1E96B

Structure of the rac/p67phox complex
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
185
structure length
185
Chain Sequence
SLVEAISLWNEGVLAADKKDWKGALDAFSAVQDPHSRICFNIGCMYTILKNMTEAEKAFTRSINRDKHLAVAYFQRGMLYYQTEKYDLAIKDLKEALIQLRGNQLIDYKILGLQFKLFACEVLYNIAFMYAKKEEWKKAEEQLALATSMKSEPRHSKIDKAMECVWKQKLYEPVVIPVGKLFRPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Tpr Domain of P67Phox in Complex with Rac.GTP
pubmed rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 1
total genus 71
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2000-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1e96B00
3CKCA 2AVPA 1ZU2A 2XCBA 3MV3B 2P58C 3RIBA 2C0LA 2E2EA 3K9IA 2HYZA 4N3AA 1HH8A 2OOEA 4I9EA 3Q5MA 4U0ZA 3CK8A 4RG6A 3RU0A 3ZFWA 4CGVA 5M72A 1B89A 3CVLA 3SZ7A 2VSYA 3KD7A 3FP3A 4LEUA 3KAEA 1ELWA 4N3BA 4I2ZA 5G05J 1PC2A 2LSUA 2I6HA 4IN3B 2VSNA 5HQ8A 5KJMA 2KATA 1P5QA 1FCHA 4G1TA 4BT9A 2BUGA 3GZ1A 4N3CA 4HOSA 4I17A 2XPIA 3CVQA 3IEGA 4U0UA 3S7BA 5CHEE 1QZ2A 4YVOA 4U07A 1YA0A 4F3VA 5EKQD 2ONDA 4I9CA 3ZPJA 2V5FA 5BT1A 1NA0A 2YHCA 3CK9A 4RG9A 2GW1A 5EX0A 3LY7A 5G04C 5KJNA 2PQRA 1A17A 2IF4A 2UY1A 2UWJG 4O6FA 4XI9A 5DIZA 3UPVA 5KJKA 3FFLA 2KCKA 4CDRA 4J8DA 2C0MA 5KJLA 1KT0A 1IYGA 1KLXA 3S7JA 5D0OD 5ARFA 4UQYA 4ABNA 4JHRA 2J9QA 3OXGA 3TGOA 4WNGA 4Y6CA 3LKUA 4U0SA 1QQEA 3QWWA 5AYWD 2QFCA 2VGYA 3CVPA 4W9RA 3RO3A 3TG4A 4HOQA 3URZA 3TAXA 3PE3A 4UI9C 1NZNA 4GPKA 4J8EA 3BEEA 1IHGA 3EDTB 4GYWA 3CV0A 3QWPA 2R5SA 4GZ3A 5BNWA 3HYMB 2Y4UA 3E4BA 3R9AB 4N2SA 4BTAA 4AM9A 5LCWC 5BW8C 2FF4A 3U3WA 4N2QA 2XGOA 2XGSA 3NF1A 3O48A 4JA7A 3GYZA 4BTBA 3MA5A 2XCCA 4A1SA 5FZQA 3ASDA 2L6JA 3ZN3A 5FZRA 3ZGQA 2KC7A 2WQHA 2FI7A 2LNIA 3GW4A 2WPVA 3GZ2A 1ZBPA 3UQ3A 1HZ4A 2PL2A 3WXXA 2VGXB 4WUYA 3ZHEA 4AY6A 2VQ2A 4AY5A 4J8FA 1OUVA 4CGWA 4HOTA 3S7FA 4GZ6A 4GYOA 5C1DA 5FZSA 5JJ7A 4B94A 2Q7FA 2Y4TA 4KYOB 2C2LA 4HOUA 1W3BA 3MV2B 4H7YA 3U4TA 4EQFA 3TG5A 2VGXA 3MEKA 4YVQC 4JL0A 3JYSA 4GA2A 4WNDA 3CKBA 1KT1A 3ASFA 3MKRA 1Y8MA 3CK7A 3Q47B 3RO2A 3ULQA 3LCAA 4HORA 5CCLA 3ZHEB 2FBNA 3KS2A 4I1AA 3VTYA 3PDNA 2YQ8A 4WNFA 4ME2A 3ASHA 2VYIA 3AS8A 3FWVA 3QOUA 2HO1A 4G26A 4XIFA 5G05C 3VTXA 5JJTA 2FEZA 4KXKB 1WM5A 4UQXA 3Q4AB 3RJVA 5FTPA 2FO7A 2KCLA 2MHKA 4JA9A 4NRHB 4N5CA 3OXLA 4XI0A 5JJ6A 3Q49B 3CEQA 2NC9A 3LY9A 5CCMA 5G04J 4NQ0A 4YNDA 5LCWJ 4G25A 1HXIA 1TJCA 5D0QD 4WNEA 3LPZA 3CVNA 4H7XA 2JLBA 5DBKA 4GYYA 4U04A 4G24A 3QDNA 5EX3A 3S7DA 2PQNA 3RKVA 4UI9K 4APOA 4AIFA 4KBQA 4UQZA 4BWRA 4N39A 5A7DB 3ESKA 2KCVA 5A6CA 1XNFA 3AS5A 3OXFA 4Y6WA 3Q15A 3AS4A 3QKYA 2IFUA 2PZIA 4G2VA 4GCOA 4J0UA 4UI9J 2LSVA 3LY8A 5FJYA 5ARGA 4G23A 2HR2A 3QWVA 3SF4A 3UUXA 5FT9A 2DBAA 1ELRA 2XEVA 3ASGA 2XGMA 5HI7A 4GA0A 4GA1A 3N71A 2UY1B 3LYAA 1E96B 1NA3A 4I2WA 4GCNA 4BT8A 3PE4A 4GZ5A 1WAO1
chains in the Genus database with same CATH superfamily
2OOEA 5CRUA 4LSZE 3V31A 2VSOE 2VTBA 1P5QA 3HVEA 5FQ7A 2WXKA 2ETBA 3ABKE 1FPPA 1RW2A 1Z5SC 4GTPA 5JHBA 5FINA 1OWMA 4B89A 1KLXA 2IU1A 2RFMA 3AU5A 4U0SA 3L82A 3DPYA 2WXPA 3BEEA 4DI3A 3HYMB 4CT0A 2FF4A 4G11A 3LJNA 4UWGA 2B6CA 1E7UA 3LDZA 3O4ZA 5ENTD 3FUNA 4HOUA 3EIQC 4ABNA 1U3DA 3DSWA 2VGEA 3FUHA 3Q79A 4A55A 3CQGB 4BERA 4GTOA 1OCOE 3W9GA 1PAQA 3C98A 4UWFA 1HO8A 3EU5A 3NOGD 3RKVA 4ZHBA 4UQZA 3KEZA 5A7DB 1FVHA 5ARGA 4XKBA 4TXQA 4BT8A 1JCRA 5CEAA 1UJKA 2R05A 5M72A 3FP3A 2XPZA 1HX8A 2AWIA 4I43A 5CBNA 1E90A 3B95A 5EKQD 1N9AA 5EX0A 5AIJA 3L17A 4CDRA 4K5AB 1KT0A 3TGOA 4ANXA 3AG1E 3QWWA 3E33A 1IHGA 1TR4A 3FU0A 3D9IA 5BW8C 2DYRE 3U3WA 5E75A 5BPPA 1K3ZD 3MA5A 3ZN3A 4IYPA 1TN8A 1HG5A 2P2CP 1U2VG 2KXPC 4L2YA 3QNKA 3CVUA 1Y8MA 3JUIA 3HXFA 4I1AA 4FJZA 3IKOB 1JPLA 4K03A 4I6GA 3QOUA 3VTXA 5AARA 4UQXA 3PUJA 2KCLA 3X2QE 4K5CA 3Q49B 3T8KA 3FTUA 2WXRA 4NQ0A 2I9CA 1EYHA 4U04A 2PQNA 2KZTA 4CT4A 3UINC 3UX4A 4J0UA 3TWWA 3SF4A 3CVVA 3ZKJA 2WQ7A 3BG0B 3U66A 4U0ZA 3FTWA 2R59A 3MCXA 3LVQE 3TWTA 1G3NB 3PRZA 5EIBE 3ONLA 4I17A 3CVQA 2F0YA 2WXNA 4F1SA 2ONDA 3BQOA 3CK9A 3Q9NC 3QARA 2J4BA 1VDYA 2YINA 4F6RD 3CQCB 3SHFA 2R02A 2EIKE 3CVPA 3ABME 4FP7A 4BX8A 2IOSA 3CV0A 3FEXA 2Y4UA 3RRUA 3FHEA 4L7TA 4EBAG 5KWDA 2WQHA 4DLOA 1UOHA 2WPVA 2LAHA 3NB2A 2ZXWE 1OT8A 5JJ7A 3FEYA 4C0MA 4EZJA 4H7YA 3UIPC 4BFRA 3FUJA 4GU5A 4JPSA 3E32A 3ULQA 3CHSA 1JWGA 5HRYA 4U7EB 4JXTA 4ANWA 3CHQA 1A5EA 2GRMA 2X6JA 1H6KA 3TXMA 2WXMA 3UKUG 5A6CA 3APFA 3AAAC 1QNFA 5CMYA 3CR3A 3G2WA 4GCNA 4PH4B 3EHNA 3I5PA 4EECA 1N4PA 2XZDG 4GAAA 1B89A 2IJGX 1TYQG 5G05J 2LSUA 1YCSB 5FQ8A 1O1RA 3S2AA 4ANUA 4GTMA 4L23A 1AP7A 3S7BA 3FUDA 1BLXB 2XS8A 4UQYA 3UXGA 3Q73A 3RRMB 5AQBA 3HXBA 5T3RA 1LTXA 4N2SA 4GTSA 4JA7A 1IQUA 3V79K 1H6PA 3DEPA 3MJWA 2WXJA 2P9UG 4YDYA 4BESA 4E85A 2J08A 2Y4TA 4TV3A 1H2TC 3Q47B 2XRYA 1Y6IA 1XGWA 2RD0A 4ME2A 3FWVA 1TN6A 1OCCE 3MX3A 4LERA 1BPOA 4AXHA 4ACLA 1U3CA 2X38A 3OXLA 3E30A 3CEQA 3BUAA 3DSUA 1H2VC 4GYYA 3QDNA 4GTQA 4UI9K 2PZIA 4L1BA 1MJ0A 4WAFA 3N71A 1NA3A 2XZTG 1D9SA 3Q9UC 2ZGDA 1PC2A 2F37A 4LCTA 1DCEA 4HRLA 1L5JA 4YVOA 3SBSA 1YA0A 5CECB 5CEDB 3EHRA 2YHCA 2X6HA 3EU9A 3OAWA 5ENSD 1UN8A 2UWJG 4HFGA 4G8LA 5AJDA 1EPUA 2C0MA 3U9WA 2CHZA 3FH7A 4K0RA 2VGYA 4OYSA 3L9TA 4DLQA 3Q75A 1O1TA 2I2OA 4HNAD 2AXUA 2L6JA 5CBOA 3FTXA 4MRUA 4AY6A 4YDWA 4K5BA 4J8YA 4AVXA 4YVQC 4WNDA 4BETA 2CG2A 3L6AA 2Y1LE 3LCAA 2FBNA 4FHKA 4A3TA 3EHQA 3Q7FA 3RJVA 2FO7A 2MHKA 3WXXA 3ZFWA 5G04J 4YNDA 3HRAA 3ZYKA 1LD8A 2A5EA 3C3RA 1E8YA 3IHVA 2JABA 3ONKA 4AIFA 3LVRE 1KZOA 4E6HA 4ATZD 4GCOA 3FTYA 2IY0C 4GZDA 2VTBB 4PUCA 4ILGA 4FJYA 1HH8A 3Q5MA 3DSSA 3ZEFA 2GRPB 5KBAA 1EDUA 3PNTB 3CVYA 2F8XK 3G2UA 3D9PA 4EHMA 3ML9A 1HU3A 2VJ8A 3NBNB 1E8WA 3R7QA 3PH0C 4OVVA 4F7AA 1E7VA 2CHWA 5ARFA 2P9LG 4HOQA 2MYOA 4GPMA 1N11A 1N4RA 4JC8A 2WMOA 1NP7A 2LXLA 4FA6A 3E4BA 1HE8A 3ZXPA 4N2QA 4HB5A 3RAUA 5AQ9A 3JUEA 1WY6A 2NSZA 2DYSE 5A23A 2HE0A 3PZ2A 3S7FA 3HXDA 5ENQD 3CSTA 3PEVB 4TXRA 2EQXA 2AJAA 2L6BA 1IQRA 3P1UA 4JZYA 4HBDA 4UUCA 3ASHA 2VYIA 4G26A 5FTPA 4NRHB 4HOTA 2LXMA 5AQ7A 2NC9A 5CCMA 3CVNA 4H7XA 1SA5A 3UT8A 2V8SE 2JLBA 5DBKA 4EZLA 3S7DA 4APOA 3T5XA 2XEHA 3OXFA 2IFUA 3PZ3A 2PM6A 4B94A 4KYOB 3MV3B 4DX2A 3F6QA 2BTDA 4I9EA 3CK8A 5EYLA 1NFIE 4CDNA 4IN3B 5KNGA 4HXIA 5B3SE 4EPZA 3FTSA 3IEGA 1QZ2A 1MYOA 1SZ9A 2PQRA 1OWPA 4RLYA 4J8DA 2J9QA 3TG4A 3PE3A 4GYWA 4KZCA 4TRQA 3UMVA 4BTAA 4ILIA 3FUEA 1SVXA 4BEPA 4DJAA 5FZQA 2WXLA 1INZA 3ASDA 4A63B 3MGBA 3G2TA 5H7PA 4WWNA 4AOFA 4WUYA 4MBGA 5BV0A 1OY3D 3IHYA 3TWVA 5EILA 4TXPA 4JL0A 4XZ4A 2AXZA 4U8YD 4HI9A 5JJ6A 4OAUC 5LCWJ 1ZB1A 3E37A 3J5PA 4GTTA 4BWRA 5B1BE 2KCVA 5D0OD 1LF8A 4ANVA 3RO3A 3QWVA 1AWCB 2X6IA 4I2WA 3FH5A 4GZ5A 2XCBA 3RIBA 1ELWA 5JMND 1OWLA 2I6HA 3FTZA 2R17C 2R03A 3G2VA 3ABLE 4DX1A 4U0UA 5CHEE 4U07A 4ACKA 4DX7D 2DVWA 2IF4A 1TNBA 2ZU6B 3QK0A 5ENRD 4BSXA 1YYHA 3OXGA 3E34A 4W9RA 3ASNE 3FUMA 5D66A 1Q2ZA 4RVBA 1BU9A 4B0ZA 5AAOA 3HVEB 5AENA 4HRNA 3NF1A 4UWKA 3DSTA 5D2MC 3CVWA 1N4SA 3C5RA 3MYVA 4TUMA 2VGXB 1YMPA 3OTNA 2OVFA 4J8FA 5C1DA 4GYOA 2OEWA 4V3IA 3JQ0A 5BUZA 3ZHEB 4U8VD 3AG2E 2HO1A 3MZLB 5BXUA 3FU6A 2A4ZA 4ATGA 1IHBA 4G25A 3ISMC 4WNEA 2QYUA 5AJLA 4B8CB 4L9PA 5HS0A 4PS7A 1Z3XA 2V0PA 3AS4A 3IXEA 2LSVA 3SY2A 2DBAA 2KM4A 3ASGA 5HI7A 3SZ7A 3Q78A 3PS6A 5G55A 4MS6A 5KNHD 2VSYA 2EINE 2KBXA 4N3BA 2F8YA 3D9OA 4DPRA 4G1TA 3U64A 4MLPA 3EHMA 3UI2A 3ZYMA 2WXGA 3CVXA 5J90A 2GW1A 3B7BA 5DIZA 4BX9A 3UPVA 5KJLA 1JCQA 3UTMA 1SQMA 2Y3AA 5AYWD 3FUKA 1TJFA 4CEMA 4J7WA 3ULYA 4AM9A 2CG3A 1UN9A 3ML8A 3SD5A 3SBTB 3GZ2A 2PL2A 3ZHEA 4CCAA 4LRZA 3GZSA 1OUVA 1HS6A 3B7SA 4CDMA 2RKKA 4AV7A 3ZXSA 3RU0A 3KS2A 2YQ8A 4FLHA 3D9JA 3SO8A 4B93B 4IRUA 2XS1A 2RG8A 4YDOA 2OVBA 2V4LA 4OVUA 2NYJA 4I6JA 3RRNB 4N39A 4Y6WA 1N95A 1MHQA 5BV1A 4KVMA 5FT9A 1ELRA 1QBQA 3NOCD 2XGMA 4TUUA 4HLEA 1WAO1 4FU3A 3CKCA 1WDYA 2E2EA 1D8DA 4LNGA 2J09A 1K1AA 1H2UA 1FCHA 1MX6A 5LP0A 2X3MA 3P2BA 1UW4B 4U8HA 4F3VA 3EJNA 3ZPJA 2ZISA 5CRVA 5BT1A 3B7UX 2P9NG 4C0EA 2A5UA 2XPYA 4O6FA 1EF1C 3FFLA 2IEJA 3AG4E 3TWRA 4JHRA 1DCQA 5T4YA 3DWLG 4GPKA 4KZ0A 1NZNA 3I4RB 3FTVA 2R5SA 5BNWA 2L0TB 3MKQB 3R9AB 3L08A 3R7RA 2PNNA 2OEVA 5ANLA 1IKND 4LG6A 5CERB 3FY4A 4J8SA 3SNXA 1ZBPA 2DZOA 3UQ3A 2YHEA 1S70B 4GMLA 3CIAA 3IBEA 5EDSA 4JVSA 3VLEA 3CKBA 2IO3C 4HORA 4I1MA 2P9PG 2I1JA 5EYPF 5EIDA 3AS8A 4XKCA 3ZNGA 3FULA 5JJTA 5ITZF 4EQFA 3TWUA 5D0QD 1MX2A 1H19A 3ZW3A 5HQ8A 4FC8A 5EX3A 4KBQA 3ASOE 3CHOA 4PS8A 3ZYLA 5LX8A 3Q15A 3VLDA 2XRZA 1JUQA 1Z3YA 2CFZA 4M3OA 5T8IA 4BT9A 2AXVA 5C2YA 3FUFA 2AVPA 1ZU2A 2P58C 4J6IA 1KZPA 1N94A 2ILRA 1RZ4A 1HF8A 4RG6A 3CVLA 2H6GA 3CLJA 3AU4A 5LOZA 2XQ0A 3SFYA 2WMNA 4N3CA 2XENA 3KEAA 3D9HA 3J5QB 3HXCA 5BXOA 3L54A 5B1AE 4L2LA 4I9CA 4CRWA 1A17A 4OAVB 3HIZA 3QJZA 2Y0BG 4YDEA 3S7JA 3PREA 1QQEA 4N5QA 1E8ZA 3EDTB 3QWPA 3I3NA 3PZ4A 3GYZA 1FVFA 2FI7A 2QC9A 3FH8A 2V4HC 3EIJA 2EIJE 2WQ6A 2RFAA 3D3MA 1BI8B 3RO2A 3FUIA 5CMWA 4GMRA 1N0QA 5FQ6A 4AJWA 2WVIA 4BSZB 1TNOA 4HRMB 3CGHA 3UUXA 4G2VA 3DRAA 1TNYA 3LYAA 2BEDA 4MKTA 3SFXA 4NACA 3UT4A 2XHEA 3JCKC 3DPDA 3QAQA 4GZCA 3BU8A 3B13A 4G8KA 5ENNA 1FT2A 3GZ1A 2WXQA 2LO6A 4FADA 1QYMA 2V5FA 4XEIG 3NQPA 5G04C 3CHRA 2P9KG 3ZUVB 1WG0A 3LKUA 1KPSB 4UI9C 4DRXE 4JB8P 4GZ3A 1TNUA 3APCA 2VSXE 5LCWC 4PS3A 2XGSA 3DSVA 3ZGQA 4Q96A 4GZ6A 3SI5A 4XX5A 2LAIA 3D9MA 3TG5A 3JYSA 4GA2A 1SA4A 2MRIA 1X81A 5CCLA 4AEZC 4D10C 3RK6A 5FWQA 4ZFHA 1OCRE 1NI1A 5ANRA 2FEZA 1WM5A 3DBSA 5FIOA 1Z6TA 3ZRHA 4A3VA 4Q69A 2KZTB 3L13A 4JD2G 4NURA 3ESKA 2DCPA 4O60A 1ELKA 2HR2A 5AN8A 3DXKG 4RQIA 4X8QA 3LS8A 1JWFA 1S64A 2H6FA 3UM0A 4I1OB 4KMOA 3NZUA 3ZU7B 1N0RA 1D8EA 3CHMA 5JHAA 3DSXA 5E76A 2WB2A 3TL5A 2XPIA 4QQIA 1TEZA 1O5MA 4RG9A 3UM2A 3LY7A 2IO2C 1OXJA 2CHXA 3ZIMA 5ENPD 2MOWA 1MQSA 4Y6CA 2QFCA 2V5QC 3DXMG 5G2NA 3TWSA 4RSYA 3SFZA 3C72A 4GTVA 3HDXA 4A1SA 5FQ4A 4HLLA 4U95D 5FZRA 4CZ2D 3PVLA 3GW4A 5EN5D 3WG7E 2P9SG 2IQCA 4AY5A 1N4QA 1DC2A 3HG0D 2J07A 3W9FA 3L22A 3PUKA 3TWXA 2H6IA 2YNQA 4BY6A 2FULA 2VGXA 4JHJA 2CFUA 3TWQA 5HKPA 2B0OE 2WXHA 4O1PA 4CYMD 3PDNA 4WNFA 1UG3A 4NIKA 3APDA 3RSEG 4PDXA 3B7TA 4QFVA 2IOLA 4EZKA 1H0AA 2BF0X 2ETAA 4APFA 1XNFA 1N54A 4UI9J 4GTRA 4Q94A 4HQDA 2WXIA 2I1KA 3PZDA 2DWZA 4I6EA 4LNUD 2HYZA 3ENEA 3KD7A 2ZGGA 3I4GA 3UT7A 4DX6D 2GRLA 2QZAA 1HG2A 4DK5A 4XI9A 1OWOA 5KJKA 2P9IG 2AW6A 1E8XA 3UM1A 3V2OA 3URZA 3TAXA 3C3QA 1K8KG 3Q7AA 3FU5A 5AQAA 2R2LA 2XEEA 3TXNA 2X6KA 2ZIRA 2XGOA 4IULA 3SGHA 1BD8A 2LNIA 3CHPA 1HZ4A 3EUVA 3SQVA 4DI4A 4CGWA 1GW6A 3DEOA 3V2XA 4HS2A 3KSQA 2Q7FA 3U4TA 2FO1E 3ASFA 4EBAA 2Y69E 2BKKB 1DNPA 2GRRB 1N52A 1O1SA 4Z68A 4KXKB 5JA4D 4HOSA 4JA9A 1TJCA 3PEUB 4HI8A 2DIWA 4G24A 2BKGA 2L9BA 3QKYA 1MZCA 3UKRG 4U63A 2XEVA 2UY1B 4DX5D 4P29A 2OV8A 5KCMA 4R7LA 4C48B 3VLFA 3IV0A 4F1PA 5KJMA 2KATA 1HFAA 3L16A 4KVOA 4GB9A 1IXVA 2BUGA 4DUIA 4KT6B 2WXOA 2JEKA 2PM7A 4JEHA 1NA0A 3UIOC 3ULEG 4U96D 2UY1A 3JQ1A 2L0IA 2KCKA 5IY5E 4HVBA 2DZNA 4JW1A 3PNLB 2X6FA 4J8EA 1V54E 2WM9A 3CSFA 3FU3A 2NXPA 5ENOD 2GROB 5J08A 4BTBA 4UWHA 2KC7A 2GRQB 4LUNU 2H6HA 4FULA 3V30A 2VQ2A 5FZSA 4WWOA 1W3BA 3MV2B 4WWPA 1TN7A 3PZ1A 3MKRA 3KSLA 1OWNA 2HM8A 4M7CA 4XIFA 3Q4AB 3ZVVA 4XI0A 3T8MA 3TJPA 3AJIA 1HXIA 3LPZA 3AG3E 3R9MA 2J49A 3QB2A 4FLBA 4AP2A 3AS5A 1H6OA 5FJYA 1DVPA 1X5BA 2J8SD 4G23A 3T5VA 3C3OA 1E96B 3ZYQA 1SZAA 4C9BB 2C0LA 3K9IA 4N3AA 2LUHA 4LNBA 4CGVA 3JXIA 3B7RL 2WXFA 4XE0A 4LEUA 3KAEA 4UWLA 3UM3A 3NZSA 4I2ZA 2VSNA 1UJJA 2EILE 4A1GA 2IONA 2OCCE 2GRNB 2GGFA 1S63A 2J4DA 3NAWA 4B8AA 5KJNA 3LJ3A 4GMJA 3ESLA 1IYGA 1MX4A 4WNGA 1S0PA 2E0IA 1JCSA 3T9KA 3LEWA 3JXJA 2QY7A 4ILHB 3O48A 1LD7A 2XCCA 2QYJA 4JEUA 3D9NA 1K1BA 4F53A 4JHKA 2M63A 2C2LA 3BG1B 3QC1A 3HHMA 1OCZE 3MEKA 1KT1A 3MKQA 3CK7A 3G2SA 1NL4A 1TNZA 3FDHA 3VTYA 5G05C 3HXEA 4O1OA 2EIME 4N5CA 5LFAA 3LY9A 4URKA 1SW6A 3D9LA 2ETCA 1V55E 3D9KA 3LXUX 1BI7B 1PY1A 3LY8A 1FT1A 4GA0A 4GA1A 4FHJA 3PE4A
chains in the Genus database with same CATH topology
3PS6A 2OOEA 4I1OB 5G55A 4MS6A 2VSYA 4KMOA 4N3BA 2VSOE 3NZUA 1PC2A 2VTBA 3D9OA 3CHMA 4DPRA 1P5QA 5JHAA 4G1TA 5E76A 2WB2A 3U64A 4MLPA 4LCTA 3TL5A 3HVEA 5FQ7A 2XPIA 3EHMA 1L5JA 2WXKA 4YVOA 3SBSA 1TEZA 1YA0A 3ZYMA 2WXGA 3CVXA 5J90A 2YHCA 4RG9A 2GW1A 2X6HA 3LY7A 3OAWA 1UN8A 2UWJG 4HFGA 5DIZA 4BX9A 3UPVA 5AJDA 5JHBA 1EPUA 1OWMA 2C0MA 3U9WA 4B89A 5KJLA 2CHXA 1KLXA 3ZIMA 2CHZA 2IU1A 2MOWA 3AU5A 3FH7A 1MQSA 1SQMA 2Y3AA 4Y6CA 4U0SA 4K0RA 5AYWD 2QFCA 2VGYA 4OYSA 5G2NA 2WXPA 3FUKA 3BEEA 4DI3A 1TJFA 4CEMA 4FHJA 3HYMB 4DLQA 4CT0A 4AM9A 2FF4A 4RSYA 2CG3A 1UN9A 2I2OA 3SFZA 4G11A 3HDXA 4A1SA 2AXUA 3ML8A 5FQ4A 2L6JA 4UWGA 5FZRA 1E7UA 3SD5A 3PVLA 3FTXA 3GW4A 3SBTB 3GZ2A 2PL2A 4MRUA 3ZHEA 4AY6A 4CCAA 4LRZA 2IQCA 3GZSA 4AY5A 3LDZA 1OUVA 3O4ZA 2J07A 3L22A 3FUNA 3PUKA 4HOUA 1HS6A 3B7SA 4AVXA 4CDMA 2YNQA 4BY6A 2FULA 2VGXA 4AV7A 4YVQC 3EIQC 4WNDA 3RU0A 2CG2A 2CFUA 3L6AA 1U3DA 4JHJA 3ZXSA 4ABNA 3LCAA 2WXHA 2FBNA 3KS2A 3FUHA 4FHKA 3PDNA 2YQ8A 4WNFA 1UG3A 4A3TA 4FLHA 3APDA 3D9JA 3RJVA 4A55A 2FO7A 2MHKA 3WXXA 3ZFWA 4PDXA 4IRUA 5G04J 3CQGB 4YNDA 3B7TA 2RG8A 3ZYKA 4QFVA 1PAQA 3C98A 2OVBA 2V4LA 1HO8A 2IOLA 4OVUA 4UWFA 4EZKA 1E8YA 3IHVA 1H0AA 3ONKA 3RKVA 4I6JA 4AIFA 4UQZA 3KEZA 2BF0X 3LVRE 3RRNB 4N39A 5A7DB 4E6HA 1FVHA 1XNFA 4APFA 1N54A 4Y6WA 4UI9J 4GCOA 1MHQA 5BV1A 4KVMA 5ARGA 4XKBA 3FTYA 4Q94A 5FT9A 1ELRA 2XGMA 2WXIA 2I1KA 3PZDA 4BT8A 4TUUA 4HLEA 1WAO1 4FU3A 3CKCA 4I6EA 4GZDA 2E2EA 2HYZA 2VTBB 4PUCA 4ILGA 4FJYA 1HH8A 3Q5MA 1UJKA 3ENEA 2J09A 5M72A 3ZEFA 3KD7A 3FP3A 1EDUA 2XPZA 1HX8A 2AWIA 1H2UA 3PNTB 1FCHA 5LP0A 3I4GA 3CVYA 3G2UA 2X3MA 3D9PA 3P2BA 3UT7A 4I43A 1UW4B 4U8HA 2GRLA 3ML9A 1HU3A 1E90A 2VJ8A 4F3VA 3EJNA 5EKQD 3ZPJA 5BT1A 3B7UX 1HG2A 5EX0A 5AIJA 1E8WA 3R7QA 4DK5A 3PH0C 2A5UA 2XPYA 4O6FA 3L17A 4OVVA 4XI9A 4C0EA 1OWOA 1EF1C 5KJKA 3FFLA 4CDRA 4F7AA 1KT0A 1E7VA 2AW6A 2CHWA 1E8XA 5ARFA 4JHRA 3TGOA 4ANXA 3QWWA 3URZA 5T4YA 4HOQA 3TAXA 4GPKA 1NZNA 4KZ0A 3I4RB 3FU5A 1IHGA 4JC8A 3FTVA 2WMOA 1NP7A 2R5SA 3D9IA 3FU0A 2L0TB 4FA6A 3E4BA 3MKQB 3R9AB 3L08A 3R7RA 1HE8A 3TXNA 2X6KA 5BW8C 3U3WA 4N2QA 2XGOA 5E75A 5ANLA 5BPPA 3MA5A 4IULA 3ZN3A 3FY4A 4J8SA 3SGHA 2LNIA 3SNXA 4IYPA 1WY6A 1ZBPA 2NSZA 1HZ4A 3CHPA 3UQ3A 2YHEA 1HG5A 5A23A 4DI4A 4CGWA 1GW6A 3S7FA 4HS2A 4GMLA 2Q7FA 3CIAA 3IBEA 4L2YA 5EDSA 3U4TA 3QNKA 4JVSA 3CVUA 3VLEA 3CKBA 3ASFA 3CSTA 1Y8MA 4EBAA 4HORA 4I1MA 2I1JA 3PEVB 2EQXA 3JUIA 1IQRA 1DNPA 4I1AA 3P1UA 4FJZA 3IKOB 4JZYA 1JPLA 4K03A 3ASHA 1N52A 2VYIA 3AS8A 3QOUA 4I6GA 4G26A 4XKCA 3VTXA 3FULA 5JJTA 4KXKB 4UQXA 3PUJA 5FTPA 4EQFA 2KCLA 4JA9A 4NRHB 4HOSA 4HOTA 3Q49B 2NC9A 3FTUA 5CCMA 2WXRA 4NQ0A 2I9CA 1TJCA 3PEUB 5D0QD 3CVNA 4H7XA 1EYHA 3UT8A 1H19A 2V8SE 2JLBA 5DBKA 4EZLA 3ZW3A 2DIWA 4U04A 5HQ8A 4FC8A 4G24A 5EX3A 3S7DA 2PQNA 4APOA 3T5XA 4KBQA 3CHOA 2KZTA 4PS8A 4CT4A 3ZYLA 2L9BA 3OXFA 5LX8A 3Q15A 3QKYA 3VLDA 2IFUA 2XRZA 3UX4A 1JUQA 1Z3YA 4J0UA 4U63A 2CFZA 4M3OA 3SF4A 3CVVA 5T8IA 2PM6A 2XEVA 4BT9A 2WQ7A 2AXVA 2UY1B 4B94A 5C2YA 3FUFA 4KYOB 4P29A 2AVPA 1ZU2A 3MV3B 2P58C 2OV8A 5KCMA 3BG0B 2BTDA 4J6IA 4R7LA 2ILRA 3U66A 4U0ZA 4I9EA 3FTWA 1HF8A 3CK8A 4RG6A 2R59A 3MCXA 3CVLA 3LVQE 3VLFA 3IV0A 3CLJA 3AU4A 3PRZA 4IN3B 4CDNA 5LOZA 5KJMA 2XQ0A 2KATA 1HFAA 4HXIA 3L16A 4KVOA 2WMNA 2BUGA 4GB9A 4N3CA 3FTSA 4EPZA 3ONLA 4I17A 4KT6B 3CVQA 3IEGA 3L54A 2WXOA 1QZ2A 4L2LA 2WXNA 4F1SA 2ONDA 2JEKA 4I9CA 2PM7A 4JEHA 1NA0A 3CK9A 4CRWA 1SZ9A 2PQRA 1A17A 1OWPA 2UY1A 3JQ1A 2L0IA 2J4BA 1VDYA 2YINA 3QARA 2KCKA 3HIZA 3CQCB 4J8DA 3QJZA 3S7JA 3SHFA 4HVBA 2J9QA 3PREA 1QQEA 3TG4A 3CVPA 4JW1A 3PNLB 3PE3A 2X6FA 4J8EA 2WM9A 3CSFA 3FU3A 1E8ZA 3EDTB 2IOSA 4FP7A 3CV0A 4GYWA 4BX8A 3FEXA 3QWPA 4KZCA 2Y4UA 2NXPA 4TRQA 3RRUA 3UMVA 3FHEA 3I3NA 4ILIA 4BTAA 4L7TA 3FUEA 4EBAG 5J08A 3GYZA 4BTBA 4DJAA 1FVFA 5FZQA 2WXLA 1INZA 3ASDA 4UWHA 2KC7A 2WQHA 2FI7A 3MGBA 4DLOA 2WPVA 3G2TA 2LAHA 4LUNU 4WWNA 4AOFA 4WUYA 4FULA 2VQ2A 5BV0A 3FH8A 3EIJA 3IHYA 5FZSA 5JJ7A 3FEYA 4C0MA 4WWOA 1W3BA 3MV2B 4EZJA 4H7YA 4WWPA 4BFRA 2WQ6A 3FUJA 3D3MA 4JL0A 4XZ4A 2AXZA 4GU5A 4JPSA 3MKRA 3RO2A 3ULQA 3CHSA 1JWGA 1OWNA 3FUIA 2HM8A 5CMWA 4JXTA 4ANWA 4XIFA 3CHQA 3Q4AB 3ZVVA 4XI0A 5JJ6A 3T8MA 5FQ6A 3TJPA 2WVIA 4AJWA 2GRMA 5LCWJ 1HXIA 2X6JA 3LPZA 1H6KA 2J49A 3QB2A 4BWRA 3TXMA 4FLBA 2KCVA 2WXMA 3CGHA 4AP2A 5A6CA 3AS5A 3APFA 1LF8A 4G2VA 5D0OD 5FJYA 3RO3A 1DVPA 3UUXA 4ANVA 1X5BA 4G23A 3QWVA 2X6IA 1QNFA 5CMYA 3T5VA 3CR3A 4I2WA 3FH5A 3G2WA 1E96B 3LYAA 1SZAA 4GCNA 4PH4B 3ZYQA 4GZ5A 4C9BB 2XCBA 4MKTA 3EHNA 3I5PA 4EECA 4NACA 3RIBA 2C0LA 3K9IA 4N3AA 4GAAA 4CGVA 3UT4A 3B7RL 2XHEA 1B89A 2WXFA 3JCKC 3DPDA 3QAQA 4XE0A 2IJGX 4LEUA 4GZCA 3KAEA 1ELWA 4UWLA 3NZSA 4I2ZA 1OWLA 5G05J 3B13A 2LSUA 2I6HA 3FTZA 2VSNA 5ENNA 1UJJA 2R17C 5FQ8A 4A1GA 2IONA 3G2VA 2GGFA 3S2AA 4ANUA 3GZ1A 2J4DA 4L23A 2WXQA 4U0UA 5CHEE 3S7BA 2LO6A 3FUDA 4U07A 4FADA 4B8AA 2V5FA 4ACKA 3NQPA 5G04C 5KJNA 3CHRA 2IF4A 3LJ3A 4GMJA 3ESLA 2ZU6B 1IYGA 3QK0A 4UQYA 4BSXA 3OXGA 4WNGA 3LKUA 1S0PA 4W9RA 2E0IA 3FUMA 4UI9C 4RVBA 3LEWA 3RRMB 4B0ZA 4GZ3A 3APCA 5T3RA 2VSXE 3HVEB 5AENA 4N2SA 5LCWC 2QY7A 4ILHB 2XGSA 1IQUA 3NF1A 3O48A 4JA7A 4PS3A 4UWKA 3CVWA 2XCCA 3MJWA 4JEUA 3ZGQA 3D9NA 2WXJA 3MYVA 2VGXB 3OTNA 2OVFA 4Q96A 4J8FA 4F53A 5C1DA 4GZ6A 4GYOA 3SI5A 4E85A 2J08A 2Y4TA 4XX5A 4JHKA 2M63A 2C2LA 3BG1B 2LAIA 3D9MA 3QC1A 4V3IA 1H2TC 3HHMA 4TV3A 3MEKA 3TG5A 3JYSA 4GA2A 3Q47B 1KT1A 2XRYA 3G2SA 3CK7A 1Y6IA 1XGWA 2RD0A 2MRIA 3JQ0A 3MKQA 5BUZA 4AEZC 5CCLA 3ZHEB 4D10C 3FDHA 3RK6A 3VTYA 5FWQA 4ME2A 3FWVA 2HO1A 3MX3A 5G05C 3MZLB 5ANRA 4LERA 2FEZA 1BPOA 1WM5A 4AXHA 3FU6A 4ACLA 2A4ZA 4N5CA 1U3CA 2X38A 3OXLA 3DBSA 4ATGA 3CEQA 3LY9A 5LFAA 4URKA 3D9LA 4G25A 1Z6TA 4WNEA 5AJLA 3ZRHA 4A3VA 4Q69A 4B8CB 2KZTB 1H2VC 3L13A 4GYYA 3QDNA 4UI9K 3D9KA 3LXUX 3ESKA 4NURA 4PS7A 1Z3XA 5BNWA 2V0PA 1PY1A 2DCPA 3AS4A 2PZIA 1ELKA 2LSVA 3LY8A 4L1BA 2HR2A 4WAFA 2DBAA 2KM4A 3ASGA 5HI7A 3SZ7A 4GA0A 4GA1A 3N71A 1NA3A 3LS8A 3PE4A 1JWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CKC A;  2AVP A;  1ZU2 A;  2XCB A;  3MV3 B;  2P58 C;  3RIB A;  2C0L A;  2E2E A;  3K9I A;  2HYZ A;  4N3A A;  1HH8 A;  2OOE A;  4I9E A;  3Q5M A;  4U0Z A;  3CK8 A;  4RG6 A;  3RU0 A;  3ZFW A;  4CGV A;  5M72 A;  1B89 A;  3CVL A;  3SZ7 A;  2VSY A;  3KD7 A;  3FP3 A;  4LEU A;  3KAE A;  1ELW A;  4N3B A;  4I2Z A;  5G05 J;  1PC2 A;  2LSU A;  2I6H A;  4IN3 B;  2VSN A;  5HQ8 A;  5KJM A;  2KAT A;  1P5Q A;  1FCH A;  4G1T A;  4BT9 A;  2BUG A;  3GZ1 A;  4N3C A;  4HOS A;  4I17 A;  2XPI A;  3CVQ A;  3IEG A;  4U0U A;  3S7B A;  5CHE E;  1QZ2 A;  4YVO A;  4U07 A;  1YA0 A;  4F3V A;  5EKQ D;  2OND A;  4I9C A;  3ZPJ A;  2V5F A;  5BT1 A;  1NA0 A;  2YHC A;  3CK9 A;  4RG9 A;  2GW1 A;  5EX0 A;  3LY7 A;  5G04 C;  5KJN A;  2PQR A;  1A17 A;  2IF4 A;  2UY1 A;  2UWJ G;  4O6F A;  4XI9 A;  5DIZ A;  3UPV A;  5KJK A;  3FFL A;  2KCK A;  4CDR A;  4J8D A;  2C0M A;  5KJL A;  1KT0 A;  1IYG A;  1KLX A;  3S7J A;  5D0O D;  5ARF A;  4UQY A;  4ABN A;  4JHR A;  2J9Q A;  3OXG A;  3TGO A;  4WNG A;  4Y6C A;  3LKU A;  4U0S A;  1QQE A;  3QWW A;  5AYW D;  2QFC A;  2VGY A;  3CVP A;  4W9R A;  3RO3 A;  3TG4 A;  4HOQ A;  3URZ A;  3TAX A;  3PE3 A;  4UI9 C;  1NZN A;  4GPK A;  4J8E A;  3BEE A;  1IHG A;  3EDT B;  4GYW A;  3CV0 A;  3QWP A;  2R5S A;  4GZ3 A;  5BNW A;  3HYM B;  2Y4U A;  3E4B A;  3R9A B;  4N2S A;  4BTA A;  4AM9 A;  5LCW C;  5BW8 C;  2FF4 A;  3U3W A;  4N2Q A;  2XGO A;  2XGS A;  3NF1 A;  3O48 A;  4JA7 A;  3GYZ A;  4BTB A;  3MA5 A;  2XCC A;  4A1S A;  5FZQ A;  3ASD A;  2L6J A;  3ZN3 A;  5FZR A;  3ZGQ A;  2KC7 A;  2WQH A;  2FI7 A;  2LNI A;  3GW4 A;  2WPV A;  3GZ2 A;  1ZBP A;  3UQ3 A;  1HZ4 A;  2PL2 A;  3WXX A;  2VGX B;  4WUY A;  3ZHE A;  4AY6 A;  2VQ2 A;  4AY5 A;  4J8F A;  1OUV A;  4CGW A;  4HOT A;  3S7F A;  4GZ6 A;  4GYO A;  5C1D A;  5FZS A;  5JJ7 A;  4B94 A;  2Q7F A;  2Y4T A;  4KYO B;  2C2L A;  4HOU A;  1W3B A;  3MV2 B;  4H7Y A;  3U4T A;  4EQF A;  3TG5 A;  2VGX A;  3MEK A;  4YVQ C;  4JL0 A;  3JYS A;  4GA2 A;  4WND A;  3CKB A;  1KT1 A;  3ASF A;  3MKR A;  1Y8M A;  3CK7 A;  3Q47 B;  3RO2 A;  3ULQ A;  3LCA A;  4HOR A;  5CCL A;  3ZHE B;  2FBN A;  3KS2 A;  4I1A A;  3VTY A;  3PDN A;  2YQ8 A;  4WNF A;  4ME2 A;  3ASH A;  2VYI A;  3AS8 A;  3FWV A;  3QOU A;  2HO1 A;  4G26 A;  4XIF A;  5G05 C;  3VTX A;  5JJT A;  2FEZ A;  4KXK B;  1WM5 A;  4UQX A;  3Q4A B;  3RJV A;  5FTP A;  2FO7 A;  2KCL A;  2MHK A;  4JA9 A;  4NRH B;  4N5C A;  3OXL A;  4XI0 A;  5JJ6 A;  3Q49 B;  3CEQ A;  2NC9 A;  3LY9 A;  5CCM A;  5G04 J;  4NQ0 A;  4YND A;  5LCW J;  4G25 A;  1HXI A;  1TJC A;  5D0Q D;  4WNE A;  3LPZ A;  3CVN A;  4H7X A;  2JLB A;  5DBK A;  4GYY A;  4U04 A;  4G24 A;  3QDN A;  5EX3 A;  3S7D A;  2PQN A;  3RKV A;  4UI9 K;  4APO A;  4AIF A;  4KBQ A;  4UQZ A;  4BWR A;  4N39 A;  5A7D B;  3ESK A;  2KCV A;  5A6C A;  1XNF A;  3AS5 A;  3OXF A;  4Y6W A;  3Q15 A;  3AS4 A;  3QKY A;  2IFU A;  2PZI A;  4G2V A;  4GCO A;  4J0U A;  4UI9 J;  2LSV A;  3LY8 A;  5FJY A;  5ARG A;  4G23 A;  2HR2 A;  3QWV A;  3SF4 A;  3UUX A;  5FT9 A;  2DBA A;  1ELR A;  2XEV A;  3ASG A;  2XGM A;  5HI7 A;  4GA0 A;  4GA1 A;  3N71 A;  2UY1 B;  3LYA A;  1E96 B;  1NA3 A;  4I2W A;  4GCN A;  4BT8 A;  3PE4 A;  4GZ5 A;  1WAO 1; 
#chains in the Genus database with same CATH topology
 2OOE A;  5CRU A;  4LSZ E;  3V31 A;  2VSO E;  2VTB A;  1P5Q A;  3HVE A;  5FQ7 A;  2WXK A;  2ETB A;  3ABK E;  1FPP A;  1RW2 A;  1Z5S C;  4GTP A;  5JHB A;  5FIN A;  1OWM A;  4B89 A;  1KLX A;  2IU1 A;  2RFM A;  3AU5 A;  4U0S A;  3L82 A;  3DPY A;  2WXP A;  3BEE A;  4DI3 A;  3HYM B;  4CT0 A;  2FF4 A;  4G11 A;  3LJN A;  4UWG A;  2B6C A;  1E7U A;  3LDZ A;  3O4Z A;  5ENT D;  3FUN A;  4HOU A;  3EIQ C;  4ABN A;  1U3D A;  3DSW A;  2VGE A;  3FUH A;  3Q79 A;  4A55 A;  3CQG B;  4BER A;  4GTO A;  1OCO E;  3W9G A;  1PAQ A;  3C98 A;  4UWF A;  1HO8 A;  3EU5 A;  3NOG D;  3RKV A;  4ZHB A;  4UQZ A;  3KEZ A;  5A7D B;  1FVH A;  5ARG A;  4XKB A;  4TXQ A;  4BT8 A;  1JCR A;  5CEA A;  1UJK A;  2R05 A;  5M72 A;  3FP3 A;  2XPZ A;  1HX8 A;  2AWI A;  4I43 A;  5CBN A;  1E90 A;  3B95 A;  5EKQ D;  1N9A A;  5EX0 A;  5AIJ A;  3L17 A;  4CDR A;  4K5A B;  1KT0 A;  3TGO A;  4ANX A;  3AG1 E;  3QWW A;  3E33 A;  1IHG A;  1TR4 A;  3FU0 A;  3D9I A;  5BW8 C;  2DYR E;  3U3W A;  5E75 A;  5BPP A;  1K3Z D;  3MA5 A;  3ZN3 A;  4IYP A;  1TN8 A;  1HG5 A;  2P2C P;  1U2V G;  2KXP C;  4L2Y A;  3QNK A;  3CVU A;  1Y8M A;  3JUI A;  3HXF A;  4I1A A;  4FJZ A;  3IKO B;  1JPL A;  4K03 A;  4I6G A;  3QOU A;  3VTX A;  5AAR A;  4UQX A;  3PUJ A;  2KCL A;  3X2Q E;  4K5C A;  3Q49 B;  3T8K A;  3FTU A;  2WXR A;  4NQ0 A;  2I9C A;  1EYH A;  4U04 A;  2PQN A;  2KZT A;  4CT4 A;  3UIN C;  3UX4 A;  4J0U A;  3TWW A;  3SF4 A;  3CVV A;  3ZKJ A;  2WQ7 A;  3BG0 B;  3U66 A;  4U0Z A;  3FTW A;  2R59 A;  3MCX A;  3LVQ E;  3TWT A;  1G3N B;  3PRZ A;  5EIB E;  3ONL A;  4I17 A;  3CVQ A;  2F0Y A;  2WXN A;  4F1S A;  2OND A;  3BQO A;  3CK9 A;  3Q9N C;  3QAR A;  2J4B A;  1VDY A;  2YIN A;  4F6R D;  3CQC B;  3SHF A;  2R02 A;  2EIK E;  3CVP A;  3ABM E;  4FP7 A;  4BX8 A;  2IOS A;  3CV0 A;  3FEX A;  2Y4U A;  3RRU A;  3FHE A;  4L7T A;  4EBA G;  5KWD A;  2WQH A;  4DLO A;  1UOH A;  2WPV A;  2LAH A;  3NB2 A;  2ZXW E;  1OT8 A;  5JJ7 A;  3FEY A;  4C0M A;  4EZJ A;  4H7Y A;  3UIP C;  4BFR A;  3FUJ A;  4GU5 A;  4JPS A;  3E32 A;  3ULQ A;  3CHS A;  1JWG A;  5HRY A;  4U7E B;  4JXT A;  4ANW A;  3CHQ A;  1A5E A;  2GRM A;  2X6J A;  1H6K A;  3TXM A;  2WXM A;  3UKU G;  5A6C A;  3APF A;  3AAA C;  1QNF A;  5CMY A;  3CR3 A;  3G2W A;  4GCN A;  4PH4 B;  3EHN A;  3I5P A;  4EEC A;  1N4P A;  2XZD G;  4GAA A;  1B89 A;  2IJG X;  1TYQ G;  5G05 J;  2LSU A;  1YCS B;  5FQ8 A;  1O1R A;  3S2A A;  4ANU A;  4GTM A;  4L23 A;  1AP7 A;  3S7B A;  3FUD A;  1BLX B;  2XS8 A;  4UQY A;  3UXG A;  3Q73 A;  3RRM B;  5AQB A;  3HXB A;  5T3R A;  1LTX A;  4N2S A;  4GTS A;  4JA7 A;  1IQU A;  3V79 K;  1H6P A;  3DEP A;  3MJW A;  2WXJ A;  2P9U G;  4YDY A;  4BES A;  4E85 A;  2J08 A;  2Y4T A;  4TV3 A;  1H2T C;  3Q47 B;  2XRY A;  1Y6I A;  1XGW A;  2RD0 A;  4ME2 A;  3FWV A;  1TN6 A;  1OCC E;  3MX3 A;  4LER A;  1BPO A;  4AXH A;  4ACL A;  1U3C A;  2X38 A;  3OXL A;  3E30 A;  3CEQ A;  3BUA A;  3DSU A;  1H2V C;  4GYY A;  3QDN A;  4GTQ A;  4UI9 K;  2PZI A;  4L1B A;  1MJ0 A;  4WAF A;  3N71 A;  1NA3 A;  2XZT G;  1D9S A;  3Q9U C;  2ZGD A;  1PC2 A;  2F37 A;  4LCT A;  1DCE A;  4HRL A;  1L5J A;  4YVO A;  3SBS A;  1YA0 A;  5CEC B;  5CED B;  3EHR A;  2YHC A;  2X6H A;  3EU9 A;  3OAW A;  5ENS D;  1UN8 A;  2UWJ G;  4HFG A;  4G8L A;  5AJD A;  1EPU A;  2C0M A;  3U9W A;  2CHZ A;  3FH7 A;  4K0R A;  2VGY A;  4OYS A;  3L9T A;  4DLQ A;  3Q75 A;  1O1T A;  2I2O A;  4HNA D;  2AXU A;  2L6J A;  5CBO A;  3FTX A;  4MRU A;  4AY6 A;  4YDW A;  4K5B A;  4J8Y A;  4AVX A;  4YVQ C;  4WND A;  4BET A;  2CG2 A;  3L6A A;  2Y1L E;  3LCA A;  2FBN A;  4FHK A;  4A3T A;  3EHQ A;  3Q7F A;  3RJV A;  2FO7 A;  2MHK A;  3WXX A;  3ZFW A;  5G04 J;  4YND A;  3HRA A;  3ZYK A;  1LD8 A;  2A5E A;  3C3R A;  1E8Y A;  3IHV A;  2JAB A;  3ONK A;  4AIF A;  3LVR E;  1KZO A;  4E6H A;  4ATZ D;  4GCO A;  3FTY A;  2IY0 C;  4GZD A;  2VTB B;  4PUC A;  4ILG A;  4FJY A;  1HH8 A;  3Q5M A;  3DSS A;  3ZEF A;  2GRP B;  5KBA A;  1EDU A;  3PNT B;  3CVY A;  2F8X K;  3G2U A;  3D9P A;  4EHM A;  3ML9 A;  1HU3 A;  2VJ8 A;  3NBN B;  1E8W A;  3R7Q A;  3PH0 C;  4OVV A;  4F7A A;  1E7V A;  2CHW A;  5ARF A;  2P9L G;  4HOQ A;  2MYO A;  4GPM A;  1N11 A;  1N4R A;  4JC8 A;  2WMO A;  1NP7 A;  2LXL A;  4FA6 A;  3E4B A;  1HE8 A;  3ZXP A;  4N2Q A;  4HB5 A;  3RAU A;  5AQ9 A;  3JUE A;  1WY6 A;  2NSZ A;  2DYS E;  5A23 A;  2HE0 A;  3PZ2 A;  3S7F A;  3HXD A;  5ENQ D;  3CST A;  3PEV B;  4TXR A;  2EQX A;  2AJA A;  2L6B A;  1IQR A;  3P1U A;  4JZY A;  4HBD A;  4UUC A;  3ASH A;  2VYI A;  4G26 A;  5FTP A;  4NRH B;  4HOT A;  2LXM A;  5AQ7 A;  2NC9 A;  5CCM A;  3CVN A;  4H7X A;  1SA5 A;  3UT8 A;  2V8S E;  2JLB A;  5DBK A;  4EZL A;  3S7D A;  4APO A;  3T5X A;  2XEH A;  3OXF A;  2IFU A;  3PZ3 A;  2PM6 A;  4B94 A;  4KYO B;  3MV3 B;  4DX2 A;  3F6Q A;  2BTD A;  4I9E A;  3CK8 A;  5EYL A;  1NFI E;  4CDN A;  4IN3 B;  5KNG A;  4HXI A;  5B3S E;  4EPZ A;  3FTS A;  3IEG A;  1QZ2 A;  1MYO A;  1SZ9 A;  2PQR A;  1OWP A;  4RLY A;  4J8D A;  2J9Q A;  3TG4 A;  3PE3 A;  4GYW A;  4KZC A;  4TRQ A;  3UMV A;  4BTA A;  4ILI A;  3FUE A;  1SVX A;  4BEP A;  4DJA A;  5FZQ A;  2WXL A;  1INZ A;  3ASD A;  4A63 B;  3MGB A;  3G2T A;  5H7P A;  4WWN A;  4AOF A;  4WUY A;  4MBG A;  5BV0 A;  1OY3 D;  3IHY A;  3TWV A;  5EIL A;  4TXP A;  4JL0 A;  4XZ4 A;  2AXZ A;  4U8Y D;  4HI9 A;  5JJ6 A;  4OAU C;  5LCW J;  1ZB1 A;  3E37 A;  3J5P A;  4GTT A;  4BWR A;  5B1B E;  2KCV A;  5D0O D;  1LF8 A;  4ANV A;  3RO3 A;  3QWV A;  1AWC B;  2X6I A;  4I2W A;  3FH5 A;  4GZ5 A;  2XCB A;  3RIB A;  1ELW A;  5JMN D;  1OWL A;  2I6H A;  3FTZ A;  2R17 C;  2R03 A;  3G2V A;  3ABL E;  4DX1 A;  4U0U A;  5CHE E;  4U07 A;  4ACK A;  4DX7 D;  2DVW A;  2IF4 A;  1TNB A;  2ZU6 B;  3QK0 A;  5ENR D;  4BSX A;  1YYH A;  3OXG A;  3E34 A;  4W9R A;  3ASN E;  3FUM A;  5D66 A;  1Q2Z A;  4RVB A;  1BU9 A;  4B0Z A;  5AAO A;  3HVE B;  5AEN A;  4HRN A;  3NF1 A;  4UWK A;  3DST A;  5D2M C;  3CVW A;  1N4S A;  3C5R A;  3MYV A;  4TUM A;  2VGX B;  1YMP A;  3OTN A;  2OVF A;  4J8F A;  5C1D A;  4GYO A;  2OEW A;  4V3I A;  3JQ0 A;  5BUZ A;  3ZHE B;  4U8V D;  3AG2 E;  2HO1 A;  3MZL B;  5BXU A;  3FU6 A;  2A4Z A;  4ATG A;  1IHB A;  4G25 A;  3ISM C;  4WNE A;  2QYU A;  5AJL A;  4B8C B;  4L9P A;  5HS0 A;  4PS7 A;  1Z3X A;  2V0P A;  3AS4 A;  3IXE A;  2LSV A;  3SY2 A;  2DBA A;  2KM4 A;  3ASG A;  5HI7 A;  3SZ7 A;  3Q78 A;  3PS6 A;  5G55 A;  4MS6 A;  5KNH D;  2VSY A;  2EIN E;  2KBX A;  4N3B A;  2F8Y A;  3D9O A;  4DPR A;  4G1T A;  3U64 A;  4MLP A;  3EHM A;  3UI2 A;  3ZYM A;  2WXG A;  3CVX A;  5J90 A;  2GW1 A;  3B7B A;  5DIZ A;  4BX9 A;  3UPV A;  5KJL A;  1JCQ A;  3UTM A;  1SQM A;  2Y3A A;  5AYW D;  3FUK A;  1TJF A;  4CEM A;  4J7W A;  3ULY A;  4AM9 A;  2CG3 A;  1UN9 A;  3ML8 A;  3SD5 A;  3SBT B;  3GZ2 A;  2PL2 A;  3ZHE A;  4CCA A;  4LRZ A;  3GZS A;  1OUV A;  1HS6 A;  3B7S A;  4CDM A;  2RKK A;  4AV7 A;  3ZXS A;  3RU0 A;  3KS2 A;  2YQ8 A;  4FLH A;  3D9J A;  3SO8 A;  4B93 B;  4IRU A;  2XS1 A;  2RG8 A;  4YDO A;  2OVB A;  2V4L A;  4OVU A;  2NYJ A;  4I6J A;  3RRN B;  4N39 A;  4Y6W A;  1N95 A;  1MHQ A;  5BV1 A;  4KVM A;  5FT9 A;  1ELR A;  1QBQ A;  3NOC D;  2XGM A;  4TUU A;  4HLE A;  1WAO 1;  4FU3 A;  3CKC A;  1WDY A;  2E2E A;  1D8D A;  4LNG A;  2J09 A;  1K1A A;  1H2U A;  1FCH A;  1MX6 A;  5LP0 A;  2X3M A;  3P2B A;  1UW4 B;  4U8H A;  4F3V A;  3EJN A;  3ZPJ A;  2ZIS A;  5CRV A;  5BT1 A;  3B7U X;  2P9N G;  4C0E A;  2A5U A;  2XPY A;  4O6F A;  1EF1 C;  3FFL A;  2IEJ A;  3AG4 E;  3TWR A;  4JHR A;  1DCQ A;  5T4Y A;  3DWL G;  4GPK A;  4KZ0 A;  1NZN A;  3I4R B;  3FTV A;  2R5S A;  5BNW A;  2L0T B;  3MKQ B;  3R9A B;  3L08 A;  3R7R A;  2PNN A;  2OEV A;  5ANL A;  1IKN D;  4LG6 A;  5CER B;  3FY4 A;  4J8S A;  3SNX A;  1ZBP A;  2DZO A;  3UQ3 A;  2YHE A;  1S70 B;  4GML A;  3CIA A;  3IBE A;  5EDS A;  4JVS A;  3VLE A;  3CKB A;  2IO3 C;  4HOR A;  4I1M A;  2P9P G;  2I1J A;  5EYP F;  5EID A;  3AS8 A;  4XKC A;  3ZNG A;  3FUL A;  5JJT A;  5ITZ F;  4EQF A;  3TWU A;  5D0Q D;  1MX2 A;  1H19 A;  3ZW3 A;  5HQ8 A;  4FC8 A;  5EX3 A;  4KBQ A;  3ASO E;  3CHO A;  4PS8 A;  3ZYL A;  5LX8 A;  3Q15 A;  3VLD A;  2XRZ A;  1JUQ A;  1Z3Y A;  2CFZ A;  4M3O A;  5T8I A;  4BT9 A;  2AXV A;  5C2Y A;  3FUF A;  2AVP A;  1ZU2 A;  2P58 C;  4J6I A;  1KZP A;  1N94 A;  2ILR A;  1RZ4 A;  1HF8 A;  4RG6 A;  3CVL A;  2H6G A;  3CLJ A;  3AU4 A;  5LOZ A;  2XQ0 A;  3SFY A;  2WMN A;  4N3C A;  2XEN A;  3KEA A;  3D9H A;  3J5Q B;  3HXC A;  5BXO A;  3L54 A;  5B1A E;  4L2L A;  4I9C A;  4CRW A;  1A17 A;  4OAV B;  3HIZ A;  3QJZ A;  2Y0B G;  4YDE A;  3S7J A;  3PRE A;  1QQE A;  4N5Q A;  1E8Z A;  3EDT B;  3QWP A;  3I3N A;  3PZ4 A;  3GYZ A;  1FVF A;  2FI7 A;  2QC9 A;  3FH8 A;  2V4H C;  3EIJ A;  2EIJ E;  2WQ6 A;  2RFA A;  3D3M A;  1BI8 B;  3RO2 A;  3FUI A;  5CMW A;  4GMR A;  1N0Q A;  5FQ6 A;  4AJW A;  2WVI A;  4BSZ B;  1TNO A;  4HRM B;  3CGH A;  3UUX A;  4G2V A;  3DRA A;  1TNY A;  3LYA A;  2BED A;  4MKT A;  3SFX A;  4NAC A;  3UT4 A;  2XHE A;  3JCK C;  3DPD A;  3QAQ A;  4GZC A;  3BU8 A;  3B13 A;  4G8K A;  5ENN A;  1FT2 A;  3GZ1 A;  2WXQ A;  2LO6 A;  4FAD A;  1QYM A;  2V5F A;  4XEI G;  3NQP A;  5G04 C;  3CHR A;  2P9K G;  3ZUV B;  1WG0 A;  3LKU A;  1KPS B;  4UI9 C;  4DRX E;  4JB8 P;  4GZ3 A;  1TNU A;  3APC A;  2VSX E;  5LCW C;  4PS3 A;  2XGS A;  3DSV A;  3ZGQ A;  4Q96 A;  4GZ6 A;  3SI5 A;  4XX5 A;  2LAI A;  3D9M A;  3TG5 A;  3JYS A;  4GA2 A;  1SA4 A;  2MRI A;  1X81 A;  5CCL A;  4AEZ C;  4D10 C;  3RK6 A;  5FWQ A;  4ZFH A;  1OCR E;  1NI1 A;  5ANR A;  2FEZ A;  1WM5 A;  3DBS A;  5FIO A;  1Z6T A;  3ZRH A;  4A3V A;  4Q69 A;  2KZT B;  3L13 A;  4JD2 G;  4NUR A;  3ESK A;  2DCP A;  4O60 A;  1ELK A;  2HR2 A;  5AN8 A;  3DXK G;  4RQI A;  4X8Q A;  3LS8 A;  1JWF A;  1S64 A;  2H6F A;  3UM0 A;  4I1O B;  4KMO A;  3NZU A;  3ZU7 B;  1N0R A;  1D8E A;  3CHM A;  5JHA A;  3DSX A;  5E76 A;  2WB2 A;  3TL5 A;  2XPI A;  4QQI A;  1TEZ A;  1O5M A;  4RG9 A;  3UM2 A;  3LY7 A;  2IO2 C;  1OXJ A;  2CHX A;  3ZIM A;  5ENP D;  2MOW A;  1MQS A;  4Y6C A;  2QFC A;  2V5Q C;  3DXM G;  5G2N A;  3TWS A;  4RSY A;  3SFZ A;  3C72 A;  4GTV A;  3HDX A;  4A1S A;  5FQ4 A;  4HLL A;  4U95 D;  5FZR A;  4CZ2 D;  3PVL A;  3GW4 A;  5EN5 D;  3WG7 E;  2P9S G;  2IQC A;  4AY5 A;  1N4Q A;  1DC2 A;  3HG0 D;  2J07 A;  3W9F A;  3L22 A;  3PUK A;  3TWX A;  2H6I A;  2YNQ A;  4BY6 A;  2FUL A;  2VGX A;  4JHJ A;  2CFU A;  3TWQ A;  5HKP A;  2B0O E;  2WXH A;  4O1P A;  4CYM D;  3PDN A;  4WNF A;  1UG3 A;  4NIK A;  3APD A;  3RSE G;  4PDX A;  3B7T A;  4QFV A;  2IOL A;  4EZK A;  1H0A A;  2BF0 X;  2ETA A;  4APF A;  1XNF A;  1N54 A;  4UI9 J;  4GTR A;  4Q94 A;  4HQD A;  2WXI A;  2I1K A;  3PZD A;  2DWZ A;  4I6E A;  4LNU D;  2HYZ A;  3ENE A;  3KD7 A;  2ZGG A;  3I4G A;  3UT7 A;  4DX6 D;  2GRL A;  2QZA A;  1HG2 A;  4DK5 A;  4XI9 A;  1OWO A;  5KJK A;  2P9I G;  2AW6 A;  1E8X A;  3UM1 A;  3V2O A;  3URZ A;  3TAX A;  3C3Q A;  1K8K G;  3Q7A A;  3FU5 A;  5AQA A;  2R2L A;  2XEE A;  3TXN A;  2X6K A;  2ZIR A;  2XGO A;  4IUL A;  3SGH A;  1BD8 A;  2LNI A;  3CHP A;  1HZ4 A;  3EUV A;  3SQV A;  4DI4 A;  4CGW A;  1GW6 A;  3DEO A;  3V2X A;  4HS2 A;  3KSQ A;  2Q7F A;  3U4T A;  2FO1 E;  3ASF A;  4EBA A;  2Y69 E;  2BKK B;  1DNP A;  2GRR B;  1N52 A;  1O1S A;  4Z68 A;  4KXK B;  5JA4 D;  4HOS A;  4JA9 A;  1TJC A;  3PEU B;  4HI8 A;  2DIW A;  4G24 A;  2BKG A;  2L9B A;  3QKY A;  1MZC A;  3UKR G;  4U63 A;  2XEV A;  2UY1 B;  4DX5 D;  4P29 A;  2OV8 A;  5KCM A;  4R7L A;  4C48 B;  3VLF A;  3IV0 A;  4F1P A;  5KJM A;  2KAT A;  1HFA A;  3L16 A;  4KVO A;  4GB9 A;  1IXV A;  2BUG A;  4DUI A;  4KT6 B;  2WXO A;  2JEK A;  2PM7 A;  4JEH A;  1NA0 A;  3UIO C;  3ULE G;  4U96 D;  2UY1 A;  3JQ1 A;  2L0I A;  2KCK A;  5IY5 E;  4HVB A;  2DZN A;  4JW1 A;  3PNL B;  2X6F A;  4J8E A;  1V54 E;  2WM9 A;  3CSF A;  3FU3 A;  2NXP A;  5ENO D;  2GRO B;  5J08 A;  4BTB A;  4UWH A;  2KC7 A;  2GRQ B;  4LUN U;  2H6H A;  4FUL A;  3V30 A;  2VQ2 A;  5FZS A;  4WWO A;  1W3B A;  3MV2 B;  4WWP A;  1TN7 A;  3PZ1 A;  3MKR A;  3KSL A;  1OWN A;  2HM8 A;  4M7C A;  4XIF A;  3Q4A B;  3ZVV A;  4XI0 A;  3T8M A;  3TJP A;  3AJI A;  1HXI A;  3LPZ A;  3AG3 E;  3R9M A;  2J49 A;  3QB2 A;  4FLB A;  4AP2 A;  3AS5 A;  1H6O A;  5FJY A;  1DVP A;  1X5B A;  2J8S D;  4G23 A;  3T5V A;  3C3O A;  1E96 B;  3ZYQ A;  1SZA A;  4C9B B;  2C0L A;  3K9I A;  4N3A A;  2LUH A;  4LNB A;  4CGV A;  3JXI A;  3B7R L;  2WXF A;  4XE0 A;  4LEU A;  3KAE A;  4UWL A;  3UM3 A;  3NZS A;  4I2Z A;  2VSN A;  1UJJ A;  2EIL E;  4A1G A;  2ION A;  2OCC E;  2GRN B;  2GGF A;  1S63 A;  2J4D A;  3NAW A;  4B8A A;  5KJN A;  3LJ3 A;  4GMJ A;  3ESL A;  1IYG A;  1MX4 A;  4WNG A;  1S0P A;  2E0I A;  1JCS A;  3T9K A;  3LEW A;  3JXJ A;  2QY7 A;  4ILH B;  3O48 A;  1LD7 A;  2XCC A;  2QYJ A;  4JEU A;  3D9N A;  1K1B A;  4F53 A;  4JHK A;  2M63 A;  2C2L A;  3BG1 B;  3QC1 A;  3HHM A;  1OCZ E;  3MEK A;  1KT1 A;  3MKQ A;  3CK7 A;  3G2S A;  1NL4 A;  1TNZ A;  3FDH A;  3VTY A;  5G05 C;  3HXE A;  4O1O A;  2EIM E;  4N5C A;  5LFA A;  3LY9 A;  4URK A;  1SW6 A;  3D9L A;  2ETC A;  1V55 E;  3D9K A;  3LXU X;  1BI7 B;  1PY1 A;  3LY8 A;  1FT1 A;  4GA0 A;  4GA1 A;  4FHJ A;  3PE4 A; 
#chains in the Genus database with same CATH homology
 3PS6 A;  2OOE A;  4I1O B;  5G55 A;  4MS6 A;  2VSY A;  4KMO A;  4N3B A;  2VSO E;  3NZU A;  1PC2 A;  2VTB A;  3D9O A;  3CHM A;  4DPR A;  1P5Q A;  5JHA A;  4G1T A;  5E76 A;  2WB2 A;  3U64 A;  4MLP A;  4LCT A;  3TL5 A;  3HVE A;  5FQ7 A;  2XPI A;  3EHM A;  1L5J A;  2WXK A;  4YVO A;  3SBS A;  1TEZ A;  1YA0 A;  3ZYM A;  2WXG A;  3CVX A;  5J90 A;  2YHC A;  4RG9 A;  2GW1 A;  2X6H A;  3LY7 A;  3OAW A;  1UN8 A;  2UWJ G;  4HFG A;  5DIZ A;  4BX9 A;  3UPV A;  5AJD A;  5JHB A;  1EPU A;  1OWM A;  2C0M A;  3U9W A;  4B89 A;  5KJL A;  2CHX A;  1KLX A;  3ZIM A;  2CHZ A;  2IU1 A;  2MOW A;  3AU5 A;  3FH7 A;  1MQS A;  1SQM A;  2Y3A A;  4Y6C A;  4U0S A;  4K0R A;  5AYW D;  2QFC A;  2VGY A;  4OYS A;  5G2N A;  2WXP A;  3FUK A;  3BEE A;  4DI3 A;  1TJF A;  4CEM A;  4FHJ A;  3HYM B;  4DLQ A;  4CT0 A;  4AM9 A;  2FF4 A;  4RSY A;  2CG3 A;  1UN9 A;  2I2O A;  3SFZ A;  4G11 A;  3HDX A;  4A1S A;  2AXU A;  3ML8 A;  5FQ4 A;  2L6J A;  4UWG A;  5FZR A;  1E7U A;  3SD5 A;  3PVL A;  3FTX A;  3GW4 A;  3SBT B;  3GZ2 A;  2PL2 A;  4MRU A;  3ZHE A;  4AY6 A;  4CCA A;  4LRZ A;  2IQC A;  3GZS A;  4AY5 A;  3LDZ A;  1OUV A;  3O4Z A;  2J07 A;  3L22 A;  3FUN A;  3PUK A;  4HOU A;  1HS6 A;  3B7S A;  4AVX A;  4CDM A;  2YNQ A;  4BY6 A;  2FUL A;  2VGX A;  4AV7 A;  4YVQ C;  3EIQ C;  4WND A;  3RU0 A;  2CG2 A;  2CFU A;  3L6A A;  1U3D A;  4JHJ A;  3ZXS A;  4ABN A;  3LCA A;  2WXH A;  2FBN A;  3KS2 A;  3FUH A;  4FHK A;  3PDN A;  2YQ8 A;  4WNF A;  1UG3 A;  4A3T A;  4FLH A;  3APD A;  3D9J A;  3RJV A;  4A55 A;  2FO7 A;  2MHK A;  3WXX A;  3ZFW A;  4PDX A;  4IRU A;  5G04 J;  3CQG B;  4YND A;  3B7T A;  2RG8 A;  3ZYK A;  4QFV A;  1PAQ A;  3C98 A;  2OVB A;  2V4L A;  1HO8 A;  2IOL A;  4OVU A;  4UWF A;  4EZK A;  1E8Y A;  3IHV A;  1H0A A;  3ONK A;  3RKV A;  4I6J A;  4AIF A;  4UQZ A;  3KEZ A;  2BF0 X;  3LVR E;  3RRN B;  4N39 A;  5A7D B;  4E6H A;  1FVH A;  1XNF A;  4APF A;  1N54 A;  4Y6W A;  4UI9 J;  4GCO A;  1MHQ A;  5BV1 A;  4KVM A;  5ARG A;  4XKB A;  3FTY A;  4Q94 A;  5FT9 A;  1ELR A;  2XGM A;  2WXI A;  2I1K A;  3PZD A;  4BT8 A;  4TUU A;  4HLE A;  1WAO 1;  4FU3 A;  3CKC A;  4I6E A;  4GZD A;  2E2E A;  2HYZ A;  2VTB B;  4PUC A;  4ILG A;  4FJY A;  1HH8 A;  3Q5M A;  1UJK A;  3ENE A;  2J09 A;  5M72 A;  3ZEF A;  3KD7 A;  3FP3 A;  1EDU A;  2XPZ A;  1HX8 A;  2AWI A;  1H2U A;  3PNT B;  1FCH A;  5LP0 A;  3I4G A;  3CVY A;  3G2U A;  2X3M A;  3D9P A;  3P2B A;  3UT7 A;  4I43 A;  1UW4 B;  4U8H A;  2GRL A;  3ML9 A;  1HU3 A;  1E90 A;  2VJ8 A;  4F3V A;  3EJN A;  5EKQ D;  3ZPJ A;  5BT1 A;  3B7U X;  1HG2 A;  5EX0 A;  5AIJ A;  1E8W A;  3R7Q A;  4DK5 A;  3PH0 C;  2A5U A;  2XPY A;  4O6F A;  3L17 A;  4OVV A;  4XI9 A;  4C0E A;  1OWO A;  1EF1 C;  5KJK A;  3FFL A;  4CDR A;  4F7A A;  1KT0 A;  1E7V A;  2AW6 A;  2CHW A;  1E8X A;  5ARF A;  4JHR A;  3TGO A;  4ANX A;  3QWW A;  3URZ A;  5T4Y A;  4HOQ A;  3TAX A;  4GPK A;  1NZN A;  4KZ0 A;  3I4R B;  3FU5 A;  1IHG A;  4JC8 A;  3FTV A;  2WMO A;  1NP7 A;  2R5S A;  3D9I A;  3FU0 A;  2L0T B;  4FA6 A;  3E4B A;  3MKQ B;  3R9A B;  3L08 A;  3R7R A;  1HE8 A;  3TXN A;  2X6K A;  5BW8 C;  3U3W A;  4N2Q A;  2XGO A;  5E75 A;  5ANL A;  5BPP A;  3MA5 A;  4IUL A;  3ZN3 A;  3FY4 A;  4J8S A;  3SGH A;  2LNI A;  3SNX A;  4IYP A;  1WY6 A;  1ZBP A;  2NSZ A;  1HZ4 A;  3CHP A;  3UQ3 A;  2YHE A;  1HG5 A;  5A23 A;  4DI4 A;  4CGW A;  1GW6 A;  3S7F A;  4HS2 A;  4GML A;  2Q7F A;  3CIA A;  3IBE A;  4L2Y A;  5EDS A;  3U4T A;  3QNK A;  4JVS A;  3CVU A;  3VLE A;  3CKB A;  3ASF A;  3CST A;  1Y8M A;  4EBA A;  4HOR A;  4I1M A;  2I1J A;  3PEV B;  2EQX A;  3JUI A;  1IQR A;  1DNP A;  4I1A A;  3P1U A;  4FJZ A;  3IKO B;  4JZY A;  1JPL A;  4K03 A;  3ASH A;  1N52 A;  2VYI A;  3AS8 A;  3QOU A;  4I6G A;  4G26 A;  4XKC A;  3VTX A;  3FUL A;  5JJT A;  4KXK B;  4UQX A;  3PUJ A;  5FTP A;  4EQF A;  2KCL A;  4JA9 A;  4NRH B;  4HOS A;  4HOT A;  3Q49 B;  2NC9 A;  3FTU A;  5CCM A;  2WXR A;  4NQ0 A;  2I9C A;  1TJC A;  3PEU B;  5D0Q D;  3CVN A;  4H7X A;  1EYH A;  3UT8 A;  1H19 A;  2V8S E;  2JLB A;  5DBK A;  4EZL A;  3ZW3 A;  2DIW A;  4U04 A;  5HQ8 A;  4FC8 A;  4G24 A;  5EX3 A;  3S7D A;  2PQN A;  4APO A;  3T5X A;  4KBQ A;  3CHO A;  2KZT A;  4PS8 A;  4CT4 A;  3ZYL A;  2L9B A;  3OXF A;  5LX8 A;  3Q15 A;  3QKY A;  3VLD A;  2IFU A;  2XRZ A;  3UX4 A;  1JUQ A;  1Z3Y A;  4J0U A;  4U63 A;  2CFZ A;  4M3O A;  3SF4 A;  3CVV A;  5T8I A;  2PM6 A;  2XEV A;  4BT9 A;  2WQ7 A;  2AXV A;  2UY1 B;  4B94 A;  5C2Y A;  3FUF A;  4KYO B;  4P29 A;  2AVP A;  1ZU2 A;  3MV3 B;  2P58 C;  2OV8 A;  5KCM A;  3BG0 B;  2BTD A;  4J6I A;  4R7L A;  2ILR A;  3U66 A;  4U0Z A;  4I9E A;  3FTW A;  1HF8 A;  3CK8 A;  4RG6 A;  2R59 A;  3MCX A;  3CVL A;  3LVQ E;  3VLF A;  3IV0 A;  3CLJ A;  3AU4 A;  3PRZ A;  4IN3 B;  4CDN A;  5LOZ A;  5KJM A;  2XQ0 A;  2KAT A;  1HFA A;  4HXI A;  3L16 A;  4KVO A;  2WMN A;  2BUG A;  4GB9 A;  4N3C A;  3FTS A;  4EPZ A;  3ONL A;  4I17 A;  4KT6 B;  3CVQ A;  3IEG A;  3L54 A;  2WXO A;  1QZ2 A;  4L2L A;  2WXN A;  4F1S A;  2OND A;  2JEK A;  4I9C A;  2PM7 A;  4JEH A;  1NA0 A;  3CK9 A;  4CRW A;  1SZ9 A;  2PQR A;  1A17 A;  1OWP A;  2UY1 A;  3JQ1 A;  2L0I A;  2J4B A;  1VDY A;  2YIN A;  3QAR A;  2KCK A;  3HIZ A;  3CQC B;  4J8D A;  3QJZ A;  3S7J A;  3SHF A;  4HVB A;  2J9Q A;  3PRE A;  1QQE A;  3TG4 A;  3CVP A;  4JW1 A;  3PNL B;  3PE3 A;  2X6F A;  4J8E A;  2WM9 A;  3CSF A;  3FU3 A;  1E8Z A;  3EDT B;  2IOS A;  4FP7 A;  3CV0 A;  4GYW A;  4BX8 A;  3FEX A;  3QWP A;  4KZC A;  2Y4U A;  2NXP A;  4TRQ A;  3RRU A;  3UMV A;  3FHE A;  3I3N A;  4ILI A;  4BTA A;  4L7T A;  3FUE A;  4EBA G;  5J08 A;  3GYZ A;  4BTB A;  4DJA A;  1FVF A;  5FZQ A;  2WXL A;  1INZ A;  3ASD A;  4UWH A;  2KC7 A;  2WQH A;  2FI7 A;  3MGB A;  4DLO A;  2WPV A;  3G2T A;  2LAH A;  4LUN U;  4WWN A;  4AOF A;  4WUY A;  4FUL A;  2VQ2 A;  5BV0 A;  3FH8 A;  3EIJ A;  3IHY A;  5FZS A;  5JJ7 A;  3FEY A;  4C0M A;  4WWO A;  1W3B A;  3MV2 B;  4EZJ A;  4H7Y A;  4WWP A;  4BFR A;  2WQ6 A;  3FUJ A;  3D3M A;  4JL0 A;  4XZ4 A;  2AXZ A;  4GU5 A;  4JPS A;  3MKR A;  3RO2 A;  3ULQ A;  3CHS A;  1JWG A;  1OWN A;  3FUI A;  2HM8 A;  5CMW A;  4JXT A;  4ANW A;  4XIF A;  3CHQ A;  3Q4A B;  3ZVV A;  4XI0 A;  5JJ6 A;  3T8M A;  5FQ6 A;  3TJP A;  2WVI A;  4AJW A;  2GRM A;  5LCW J;  1HXI A;  2X6J A;  3LPZ A;  1H6K A;  2J49 A;  3QB2 A;  4BWR A;  3TXM A;  4FLB A;  2KCV A;  2WXM A;  3CGH A;  4AP2 A;  5A6C A;  3AS5 A;  3APF A;  1LF8 A;  4G2V A;  5D0O D;  5FJY A;  3RO3 A;  1DVP A;  3UUX A;  4ANV A;  1X5B A;  4G23 A;  3QWV A;  2X6I A;  1QNF A;  5CMY A;  3T5V A;  3CR3 A;  4I2W A;  3FH5 A;  3G2W A;  1E96 B;  3LYA A;  1SZA A;  4GCN A;  4PH4 B;  3ZYQ A;  4GZ5 A;  4C9B B;  2XCB A;  4MKT A;  3EHN A;  3I5P A;  4EEC A;  4NAC A;  3RIB A;  2C0L A;  3K9I A;  4N3A A;  4GAA A;  4CGV A;  3UT4 A;  3B7R L;  2XHE A;  1B89 A;  2WXF A;  3JCK C;  3DPD A;  3QAQ A;  4XE0 A;  2IJG X;  4LEU A;  4GZC A;  3KAE A;  1ELW A;  4UWL A;  3NZS A;  4I2Z A;  1OWL A;  5G05 J;  3B13 A;  2LSU A;  2I6H A;  3FTZ A;  2VSN A;  5ENN A;  1UJJ A;  2R17 C;  5FQ8 A;  4A1G A;  2ION A;  3G2V A;  2GGF A;  3S2A A;  4ANU A;  3GZ1 A;  2J4D A;  4L23 A;  2WXQ A;  4U0U A;  5CHE E;  3S7B A;  2LO6 A;  3FUD A;  4U07 A;  4FAD A;  4B8A A;  2V5F A;  4ACK A;  3NQP A;  5G04 C;  5KJN A;  3CHR A;  2IF4 A;  3LJ3 A;  4GMJ A;  3ESL A;  2ZU6 B;  1IYG A;  3QK0 A;  4UQY A;  4BSX A;  3OXG A;  4WNG A;  3LKU A;  1S0P A;  4W9R A;  2E0I A;  3FUM A;  4UI9 C;  4RVB A;  3LEW A;  3RRM B;  4B0Z A;  4GZ3 A;  3APC A;  5T3R A;  2VSX E;  3HVE B;  5AEN A;  4N2S A;  5LCW C;  2QY7 A;  4ILH B;  2XGS A;  1IQU A;  3NF1 A;  3O48 A;  4JA7 A;  4PS3 A;  4UWK A;  3CVW A;  2XCC A;  3MJW A;  4JEU A;  3ZGQ A;  3D9N A;  2WXJ A;  3MYV A;  2VGX B;  3OTN A;  2OVF A;  4Q96 A;  4J8F A;  4F53 A;  5C1D A;  4GZ6 A;  4GYO A;  3SI5 A;  4E85 A;  2J08 A;  2Y4T A;  4XX5 A;  4JHK A;  2M63 A;  2C2L A;  3BG1 B;  2LAI A;  3D9M A;  3QC1 A;  4V3I A;  1H2T C;  3HHM A;  4TV3 A;  3MEK A;  3TG5 A;  3JYS A;  4GA2 A;  3Q47 B;  1KT1 A;  2XRY A;  3G2S A;  3CK7 A;  1Y6I A;  1XGW A;  2RD0 A;  2MRI A;  3JQ0 A;  3MKQ A;  5BUZ A;  4AEZ C;  5CCL A;  3ZHE B;  4D10 C;  3FDH A;  3RK6 A;  3VTY A;  5FWQ A;  4ME2 A;  3FWV A;  2HO1 A;  3MX3 A;  5G05 C;  3MZL B;  5ANR A;  4LER A;  2FEZ A;  1BPO A;  1WM5 A;  4AXH A;  3FU6 A;  4ACL A;  2A4Z A;  4N5C A;  1U3C A;  2X38 A;  3OXL A;  3DBS A;  4ATG A;  3CEQ A;  3LY9 A;  5LFA A;  4URK A;  3D9L A;  4G25 A;  1Z6T A;  4WNE A;  5AJL A;  3ZRH A;  4A3V A;  4Q69 A;  4B8C B;  2KZT B;  1H2V C;  3L13 A;  4GYY A;  3QDN A;  4UI9 K;  3D9K A;  3LXU X;  3ESK A;  4NUR A;  4PS7 A;  1Z3X A;  5BNW A;  2V0P A;  1PY1 A;  2DCP A;  3AS4 A;  2PZI A;  1ELK A;  2LSV A;  3LY8 A;  4L1B A;  2HR2 A;  4WAF A;  2DBA A;  2KM4 A;  3ASG A;  5HI7 A;  3SZ7 A;  4GA0 A;  4GA1 A;  3N71 A;  1NA3 A;  3LS8 A;  3PE4 A;  1JWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...