2XCBA

Crystal structure of pcrh in complex with the chaperone binding region of popd
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
133
structure length
133
Chain Sequence
MLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Chaperone Recognition of Type III Secretion System Minor Translocator Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein binding
molecule keywords REGULATORY PROTEIN PCRH
total genus 60
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xcbA00
1OUVA 2FBNA 4JHRA 4U04A 1ZBPA 5FZSA 1TJCA 1E96B 5BT1A 4NQ0A 3LY8A 3ZPJA 3ASDA 3TAXA 4ABNA 2XGSA 3AS5A 2FI7A 3GW4A 3FFLA 4N5CA 1B89A 3ASFA 3E4BA 1ELWA 1PC2A 4YNDA 2FO7A 4ME2A 3RIBA 3PDNA 4APOA 4G26A 4AY5A 2HO1A 4BT8A 4BWRA 5A6CA 2Y4TA 3CV0A 5G04J 1HH8A 3CVNA 3GZ1A 3JYSA 3Q15A 4UI9K 4N2QA 3WXXA 3GYZA 2R5SA 1KLXA 2P58C 3S7DA 3UQ3A 2IF4A 3Q49B 5FZQA 3RKVA 3RO2A 5AYWD 2KATA 1NZNA 3CVLA 4G1TA 2UWJG 5JJTA 4IN3B 3ESKA 4J8EA 1IYGA 3RO3A 4G2VA 5KJMA 4KXKB 3CVQA 2VQ2A 4W9RA 4WUYA 3S7JA 4HOTA 4H7XA 3ZN3A 4J8FA 4N3CA 5FT9A 4AIFA 3KD7A 4YVQC 2PQNA 4I9CA 5EX0A 3MA5A 1KT1A 2VGXB 4N3BA 2NC9A 3VTYA 2UY1A 3CEQA 3LPZA 4I9EA 3R9AB 4WNGA 3MV3B 1QZ2A 5JJ7A 2VSNA 2KC7A 2E2EA 4N39A 4G25A 2Q7FA 4Y6WA 3TG4A 4AM9A 2IFUA 3LY9A 4KBQA 4U07A 3CKCA 5ARFA 3UUXA 2VYIA 2KCLA 3EDTB 4EQFA 4JA9A 5G04C 4UI9C 3ZHEB 5ARGA 5FJYA 3LY7A 1QQEA 4CGWA 5G05J 1NA0A 4U0SA 4CGVA 4BTAA 1HZ4A 5D0QD 4GA0A 5HQ8A 3GZ2A 1WM5A 1A17A 3AS4A 3OXLA 3KS2A 2J9QA 3QKYA 4GYWA 4UI9J 2PZIA 4GA2A 4HOQA 5JJ6A 2Y4UA 3QOUA 3MKRA 4CDRA 5KJLA 3O48A 1WAO1 2HR2A 4GZ6A 1P5QA 3TG5A 5BW8C 4F3VA 4HOSA 3ZFWA 4WNEA 5A7DB 3LKUA 1ZU2A 1YA0A 4NRHB 3ASHA 4HOUA 3LYAA 2LNIA 5LCWC 2MHKA 4GPKA 1HXIA 2AVPA 4RG6A 2VSYA 1KT0A 2PL2A 2XCBA 2YHCA 1NA3A 4GYYA 3Q5MA 3QWWA 4JL0A 3RU0A 4O6FA 3LCAA 3Q4AB 3QWVA 2GW1A 4GCNA 3OXFA 4GYOA 3VTXA 2YQ8A 3QWPA 3CK7A 4A1SA 2WPVA 4U0ZA 2ONDA 4GZ5A 3IEGA 3S7BA 5M72A 3HYMB 2WQHA 3AS8A 4KYOB 3ZHEA 5KJKA 3ASGA 1IHGA 4JA7A 5CCLA 1Y8MA 3OXGA 4I1AA 2C0MA 1XNFA 3PE4A 4GCOA 5EX3A 4AY6A 4J8DA 4B94A 1FCHA 2XCCA 3Q47B 2FF4A 4UQZA 3MEKA 2C0LA 2I6HA 2XGOA 2JLBA 5DIZA 3URZA 3S7FA 2C2LA 3MV2B 4N3AA 5HI7A 4HORA 4YVOA 4WNDA 4XI0A 4U0UA 1ELRA 2DBAA 4BTBA 3CK8A 3U3WA 4RG9A 3PE3A 2XGMA 5BNWA 2PQRA 2QFCA 3BEEA 3RJVA 2HYZA 2UY1B 2VGXA 2XPIA 4GZ3A 4XIFA 4G23A 2BUGA 2V5FA 4UQYA 3UPVA 3SF4A 2OOEA 2VGYA 4WNFA 3KAEA 4UQXA 3SZ7A 4H7YA 5CHEE 3N71A 2KCKA 3CK9A 4I17A 4GA1A 3TGOA 2LSVA 3CVPA 3K9IA 5FTPA 5CCMA 3FWVA 3U4TA 3ULQA 2FEZA 4J0UA 4Y6CA 5DBKA 4G24A 5EKQD 5G05C 3FP3A 4XI9A 4BT9A 3NF1A 4I2ZA 2L6JA 3ZGQA 4I2WA 5KJNA 5FZRA 4N2SA 2LSUA 2KCVA 3CKBA 4LEUA 2XEVA 1W3BA 5LCWJ 5D0OD 5C1DA 3QDNA
chains in the Genus database with same CATH superfamily
1OUVA 3FULA 1MX6A 2CHWA 4F6RD 3U9WA 3RIBA 1Y6IA 2ZGGA 1HF8A 1Z5SC 4HQDA 5G04J 1RZ4A 5FQ8A 2IU1A 2FO1E 4BEPA 3RO3A 4L23A 1ELKA 4H7XA 4AIFA 1XGWA 4J7WA 4F1SA 1HS6A 2YINA 4AXHA 4A63B 2F0YA 4N39A 2OVBA 2LAHA 4GZDA 3R7RA 3FU3A 2DZNA 4CGVA 1TNUA 1WM5A 2H6HA 3QKYA 1MZCA 2PZIA 4X8QA 4HOSA 3Q78A 1V54E 3SFZA 2WXJA 3E37A 3HIZA 2GRRB 2RD0A 2ONDA 2J09A 3ZHEA 4DPRA 3OXGA 2BKKB 2ETCA 3BG1B 2WXMA 2DBAA 4JB8P 3MGBA 2CFZA 4ATZD 2XPZA 3QK0A 2V5FA 4G23A 4AP2A 4F53A 2WXRA 2KBXA 3FWVA 4JHKA 2FEZA 4XI9A 3E30A 5KJNA 4ILHB 2KCVA 1W3BA 2WXPA 4ATGA 1U3DA 1UJKA 5EIBE 4L9PA 2HO1A 2Y4TA 5CBNA 5CRVA 3L13A 4HRLA 4UI9K 2WXKA 3NOGD 1G3NB 2AXZA 4Q96A 5HRYA 1N4SA 4CDMA 3ZXSA 4J8FA 5FWQA 4TXPA 3KSQA 2VGXB 5FQ6A 5B3SE 1K3ZD 4K0RA 4LNGA 1QZ2A 2VSNA 1YYHA 1KZOA 1E8XA 3B7RL 4UI9J 5CERB 4GA2A 4GU5A 3QOUA 3V2OA 1P5QA 1QBQA 1IXVA 2IY0C 3CVYA 4RG9A 5JMND 1BD8A 3QWVA 3CVXA 3FDHA 3LVQE 3WG7E 4U8YD 2V0PA 3RRMB 1O1RA 1FCHA 3EIQC 5LP0A 3BG0B 3D9LA 2XGMA 2MRIA 4J6IA 2BUGA 3ESLA 5AAOA 1H2UA 3V79K 2VGYA 1SA5A 3GZSA 1O5MA 2JEKA 2WXHA 3KSLA 2WMOA 3CHPA 1D9SA 3CHRA 1OCCE 2LSUA 2M63A 1HO8A 3CKBA 3D9OA 4JEUA 2XRZA 2XRYA 5JHAA 1ZBPA 5BT1A 3DPYA 2DZOA 4BWRA 5AN8A 1HH8A 1LTXA 4K5CA 4L2LA 1OCOE 3DSSA 3AJIA 4AJWA 3I4RB 3CSTA 2KM4A 2WQ7A 2WXLA 3B95A 4I9CA 1WG0A 4OVUA 2NC9A 5E75A 4WNGA 5KNGA 3B7TA 4U07A 2KCLA 3AG1E 3ULEG 2J9QA 3HXBA 1TYQG 1IQRA 3MZLB 4HOUA 4HI8A 2F8XK 3MKQA 5KCMA 3BU8A 5EIDA 4GZ5A 3CR3A 1IKND 2BF0X 4GMJA 2KZTA 5AQBA 1BPOA 3Q47B 4GTTA 2XGOA 3ZYKA 4RSYA 3NQPA 3DRAA 3CHSA 1EPUA 3QB2A 4BSXA 3RAUA 3FUJA 3L54A 2CG2A 4UUCA 2NXPA 5KJKA 4G24A 3NF1A 1EYHA 2WM9A 4HLLA 2Y3AA 1MHQA 3D9MA 3L17A 4U04A 2P9LG 2GROB 3V30A 2RKKA 4G8KA 3E4BA 4O60A 2P9SG 3Q7FA 2QY7A 4RQIA 1NFIE 3EU5A 1UOHA 4DJAA 4HLEA 3HDXA 4FP7A 5JJTA 2WXOA 2VGEA 3KD7A 1IQUA 1U2VG 5ENPD 5ARFA 2IOLA 4I1MA 2I1KA 1NL4A 1BLXB 4U0SA 2I1JA 2JABA 4EBAA 4ILIA 4TUMA 4BETA 4B8AA 3ASHA 2ETBA 3LS8A 2H6IA 2XCBA 4B0ZA 3IXEA 5CBOA 1H6PA 2GW1A 1IHBA 2J07A 3FUFA 2J4DA 1U3CA 3J5QB 3NZUA 5EX3A 4UWLA 4GTQA 4EZKA 5EYLA 3FU5A 4A3VA 1H6KA 4WNDA 2PNNA 3DPDA 3FUIA 2UY1B 3DSVA 4JXTA 3ZVVA 5CMWA 3SHFA 2IO3C 4DI4A 4XX5A 3JUIA 4IULA 4E85A 3EHQA 4C48B 3AG3E 3ONLA 4PS7A 1PAQA 3UQ3A 4YDWA 4EPZA 3Q7AA 5BV1A 4IN3B 1FVFA 4UWGA 3JXJA 4C9BB 3ZN3A 4I43A 4EHMA 3ENEA 4I9EA 2V5QC 1WY6A 2X3MA 3I3NA 3CKCA 1H2TC 1D8DA 4O1PA 2HE0A 1NI1A 3GZ2A 3OXLA 3FUNA 2L6BA 1S64A 4CDRA 3TWRA 4MKTA 1S70B 2HR2A 4GTOA 4F3VA 3PH0C 4ANVA 3SNXA 1TNBA 4BSZB 3AG4E 3Q5MA 3QWWA 3FY4A 3LCAA 3HVEB 1AP7A 5D66A 4MS6A 2A5EA 4TXQA 4FJZA 1Q2ZA 4XKCA 5AJLA 3NOCD 4OYSA 3TWVA 1HX8A 3URZA 2C2LA 4A1GA 2OVFA 3CK8A 2DCPA 1SZ9A 3DXMG 5CRUA 1INZA 5CCMA 1E8WA 3PZ3A 4GZCA 2VTBB 4FC8A 2J4BA 4HNAD 2F8YA 2IQCA 4FLBA 1S63A 2XGSA 3F6QA 1E8ZA 5A6CA 1LF8A 4TRQA 3DBSA 4U8HA 3G2SA 1MJ0A 4EBAG 3GYZA 4CEMA 3G2VA 4J8YA 2UWJG 3OAWA 2XHEA 3SFXA 3TWTA 3PNTB 1A5EA 1GW6A 3S7JA 4HOTA 1MYOA 2NYJA 2AW6A 4CT0A 1VDYA 3HRAA 3MKQB 3MV3B 2XZDG 3L16A 2GRQB 3UTMA 4UI9C 3CQGB 4GTPA 4LCTA 2BKGA 5JJ6A 4ANUA 4N2SA 3HVEA 4CRWA 5LCWC 3CGHA 4CGWA 2PL2A 2DVWA 4O6FA 3FEXA 1ZB1A 3ZIMA 3HYMB 4KYOB 2GRNB 3J5PA 3VLFA 1IHGA 1SZAA 4TV3A 4GCOA 4IRUA 4B94A 1OT8A 4A55A 3C3QA 2PQRA 2HYZA 4XKBA 4AV7A 3HXFA 3LEWA 5FTPA 3UM3A 1UN8A 5LCWJ 5C1DA 2VJ8A 4JHRA 1TJCA 3LY8A 3FUMA 3EHMA 4N5CA 4BERA 4GPMA 2Y69E 5T3RA 3CVNA 2LXMA 4HI9A 3OTNA 2KATA 3ABLE 1L5JA 5BV0A 3ASNE 2VQ2A 2ZU6B 4B93B 3NZSA 2R02A 4N3CA 2P9NG 3D9PA 4UWHA 2AXVA 4N3BA 4BESA 1V55E 5G55A 4BFRA 2GRLA 2XZTG 1EF1C 3EDTB 4JA9A 4K5BA 5A23A 1JUQA 3LDZA 4DLQA 4BX9A 2EIJE 5EYPF 3FTVA 3C98A 3TG5A 2XQ0A 3TXNA 3TL5A 3Q73A 4GPKA 1S0PA 2P2CP 3UX4A 4PUCA 4A1SA 3ASOE 5BXUA 2L0TB 1MX4A 1XNFA 4K5AB 1N9AA 3MV2B 2LUHA 4I6GA 3BEEA 3O4ZA 1EDUA 4ANWA 4H7YA 3R9MA 5DBKA 5AJDA 1K8KG 5T4YA 3Q9NC 1Z6TA 3C3RA 3PZ4A 4NIKA 3ASDA 3TAXA 3GW4A 1TN8A 2FO7A 3PDNA 3UXGA 4ZHBA 3JYSA 4CYMD 3WXXA 1N54A 3Q49B 5ENSD 4DLOA 4C0MA 4YDEA 4JD2G 2Y0BG 3FEYA 2WVIA 1X5BA 1DCQA 4AM9A 4V3IA 2E2EA 3QNKA 3VLDA 4AVXA 4GTSA 1KPSB 1HG2A 5FJYA 5CECB 3AS4A 4ILGA 5LOZA 3P2BA 5A7DB 1YA0A 3LXUX 3APFA 3EUVA 3FTWA 4GYOA 3OXFA 4MBGA 2I2OA 2WQHA 3ASGA 2OV8A 1Y8MA 3S2AA 3L82A 2CFUA 3S7FA 3EHNA 4C0EA 3SD5A 3HXCA 5ENNA 3NAWA 1N0QA 3PE3A 1RW2A 2RFMA 4WAFA 3BQOA 4XIFA 2ZGDA 3CLJA 4F1PA 4FA6A 5CHEE 2WXGA 4GTRA 5D2MC 5ENQD 4FJYA 3TWWA 4KMOA 4PDXA 4KZ0A 5G05C 4Y6CA 3L22A 3QARA 4EZJA 4I2WA 5ITZF 1OCRE 2NSZA 2ETAA 2CHZA 1E96B 4CT4A 3RSEG 1N0RA 1AWCB 2L9BA 5C2YA 4CZ2D 5BXOA 4KT6B 1N11A 4Q69A 3CV0A 2IJGX 3GZ1A 4LRZA 3MCXA 1O1TA 3UI2A 3C3OA 1D8EA 1JWGA 3ESKA 2AXUA 3QJZA 3SY2A 4F7AA 1E7VA 2DWZA 4DX1A 2GGFA 5FT9A 4U63A 1OWLA 3VTYA 4E6HA 3PVLA 5CEAA 1LD7A 4HXIA 3SBSA 1N4PA 4GA0A 1LD8A 1TNYA 4ACKA 5KJLA 2Y4UA 5ANRA 4NACA 4NURA 1NP7A 4U96D 3UINC 3Q75A 5FZSA 3FU6A 2VSYA 1NA3A 2AWIA 3Q4AB 2MYOA 2QZAA 3PS6A 3CK7A 2OEVA 3IEGA 5M72A 2KXPC 3E34A 3CIAA 3B13A 2C0MA 2RFAA 4LNBA 3BUAA 3IHYA 2I6HA 4HBDA 3ML8A 2X6KA 4OAVB 4EECA 1QNFA 4GZ3A 3JQ1A 4I6EA 4P29A 1N4QA 3CVVA 5AARA 4DX7D 5ENTD 3DSWA 4DX6D 2QYUA 3CK9A 4I17A 3ISMC 5AQ7A 3U4TA 3LVRE 4J0UA 3FP3A 4DI3A 3TWXA 3ZYQA 4PS8A 4FLHA 5D0OD 4O1OA 4HORA 3QAQA 4K03A 3ZKJA 2XS8A 4AY6A 4APOA 4AY5A 5ENOD 4G26A 3D9HA 4L2YA 5FZQA 2X6FA 1K1AA 4JEHA 1DNPA 1N4RA 1IYGA 2WXQA 4UWKA 4J8SA 4JZYA 5EDSA 3ABKE 1E7UA 3CSFA 4L1BA 5EN5D 4BTAA 3PEUB 2FULA 2VTBA 1JWFA 1OWNA 3ZU7B 1SA4A 3L08A 4DX5D 5B1AE 2KZTB 3Q79A 2DYSE 5AENA 2AJAA 3AS8A 4WWOA 4I1AA 2QC9A 5E76A 1BI8B 5ANLA 2JLBA 4U95D 1H2VC 3AU5A 1JPLA 1HG5A 3I5PA 2RG8A 4U8VD 5AQ9A 2QFCA 4IYPA 2H6GA 3KAEA 1N95A 2ZISA 2P9IG 4KZCA 4GA1A 2DYRE 4B8CB 2WXIA 4BT9A 3PZ1A 2FBNA 3DSXA 4NQ0A 4I6JA 3AS5A 3JXIA 4ZFHA 5CMYA 2IEJA 3UM2A 3UKUG 1SVXA 1NZNA 2R17C 4J8EA 1N52A 4W9RA 4WUYA 2PQNA 3ML9A 3E32A 1OXJA 5EX0A 3T8KA 3CEQA 5ENRD 3R9AB 4FU3A 3ZRHA 4BY6A 2KC7A 4FULA 3LY9A 4KBQA 5FINA 3UUXA 1TEZA 5ARGA 2H6FA 3U64A 1MX2A 5KBAA 1A17A 4GYWA 4M7CA 1WAO1 4GZ6A 5BW8C 5FQ4A 4L7TA 2P9UG 3LKUA 4M3OA 4NRHB 4RLYA 3EIJA 3LYAA 2LNIA 1YCSB 4CCAA 4JL0A 4R7LA 3RK6A 3RRNB 4U0ZA 3SGHA 4JHJA 3G2TA 4JA7A 1TNZA 4Z68A 2FF4A 2C0LA 4LERA 4A3TA 4N3AA 5HI7A 2IO2C 3T9KA 3EJNA 3PZDA 3C5RA 5J90A 3G2WA 3U3WA 4ANXA 1TJFA 2VSOE 4UQYA 1E8YA 1TN6A 3N71A 3CVPA 1QYMA 4MLPA 4CDNA 2PM7A 4WWPA 4DX2A 2X6IA 2YNQA 4EZLA 3QDNA 2VSXE 1OWMA 5LFAA 1OCZE 1B89A 1X81A 3ASFA 1ELWA 3DWLG 3FH5A 3TXMA 2R59A 3APDA 5AYWD 1HFAA 3IV0A 4G1TA 5HKPA 3ZYMA 3FTYA 3MA5A 3T5XA 2LAIA 5JJ7A 1DC2A 2IFUA 3MJWA 3D9JA 4JW1A 5G04C 3LY7A 5HQ8A 3IKOB 5LX8A 1O1SA 2X6JA 3FUKA 1ZU2A 3JCKC 2MHKA 4GYYA 4XE0A 3UT8A 3RU0A 2ZIRA 2V8SE 2XEHA 3U66A 2YQ8A 1UJJA 4JVSA 4OAUC 4AOFA 2J49A 3FUDA 2XCCA 1SQMA 4DUIA 2P9KG 4YDOA 4PS3A 2VGXA 3KEAA 1HE8A 3FTUA 4HRNA 4TUUA 3DSUA 2KCKA 3UM0A 3UT4A 5EKQD 3AG2E 4I2ZA 3R7QA 1TNOA 3TWSA 3FUEA 2ILRA 3UM1A 1JCRA 3ZPJA 2A5UA 4ME2A 5CEDB 4BT8A 3NB2A 2R5SA 1KLXA 4G8LA 3CHOA 1SW6A 2R03A 4TXRA 5HS0A 3UMVA 3V31A 4PH4B 4HS2A 2E0IA 2EIME 4WWNA 4KVMA 4HFGA 1DVPA 3D3MA 3Q9UC 3SI5A 2WXFA 2LXLA 3MYVA 3KS2A 4HOQA 1FPPA 4AEZC 2Y1LE 1UG3A 2BEDA 2PM6A 4RG6A 2IOSA 5FQ7A 2CHXA 3ZW3A 2OEWA 2WPVA 3QC1A 4JPSA 3I4GA 4DK5A 1E90A 3MEKA 3SFYA 1ELRA 5B1BE 3VLEA 3EHRA 2WB2A 1FT2A 2OOEA 4WNFA 5JHBA 3HXDA 3SQVA 5H7PA 3FUHA 2X38A 3K9IA 4Q94A 2GRMA 3D9KA 3FTXA 5KNHD 3PREA 3L9TA 4FHJA 1PC2A 4QQIA 2IONA 5G2NA 4LG6A 2I9CA 3ZXPA 2WQ6A 2P58C 3S7DA 4LUNU 3FTSA 3CVLA 3UIOC 3PRZA 4XEIG 1UW4B 4KXKB 5EILA 1MQSA 3DSTA 1BI7B 3KEZA 5AIJA 2F37A 3APCA 4G25A 3TG4A 4APFA 2VYIA 3ZHEB 5G05J 3C72A 3ZFWA 4WNEA 2YHEA 1HU3A 3CHQA 3SO8A 3UT7A 1Z3YA 3RO2A 1KT0A 1PY1A 4FHKA 4GCNA 5KWDA 3UIPC 3CVUA 4KVOA 2BTDA 3TWUA 3FU0A 3D9NA 2WXNA 4J8DA 4UQZA 2EIKE 2OCCE 1DCEA 3DXKG 4XI0A 4U0UA 2J08A 3HXEA 1FVHA 3PZ2A 1OWOA 3RJVA 3EU9A 1H6OA 3UKRG 3UPVA 2XEEA 1OY3D 3SZ7A 1BU9A 2XPYA 3TWQA 4MRUA 4XZ4A 1OWPA 2L6JA 2EINE 3CHMA 3P1UA 2XEVA 2B6CA 3PUKA 2LO6A 3DEOA 4ABNA 1Z3XA 4DRXE 4FADA 4YNDA 2ZXWE 4LNUD 3PUJA 3JQ0A 3FHEA 3Q15A 3AU4A 3CVWA 4URKA 3T8MA 2IF4A 4ACLA 2HM8A 2WMNA 3D9IA 3SBTB 3CVQA 2R2LA 3ZYLA 4YVQC 2A4ZA 3NBNB 2UY1A 4I1OB 4Y6WA 3L6AA 4QFVA 4OVVA 2L0IA 1HZ4A 5D0QD 1H0AA 4GAAA 3MKRA 3O48A 3IBEA 5AQAA 3W9GA 4G11A 1FT1A 1TR4A 2YHCA 5J08A 4B89A 1YMPA 5JA4D 3B7UX 4GTVA 3IHVA 4LSZE 3FH8A 5IY5E 4U7EB 1JCQA 2CG3A 2XS1A 3FTZA 4YVOA 4BTBA 3T5VA 4GB9A 1KZPA 3V2XA 1UN9A 3TGOA 3ULQA 4GTMA 2X6HA 1K1BA 5T8IA 3ZUVB 4N5QA 2EQXA 2FI7A 3DEPA 3FFLA 5BPPA 4EQFA 3ULYA 3ZEFA 4HRMB 3G2UA 3JUEA 3HHMA 3MX3A 4N2QA 4YDYA 3RKVA 4HB5A 4GMRA 4G2VA 5KJMA 3LJ3A 2DIWA 1N94A 3ABME 4UWFA 2QYJA 1KT1A 3LPZA 4RVBA 1JCSA 2Q7FA 4HVBA 4JC8A 1QQEA 1NA0A 4BX8A 4D10C 3FH7A 5BUZA 2B0OE 2V4HC 1HXIA 2AVPA 3ZNGA 3X2QE 3CQCB 3VTXA 3QWPA 3TJPA 3S7BA 1TN7A 3W9FA 5CCLA 2V4LA 3PE4A 3ONKA 1H19A 2J8SD 2MOWA 3B7SA 5DIZA 3RRUA 1WDYA 2XENA 2R05A 2P9PG 5BNWA 3PNLB 2XPIA 3SF4A 3PEVB 4UQXA 3B7BA 3LJNA 2LSVA 5FIOA 2EILE 4GMLA 3AAAC 3E33A 3ZGQA 5FZRA 3HG0D 4LEUA 2GRPB
chains in the Genus database with same CATH topology
1OUVA 2CHZA 3FULA 1E96B 2CHWA 4E85A 4CT4A 3ZPJA 3U9WA 2A5UA 2L9BA 5C2YA 4KT6B 3RIBA 4ME2A 1Y6IA 1HF8A 4BT8A 4Q69A 3CV0A 2IJGX 5G04J 5FQ8A 3GZ1A 2IU1A 3ONLA 4LRZA 3MCXA 4PS7A 1PAQA 2R5SA 1KLXA 3UQ3A 3CHOA 4EPZA 1JWGA 3UMVA 4IN3B 3ESKA 2AXUA 3QJZA 4PH4B 3RO3A 1FVFA 5BV1A 4F7AA 1E7VA 4HS2A 4L23A 4UWGA 1ELKA 2E0IA 4C9BB 4H7XA 3ZN3A 4WWNA 2GGFA 4KVMA 5FT9A 4AIFA 4I43A 1XGWA 4HFGA 1DVPA 4U63A 3D3MA 1OWLA 3VTYA 3ENEA 1HS6A 2YINA 4I9EA 4E6HA 4F1SA 3PVLA 1WY6A 4AXHA 4N39A 2X3MA 3I3NA 2OVBA 2LAHA 4GZDA 3SI5A 3CKCA 1H2TC 2WXFA 4HXIA 3R7RA 3FU3A 3SBSA 3MYVA 4CGVA 4GA0A 3GZ2A 1WM5A 3FUNA 3OXLA 3QKYA 3KS2A 4ACKA 2PZIA 4HOQA 4CDRA 2Y4UA 5KJLA 4MKTA 2HR2A 4AEZC 4F3VA 5ANRA 4HOSA 4NACA 4NURA 1NP7A 1UG3A 3PH0C 4ANVA 3SNXA 2PM6A 4RG6A 2IOSA 2VSYA 3FU6A 5FQ7A 5FZSA 2CHXA 1NA3A 3SFZA 3Q5MA 3QWWA 2WXJA 2AWIA 3FY4A 3HIZA 3LCAA 3Q4AB 2RD0A 3ZW3A 3HVEB 3PS6A 3CK7A 4MS6A 2WPVA 2ONDA 2J09A 3QC1A 3IEGA 5M72A 3ZHEA 4FJZA 4JPSA 4DPRA 3OXGA 4XKCA 3CIAA 3B13A 2C0MA 3I4GA 5AJLA 4DK5A 4OYSA 1E90A 3IHYA 3MEKA 1HX8A 2I6HA 3URZA 2C2LA 3ML8A 4A1GA 3BG1B 1ELRA 2DBAA 2OVFA 2X6KA 2WXMA 4EECA 3CK8A 2DCPA 3VLEA 3MGBA 2CFZA 1QNFA 4GZ3A 2XPZA 3JQ1A 3QK0A 2V5FA 4G23A 4I6EA 4P29A 2WB2A 2OOEA 4WNFA 5JHBA 1SZ9A 3CVVA 1INZA 4AP2A 3CK9A 4I17A 3FUHA 4F53A 2X38A 2WXRA 3K9IA 5CCMA 3FWVA 3U4TA 4JHKA 2FEZA 3LVRE 4J0UA 4Q94A 2GRMA 3FP3A 3D9KA 4XI9A 1E8WA 4DI3A 3ZYQA 4GZCA 2VTBB 3FTXA 4FC8A 5KJNA 2J4BA 4ILHB 2KCVA 4PS8A 1W3BA 2WXPA 4FLHA 5D0OD 4HORA 3PREA 2IQCA 1U3DA 4FLBA 3QAQA 4K03A 4ATGA 1UJKA 2XGSA 1E8ZA 4FHJA 1PC2A 4AY6A 4APOA 4AY5A 2IONA 5G2NA 4G26A 5A6CA 2HO1A 1LF8A 2Y4TA 4TRQA 3DBSA 4U8HA 3G2SA 4EBAG 3L13A 2I9CA 4UI9K 4L2YA 2WQ6A 3GYZA 2P58C 3S7DA 4CEMA 2WXKA 4LUNU 3FTSA 5FZQA 2AXZA 2X6FA 4JEHA 3G2VA 1DNPA 3CVLA 2UWJG 1IYGA 3OAWA 2XHEA 4Q96A 3PRZA 3PNTB 1UW4B 2WXQA 4KXKB 1GW6A 4CDMA 1MQSA 4UWKA 3S7JA 4HOTA 3ZXSA 4J8FA 4J8SA 5FWQA 2AW6A 3KEZA 4CT0A 5AIJA 2VGXB 1VDYA 4JZYA 5FQ6A 5EDSA 3MKQB 4K0RA 3MV3B 1QZ2A 2VSNA 3APCA 4G25A 3TG4A 4APFA 1E7UA 3L16A 2VYIA 3CSFA 4L1BA 4UI9C 3ZHEB 1E8XA 3CQGB 5G05J 4LCTA 3B7RL 4BTAA 3PEUB 2FULA 4UI9J 5JJ6A 4GA2A 4GU5A 2VTBA 4ANUA 3QOUA 4N2SA 1P5QA 3HVEA 4CRWA 3ZFWA 4WNEA 2YHEA 1HU3A 3CHQA 1JWFA 1OWNA 3UT7A 1Z3YA 3CVYA 5LCWC 3CGHA 4RG9A 3L08A 3RO2A 1KT0A 4CGWA 2PL2A 1PY1A 2KZTB 4O6FA 3QWVA 4FHKA 3CVXA 4GCNA 3FDHA 3LVQE 3FEXA 3CVUA 3ZIMA 5AENA 3HYMB 3AS8A 4KYOB 4KVOA 3VLFA 1IHGA 1SZAA 2BTDA 2V0PA 4WWOA 4I1AA 3FU0A 4TV3A 4GCOA 5E76A 3D9NA 3RRMB 2WXNA 4IRUA 1FCHA 4J8DA 4B94A 4UQZA 5ANLA 2JLBA 1H2VC 3AU5A 3EIQC 1JPLA 1HG5A 4A55A 4XI0A 5LP0A 3BG0B 2J08A 4U0UA 3D9LA 1FVHA 2RG8A 3I5PA 2XGMA 1OWOA 2MRIA 4J6IA 2PQRA 2QFCA 3RJVA 2HYZA 4IYPA 4XKBA 2BUGA 3ESLA 1H2UA 3UPVA 2VGYA 3SZ7A 3KAEA 4AV7A 2XPYA 3GZSA 4MRUA 4KZCA 4GA1A 3LEWA 5FTPA 4B8CB 2WXIA 4BT9A 1UN8A 4XZ4A 2JEKA 2WXHA 2WMOA 1OWPA 2L6JA 3CHPA 3CHRA 2LSUA 2M63A 3D9OA 1HO8A 3CHMA 3CKBA 2XEVA 3P1UA 4JEUA 2XRZA 5LCWJ 2XRYA 5C1DA 5JHAA 3PUKA 2VJ8A 2FBNA 4JHRA 2LO6A 1ZBPA 1TJCA 5BT1A 4NQ0A 4I6JA 3LY8A 4ABNA 3FUMA 3AS5A 1Z3XA 3EHMA 4N5CA 5CMYA 4FADA 4YNDA 4BWRA 3PUJA 3JQ0A 5T3RA 1HH8A 3CVNA 3FHEA 3Q15A 3AU4A 3CVWA 4URKA 4L2LA 3T8MA 2IF4A 3OTNA 4AJWA 2KATA 3I4RB 1NZNA 2R17C 3CSTA 4ACLA 1L5JA 2HM8A 5BV0A 2WMNA 3D9IA 4J8EA 2KM4A 3SBTB 1N52A 2WQ7A 2WXLA 2VQ2A 2ZU6B 3CVQA 4W9RA 4WUYA 3NZSA 3ZYLA 4N3CA 4YVQC 2PQNA 4I9CA 3ML9A 5EX0A 2A4ZA 3D9PA 4UWHA 2AXVA 4N3BA 4OVUA 5E75A 2NC9A 2UY1A 3CEQA 5G55A 4I1OB 4FU3A 4WNGA 3R9AB 3ZRHA 4BY6A 4BFRA 4Y6WA 2KC7A 4FULA 2GRLA 3B7TA 3L6AA 3LY9A 4KBQA 4U07A 3UUXA 1EF1C 3EDTB 2KCLA 1TEZA 4JA9A 5ARGA 4QFVA 4OVVA 3U64A 5A23A 1JUQA 3LDZA 2L0IA 1HZ4A 5D0QD 1H0AA 1A17A 4GAAA 4GYWA 4DLQA 2J9QA 4BX9A 3MKRA 3O48A 1WAO1 3FTVA 4GZ6A 3IBEA 3C98A 3TG5A 5BW8C 1IQRA 2XQ0A 4L7TA 5FQ4A 3LKUA 4M3OA 4NRHB 3TXNA 3MZLB 3EIJA 4HOUA 3LYAA 3TL5A 2LNIA 4GPKA 4G11A 1S0PA 2YHCA 4CCAA 5J08A 4JL0A 4B89A 3MKQA 3B7UX 4R7LA 5KCMA 3RK6A 3RRNB 4PUCA 3UX4A 4A1SA 4U0ZA 4GZ5A 3SGHA 3IHVA 3G2TA 4JHJA 2L0TB 3CR3A 2BF0X 4JA7A 4GMJA 1XNFA 3FH8A 2KZTA 1BPOA 2FF4A 3Q47B 2C0LA 4LERA 2XGOA 2CG3A 4A3TA 3MV2B 4N3AA 3FTZA 5HI7A 4YVOA 3EJNA 3PZDA 3ZYKA 4RSYA 5J90A 3NQPA 3G2WA 4BTBA 3T5VA 3U3WA 4ANXA 1TJFA 1EPUA 3CHSA 4GB9A 4I6GA 3BEEA 3O4ZA 3QB2A 4BSXA 2VSOE 4UQYA 1E8YA 1EDUA 4ANWA 4H7YA 3N71A 1UN9A 3FUJA 3L54A 2CG2A 3TGOA 3CVPA 2NXPA 5KJKA 3ULQA 5DBKA 4G24A 4MLPA 4CDNA 2PM7A 3NF1A 1EYHA 2WM9A 2X6HA 4WWPA 5AJDA 5T8IA 5T4YA 2X6IA 2Y3AA 1MHQA 2YNQA 4EZLA 3D9MA 3QDNA 2VSXE 1OWMA 3L17A 5LFAA 4U04A 1Z6TA 2EQXA 3ASDA 3TAXA 2FI7A 3GW4A 3FFLA 5BPPA 1B89A 3ASFA 3E4BA 1ELWA 2FO7A 4EQFA 3PDNA 2QY7A 3ZEFA 3G2UA 3JYSA 3HHMA 3MX3A 3FH5A 3TXMA 3WXXA 4N2QA 2R59A 1N54A 4DJAA 3Q49B 3HDXA 3RKVA 3APDA 4HLEA 5AYWD 1HFAA 3IV0A 4FP7A 4DLOA 4C0MA 4G1TA 5JJTA 2WXOA 4G2VA 5KJMA 3FEYA 3LJ3A 2DIWA 3ZYMA 3KD7A 4UWFA 3FTYA 3MA5A 2WVIA 1KT1A 1IQUA 1X5BA 3LPZA 3T5XA 2LAIA 5JJ7A 4AM9A 4V3IA 2E2EA 3QNKA 2Q7FA 4RVBA 3VLDA 4HVBA 2IFUA 5ARFA 3MJWA 2IOLA 3D9JA 4JW1A 4I1MA 2I1KA 5G04C 4AVXA 1HG2A 4JC8A 5FJYA 3LY7A 1QQEA 1NA0A 4U0SA 5HQ8A 3IKOB 4BX8A 2X6JA 3AS4A 5LX8A 4ILGA 2I1JA 3FH7A 4D10C 5BUZA 4EBAA 5LOZA 3P2BA 3FUKA 4ILIA 5A7DB 1YA0A 1ZU2A 4B8AA 3ASHA 3JCKC 3LXUX 2MHKA 3APFA 3LS8A 1HXIA 2AVPA 2XCBA 3FTWA 4GYYA 4XE0A 4B0ZA 3UT8A 3RU0A 3CQCB 4GYOA 3VTXA 2GW1A 2V8SE 3OXFA 2YQ8A 1UJJA 3U66A 4JVSA 3FUFA 2J07A 3QWPA 2I2OA 2J4DA 3TJPA 3S7BA 2WQHA 1U3CA 3ASGA 2OV8A 4AOFA 5CCLA 1Y8MA 2V4LA 3S2AA 2J49A 3FUDA 3NZUA 3PE4A 5EX3A 4UWLA 3ONKA 4EZKA 1H19A 2XCCA 2MOWA 3FU5A 2CFUA 3B7SA 5DIZA 3S7FA 4A3VA 3EHNA 1H6KA 4C0EA 1SQMA 3RRUA 3SD5A 4WNDA 5ENNA 4PS3A 3DPDA 3PE3A 3FUIA 5BNWA 4WAFA 3PNLB 2UY1B 2VGXA 2XPIA 1HE8A 4XIFA 4JXTA 3ZVVA 3FTUA 3CLJA 3SF4A 4FA6A 3PEVB 4UQXA 4TUUA 5CHEE 5CMWA 2KCKA 2WXGA 3SHFA 4FJYA 3UT4A 4DI4A 2LSVA 4KMOA 4GMLA 4PDXA 4KZ0A 5G05C 4Y6CA 5EKQD 3L22A 3QARA 4EZJA 4I2ZA 3R7QA 3ZGQA 4XX5A 4I2WA 3JUIA 5FZRA 4LEUA 4IULA 3FUEA 2ILRA 2NSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OUV A;  2FBN A;  4JHR A;  4U04 A;  1ZBP A;  5FZS A;  1TJC A;  1E96 B;  5BT1 A;  4NQ0 A;  3LY8 A;  3ZPJ A;  3ASD A;  3TAX A;  4ABN A;  2XGS A;  3AS5 A;  2FI7 A;  3GW4 A;  3FFL A;  4N5C A;  1B89 A;  3ASF A;  3E4B A;  1ELW A;  1PC2 A;  4YND A;  2FO7 A;  4ME2 A;  3RIB A;  3PDN A;  4APO A;  4G26 A;  4AY5 A;  2HO1 A;  4BT8 A;  4BWR A;  5A6C A;  2Y4T A;  3CV0 A;  5G04 J;  1HH8 A;  3CVN A;  3GZ1 A;  3JYS A;  3Q15 A;  4UI9 K;  4N2Q A;  3WXX A;  3GYZ A;  2R5S A;  1KLX A;  2P58 C;  3S7D A;  3UQ3 A;  2IF4 A;  3Q49 B;  5FZQ A;  3RKV A;  3RO2 A;  5AYW D;  2KAT A;  1NZN A;  3CVL A;  4G1T A;  2UWJ G;  5JJT A;  4IN3 B;  3ESK A;  4J8E A;  1IYG A;  3RO3 A;  4G2V A;  5KJM A;  4KXK B;  3CVQ A;  2VQ2 A;  4W9R A;  4WUY A;  3S7J A;  4HOT A;  4H7X A;  3ZN3 A;  4J8F A;  4N3C A;  5FT9 A;  4AIF A;  3KD7 A;  4YVQ C;  2PQN A;  4I9C A;  5EX0 A;  3MA5 A;  1KT1 A;  2VGX B;  4N3B A;  2NC9 A;  3VTY A;  2UY1 A;  3CEQ A;  3LPZ A;  4I9E A;  3R9A B;  4WNG A;  3MV3 B;  1QZ2 A;  5JJ7 A;  2VSN A;  2KC7 A;  2E2E A;  4N39 A;  4G25 A;  2Q7F A;  4Y6W A;  3TG4 A;  4AM9 A;  2IFU A;  3LY9 A;  4KBQ A;  4U07 A;  3CKC A;  5ARF A;  3UUX A;  2VYI A;  2KCL A;  3EDT B;  4EQF A;  4JA9 A;  5G04 C;  4UI9 C;  3ZHE B;  5ARG A;  5FJY A;  3LY7 A;  1QQE A;  4CGW A;  5G05 J;  1NA0 A;  4U0S A;  4CGV A;  4BTA A;  1HZ4 A;  5D0Q D;  4GA0 A;  5HQ8 A;  3GZ2 A;  1WM5 A;  1A17 A;  3AS4 A;  3OXL A;  3KS2 A;  2J9Q A;  3QKY A;  4GYW A;  4UI9 J;  2PZI A;  4GA2 A;  4HOQ A;  5JJ6 A;  2Y4U A;  3QOU A;  3MKR A;  4CDR A;  5KJL A;  3O48 A;  1WAO 1;  2HR2 A;  4GZ6 A;  1P5Q A;  3TG5 A;  5BW8 C;  4F3V A;  4HOS A;  3ZFW A;  4WNE A;  5A7D B;  3LKU A;  1ZU2 A;  1YA0 A;  4NRH B;  3ASH A;  4HOU A;  3LYA A;  2LNI A;  5LCW C;  2MHK A;  4GPK A;  1HXI A;  2AVP A;  4RG6 A;  2VSY A;  1KT0 A;  2PL2 A;  2XCB A;  2YHC A;  1NA3 A;  4GYY A;  3Q5M A;  3QWW A;  4JL0 A;  3RU0 A;  4O6F A;  3LCA A;  3Q4A B;  3QWV A;  2GW1 A;  4GCN A;  3OXF A;  4GYO A;  3VTX A;  2YQ8 A;  3QWP A;  3CK7 A;  4A1S A;  2WPV A;  4U0Z A;  2OND A;  4GZ5 A;  3IEG A;  3S7B A;  5M72 A;  3HYM B;  2WQH A;  3AS8 A;  4KYO B;  3ZHE A;  5KJK A;  3ASG A;  1IHG A;  4JA7 A;  5CCL A;  1Y8M A;  3OXG A;  4I1A A;  2C0M A;  1XNF A;  3PE4 A;  4GCO A;  5EX3 A;  4AY6 A;  4J8D A;  4B94 A;  1FCH A;  2XCC A;  3Q47 B;  2FF4 A;  4UQZ A;  3MEK A;  2C0L A;  2I6H A;  2XGO A;  2JLB A;  5DIZ A;  3URZ A;  3S7F A;  2C2L A;  3MV2 B;  4N3A A;  5HI7 A;  4HOR A;  4YVO A;  4WND A;  4XI0 A;  4U0U A;  1ELR A;  2DBA A;  4BTB A;  3CK8 A;  3U3W A;  4RG9 A;  3PE3 A;  2XGM A;  5BNW A;  2PQR A;  2QFC A;  3BEE A;  3RJV A;  2HYZ A;  2UY1 B;  2VGX A;  2XPI A;  4GZ3 A;  4XIF A;  4G23 A;  2BUG A;  2V5F A;  4UQY A;  3UPV A;  3SF4 A;  2OOE A;  2VGY A;  4WNF A;  3KAE A;  4UQX A;  3SZ7 A;  4H7Y A;  5CHE E;  3N71 A;  2KCK A;  3CK9 A;  4I17 A;  4GA1 A;  3TGO A;  2LSV A;  3CVP A;  3K9I A;  5FTP A;  5CCM A;  3FWV A;  3U4T A;  3ULQ A;  2FEZ A;  4J0U A;  4Y6C A;  5DBK A;  4G24 A;  5EKQ D;  5G05 C;  3FP3 A;  4XI9 A;  4BT9 A;  3NF1 A;  4I2Z A;  2L6J A;  3ZGQ A;  4I2W A;  5KJN A;  5FZR A;  4N2S A;  2LSU A;  2KCV A;  3CKB A;  4LEU A;  2XEV A;  1W3B A;  5LCW J;  5D0O D;  5C1D A;  3QDN A; 
#chains in the Genus database with same CATH topology
 1OUV A;  3FUL A;  1MX6 A;  2CHW A;  4F6R D;  3U9W A;  3RIB A;  1Y6I A;  2ZGG A;  1HF8 A;  1Z5S C;  4HQD A;  5G04 J;  1RZ4 A;  5FQ8 A;  2IU1 A;  2FO1 E;  4BEP A;  3RO3 A;  4L23 A;  1ELK A;  4H7X A;  4AIF A;  1XGW A;  4J7W A;  4F1S A;  1HS6 A;  2YIN A;  4AXH A;  4A63 B;  2F0Y A;  4N39 A;  2OVB A;  2LAH A;  4GZD A;  3R7R A;  3FU3 A;  2DZN A;  4CGV A;  1TNU A;  1WM5 A;  2H6H A;  3QKY A;  1MZC A;  2PZI A;  4X8Q A;  4HOS A;  3Q78 A;  1V54 E;  3SFZ A;  2WXJ A;  3E37 A;  3HIZ A;  2GRR B;  2RD0 A;  2OND A;  2J09 A;  3ZHE A;  4DPR A;  3OXG A;  2BKK B;  2ETC A;  3BG1 B;  2WXM A;  2DBA A;  4JB8 P;  3MGB A;  2CFZ A;  4ATZ D;  2XPZ A;  3QK0 A;  2V5F A;  4G23 A;  4AP2 A;  4F53 A;  2WXR A;  2KBX A;  3FWV A;  4JHK A;  2FEZ A;  4XI9 A;  3E30 A;  5KJN A;  4ILH B;  2KCV A;  1W3B A;  2WXP A;  4ATG A;  1U3D A;  1UJK A;  5EIB E;  4L9P A;  2HO1 A;  2Y4T A;  5CBN A;  5CRV A;  3L13 A;  4HRL A;  4UI9 K;  2WXK A;  3NOG D;  1G3N B;  2AXZ A;  4Q96 A;  5HRY A;  1N4S A;  4CDM A;  3ZXS A;  4J8F A;  5FWQ A;  4TXP A;  3KSQ A;  2VGX B;  5FQ6 A;  5B3S E;  1K3Z D;  4K0R A;  4LNG A;  1QZ2 A;  2VSN A;  1YYH A;  1KZO A;  1E8X A;  3B7R L;  4UI9 J;  5CER B;  4GA2 A;  4GU5 A;  3QOU A;  3V2O A;  1P5Q A;  1QBQ A;  1IXV A;  2IY0 C;  3CVY A;  4RG9 A;  5JMN D;  1BD8 A;  3QWV A;  3CVX A;  3FDH A;  3LVQ E;  3WG7 E;  4U8Y D;  2V0P A;  3RRM B;  1O1R A;  1FCH A;  3EIQ C;  5LP0 A;  3BG0 B;  3D9L A;  2XGM A;  2MRI A;  4J6I A;  2BUG A;  3ESL A;  5AAO A;  1H2U A;  3V79 K;  2VGY A;  1SA5 A;  3GZS A;  1O5M A;  2JEK A;  2WXH A;  3KSL A;  2WMO A;  3CHP A;  1D9S A;  3CHR A;  1OCC E;  2LSU A;  2M63 A;  1HO8 A;  3CKB A;  3D9O A;  4JEU A;  2XRZ A;  2XRY A;  5JHA A;  1ZBP A;  5BT1 A;  3DPY A;  2DZO A;  4BWR A;  5AN8 A;  1HH8 A;  1LTX A;  4K5C A;  4L2L A;  1OCO E;  3DSS A;  3AJI A;  4AJW A;  3I4R B;  3CST A;  2KM4 A;  2WQ7 A;  2WXL A;  3B95 A;  4I9C A;  1WG0 A;  4OVU A;  2NC9 A;  5E75 A;  4WNG A;  5KNG A;  3B7T A;  4U07 A;  2KCL A;  3AG1 E;  3ULE G;  2J9Q A;  3HXB A;  1TYQ G;  1IQR A;  3MZL B;  4HOU A;  4HI8 A;  2F8X K;  3MKQ A;  5KCM A;  3BU8 A;  5EID A;  4GZ5 A;  3CR3 A;  1IKN D;  2BF0 X;  4GMJ A;  2KZT A;  5AQB A;  1BPO A;  3Q47 B;  4GTT A;  2XGO A;  3ZYK A;  4RSY A;  3NQP A;  3DRA A;  3CHS A;  1EPU A;  3QB2 A;  4BSX A;  3RAU A;  3FUJ A;  3L54 A;  2CG2 A;  4UUC A;  2NXP A;  5KJK A;  4G24 A;  3NF1 A;  1EYH A;  2WM9 A;  4HLL A;  2Y3A A;  1MHQ A;  3D9M A;  3L17 A;  4U04 A;  2P9L G;  2GRO B;  3V30 A;  2RKK A;  4G8K A;  3E4B A;  4O60 A;  2P9S G;  3Q7F A;  2QY7 A;  4RQI A;  1NFI E;  3EU5 A;  1UOH A;  4DJA A;  4HLE A;  3HDX A;  4FP7 A;  5JJT A;  2WXO A;  2VGE A;  3KD7 A;  1IQU A;  1U2V G;  5ENP D;  5ARF A;  2IOL A;  4I1M A;  2I1K A;  1NL4 A;  1BLX B;  4U0S A;  2I1J A;  2JAB A;  4EBA A;  4ILI A;  4TUM A;  4BET A;  4B8A A;  3ASH A;  2ETB A;  3LS8 A;  2H6I A;  2XCB A;  4B0Z A;  3IXE A;  5CBO A;  1H6P A;  2GW1 A;  1IHB A;  2J07 A;  3FUF A;  2J4D A;  1U3C A;  3J5Q B;  3NZU A;  5EX3 A;  4UWL A;  4GTQ A;  4EZK A;  5EYL A;  3FU5 A;  4A3V A;  1H6K A;  4WND A;  2PNN A;  3DPD A;  3FUI A;  2UY1 B;  3DSV A;  4JXT A;  3ZVV A;  5CMW A;  3SHF A;  2IO3 C;  4DI4 A;  4XX5 A;  3JUI A;  4IUL A;  4E85 A;  3EHQ A;  4C48 B;  3AG3 E;  3ONL A;  4PS7 A;  1PAQ A;  3UQ3 A;  4YDW A;  4EPZ A;  3Q7A A;  5BV1 A;  4IN3 B;  1FVF A;  4UWG A;  3JXJ A;  4C9B B;  3ZN3 A;  4I43 A;  4EHM A;  3ENE A;  4I9E A;  2V5Q C;  1WY6 A;  2X3M A;  3I3N A;  3CKC A;  1H2T C;  1D8D A;  4O1P A;  2HE0 A;  1NI1 A;  3GZ2 A;  3OXL A;  3FUN A;  2L6B A;  1S64 A;  4CDR A;  3TWR A;  4MKT A;  1S70 B;  2HR2 A;  4GTO A;  4F3V A;  3PH0 C;  4ANV A;  3SNX A;  1TNB A;  4BSZ B;  3AG4 E;  3Q5M A;  3QWW A;  3FY4 A;  3LCA A;  3HVE B;  1AP7 A;  5D66 A;  4MS6 A;  2A5E A;  4TXQ A;  4FJZ A;  1Q2Z A;  4XKC A;  5AJL A;  3NOC D;  4OYS A;  3TWV A;  1HX8 A;  3URZ A;  2C2L A;  4A1G A;  2OVF A;  3CK8 A;  2DCP A;  1SZ9 A;  3DXM G;  5CRU A;  1INZ A;  5CCM A;  1E8W A;  3PZ3 A;  4GZC A;  2VTB B;  4FC8 A;  2J4B A;  4HNA D;  2F8Y A;  2IQC A;  4FLB A;  1S63 A;  2XGS A;  3F6Q A;  1E8Z A;  5A6C A;  1LF8 A;  4TRQ A;  3DBS A;  4U8H A;  3G2S A;  1MJ0 A;  4EBA G;  3GYZ A;  4CEM A;  3G2V A;  4J8Y A;  2UWJ G;  3OAW A;  2XHE A;  3SFX A;  3TWT A;  3PNT B;  1A5E A;  1GW6 A;  3S7J A;  4HOT A;  1MYO A;  2NYJ A;  2AW6 A;  4CT0 A;  1VDY A;  3HRA A;  3MKQ B;  3MV3 B;  2XZD G;  3L16 A;  2GRQ B;  3UTM A;  4UI9 C;  3CQG B;  4GTP A;  4LCT A;  2BKG A;  5JJ6 A;  4ANU A;  4N2S A;  3HVE A;  4CRW A;  5LCW C;  3CGH A;  4CGW A;  2PL2 A;  2DVW A;  4O6F A;  3FEX A;  1ZB1 A;  3ZIM A;  3HYM B;  4KYO B;  2GRN B;  3J5P A;  3VLF A;  1IHG A;  1SZA A;  4TV3 A;  4GCO A;  4IRU A;  4B94 A;  1OT8 A;  4A55 A;  3C3Q A;  2PQR A;  2HYZ A;  4XKB A;  4AV7 A;  3HXF A;  3LEW A;  5FTP A;  3UM3 A;  1UN8 A;  5LCW J;  5C1D A;  2VJ8 A;  4JHR A;  1TJC A;  3LY8 A;  3FUM A;  3EHM A;  4N5C A;  4BER A;  4GPM A;  2Y69 E;  5T3R A;  3CVN A;  2LXM A;  4HI9 A;  3OTN A;  2KAT A;  3ABL E;  1L5J A;  5BV0 A;  3ASN E;  2VQ2 A;  2ZU6 B;  4B93 B;  3NZS A;  2R02 A;  4N3C A;  2P9N G;  3D9P A;  4UWH A;  2AXV A;  4N3B A;  4BES A;  1V55 E;  5G55 A;  4BFR A;  2GRL A;  2XZT G;  1EF1 C;  3EDT B;  4JA9 A;  4K5B A;  5A23 A;  1JUQ A;  3LDZ A;  4DLQ A;  4BX9 A;  2EIJ E;  5EYP F;  3FTV A;  3C98 A;  3TG5 A;  2XQ0 A;  3TXN A;  3TL5 A;  3Q73 A;  4GPK A;  1S0P A;  2P2C P;  3UX4 A;  4PUC A;  4A1S A;  3ASO E;  5BXU A;  2L0T B;  1MX4 A;  1XNF A;  4K5A B;  1N9A A;  3MV2 B;  2LUH A;  4I6G A;  3BEE A;  3O4Z A;  1EDU A;  4ANW A;  4H7Y A;  3R9M A;  5DBK A;  5AJD A;  1K8K G;  5T4Y A;  3Q9N C;  1Z6T A;  3C3R A;  3PZ4 A;  4NIK A;  3ASD A;  3TAX A;  3GW4 A;  1TN8 A;  2FO7 A;  3PDN A;  3UXG A;  4ZHB A;  3JYS A;  4CYM D;  3WXX A;  1N54 A;  3Q49 B;  5ENS D;  4DLO A;  4C0M A;  4YDE A;  4JD2 G;  2Y0B G;  3FEY A;  2WVI A;  1X5B A;  1DCQ A;  4AM9 A;  4V3I A;  2E2E A;  3QNK A;  3VLD A;  4AVX A;  4GTS A;  1KPS B;  1HG2 A;  5FJY A;  5CEC B;  3AS4 A;  4ILG A;  5LOZ A;  3P2B A;  5A7D B;  1YA0 A;  3LXU X;  3APF A;  3EUV A;  3FTW A;  4GYO A;  3OXF A;  4MBG A;  2I2O A;  2WQH A;  3ASG A;  2OV8 A;  1Y8M A;  3S2A A;  3L82 A;  2CFU A;  3S7F A;  3EHN A;  4C0E A;  3SD5 A;  3HXC A;  5ENN A;  3NAW A;  1N0Q A;  3PE3 A;  1RW2 A;  2RFM A;  4WAF A;  3BQO A;  4XIF A;  2ZGD A;  3CLJ A;  4F1P A;  4FA6 A;  5CHE E;  2WXG A;  4GTR A;  5D2M C;  5ENQ D;  4FJY A;  3TWW A;  4KMO A;  4PDX A;  4KZ0 A;  5G05 C;  4Y6C A;  3L22 A;  3QAR A;  4EZJ A;  4I2W A;  5ITZ F;  1OCR E;  2NSZ A;  2ETA A;  2CHZ A;  1E96 B;  4CT4 A;  3RSE G;  1N0R A;  1AWC B;  2L9B A;  5C2Y A;  4CZ2 D;  5BXO A;  4KT6 B;  1N11 A;  4Q69 A;  3CV0 A;  2IJG X;  3GZ1 A;  4LRZ A;  3MCX A;  1O1T A;  3UI2 A;  3C3O A;  1D8E A;  1JWG A;  3ESK A;  2AXU A;  3QJZ A;  3SY2 A;  4F7A A;  1E7V A;  2DWZ A;  4DX1 A;  2GGF A;  5FT9 A;  4U63 A;  1OWL A;  3VTY A;  4E6H A;  3PVL A;  5CEA A;  1LD7 A;  4HXI A;  3SBS A;  1N4P A;  4GA0 A;  1LD8 A;  1TNY A;  4ACK A;  5KJL A;  2Y4U A;  5ANR A;  4NAC A;  4NUR A;  1NP7 A;  4U96 D;  3UIN C;  3Q75 A;  5FZS A;  3FU6 A;  2VSY A;  1NA3 A;  2AWI A;  3Q4A B;  2MYO A;  2QZA A;  3PS6 A;  3CK7 A;  2OEV A;  3IEG A;  5M72 A;  2KXP C;  3E34 A;  3CIA A;  3B13 A;  2C0M A;  2RFA A;  4LNB A;  3BUA A;  3IHY A;  2I6H A;  4HBD A;  3ML8 A;  2X6K A;  4OAV B;  4EEC A;  1QNF A;  4GZ3 A;  3JQ1 A;  4I6E A;  4P29 A;  1N4Q A;  3CVV A;  5AAR A;  4DX7 D;  5ENT D;  3DSW A;  4DX6 D;  2QYU A;  3CK9 A;  4I17 A;  3ISM C;  5AQ7 A;  3U4T A;  3LVR E;  4J0U A;  3FP3 A;  4DI3 A;  3TWX A;  3ZYQ A;  4PS8 A;  4FLH A;  5D0O D;  4O1O A;  4HOR A;  3QAQ A;  4K03 A;  3ZKJ A;  2XS8 A;  4AY6 A;  4APO A;  4AY5 A;  5ENO D;  4G26 A;  3D9H A;  4L2Y A;  5FZQ A;  2X6F A;  1K1A A;  4JEH A;  1DNP A;  1N4R A;  1IYG A;  2WXQ A;  4UWK A;  4J8S A;  4JZY A;  5EDS A;  3ABK E;  1E7U A;  3CSF A;  4L1B A;  5EN5 D;  4BTA A;  3PEU B;  2FUL A;  2VTB A;  1JWF A;  1OWN A;  3ZU7 B;  1SA4 A;  3L08 A;  4DX5 D;  5B1A E;  2KZT B;  3Q79 A;  2DYS E;  5AEN A;  2AJA A;  3AS8 A;  4WWO A;  4I1A A;  2QC9 A;  5E76 A;  1BI8 B;  5ANL A;  2JLB A;  4U95 D;  1H2V C;  3AU5 A;  1JPL A;  1HG5 A;  3I5P A;  2RG8 A;  4U8V D;  5AQ9 A;  2QFC A;  4IYP A;  2H6G A;  3KAE A;  1N95 A;  2ZIS A;  2P9I G;  4KZC A;  4GA1 A;  2DYR E;  4B8C B;  2WXI A;  4BT9 A;  3PZ1 A;  2FBN A;  3DSX A;  4NQ0 A;  4I6J A;  3AS5 A;  3JXI A;  4ZFH A;  5CMY A;  2IEJ A;  3UM2 A;  3UKU G;  1SVX A;  1NZN A;  2R17 C;  4J8E A;  1N52 A;  4W9R A;  4WUY A;  2PQN A;  3ML9 A;  3E32 A;  1OXJ A;  5EX0 A;  3T8K A;  3CEQ A;  5ENR D;  3R9A B;  4FU3 A;  3ZRH A;  4BY6 A;  2KC7 A;  4FUL A;  3LY9 A;  4KBQ A;  5FIN A;  3UUX A;  1TEZ A;  5ARG A;  2H6F A;  3U64 A;  1MX2 A;  5KBA A;  1A17 A;  4GYW A;  4M7C A;  1WAO 1;  4GZ6 A;  5BW8 C;  5FQ4 A;  4L7T A;  2P9U G;  3LKU A;  4M3O A;  4NRH B;  4RLY A;  3EIJ A;  3LYA A;  2LNI A;  1YCS B;  4CCA A;  4JL0 A;  4R7L A;  3RK6 A;  3RRN B;  4U0Z A;  3SGH A;  4JHJ A;  3G2T A;  4JA7 A;  1TNZ A;  4Z68 A;  2FF4 A;  2C0L A;  4LER A;  4A3T A;  4N3A A;  5HI7 A;  2IO2 C;  3T9K A;  3EJN A;  3PZD A;  3C5R A;  5J90 A;  3G2W A;  3U3W A;  4ANX A;  1TJF A;  2VSO E;  4UQY A;  1E8Y A;  1TN6 A;  3N71 A;  3CVP A;  1QYM A;  4MLP A;  4CDN A;  2PM7 A;  4WWP A;  4DX2 A;  2X6I A;  2YNQ A;  4EZL A;  3QDN A;  2VSX E;  1OWM A;  5LFA A;  1OCZ E;  1B89 A;  1X81 A;  3ASF A;  1ELW A;  3DWL G;  3FH5 A;  3TXM A;  2R59 A;  3APD A;  5AYW D;  1HFA A;  3IV0 A;  4G1T A;  5HKP A;  3ZYM A;  3FTY A;  3MA5 A;  3T5X A;  2LAI A;  5JJ7 A;  1DC2 A;  2IFU A;  3MJW A;  3D9J A;  4JW1 A;  5G04 C;  3LY7 A;  5HQ8 A;  3IKO B;  5LX8 A;  1O1S A;  2X6J A;  3FUK A;  1ZU2 A;  3JCK C;  2MHK A;  4GYY A;  4XE0 A;  3UT8 A;  3RU0 A;  2ZIR A;  2V8S E;  2XEH A;  3U66 A;  2YQ8 A;  1UJJ A;  4JVS A;  4OAU C;  4AOF A;  2J49 A;  3FUD A;  2XCC A;  1SQM A;  4DUI A;  2P9K G;  4YDO A;  4PS3 A;  2VGX A;  3KEA A;  1HE8 A;  3FTU A;  4HRN A;  4TUU A;  3DSU A;  2KCK A;  3UM0 A;  3UT4 A;  5EKQ D;  3AG2 E;  4I2Z A;  3R7Q A;  1TNO A;  3TWS A;  3FUE A;  2ILR A;  3UM1 A;  1JCR A;  3ZPJ A;  2A5U A;  4ME2 A;  5CED B;  4BT8 A;  3NB2 A;  2R5S A;  1KLX A;  4G8L A;  3CHO A;  1SW6 A;  2R03 A;  4TXR A;  5HS0 A;  3UMV A;  3V31 A;  4PH4 B;  4HS2 A;  2E0I A;  2EIM E;  4WWN A;  4KVM A;  4HFG A;  1DVP A;  3D3M A;  3Q9U C;  3SI5 A;  2WXF A;  2LXL A;  3MYV A;  3KS2 A;  4HOQ A;  1FPP A;  4AEZ C;  2Y1L E;  1UG3 A;  2BED A;  2PM6 A;  4RG6 A;  2IOS A;  5FQ7 A;  2CHX A;  3ZW3 A;  2OEW A;  2WPV A;  3QC1 A;  4JPS A;  3I4G A;  4DK5 A;  1E90 A;  3MEK A;  3SFY A;  1ELR A;  5B1B E;  3VLE A;  3EHR A;  2WB2 A;  1FT2 A;  2OOE A;  4WNF A;  5JHB A;  3HXD A;  3SQV A;  5H7P A;  3FUH A;  2X38 A;  3K9I A;  4Q94 A;  2GRM A;  3D9K A;  3FTX A;  5KNH D;  3PRE A;  3L9T A;  4FHJ A;  1PC2 A;  4QQI A;  2ION A;  5G2N A;  4LG6 A;  2I9C A;  3ZXP A;  2WQ6 A;  2P58 C;  3S7D A;  4LUN U;  3FTS A;  3CVL A;  3UIO C;  3PRZ A;  4XEI G;  1UW4 B;  4KXK B;  5EIL A;  1MQS A;  3DST A;  1BI7 B;  3KEZ A;  5AIJ A;  2F37 A;  3APC A;  4G25 A;  3TG4 A;  4APF A;  2VYI A;  3ZHE B;  5G05 J;  3C72 A;  3ZFW A;  4WNE A;  2YHE A;  1HU3 A;  3CHQ A;  3SO8 A;  3UT7 A;  1Z3Y A;  3RO2 A;  1KT0 A;  1PY1 A;  4FHK A;  4GCN A;  5KWD A;  3UIP C;  3CVU A;  4KVO A;  2BTD A;  3TWU A;  3FU0 A;  3D9N A;  2WXN A;  4J8D A;  4UQZ A;  2EIK E;  2OCC E;  1DCE A;  3DXK G;  4XI0 A;  4U0U A;  2J08 A;  3HXE A;  1FVH A;  3PZ2 A;  1OWO A;  3RJV A;  3EU9 A;  1H6O A;  3UKR G;  3UPV A;  2XEE A;  1OY3 D;  3SZ7 A;  1BU9 A;  2XPY A;  3TWQ A;  4MRU A;  4XZ4 A;  1OWP A;  2L6J A;  2EIN E;  3CHM A;  3P1U A;  2XEV A;  2B6C A;  3PUK A;  2LO6 A;  3DEO A;  4ABN A;  1Z3X A;  4DRX E;  4FAD A;  4YND A;  2ZXW E;  4LNU D;  3PUJ A;  3JQ0 A;  3FHE A;  3Q15 A;  3AU4 A;  3CVW A;  4URK A;  3T8M A;  2IF4 A;  4ACL A;  2HM8 A;  2WMN A;  3D9I A;  3SBT B;  3CVQ A;  2R2L A;  3ZYL A;  4YVQ C;  2A4Z A;  3NBN B;  2UY1 A;  4I1O B;  4Y6W A;  3L6A A;  4QFV A;  4OVV A;  2L0I A;  1HZ4 A;  5D0Q D;  1H0A A;  4GAA A;  3MKR A;  3O48 A;  3IBE A;  5AQA A;  3W9G A;  4G11 A;  1FT1 A;  1TR4 A;  2YHC A;  5J08 A;  4B89 A;  1YMP A;  5JA4 D;  3B7U X;  4GTV A;  3IHV A;  4LSZ E;  3FH8 A;  5IY5 E;  4U7E B;  1JCQ A;  2CG3 A;  2XS1 A;  3FTZ A;  4YVO A;  4BTB A;  3T5V A;  4GB9 A;  1KZP A;  3V2X A;  1UN9 A;  3TGO A;  3ULQ A;  4GTM A;  2X6H A;  1K1B A;  5T8I A;  3ZUV B;  4N5Q A;  2EQX A;  2FI7 A;  3DEP A;  3FFL A;  5BPP A;  4EQF A;  3ULY A;  3ZEF A;  4HRM B;  3G2U A;  3JUE A;  3HHM A;  3MX3 A;  4N2Q A;  4YDY A;  3RKV A;  4HB5 A;  4GMR A;  4G2V A;  5KJM A;  3LJ3 A;  2DIW A;  1N94 A;  3ABM E;  4UWF A;  2QYJ A;  1KT1 A;  3LPZ A;  4RVB A;  1JCS A;  2Q7F A;  4HVB A;  4JC8 A;  1QQE A;  1NA0 A;  4BX8 A;  4D10 C;  3FH7 A;  5BUZ A;  2B0O E;  2V4H C;  1HXI A;  2AVP A;  3ZNG A;  3X2Q E;  3CQC B;  3VTX A;  3QWP A;  3TJP A;  3S7B A;  1TN7 A;  3W9F A;  5CCL A;  2V4L A;  3PE4 A;  3ONK A;  1H19 A;  2J8S D;  2MOW A;  3B7S A;  5DIZ A;  3RRU A;  1WDY A;  2XEN A;  2R05 A;  2P9P G;  5BNW A;  3PNL B;  2XPI A;  3SF4 A;  3PEV B;  4UQX A;  3B7B A;  3LJN A;  2LSV A;  5FIO A;  2EIL E;  4GML A;  3AAA C;  3E33 A;  3ZGQ A;  5FZR A;  3HG0 D;  4LEU A;  2GRP B; 
#chains in the Genus database with same CATH homology
 1OUV A;  2CHZ A;  3FUL A;  1E96 B;  2CHW A;  4E85 A;  4CT4 A;  3ZPJ A;  3U9W A;  2A5U A;  2L9B A;  5C2Y A;  4KT6 B;  3RIB A;  4ME2 A;  1Y6I A;  1HF8 A;  4BT8 A;  4Q69 A;  3CV0 A;  2IJG X;  5G04 J;  5FQ8 A;  3GZ1 A;  2IU1 A;  3ONL A;  4LRZ A;  3MCX A;  4PS7 A;  1PAQ A;  2R5S A;  1KLX A;  3UQ3 A;  3CHO A;  4EPZ A;  1JWG A;  3UMV A;  4IN3 B;  3ESK A;  2AXU A;  3QJZ A;  4PH4 B;  3RO3 A;  1FVF A;  5BV1 A;  4F7A A;  1E7V A;  4HS2 A;  4L23 A;  4UWG A;  1ELK A;  2E0I A;  4C9B B;  4H7X A;  3ZN3 A;  4WWN A;  2GGF A;  4KVM A;  5FT9 A;  4AIF A;  4I43 A;  1XGW A;  4HFG A;  1DVP A;  4U63 A;  3D3M A;  1OWL A;  3VTY A;  3ENE A;  1HS6 A;  2YIN A;  4I9E A;  4E6H A;  4F1S A;  3PVL A;  1WY6 A;  4AXH A;  4N39 A;  2X3M A;  3I3N A;  2OVB A;  2LAH A;  4GZD A;  3SI5 A;  3CKC A;  1H2T C;  2WXF A;  4HXI A;  3R7R A;  3FU3 A;  3SBS A;  3MYV A;  4CGV A;  4GA0 A;  3GZ2 A;  1WM5 A;  3FUN A;  3OXL A;  3QKY A;  3KS2 A;  4ACK A;  2PZI A;  4HOQ A;  4CDR A;  2Y4U A;  5KJL A;  4MKT A;  2HR2 A;  4AEZ C;  4F3V A;  5ANR A;  4HOS A;  4NAC A;  4NUR A;  1NP7 A;  1UG3 A;  3PH0 C;  4ANV A;  3SNX A;  2PM6 A;  4RG6 A;  2IOS A;  2VSY A;  3FU6 A;  5FQ7 A;  5FZS A;  2CHX A;  1NA3 A;  3SFZ A;  3Q5M A;  3QWW A;  2WXJ A;  2AWI A;  3FY4 A;  3HIZ A;  3LCA A;  3Q4A B;  2RD0 A;  3ZW3 A;  3HVE B;  3PS6 A;  3CK7 A;  4MS6 A;  2WPV A;  2OND A;  2J09 A;  3QC1 A;  3IEG A;  5M72 A;  3ZHE A;  4FJZ A;  4JPS A;  4DPR A;  3OXG A;  4XKC A;  3CIA A;  3B13 A;  2C0M A;  3I4G A;  5AJL A;  4DK5 A;  4OYS A;  1E90 A;  3IHY A;  3MEK A;  1HX8 A;  2I6H A;  3URZ A;  2C2L A;  3ML8 A;  4A1G A;  3BG1 B;  1ELR A;  2DBA A;  2OVF A;  2X6K A;  2WXM A;  4EEC A;  3CK8 A;  2DCP A;  3VLE A;  3MGB A;  2CFZ A;  1QNF A;  4GZ3 A;  2XPZ A;  3JQ1 A;  3QK0 A;  2V5F A;  4G23 A;  4I6E A;  4P29 A;  2WB2 A;  2OOE A;  4WNF A;  5JHB A;  1SZ9 A;  3CVV A;  1INZ A;  4AP2 A;  3CK9 A;  4I17 A;  3FUH A;  4F53 A;  2X38 A;  2WXR A;  3K9I A;  5CCM A;  3FWV A;  3U4T A;  4JHK A;  2FEZ A;  3LVR E;  4J0U A;  4Q94 A;  2GRM A;  3FP3 A;  3D9K A;  4XI9 A;  1E8W A;  4DI3 A;  3ZYQ A;  4GZC A;  2VTB B;  3FTX A;  4FC8 A;  5KJN A;  2J4B A;  4ILH B;  2KCV A;  4PS8 A;  1W3B A;  2WXP A;  4FLH A;  5D0O D;  4HOR A;  3PRE A;  2IQC A;  1U3D A;  4FLB A;  3QAQ A;  4K03 A;  4ATG A;  1UJK A;  2XGS A;  1E8Z A;  4FHJ A;  1PC2 A;  4AY6 A;  4APO A;  4AY5 A;  2ION A;  5G2N A;  4G26 A;  5A6C A;  2HO1 A;  1LF8 A;  2Y4T A;  4TRQ A;  3DBS A;  4U8H A;  3G2S A;  4EBA G;  3L13 A;  2I9C A;  4UI9 K;  4L2Y A;  2WQ6 A;  3GYZ A;  2P58 C;  3S7D A;  4CEM A;  2WXK A;  4LUN U;  3FTS A;  5FZQ A;  2AXZ A;  2X6F A;  4JEH A;  3G2V A;  1DNP A;  3CVL A;  2UWJ G;  1IYG A;  3OAW A;  2XHE A;  4Q96 A;  3PRZ A;  3PNT B;  1UW4 B;  2WXQ A;  4KXK B;  1GW6 A;  4CDM A;  1MQS A;  4UWK A;  3S7J A;  4HOT A;  3ZXS A;  4J8F A;  4J8S A;  5FWQ A;  2AW6 A;  3KEZ A;  4CT0 A;  5AIJ A;  2VGX B;  1VDY A;  4JZY A;  5FQ6 A;  5EDS A;  3MKQ B;  4K0R A;  3MV3 B;  1QZ2 A;  2VSN A;  3APC A;  4G25 A;  3TG4 A;  4APF A;  1E7U A;  3L16 A;  2VYI A;  3CSF A;  4L1B A;  4UI9 C;  3ZHE B;  1E8X A;  3CQG B;  5G05 J;  4LCT A;  3B7R L;  4BTA A;  3PEU B;  2FUL A;  4UI9 J;  5JJ6 A;  4GA2 A;  4GU5 A;  2VTB A;  4ANU A;  3QOU A;  4N2S A;  1P5Q A;  3HVE A;  4CRW A;  3ZFW A;  4WNE A;  2YHE A;  1HU3 A;  3CHQ A;  1JWF A;  1OWN A;  3UT7 A;  1Z3Y A;  3CVY A;  5LCW C;  3CGH A;  4RG9 A;  3L08 A;  3RO2 A;  1KT0 A;  4CGW A;  2PL2 A;  1PY1 A;  2KZT B;  4O6F A;  3QWV A;  4FHK A;  3CVX A;  4GCN A;  3FDH A;  3LVQ E;  3FEX A;  3CVU A;  3ZIM A;  5AEN A;  3HYM B;  3AS8 A;  4KYO B;  4KVO A;  3VLF A;  1IHG A;  1SZA A;  2BTD A;  2V0P A;  4WWO A;  4I1A A;  3FU0 A;  4TV3 A;  4GCO A;  5E76 A;  3D9N A;  3RRM B;  2WXN A;  4IRU A;  1FCH A;  4J8D A;  4B94 A;  4UQZ A;  5ANL A;  2JLB A;  1H2V C;  3AU5 A;  3EIQ C;  1JPL A;  1HG5 A;  4A55 A;  4XI0 A;  5LP0 A;  3BG0 B;  2J08 A;  4U0U A;  3D9L A;  1FVH A;  2RG8 A;  3I5P A;  2XGM A;  1OWO A;  2MRI A;  4J6I A;  2PQR A;  2QFC A;  3RJV A;  2HYZ A;  4IYP A;  4XKB A;  2BUG A;  3ESL A;  1H2U A;  3UPV A;  2VGY A;  3SZ7 A;  3KAE A;  4AV7 A;  2XPY A;  3GZS A;  4MRU A;  4KZC A;  4GA1 A;  3LEW A;  5FTP A;  4B8C B;  2WXI A;  4BT9 A;  1UN8 A;  4XZ4 A;  2JEK A;  2WXH A;  2WMO A;  1OWP A;  2L6J A;  3CHP A;  3CHR A;  2LSU A;  2M63 A;  3D9O A;  1HO8 A;  3CHM A;  3CKB A;  2XEV A;  3P1U A;  4JEU A;  2XRZ A;  5LCW J;  2XRY A;  5C1D A;  5JHA A;  3PUK A;  2VJ8 A;  2FBN A;  4JHR A;  2LO6 A;  1ZBP A;  1TJC A;  5BT1 A;  4NQ0 A;  4I6J A;  3LY8 A;  4ABN A;  3FUM A;  3AS5 A;  1Z3X A;  3EHM A;  4N5C A;  5CMY A;  4FAD A;  4YND A;  4BWR A;  3PUJ A;  3JQ0 A;  5T3R A;  1HH8 A;  3CVN A;  3FHE A;  3Q15 A;  3AU4 A;  3CVW A;  4URK A;  4L2L A;  3T8M A;  2IF4 A;  3OTN A;  4AJW A;  2KAT A;  3I4R B;  1NZN A;  2R17 C;  3CST A;  4ACL A;  1L5J A;  2HM8 A;  5BV0 A;  2WMN A;  3D9I A;  4J8E A;  2KM4 A;  3SBT B;  1N52 A;  2WQ7 A;  2WXL A;  2VQ2 A;  2ZU6 B;  3CVQ A;  4W9R A;  4WUY A;  3NZS A;  3ZYL A;  4N3C A;  4YVQ C;  2PQN A;  4I9C A;  3ML9 A;  5EX0 A;  2A4Z A;  3D9P A;  4UWH A;  2AXV A;  4N3B A;  4OVU A;  5E75 A;  2NC9 A;  2UY1 A;  3CEQ A;  5G55 A;  4I1O B;  4FU3 A;  4WNG A;  3R9A B;  3ZRH A;  4BY6 A;  4BFR A;  4Y6W A;  2KC7 A;  4FUL A;  2GRL A;  3B7T A;  3L6A A;  3LY9 A;  4KBQ A;  4U07 A;  3UUX A;  1EF1 C;  3EDT B;  2KCL A;  1TEZ A;  4JA9 A;  5ARG A;  4QFV A;  4OVV A;  3U64 A;  5A23 A;  1JUQ A;  3LDZ A;  2L0I A;  1HZ4 A;  5D0Q D;  1H0A A;  1A17 A;  4GAA A;  4GYW A;  4DLQ A;  2J9Q A;  4BX9 A;  3MKR A;  3O48 A;  1WAO 1;  3FTV A;  4GZ6 A;  3IBE A;  3C98 A;  3TG5 A;  5BW8 C;  1IQR A;  2XQ0 A;  4L7T A;  5FQ4 A;  3LKU A;  4M3O A;  4NRH B;  3TXN A;  3MZL B;  3EIJ A;  4HOU A;  3LYA A;  3TL5 A;  2LNI A;  4GPK A;  4G11 A;  1S0P A;  2YHC A;  4CCA A;  5J08 A;  4JL0 A;  4B89 A;  3MKQ A;  3B7U X;  4R7L A;  5KCM A;  3RK6 A;  3RRN B;  4PUC A;  3UX4 A;  4A1S A;  4U0Z A;  4GZ5 A;  3SGH A;  3IHV A;  3G2T A;  4JHJ A;  2L0T B;  3CR3 A;  2BF0 X;  4JA7 A;  4GMJ A;  1XNF A;  3FH8 A;  2KZT A;  1BPO A;  2FF4 A;  3Q47 B;  2C0L A;  4LER A;  2XGO A;  2CG3 A;  4A3T A;  3MV2 B;  4N3A A;  3FTZ A;  5HI7 A;  4YVO A;  3EJN A;  3PZD A;  3ZYK A;  4RSY A;  5J90 A;  3NQP A;  3G2W A;  4BTB A;  3T5V A;  3U3W A;  4ANX A;  1TJF A;  1EPU A;  3CHS A;  4GB9 A;  4I6G A;  3BEE A;  3O4Z A;  3QB2 A;  4BSX A;  2VSO E;  4UQY A;  1E8Y A;  1EDU A;  4ANW A;  4H7Y A;  3N71 A;  1UN9 A;  3FUJ A;  3L54 A;  2CG2 A;  3TGO A;  3CVP A;  2NXP A;  5KJK A;  3ULQ A;  5DBK A;  4G24 A;  4MLP A;  4CDN A;  2PM7 A;  3NF1 A;  1EYH A;  2WM9 A;  2X6H A;  4WWP A;  5AJD A;  5T8I A;  5T4Y A;  2X6I A;  2Y3A A;  1MHQ A;  2YNQ A;  4EZL A;  3D9M A;  3QDN A;  2VSX E;  1OWM A;  3L17 A;  5LFA A;  4U04 A;  1Z6T A;  2EQX A;  3ASD A;  3TAX A;  2FI7 A;  3GW4 A;  3FFL A;  5BPP A;  1B89 A;  3ASF A;  3E4B A;  1ELW A;  2FO7 A;  4EQF A;  3PDN A;  2QY7 A;  3ZEF A;  3G2U A;  3JYS A;  3HHM A;  3MX3 A;  3FH5 A;  3TXM A;  3WXX A;  4N2Q A;  2R59 A;  1N54 A;  4DJA A;  3Q49 B;  3HDX A;  3RKV A;  3APD A;  4HLE A;  5AYW D;  1HFA A;  3IV0 A;  4FP7 A;  4DLO A;  4C0M A;  4G1T A;  5JJT A;  2WXO A;  4G2V A;  5KJM A;  3FEY A;  3LJ3 A;  2DIW A;  3ZYM A;  3KD7 A;  4UWF A;  3FTY A;  3MA5 A;  2WVI A;  1KT1 A;  1IQU A;  1X5B A;  3LPZ A;  3T5X A;  2LAI A;  5JJ7 A;  4AM9 A;  4V3I A;  2E2E A;  3QNK A;  2Q7F A;  4RVB A;  3VLD A;  4HVB A;  2IFU A;  5ARF A;  3MJW A;  2IOL A;  3D9J A;  4JW1 A;  4I1M A;  2I1K A;  5G04 C;  4AVX A;  1HG2 A;  4JC8 A;  5FJY A;  3LY7 A;  1QQE A;  1NA0 A;  4U0S A;  5HQ8 A;  3IKO B;  4BX8 A;  2X6J A;  3AS4 A;  5LX8 A;  4ILG A;  2I1J A;  3FH7 A;  4D10 C;  5BUZ A;  4EBA A;  5LOZ A;  3P2B A;  3FUK A;  4ILI A;  5A7D B;  1YA0 A;  1ZU2 A;  4B8A A;  3ASH A;  3JCK C;  3LXU X;  2MHK A;  3APF A;  3LS8 A;  1HXI A;  2AVP A;  2XCB A;  3FTW A;  4GYY A;  4XE0 A;  4B0Z A;  3UT8 A;  3RU0 A;  3CQC B;  4GYO A;  3VTX A;  2GW1 A;  2V8S E;  3OXF A;  2YQ8 A;  1UJJ A;  3U66 A;  4JVS A;  3FUF A;  2J07 A;  3QWP A;  2I2O A;  2J4D A;  3TJP A;  3S7B A;  2WQH A;  1U3C A;  3ASG A;  2OV8 A;  4AOF A;  5CCL A;  1Y8M A;  2V4L A;  3S2A A;  2J49 A;  3FUD A;  3NZU A;  3PE4 A;  5EX3 A;  4UWL A;  3ONK A;  4EZK A;  1H19 A;  2XCC A;  2MOW A;  3FU5 A;  2CFU A;  3B7S A;  5DIZ A;  3S7F A;  4A3V A;  3EHN A;  1H6K A;  4C0E A;  1SQM A;  3RRU A;  3SD5 A;  4WND A;  5ENN A;  4PS3 A;  3DPD A;  3PE3 A;  3FUI A;  5BNW A;  4WAF A;  3PNL B;  2UY1 B;  2VGX A;  2XPI A;  1HE8 A;  4XIF A;  4JXT A;  3ZVV A;  3FTU A;  3CLJ A;  3SF4 A;  4FA6 A;  3PEV B;  4UQX A;  4TUU A;  5CHE E;  5CMW A;  2KCK A;  2WXG A;  3SHF A;  4FJY A;  3UT4 A;  4DI4 A;  2LSV A;  4KMO A;  4GML A;  4PDX A;  4KZ0 A;  5G05 C;  4Y6C A;  5EKQ D;  3L22 A;  3QAR A;  4EZJ A;  4I2Z A;  3R7Q A;  3ZGQ A;  4XX5 A;  4I2W A;  3JUI A;  5FZR A;  4LEU A;  4IUL A;  3FUE A;  2ILR A;  2NSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...