKE 5CRVA 2NYJA 4CEMA 2IOSA 2L0IA 1HG5A 1TNUA 4N39A 4N2QA 2CFZA 3ZHEA 4DX1A 3ISMC 4N3CA 3CQCB 2DZOA 2FO7A 2I2OA 3G2WA 4EECA 4MRUA 2J08A 3CGHA 3FHEA 3AU4A 3ZRHA 3K9IA 3D9PA 3AAAC 3UIOC 3UT8A 2ZU6B 5EN5D 5LCWC 3T9KA 2CFUA 2IF4A 1U2VG 2WB2A 1Q2ZA 4UQZA 5HKPA 1PC2A 2Y4TA 5AQBA 3RU0A 3FH8A 3R7QA 1H2TC 2B6CA 3B7TA 4H7XA 4H7YA 2FULA 4OYSA 2AW6A 2P2CP 3APCA 4N5CA 3JCKC 5HS0A 2XEEA 4LSZE 5LX8A 4GMJA 1N4QA 4FJZA 2WXNA 4DX2A 4DK5A 2HYZA 4GA1A 3U3WA 2IFUA 1KLXA 2X6FA 5ENTD 3IHVA 4B89A 1QNFA 2AXUA 4MS6A 4OVVA 4K0RA 1BLXB 3CQGB 1E8XA 2IY0C 3E32A 3GZSA 2CG2A 3UUXA 4I17A 2GROB 3E37A 3KSQA 3FH7A 3PRZA 1EF1C 3JXJA 4QQIA 3ZKJA 4I6JA 5FT9A 4ATGA 4TV3A 1OUVA 1XGWA 4GCOA 1VDYA 4YDEA 2LUHA 3CK7A 3ULQA 1N54A 3KSLA 1HS6A 4IYPA 4ILIA 5EIBE 4FA6A 4JZYA 2CHXA 3ASHA 1HF8A 4GPMA 3RRNB 1MX6A 4AIFA 2R5SA 3MZLB 3GYZA 5KBAA 2E0IA 4PDXA 5AJLA 3NB2A 4B93B 4EBAG 1Y6IA 5G55A 1H19A 3UQ3A 3AG1E 4CGWA 4YVOA 1K8KG 2IOLA 3Q7AA 2FBNA 4HOTA 3CVQA 5BNWA 1HG2A 3QWVA 4L7TA 3FDHA 2V5FA 1TR4A 3QARA 5ARFA 2WXJA 4P29A 3B95A 3S7DA 3CR3A 2XZDG 2KC7A 4I1AA 3Q7FA 5EIDA 4F53A 4FC8A 2LNIA 4O60A 4GAAA 3QWPA 4A3TA 4G11A 1TNOA 3UXGA 4XI0A 4CT4A 4J8DA 2OV8A 2X6HA 3DSTA 3GW4A 2WQ6A 2EIJE 3MGBA 2OEVA 2WMOA 5CBOA 4GTQA 4TXRA 4A55A 1LF8A 2BUGA 5FQ8A 4KT6B 3CVLA 4UI9C 3EHNA 4GZ6A 3DWLG 1NP7A 1BD8A 4RQIA 1MHQA 3C5RA 3N71A 3KEAA 5KJNA 2GRQB 1UN8A 2Q7FA 4LNUD 3FUFA 3HVEA 5JHAA 5EX3A 1E7UA 3FUEA 3UINC 3TG5A 4U8YD 3NQPA 3PUJA 3Q78A 1KZPA 3CHPA 1WY6A 3ZYQA 4C0MA 5AJDA 4XE0A 2JLBA 5J90A 2A5EA 3MJWA 3SD5A 1NA0A 1W3BA 3EHMA 5EILA 4ANUA 4CYMD 4KVMA 4ME2A 4DI4A 5ITZF 1OWNA 2XGOA 4B8AA 2DZNA 1JUQA 2F8YA 3J5PA 1MQSA 4I2ZA 1RW2A 4UQYA 5JJ6A 5LP0A 3FUMA 1RZ4A 1HX8A 3OXLA 1N4RA
chains in the Genus database with same CATH topology
4CDRA 1B89A 3FU6A 3ZEFA 2VTBA 3RRMB 4Q94A 1Z3YA 4Q96A 4V3IA 3IV0A 4UWGA 3FTUA 3RRUA 1H6KA 3TXMA 3CVNA 3UT4A 1DNPA 3UMVA 3FUDA 4MKTA 3I4GA 4BWRA 4AY6A 4BTAA 1E8WA 2UWJG 3MEKA 3B7SA 3EJNA 4WWPA 4WNFA 3Q49B 1SZ9A 3EIQC 4DJAA 5KJLA 1EPUA 1S0PA 2L0TB 3D9KA 3MV2B 2KM4A 4U63A 1N52A 1U3DA 4Y6WA 2FF4A 4I9EA 3CHSA 4KXKB 1U3CA 3B7UX 5CHEE 4GZ3A 2VGXA 5M72A 5JHBA 2IJGX 2MOWA 1SZAA 3CK8A 2WXPA 4AM9A 1UJKA 2I1KA 3SF4A 4EQFA 4D10C 2YINA 3SBSA 4WAFA 4FP7A 4A1GA 3FEYA 3OTNA 4GYWA 4HORA 4XZ4A 4Y6CA 5G04J 2J4BA 3CVXA 3FU0A 5D0OD 3S2AA 1OWMA 1JPLA 2PZIA 3AU5A 4WNEA 1INZA 3D9IA 4N3BA 2IU1A 2GGFA 3CEQA 1SQMA 4FHJA 2NXPA 1OWOA 3PH0C 4FLHA 2WXOA 1UW4B 3KEZA 3SGHA 2BTDA 4L2LA 3MA5A 3AS5A 4EZJA 1GW6A 1YA0A 5FZRA 1HU3A 3ESLA 2WXQA 4XI9A 3E4BA 5AYWD 4PS7A 4CDNA 2CHZA 3PEVB 4IULA 3FTWA 4JL0A 3ZYMA 4F3VA 3FTYA 3LCAA 3RO3A 2WQ7A 2LAIA 2KZTB 1BPOA 3FULA 4A1SA 4HVBA 2X6JA 2XCCA 2PM7A 2A5UA 4I2WA 4L2YA 4RSYA 3ZFWA 2X6IA 4BY6A 2UY1B 3QAQA 1WAO1 3CHRA 1IYGA 2WQHA 3AS4A 4URKA 3FEXA 4ANVA 2OVBA 5ANRA 4HOUA 3CSTA 4DLQA 3LY7A 2C0LA 2WXGA 3FU3A 3TJPA 5KCMA 4PH4B 2M63A 5D0QD 3ZXSA 4E85A 4HOQA 4BX9A 2GRMA 4XX5A 3P1UA 2WXHA 1KT0A 3CVUA 3ZGQA 2KZTA 3IBEA 4AV7A 4BSXA 3LKUA 1PAQA 4LCTA 5AIJA 2NC9A 5BV0A 4NRHB 1IHGA 1QQEA 3CKCA 1X5BA 4CEMA 4NACA 2IOSA 3B7RL 4FJYA 3QOUA 3U64A 4ILHB 3UX4A 2L0IA 1HG5A 1P5QA 4N39A 3ENEA 4TRQA 4WUYA 4TUUA 4N2QA 2CFZA 5CMWA 5KJMA 4UI9K 3ZHEA 5BW8C 3Q4AB 5HQ8A 3JQ1A 2FI7A 4RG6A 5LOZA 3VLEA 3GZ2A 2YNQA 2HM8A 3D3MA 3FY4A 3PEUB 2XEVA 4N3CA 3CQCB 3ASGA 4GZ5A 4JHRA 3I3NA 2FO7A 2I2OA 3G2WA 4EECA 1FVHA 2J08A 4MRUA 2PL2A 2FEZA 3CGHA 1E8ZA 3QKYA 3FHEA 3JUIA 3AU4A 4HS2A 3ZRHA 2WXKA 3HIZA 3K9IA 2OVFA 3D9PA 4ACLA 3UT8A 4CCAA 2ZU6B 5T3RA 3VLFA 4B0ZA 5LCWC 3QJZA 1E8YA 2CFUA 2IF4A 4CDMA 2WB2A 2WMNA 3TGOA 3S7BA 4XKBA 3SBTB 4UQZA 2LAHA 4I43A 5T8IA 2NSZA 1PC2A 2CG3A 3L22A 2Y4TA 4M3OA 4ILGA 4PUCA 1XNFA 4Q69A 3FUIA 3RU0A 2VQ2A 3FH8A 3CVVA 2DIWA 3R7QA 4IRUA 1H2TC 3VTYA 2J49A 2AXZA 3FUKA 3ZYLA 3B7TA 3FP3A 4H7XA 4H7YA 3D9LA 3QC1A 2JEKA 2FULA 4DPRA 3PS6A 1H0AA 3PZDA 4OYSA 2LO6A 3CHMA 2A4ZA 2I1JA 3ASDA 2AW6A 4EPZA 3APCA 3PVLA 4G2VA 2XPYA 4N5CA 1HO8A 3JCKC 1FVFA 5CCLA 2PQRA 4RG9A 4ANXA 4J8SA 4KMOA 5LX8A 4AP2A 3B13A 1FCHA 2X6KA 3I5PA 4FLBA 4GMJA 4K03A 2X38A 4NQ0A 4AVXA 4FJZA 3NZUA 2WXNA 4B8CB 2GRLA 4AXHA 3L16A 1DVPA 2XPZA 3O4ZA 2LSUA 4GMLA 4DK5A 3RO2A 3LYAA 2HYZA 1EDUA 4QFVA 2KCVA 3BG1B 5JJ7A 4GA1A 3U3WA 2IFUA 4J8FA 1KLXA 2X6FA 3SZ7A 2J4DA 4JPSA 3IHVA 4EBAA 1Y8MA 3LVQE 1OWLA 1QNFA 2AXUA 2V4LA 4GB9A 5C2YA 4B89A 2VTBB 4MS6A 4J0UA 3U66A 4OVVA 4I6GA 4K0RA 2VSYA 3CVWA 3CQGB 4JVSA 3LEWA 5FQ6A 1H2UA 1E8XA 2YHCA 5FZSA 4A3VA 4ACKA 3MX3A 4CRWA 2XHEA 3LY9A 3GZSA 1Z6TA 2CG2A 3O48A 3UUXA 4I17A 1ELKA 3U9WA 1OWPA 5A23A 4GA0A 1ELWA 3CHOA 3FH5A 5CMYA 2DBAA 3FTZA 3FH7A 3PRZA 4I1MA 3G2TA 5ANLA 3SFZA 5FQ7A 1EF1C 4EZKA 2V0PA 1JWGA 2KATA 3HVEB 5FQ4A 1E90A 3DBSA 4U07A 1HE8A 1ZU2A 3QK0A 2WXLA 2VSOE 3D9OA 3GZ1A 4I6JA 5FT9A 4ATGA 3QB2A 3C98A 3KS2A 3ONKA 4I9CA 3TXNA 4TV3A 1OUVA 2AWIA 1XGWA 4GCOA 2WPVA 1VDYA 4U8HA 2Y4UA 3WXXA 2I6HA 3Q47B 5T4YA 2HO1A 3CK7A 3ULQA 5CCMA 1N54A 4AY5A 4GCNA 4KVOA 4L23A 3FFLA 4KZ0A 4F7AA 4WWOA 1HS6A 4O6FA 4KYOB 3NZSA 1UJJA 2IONA 4IYPA 4ILIA 2P58C 2HR2A 4G24A 3SNXA 3OXFA 5EX0A 4AOFA 5BUZA 4FA6A 5G05C 3UPVA 4JZYA 2CHXA 3FTSA 1NZNA 2YHEA 3APFA 4U0ZA 4GPKA 5EDSA 3SHFA 2L9BA 2WVIA 4FHKA 5EKQD 3ASHA 3CHQA 3CKBA 1HF8A 1TEZA 1UN9A 5E75A 4JC8A 4ABNA 2XPIA 4JEUA 4XIFA 3RRNB 1ELRA 3CVYA 2R59A 5LFAA 4U0UA 4AIFA 2R5SA 2MHKA 3CSFA 3MZLB 3GYZA 2J07A 2R17C 3FUHA 2BF0X 1TJFA 4GZDA 2E0IA 4PDXA 5AJLA 3ZIMA 3PE3A 2WXIA 4JHJA 4JW1A 1IQUA 5BPPA 5KJKA 3PREA 4EBAG 3OAWA 1TJCA 1WM5A 1H2VC 1H19A 1Y6IA 4GZCA 4XKCA 2RD0A 5FJYA 5G55A 3UQ3A 4BFRA 2DCPA 4J6IA 2XGMA 4APOA 5ENNA 4CGWA 4YVOA 4JEHA 1L5JA 2IOLA 3Q5MA 2FBNA 2PM6A 3EIJA 3L13A 3P2BA 3LXUX 4L1BA 5FWQA 3RIBA 4HOTA 3S7JA 2YQ8A 3FWVA 3QDNA 3MKQB 3ZVVA 3CVQA 5BNWA 5DIZA 2C0MA 4GYYA 4WNDA 4E6HA 4WWNA 1HG2A 2IQCA 4U0SA 4BTBA 2QY7A 3QWVA 4DI3A 4L7TA 3QWWA 3LY8A 3LDZA 3FDHA 4C9BB 1JWFA 2I9CA 2V5FA 2XRZA 5FTPA 4HFGA 3QARA 3KD7A 5ARFA 4BX8A 4BT8A 2WXJA 1HH8A 4P29A 4WNGA 3D9MA 4LUNU 3S7DA 1KT1A 3CR3A 4JA7A 2KC7A 4I1AA 4C0EA 4G23A 3ML8A 4F53A 2XRYA 4FC8A 4ANWA 2LNIA 3CVPA 5HI7A 1QZ2A 3LJ3A 4GAAA 4R7LA 4JA9A 2AXVA 3QWPA 1NA3A 3CV0A 3FTVA 3LPZA 3ZHEB 4A3TA 4UWLA 4G11A 5J08A 2KCKA 3FU5A 4LRZA 2EQXA 4YNDA 2J09A 4DLOA 4LERA 4XI0A 3OXGA 3APDA 3TL5A 2VYIA 3T8MA 3HYMB 4CT4A 4J8DA 3I4RB 4G25A 3FTXA 4GU5A 4J8EA 3FUJA 3JQ0A 2OV8A 3MKQA 5G2NA 2X6HA 1IQRA 2WXRA 4FADA 3GW4A 4PS3A 2WQ6A 3MYVA 2PQNA 1A17A 2XQ0A 3MGBA 3TAXA 3MCXA 2WMOA 3CK9A 2E2EA 4IN3B 3CLJA 5E76A 3U4TA 1EYHA 2UY1A 1E96B 3NF1A 4W9RA 3RKVA 3VLDA 3D9JA 4APFA 4A55A 3CIAA 3G2UA 1LF8A 2BUGA 2VGYA 4B94A 5FQ8A 3PUKA 4F1SA 4OVUA 4KT6B 3CVLA 3HHMA 4UI9C 4AJWA 4HXIA 2CHWA 3EHNA 4GZ6A 4GYOA 2VSXE 3QNKA 5G05J 1NP7A 2X3MA 4UWKA 3ZYKA 1MHQA 3N71A 5FZQA 5AENA 2RG8A 3L54A 4G26A 5KJNA 1UG3A 3Q15A 3MKRA 5C1DA 3MV3B 4GA2A 1UN8A 2Q7FA 3KAEA 4FU3A 3FUFA 3HVEA 2WXMA 3ASFA 5JHAA 4UQXA 4KBQA 1Z3XA 5EX3A 3PNTB 1HXIA 1E7VA 1E7UA 3FUEA 3PDNA 3TG5A 3ESKA 4CT0A 4NURA 5A7DB 4RVBA 4JXTA 3T5XA 4U04A 2MRIA 4AEZC 2C2LA 3NQPA 3PUJA 2AVPA 3ML9A 5BT1A 4EZLA 3TG4A 4HLEA 2Y3AA 3CHPA 1WY6A 2ONDA 3ZYQA 3UT7A 4C0MA 5AJDA 1HFAA 3EDTB 4XE0A 3T5VA 3JYSA 4PS8A 3AS8A 3BEEA 3LVRE 4CGVA 2JLBA 5J90A 3PNLB 2V8SE 5DBKA 3ZPJA 4JHKA 4YVQC 3MJWA 2J9QA 2KCLA 1NA0A 1ZBPA 1W3BA 2ILRA 2LSVA 3IKOB 3SD5A 2XGSA 3EHMA 1PY1A 4KZCA 4I6EA 2L6JA 2WM9A 3S7FA 3SI5A 4ANUA 1HZ4A 5BV1A 4KVMA 3R9AB 4N2SA 2WXFA 4ME2A 4BT9A 3VTXA 3ZW3A 3D9NA 4DI4A 1OWNA 3L6AA 3L17A 2XGOA 3G2SA 3IHYA 3PE4A 5ARGA 5A6CA 4UWHA 4HOSA 4N3AA 3IEGA 4B8AA 4UWFA 3LS8A 1JUQA 2VSNA 4LEUA 3ONLA 3URZA 5G04C 5JJTA 3DPDA 2OOEA 2VGXB 3HDXA 1MQSA 4I2ZA 4I1OB 4UQYA 5JJ6A 4G1TA 5LP0A 2VJ8A 3FUMA 3R7RA 2QFCA 4UI9J 3L08A 4MLPA 4FULA 2XCBA 1HX8A 3RJVA 2GW1A 3G2VA 3RK6A 3BG0B 3OXLA 3FUNA 3ZN3A 5LCWJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPV A;  4CDR A;  1B89 A;  2FEZ A;  3QKY A;  4J8E A;  2Y4U A;  3WXX A;  2I6H A;  3Q47 B;  2HO1 A;  3CK7 A;  3K9I A;  3GW4 A;  3ULQ A;  5CCM A;  4AY5 A;  4GCN A;  2PQN A;  3CVN A;  1A17 A;  5JJ7 A;  3TAX A;  3FFL A;  4AY6 A;  4BWR A;  4BTA A;  3CK9 A;  5LCW C;  2E2E A;  4IN3 B;  2IF4 A;  2UWJ G;  4KYO B;  4O6F A;  3MEK A;  3U4T A;  3S7B A;  2P58 C;  2UY1 A;  3TGO A;  1E96 B;  2HR2 A;  3NF1 A;  4G24 A;  3OXF A;  4UQZ A;  3Q49 B;  4W9R A;  4WNF A;  5EX0 A;  3RKV A;  5KJL A;  3MV2 B;  5G05 C;  1PC2 A;  2Y4T A;  2BUG A;  2VGY A;  4Y6W A;  2FF4 A;  1XNF A;  4I9E A;  4B94 A;  3UPV A;  4KXK B;  1NZN A;  4U0Z A;  3CVL A;  4GZ3 A;  5CHE E;  2VQ2 A;  2VGX A;  4UI9 C;  3RU0 A;  5M72 A;  4GPK A;  4GZ6 A;  3CK8 A;  4GYO A;  3ASH A;  5EKQ D;  3CKB A;  3SF4 A;  5G05 J;  3VTY A;  4AM9 A;  4EQF A;  4ABN A;  2XPI A;  4XIF A;  3FP3 A;  4H7X A;  4H7Y A;  5FZQ A;  3N71 A;  4GYW A;  4HOR A;  4G26 A;  4Y6C A;  5G04 J;  5KJN A;  1ELR A;  3Q15 A;  5D0O D;  5HQ8 A;  3MKR A;  5C1D A;  2PZI A;  3MV3 B;  4WNE A;  4U0U A;  4AIF A;  2R5S A;  4GA2 A;  2MHK A;  3ASD A;  4N3B A;  3GYZ A;  2Q7F A;  3KAE A;  4G2V A;  3CEQ A;  4N5C A;  3ASF A;  5CCL A;  2PQR A;  4KBQ A;  4RG9 A;  4UQX A;  3MA5 A;  3PE3 A;  5EX3 A;  1HXI A;  3PDN A;  3AS5 A;  3TG5 A;  3ESK A;  1FCH A;  4NQ0 A;  1YA0 A;  5A7D B;  5FZR A;  5AYW D;  4XI9 A;  3E4B A;  4U04 A;  5KJK A;  2C2L A;  1TJC A;  1WM5 A;  5FJY A;  2AVP A;  4JL0 A;  5BT1 A;  3UQ3 A;  4F3V A;  2LSU A;  2XGM A;  3TG4 A;  4APO A;  3LCA A;  3RO3 A;  3RO2 A;  3LYA A;  4CGW A;  2OND A;  2HYZ A;  4A1S A;  4YVO A;  3EDT B;  3Q5M A;  2KCV A;  2XCC A;  2FBN A;  3JYS A;  4GA1 A;  4I2W A;  3AS8 A;  3RIB A;  2IFU A;  3ZFW A;  2UY1 B;  3BEE A;  1KLX A;  4J8F A;  1WAO 1;  3S7J A;  3SZ7 A;  4HOT A;  4CGV A;  2YQ8 A;  3FWV A;  3QDN A;  2JLB A;  2WQH A;  3AS4 A;  1IYG A;  1Y8M A;  5DBK A;  3ZPJ A;  3CVQ A;  5BNW A;  5DIZ A;  2C0M A;  4GYY A;  4WND A;  4YVQ C;  3ZHE B;  4J0U A;  4BTB A;  2J9Q A;  2KCL A;  1NA0 A;  1ZBP A;  1W3B A;  2LSV A;  3QWV A;  3LY7 A;  2C0L A;  2VSY A;  3QWW A;  3LY8 A;  4HOU A;  2XGS A;  5D0Q D;  2V5F A;  4HOQ A;  2L6J A;  3S7F A;  5FTP A;  3KD7 A;  2YHC A;  1HZ4 A;  1KT0 A;  5ARF A;  5FZS A;  3R9A B;  3ZGQ A;  4BT8 A;  4N2S A;  1HH8 A;  4ME2 A;  4BT9 A;  3U3W A;  3VTX A;  3LY9 A;  3LKU A;  3O48 A;  4WNG A;  3UUX A;  4I17 A;  2NC9 A;  3S7D A;  1KT1 A;  4JA7 A;  5ARG A;  3PE4 A;  2XGO A;  2KC7 A;  1IHG A;  1QQE A;  4I1A A;  4G23 A;  3CKC A;  4GA0 A;  4NRH B;  5A6C A;  4N3A A;  5LCW J;  1ELW A;  3IEG A;  2DBA A;  2LNI A;  3CVP A;  3QOU A;  2VSN A;  5HI7 A;  4LEU A;  4HOS A;  1QZ2 A;  1P5Q A;  4N39 A;  4WUY A;  5BW8 C;  3URZ A;  5G04 C;  5JJT A;  4N2Q A;  5KJM A;  2OOE A;  4UI9 K;  4JA9 A;  3ZHE A;  2VGX B;  2KAT A;  1NA3 A;  3CV0 A;  3LPZ A;  2FI7 A;  3Q4A B;  3QWP A;  4I2Z A;  4RG6 A;  4U07 A;  3GZ2 A;  4UQY A;  4G1T A;  5JJ6 A;  2KCK A;  1ZU2 A;  3GZ1 A;  4YND A;  5FT9 A;  2XEV A;  2QFC A;  4U0S A;  4N3C A;  4UI9 J;  4XI0 A;  3ASG A;  3KS2 A;  3OXG A;  2XCB A;  4GZ5 A;  4I9C A;  4JHR A;  2GW1 A;  3RJV A;  2FO7 A;  3OXL A;  2VYI A;  1OUV A;  3HYM B;  3ZN3 A;  4J8D A;  2PL2 A;  4GCO A;  4G25 A; 
#chains in the Genus database with same CATH topology
 4CDR A;  3RSE G;  1H6K A;  1DNP A;  3FUD A;  4BWR A;  4BTA A;  4JB8 P;  1E8W A;  2UWJ G;  3EJN A;  2DWZ A;  1EPU A;  2MYO A;  2L0T B;  3D9K A;  3MV2 B;  5FIN A;  1N52 A;  1U3D A;  5KWD A;  1TYQ G;  4I9E A;  3CHS A;  5CHE E;  4CZ2 D;  2VGX A;  2MOW A;  3CK8 A;  1UJK A;  2I1K A;  5ENS D;  3SF4 A;  2ZGG A;  3SBS A;  3FEY A;  3OTN A;  4GTT A;  4HOR A;  4XZ4 A;  3CVX A;  3S2A A;  4C48 B;  1OWM A;  2PZI A;  4N3B A;  2WXO A;  1UW4 B;  3KEZ A;  5ENQ D;  1LD8 A;  1IHB A;  1YYH A;  1YA0 A;  3PEV B;  4JL0 A;  3ZYM A;  1QBQ A;  1BPO A;  2KZT B;  2XCC A;  3HRA A;  4URK A;  2C0L A;  2WXG A;  5D0Q D;  4BX9 A;  4U96 D;  2BKK B;  2DYR E;  3CVU A;  3ZGQ A;  3IBE A;  4AV7 A;  4NRH B;  1X5B A;  3B7R L;  3UX4 A;  1JCS A;  3ENE A;  4TUU A;  4UI9 K;  5BW8 C;  3Q4A B;  5HQ8 A;  4RG6 A;  5LOZ A;  3D3M A;  3FY4 A;  4GZ5 A;  3AJI A;  2KBX A;  3LJN A;  1A5E A;  4HS2 A;  2WXK A;  3HIZ A;  4ACL A;  1NL4 A;  4M7C A;  4O1O A;  5T3R A;  3VLF A;  3TGO A;  3TWX A;  4X8Q A;  4DX7 D;  5T8I A;  2NSZ A;  2CG3 A;  3W9F A;  3FUI A;  3V79 K;  2VQ2 A;  3CVV A;  2DIW A;  4IRU A;  2AXZ A;  3AG3 E;  3ZYL A;  5JMN D;  3D9L A;  3QC1 A;  3L9T A;  1K1A A;  2I1J A;  3ASD A;  3PVL A;  5CCL A;  4ANX A;  4RG9 A;  4AP2 A;  1FCH A;  3I5P A;  4FLB A;  4NQ0 A;  2X38 A;  4B8C B;  3NZU A;  1MX4 A;  2GRL A;  4GML A;  4XEI G;  3LYA A;  2KCV A;  3BG1 B;  5KNG A;  5JA4 D;  1OY3 D;  1D9S A;  2V4L A;  2VTB B;  4J0U A;  3U66 A;  4I6G A;  2VSY A;  4JVS A;  2V5Q C;  4N5Q A;  3MX3 A;  2XHE A;  3TWR A;  1Z6T A;  3O48 A;  3U9W A;  4GA0 A;  4HRL A;  3ASO E;  3FTZ A;  5ANL A;  3SFZ A;  2P9U G;  5FQ7 A;  1MX2 A;  5CRU A;  2EIN E;  5FQ4 A;  1E90 A;  1BI8 B;  3GZ1 A;  3KS2 A;  3TXN A;  1TNZ A;  1N9A A;  3Q47 B;  5T4Y A;  5CCM A;  4KVO A;  3NZS A;  4G24 A;  5EX0 A;  5G05 C;  2OEW A;  4HI8 A;  3PZ1 A;  2L9B A;  1TEZ A;  1UN9 A;  4XIF A;  1K1B A;  1ELR A;  4G8K A;  1OXJ A;  2J07 A;  2R17 C;  2L6B A;  1TJF A;  4JHJ A;  4JW1 A;  5BPP A;  2Y0B G;  4J6I A;  2XGM A;  4APO A;  3E33 A;  5ENN A;  4JEH A;  5FWQ A;  3P2B A;  3QDN A;  3PZ4 A;  4WND A;  4UUC A;  4BTB A;  2ETA A;  2QY7 A;  4DI3 A;  4ZFH A;  5FTP A;  3SO8 A;  1YMP A;  2AJA A;  4G23 A;  2XS1 A;  3CVP A;  1QZ2 A;  1S63 A;  3CV0 A;  4G8L A;  3C3R A;  5J08 A;  2KCK A;  2QYJ A;  4YND A;  3AG2 E;  3OXG A;  3APD A;  3V2O A;  3AG4 E;  1OCO E;  2KXP C;  2RFA A;  3JXI A;  3UM3 A;  3MYV A;  3MCX A;  5AQ9 A;  3CLJ A;  2UY1 A;  2P9I G;  1E96 B;  1N4P A;  3CIA A;  4B94 A;  2H6G A;  3EU9 A;  3HHM A;  4HXI A;  2CHW A;  1S64 A;  2XEN A;  5G05 J;  1O5M A;  2ZIR A;  3HXB A;  2P9P G;  3KAE A;  4FU3 A;  5D2M C;  4UQX A;  1Z3X A;  4U7E B;  4DX5 D;  2AVP A;  4HLE A;  2Y3A A;  4OAU C;  4PS8 A;  2R05 A;  3BEE A;  3ABL E;  3V2X A;  2V8S E;  5DBK A;  4JHK A;  2J9Q A;  2LSV A;  2ILR A;  3L82 A;  2L6J A;  3S7F A;  4N2S A;  4BT9 A;  2R2L A;  3VTX A;  4HRN A;  3L17 A;  5ARG A;  3G2S A;  3IHY A;  5A6C A;  4N3A A;  4UWF A;  3HG0 D;  4LEU A;  3ONL A;  5JJT A;  2VJ8 A;  2BED A;  4FUL A;  3RJV A;  5BXU A;  3X2Q E;  2PNN A;  1V54 E;  3ZEF A;  4Q94 A;  4Q96 A;  4V3I A;  4UWG A;  2XEH A;  4YDY A;  1OCZ E;  3UT4 A;  3UMV A;  4MKT A;  2V4H C;  4YDW A;  3MEK A;  3E30 A;  3BU8 A;  3Q49 B;  4DJA A;  5KJL A;  1S0P A;  3EHQ A;  2KM4 A;  2FF4 A;  1U3C A;  4GZ3 A;  4AM9 A;  4EQF A;  3UIP C;  4D10 C;  2YIN A;  2DYS E;  3FU0 A;  5D0O D;  3TWT A;  4WNE A;  3PZ2 A;  2IU1 A;  1SQM A;  3W9G A;  3ZUV B;  4GTM A;  3E34 A;  2BTD A;  4L2L A;  4EZJ A;  1GW6 A;  4OAV B;  1HU3 A;  3ESL A;  3NOG D;  4XI9 A;  5AYW D;  4PS7 A;  4IUL A;  3FTW A;  3LCA A;  4HVB A;  4L2Y A;  2PM7 A;  2A5U A;  4I2W A;  3ZFW A;  5ENR D;  1WAO 1;  3CHR A;  4K5C A;  2WQH A;  2H6H A;  2OVB A;  4HOU A;  3CST A;  3FU3 A;  4PH4 B;  2M63 A;  3PZ3 A;  4K5A B;  3P1U A;  4BER A;  4BSX A;  3LKU A;  1PAQ A;  4LCT A;  3J5Q B;  2NC9 A;  2R03 A;  1IHG A;  2IO3 C;  1O1T A;  3QOU A;  3U64 A;  4ILH B;  4HOS A;  1P5Q A;  5CMW A;  5KJM A;  1DC2 A;  2FI7 A;  3VLE A;  3GZ2 A;  4JHR A;  1WDY A;  2LXL A;  1E8Z A;  2QYU A;  3JUI A;  2OVF A;  4CCA A;  1BI7 B;  3R9M A;  1KPS B;  3QJZ A;  1E8Y A;  4HI9 A;  4U8V D;  4XKB A;  1ZB1 A;  2LAH A;  4I43 A;  3L22 A;  4M3O A;  4Q69 A;  2H6F A;  3VTY A;  3FUK A;  3FP3 A;  1SW6 A;  2F8X K;  2JEK A;  5ENO D;  1H0A A;  3PZD A;  1TN8 A;  1SA5 A;  2Y1L E;  2LO6 A;  2XPY A;  1HO8 A;  1FVF A;  4J8S A;  1YCS B;  4Z68 A;  4AVX A;  3TWQ A;  4AXH A;  3L16 A;  2LSU A;  5H7P A;  1EDU A;  2ZXW E;  5ENP D;  2J4D A;  4JPS A;  4EBA A;  3LVQ E;  1OWL A;  4DRX E;  4GTV A;  3TWW A;  3CVW A;  4J7W A;  4ATZ D;  1H2U A;  5FZS A;  4A3V A;  4BEP A;  1D8E A;  2LXM A;  2ETC A;  1ELK A;  1OWP A;  5A23 A;  1ELW A;  3CHO A;  3FH5 A;  1WG0 A;  2DBA A;  4I1M A;  3G2T A;  3HVE B;  2KAT A;  4U07 A;  3DBS A;  1HE8 A;  1TNY A;  3QK0 A;  3D9O A;  2VSO E;  3QB2 A;  3ONK A;  4I9C A;  1D8D A;  4TXP A;  2AWI A;  2WPV A;  5CED B;  4U8H A;  2Y4U A;  2DVW A;  2HO1 A;  2XZT G;  4AY5 A;  4GCN A;  3SY2 A;  4F7A A;  4WWO A;  4U95 D;  4O6F A;  2ION A;  2P58 C;  2HR2 A;  3SFX A;  5EYL A;  3RAU A;  3FTS A;  1NZN A;  2YHE A;  3APF A;  4U0Z A;  4GPK A;  2H6I A;  3SHF A;  1Z5S C;  4JC8 A;  4JEU A;  1S70 B;  5D66 A;  3CVY A;  5LFA A;  4U0U A;  3CSF A;  3FUH A;  2BF0 X;  3ZIM A;  2WXI A;  1IQU A;  5KJK A;  3PRE A;  1H2V C;  4XKC A;  3Q5M A;  2PM6 A;  3EIJ A;  4L1B A;  3RIB A;  3LXU X;  4HBD A;  3ZVV A;  1IKN D;  5DIZ A;  4GYY A;  5AAR A;  4U0S A;  3QWW A;  3LY8 A;  3LDZ A;  2Y69 E;  4C9B B;  1JWF A;  2I9C A;  3KD7 A;  1HH8 A;  4ZHB A;  4JA7 A;  2J8S D;  2XRY A;  4LG6 A;  5HI7 A;  3LJ3 A;  2P9L G;  3FTV A;  2ETB A;  3D9H A;  4UWL A;  3FU5 A;  4LRZ A;  1KZO A;  2EQX A;  4DLO A;  3T8M A;  4BET A;  3HYM B;  4G25 A;  3FTX A;  3FUJ A;  3MKQ A;  1IQR A;  2GRR B;  4FAD A;  4PS3 A;  2PQN A;  3UM2 A;  1A17 A;  2XQ0 A;  1N11 A;  3EUV A;  3DXM G;  4IN3 B;  3C72 A;  5E76 A;  3U4T A;  1EYH A;  4GTS A;  4HLL A;  3RKV A;  1N0Q A;  3D9J A;  4APF A;  3G2U A;  4F1S A;  2VGY A;  4DX6 D;  4OVU A;  1N0R A;  4AJW A;  3QNK A;  2X3M A;  4UWK A;  3ZYK A;  5FZQ A;  3L54 A;  1UG3 A;  3Q15 A;  4F1P A;  3MV3 B;  4GA2 A;  1TN7 A;  4L9P A;  4KBQ A;  3ESK A;  4CT0 A;  4NUR A;  5A7D B;  4RVB A;  3T5X A;  2MRI A;  3ML9 A;  4EZL A;  2GRP B;  2OND A;  3EDT B;  3JYS A;  3EHR A;  3AS8 A;  1DCQ A;  3LVR E;  3ZPJ A;  1ZBP A;  4BSZ B;  3NBN B;  2XGS A;  2WM9 A;  3SI5 A;  1HZ4 A;  2P9S G;  1FPP A;  1OT8 A;  3PE4 A;  3IEG A;  2QZA A;  2VSN A;  5G04 C;  4A63 B;  2OOE A;  2VGX B;  3DSV A;  4G1T A;  1UOH A;  3R7R A;  4UI9 J;  3L08 A;  4MLP A;  1N4S A;  3BG0 B;  4BES A;  4YDO A;  2IO2 C;  2VTB A;  3RRM B;  1Z3Y A;  3IV0 A;  3FTU A;  3RRU A;  3CVN A;  4AY6 A;  1FT1 A;  1SZ9 A;  3EIQ C;  3B7U X;  5M72 A;  5JHB A;  2IJG X;  2B0O E;  4WAF A;  4MBG A;  4JD2 G;  3AU5 A;  4HQD A;  2NXP A;  4FLH A;  3SGH A;  3MA5 A;  3B7B A;  3E4B A;  3IXE A;  2QC9 A;  4CDN A;  4F3V A;  2WQ7 A;  3RO3 A;  3FUL A;  2X6I A;  2UY1 B;  3UTM A;  3AS4 A;  3UM1 A;  4DLQ A;  3LY7 A;  4EHM A;  3TJP A;  2GRM A;  2WXH A;  2KZT A;  3SFY A;  5AIJ A;  1SA4 A;  5BV0 A;  1QQE A;  3CKC A;  1OCC E;  4NAC A;  4FJY A;  3UI2 A;  4TRQ A;  4WUY A;  3JQ1 A;  5AQA A;  2YNQ A;  2HM8 A;  2F0Y A;  3PEU B;  5HRY A;  2XEV A;  1H6O A;  3ASG A;  3I3N A;  1FVH A;  2PL2 A;  5CER B;  2FEZ A;  3QKY A;  4HB5 A;  5B1B E;  2ZGD A;  2XS8 A;  5CEC B;  4B0Z A;  1AWC B;  4CDM A;  2WMN A;  3S7B A;  3SBT B;  5B1A E;  4F6R D;  1TNB A;  4ILG A;  4PUC A;  1XNF A;  3ULE G;  3ZXP A;  2J49 A;  2R02 A;  1MJ0 A;  4DPR A;  3PS6 A;  3DSW A;  3CHM A;  2A4Z A;  4EPZ A;  4G2V A;  4GTO A;  2PQR A;  3ASN E;  4KMO A;  2EIL E;  3ABK E;  3B13 A;  3NAW A;  2X6K A;  4K03 A;  1DVP A;  2EIM E;  2XPZ A;  3O4Z A;  3RO2 A;  4QFV A;  5JJ7 A;  4J8F A;  3SZ7 A;  3DPY A;  1Y8M A;  5C2Y A;  4GB9 A;  1MZC A;  3LEW A;  5FQ6 A;  2YHC A;  4ACK A;  4CRW A;  3LY9 A;  1JCQ A;  1X81 A;  5CMY A;  4NIK A;  4EZK A;  2V0P A;  4GTP A;  1JWG A;  1ZU2 A;  2WXL A;  5KNH D;  1NFI E;  3NOC D;  5CBN A;  3C98 A;  2GRN B;  4RLY A;  3HXD A;  5AN8 A;  3WXX A;  2I6H A;  4L23 A;  4TXQ A;  3FFL A;  4KZ0 A;  3Q73 A;  4KYO B;  1UJJ A;  3TWV A;  1BU9 A;  3SNX A;  3OXF A;  4AOF A;  5BUZ A;  3UPV A;  5EDS A;  2WVI A;  5EKQ D;  2VGE A;  4FHK A;  3CHQ A;  3CKB A;  4K5B A;  5E75 A;  3UKR G;  4ABN A;  2XPI A;  3DXK G;  3C3Q A;  1LD7 A;  2R59 A;  2MHK A;  3Q9U C;  5FIO A;  2RKK A;  4GZD A;  3PE3 A;  3OAW A;  1TJC A;  1WM5 A;  4GZC A;  5FJY A;  4BFR A;  2RD0 A;  3TWS A;  1O1S A;  2DCP A;  2P9K G;  1IXV A;  1L5J A;  3L13 A;  3V30 A;  2IEJ A;  3S7J A;  2YQ8 A;  3FWV A;  3MKQ B;  2C0M A;  4E6H A;  4WWN A;  2IQC A;  3HXE A;  2ZIS A;  2XRZ A;  4HFG A;  4BX8 A;  4BT8 A;  3BUA A;  4WNG A;  3D9M A;  4LUN U;  1KT1 A;  4C0E A;  3Q75 A;  2JAB A;  3ML8 A;  4ANW A;  1V55 E;  1FT2 A;  4R7L A;  4JA9 A;  2AXV A;  3ZHE B;  1NA3 A;  3T8K A;  3LPZ A;  3ZU7 B;  5AAO A;  2J09 A;  4LER A;  1N94 A;  3TL5 A;  2VYI A;  5BXO A;  3I4R B;  3DEP A;  4GU5 A;  4J8E A;  3JQ0 A;  3HXF A;  5G2N A;  2WXR A;  1N95 A;  5B3S E;  3DEO A;  3TAX A;  3CK9 A;  2E2E A;  1JCR A;  2RFM A;  3NF1 A;  4W9R A;  1DCE A;  3VLD A;  3PUK A;  3Q79 A;  4GYO A;  2VSX E;  5AQ7 A;  4O1P A;  5AEN A;  2RG8 A;  4G26 A;  3UM0 A;  4J8Y A;  3MKR A;  5C1D A;  3V31 A;  2F37 A;  3F6Q A;  2OCC E;  2WXM A;  3ASF A;  1H6P A;  3DSU A;  3PNT B;  1HXI A;  1E7V A;  3PDN A;  2FO1 E;  3SQV A;  4JXT A;  1MYO A;  4U04 A;  4AEZ C;  2C2L A;  1O1R A;  5BT1 A;  3TG4 A;  3UT7 A;  1QYM A;  1HFA A;  3T5V A;  4CGV A;  3ULY A;  3PNL B;  4YVQ C;  2KCL A;  1K3Z D;  3IKO B;  3Q9N C;  1PY1 A;  4HRM B;  4I6E A;  4KZC A;  5BV1 A;  3DSS A;  3R9A B;  2WXF A;  3ZW3 A;  3D9N A;  2BKG A;  3L6A A;  4UWH A;  3LS8 A;  4DUI A;  1AP7 A;  3C3O A;  3URZ A;  3DPD A;  3HDX A;  4I1O B;  1LTX A;  2QFC A;  5EYP F;  2XCB A;  2GW1 A;  3G2V A;  3RK6 A;  3FUN A;  3ZN3 A;  5LCW J;  4LNG A;  1B89 A;  3FU6 A;  4GMR A;  3TXM A;  3I4G A;  4HNA D;  5IY5 E;  3B7S A;  4WWP A;  4WNF A;  4U63 A;  3UKU G;  1TN6 A;  4Y6W A;  4KXK B;  3ZNG A;  1SZA A;  2WXP A;  3TWU A;  1SVX A;  4FP7 A;  4A1G A;  3WG7 E;  4GYW A;  4Y6C A;  5G04 J;  2J4B A;  1JPL A;  1INZ A;  3D9I A;  2GGF A;  3CEQ A;  4FHJ A;  3ABM E;  3PH0 C;  1OWO A;  4LNB A;  1G3N B;  3AS5 A;  5CEA A;  3JUE A;  5FZR A;  2WXQ A;  4TUM A;  3HXC A;  2CHZ A;  3DRA A;  3FTY A;  2LAI A;  4A1S A;  2X6J A;  4RSY A;  3DSX A;  4BY6 A;  3QAQ A;  1IYG A;  3BQO A;  1NI1 A;  3FEX A;  4ANV A;  5ANR A;  3EU5 A;  2HE0 A;  2P9N G;  1OCR E;  3ZXS A;  4E85 A;  5KCM A;  4HOQ A;  4XX5 A;  1KT0 A;  4GTR A;  2EIK E;  5CRV A;  2NYJ A;  4CEM A;  2IOS A;  2L0I A;  1HG5 A;  1TNU A;  4N39 A;  4N2Q A;  2CFZ A;  3ZHE A;  4DX1 A;  3ISM C;  4N3C A;  3CQC B;  2DZO A;  2FO7 A;  2I2O A;  3G2W A;  4EEC A;  4MRU A;  2J08 A;  3CGH A;  3FHE A;  3AU4 A;  3ZRH A;  3K9I A;  3D9P A;  3AAA C;  3UIO C;  3UT8 A;  2ZU6 B;  5EN5 D;  5LCW C;  3T9K A;  2CFU A;  2IF4 A;  1U2V G;  2WB2 A;  1Q2Z A;  4UQZ A;  5HKP A;  1PC2 A;  2Y4T A;  5AQB A;  3RU0 A;  3FH8 A;  3R7Q A;  1H2T C;  2B6C A;  3B7T A;  4H7X A;  4H7Y A;  2FUL A;  4OYS A;  2AW6 A;  2P2C P;  3APC A;  4N5C A;  3JCK C;  5HS0 A;  2XEE A;  4LSZ E;  5LX8 A;  4GMJ A;  1N4Q A;  4FJZ A;  2WXN A;  4DX2 A;  4DK5 A;  2HYZ A;  4GA1 A;  3U3W A;  2IFU A;  1KLX A;  2X6F A;  5ENT D;  3IHV A;  4B89 A;  1QNF A;  2AXU A;  4MS6 A;  4OVV A;  4K0R A;  1BLX B;  3CQG B;  1E8X A;  2IY0 C;  3E32 A;  3GZS A;  2CG2 A;  3UUX A;  4I17 A;  2GRO B;  3E37 A;  3KSQ A;  3FH7 A;  3PRZ A;  1EF1 C;  3JXJ A;  4QQI A;  3ZKJ A;  4I6J A;  5FT9 A;  4ATG A;  4TV3 A;  1OUV A;  1XGW A;  4GCO A;  1VDY A;  4YDE A;  2LUH A;  3CK7 A;  3ULQ A;  1N54 A;  3KSL A;  1HS6 A;  4IYP A;  4ILI A;  5EIB E;  4FA6 A;  4JZY A;  2CHX A;  3ASH A;  1HF8 A;  4GPM A;  3RRN B;  1MX6 A;  4AIF A;  2R5S A;  3MZL B;  3GYZ A;  5KBA A;  2E0I A;  4PDX A;  5AJL A;  3NB2 A;  4B93 B;  4EBA G;  1Y6I A;  5G55 A;  1H19 A;  3UQ3 A;  3AG1 E;  4CGW A;  4YVO A;  1K8K G;  2IOL A;  3Q7A A;  2FBN A;  4HOT A;  3CVQ A;  5BNW A;  1HG2 A;  3QWV A;  4L7T A;  3FDH A;  2V5F A;  1TR4 A;  3QAR A;  5ARF A;  2WXJ A;  4P29 A;  3B95 A;  3S7D A;  3CR3 A;  2XZD G;  2KC7 A;  4I1A A;  3Q7F A;  5EID A;  4F53 A;  4FC8 A;  2LNI A;  4O60 A;  4GAA A;  3QWP A;  4A3T A;  4G11 A;  1TNO A;  3UXG A;  4XI0 A;  4CT4 A;  4J8D A;  2OV8 A;  2X6H A;  3DST A;  3GW4 A;  2WQ6 A;  2EIJ E;  3MGB A;  2OEV A;  2WMO A;  5CBO A;  4GTQ A;  4TXR A;  4A55 A;  1LF8 A;  2BUG A;  5FQ8 A;  4KT6 B;  3CVL A;  4UI9 C;  3EHN A;  4GZ6 A;  3DWL G;  1NP7 A;  1BD8 A;  4RQI A;  1MHQ A;  3C5R A;  3N71 A;  3KEA A;  5KJN A;  2GRQ B;  1UN8 A;  2Q7F A;  4LNU D;  3FUF A;  3HVE A;  5JHA A;  5EX3 A;  1E7U A;  3FUE A;  3UIN C;  3TG5 A;  4U8Y D;  3NQP A;  3PUJ A;  3Q78 A;  1KZP A;  3CHP A;  1WY6 A;  3ZYQ A;  4C0M A;  5AJD A;  4XE0 A;  2JLB A;  5J90 A;  2A5E A;  3MJW A;  3SD5 A;  1NA0 A;  1W3B A;  3EHM A;  5EIL A;  4ANU A;  4CYM D;  4KVM A;  4ME2 A;  4DI4 A;  5ITZ F;  1OWN A;  2XGO A;  4B8A A;  2DZN A;  1JUQ A;  2F8Y A;  3J5P A;  1MQS A;  4I2Z A;  1RW2 A;  4UQY A;  5JJ6 A;  5LP0 A;  3FUM A;  1RZ4 A;  1HX8 A;  3OXL A;  1N4R A; 
#chains in the Genus database with same CATH homology
 4CDR A;  1B89 A;  3FU6 A;  3ZEF A;  2VTB A;  3RRM B;  4Q94 A;  1Z3Y A;  4Q96 A;  4V3I A;  3IV0 A;  4UWG A;  3FTU A;  3RRU A;  1H6K A;  3TXM A;  3CVN A;  3UT4 A;  1DNP A;  3UMV A;  3FUD A;  4MKT A;  3I4G A;  4BWR A;  4AY6 A;  4BTA A;  1E8W A;  2UWJ G;  3MEK A;  3B7S A;  3EJN A;  4WWP A;  4WNF A;  3Q49 B;  1SZ9 A;  3EIQ C;  4DJA A;  5KJL A;  1EPU A;  1S0P A;  2L0T B;  3D9K A;  3MV2 B;  2KM4 A;  4U63 A;  1N52 A;  1U3D A;  4Y6W A;  2FF4 A;  4I9E A;  3CHS A;  4KXK B;  1U3C A;  3B7U X;  5CHE E;  4GZ3 A;  2VGX A;  5M72 A;  5JHB A;  2IJG X;  2MOW A;  1SZA A;  3CK8 A;  2WXP A;  4AM9 A;  1UJK A;  2I1K A;  3SF4 A;  4EQF A;  4D10 C;  2YIN A;  3SBS A;  4WAF A;  4FP7 A;  4A1G A;  3FEY A;  3OTN A;  4GYW A;  4HOR A;  4XZ4 A;  4Y6C A;  5G04 J;  2J4B A;  3CVX A;  3FU0 A;  5D0O D;  3S2A A;  1OWM A;  1JPL A;  2PZI A;  3AU5 A;  4WNE A;  1INZ A;  3D9I A;  4N3B A;  2IU1 A;  2GGF A;  3CEQ A;  1SQM A;  4FHJ A;  2NXP A;  1OWO A;  3PH0 C;  4FLH A;  2WXO A;  1UW4 B;  3KEZ A;  3SGH A;  2BTD A;  4L2L A;  3MA5 A;  3AS5 A;  4EZJ A;  1GW6 A;  1YA0 A;  5FZR A;  1HU3 A;  3ESL A;  2WXQ A;  4XI9 A;  3E4B A;  5AYW D;  4PS7 A;  4CDN A;  2CHZ A;  3PEV B;  4IUL A;  3FTW A;  4JL0 A;  3ZYM A;  4F3V A;  3FTY A;  3LCA A;  3RO3 A;  2WQ7 A;  2LAI A;  2KZT B;  1BPO A;  3FUL A;  4A1S A;  4HVB A;  2X6J A;  2XCC A;  2PM7 A;  2A5U A;  4I2W A;  4L2Y A;  4RSY A;  3ZFW A;  2X6I A;  4BY6 A;  2UY1 B;  3QAQ A;  1WAO 1;  3CHR A;  1IYG A;  2WQH A;  3AS4 A;  4URK A;  3FEX A;  4ANV A;  2OVB A;  5ANR A;  4HOU A;  3CST A;  4DLQ A;  3LY7 A;  2C0L A;  2WXG A;  3FU3 A;  3TJP A;  5KCM A;  4PH4 B;  2M63 A;  5D0Q D;  3ZXS A;  4E85 A;  4HOQ A;  4BX9 A;  2GRM A;  4XX5 A;  3P1U A;  2WXH A;  1KT0 A;  3CVU A;  3ZGQ A;  2KZT A;  3IBE A;  4AV7 A;  4BSX A;  3LKU A;  1PAQ A;  4LCT A;  5AIJ A;  2NC9 A;  5BV0 A;  4NRH B;  1IHG A;  1QQE A;  3CKC A;  1X5B A;  4CEM A;  4NAC A;  2IOS A;  3B7R L;  4FJY A;  3QOU A;  3U64 A;  4ILH B;  3UX4 A;  2L0I A;  1HG5 A;  1P5Q A;  4N39 A;  3ENE A;  4TRQ A;  4WUY A;  4TUU A;  4N2Q A;  2CFZ A;  5CMW A;  5KJM A;  4UI9 K;  3ZHE A;  5BW8 C;  3Q4A B;  5HQ8 A;  3JQ1 A;  2FI7 A;  4RG6 A;  5LOZ A;  3VLE A;  3GZ2 A;  2YNQ A;  2HM8 A;  3D3M A;  3FY4 A;  3PEU B;  2XEV A;  4N3C A;  3CQC B;  3ASG A;  4GZ5 A;  4JHR A;  3I3N A;  2FO7 A;  2I2O A;  3G2W A;  4EEC A;  1FVH A;  2J08 A;  4MRU A;  2PL2 A;  2FEZ A;  3CGH A;  1E8Z A;  3QKY A;  3FHE A;  3JUI A;  3AU4 A;  4HS2 A;  3ZRH A;  2WXK A;  3HIZ A;  3K9I A;  2OVF A;  3D9P A;  4ACL A;  3UT8 A;  4CCA A;  2ZU6 B;  5T3R A;  3VLF A;  4B0Z A;  5LCW C;  3QJZ A;  1E8Y A;  2CFU A;  2IF4 A;  4CDM A;  2WB2 A;  2WMN A;  3TGO A;  3S7B A;  4XKB A;  3SBT B;  4UQZ A;  2LAH A;  4I43 A;  5T8I A;  2NSZ A;  1PC2 A;  2CG3 A;  3L22 A;  2Y4T A;  4M3O A;  4ILG A;  4PUC A;  1XNF A;  4Q69 A;  3FUI A;  3RU0 A;  2VQ2 A;  3FH8 A;  3CVV A;  2DIW A;  3R7Q A;  4IRU A;  1H2T C;  3VTY A;  2J49 A;  2AXZ A;  3FUK A;  3ZYL A;  3B7T A;  3FP3 A;  4H7X A;  4H7Y A;  3D9L A;  3QC1 A;  2JEK A;  2FUL A;  4DPR A;  3PS6 A;  1H0A A;  3PZD A;  4OYS A;  2LO6 A;  3CHM A;  2A4Z A;  2I1J A;  3ASD A;  2AW6 A;  4EPZ A;  3APC A;  3PVL A;  4G2V A;  2XPY A;  4N5C A;  1HO8 A;  3JCK C;  1FVF A;  5CCL A;  2PQR A;  4RG9 A;  4ANX A;  4J8S A;  4KMO A;  5LX8 A;  4AP2 A;  3B13 A;  1FCH A;  2X6K A;  3I5P A;  4FLB A;  4GMJ A;  4K03 A;  2X38 A;  4NQ0 A;  4AVX A;  4FJZ A;  3NZU A;  2WXN A;  4B8C B;  2GRL A;  4AXH A;  3L16 A;  1DVP A;  2XPZ A;  3O4Z A;  2LSU A;  4GML A;  4DK5 A;  3RO2 A;  3LYA A;  2HYZ A;  1EDU A;  4QFV A;  2KCV A;  3BG1 B;  5JJ7 A;  4GA1 A;  3U3W A;  2IFU A;  4J8F A;  1KLX A;  2X6F A;  3SZ7 A;  2J4D A;  4JPS A;  3IHV A;  4EBA A;  1Y8M A;  3LVQ E;  1OWL A;  1QNF A;  2AXU A;  2V4L A;  4GB9 A;  5C2Y A;  4B89 A;  2VTB B;  4MS6 A;  4J0U A;  3U66 A;  4OVV A;  4I6G A;  4K0R A;  2VSY A;  3CVW A;  3CQG B;  4JVS A;  3LEW A;  5FQ6 A;  1H2U A;  1E8X A;  2YHC A;  5FZS A;  4A3V A;  4ACK A;  3MX3 A;  4CRW A;  2XHE A;  3LY9 A;  3GZS A;  1Z6T A;  2CG2 A;  3O48 A;  3UUX A;  4I17 A;  1ELK A;  3U9W A;  1OWP A;  5A23 A;  4GA0 A;  1ELW A;  3CHO A;  3FH5 A;  5CMY A;  2DBA A;  3FTZ A;  3FH7 A;  3PRZ A;  4I1M A;  3G2T A;  5ANL A;  3SFZ A;  5FQ7 A;  1EF1 C;  4EZK A;  2V0P A;  1JWG A;  2KAT A;  3HVE B;  5FQ4 A;  1E90 A;  3DBS A;  4U07 A;  1HE8 A;  1ZU2 A;  3QK0 A;  2WXL A;  2VSO E;  3D9O A;  3GZ1 A;  4I6J A;  5FT9 A;  4ATG A;  3QB2 A;  3C98 A;  3KS2 A;  3ONK A;  4I9C A;  3TXN A;  4TV3 A;  1OUV A;  2AWI A;  1XGW A;  4GCO A;  2WPV A;  1VDY A;  4U8H A;  2Y4U A;  3WXX A;  2I6H A;  3Q47 B;  5T4Y A;  2HO1 A;  3CK7 A;  3ULQ A;  5CCM A;  1N54 A;  4AY5 A;  4GCN A;  4KVO A;  4L23 A;  3FFL A;  4KZ0 A;  4F7A A;  4WWO A;  1HS6 A;  4O6F A;  4KYO B;  3NZS A;  1UJJ A;  2ION A;  4IYP A;  4ILI A;  2P58 C;  2HR2 A;  4G24 A;  3SNX A;  3OXF A;  5EX0 A;  4AOF A;  5BUZ A;  4FA6 A;  5G05 C;  3UPV A;  4JZY A;  2CHX A;  3FTS A;  1NZN A;  2YHE A;  3APF A;  4U0Z A;  4GPK A;  5EDS A;  3SHF A;  2L9B A;  2WVI A;  4FHK A;  5EKQ D;  3ASH A;  3CHQ A;  3CKB A;  1HF8 A;  1TEZ A;  1UN9 A;  5E75 A;  4JC8 A;  4ABN A;  2XPI A;  4JEU A;  4XIF A;  3RRN B;  1ELR A;  3CVY A;  2R59 A;  5LFA A;  4U0U A;  4AIF A;  2R5S A;  2MHK A;  3CSF A;  3MZL B;  3GYZ A;  2J07 A;  2R17 C;  3FUH A;  2BF0 X;  1TJF A;  4GZD A;  2E0I A;  4PDX A;  5AJL A;  3ZIM A;  3PE3 A;  2WXI A;  4JHJ A;  4JW1 A;  1IQU A;  5BPP A;  5KJK A;  3PRE A;  4EBA G;  3OAW A;  1TJC A;  1WM5 A;  1H2V C;  1H19 A;  1Y6I A;  4GZC A;  4XKC A;  2RD0 A;  5FJY A;  5G55 A;  3UQ3 A;  4BFR A;  2DCP A;  4J6I A;  2XGM A;  4APO A;  5ENN A;  4CGW A;  4YVO A;  4JEH A;  1L5J A;  2IOL A;  3Q5M A;  2FBN A;  2PM6 A;  3EIJ A;  3L13 A;  3P2B A;  3LXU X;  4L1B A;  5FWQ A;  3RIB A;  4HOT A;  3S7J A;  2YQ8 A;  3FWV A;  3QDN A;  3MKQ B;  3ZVV A;  3CVQ A;  5BNW A;  5DIZ A;  2C0M A;  4GYY A;  4WND A;  4E6H A;  4WWN A;  1HG2 A;  2IQC A;  4U0S A;  4BTB A;  2QY7 A;  3QWV A;  4DI3 A;  4L7T A;  3QWW A;  3LY8 A;  3LDZ A;  3FDH A;  4C9B B;  1JWF A;  2I9C A;  2V5F A;  2XRZ A;  5FTP A;  4HFG A;  3QAR A;  3KD7 A;  5ARF A;  4BX8 A;  4BT8 A;  2WXJ A;  1HH8 A;  4P29 A;  4WNG A;  3D9M A;  4LUN U;  3S7D A;  1KT1 A;  3CR3 A;  4JA7 A;  2KC7 A;  4I1A A;  4C0E A;  4G23 A;  3ML8 A;  4F53 A;  2XRY A;  4FC8 A;  4ANW A;  2LNI A;  3CVP A;  5HI7 A;  1QZ2 A;  3LJ3 A;  4GAA A;  4R7L A;  4JA9 A;  2AXV A;  3QWP A;  1NA3 A;  3CV0 A;  3FTV A;  3LPZ A;  3ZHE B;  4A3T A;  4UWL A;  4G11 A;  5J08 A;  2KCK A;  3FU5 A;  4LRZ A;  2EQX A;  4YND A;  2J09 A;  4DLO A;  4LER A;  4XI0 A;  3OXG A;  3APD A;  3TL5 A;  2VYI A;  3T8M A;  3HYM B;  4CT4 A;  4J8D A;  3I4R B;  4G25 A;  3FTX A;  4GU5 A;  4J8E A;  3FUJ A;  3JQ0 A;  2OV8 A;  3MKQ A;  5G2N A;  2X6H A;  1IQR A;  2WXR A;  4FAD A;  3GW4 A;  4PS3 A;  2WQ6 A;  3MYV A;  2PQN A;  1A17 A;  2XQ0 A;  3MGB A;  3TAX A;  3MCX A;  2WMO A;  3CK9 A;  2E2E A;  4IN3 B;  3CLJ A;  5E76 A;  3U4T A;  1EYH A;  2UY1 A;  1E96 B;  3NF1 A;  4W9R A;  3RKV A;  3VLD A;  3D9J A;  4APF A;  4A55 A;  3CIA A;  3G2U A;  1LF8 A;  2BUG A;  2VGY A;  4B94 A;  5FQ8 A;  3PUK A;  4F1S A;  4OVU A;  4KT6 B;  3CVL A;  3HHM A;  4UI9 C;  4AJW A;  4HXI A;  2CHW A;  3EHN A;  4GZ6 A;  4GYO A;  2VSX E;  3QNK A;  5G05 J;  1NP7 A;  2X3M A;  4UWK A;  3ZYK A;  1MHQ A;  3N71 A;  5FZQ A;  5AEN A;  2RG8 A;  3L54 A;  4G26 A;  5KJN A;  1UG3 A;  3Q15 A;  3MKR A;  5C1D A;  3MV3 B;  4GA2 A;  1UN8 A;  2Q7F A;  3KAE A;  4FU3 A;  3FUF A;  3HVE A;  2WXM A;  3ASF A;  5JHA A;  4UQX A;  4KBQ A;  1Z3X A;  5EX3 A;  3PNT B;  1HXI A;  1E7V A;  1E7U A;  3FUE A;  3PDN A;  3TG5 A;  3ESK A;  4CT0 A;  4NUR A;  5A7D B;  4RVB A;  4JXT A;  3T5X A;  4U04 A;  2MRI A;  4AEZ C;  2C2L A;  3NQP A;  3PUJ A;  2AVP A;  3ML9 A;  5BT1 A;  4EZL A;  3TG4 A;  4HLE A;  2Y3A A;  3CHP A;  1WY6 A;  2OND A;  3ZYQ A;  3UT7 A;  4C0M A;  5AJD A;  1HFA A;  3EDT B;  4XE0 A;  3T5V A;  3JYS A;  4PS8 A;  3AS8 A;  3BEE A;  3LVR E;  4CGV A;  2JLB A;  5J90 A;  3PNL B;  2V8S E;  5DBK A;  3ZPJ A;  4JHK A;  4YVQ C;  3MJW A;  2J9Q A;  2KCL A;  1NA0 A;  1ZBP A;  1W3B A;  2ILR A;  2LSV A;  3IKO B;  3SD5 A;  2XGS A;  3EHM A;  1PY1 A;  4KZC A;  4I6E A;  2L6J A;  2WM9 A;  3S7F A;  3SI5 A;  4ANU A;  1HZ4 A;  5BV1 A;  4KVM A;  3R9A B;  4N2S A;  2WXF A;  4ME2 A;  4BT9 A;  3VTX A;  3ZW3 A;  3D9N A;  4DI4 A;  1OWN A;  3L6A A;  3L17 A;  2XGO A;  3G2S A;  3IHY A;  3PE4 A;  5ARG A;  5A6C A;  4UWH A;  4HOS A;  4N3A A;  3IEG A;  4B8A A;  4UWF A;  3LS8 A;  1JUQ A;  2VSN A;  4LEU A;  3ONL A;  3URZ A;  5G04 C;  5JJT A;  3DPD A;  2OOE A;  2VGX B;  3HDX A;  1MQS A;  4I2Z A;  4I1O B;  4UQY A;  5JJ6 A;  4G1T A;  5LP0 A;  2VJ8 A;  3FUM A;  3R7R A;  2QFC A;  4UI9 J;  3L08 A;  4MLP A;  4FUL A;  2XCB A;  1HX8 A;  3RJV A;  2GW1 A;  3G2V A;  3RK6 A;  3BG0 B;  3OXL A;  3FUN A;  3ZN3 A;  5LCW J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...