1E96B

Structure of the rac/p67phox complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
185
structure length
185
Chain Sequence
SLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
publication title Structure of the Tpr Domain of P67Phox in Complex with Rac.GTP
pubmed rcsb
source organism Homo sapiens
total genus 71
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1e96B00
4Y6WA 3LKUA 2WPVA 3LYAA 3PE4A 1HXIA 1HH8A 2XCCA 5M72A 3CVQA 4WNGA 5FJYA 4JL0A 3K9IA 2P58C 2IFUA 3QDNA 3CV0A 4N3BA 4UI9K 3OXLA 2NC9A 4YVOA 4ME2A 3UQ3A 4HOQA 1YA0A 4APOA 3LPZA 5KJMA 5BW8C 4JA9A 5G05C 3Q15A 2PQNA 4AY6A 3RKVA 5A6CA 3URZA 2IF4A 4GYOA 1IHGA 3S7DA 3RIBA 2PQRA 2I6HA 4GCNA 2XGOA 4AM9A 4G1TA 1WAO1 1PC2A 3KAEA 5G04J 4WNDA 4G23A 3TG5A 3ZFWA 3UPVA 4U0ZA 2VYIA 4JA7A 2LSVA 5EX0A 3TAXA 1IYGA 4H7YA 4GPKA 5JJ7A 5AYWD 2FI7A 3S7FA 4AIFA 4G26A 2UWJG 4F3VA 2FO7A 4BT9A 3CK8A 3Q5MA 2XEVA 3BEEA 3AS4A 4N2QA 2L6JA 4G24A 1WM5A 3RO2A 3R9AB 4I9CA 3RO3A 3EDTB 1B89A 2VGXB 3TG4A 2Y4UA 4UI9C 3SZ7A 4GA1A 2XGSA 4AY5A 5HQ8A 3LY9A 1E96B 2Q7FA 4HOSA 3U3WA 3N71A 1ELWA 1TJCA 4I17A 2VQ2A 5JJ6A 4WUYA 3FP3A 2UY1B 4A1SA 4GZ6A 4N2SA 5KJKA 2VGXA 4G2VA 4XI9A 4U0SA 4KYOB 4LEUA 5FZQA 3LY8A 2VGYA 4N3CA 3FWVA 4I9EA 2PL2A 4N3AA 5EKQD 4G25A 4B94A 1QZ2A 3PDNA 4UQZA 4N39A 2UY1A 4I2ZA 3ZPJA 5G05J 4GYWA 3MA5A 4NRHB 4CGVA 5D0QD 4CDRA 5D0OD 3CKCA 4HOUA 2BUGA 2XPIA 5ARGA 5HI7A 4YNDA 3UUXA 2FEZA 4GA0A 3VTXA 3Q49B 2GW1A 1ELRA 3GZ2A 5FZRA 3Q4AB 1FCHA 1ZU2A 3S7JA 4U04A 3VTYA 3QOUA 3FFLA 4UQYA 1QQEA 3MEKA 3OXFA 2KCVA 4KBQA 3WXXA 2J9QA 3AS5A 1ZBPA 4XIFA 1A17A 3OXGA 2LSUA 3KD7A 5LCWC 5CHEE 3RJVA 3QWWA 2KCKA 5FTPA 3LCAA 5CCMA 2R5SA 3CEQA 4IN3B 4ABNA 2HR2A 5C1DA 4BT8A 3O48A 3ZN3A 3TGOA 4XI0A 2YQ8A 4J8FA 3RU0A 4BWRA 3CVPA 3ASHA 3CK7A 4RG6A 3ZHEB 4I2WA 3GZ1A 3MV3B 3ZGQA 4BTAA 2VSNA 2LNIA 1KLXA 4HORA 2FF4A 2PZIA 2MHKA 4H7XA 1Y8MA 5ARFA 2VSYA 3GYZA 2HO1A 5BNWA 3S7BA 3QKYA 5KJNA 3CKBA 2DBAA 3ASGA 2ONDA 2KCLA 2C0LA 3ZHEA 3QWVA 3U4TA 2AVPA 4O6FA 3ULQA 2E2EA 5G04C 4GA2A 4HOTA 5EX3A 4U0UA 3ASDA 2C2LA 4CGWA 4Y6CA 4GZ3A 4BTBA 2FBNA 1KT0A 5FT9A 2JLBA 5A7DB 3E4BA 4I1AA 3IEGA 1HZ4A 1NA0A 4GYYA 4J0UA 2WQHA 1NA3A 1P5QA 1KT1A 1XNFA 5DIZA 2KC7A 2OOEA 4KXKB 5CCLA 4W9RA 3ASFA 3MV2B 3CVLA 4GZ5A 4RG9A 3CVNA 2YHCA 3KS2A 5KJLA 4UI9J 3Q47B 4YVQC 3JYSA 5BT1A 3ESKA 4GCOA 3LY7A 3QWPA 5LCWJ 4EQFA 2HYZA 5JJTA 2XGMA 2C0MA 4JHRA 1OUVA 4N5CA 5DBKA 2Y4TA 4WNFA 1W3BA 5FZSA 4J8EA 3SF4A 4NQ0A 3MKRA 3HYMB 2KATA 4UQXA 1NZNA 3CK9A 4U07A 2V5FA 3PE3A 2XCBA 4WNEA 2QFCA 3NF1A 4J8DA 3GW4A 3AS8A
chains in the Genus database with same CATH superfamily
2LAHA 2QZAA 3LKUA 1RZ4A 3EJNA 1UN9A 3PE4A 2XCCA 3CVXA 3L22A 4YDOA 3S2AA 3CV0A 2Y3AA 3OXLA 2H6GA 2NC9A 4I6GA 5CEDB 3UQ3A 3JQ0A 3NZUA 4C0EA 3FTZA 5CECB 4GTSA 1DC2A 2PQNA 4AY6A 1HX8A 3CHRA 1LTXA 4CEMA 5FQ8A 2OEVA 4LERA 3D9IA 5CMYA 1E7VA 4AM9A 4TXPA 4G1TA 4EBAA 3NQPA 1WAO1 1PC2A 1SA5A 3AG4E 4KZCA 2X38A 2H6HA 3FUEA 5G04J 4G23A 4I6JA 1KZPA 2WXHA 5AJDA 3UPVA 4MBGA 4JA7A 3FEYA 3LVQE 4FHJA 4M7CA 3O4ZA 4K0RA 4L23A 3ZUVB 1MYOA 4U63A 5KNGA 3MZLB 1AP7A 4GPKA 3S7FA 2X6HA 2GRMA 3UT8A 2EIKE 3ZNGA 3FH5A 4F3VA 2L9BA 2J4BA 3AS4A 3I5PA 5FINA 3DSSA 3T9KA 4G24A 2ZU6B 1IKND 4TUUA 4HI9A 3RO3A 3ONKA 3ZYKA 2WXPA 1TN8A 3Q79A 2XPZA 3IHVA 3J5PA 3W9FA 3G2TA 2OCCE 5HQ8A 2XEHA 5LOZA 2F37A 3CGHA 1E8XA 2I2OA 1KZOA 1PAQA 2Q7FA 2XEEA 5BPPA 1U3DA 3AAAC 4HOSA 3EU5A 2V8SE 3PNTB 2P9NG 5JJ6A 1TR4A 3T5XA 4N2SA 4JVSA 2EIME 2VTBB 4P29A 4BSXA 1N4RA 4UWHA 2RG8A 2WXOA 2ETBA 4KYOB 4GAAA 4ANXA 4UWKA 4FP7A 3FEXA 3CHPA 3IXEA 4FJZA 3L08A 4FJYA 4DPRA 3V2OA 3QAQA 4N3CA 1IQUA 4WAFA 3U64A 2L6BA 4N3AA 4TXRA 1TNOA 2J49A 2BKGA 3BQOA 3PDNA 4UQZA 4N39A 3BU8A 3HVEA 2XHEA 4U8HA 2CG2A 4BESA 4GZDA 3MA5A 3LJ3A 3U9WA 3V2XA 1N0QA 4NRHB 2V5QC 4CGVA 5D0QD 3DBSA 2CG3A 3PRZA 4BX8A 2BUGA 1UG3A 2IU1A 3D9NA 5HI7A 4YNDA 3UIOC 4Q96A 1N52A 4U8VD 3DSUA 3KEZA 2GRRB 3TXNA 5EIDA 4UWLA 1S0PA 4DX6D 4PS8A 2XZDG 2R02A 2GW1A 3G2VA 3Q4AB 4HS2A 3S7JA 5CEAA 1LD7A 2LAIA 3VTYA 3FFLA 3ASOE 4RVBA 3DEOA 4GMRA 3HG0D 5ENPD 3OXFA 5EN5D 4D10C 1H19A 3WXXA 2J9QA 3EUVA 1E8YA 1A17A 3OXGA 3PZ2A 2LSUA 3ABME 2R03A 3AJIA 5B1BE 3QWWA 2KCKA 1HG2A 2KZTA 5FTPA 3HXEA 3I4RB 4C0MA 3B95A 4GPMA 4HBDA 4O1PA 2HR2A 1OWMA 1SVXA 3RU0A 1JPLA 3CVPA 4FADA 3ZYQA 3CK7A 4I6EA 1UJKA 1D9SA 2L0IA 3ISMC 3C3QA 3UT7A 3LEWA 4AJWA 4H7XA 3FUMA 3GYZA 2GRPB 5EYPF 3I3NA 4K5CA 4DJAA 3ASGA 3ML8A 3TWVA 5BV0A 2KCLA 3UIPC 2WXGA 3ZHEA 5KCMA 5AQAA 3ENEA 1EYHA 2J4DA 3CIAA 5EDSA 2EILE 2E2EA 2ZISA 5AQ9A 5AARA 4GA2A 3ASDA 3IV0A 3ZXSA 3FULA 1U3CA 4AEZC 4GZ3A 2NXPA 3PREA 1KT0A 2M63A 4C9BB 4I1AA 4A55A 2ZXWE 4TUMA 2WXLA 3G2WA 4ILGA 3R7QA 3HXDA 2ZGGA 4GTMA 3CHSA 2CHZA 2WB2A 4KXKB 4J7WA 3FUJA 4GZ5A 4RG9A 1KPSB 5KJLA 4CZ2D 3PZ1A 3CR3A 1TNUA 3FTUA 3UI2A 3QJZA 5ITZF 3CLJA 4HVBA 3QWPA 4JHRA 4JEHA 4N5CA 3ULEG 2I9CA 5T4YA 4J8EA 5AAOA 3FTSA 3MKRA 3HYMB 2KATA 1NZNA 4U07A 1E90A 2F0YA 2V5FA 2DYSE 4URKA 3L82A 3GW4A 1WDYA 2XQ0A 4UWGA 3CHOA 3TJPA 2HE0A 4HLEA 4U8YD 3F6QA 1HXIA 4HI8A 4B93B 5M72A 1SZ9A 3CVQA 2WMOA 4DX1A 4JL0A 3K9IA 3SFZA 1YMPA 2HM8A 2IFUA 4WWOA 4YVOA 3E30A 1OWNA 4HOQA 1BLXB 4APOA 4U96D 1BD8A 5BW8C 3UTMA 1X81A 5G05C 4N5QA 3URZA 3JXJA 2IF4A 4GYOA 3S7DA 1AWCB 1D8DA 5KBAA 1OCOE 3UX4A 2XGOA 1HO8A 5T8IA 3LVRE 4XEIG 2J07A 3B13A 3UKUG 3TG5A 4U0ZA 3V79K 3ULYA 1N4PA 2X6IA 3DSXA 5G2NA 1S63A 5EILA 1H6PA 1IYGA 5JA4D 5JJ7A 4KVOA 4HLLA 2IO3C 2UWJG 4FC8A 2DZOA 2FO7A 3AU5A 3CK8A 5AQ7A 2XEVA 4OAVB 4QFVA 3CSFA 5LP0A 2IOSA 4I9CA 2Y69E 3EDTB 3L13A 1HG5A 2VGXB 3ZYLA 2Y4UA 3SZ7A 4AV7A 4DX5D 4L1BA 3D9HA 3DXMG 3LY9A 3Q7AA 3PZ3A 4RSYA 3G2UA 1WY6A 5KNHD 3FHEA 2WXJA 1MQSA 3SO8A 4F1SA 2DVWA 4WUYA 2UY1B 1A5EA 4G2VA 4JW1A 5HKPA 2WXNA 3FH7A 2IY0C 3LY8A 3EIQC 3RRMB 3FH8A 3TWQA 2VGYA 4HRMB 3FWVA 1JWGA 4G25A 4JXTA 3CVVA 2IEJA 2NYJA 5G55A 4V3IA 4A3TA 2FO1E 5JHBA 4YDEA 4GYWA 1NP7A 1ELKA 4LG6A 4OYSA 4I43A 4XKCA 2WQ7A 3UM3A 3Q75A 1NFIE 5D0OD 2XRZA 3CKCA 5ARGA 4GTQA 4XE0A 3U66A 1OWLA 2EINE 4IRUA 3CVWA 2FEZA 3DWLG 2I1KA 4L9PA 4DX2A 1IQRA 2QC9A 2DZNA 1ELRA 2VSXE 4JEUA 1FCHA 1L5JA 1ZU2A 1N9AA 3E34A 1MZCA 3L9TA 3NAWA 4J8YA 3QOUA 1HE8A 4WWPA 3PVLA 1QQEA 3MEKA 5JMND 1HFAA 4TRQA 4EZKA 2MOWA 4ANVA 3HXFA 3PUJA 5LCWC 2LO6A 3QARA 2R59A 1RW2A 1OY3D 2WXIA 4AOFA 3ZW3A 2R5SA 3KEAA 4IN3B 1XGWA 5C1DA 4KMOA 2OVFA 4DRXE 3CVYA 2LUHA 3TGOA 5J08A 4EECA 4O1OA 3JXIA 4PUCA 3PZDA 4BWRA 2YHEA 3GZ1A 4FULA 3PZ4A 3AU4A 5FWQA 4YDWA 2WVIA 1KLXA 4HORA 3TWSA 2PZIA 1OT8A 3FU6A 2H6FA 3SBTB 2HO1A 1O5MA 3S7BA 3DEPA 3TWXA 3JCKC 2QYJA 3QKYA 1UW4B 5KJNA 5ANLA 3DXKG 2C0LA 3IBEA 1UN8A 3QWVA 3E37A 4HNAD 3MYVA 4O6FA 3ULQA 5KWDA 2ETAA 5G04C 1Z3XA 4CCAA 2DWZA 4U0UA 2C2LA 4Q69A 3B7UX 3APDA 1TNZA 5D66A 2J08A 4WWNA 3UT4A 1N54A 3UINC 4BETA 2P2CP 4K03A 4DK5A 2ZGDA 1NA3A 1P5QA 5B1AE 1GW6A 1FVFA 2X6FA 4GZCA 5CCLA 4W9RA 3E33A 3ABLE 1JWFA 5CRUA 3CQGB 3RK6A 2B0OE 3CVLA 1K8KG 4OVUA 2BF0X 2MRIA 2PM7A 2XZTG 4TXQA 2GRQB 3HXCA 4UI9J 3Q47B 3P1UA 1DNPA 3JYSA 3ZXPA 2EQXA 5EIBE 1N95A 4BFRA 3LY7A 2HYZA 3BG0B 2XGMA 1OUVA 1O1TA 3SFXA 4K5BA 4WNFA 1W3BA 3SF4A 4U95D 3TXMA 3IHYA 3CK9A 4Q94A 3T5VA 5BV1A 4Y6WA 3UM1A 2WPVA 4O60A 3D9LA 3V31A 4WNGA 3FDHA 4B8CB 4G11A 2P58C 3SBSA 3QDNA 4N3BA 3QNKA 4EZLA 4ME2A 3PEUB 3LPZA 2IOLA 5KJMA 3GZSA 4KVMA 1HF8A 3Q15A 5A6CA 4ILIA 1FT2A 3SFYA 3DSTA 3T8KA 5J90A 3RIBA 3BUAA 4LNBA 4M3OA 2A4ZA 3B7SA 3IKOB 1JUQA 4WNDA 3EHQA 4ANUA 4YDYA 1K1AA 2YINA 3PH0C 3ZEFA 4GTTA 3NBNB 2VJ8A 3TAXA 4CT0A 3W9GA 1K3ZD 1H0AA 2JEKA 4NACA 5D2MC 3D9OA 3PS6A 1BI7B 5AYWD 2FI7A 3C72A 2KZTB 2RKKA 5FQ4A 3Q5MA 2XPYA 3QC1A 4I1OB 1Z6TA 3B7BA 4L2YA 3D3MA 2L6JA 3JUIA 1WM5A 3RO2A 4HRNA 1B89A 5FQ7A 3PUKA 4GMLA 3UM0A 4A63B 3TG4A 4UI9C 3CHMA 3EHRA 4BY6A 4GA1A 4EBAG 2XGSA 3MX3A 3SY2A 1E96B 1TNBA 1MX6A 3C5RA 1Y6IA 2GROB 5EYLA 2VGEA 3CSTA 1TJCA 3KSLA 3SD5A 4CRWA 2VQ2A 3FP3A 4A1SA 4DLQA 3MGBA 1MJ0A 3Q9UC 2VGXA 2BEDA 4B0ZA 4LEUA 4FU3A 4GTOA 2OEWA 3ZKJA 3SHFA 1VDYA 1H2TC 4DUIA 2Y1LE 4F1PA 1UOHA 3MKQA 4B94A 3E32A 1QZ2A 5E75A 2CHXA 3EHMA 4R7LA 3FUHA 2UY1A 3R9MA 3AG3E 1LF8A 2VSOE 2P9PG 3HDXA 4RLYA 4UUCA 3FU3A 2RD0A 2AXVA 2CFUA 2KXPC 1WG0A 4CDRA 3SI5A 4XX5A 3FTWA 4HOUA 2BKKB 2ILRA 3DPYA 3Q73A 4CDMA 1SZAA 5HS0A 1HS6A 4KT6B 3R7RA 2X6JA 4JHJA 2IJGX 1OCCE 3L16A 2IO2C 4U04A 4CT4A 2BTDA 3ZRHA 4GTVA 1O1RA 5ENSD 1H6KA 1BU9A 3NB2A 1MX2A 1X5BA 1ZBPA 1TN6A 4XIFA 2DCPA 3ASNE 2RFAA 4L7TA 2B6CA 2FULA 4C48B 2R2LA 4OVVA 4CDNA 2WXFA 2V4LA 3C98A 5B3SE 5C2YA 4APFA 1V54E 4ABNA 4ACKA 3CQCB 4JD2G 4MS6A 4LRZA 3O48A 4HQDA 4E6HA 4J8FA 4BX9A 4F6RD 2X3MA 4PDXA 4QQIA 3MV3B 3ZGQA 2OV8A 3TWRA 4BTAA 3UM2A 3LXUX 2VSNA 4G8KA 4E85A 2LNIA 2WMNA 2FF4A 4X8QA 1Y8MA 4B89A 2VSYA 2MYOA 3J5QB 3ONLA 2AW6A 3QK0A 3C3RA 4XKBA 5A23A 3HXBA 2VTBA 1OWOA 3FTYA 4GB9A 3U4TA 4A1GA 2GGFA 2AVPA 4MKTA 2IONA 5EX3A 1SW6A 4HOTA 1FT1A 3T8MA 5ENQD 2P9LG 4CGWA 2L0TB 1G3NB 2R17C 3DSWA 2A5UA 4BTBA 2FBNA 1V55E 3L54A 5BXUA 2JLBA 3D9PA 3FTVA 3KSQA 1HZ4A 3P2BA 2WQHA 4J0UA 5LX8A 3MCXA 1KT1A 1XNFA 3VLFA 5DIZA 5LFAA 2KC7A 4F53A 2OOEA 2AWIA 3MJWA 2XS1A 4Z68A 3SQVA 4I1MA 3ZU7B 2H6IA 5BXOA 3MV2B 1HU3A 1JCQA 5HRYA 3KS2A 1E7UA 1FVHA 5AENA 3ESKA 4GCOA 4EQFA 4FA6A 4HRLA 5DBKA 2Y4TA 4A3VA 5ENRD 3ESLA 3JQ1A 3APFA 1YYHA 1N0RA 2E0IA 1Q2ZA 3PE3A 3V30A 2XCBA 5T3RA 3DPDA 1U2VG 2J8SD 1NI1A 5BUZA 3LYAA 3UXGA 2WXRA 1MX4A 1HH8A 5CMWA 3PNLB 1BI8B 5FIOA 5FJYA 2J09A 3LJNA 3LS8A 4UI9K 4L2LA 1YA0A 3Q78A 5E76A 3TWWA 1EPUA 5H7PA 4JA9A 4EPZA 5ENNA 3RKVA 5IY5E 3FU5A 1IHGA 1N4QA 1K1BA 4HXIA 3RRUA 2PQRA 2I6HA 4GCNA 2EIJE 4AP2A 3KAEA 4GTPA 3ZFWA 3UMVA 4HB5A 2VYIA 1JCSA 2AXUA 4EZJA 2LSVA 2P9SG 3FU0A 5EX0A 3RRNB 3ZVVA 3D9MA 4H7YA 2PM6A 2V4HC 3FUFA 4XZ4A 1SA4A 3APCA 5ENOD 4AIFA 4G26A 2XS8A 2KBXA 4BT9A 3BEEA 4JHKA 1IXVA 1E8WA 4N2QA 1N94A 4BSZB 3R9AB 4LNGA 2JABA 2NSZA 5AQBA 1OCZE 1PY1A 4OAUC 4AY5A 5CRVA 4GMJA 3Q9NC 2WXMA 1O1SA 4LUNU 1N4SA 3B7RL 3U3WA 4J6IA 4LSZE 4AXHA 3EU9A 2RFMA 2P9KG 3N71A 1ELWA 4I17A 2IQCA 3HRAA 3HVEB 3ML9A 1JCRA 4GZ6A 3NOCD 2AXZA 5KJKA 3SNXA 2CFZA 3NZSA 4XI9A 1TN7A 1DCEA 4U0SA 4DI4A 2WM9A 1OWPA 5FZQA 3UKRG 2QY7A 2P9IG 3FUDA 4BEPA 3BG1B 5CERB 3ZYMA 4F7AA 4ZFHA 4I9EA 3WG7E 2PL2A 1SQMA 5EKQD 2LXMA 4ACLA 2F8YA 4ZHBA 1Z5SC 1LD8A 4IYPA 3AG1E 3NOGD 4I2ZA 3CVUA 3ZPJA 5G05J 3ZIMA 4GU5A 1UJJA 3FUKA 4ANWA 4LCTA 4FLBA 3RAUA 4GTRA 2WXQA 2XPIA 5CBOA 1OXJA 1D8EA 2ZIRA 3Q7FA 3UUXA 2GRLA 4KZ0A 4BERA 2R05A 4GA0A 3VTXA 3Q49B 1TJFA 4JB8P 4EHMA 3GZ2A 5FZRA 2P9UG 1DVPA 1INZA 4FHKA 4NIKA 1TEZA 4ILHB 1E8ZA 4UQYA 3SGHA 3LDZA 2KCVA 4KBQA 3AS5A 4NURA 2WXKA 1IHBA 4UWFA 5AJLA 1BPOA 3QB2A 4J8SA 4B8AA 3KD7A 1N11A 1OCRE 5CHEE 3RJVA 2XENA 3PEVB 3LCAA 2QYUA 2OVBA 2F8XK 4TV3A 5CCMA 3CEQA 3FUIA 4ATGA 5ANRA 4BT8A 3OTNA 2KM4A 3L17A 3ZN3A 4XI0A 2YQ8A 2X6KA 3ASHA 3B7TA 3FUNA 5ENTD 4RG6A 2ETCA 3ZHEB 4I2WA 3TWTA 3TWUA 3EIJA 1S70B 1QNFA 4U7EB 2I1JA 4IULA 5JHAA 3VLDA 1QYMA 2MHKA 4DX7D 5ARFA 5BNWA 2PNNA 3CKBA 2DBAA 3CHQA 4G8LA 2ONDA 5FQ6A 1EDUA 1S64A 3DSVA 1EF1C 2AJAA 1H2VC 5AIJA 3VLEA 1YCSB 4DLOA 1DCQA 4RQIA 2YNQA 4LNUD 2CHWA 4PH4B 3ABKE 1ZB1A 3FTXA 1TNYA 4Y6CA 3D9KA 4HFGA 3TL5A 3OAWA 2GRNB 2WQ6A 1Z3YA 4PS3A 5FT9A 2A5EA 3D9JA 5A7DB 3E4BA 2LXLA 3C3OA 3IEGA 5CBNA 1NA0A 1NL4A 3X2QE 4FLHA 4GYYA 4ATZD 2V0PA 3L6AA 3AG2E 1QBQA 1FPPA 3HHMA 4CYMD 3DRAA 2XRYA 4JZYA 4MRUA 3EHNA 1TYQG 3JUEA 3ASFA 3HIZA 4MLPA 4DI3A 4JC8A 3CVNA 2YHCA 5AN8A 4YVQC 3RSEG 1H6OA 5BT1A 5LCWJ 2Y0BG 5JJTA 2DYRE 2C0MA 1H2UA 3FY4A 5FZSA 4NQ0A 4K5AB 3G2SA 4AVXA 4JPSA 2DIWA 4UQXA 3I4GA 3MKQB 4WNEA 2QFCA 3NF1A 4J8DA 4PS7A 1MHQA 3AS8A
chains in the Genus database with same CATH topology
2LAHA 2XQ0A 4Y6WA 3LKUA 5BUZA 2WPVA 3EJNA 4UWGA 3CHOA 3LYAA 3TJPA 4HLEA 1UN9A 3PE4A 2WXRA 1HXIA 5CMWA 1HH8A 2XCCA 5M72A 1SZ9A 3D9LA 3PNLB 3CVQA 4WNGA 2WMOA 3CVXA 5FJYA 2J09A 3FDHA 4JL0A 4B8CB 4G11A 3L22A 3K9IA 3LS8A 2P58C 3SFZA 2HM8A 2IFUA 4WWOA 3S2AA 3SBSA 3QDNA 3CV0A 4N3BA 2Y3AA 4UI9K 3OXLA 2NC9A 3QNKA 4YVOA 4EZLA 4I6GA 4ME2A 1OWNA 3UQ3A 4L2LA 4HOQA 1YA0A 3JQ0A 3PEUB 4APOA 3LPZA 3NZUA 2IOLA 5E76A 5KJMA 4C0EA 1EPUA 5BW8C 3FTZA 3GZSA 4KVMA 4JA9A 5G05C 1HF8A 3Q15A 4EPZA 2PQNA 4AY6A 5ENNA 3RKVA 5A6CA 3URZA 1HX8A 4ILIA 3CHRA 2IF4A 4CEMA 3FU5A 4GYOA 5FQ8A 1IHGA 5J90A 4HXIA 3S7DA 4LERA 3RIBA 3RRUA 2PQRA 2I6HA 4GCNA 2XGOA 3D9IA 3UX4A 5CMYA 1E7VA 4AM9A 1HO8A 4G1TA 4EBAA 4M3OA 2A4ZA 3NQPA 1WAO1 1PC2A 3B7SA 5T8IA 3LVRE 4KZCA 2J07A 3IKOB 2X38A 4AP2A 1JUQA 3FUEA 4CDNA 3KAEA 5G04J 4WNDA 3B13A 4G23A 4I6JA 4ANUA 3TG5A 2WXHA 5AJDA 3ZFWA 3UPVA 3UMVA 4U0ZA 2VYIA 4JA7A 2YINA 3PH0C 2AXUA 3FEYA 3ZEFA 2X6IA 3LVQE 2LSVA 3FU0A 2VJ8A 4FHJA 5EX0A 3RRNB 3TAXA 4CT0A 3O4ZA 3ZVVA 5G2NA 4K0RA 1H0AA 4L23A 2JEKA 4NACA 1IYGA 3D9MA 4U63A 3MZLB 3D9OA 4H7YA 4GPKA 5JJ7A 3PS6A 2PM6A 4KVOA 5AYWD 3FUFA 4XZ4A 2FI7A 2KZTB 3S7FA 3APCA 2X6HA 4AIFA 4G26A 2UWJG 2GRMA 4FC8A 5FQ4A 3UT8A 3FH5A 4F3VA 2L9BA 2FO7A 2J4BA 3AU5A 4BT9A 3CK8A 3Q5MA 2XEVA 3BEEA 4JHKA 4QFVA 3AS4A 2XPYA 3QC1A 3I5PA 4I1OB 1E8WA 1Z6TA 3CSFA 4L2YA 5LP0A 4N2QA 3D3MA 2L6JA 3JUIA 4G24A 2ZU6B 2IOSA 4TUUA 1WM5A 3RO2A 3R9AB 4I9CA 3RO3A 3EDTB 2NSZA 1B89A 3ONKA 3PUKA 3L13A 4GMLA 1HG5A 5FQ7A 2VGXB 3ZYKA 2WXPA 3TG4A 3ZYLA 2Y4UA 4UI9C 3SZ7A 2XPZA 3CHMA 4BY6A 4GA1A 1PY1A 4AV7A 3IHVA 4EBAG 2XGSA 3MX3A 4L1BA 4AY5A 3G2TA 5HQ8A 5LOZA 3CGHA 1E8XA 3LY9A 2I2OA 1E96B 1PAQA 2Q7FA 4GMJA 5BPPA 4RSYA 1U3DA 2WXMA 1Y6IA 4LUNU 3G2UA 1WY6A 4HOSA 3B7RL 3U3WA 4J6IA 4AXHA 3CSTA 2V8SE 3PNTB 3FHEA 3N71A 1ELWA 1TJCA 3SD5A 2WXJA 4I17A 1MQSA 4CRWA 2IQCA 4F1SA 2VQ2A 5JJ6A 3HVEB 3ML9A 4WUYA 3FP3A 2UY1B 4A1SA 4DLQA 4GZ6A 3MGBA 3T5XA 4N2SA 2AXZA 4JVSA 5KJKA 2VTBB 4P29A 3SNXA 2CFZA 3NZSA 2VGXA 4G2VA 4JW1A 4BSXA 4UWHA 2RG8A 4XI9A 2WXOA 4B0ZA 4U0SA 4DI4A 4KYOB 2WXNA 2WM9A 4GAAA 3FH7A 4LEUA 1OWPA 4FU3A 4UWKA 5FZQA 4ANXA 2QY7A 3LY8A 3FUDA 4FP7A 3BG1B 3EIQC 3RRMB 3SHFA 1VDYA 3FEXA 3CHPA 1H2TC 3FH8A 4FJZA 4FJYA 3L08A 3ZYMA 4DPRA 2VGYA 3QAQA 4N3CA 1IQUA 4WAFA 3U64A 3FWVA 4F7AA 3MKQA 4I9EA 2PL2A 1JWGA 1SQMA 4N3AA 5EKQD 4G25A 4JXTA 4B94A 3CVVA 2J49A 4ACLA 1QZ2A 3PDNA 4UQZA 2CHXA 3EHMA 4N39A 4R7LA 5E75A 4IYPA 5G55A 4V3IA 4A3TA 3HVEA 3FUHA 5JHBA 2UY1A 4I2ZA 3CVUA 2XHEA 3ZPJA 4U8HA 2CG2A 4GYWA 5G05J 1LF8A 1NP7A 3ZIMA 2VSOE 1ELKA 3HDXA 3MA5A 3LJ3A 4GZDA 1UJJA 3FUKA 4GU5A 4OYSA 4I43A 4XKCA 3U9WA 3FU3A 2RD0A 2WQ7A 2AXVA 4ANWA 2CFUA 4NRHB 4CGVA 4LCTA 5D0QD 4CDRA 3SI5A 4FLBA 3DBSA 5D0OD 4XX5A 3FTWA 2CG3A 3CKCA 2XRZA 4HOUA 3PRZA 4BX8A 2WXQA 2BUGA 2ILRA 2XPIA 5ARGA 1UG3A 4XE0A 2IU1A 3D9NA 5HI7A 1SZAA 4YNDA 3UUXA 4CDMA 3U66A 4Q96A 2GRLA 1HS6A 4KT6B 1N52A 1OWLA 4KZ0A 4IRUA 3KEZA 3CVWA 2FEZA 3TXNA 4UWLA 1S0PA 4GA0A 3R7RA 4PS8A 2X6JA 3VTXA 4EZJA 2I1KA 3Q49B 4JHJA 2GW1A 1IQRA 2IJGX 1TJFA 3G2VA 1ELRA 2VSXE 3GZ2A 5FZRA 3L16A 3Q4AB 4HS2A 4JEUA 1FCHA 1L5JA 1ZU2A 3S7JA 4U04A 2LAIA 3VTYA 3QOUA 1DVPA 3FFLA 1INZA 4FHKA 1HE8A 1TEZA 4WWPA 4RVBA 4CT4A 2BTDA 4ILHB 1E8ZA 3PVLA 4UQYA 3SGHA 1QQEA 3MEKA 3ZRHA 3OXFA 4D10C 1H19A 3LDZA 1HFAA 2KCVA 4TRQA 4KBQA 3WXXA 2J9QA 3AS5A 4NURA 2WXKA 1H6KA 4EZKA 1X5BA 1ZBPA 4XIFA 1E8YA 2DCPA 4L7TA 2MOWA 1A17A 2FULA 3OXGA 4UWFA 2LSUA 5AJLA 4OVVA 4ANVA 1BPOA 3PUJA 3QB2A 2WXFA 4J8SA 2V4LA 3C98A 3KD7A 4B8AA 5LCWC 5CHEE 2LO6A 3RJVA 3QARA 3QWWA 2KCKA 1HG2A 2R59A 2KZTA 3PEVB 5FTPA 3LCAA 2WXIA 3I4RB 2OVBA 5C2YA 4APFA 4AOFA 3ZW3A 4TV3A 2R5SA 3CEQA 4IN3B 4C0MA 5CCMA 4ABNA 2HR2A 4ACKA 1XGWA 3CQCB 1OWMA 3FUIA 5C1DA 4KMOA 2OVFA 4MS6A 4LRZA 4ATGA 5ANRA 4BT8A 3OTNA 2KM4A 3L17A 3O48A 3CVYA 3ZN3A 4E6HA 3TGOA 4XI0A 5J08A 2YQ8A 4EECA 4J8FA 3RU0A 1JPLA 4PUCA 4BWRA 3CVPA 3PZDA 2X6KA 2YHEA 3ASHA 3B7TA 3ZYQA 3FUNA 4BX9A 4FADA 3CK7A 4I6EA 1UJKA 4RG6A 3ZHEB 4I2WA 2X3MA 3GZ1A 2L0IA 4PDXA 4FULA 3MV3B 3ZGQA 2OV8A 3AU4A 4BTAA 3EIJA 5FWQA 1QNFA 2I1JA 4IULA 5JHAA 3LXUX 2VSNA 3VLDA 3UT7A 4E85A 2LNIA 2WMNA 2WVIA 1KLXA 3LEWA 4HORA 2FF4A 2PZIA 3FU6A 4AJWA 2MHKA 4H7XA 1Y8MA 4B89A 5ARFA 3SBTB 3FUMA 2VSYA 3GYZA 2HO1A 5BNWA 3S7BA 3JCKC 3QKYA 1UW4B 3I3NA 3ONLA 5KJNA 3CKBA 2AW6A 5ANLA 4DJAA 2DBAA 3ASGA 3CHQA 3ML8A 3QK0A 2ONDA 5BV0A 5FQ6A 2KCLA 4XKBA 5A23A 2C0LA 1EDUA 3IBEA 2VTBA 1OWOA 1UN8A 2WXGA 3FTYA 5KCMA 3ZHEA 3QWVA 4GB9A 3U4TA 1EF1C 3ENEA 4A1GA 1H2VC 5AIJA 3MYVA 3VLEA 1EYHA 2J4DA 2GGFA 2AVPA 3CIAA 4O6FA 3ULQA 4DLOA 5EDSA 2YNQA 2CHWA 2E2EA 4PH4B 4MKTA 4GA2A 5G04C 1Z3XA 2IONA 5EX3A 4HOTA 4CCAA 4U0UA 3ASDA 3T8MA 2C2LA 3IV0A 3ZXSA 4CGWA 3FTXA 3FULA 4Y6CA 1U3CA 2L0TB 3D9KA 4HFGA 3TL5A 4AEZC 2R17C 4Q69A 4GZ3A 3OAWA 2A5UA 2NXPA 4BTBA 3B7UX 3APDA 2FBNA 2WQ6A 3PREA 1KT0A 3L54A 2M63A 1Z3YA 2J08A 4PS3A 5FT9A 4WWNA 2JLBA 3D9JA 3D9PA 5A7DB 3UT4A 4C9BB 1N54A 3E4BA 3FTVA 4I1AA 3IEGA 4A55A 1HZ4A 1NA0A 2WXLA 3G2WA 4FLHA 4GYYA 4ILGA 4K03A 2V0PA 4DK5A 3P2BA 2WQHA 4J0UA 3L6AA 3R7QA 5LX8A 1NA3A 1P5QA 3MCXA 1KT1A 1XNFA 3VLFA 5DIZA 1GW6A 2KC7A 5LFAA 4F53A 2OOEA 2AWIA 3CHSA 3MJWA 3HHMA 1FVFA 2X6FA 2CHZA 2XRYA 4GZCA 4JZYA 4KXKB 2WB2A 4MRUA 5CCLA 4W9RA 4I1MA 3EHNA 1JWFA 3FUJA 3CQGB 3RK6A 3ASFA 3HIZA 3MV2B 4MLPA 4DI3A 3CVLA 4GZ5A 4OVUA 2BF0X 4JC8A 1HU3A 2MRIA 2PM7A 4RG9A 3CVNA 2YHCA 3KS2A 1E7UA 5KJLA 4UI9J 3Q47B 3P1UA 4YVQC 1DNPA 3CR3A 3JYSA 1FVHA 2EQXA 3FTUA 5BT1A 3QJZA 5AENA 3ESKA 4BFRA 4GCOA 3CLJA 3LY7A 3QWPA 4HVBA 4EQFA 5LCWJ 2HYZA 3BG0B 5JJTA 2XGMA 2C0MA 4JHRA 4JEHA 4FA6A 1OUVA 4N5CA 1H2UA 2Y4TA 5DBKA 2I9CA 5T4YA 4WNFA 4A3VA 3FY4A 1W3BA 5FZSA 4J8EA 3SF4A 4NQ0A 3G2SA 4AVXA 3ESLA 3JQ1A 3FTSA 4JPSA 3TXMA 3APFA 3MKRA 3HYMB 2E0IA 2KATA 2DIWA 3IHYA 4UQXA 1NZNA 3I4GA 3CK9A 4Q94A 4U07A 1E90A 3MKQB 2V5FA 3PE3A 2XCBA 4WNEA 4URKA 2QFCA 5T3RA 3DPDA 3T5VA 3NF1A 4J8DA 4PS7A 1MHQA 3GW4A 5BV1A 3AS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y6W A;  3LKU A;  2WPV A;  3LYA A;  3PE4 A;  1HXI A;  1HH8 A;  2XCC A;  5M72 A;  3CVQ A;  4WNG A;  5FJY A;  4JL0 A;  3K9I A;  2P58 C;  2IFU A;  3QDN A;  3CV0 A;  4N3B A;  4UI9 K;  3OXL A;  2NC9 A;  4YVO A;  4ME2 A;  3UQ3 A;  4HOQ A;  1YA0 A;  4APO A;  3LPZ A;  5KJM A;  5BW8 C;  4JA9 A;  5G05 C;  3Q15 A;  2PQN A;  4AY6 A;  3RKV A;  5A6C A;  3URZ A;  2IF4 A;  4GYO A;  1IHG A;  3S7D A;  3RIB A;  2PQR A;  2I6H A;  4GCN A;  2XGO A;  4AM9 A;  4G1T A;  1WAO 1;  1PC2 A;  3KAE A;  5G04 J;  4WND A;  4G23 A;  3TG5 A;  3ZFW A;  3UPV A;  4U0Z A;  2VYI A;  4JA7 A;  2LSV A;  5EX0 A;  3TAX A;  1IYG A;  4H7Y A;  4GPK A;  5JJ7 A;  5AYW D;  2FI7 A;  3S7F A;  4AIF A;  4G26 A;  2UWJ G;  4F3V A;  2FO7 A;  4BT9 A;  3CK8 A;  3Q5M A;  2XEV A;  3BEE A;  3AS4 A;  4N2Q A;  2L6J A;  4G24 A;  1WM5 A;  3RO2 A;  3R9A B;  4I9C A;  3RO3 A;  3EDT B;  1B89 A;  2VGX B;  3TG4 A;  2Y4U A;  4UI9 C;  3SZ7 A;  4GA1 A;  2XGS A;  4AY5 A;  5HQ8 A;  3LY9 A;  1E96 B;  2Q7F A;  4HOS A;  3U3W A;  3N71 A;  1ELW A;  1TJC A;  4I17 A;  2VQ2 A;  5JJ6 A;  4WUY A;  3FP3 A;  2UY1 B;  4A1S A;  4GZ6 A;  4N2S A;  5KJK A;  2VGX A;  4G2V A;  4XI9 A;  4U0S A;  4KYO B;  4LEU A;  5FZQ A;  3LY8 A;  2VGY A;  4N3C A;  3FWV A;  4I9E A;  2PL2 A;  4N3A A;  5EKQ D;  4G25 A;  4B94 A;  1QZ2 A;  3PDN A;  4UQZ A;  4N39 A;  2UY1 A;  4I2Z A;  3ZPJ A;  5G05 J;  4GYW A;  3MA5 A;  4NRH B;  4CGV A;  5D0Q D;  4CDR A;  5D0O D;  3CKC A;  4HOU A;  2BUG A;  2XPI A;  5ARG A;  5HI7 A;  4YND A;  3UUX A;  2FEZ A;  4GA0 A;  3VTX A;  3Q49 B;  2GW1 A;  1ELR A;  3GZ2 A;  5FZR A;  3Q4A B;  1FCH A;  1ZU2 A;  3S7J A;  4U04 A;  3VTY A;  3QOU A;  3FFL A;  4UQY A;  1QQE A;  3MEK A;  3OXF A;  2KCV A;  4KBQ A;  3WXX A;  2J9Q A;  3AS5 A;  1ZBP A;  4XIF A;  1A17 A;  3OXG A;  2LSU A;  3KD7 A;  5LCW C;  5CHE E;  3RJV A;  3QWW A;  2KCK A;  5FTP A;  3LCA A;  5CCM A;  2R5S A;  3CEQ A;  4IN3 B;  4ABN A;  2HR2 A;  5C1D A;  4BT8 A;  3O48 A;  3ZN3 A;  3TGO A;  4XI0 A;  2YQ8 A;  4J8F A;  3RU0 A;  4BWR A;  3CVP A;  3ASH A;  3CK7 A;  4RG6 A;  3ZHE B;  4I2W A;  3GZ1 A;  3MV3 B;  3ZGQ A;  4BTA A;  2VSN A;  2LNI A;  1KLX A;  4HOR A;  2FF4 A;  2PZI A;  2MHK A;  4H7X A;  1Y8M A;  5ARF A;  2VSY A;  3GYZ A;  2HO1 A;  5BNW A;  3S7B A;  3QKY A;  5KJN A;  3CKB A;  2DBA A;  3ASG A;  2OND A;  2KCL A;  2C0L A;  3ZHE A;  3QWV A;  3U4T A;  2AVP A;  4O6F A;  3ULQ A;  2E2E A;  5G04 C;  4GA2 A;  4HOT A;  5EX3 A;  4U0U A;  3ASD A;  2C2L A;  4CGW A;  4Y6C A;  4GZ3 A;  4BTB A;  2FBN A;  1KT0 A;  5FT9 A;  2JLB A;  5A7D B;  3E4B A;  4I1A A;  3IEG A;  1HZ4 A;  1NA0 A;  4GYY A;  4J0U A;  2WQH A;  1NA3 A;  1P5Q A;  1KT1 A;  1XNF A;  5DIZ A;  2KC7 A;  2OOE A;  4KXK B;  5CCL A;  4W9R A;  3ASF A;  3MV2 B;  3CVL A;  4GZ5 A;  4RG9 A;  3CVN A;  2YHC A;  3KS2 A;  5KJL A;  4UI9 J;  3Q47 B;  4YVQ C;  3JYS A;  5BT1 A;  3ESK A;  4GCO A;  3LY7 A;  3QWP A;  5LCW J;  4EQF A;  2HYZ A;  5JJT A;  2XGM A;  2C0M A;  4JHR A;  1OUV A;  4N5C A;  5DBK A;  2Y4T A;  4WNF A;  1W3B A;  5FZS A;  4J8E A;  3SF4 A;  4NQ0 A;  3MKR A;  3HYM B;  2KAT A;  4UQX A;  1NZN A;  3CK9 A;  4U07 A;  2V5F A;  3PE3 A;  2XCB A;  4WNE A;  2QFC A;  3NF1 A;  4J8D A;  3GW4 A;  3AS8 A; 
#chains in the Genus database with same CATH topology
 2LAH A;  2QZA A;  3LKU A;  1RZ4 A;  3EJN A;  1UN9 A;  3PE4 A;  2XCC A;  3CVX A;  3L22 A;  4YDO A;  3S2A A;  3CV0 A;  2Y3A A;  3OXL A;  2H6G A;  2NC9 A;  4I6G A;  5CED B;  3UQ3 A;  3JQ0 A;  3NZU A;  4C0E A;  3FTZ A;  5CEC B;  4GTS A;  1DC2 A;  2PQN A;  4AY6 A;  1HX8 A;  3CHR A;  1LTX A;  4CEM A;  5FQ8 A;  2OEV A;  4LER A;  3D9I A;  5CMY A;  1E7V A;  4AM9 A;  4TXP A;  4G1T A;  4EBA A;  3NQP A;  1WAO 1;  1PC2 A;  1SA5 A;  3AG4 E;  4KZC A;  2X38 A;  2H6H A;  3FUE A;  5G04 J;  4G23 A;  4I6J A;  1KZP A;  2WXH A;  5AJD A;  3UPV A;  4MBG A;  4JA7 A;  3FEY A;  3LVQ E;  4FHJ A;  4M7C A;  3O4Z A;  4K0R A;  4L23 A;  3ZUV B;  1MYO A;  4U63 A;  5KNG A;  3MZL B;  1AP7 A;  4GPK A;  3S7F A;  2X6H A;  2GRM A;  3UT8 A;  2EIK E;  3ZNG A;  3FH5 A;  4F3V A;  2L9B A;  2J4B A;  3AS4 A;  3I5P A;  5FIN A;  3DSS A;  3T9K A;  4G24 A;  2ZU6 B;  1IKN D;  4TUU A;  4HI9 A;  3RO3 A;  3ONK A;  3ZYK A;  2WXP A;  1TN8 A;  3Q79 A;  2XPZ A;  3IHV A;  3J5P A;  3W9F A;  3G2T A;  2OCC E;  5HQ8 A;  2XEH A;  5LOZ A;  2F37 A;  3CGH A;  1E8X A;  2I2O A;  1KZO A;  1PAQ A;  2Q7F A;  2XEE A;  5BPP A;  1U3D A;  3AAA C;  4HOS A;  3EU5 A;  2V8S E;  3PNT B;  2P9N G;  5JJ6 A;  1TR4 A;  3T5X A;  4N2S A;  4JVS A;  2EIM E;  2VTB B;  4P29 A;  4BSX A;  1N4R A;  4UWH A;  2RG8 A;  2WXO A;  2ETB A;  4KYO B;  4GAA A;  4ANX A;  4UWK A;  4FP7 A;  3FEX A;  3CHP A;  3IXE A;  4FJZ A;  3L08 A;  4FJY A;  4DPR A;  3V2O A;  3QAQ A;  4N3C A;  1IQU A;  4WAF A;  3U64 A;  2L6B A;  4N3A A;  4TXR A;  1TNO A;  2J49 A;  2BKG A;  3BQO A;  3PDN A;  4UQZ A;  4N39 A;  3BU8 A;  3HVE A;  2XHE A;  4U8H A;  2CG2 A;  4BES A;  4GZD A;  3MA5 A;  3LJ3 A;  3U9W A;  3V2X A;  1N0Q A;  4NRH B;  2V5Q C;  4CGV A;  5D0Q D;  3DBS A;  2CG3 A;  3PRZ A;  4BX8 A;  2BUG A;  1UG3 A;  2IU1 A;  3D9N A;  5HI7 A;  4YND A;  3UIO C;  4Q96 A;  1N52 A;  4U8V D;  3DSU A;  3KEZ A;  2GRR B;  3TXN A;  5EID A;  4UWL A;  1S0P A;  4DX6 D;  4PS8 A;  2XZD G;  2R02 A;  2GW1 A;  3G2V A;  3Q4A B;  4HS2 A;  3S7J A;  5CEA A;  1LD7 A;  2LAI A;  3VTY A;  3FFL A;  3ASO E;  4RVB A;  3DEO A;  4GMR A;  3HG0 D;  5ENP D;  3OXF A;  5EN5 D;  4D10 C;  1H19 A;  3WXX A;  2J9Q A;  3EUV A;  1E8Y A;  1A17 A;  3OXG A;  3PZ2 A;  2LSU A;  3ABM E;  2R03 A;  3AJI A;  5B1B E;  3QWW A;  2KCK A;  1HG2 A;  2KZT A;  5FTP A;  3HXE A;  3I4R B;  4C0M A;  3B95 A;  4GPM A;  4HBD A;  4O1P A;  2HR2 A;  1OWM A;  1SVX A;  3RU0 A;  1JPL A;  3CVP A;  4FAD A;  3ZYQ A;  3CK7 A;  4I6E A;  1UJK A;  1D9S A;  2L0I A;  3ISM C;  3C3Q A;  3UT7 A;  3LEW A;  4AJW A;  4H7X A;  3FUM A;  3GYZ A;  2GRP B;  5EYP F;  3I3N A;  4K5C A;  4DJA A;  3ASG A;  3ML8 A;  3TWV A;  5BV0 A;  2KCL A;  3UIP C;  2WXG A;  3ZHE A;  5KCM A;  5AQA A;  3ENE A;  1EYH A;  2J4D A;  3CIA A;  5EDS A;  2EIL E;  2E2E A;  2ZIS A;  5AQ9 A;  5AAR A;  4GA2 A;  3ASD A;  3IV0 A;  3ZXS A;  3FUL A;  1U3C A;  4AEZ C;  4GZ3 A;  2NXP A;  3PRE A;  1KT0 A;  2M63 A;  4C9B B;  4I1A A;  4A55 A;  2ZXW E;  4TUM A;  2WXL A;  3G2W A;  4ILG A;  3R7Q A;  3HXD A;  2ZGG A;  4GTM A;  3CHS A;  2CHZ A;  2WB2 A;  4KXK B;  4J7W A;  3FUJ A;  4GZ5 A;  4RG9 A;  1KPS B;  5KJL A;  4CZ2 D;  3PZ1 A;  3CR3 A;  1TNU A;  3FTU A;  3UI2 A;  3QJZ A;  5ITZ F;  3CLJ A;  4HVB A;  3QWP A;  4JHR A;  4JEH A;  4N5C A;  3ULE G;  2I9C A;  5T4Y A;  4J8E A;  5AAO A;  3FTS A;  3MKR A;  3HYM B;  2KAT A;  1NZN A;  4U07 A;  1E90 A;  2F0Y A;  2V5F A;  2DYS E;  4URK A;  3L82 A;  3GW4 A;  1WDY A;  2XQ0 A;  4UWG A;  3CHO A;  3TJP A;  2HE0 A;  4HLE A;  4U8Y D;  3F6Q A;  1HXI A;  4HI8 A;  4B93 B;  5M72 A;  1SZ9 A;  3CVQ A;  2WMO A;  4DX1 A;  4JL0 A;  3K9I A;  3SFZ A;  1YMP A;  2HM8 A;  2IFU A;  4WWO A;  4YVO A;  3E30 A;  1OWN A;  4HOQ A;  1BLX B;  4APO A;  4U96 D;  1BD8 A;  5BW8 C;  3UTM A;  1X81 A;  5G05 C;  4N5Q A;  3URZ A;  3JXJ A;  2IF4 A;  4GYO A;  3S7D A;  1AWC B;  1D8D A;  5KBA A;  1OCO E;  3UX4 A;  2XGO A;  1HO8 A;  5T8I A;  3LVR E;  4XEI G;  2J07 A;  3B13 A;  3UKU G;  3TG5 A;  4U0Z A;  3V79 K;  3ULY A;  1N4P A;  2X6I A;  3DSX A;  5G2N A;  1S63 A;  5EIL A;  1H6P A;  1IYG A;  5JA4 D;  5JJ7 A;  4KVO A;  4HLL A;  2IO3 C;  2UWJ G;  4FC8 A;  2DZO A;  2FO7 A;  3AU5 A;  3CK8 A;  5AQ7 A;  2XEV A;  4OAV B;  4QFV A;  3CSF A;  5LP0 A;  2IOS A;  4I9C A;  2Y69 E;  3EDT B;  3L13 A;  1HG5 A;  2VGX B;  3ZYL A;  2Y4U A;  3SZ7 A;  4AV7 A;  4DX5 D;  4L1B A;  3D9H A;  3DXM G;  3LY9 A;  3Q7A A;  3PZ3 A;  4RSY A;  3G2U A;  1WY6 A;  5KNH D;  3FHE A;  2WXJ A;  1MQS A;  3SO8 A;  4F1S A;  2DVW A;  4WUY A;  2UY1 B;  1A5E A;  4G2V A;  4JW1 A;  5HKP A;  2WXN A;  3FH7 A;  2IY0 C;  3LY8 A;  3EIQ C;  3RRM B;  3FH8 A;  3TWQ A;  2VGY A;  4HRM B;  3FWV A;  1JWG A;  4G25 A;  4JXT A;  3CVV A;  2IEJ A;  2NYJ A;  5G55 A;  4V3I A;  4A3T A;  2FO1 E;  5JHB A;  4YDE A;  4GYW A;  1NP7 A;  1ELK A;  4LG6 A;  4OYS A;  4I43 A;  4XKC A;  2WQ7 A;  3UM3 A;  3Q75 A;  1NFI E;  5D0O D;  2XRZ A;  3CKC A;  5ARG A;  4GTQ A;  4XE0 A;  3U66 A;  1OWL A;  2EIN E;  4IRU A;  3CVW A;  2FEZ A;  3DWL G;  2I1K A;  4L9P A;  4DX2 A;  1IQR A;  2QC9 A;  2DZN A;  1ELR A;  2VSX E;  4JEU A;  1FCH A;  1L5J A;  1ZU2 A;  1N9A A;  3E34 A;  1MZC A;  3L9T A;  3NAW A;  4J8Y A;  3QOU A;  1HE8 A;  4WWP A;  3PVL A;  1QQE A;  3MEK A;  5JMN D;  1HFA A;  4TRQ A;  4EZK A;  2MOW A;  4ANV A;  3HXF A;  3PUJ A;  5LCW C;  2LO6 A;  3QAR A;  2R59 A;  1RW2 A;  1OY3 D;  2WXI A;  4AOF A;  3ZW3 A;  2R5S A;  3KEA A;  4IN3 B;  1XGW A;  5C1D A;  4KMO A;  2OVF A;  4DRX E;  3CVY A;  2LUH A;  3TGO A;  5J08 A;  4EEC A;  4O1O A;  3JXI A;  4PUC A;  3PZD A;  4BWR A;  2YHE A;  3GZ1 A;  4FUL A;  3PZ4 A;  3AU4 A;  5FWQ A;  4YDW A;  2WVI A;  1KLX A;  4HOR A;  3TWS A;  2PZI A;  1OT8 A;  3FU6 A;  2H6F A;  3SBT B;  2HO1 A;  1O5M A;  3S7B A;  3DEP A;  3TWX A;  3JCK C;  2QYJ A;  3QKY A;  1UW4 B;  5KJN A;  5ANL A;  3DXK G;  2C0L A;  3IBE A;  1UN8 A;  3QWV A;  3E37 A;  4HNA D;  3MYV A;  4O6F A;  3ULQ A;  5KWD A;  2ETA A;  5G04 C;  1Z3X A;  4CCA A;  2DWZ A;  4U0U A;  2C2L A;  4Q69 A;  3B7U X;  3APD A;  1TNZ A;  5D66 A;  2J08 A;  4WWN A;  3UT4 A;  1N54 A;  3UIN C;  4BET A;  2P2C P;  4K03 A;  4DK5 A;  2ZGD A;  1NA3 A;  1P5Q A;  5B1A E;  1GW6 A;  1FVF A;  2X6F A;  4GZC A;  5CCL A;  4W9R A;  3E33 A;  3ABL E;  1JWF A;  5CRU A;  3CQG B;  3RK6 A;  2B0O E;  3CVL A;  1K8K G;  4OVU A;  2BF0 X;  2MRI A;  2PM7 A;  2XZT G;  4TXQ A;  2GRQ B;  3HXC A;  4UI9 J;  3Q47 B;  3P1U A;  1DNP A;  3JYS A;  3ZXP A;  2EQX A;  5EIB E;  1N95 A;  4BFR A;  3LY7 A;  2HYZ A;  3BG0 B;  2XGM A;  1OUV A;  1O1T A;  3SFX A;  4K5B A;  4WNF A;  1W3B A;  3SF4 A;  4U95 D;  3TXM A;  3IHY A;  3CK9 A;  4Q94 A;  3T5V A;  5BV1 A;  4Y6W A;  3UM1 A;  2WPV A;  4O60 A;  3D9L A;  3V31 A;  4WNG A;  3FDH A;  4B8C B;  4G11 A;  2P58 C;  3SBS A;  3QDN A;  4N3B A;  3QNK A;  4EZL A;  4ME2 A;  3PEU B;  3LPZ A;  2IOL A;  5KJM A;  3GZS A;  4KVM A;  1HF8 A;  3Q15 A;  5A6C A;  4ILI A;  1FT2 A;  3SFY A;  3DST A;  3T8K A;  5J90 A;  3RIB A;  3BUA A;  4LNB A;  4M3O A;  2A4Z A;  3B7S A;  3IKO B;  1JUQ A;  4WND A;  3EHQ A;  4ANU A;  4YDY A;  1K1A A;  2YIN A;  3PH0 C;  3ZEF A;  4GTT A;  3NBN B;  2VJ8 A;  3TAX A;  4CT0 A;  3W9G A;  1K3Z D;  1H0A A;  2JEK A;  4NAC A;  5D2M C;  3D9O A;  3PS6 A;  1BI7 B;  5AYW D;  2FI7 A;  3C72 A;  2KZT B;  2RKK A;  5FQ4 A;  3Q5M A;  2XPY A;  3QC1 A;  4I1O B;  1Z6T A;  3B7B A;  4L2Y A;  3D3M A;  2L6J A;  3JUI A;  1WM5 A;  3RO2 A;  4HRN A;  1B89 A;  5FQ7 A;  3PUK A;  4GML A;  3UM0 A;  4A63 B;  3TG4 A;  4UI9 C;  3CHM A;  3EHR A;  4BY6 A;  4GA1 A;  4EBA G;  2XGS A;  3MX3 A;  3SY2 A;  1E96 B;  1TNB A;  1MX6 A;  3C5R A;  1Y6I A;  2GRO B;  5EYL A;  2VGE A;  3CST A;  1TJC A;  3KSL A;  3SD5 A;  4CRW A;  2VQ2 A;  3FP3 A;  4A1S A;  4DLQ A;  3MGB A;  1MJ0 A;  3Q9U C;  2VGX A;  2BED A;  4B0Z A;  4LEU A;  4FU3 A;  4GTO A;  2OEW A;  3ZKJ A;  3SHF A;  1VDY A;  1H2T C;  4DUI A;  2Y1L E;  4F1P A;  1UOH A;  3MKQ A;  4B94 A;  3E32 A;  1QZ2 A;  5E75 A;  2CHX A;  3EHM A;  4R7L A;  3FUH A;  2UY1 A;  3R9M A;  3AG3 E;  1LF8 A;  2VSO E;  2P9P G;  3HDX A;  4RLY A;  4UUC A;  3FU3 A;  2RD0 A;  2AXV A;  2CFU A;  2KXP C;  1WG0 A;  4CDR A;  3SI5 A;  4XX5 A;  3FTW A;  4HOU A;  2BKK B;  2ILR A;  3DPY A;  3Q73 A;  4CDM A;  1SZA A;  5HS0 A;  1HS6 A;  4KT6 B;  3R7R A;  2X6J A;  4JHJ A;  2IJG X;  1OCC E;  3L16 A;  2IO2 C;  4U04 A;  4CT4 A;  2BTD A;  3ZRH A;  4GTV A;  1O1R A;  5ENS D;  1H6K A;  1BU9 A;  3NB2 A;  1MX2 A;  1X5B A;  1ZBP A;  1TN6 A;  4XIF A;  2DCP A;  3ASN E;  2RFA A;  4L7T A;  2B6C A;  2FUL A;  4C48 B;  2R2L A;  4OVV A;  4CDN A;  2WXF A;  2V4L A;  3C98 A;  5B3S E;  5C2Y A;  4APF A;  1V54 E;  4ABN A;  4ACK A;  3CQC B;  4JD2 G;  4MS6 A;  4LRZ A;  3O48 A;  4HQD A;  4E6H A;  4J8F A;  4BX9 A;  4F6R D;  2X3M A;  4PDX A;  4QQI A;  3MV3 B;  3ZGQ A;  2OV8 A;  3TWR A;  4BTA A;  3UM2 A;  3LXU X;  2VSN A;  4G8K A;  4E85 A;  2LNI A;  2WMN A;  2FF4 A;  4X8Q A;  1Y8M A;  4B89 A;  2VSY A;  2MYO A;  3J5Q B;  3ONL A;  2AW6 A;  3QK0 A;  3C3R A;  4XKB A;  5A23 A;  3HXB A;  2VTB A;  1OWO A;  3FTY A;  4GB9 A;  3U4T A;  4A1G A;  2GGF A;  2AVP A;  4MKT A;  2ION A;  5EX3 A;  1SW6 A;  4HOT A;  1FT1 A;  3T8M A;  5ENQ D;  2P9L G;  4CGW A;  2L0T B;  1G3N B;  2R17 C;  3DSW A;  2A5U A;  4BTB A;  2FBN A;  1V55 E;  3L54 A;  5BXU A;  2JLB A;  3D9P A;  3FTV A;  3KSQ A;  1HZ4 A;  3P2B A;  2WQH A;  4J0U A;  5LX8 A;  3MCX A;  1KT1 A;  1XNF A;  3VLF A;  5DIZ A;  5LFA A;  2KC7 A;  4F53 A;  2OOE A;  2AWI A;  3MJW A;  2XS1 A;  4Z68 A;  3SQV A;  4I1M A;  3ZU7 B;  2H6I A;  5BXO A;  3MV2 B;  1HU3 A;  1JCQ A;  5HRY A;  3KS2 A;  1E7U A;  1FVH A;  5AEN A;  3ESK A;  4GCO A;  4EQF A;  4FA6 A;  4HRL A;  5DBK A;  2Y4T A;  4A3V A;  5ENR D;  3ESL A;  3JQ1 A;  3APF A;  1YYH A;  1N0R A;  2E0I A;  1Q2Z A;  3PE3 A;  3V30 A;  2XCB A;  5T3R A;  3DPD A;  1U2V G;  2J8S D;  1NI1 A;  5BUZ A;  3LYA A;  3UXG A;  2WXR A;  1MX4 A;  1HH8 A;  5CMW A;  3PNL B;  1BI8 B;  5FIO A;  5FJY A;  2J09 A;  3LJN A;  3LS8 A;  4UI9 K;  4L2L A;  1YA0 A;  3Q78 A;  5E76 A;  3TWW A;  1EPU A;  5H7P A;  4JA9 A;  4EPZ A;  5ENN A;  3RKV A;  5IY5 E;  3FU5 A;  1IHG A;  1N4Q A;  1K1B A;  4HXI A;  3RRU A;  2PQR A;  2I6H A;  4GCN A;  2EIJ E;  4AP2 A;  3KAE A;  4GTP A;  3ZFW A;  3UMV A;  4HB5 A;  2VYI A;  1JCS A;  2AXU A;  4EZJ A;  2LSV A;  2P9S G;  3FU0 A;  5EX0 A;  3RRN B;  3ZVV A;  3D9M A;  4H7Y A;  2PM6 A;  2V4H C;  3FUF A;  4XZ4 A;  1SA4 A;  3APC A;  5ENO D;  4AIF A;  4G26 A;  2XS8 A;  2KBX A;  4BT9 A;  3BEE A;  4JHK A;  1IXV A;  1E8W A;  4N2Q A;  1N94 A;  4BSZ B;  3R9A B;  4LNG A;  2JAB A;  2NSZ A;  5AQB A;  1OCZ E;  1PY1 A;  4OAU C;  4AY5 A;  5CRV A;  4GMJ A;  3Q9N C;  2WXM A;  1O1S A;  4LUN U;  1N4S A;  3B7R L;  3U3W A;  4J6I A;  4LSZ E;  4AXH A;  3EU9 A;  2RFM A;  2P9K G;  3N71 A;  1ELW A;  4I17 A;  2IQC A;  3HRA A;  3HVE B;  3ML9 A;  1JCR A;  4GZ6 A;  3NOC D;  2AXZ A;  5KJK A;  3SNX A;  2CFZ A;  3NZS A;  4XI9 A;  1TN7 A;  1DCE A;  4U0S A;  4DI4 A;  2WM9 A;  1OWP A;  5FZQ A;  3UKR G;  2QY7 A;  2P9I G;  3FUD A;  4BEP A;  3BG1 B;  5CER B;  3ZYM A;  4F7A A;  4ZFH A;  4I9E A;  3WG7 E;  2PL2 A;  1SQM A;  5EKQ D;  2LXM A;  4ACL A;  2F8Y A;  4ZHB A;  1Z5S C;  1LD8 A;  4IYP A;  3AG1 E;  3NOG D;  4I2Z A;  3CVU A;  3ZPJ A;  5G05 J;  3ZIM A;  4GU5 A;  1UJJ A;  3FUK A;  4ANW A;  4LCT A;  4FLB A;  3RAU A;  4GTR A;  2WXQ A;  2XPI A;  5CBO A;  1OXJ A;  1D8E A;  2ZIR A;  3Q7F A;  3UUX A;  2GRL A;  4KZ0 A;  4BER A;  2R05 A;  4GA0 A;  3VTX A;  3Q49 B;  1TJF A;  4JB8 P;  4EHM A;  3GZ2 A;  5FZR A;  2P9U G;  1DVP A;  1INZ A;  4FHK A;  4NIK A;  1TEZ A;  4ILH B;  1E8Z A;  4UQY A;  3SGH A;  3LDZ A;  2KCV A;  4KBQ A;  3AS5 A;  4NUR A;  2WXK A;  1IHB A;  4UWF A;  5AJL A;  1BPO A;  3QB2 A;  4J8S A;  4B8A A;  3KD7 A;  1N11 A;  1OCR E;  5CHE E;  3RJV A;  2XEN A;  3PEV B;  3LCA A;  2QYU A;  2OVB A;  2F8X K;  4TV3 A;  5CCM A;  3CEQ A;  3FUI A;  4ATG A;  5ANR A;  4BT8 A;  3OTN A;  2KM4 A;  3L17 A;  3ZN3 A;  4XI0 A;  2YQ8 A;  2X6K A;  3ASH A;  3B7T A;  3FUN A;  5ENT D;  4RG6 A;  2ETC A;  3ZHE B;  4I2W A;  3TWT A;  3TWU A;  3EIJ A;  1S70 B;  1QNF A;  4U7E B;  2I1J A;  4IUL A;  5JHA A;  3VLD A;  1QYM A;  2MHK A;  4DX7 D;  5ARF A;  5BNW A;  2PNN A;  3CKB A;  2DBA A;  3CHQ A;  4G8L A;  2OND A;  5FQ6 A;  1EDU A;  1S64 A;  3DSV A;  1EF1 C;  2AJA A;  1H2V C;  5AIJ A;  3VLE A;  1YCS B;  4DLO A;  1DCQ A;  4RQI A;  2YNQ A;  4LNU D;  2CHW A;  4PH4 B;  3ABK E;  1ZB1 A;  3FTX A;  1TNY A;  4Y6C A;  3D9K A;  4HFG A;  3TL5 A;  3OAW A;  2GRN B;  2WQ6 A;  1Z3Y A;  4PS3 A;  5FT9 A;  2A5E A;  3D9J A;  5A7D B;  3E4B A;  2LXL A;  3C3O A;  3IEG A;  5CBN A;  1NA0 A;  1NL4 A;  3X2Q E;  4FLH A;  4GYY A;  4ATZ D;  2V0P A;  3L6A A;  3AG2 E;  1QBQ A;  1FPP A;  3HHM A;  4CYM D;  3DRA A;  2XRY A;  4JZY A;  4MRU A;  3EHN A;  1TYQ G;  3JUE A;  3ASF A;  3HIZ A;  4MLP A;  4DI3 A;  4JC8 A;  3CVN A;  2YHC A;  5AN8 A;  4YVQ C;  3RSE G;  1H6O A;  5BT1 A;  5LCW J;  2Y0B G;  5JJT A;  2DYR E;  2C0M A;  1H2U A;  3FY4 A;  5FZS A;  4NQ0 A;  4K5A B;  3G2S A;  4AVX A;  4JPS A;  2DIW A;  4UQX A;  3I4G A;  3MKQ B;  4WNE A;  2QFC A;  3NF1 A;  4J8D A;  4PS7 A;  1MHQ A;  3AS8 A; 
#chains in the Genus database with same CATH homology
 2LAH A;  2XQ0 A;  4Y6W A;  3LKU A;  5BUZ A;  2WPV A;  3EJN A;  4UWG A;  3CHO A;  3LYA A;  3TJP A;  4HLE A;  1UN9 A;  3PE4 A;  2WXR A;  1HXI A;  5CMW A;  1HH8 A;  2XCC A;  5M72 A;  1SZ9 A;  3D9L A;  3PNL B;  3CVQ A;  4WNG A;  2WMO A;  3CVX A;  5FJY A;  2J09 A;  3FDH A;  4JL0 A;  4B8C B;  4G11 A;  3L22 A;  3K9I A;  3LS8 A;  2P58 C;  3SFZ A;  2HM8 A;  2IFU A;  4WWO A;  3S2A A;  3SBS A;  3QDN A;  3CV0 A;  4N3B A;  2Y3A A;  4UI9 K;  3OXL A;  2NC9 A;  3QNK A;  4YVO A;  4EZL A;  4I6G A;  4ME2 A;  1OWN A;  3UQ3 A;  4L2L A;  4HOQ A;  1YA0 A;  3JQ0 A;  3PEU B;  4APO A;  3LPZ A;  3NZU A;  2IOL A;  5E76 A;  5KJM A;  4C0E A;  1EPU A;  5BW8 C;  3FTZ A;  3GZS A;  4KVM A;  4JA9 A;  5G05 C;  1HF8 A;  3Q15 A;  4EPZ A;  2PQN A;  4AY6 A;  5ENN A;  3RKV A;  5A6C A;  3URZ A;  1HX8 A;  4ILI A;  3CHR A;  2IF4 A;  4CEM A;  3FU5 A;  4GYO A;  5FQ8 A;  1IHG A;  5J90 A;  4HXI A;  3S7D A;  4LER A;  3RIB A;  3RRU A;  2PQR A;  2I6H A;  4GCN A;  2XGO A;  3D9I A;  3UX4 A;  5CMY A;  1E7V A;  4AM9 A;  1HO8 A;  4G1T A;  4EBA A;  4M3O A;  2A4Z A;  3NQP A;  1WAO 1;  1PC2 A;  3B7S A;  5T8I A;  3LVR E;  4KZC A;  2J07 A;  3IKO B;  2X38 A;  4AP2 A;  1JUQ A;  3FUE A;  4CDN A;  3KAE A;  5G04 J;  4WND A;  3B13 A;  4G23 A;  4I6J A;  4ANU A;  3TG5 A;  2WXH A;  5AJD A;  3ZFW A;  3UPV A;  3UMV A;  4U0Z A;  2VYI A;  4JA7 A;  2YIN A;  3PH0 C;  2AXU A;  3FEY A;  3ZEF A;  2X6I A;  3LVQ E;  2LSV A;  3FU0 A;  2VJ8 A;  4FHJ A;  5EX0 A;  3RRN B;  3TAX A;  4CT0 A;  3O4Z A;  3ZVV A;  5G2N A;  4K0R A;  1H0A A;  4L23 A;  2JEK A;  4NAC A;  1IYG A;  3D9M A;  4U63 A;  3MZL B;  3D9O A;  4H7Y A;  4GPK A;  5JJ7 A;  3PS6 A;  2PM6 A;  4KVO A;  5AYW D;  3FUF A;  4XZ4 A;  2FI7 A;  2KZT B;  3S7F A;  3APC A;  2X6H A;  4AIF A;  4G26 A;  2UWJ G;  2GRM A;  4FC8 A;  5FQ4 A;  3UT8 A;  3FH5 A;  4F3V A;  2L9B A;  2FO7 A;  2J4B A;  3AU5 A;  4BT9 A;  3CK8 A;  3Q5M A;  2XEV A;  3BEE A;  4JHK A;  4QFV A;  3AS4 A;  2XPY A;  3QC1 A;  3I5P A;  4I1O B;  1E8W A;  1Z6T A;  3CSF A;  4L2Y A;  5LP0 A;  4N2Q A;  3D3M A;  2L6J A;  3JUI A;  4G24 A;  2ZU6 B;  2IOS A;  4TUU A;  1WM5 A;  3RO2 A;  3R9A B;  4I9C A;  3RO3 A;  3EDT B;  2NSZ A;  1B89 A;  3ONK A;  3PUK A;  3L13 A;  4GML A;  1HG5 A;  5FQ7 A;  2VGX B;  3ZYK A;  2WXP A;  3TG4 A;  3ZYL A;  2Y4U A;  4UI9 C;  3SZ7 A;  2XPZ A;  3CHM A;  4BY6 A;  4GA1 A;  1PY1 A;  4AV7 A;  3IHV A;  4EBA G;  2XGS A;  3MX3 A;  4L1B A;  4AY5 A;  3G2T A;  5HQ8 A;  5LOZ A;  3CGH A;  1E8X A;  3LY9 A;  2I2O A;  1E96 B;  1PAQ A;  2Q7F A;  4GMJ A;  5BPP A;  4RSY A;  1U3D A;  2WXM A;  1Y6I A;  4LUN U;  3G2U A;  1WY6 A;  4HOS A;  3B7R L;  3U3W A;  4J6I A;  4AXH A;  3CST A;  2V8S E;  3PNT B;  3FHE A;  3N71 A;  1ELW A;  1TJC A;  3SD5 A;  2WXJ A;  4I17 A;  1MQS A;  4CRW A;  2IQC A;  4F1S A;  2VQ2 A;  5JJ6 A;  3HVE B;  3ML9 A;  4WUY A;  3FP3 A;  2UY1 B;  4A1S A;  4DLQ A;  4GZ6 A;  3MGB A;  3T5X A;  4N2S A;  2AXZ A;  4JVS A;  5KJK A;  2VTB B;  4P29 A;  3SNX A;  2CFZ A;  3NZS A;  2VGX A;  4G2V A;  4JW1 A;  4BSX A;  4UWH A;  2RG8 A;  4XI9 A;  2WXO A;  4B0Z A;  4U0S A;  4DI4 A;  4KYO B;  2WXN A;  2WM9 A;  4GAA A;  3FH7 A;  4LEU A;  1OWP A;  4FU3 A;  4UWK A;  5FZQ A;  4ANX A;  2QY7 A;  3LY8 A;  3FUD A;  4FP7 A;  3BG1 B;  3EIQ C;  3RRM B;  3SHF A;  1VDY A;  3FEX A;  3CHP A;  1H2T C;  3FH8 A;  4FJZ A;  4FJY A;  3L08 A;  3ZYM A;  4DPR A;  2VGY A;  3QAQ A;  4N3C A;  1IQU A;  4WAF A;  3U64 A;  3FWV A;  4F7A A;  3MKQ A;  4I9E A;  2PL2 A;  1JWG A;  1SQM A;  4N3A A;  5EKQ D;  4G25 A;  4JXT A;  4B94 A;  3CVV A;  2J49 A;  4ACL A;  1QZ2 A;  3PDN A;  4UQZ A;  2CHX A;  3EHM A;  4N39 A;  4R7L A;  5E75 A;  4IYP A;  5G55 A;  4V3I A;  4A3T A;  3HVE A;  3FUH A;  5JHB A;  2UY1 A;  4I2Z A;  3CVU A;  2XHE A;  3ZPJ A;  4U8H A;  2CG2 A;  4GYW A;  5G05 J;  1LF8 A;  1NP7 A;  3ZIM A;  2VSO E;  1ELK A;  3HDX A;  3MA5 A;  3LJ3 A;  4GZD A;  1UJJ A;  3FUK A;  4GU5 A;  4OYS A;  4I43 A;  4XKC A;  3U9W A;  3FU3 A;  2RD0 A;  2WQ7 A;  2AXV A;  4ANW A;  2CFU A;  4NRH B;  4CGV A;  4LCT A;  5D0Q D;  4CDR A;  3SI5 A;  4FLB A;  3DBS A;  5D0O D;  4XX5 A;  3FTW A;  2CG3 A;  3CKC A;  2XRZ A;  4HOU A;  3PRZ A;  4BX8 A;  2WXQ A;  2BUG A;  2ILR A;  2XPI A;  5ARG A;  1UG3 A;  4XE0 A;  2IU1 A;  3D9N A;  5HI7 A;  1SZA A;  4YND A;  3UUX A;  4CDM A;  3U66 A;  4Q96 A;  2GRL A;  1HS6 A;  4KT6 B;  1N52 A;  1OWL A;  4KZ0 A;  4IRU A;  3KEZ A;  3CVW A;  2FEZ A;  3TXN A;  4UWL A;  1S0P A;  4GA0 A;  3R7R A;  4PS8 A;  2X6J A;  3VTX A;  4EZJ A;  2I1K A;  3Q49 B;  4JHJ A;  2GW1 A;  1IQR A;  2IJG X;  1TJF A;  3G2V A;  1ELR A;  2VSX E;  3GZ2 A;  5FZR A;  3L16 A;  3Q4A B;  4HS2 A;  4JEU A;  1FCH A;  1L5J A;  1ZU2 A;  3S7J A;  4U04 A;  2LAI A;  3VTY A;  3QOU A;  1DVP A;  3FFL A;  1INZ A;  4FHK A;  1HE8 A;  1TEZ A;  4WWP A;  4RVB A;  4CT4 A;  2BTD A;  4ILH B;  1E8Z A;  3PVL A;  4UQY A;  3SGH A;  1QQE A;  3MEK A;  3ZRH A;  3OXF A;  4D10 C;  1H19 A;  3LDZ A;  1HFA A;  2KCV A;  4TRQ A;  4KBQ A;  3WXX A;  2J9Q A;  3AS5 A;  4NUR A;  2WXK A;  1H6K A;  4EZK A;  1X5B A;  1ZBP A;  4XIF A;  1E8Y A;  2DCP A;  4L7T A;  2MOW A;  1A17 A;  2FUL A;  3OXG A;  4UWF A;  2LSU A;  5AJL A;  4OVV A;  4ANV A;  1BPO A;  3PUJ A;  3QB2 A;  2WXF A;  4J8S A;  2V4L A;  3C98 A;  3KD7 A;  4B8A A;  5LCW C;  5CHE E;  2LO6 A;  3RJV A;  3QAR A;  3QWW A;  2KCK A;  1HG2 A;  2R59 A;  2KZT A;  3PEV B;  5FTP A;  3LCA A;  2WXI A;  3I4R B;  2OVB A;  5C2Y A;  4APF A;  4AOF A;  3ZW3 A;  4TV3 A;  2R5S A;  3CEQ A;  4IN3 B;  4C0M A;  5CCM A;  4ABN A;  2HR2 A;  4ACK A;  1XGW A;  3CQC B;  1OWM A;  3FUI A;  5C1D A;  4KMO A;  2OVF A;  4MS6 A;  4LRZ A;  4ATG A;  5ANR A;  4BT8 A;  3OTN A;  2KM4 A;  3L17 A;  3O48 A;  3CVY A;  3ZN3 A;  4E6H A;  3TGO A;  4XI0 A;  5J08 A;  2YQ8 A;  4EEC A;  4J8F A;  3RU0 A;  1JPL A;  4PUC A;  4BWR A;  3CVP A;  3PZD A;  2X6K A;  2YHE A;  3ASH A;  3B7T A;  3ZYQ A;  3FUN A;  4BX9 A;  4FAD A;  3CK7 A;  4I6E A;  1UJK A;  4RG6 A;  3ZHE B;  4I2W A;  2X3M A;  3GZ1 A;  2L0I A;  4PDX A;  4FUL A;  3MV3 B;  3ZGQ A;  2OV8 A;  3AU4 A;  4BTA A;  3EIJ A;  5FWQ A;  1QNF A;  2I1J A;  4IUL A;  5JHA A;  3LXU X;  2VSN A;  3VLD A;  3UT7 A;  4E85 A;  2LNI A;  2WMN A;  2WVI A;  1KLX A;  3LEW A;  4HOR A;  2FF4 A;  2PZI A;  3FU6 A;  4AJW A;  2MHK A;  4H7X A;  1Y8M A;  4B89 A;  5ARF A;  3SBT B;  3FUM A;  2VSY A;  3GYZ A;  2HO1 A;  5BNW A;  3S7B A;  3JCK C;  3QKY A;  1UW4 B;  3I3N A;  3ONL A;  5KJN A;  3CKB A;  2AW6 A;  5ANL A;  4DJA A;  2DBA A;  3ASG A;  3CHQ A;  3ML8 A;  3QK0 A;  2OND A;  5BV0 A;  5FQ6 A;  2KCL A;  4XKB A;  5A23 A;  2C0L A;  1EDU A;  3IBE A;  2VTB A;  1OWO A;  1UN8 A;  2WXG A;  3FTY A;  5KCM A;  3ZHE A;  3QWV A;  4GB9 A;  3U4T A;  1EF1 C;  3ENE A;  4A1G A;  1H2V C;  5AIJ A;  3MYV A;  3VLE A;  1EYH A;  2J4D A;  2GGF A;  2AVP A;  3CIA A;  4O6F A;  3ULQ A;  4DLO A;  5EDS A;  2YNQ A;  2CHW A;  2E2E A;  4PH4 B;  4MKT A;  4GA2 A;  5G04 C;  1Z3X A;  2ION A;  5EX3 A;  4HOT A;  4CCA A;  4U0U A;  3ASD A;  3T8M A;  2C2L A;  3IV0 A;  3ZXS A;  4CGW A;  3FTX A;  3FUL A;  4Y6C A;  1U3C A;  2L0T B;  3D9K A;  4HFG A;  3TL5 A;  4AEZ C;  2R17 C;  4Q69 A;  4GZ3 A;  3OAW A;  2A5U A;  2NXP A;  4BTB A;  3B7U X;  3APD A;  2FBN A;  2WQ6 A;  3PRE A;  1KT0 A;  3L54 A;  2M63 A;  1Z3Y A;  2J08 A;  4PS3 A;  5FT9 A;  4WWN A;  2JLB A;  3D9J A;  3D9P A;  5A7D B;  3UT4 A;  4C9B B;  1N54 A;  3E4B A;  3FTV A;  4I1A A;  3IEG A;  4A55 A;  1HZ4 A;  1NA0 A;  2WXL A;  3G2W A;  4FLH A;  4GYY A;  4ILG A;  4K03 A;  2V0P A;  4DK5 A;  3P2B A;  2WQH A;  4J0U A;  3L6A A;  3R7Q A;  5LX8 A;  1NA3 A;  1P5Q A;  3MCX A;  1KT1 A;  1XNF A;  3VLF A;  5DIZ A;  1GW6 A;  2KC7 A;  5LFA A;  4F53 A;  2OOE A;  2AWI A;  3CHS A;  3MJW A;  3HHM A;  1FVF A;  2X6F A;  2CHZ A;  2XRY A;  4GZC A;  4JZY A;  4KXK B;  2WB2 A;  4MRU A;  5CCL A;  4W9R A;  4I1M A;  3EHN A;  1JWF A;  3FUJ A;  3CQG B;  3RK6 A;  3ASF A;  3HIZ A;  3MV2 B;  4MLP A;  4DI3 A;  3CVL A;  4GZ5 A;  4OVU A;  2BF0 X;  4JC8 A;  1HU3 A;  2MRI A;  2PM7 A;  4RG9 A;  3CVN A;  2YHC A;  3KS2 A;  1E7U A;  5KJL A;  4UI9 J;  3Q47 B;  3P1U A;  4YVQ C;  1DNP A;  3CR3 A;  3JYS A;  1FVH A;  2EQX A;  3FTU A;  5BT1 A;  3QJZ A;  5AEN A;  3ESK A;  4BFR A;  4GCO A;  3CLJ A;  3LY7 A;  3QWP A;  4HVB A;  4EQF A;  5LCW J;  2HYZ A;  3BG0 B;  5JJT A;  2XGM A;  2C0M A;  4JHR A;  4JEH A;  4FA6 A;  1OUV A;  4N5C A;  1H2U A;  2Y4T A;  5DBK A;  2I9C A;  5T4Y A;  4WNF A;  4A3V A;  3FY4 A;  1W3B A;  5FZS A;  4J8E A;  3SF4 A;  4NQ0 A;  3G2S A;  4AVX A;  3ESL A;  3JQ1 A;  3FTS A;  4JPS A;  3TXM A;  3APF A;  3MKR A;  3HYM B;  2E0I A;  2KAT A;  2DIW A;  3IHY A;  4UQX A;  1NZN A;  3I4G A;  3CK9 A;  4Q94 A;  4U07 A;  1E90 A;  3MKQ B;  2V5F A;  3PE3 A;  2XCB A;  4WNE A;  4URK A;  2QFC A;  5T3R A;  3DPD A;  3T5V A;  3NF1 A;  4J8D A;  4PS7 A;  1MHQ A;  3GW4 A;  5BV1 A;  3AS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...