2XCBA

Crystal structure of pcrh in complex with the chaperone binding region of popd
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
133
structure length
133
Chain Sequence
MLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN PCRH
publication title Structural Basis of Chaperone Recognition of Type III Secretion System Minor Translocator Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein binding
total genus 60
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xcbA00
4KBQA 2VGXB 2UY1B 4J8EA 5DBKA 3WXXA 4AM9A 3ZN3A 5JJTA 1WM5A 3ZFWA 2VSNA 2XGSA 3MA5A 3LCAA 1HH8A 5BW8C 2KC7A 4H7XA 4GPKA 4APOA 2Y4UA 3LY9A 5JJ7A 3ASFA 2IF4A 3QWPA 5G05C 1XNFA 2Q7FA 5D0OD 4RG9A 2VYIA 4JA9A 2FI7A 4I1AA 3CVLA 1HZ4A 3U3WA 4AY6A 4HOSA 3OXFA 3RU0A 3LKUA 5HQ8A 4H7YA 5KJMA 5G04C 5JJ6A 5G05J 3UQ3A 3ZPJA 2YQ8A 5FT9A 2C0MA 3AS4A 3LPZA 2FEZA 2I6HA 3CEQA 4GA0A 3CVPA 4GZ5A 2FF4A 4WNFA 4HOUA 5DIZA 1A17A 3UUXA 4WNGA 4CGVA 5FZSA 5G04J 4HOTA 3CK7A 4U04A 1KLXA 4IN3B 2HO1A 3SF4A 3OXLA 3OXGA 4UI9J 3MKRA 4I9EA 4LEUA 2XCBA 3GW4A 2PZIA 4YVQC 3MV3B 1IYGA 2HR2A 4N2SA 4JHRA 3FP3A 2WQHA 4ME2A 1WAO1 4BT9A 1KT0A 4HORA 2FO7A 3QDNA 2Y4TA 5CHEE 3O48A 2DBAA 3KD7A 4I17A 2E2EA 3N71A 2P58C 2ONDA 4UQYA 5CCMA 2YHCA 2LSVA 3AS8A 4U0SA 4AY5A 4U0ZA 1ZBPA 2MHKA 3LY7A 3TG4A 4O6FA 3SZ7A 5D0QD 2PQRA 2FBNA 2JLBA 4GCOA 3CK9A 4GZ3A 4I2ZA 4U0UA 3TGOA 4BTBA 2LSUA 3U4TA 4HOQA 5M72A 1Y8MA 2L6JA 5FTPA 5HI7A 4GYWA 3S7JA 2KCVA 2KATA 4XIFA 3PDNA 3RJVA 4N3AA 4UI9C 3MEKA 2R5SA 3ASHA 4GYYA 4G24A 4GYOA 5FZRA 3NF1A 1NZNA 1NA0A 3S7FA 5CCLA 4UQXA 3CK8A 2LNIA 3GZ2A 3QWVA 1B89A 5A7DB 2HYZA 5KJNA 4YVOA 5KJKA 1KT1A 1P5QA 1TJCA 3EDTB 3S7BA 3QWWA 5FJYA 3FWVA 3BEEA 5A6CA 3S7DA 3QKYA 2GW1A 1ELWA 2NC9A 4GCNA 1QZ2A 2XCCA 4G25A 4N3CA 4UI9K 3ASGA 2BUGA 3LYAA 2PQNA 4JL0A 3CVQA 4KXKB 3CKBA 3VTXA 2C2LA 3Q49B 3QOUA 3JYSA 3ULQA 4N2QA 3Q5MA 1ZU2A 5FZQA 3Q15A 3CVNA 2XEVA 5EX3A 4BTAA 3PE3A 3RO3A 1FCHA 5BT1A 3KS2A 2AVPA 3CKCA 4B94A 3ZGQA 5LCWC 3ZHEA 3AS5A 1PC2A 4J8FA 3E4BA 3K9IA 4WUYA 3TG5A 2XGMA 4GA2A 2KCKA 4NRHB 3ASDA 2KCLA 4J0UA 2J9QA 3RKVA 4J8DA 4XI9A 4WNEA 3RO2A 4RG6A 2UWJG 3ZHEB 5LCWJ 4CGWA 3KAEA 3FFLA 3LY8A 1ELRA 1HXIA 4AIFA 5ARGA 3R9AB 4N39A 3CV0A 2PL2A 3TAXA 4EQFA 3URZA 3RIBA 4BWRA 5EX0A 1E96B 4YNDA 2QFCA 5KJLA 2VSYA 2WPVA 2XGOA 1QQEA 1W3BA 4G26A 4Y6CA 4BT8A 4WNDA 2XPIA 3PE4A 4N5CA 4W9RA 3Q4AB 4GZ6A 2OOEA 4KYOB 1YA0A 4G1TA 5AYWD 4G2VA 4G23A 3HYMB 3GZ1A 4U07A 1NA3A 5EKQD 1OUVA 3GYZA 4GA1A 4XI0A 4I2WA 3IEGA 5BNWA 4JA7A 3MV2B 2VGYA 4CDRA 2VGXA 2UY1A 2VQ2A 2IFUA 5C1DA 3VTYA 2C0LA 4ABNA 4N3BA 5ARFA 3Q47B 1IHGA 3ESKA 4Y6WA 4F3VA 2V5FA 4I9CA 4UQZA 3UPVA 4NQ0A 4A1SA
chains in the Genus database with same CATH superfamily
4FHJA 4GTOA 2CHZA 1K8KG 2UY1B 2IO3C 2WXNA 5DBKA 5JJTA 1TNZA 2F0YA 4UWLA 3MA5A 3LCAA 4QQIA 3UIPC 3FTSA 3UT7A 3TJPA 2JABA 2X6IA 2Y4UA 1SZAA 1EF1C 4U96D 5BXUA 3FUEA 5G05C 3DEPA 2OV8A 4BSZB 2FI7A 1BU9A 4CT0A 2E0IA 1HZ4A 3FUNA 4FA6A 2XQ0A 4DX7D 5J90A 3Q9UC 4HI9A 4D10C 1HX8A 3C5RA 4H7YA 3ESLA 2V8SE 1N11A 5G05J 5CEDB 2IQCA 3SBSA 3UQ3A 3KSLA 2C0MA 3PH0C 1YCSB 2FF4A 5EDSA 5AN8A 1A17A 1H6KA 3QNKA 5FZSA 4EPZA 2LXLA 4HOTA 3CK7A 3NOCD 3ZYQA 4C0MA 3DBSA 3EUVA 4DJAA 3B7SA 2X6HA 4LNBA 3ABME 3MV3B 4DPRA 4KZCA 2HR2A 3DSSA 3FP3A 3RSEG 3L13A 3T5XA 4BT9A 5HS0A 2ETBA 2WXOA 1IQUA 1MX4A 4HB5A 4JZYA 1DVPA 3R7QA 4CDNA 3CQCB 2YHEA 2DBAA 1MJ0A 4I17A 4FJYA 3Q75A 1OWOA 3IKOB 1E8ZA 5FINA 5T3RA 5CCMA 2YHCA 4DX5D 1Z6TA 4U0SA 2VGEA 4TV3A 2I1KA 4AY5A 5AQBA 1ZBPA 2PM6A 4G8KA 1IHBA 3LY7A 2IOSA 4O6FA 3SZ7A 5D0QD 3UKUG 3ULEG 1SZ9A 3C3RA 4NURA 5H7PA 3EJNA 2FBNA 5AQ9A 4GCOA 3CK9A 3UIOC 4U0UA 4LG6A 4FADA 2GRPB 5BV0A 4HOQA 2J09A 2ZXWE 3ZW3A 5ENRD 3SFXA 4GTQA 5JHAA 5ITZF 3S7JA 2OEWA 5CEAA 5EN5D 4J8YA 5KCMA 3UKRG 3TWXA 2H6GA 2ZIRA 3BG0B 2R5SA 4GYOA 2WXJA 3Q7AA 3S7FA 5CCLA 4UQXA 3CK8A 1H19A 4B0ZA 4JHJA 3E34A 5FWQA 3V30A 1B89A 1O1RA 1OXJA 4F1SA 1Z5SC 3FTUA 2L0TB 2AW6A 3EHQA 2ZISA 1KT1A 2CHXA 4U63A 3RRMB 3L16A 3QB2A 1HE8A 1D8DA 3DSVA 4ACLA 4ATGA 3ASOE 1BI8B 4I1OB 2DCPA 1ELWA 1Z3YA 2WXIA 2I1JA 3AAAC 4V3IA 2X3MA 3GZSA 3ASNE 4F1PA 5CRVA 3NB2A 4Q94A 3NOGD 3FH8A 4ZFHA 3B7RL 4JL0A 3CKBA 3VTXA 3Q49B 2B6CA 1SQMA 2WXFA 3CHRA 3JYSA 4N2QA 3Q5MA 4FHKA 3JUIA 1FT2A 1FCHA 3VLDA 3CKCA 3ZUVB 5LCWC 3ENEA 3AS5A 3CHMA 1SA4A 3FH5A 2H6HA 2EIKE 4WUYA 4WWNA 1FVFA 3KEAA 4GA2A 3OTNA 1JWFA 4J0UA 2XS1A 1OWPA 4Z68A 3UINC 5LCWJ 5B1AE 3L9TA 5FQ8A 1V54E 3HXDA 4RQIA 3BQOA 2P9UG 2IOLA 1KZPA 3TXNA 2L6BA 4XZ4A 1WG0A 3RRUA 4EQFA 3RIBA 2NSZA 4AV7A 1E96B 1JCQA 3FTXA 4BX8A 2WVIA 4JB8P 3PZDA 4HS2A 5AAOA 2XPIA 3PE4A 4N5CA 5C2YA 4GZ6A 4KYOB 1YA0A 4EECA 3FHEA 2GROB 2M63A 3GZ1A 2A5UA 3CQGB 4U8HA 2I2OA 4OAUC 1KZOA 4DX6D 4LCTA 2RG8A 4JA7A 3R9MA 2VQ2A 2OVFA 4AEZC 4P29A 4R7LA 3ESKA 4Y6WA 2IEJA 3W9FA 3D9NA 4RLYA 3FY4A 3DEOA 1EYHA 3R7RA 4CCAA 2DZNA 4TXRA 4DUIA 4EZJA 2NYJA 5G55A 4J8EA 1N94A 4J6IA 3QAQA 4ATZD 5AENA 1O1TA 4GTTA 2XGSA 5BW8C 2DZOA 1DNPA 2KC7A 4A63B 3NZUA 2V4LA 1DCQA 3DPDA 3AG1E 1E90A 1NI1A 2Q7FA 4K03A 5D0OD 3JQ0A 4I1AA 5AIJA 3V2XA 3TWQA 4OVUA 4U8YD 4AY6A 2MYOA 3OXFA 1N4QA 5CMWA 5G04C 4Q69A 4F6RD 3PZ3A 3TXMA 3BG1B 2YQ8A 5ANRA 3AS4A 3CSTA 4AXHA 2WQ7A 1OCZE 3CVPA 1WDYA 1X5BA 4LNUD 5T8IA 4RVBA 2J07A 4WNGA 2VSOE 5G04J 3NBNB 4X8QA 3SBTB 4GZDA 1TNOA 4U04A 1AP7A 2P2CP 3E37A 3OXLA 4UWHA 3OXGA 4UI9J 3HVEA 3GW4A 2FO1E 2PZIA 4YVQC 1IYGA 3LXUX 5ENSD 2BKGA 4N2SA 4GTVA 4JHRA 1TNYA 1NL4A 4E6HA 3EHRA 3I4RB 1HU3A 4ME2A 2IONA 1KT0A 2EINE 3CHPA 3SY2A 3ZIMA 5KNGA 2FO7A 3HVEB 2Y4TA 5CMYA 3ZKJA 2HM8A 4DI4A 5B1BE 1MQSA 3HXFA 2F8YA 2E2EA 4U8VD 2P58C 4MKTA 3JUEA 2DYSE 5FQ6A 3T9KA 5AJDA 3NZSA 4I6GA 3APDA 2L9BA 3FEXA 3QC1A 3UX4A 1E8WA 2XRYA 5J08A 3UM0A 4EZLA 1D8EA 3TG4A 3ULYA 1Q2ZA 3PZ4A 2AWIA 3IXEA 5FQ4A 3U9WA 3FUFA 4JC8A 1Z3XA 1MX2A 4L7TA 2DIWA 4GZ3A 3DRAA 4YDOA 4A1GA 3Q78A 2LSUA 4K5AB 3ABKE 3U4TA 1JPLA 3SNXA 2V5QC 2L6JA 4ANXA 2OCCE 1TNUA 1K3ZD 2ZGGA 2LO6A 5EILA 4XIFA 3D9LA 3NQPA 1JCSA 4CZ2D 1LD8A 4EBAG 3EIJA 4UWKA 2V4HC 3NF1A 4MLPA 2L0IA 3FTVA 1HO8A 3QWVA 4C9BB 1YYHA 1HG5A 4HRLA 2XS8A 3E33A 2X6KA 5A7DB 3EU9A 4O60A 5KJNA 2EIME 5KJKA 1P5QA 3AG2E 4Q96A 1TJCA 3FULA 3CVXA 2ETCA 4APFA 3QWWA 1UJJA 3FWVA 5D2MC 3LJ3A 3IHYA 3QKYA 2NC9A 2XCCA 2I9CA 3D9OA 5KWDA 2CG3A 4G25A 4UI9K 3ASGA 1JWGA 1E7VA 2BF0X 4KXKB 1XGWA 2MRIA 4KMOA 3KSQA 1H2UA 3RRNB 1UJKA 3ULQA 3CVNA 4A55A 2J8SD 5EX3A 3UMVA 4BTAA 3PE3A 1UOHA 3IV0A 3KS2A 4B94A 3ZNGA 5LX8A 3ZYLA 3K9IA 2X6FA 2WQ6A 3AJIA 5ENNA 5BV1A 2J9QA 2R02A 3RKVA 4J8DA 4XI9A 4B8AA 3TWTA 3ZYMA 2P9IG 4KVOA 3X2QE 3LY8A 4JVSA 1SW6A 1ELRA 2LXMA 5E76A 3FUKA 2EIJE 4GZCA 4GTRA 4GB9A 3CV0A 4UWGA 3G2UA 3FUHA 2IJGX 2WXLA 3G2WA 4BWRA 1IQRA 4DLQA 4HLLA 2P9NG 3AU5A 4YNDA 3PRZA 4FC8A 4AOFA 2WPVA 3CR3A 4DLOA 1OWLA 5EYPF 1LD7A 1W3BA 4G26A 1AWCB 5CBNA 2VSXE 2RFMA 2OOEA 5ENTD 2AXUA 1MYOA 2IU1A 3HYMB 3HG0D 1NA3A 3D9PA 4TXPA 2XPZA 3I3NA 4B8CB 1N4PA 3ZU7B 4KZ0A 1N95A 3IEGA 5BNWA 3DSTA 3UM2A 1EDUA 2WMOA 3AU4A 3UXGA 3VTYA 3B7BA 4CYMD 4I6JA 4ABNA 2XZDG 5ARFA 1L5JA 4O1OA 1IHGA 3DSWA 4F3VA 2V5FA 5EYLA 2WMNA 3PUKA 1GW6A 4JXTA 3FDHA 4A1SA 1TNBA 2XHEA 4KBQA 4OAVB 4AP2A 4G8LA 1UN9A 3JCKC 1X81A 4ACKA 3ZN3A 3V2OA 3ZFWA 3Q73A 1HH8A 4YDWA 4H7XA 5ANLA 1OWNA 5IY5E 2ETAA 5JJ7A 3ASFA 2IF4A 3QWPA 3PNTB 1N54A 2R03A 4RG9A 5KNHD 2VYIA 1QBQA 2LAIA 1TR4A 3CVLA 4F53A 3U3WA 4GU5A 3RU0A 3FU5A 3LKUA 3TWUA 2ZGDA 2CFUA 5T4YA 4F7AA 2WXMA 3I4GA 3ZPJA 3APCA 3EHMA 3D9JA 3LPZA 3SFYA 2I6HA 3FU3A 3CEQA 4BERA 2ILRA 3J5QB 3ML9A 2R2LA 5BXOA 2CHWA 1UN8A 2XENA 2XEEA 1OCCE 4CGVA 3J5PA 3SQVA 3E32A 4HRNA 4KT6B 1KLXA 4GPMA 3MZLB 4IN3B 3D9IA 2HO1A 3SF4A 1BPOA 4GMRA 1WY6A 2Y69E 4I9EA 2XRZA 3FU6A 4HBDA 2RKKA 3CVYA 3RAUA 4MBGA 3B7UX 3FEYA 2J4BA 2WQHA 2NXPA 1K1AA 4CRWA 3HXBA 2J4DA 5G2NA 4GTPA 3VLEA 2WB2A 4HORA 4LNGA 2A4ZA 3QDNA 1PY1A 4ILIA 3O48A 3EHNA 3JXIA 2AXVA 5EIDA 4XKCA 4URKA 3APFA 4B93B 4L23A 2ONDA 2QZAA 5E75A 3TL5A 2WXPA 3Q79A 2WM9A 3CIAA 4EHMA 4N5QA 3QJZA 2XPYA 4WWOA 3HIZA 4ILHB 4DX2A 4A3TA 3SGHA 2X38A 5JHBA 1RW2A 2QYJA 5CERB 2PQRA 2RFAA 4L2YA 3O4ZA 1BLXB 3HDXA 3L82A 1Y6IA 4M3OA 3UT4A 1UG3A 1RZ4A 5M72A 1Y8MA 4HQDA 3EU5A 1N0QA 4U7EB 3D9KA 3AG4E 4TXQA 2F8XK 1S70B 1YMPA 5HI7A 4GYWA 5HRYA 3V79K 1UW4B 2LUHA 4UI9C 4EBAA 4GYYA 3LS8A 4G24A 2J49A 1NZNA 1NA0A 2QC9A 4JW1A 4I43A 1OY3D 4BY6A 2GRQB 2HYZA 4YVOA 3FUJA 4FULA 5AARA 4JHKA 1S64A 1TN7A 3BEEA 2YINA 4LSZE 3MCXA 1NFIE 4OVVA 4ZHBA 4GCNA 2H6FA 4QFVA 1H0AA 1E7UA 4FP7A 2DVWA 5JA4D 3CVQA 2C2LA 3G2VA 4FJZA 5CRUA 3BU8A 1H2TC 1ZU2A 5FZQA 2EQXA 2XEVA 2F37A 2P9KG 5HKPA 5LFAA 3RO3A 5AQ7A 3FU0A 5BT1A 3FUIA 1N52A 4DX1A 3ZGQA 1JUQA 3ZHEA 2PM7A 4J8FA 1S63A 2AJAA 2XGMA 4NRHB 3ASDA 3FTZA 2LAHA 3UTMA 4NACA 3B95A 4PS7A 3QK0A 4DK5A 2XZTG 2GRRB 3MGBA 3ZHEB 3EIQC 4RSYA 4CGWA 3KAEA 4K5BA 3UM1A 4XKBA 1MX6A 5ARGA 3TWVA 3MJWA 1TN8A 2GRMA 2RD0A 2PL2A 2AXZA 5EX0A 2QFCA 1EPUA 1OCRE 2VSYA 1H6OA 3HXCA 3ONLA 4CDMA 3CVWA 3U66A 3TWWA 3DXKG 4K0RA 4BT8A 2P9LG 2B0OE 4FLBA 3MYVA 4W9RA 3Q4AB 4PS8A 1HS6A 5AYWD 4G2VA 4U07A 3LDZA 5EKQD 4O1PA 1S0PA 3L54A 4PDXA 4GA1A 3HHMA 3C98A 2KXPC 1H2VC 1N0RA 3L6AA 4L1BA 2VGXA 3CVVA 4ANWA 4HLEA 1E8YA 5C1DA 3IBEA 3PZ2A 1ELKA 1QNFA 5FIOA 4N3BA 1U3DA 4L2LA 1U3CA 2P9SG 3C3OA 4I9CA 4UQZA 5ENOD 5KJLA 1KPSB 2H6IA 4ANVA 4I6EA 3T5VA 1SA5A 2VGXB 4HNAD 3WXXA 4AM9A 3SI5A 2BEDA 3UT8A 5JMND 4FLHA 1WM5A 2VSNA 4OYSA 1G3NB 4GTSA 1SVXA 3V31A 2WXQA 4GPKA 4APOA 4ANUA 3AG3E 3D9MA 3LY9A 3ZXSA 1JCRA 3FH7A 4PH4B 2J08A 1XNFA 2GRNB 2KBXA 3PNLB 4JA9A 3ZRHA 3KEZA 1FVHA 4HOSA 4LRZA 5A23A 4K5CA 4IULA 3MKQA 5HQ8A 5KJMA 3DXMG 2VJ8A 5JJ6A 1HG2A 5BUZA 4CT4A 5FT9A 4GAAA 1E8XA 3FUMA 2FEZA 4GA0A 5FQ7A 4GZ5A 4WNFA 4B89A 4GMLA 1DC2A 4HOUA 5DIZA 4MRUA 3MKQB 2OVBA 5KBAA 1ZB1A 1NP7A 3UUXA 2P9PG 4I1MA 4AJWA 1TYQG 2FULA 3DWLG 3PZ1A 2ZU6B 1TEZA 5D66A 3CGHA 3S2AA 3MKRA 5EIBE 5LP0A 4LEUA 2XCBA 1PAQA 2VTBA 4J8SA 3PEVB 3PUJA 4LERA 3I5PA 3UM3A 4FU3A 5ENPD 4BX9A 1HFAA 1WAO1 4JPSA 1V55E 2GRLA 4HI8A 3RK6A 3W9GA 1O1SA 1MHQA 1LTXA 2HE0A 2IY0C 3E30A 5CHEE 2QY7A 2VTBB 3KD7A 3N71A 3FTYA 3P2BA 4UQYA 2LSVA 3SHFA 2KM4A 3AS8A 1OT8A 5CECB 4U0ZA 2XEHA 1VDYA 2KZTA 3BUAA 2MHKA 1TN6A 3HRAA 5B3SE 3UI2A 2BKKB 2JLBA 1D9SA 4I2ZA 3TGOA 4BETA 5AQAA 3PEUB 3Q7FA 4BTBA 4C48B 2KZTB 3JQ1A 4HVBA 4UUCA 4WAFA 3CHQA 4HFGA 3U64A 4JEUA 2EILE 4XEIG 3PVLA 4JEHA 5FTPA 4EZKA 1A5EA 2KCVA 2KATA 3PDNA 3D9HA 3RJVA 2R05A 1MZCA 3DSUA 4LUNU 2BTDA 4N3AA 3MEKA 3ASHA 3QARA 4CEMA 3ISMC 3LEWA 3LJNA 5FZRA 1BD8A 3L22A 1DCEA 2LNIA 3GZ2A 3L17A 3DPYA 3CSFA 4L9PA 2QYUA 2WXGA 3EDTB 3B13A 3S7BA 5FJYA 3MX3A 3SO8A 4J7WA 3ZEFA 5A6CA 3S7DA 1IXVA 1FT1A 1N4RA 2GW1A 3C72A 1LF8A 1QZ2A 3FUDA 4C0EA 3ONKA 3L08A 4N3CA 3HXEA 4YDEA 3T8MA 3IHVA 2BUGA 3JXJA 1OWMA 4BESA 2GGFA 3ZXPA 3B7TA 3C3QA 3LYAA 3G2TA 1H6PA 2PQNA 3OAWA 4NIKA 2CG2A 3QOUA 2PNNA 4M7CA 3Q15A 2MOWA 4AVXA 2OEVA 3P1UA 3LVRE 3G2SA 4PS3A 4BSXA 2AVPA 4DI3A 4BEPA 1PC2A 1QYMA 3E4BA 1BI7B 3TG5A 2DYRE 3CHOA 2KCKA 3LVQE 1U2VG 2KCLA 4DRXE 4UWFA 4BFRA 2A5EA 3F6QA 2CFZA 4WNEA 1INZA 3RO2A 4RG6A 1K1BA 2UWJG 3PS6A 1HF8A 2JEKA 3FFLA 1O5MA 3NAWA 1HXIA 4AIFA 3R9AB 4IYPA 4YDYA 5AJLA 4HXIA 3SFZA 3DSXA 4N39A 4A3VA 3TAXA 2WXRA 4JD2G 5BPPA 3URZA 3ZVVA 3ZYKA 3PREA 4GTMA 2Y1LE 3VLFA 2V0PA 4G11A 4XX5A 3ABLE 2R17C 2XGOA 3SD5A 1QQEA 2Y0BG 4Y6CA 4WNDA 2DWZA 3WG7E 5CBOA 1N9AA 3Q9NC 4G1TA 1FPPA 3TWRA 4U95D 4G23A 2WXHA 4GMJA 3CLJA 3D3MA 1IKND 4KVMA 3ML8A 3CVUA 4WWPA 3T8KA 5LOZA 2IO2C 1OUVA 4PUCA 3GYZA 2R59A 4XI0A 4I2WA 2Y3AA 4ILGA 4MS6A 3CHSA 2VGYA 3MV2B 4CDRA 4TUMA 3FTWA 4E85A 2WXKA 2UY1A 1N4SA 4TRQA 3TWSA 2IFUA 4TUUA 2C0LA 2X6JA 4XE0A 4IRUA 3Q47B 1TJFA 2YNQA 5ENQD 3UPVA 4NQ0A 1OCOE 4HRMB
chains in the Genus database with same CATH topology
3R7RA 4FHJA 4CCAA 4ANVA 4I6EA 2XHEA 4KBQA 2CHZA 3T5VA 4AP2A 2VGXB 2UY1B 4EZJA 1UN9A 3JCKC 5G55A 2WXNA 4J8EA 4J6IA 5DBKA 3WXXA 4AM9A 3SI5A 3QAQA 3UT8A 4ACKA 3ZN3A 5AENA 5JJTA 4FLHA 1WM5A 3ZFWA 2VSNA 2XGSA 4OYSA 4UWLA 3MA5A 3LCAA 1HH8A 5BW8C 2WXQA 3FTSA 1DNPA 2KC7A 4H7XA 4GPKA 5ANLA 1OWNA 3TJPA 3UT7A 4APOA 2X6IA 2Y4UA 1SZAA 1EF1C 3NZUA 4ANUA 2V4LA 3D9MA 3LY9A 5JJ7A 3ASFA 2IF4A 3QWPA 3PNTB 3ZXSA 1N54A 3FH7A 4PH4B 2J08A 3FUEA 3DPDA 1XNFA 5G05C 1E90A 2Q7FA 4K03A 5D0OD 4RG9A 3PNLB 2VYIA 4JA9A 2OV8A 3JQ0A 2FI7A 2LAIA 4CT0A 2E0IA 4I1AA 3CVLA 4F53A 3ZRHA 3KEZA 1HZ4A 3FUNA 4FA6A 2XQ0A 5AIJA 3U3WA 4OVUA 1FVHA 4AY6A 5J90A 4HOSA 3OXFA 4GU5A 4LRZA 3RU0A 4D10C 3FU5A 3LKUA 5A23A 5CMWA 4IULA 3MKQA 1HX8A 5HQ8A 2CFUA 4H7YA 3ESLA 2V8SE 5G04C 4Q69A 5T4YA 5KJMA 2VJ8A 5G05J 5JJ6A 4F7AA 1HG2A 5BUZA 2IQCA 2WXMA 3I4GA 3SBSA 4CT4A 3TXMA 3UQ3A 3BG1B 3ZPJA 2YQ8A 5FT9A 3APCA 4GAAA 5ANRA 1E8XA 2C0MA 3EHMA 3AS4A 3FUMA 3PH0C 3CSTA 3D9JA 3LPZA 2FEZA 2I6HA 3FU3A 3CEQA 4GA0A 5FQ7A 4AXHA 2ILRA 2WQ7A 3CVPA 3ML9A 5T8IA 1X5BA 4GZ5A 2FF4A 4WNFA 5EDSA 4B89A 4GMLA 2CHWA 1UN8A 4HOUA 4RVBA 5DIZA 4MRUA 2J07A 3MKQB 1A17A 2OVBA 1H6KA 1NP7A 3UUXA 4WNGA 4CGVA 4I1MA 3QNKA 5FZSA 4AJWA 2VSOE 5G04J 4KT6B 4EPZA 2FULA 3SBTB 4HOTA 4GZDA 3CK7A 4U04A 1KLXA 3MZLB 3ZYQA 4C0MA 4IN3B 3D9IA 3DBSA 2ZU6B 2HO1A 3SF4A 3OXLA 1TEZA 3CGHA 1BPOA 3OXGA 4UWHA 4UI9J 3S2AA 3MKRA 4DJAA 1WY6A 3HVEA 4I9EA 3B7SA 2X6HA 2XRZA 5LP0A 4LEUA 2XCBA 3GW4A 3FU6A 2PZIA 4YVQC 3MV3B 1PAQA 1IYGA 4DPRA 4KZCA 3LXUX 2VTBA 2HR2A 3CVYA 4J8SA 4N2SA 4JHRA 3PEVB 3FP3A 3B7UX 3PUJA 4LERA 3FEYA 4E6HA 2J4BA 3I5PA 3I4RB 3L13A 4FU3A 1HU3A 2WQHA 3T5XA 4ME2A 1HFAA 4BX9A 2IONA 1WAO1 2NXPA 4JPSA 4CRWA 4BT9A 2GRLA 1KT0A 3RK6A 2J4DA 3CHPA 5G2NA 2WXOA 3ZIMA 1IQUA 1MHQA 3VLEA 2WB2A 4HORA 2FO7A 3HVEB 2A4ZA 4JZYA 3QDNA 1DVPA 2Y4TA 3R7QA 1PY1A 5CMYA 2HM8A 5CHEE 4ILIA 4CDNA 4DI4A 3O48A 3CQCB 1MQSA 2QY7A 2YHEA 2VTBB 2DBAA 3KD7A 4I17A 4FJYA 3EHNA 2E2EA 2AXVA 1OWOA 3N71A 3IKOB 2P58C 3APFA 4MKTA 1E8ZA 4XKCA 4URKA 4L23A 3FTYA 5FQ6A 2ONDA 5E75A 5AJDA 3P2BA 3NZSA 2WXPA 4UQYA 5T3RA 3TL5A 5CCMA 2YHCA 2LSVA 1Z6TA 3SHFA 2KM4A 2WM9A 3CIAA 3AS8A 4U0SA 4I6GA 3APDA 3QJZA 2XPYA 4TV3A 4WWOA 2I1KA 2L9BA 4AY5A 3FEXA 3HIZA 3QC1A 4ILHB 3UX4A 4U0ZA 1E8WA 1ZBPA 4A3TA 1VDYA 2KZTA 2PM6A 2XRYA 3SGHA 5J08A 2MHKA 4EZLA 3LY7A 2IOSA 2X38A 3TG4A 5JHBA 2AWIA 4O6FA 3SZ7A 5D0QD 1SZ9A 5FQ4A 3U9WA 3FUFA 4NURA 4JC8A 2PQRA 1Z3XA 4L2YA 3EJNA 3O4ZA 2FBNA 3HDXA 4L7TA 2JLBA 4GCOA 3CK9A 2DIWA 4GZ3A 4I2ZA 4U0UA 3TGOA 4FADA 1Y6IA 3PEUB 4A1GA 4BTBA 2KZTB 5BV0A 4M3OA 2LSUA 3U4TA 1UG3A 3JQ1A 3UT4A 4HOQA 1JPLA 4HVBA 2J09A 3ZW3A 4WAFA 5M72A 3SNXA 1Y8MA 2L6JA 3CHQA 4HFGA 3U64A 4JEUA 5JHAA 4ANXA 3D9KA 3PVLA 4JEHA 5FTPA 5HI7A 4GYWA 4EZKA 3S7JA 2KCVA 2LO6A 2KATA 4XIFA 3D9LA 3NQPA 3PDNA 5KCMA 1UW4B 3RJVA 4LUNU 3BG0B 2BTDA 4N3AA 4UI9C 4EBAA 3MEKA 2R5SA 3ASHA 4GYYA 3LS8A 4EBAG 3QARA 4G24A 4CEMA 3LEWA 4GYOA 3EIJA 4UWKA 2J49A 5FZRA 3NF1A 3L22A 1NZNA 4MLPA 2WXJA 1NA0A 3S7FA 5CCLA 4UQXA 3CK8A 1H19A 2L0IA 3FTVA 4B0ZA 4JHJA 1HO8A 2LNIA 3GZ2A 5FWQA 3L17A 3QWVA 4JW1A 4I43A 4C9BB 1HG5A 3CSFA 1B89A 4BY6A 2X6KA 5A7DB 4F1SA 2HYZA 2WXGA 3FTUA 5KJNA 4YVOA 5KJKA 2L0TB 2AW6A 1KT1A 1P5QA 2CHXA 3FUJA 4FULA 4U63A 3RRMB 4Q96A 1TJCA 3FULA 3EDTB 3L16A 3QB2A 1HE8A 3B13A 3CVXA 3S7BA 4APFA 3QWWA 1UJJA 4JHKA 4ACLA 5FJYA 3MX3A 3FWVA 4ATGA 3BEEA 3ZEFA 3LJ3A 2YINA 5A6CA 3S7DA 3MCXA 4I1OB 3IHYA 2DCPA 3QKYA 2GW1A 1ELWA 1Z3YA 4OVVA 2NC9A 1LF8A 2WXIA 4GCNA 1QZ2A 2I1JA 3FUDA 2XCCA 4C0EA 2I9CA 3ONKA 3D9OA 4V3IA 2X3MA 3GZSA 3L08A 2CG3A 4G25A 4N3CA 4QFVA 4UI9K 3ASGA 3T8MA 4Q94A 3IHVA 2BUGA 1OWMA 1JWGA 2GGFA 3B7TA 1E7VA 3LYAA 1H0AA 3G2TA 2BF0X 1E7UA 4FP7A 3FH8A 2PQNA 3OAWA 3B7RL 4JL0A 3CVQA 4KXKB 3CKBA 1XGWA 3VTXA 2MRIA 2C2LA 4KMOA 3G2VA 3Q49B 2CG2A 3QOUA 1H2UA 4FJZA 3RRNB 1SQMA 2WXFA 1UJKA 3CHRA 3JYSA 3ULQA 1H2TC 4N2QA 3Q5MA 4FHKA 1ZU2A 5FZQA 3Q15A 3CVNA 4A55A 2EQXA 2XEVA 2MOWA 5EX3A 3JUIA 4AVXA 3UMVA 4BTAA 3P1UA 3PE3A 5LFAA 3IV0A 3LVRE 3G2SA 4PS3A 1FCHA 3RO3A 3VLDA 3FU0A 4BSXA 5BT1A 3KS2A 2AVPA 3CKCA 3FUIA 1N52A 4B94A 3ZGQA 4DI3A 5LCWC 3ENEA 1JUQA 3ZHEA 2PM7A 3AS5A 1PC2A 5LX8A 3ZYLA 3CHMA 3FH5A 4J8FA 3E4BA 3K9IA 4WUYA 3TG5A 4WWNA 1FVFA 2XGMA 3CHOA 4GA2A 3OTNA 2KCKA 4NRHB 2X6FA 3LVQE 3ASDA 1JWFA 2KCLA 3FTZA 2WQ6A 4UWFA 5ENNA 5BV1A 4BFRA 4J0UA 2J9QA 2LAHA 3RKVA 4NACA 2CFZA 4J8DA 4XI9A 4WNEA 4B8AA 1INZA 3RO2A 4RG6A 1OWPA 4PS7A 3QK0A 4DK5A 2UWJG 3ZHEB 3PS6A 3MGBA 3ZYMA 5LCWJ 1HF8A 5FQ8A 4KVOA 3EIQC 4RSYA 4CGWA 2JEKA 3KAEA 2IOLA 3FFLA 4XKBA 3LY8A 4JVSA 1ELRA 1HXIA 4AIFA 5ARGA 5E76A 3R9AB 4IYPA 3FUKA 5AJLA 3TXNA 4HXIA 4XZ4A 4N39A 3SFZA 3MJWA 4GZCA 2GRMA 2RD0A 3CV0A 4GB9A 2PL2A 4A3VA 3RRUA 4UWGA 2WXRA 3TAXA 4EQFA 3G2UA 3FUHA 5BPPA 3URZA 3ZVVA 2AXZA 2IJGX 2WXLA 2NSZA 3G2WA 1IQRA 3PREA 3RIBA 3ZYKA 5EX0A 4BWRA 4DLQA 4AV7A 3AU5A 1E96B 4YNDA 2QFCA 5KJLA 3VLFA 3PRZA 1EPUA 4FC8A 2VSYA 4AOFA 2V0PA 3ONLA 2WPVA 3CR3A 4G11A 4XX5A 4CDMA 3CVWA 2R17C 3FTXA 2XGOA 4DLOA 3SD5A 1OWLA 1QQEA 3U66A 1W3BA 4K0RA 4G26A 4Y6CA 4BT8A 4BX8A 4WNDA 2WVIA 2VSXE 3PZDA 4HS2A 4FLBA 2XPIA 3PE4A 3MYVA 4N5CA 4W9RA 3Q4AB 4PS8A 5C2YA 4GZ6A 2OOEA 4KYOB 1HS6A 1YA0A 4G1TA 4EECA 2AXUA 3FHEA 5AYWD 4G2VA 2IU1A 4G23A 2WXHA 3HYMB 2M63A 3GZ1A 4U07A 2A5UA 3LDZA 1NA3A 3CQGB 3D9PA 4U8HA 5EKQD 2I2OA 3CLJA 2XPZA 4GMJA 3D3MA 4KVMA 3ML8A 3CVUA 4WWPA 5LOZA 3I3NA 4B8CB 1S0PA 4LCTA 3L54A 1OUVA 4PUCA 4PDXA 3GYZA 4GA1A 4KZ0A 2RG8A 3C98A 2R59A 3HHMA 4I2WA 2Y3AA 4XI0A 4A1SA 3IEGA 4ILGA 5BNWA 4JA7A 4MS6A 1H2VC 2VGYA 3CHSA 3MV2B 4CDRA 3FTWA 1EDUA 3L6AA 4L1BA 4E85A 2WMOA 2VGXA 2UY1A 2WXKA 2VQ2A 4TRQA 4ANWA 3AU4A 3CVVA 2IFUA 4HLEA 1E8YA 2OVFA 5C1DA 3IBEA 4TUUA 3VTYA 1ELKA 4AEZC 2C0LA 2X6JA 1QNFA 4I6JA 4N3BA 4ABNA 5ARFA 1L5JA 4P29A 4XE0A 1U3DA 4R7LA 4IRUA 3Q47B 1IHGA 3ESKA 1TJFA 4L2LA 4Y6WA 1U3CA 4F3VA 2V5FA 2WMNA 3D9NA 3PUKA 1GW6A 2YNQA 4I9CA 3FY4A 4UQZA 3UPVA 4NQ0A 4JXTA 3FDHA 1EYHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBQ A;  2VGX B;  2UY1 B;  4J8E A;  5DBK A;  3WXX A;  4AM9 A;  3ZN3 A;  5JJT A;  1WM5 A;  3ZFW A;  2VSN A;  2XGS A;  3MA5 A;  3LCA A;  1HH8 A;  5BW8 C;  2KC7 A;  4H7X A;  4GPK A;  4APO A;  2Y4U A;  3LY9 A;  5JJ7 A;  3ASF A;  2IF4 A;  3QWP A;  5G05 C;  1XNF A;  2Q7F A;  5D0O D;  4RG9 A;  2VYI A;  4JA9 A;  2FI7 A;  4I1A A;  3CVL A;  1HZ4 A;  3U3W A;  4AY6 A;  4HOS A;  3OXF A;  3RU0 A;  3LKU A;  5HQ8 A;  4H7Y A;  5KJM A;  5G04 C;  5JJ6 A;  5G05 J;  3UQ3 A;  3ZPJ A;  2YQ8 A;  5FT9 A;  2C0M A;  3AS4 A;  3LPZ A;  2FEZ A;  2I6H A;  3CEQ A;  4GA0 A;  3CVP A;  4GZ5 A;  2FF4 A;  4WNF A;  4HOU A;  5DIZ A;  1A17 A;  3UUX A;  4WNG A;  4CGV A;  5FZS A;  5G04 J;  4HOT A;  3CK7 A;  4U04 A;  1KLX A;  4IN3 B;  2HO1 A;  3SF4 A;  3OXL A;  3OXG A;  4UI9 J;  3MKR A;  4I9E A;  4LEU A;  2XCB A;  3GW4 A;  2PZI A;  4YVQ C;  3MV3 B;  1IYG A;  2HR2 A;  4N2S A;  4JHR A;  3FP3 A;  2WQH A;  4ME2 A;  1WAO 1;  4BT9 A;  1KT0 A;  4HOR A;  2FO7 A;  3QDN A;  2Y4T A;  5CHE E;  3O48 A;  2DBA A;  3KD7 A;  4I17 A;  2E2E A;  3N71 A;  2P58 C;  2OND A;  4UQY A;  5CCM A;  2YHC A;  2LSV A;  3AS8 A;  4U0S A;  4AY5 A;  4U0Z A;  1ZBP A;  2MHK A;  3LY7 A;  3TG4 A;  4O6F A;  3SZ7 A;  5D0Q D;  2PQR A;  2FBN A;  2JLB A;  4GCO A;  3CK9 A;  4GZ3 A;  4I2Z A;  4U0U A;  3TGO A;  4BTB A;  2LSU A;  3U4T A;  4HOQ A;  5M72 A;  1Y8M A;  2L6J A;  5FTP A;  5HI7 A;  4GYW A;  3S7J A;  2KCV A;  2KAT A;  4XIF A;  3PDN A;  3RJV A;  4N3A A;  4UI9 C;  3MEK A;  2R5S A;  3ASH A;  4GYY A;  4G24 A;  4GYO A;  5FZR A;  3NF1 A;  1NZN A;  1NA0 A;  3S7F A;  5CCL A;  4UQX A;  3CK8 A;  2LNI A;  3GZ2 A;  3QWV A;  1B89 A;  5A7D B;  2HYZ A;  5KJN A;  4YVO A;  5KJK A;  1KT1 A;  1P5Q A;  1TJC A;  3EDT B;  3S7B A;  3QWW A;  5FJY A;  3FWV A;  3BEE A;  5A6C A;  3S7D A;  3QKY A;  2GW1 A;  1ELW A;  2NC9 A;  4GCN A;  1QZ2 A;  2XCC A;  4G25 A;  4N3C A;  4UI9 K;  3ASG A;  2BUG A;  3LYA A;  2PQN A;  4JL0 A;  3CVQ A;  4KXK B;  3CKB A;  3VTX A;  2C2L A;  3Q49 B;  3QOU A;  3JYS A;  3ULQ A;  4N2Q A;  3Q5M A;  1ZU2 A;  5FZQ A;  3Q15 A;  3CVN A;  2XEV A;  5EX3 A;  4BTA A;  3PE3 A;  3RO3 A;  1FCH A;  5BT1 A;  3KS2 A;  2AVP A;  3CKC A;  4B94 A;  3ZGQ A;  5LCW C;  3ZHE A;  3AS5 A;  1PC2 A;  4J8F A;  3E4B A;  3K9I A;  4WUY A;  3TG5 A;  2XGM A;  4GA2 A;  2KCK A;  4NRH B;  3ASD A;  2KCL A;  4J0U A;  2J9Q A;  3RKV A;  4J8D A;  4XI9 A;  4WNE A;  3RO2 A;  4RG6 A;  2UWJ G;  3ZHE B;  5LCW J;  4CGW A;  3KAE A;  3FFL A;  3LY8 A;  1ELR A;  1HXI A;  4AIF A;  5ARG A;  3R9A B;  4N39 A;  3CV0 A;  2PL2 A;  3TAX A;  4EQF A;  3URZ A;  3RIB A;  4BWR A;  5EX0 A;  1E96 B;  4YND A;  2QFC A;  5KJL A;  2VSY A;  2WPV A;  2XGO A;  1QQE A;  1W3B A;  4G26 A;  4Y6C A;  4BT8 A;  4WND A;  2XPI A;  3PE4 A;  4N5C A;  4W9R A;  3Q4A B;  4GZ6 A;  2OOE A;  4KYO B;  1YA0 A;  4G1T A;  5AYW D;  4G2V A;  4G23 A;  3HYM B;  3GZ1 A;  4U07 A;  1NA3 A;  5EKQ D;  1OUV A;  3GYZ A;  4GA1 A;  4XI0 A;  4I2W A;  3IEG A;  5BNW A;  4JA7 A;  3MV2 B;  2VGY A;  4CDR A;  2VGX A;  2UY1 A;  2VQ2 A;  2IFU A;  5C1D A;  3VTY A;  2C0L A;  4ABN A;  4N3B A;  5ARF A;  3Q47 B;  1IHG A;  3ESK A;  4Y6W A;  4F3V A;  2V5F A;  4I9C A;  4UQZ A;  3UPV A;  4NQ0 A;  4A1S A; 
#chains in the Genus database with same CATH topology
 4FHJ A;  4GTO A;  2CHZ A;  1K8K G;  2UY1 B;  2IO3 C;  2WXN A;  5DBK A;  5JJT A;  1TNZ A;  2F0Y A;  4UWL A;  3MA5 A;  3LCA A;  4QQI A;  3UIP C;  3FTS A;  3UT7 A;  3TJP A;  2JAB A;  2X6I A;  2Y4U A;  1SZA A;  1EF1 C;  4U96 D;  5BXU A;  3FUE A;  5G05 C;  3DEP A;  2OV8 A;  4BSZ B;  2FI7 A;  1BU9 A;  4CT0 A;  2E0I A;  1HZ4 A;  3FUN A;  4FA6 A;  2XQ0 A;  4DX7 D;  5J90 A;  3Q9U C;  4HI9 A;  4D10 C;  1HX8 A;  3C5R A;  4H7Y A;  3ESL A;  2V8S E;  1N11 A;  5G05 J;  5CED B;  2IQC A;  3SBS A;  3UQ3 A;  3KSL A;  2C0M A;  3PH0 C;  1YCS B;  2FF4 A;  5EDS A;  5AN8 A;  1A17 A;  1H6K A;  3QNK A;  5FZS A;  4EPZ A;  2LXL A;  4HOT A;  3CK7 A;  3NOC D;  3ZYQ A;  4C0M A;  3DBS A;  3EUV A;  4DJA A;  3B7S A;  2X6H A;  4LNB A;  3ABM E;  3MV3 B;  4DPR A;  4KZC A;  2HR2 A;  3DSS A;  3FP3 A;  3RSE G;  3L13 A;  3T5X A;  4BT9 A;  5HS0 A;  2ETB A;  2WXO A;  1IQU A;  1MX4 A;  4HB5 A;  4JZY A;  1DVP A;  3R7Q A;  4CDN A;  3CQC B;  2YHE A;  2DBA A;  1MJ0 A;  4I17 A;  4FJY A;  3Q75 A;  1OWO A;  3IKO B;  1E8Z A;  5FIN A;  5T3R A;  5CCM A;  2YHC A;  4DX5 D;  1Z6T A;  4U0S A;  2VGE A;  4TV3 A;  2I1K A;  4AY5 A;  5AQB A;  1ZBP A;  2PM6 A;  4G8K A;  1IHB A;  3LY7 A;  2IOS A;  4O6F A;  3SZ7 A;  5D0Q D;  3UKU G;  3ULE G;  1SZ9 A;  3C3R A;  4NUR A;  5H7P A;  3EJN A;  2FBN A;  5AQ9 A;  4GCO A;  3CK9 A;  3UIO C;  4U0U A;  4LG6 A;  4FAD A;  2GRP B;  5BV0 A;  4HOQ A;  2J09 A;  2ZXW E;  3ZW3 A;  5ENR D;  3SFX A;  4GTQ A;  5JHA A;  5ITZ F;  3S7J A;  2OEW A;  5CEA A;  5EN5 D;  4J8Y A;  5KCM A;  3UKR G;  3TWX A;  2H6G A;  2ZIR A;  3BG0 B;  2R5S A;  4GYO A;  2WXJ A;  3Q7A A;  3S7F A;  5CCL A;  4UQX A;  3CK8 A;  1H19 A;  4B0Z A;  4JHJ A;  3E34 A;  5FWQ A;  3V30 A;  1B89 A;  1O1R A;  1OXJ A;  4F1S A;  1Z5S C;  3FTU A;  2L0T B;  2AW6 A;  3EHQ A;  2ZIS A;  1KT1 A;  2CHX A;  4U63 A;  3RRM B;  3L16 A;  3QB2 A;  1HE8 A;  1D8D A;  3DSV A;  4ACL A;  4ATG A;  3ASO E;  1BI8 B;  4I1O B;  2DCP A;  1ELW A;  1Z3Y A;  2WXI A;  2I1J A;  3AAA C;  4V3I A;  2X3M A;  3GZS A;  3ASN E;  4F1P A;  5CRV A;  3NB2 A;  4Q94 A;  3NOG D;  3FH8 A;  4ZFH A;  3B7R L;  4JL0 A;  3CKB A;  3VTX A;  3Q49 B;  2B6C A;  1SQM A;  2WXF A;  3CHR A;  3JYS A;  4N2Q A;  3Q5M A;  4FHK A;  3JUI A;  1FT2 A;  1FCH A;  3VLD A;  3CKC A;  3ZUV B;  5LCW C;  3ENE A;  3AS5 A;  3CHM A;  1SA4 A;  3FH5 A;  2H6H A;  2EIK E;  4WUY A;  4WWN A;  1FVF A;  3KEA A;  4GA2 A;  3OTN A;  1JWF A;  4J0U A;  2XS1 A;  1OWP A;  4Z68 A;  3UIN C;  5LCW J;  5B1A E;  3L9T A;  5FQ8 A;  1V54 E;  3HXD A;  4RQI A;  3BQO A;  2P9U G;  2IOL A;  1KZP A;  3TXN A;  2L6B A;  4XZ4 A;  1WG0 A;  3RRU A;  4EQF A;  3RIB A;  2NSZ A;  4AV7 A;  1E96 B;  1JCQ A;  3FTX A;  4BX8 A;  2WVI A;  4JB8 P;  3PZD A;  4HS2 A;  5AAO A;  2XPI A;  3PE4 A;  4N5C A;  5C2Y A;  4GZ6 A;  4KYO B;  1YA0 A;  4EEC A;  3FHE A;  2GRO B;  2M63 A;  3GZ1 A;  2A5U A;  3CQG B;  4U8H A;  2I2O A;  4OAU C;  1KZO A;  4DX6 D;  4LCT A;  2RG8 A;  4JA7 A;  3R9M A;  2VQ2 A;  2OVF A;  4AEZ C;  4P29 A;  4R7L A;  3ESK A;  4Y6W A;  2IEJ A;  3W9F A;  3D9N A;  4RLY A;  3FY4 A;  3DEO A;  1EYH A;  3R7R A;  4CCA A;  2DZN A;  4TXR A;  4DUI A;  4EZJ A;  2NYJ A;  5G55 A;  4J8E A;  1N94 A;  4J6I A;  3QAQ A;  4ATZ D;  5AEN A;  1O1T A;  4GTT A;  2XGS A;  5BW8 C;  2DZO A;  1DNP A;  2KC7 A;  4A63 B;  3NZU A;  2V4L A;  1DCQ A;  3DPD A;  3AG1 E;  1E90 A;  1NI1 A;  2Q7F A;  4K03 A;  5D0O D;  3JQ0 A;  4I1A A;  5AIJ A;  3V2X A;  3TWQ A;  4OVU A;  4U8Y D;  4AY6 A;  2MYO A;  3OXF A;  1N4Q A;  5CMW A;  5G04 C;  4Q69 A;  4F6R D;  3PZ3 A;  3TXM A;  3BG1 B;  2YQ8 A;  5ANR A;  3AS4 A;  3CST A;  4AXH A;  2WQ7 A;  1OCZ E;  3CVP A;  1WDY A;  1X5B A;  4LNU D;  5T8I A;  4RVB A;  2J07 A;  4WNG A;  2VSO E;  5G04 J;  3NBN B;  4X8Q A;  3SBT B;  4GZD A;  1TNO A;  4U04 A;  1AP7 A;  2P2C P;  3E37 A;  3OXL A;  4UWH A;  3OXG A;  4UI9 J;  3HVE A;  3GW4 A;  2FO1 E;  2PZI A;  4YVQ C;  1IYG A;  3LXU X;  5ENS D;  2BKG A;  4N2S A;  4GTV A;  4JHR A;  1TNY A;  1NL4 A;  4E6H A;  3EHR A;  3I4R B;  1HU3 A;  4ME2 A;  2ION A;  1KT0 A;  2EIN E;  3CHP A;  3SY2 A;  3ZIM A;  5KNG A;  2FO7 A;  3HVE B;  2Y4T A;  5CMY A;  3ZKJ A;  2HM8 A;  4DI4 A;  5B1B E;  1MQS A;  3HXF A;  2F8Y A;  2E2E A;  4U8V D;  2P58 C;  4MKT A;  3JUE A;  2DYS E;  5FQ6 A;  3T9K A;  5AJD A;  3NZS A;  4I6G A;  3APD A;  2L9B A;  3FEX A;  3QC1 A;  3UX4 A;  1E8W A;  2XRY A;  5J08 A;  3UM0 A;  4EZL A;  1D8E A;  3TG4 A;  3ULY A;  1Q2Z A;  3PZ4 A;  2AWI A;  3IXE A;  5FQ4 A;  3U9W A;  3FUF A;  4JC8 A;  1Z3X A;  1MX2 A;  4L7T A;  2DIW A;  4GZ3 A;  3DRA A;  4YDO A;  4A1G A;  3Q78 A;  2LSU A;  4K5A B;  3ABK E;  3U4T A;  1JPL A;  3SNX A;  2V5Q C;  2L6J A;  4ANX A;  2OCC E;  1TNU A;  1K3Z D;  2ZGG A;  2LO6 A;  5EIL A;  4XIF A;  3D9L A;  3NQP A;  1JCS A;  4CZ2 D;  1LD8 A;  4EBA G;  3EIJ A;  4UWK A;  2V4H C;  3NF1 A;  4MLP A;  2L0I A;  3FTV A;  1HO8 A;  3QWV A;  4C9B B;  1YYH A;  1HG5 A;  4HRL A;  2XS8 A;  3E33 A;  2X6K A;  5A7D B;  3EU9 A;  4O60 A;  5KJN A;  2EIM E;  5KJK A;  1P5Q A;  3AG2 E;  4Q96 A;  1TJC A;  3FUL A;  3CVX A;  2ETC A;  4APF A;  3QWW A;  1UJJ A;  3FWV A;  5D2M C;  3LJ3 A;  3IHY A;  3QKY A;  2NC9 A;  2XCC A;  2I9C A;  3D9O A;  5KWD A;  2CG3 A;  4G25 A;  4UI9 K;  3ASG A;  1JWG A;  1E7V A;  2BF0 X;  4KXK B;  1XGW A;  2MRI A;  4KMO A;  3KSQ A;  1H2U A;  3RRN B;  1UJK A;  3ULQ A;  3CVN A;  4A55 A;  2J8S D;  5EX3 A;  3UMV A;  4BTA A;  3PE3 A;  1UOH A;  3IV0 A;  3KS2 A;  4B94 A;  3ZNG A;  5LX8 A;  3ZYL A;  3K9I A;  2X6F A;  2WQ6 A;  3AJI A;  5ENN A;  5BV1 A;  2J9Q A;  2R02 A;  3RKV A;  4J8D A;  4XI9 A;  4B8A A;  3TWT A;  3ZYM A;  2P9I G;  4KVO A;  3X2Q E;  3LY8 A;  4JVS A;  1SW6 A;  1ELR A;  2LXM A;  5E76 A;  3FUK A;  2EIJ E;  4GZC A;  4GTR A;  4GB9 A;  3CV0 A;  4UWG A;  3G2U A;  3FUH A;  2IJG X;  2WXL A;  3G2W A;  4BWR A;  1IQR A;  4DLQ A;  4HLL A;  2P9N G;  3AU5 A;  4YND A;  3PRZ A;  4FC8 A;  4AOF A;  2WPV A;  3CR3 A;  4DLO A;  1OWL A;  5EYP F;  1LD7 A;  1W3B A;  4G26 A;  1AWC B;  5CBN A;  2VSX E;  2RFM A;  2OOE A;  5ENT D;  2AXU A;  1MYO A;  2IU1 A;  3HYM B;  3HG0 D;  1NA3 A;  3D9P A;  4TXP A;  2XPZ A;  3I3N A;  4B8C B;  1N4P A;  3ZU7 B;  4KZ0 A;  1N95 A;  3IEG A;  5BNW A;  3DST A;  3UM2 A;  1EDU A;  2WMO A;  3AU4 A;  3UXG A;  3VTY A;  3B7B A;  4CYM D;  4I6J A;  4ABN A;  2XZD G;  5ARF A;  1L5J A;  4O1O A;  1IHG A;  3DSW A;  4F3V A;  2V5F A;  5EYL A;  2WMN A;  3PUK A;  1GW6 A;  4JXT A;  3FDH A;  4A1S A;  1TNB A;  2XHE A;  4KBQ A;  4OAV B;  4AP2 A;  4G8L A;  1UN9 A;  3JCK C;  1X81 A;  4ACK A;  3ZN3 A;  3V2O A;  3ZFW A;  3Q73 A;  1HH8 A;  4YDW A;  4H7X A;  5ANL A;  1OWN A;  5IY5 E;  2ETA A;  5JJ7 A;  3ASF A;  2IF4 A;  3QWP A;  3PNT B;  1N54 A;  2R03 A;  4RG9 A;  5KNH D;  2VYI A;  1QBQ A;  2LAI A;  1TR4 A;  3CVL A;  4F53 A;  3U3W A;  4GU5 A;  3RU0 A;  3FU5 A;  3LKU A;  3TWU A;  2ZGD A;  2CFU A;  5T4Y A;  4F7A A;  2WXM A;  3I4G A;  3ZPJ A;  3APC A;  3EHM A;  3D9J A;  3LPZ A;  3SFY A;  2I6H A;  3FU3 A;  3CEQ A;  4BER A;  2ILR A;  3J5Q B;  3ML9 A;  2R2L A;  5BXO A;  2CHW A;  1UN8 A;  2XEN A;  2XEE A;  1OCC E;  4CGV A;  3J5P A;  3SQV A;  3E32 A;  4HRN A;  4KT6 B;  1KLX A;  4GPM A;  3MZL B;  4IN3 B;  3D9I A;  2HO1 A;  3SF4 A;  1BPO A;  4GMR A;  1WY6 A;  2Y69 E;  4I9E A;  2XRZ A;  3FU6 A;  4HBD A;  2RKK A;  3CVY A;  3RAU A;  4MBG A;  3B7U X;  3FEY A;  2J4B A;  2WQH A;  2NXP A;  1K1A A;  4CRW A;  3HXB A;  2J4D A;  5G2N A;  4GTP A;  3VLE A;  2WB2 A;  4HOR A;  4LNG A;  2A4Z A;  3QDN A;  1PY1 A;  4ILI A;  3O48 A;  3EHN A;  3JXI A;  2AXV A;  5EID A;  4XKC A;  4URK A;  3APF A;  4B93 B;  4L23 A;  2OND A;  2QZA A;  5E75 A;  3TL5 A;  2WXP A;  3Q79 A;  2WM9 A;  3CIA A;  4EHM A;  4N5Q A;  3QJZ A;  2XPY A;  4WWO A;  3HIZ A;  4ILH B;  4DX2 A;  4A3T A;  3SGH A;  2X38 A;  5JHB A;  1RW2 A;  2QYJ A;  5CER B;  2PQR A;  2RFA A;  4L2Y A;  3O4Z A;  1BLX B;  3HDX A;  3L82 A;  1Y6I A;  4M3O A;  3UT4 A;  1UG3 A;  1RZ4 A;  5M72 A;  1Y8M A;  4HQD A;  3EU5 A;  1N0Q A;  4U7E B;  3D9K A;  3AG4 E;  4TXQ A;  2F8X K;  1S70 B;  1YMP A;  5HI7 A;  4GYW A;  5HRY A;  3V79 K;  1UW4 B;  2LUH A;  4UI9 C;  4EBA A;  4GYY A;  3LS8 A;  4G24 A;  2J49 A;  1NZN A;  1NA0 A;  2QC9 A;  4JW1 A;  4I43 A;  1OY3 D;  4BY6 A;  2GRQ B;  2HYZ A;  4YVO A;  3FUJ A;  4FUL A;  5AAR A;  4JHK A;  1S64 A;  1TN7 A;  3BEE A;  2YIN A;  4LSZ E;  3MCX A;  1NFI E;  4OVV A;  4ZHB A;  4GCN A;  2H6F A;  4QFV A;  1H0A A;  1E7U A;  4FP7 A;  2DVW A;  5JA4 D;  3CVQ A;  2C2L A;  3G2V A;  4FJZ A;  5CRU A;  3BU8 A;  1H2T C;  1ZU2 A;  5FZQ A;  2EQX A;  2XEV A;  2F37 A;  2P9K G;  5HKP A;  5LFA A;  3RO3 A;  5AQ7 A;  3FU0 A;  5BT1 A;  3FUI A;  1N52 A;  4DX1 A;  3ZGQ A;  1JUQ A;  3ZHE A;  2PM7 A;  4J8F A;  1S63 A;  2AJA A;  2XGM A;  4NRH B;  3ASD A;  3FTZ A;  2LAH A;  3UTM A;  4NAC A;  3B95 A;  4PS7 A;  3QK0 A;  4DK5 A;  2XZT G;  2GRR B;  3MGB A;  3ZHE B;  3EIQ C;  4RSY A;  4CGW A;  3KAE A;  4K5B A;  3UM1 A;  4XKB A;  1MX6 A;  5ARG A;  3TWV A;  3MJW A;  1TN8 A;  2GRM A;  2RD0 A;  2PL2 A;  2AXZ A;  5EX0 A;  2QFC A;  1EPU A;  1OCR E;  2VSY A;  1H6O A;  3HXC A;  3ONL A;  4CDM A;  3CVW A;  3U66 A;  3TWW A;  3DXK G;  4K0R A;  4BT8 A;  2P9L G;  2B0O E;  4FLB A;  3MYV A;  4W9R A;  3Q4A B;  4PS8 A;  1HS6 A;  5AYW D;  4G2V A;  4U07 A;  3LDZ A;  5EKQ D;  4O1P A;  1S0P A;  3L54 A;  4PDX A;  4GA1 A;  3HHM A;  3C98 A;  2KXP C;  1H2V C;  1N0R A;  3L6A A;  4L1B A;  2VGX A;  3CVV A;  4ANW A;  4HLE A;  1E8Y A;  5C1D A;  3IBE A;  3PZ2 A;  1ELK A;  1QNF A;  5FIO A;  4N3B A;  1U3D A;  4L2L A;  1U3C A;  2P9S G;  3C3O A;  4I9C A;  4UQZ A;  5ENO D;  5KJL A;  1KPS B;  2H6I A;  4ANV A;  4I6E A;  3T5V A;  1SA5 A;  2VGX B;  4HNA D;  3WXX A;  4AM9 A;  3SI5 A;  2BED A;  3UT8 A;  5JMN D;  4FLH A;  1WM5 A;  2VSN A;  4OYS A;  1G3N B;  4GTS A;  1SVX A;  3V31 A;  2WXQ A;  4GPK A;  4APO A;  4ANU A;  3AG3 E;  3D9M A;  3LY9 A;  3ZXS A;  1JCR A;  3FH7 A;  4PH4 B;  2J08 A;  1XNF A;  2GRN B;  2KBX A;  3PNL B;  4JA9 A;  3ZRH A;  3KEZ A;  1FVH A;  4HOS A;  4LRZ A;  5A23 A;  4K5C A;  4IUL A;  3MKQ A;  5HQ8 A;  5KJM A;  3DXM G;  2VJ8 A;  5JJ6 A;  1HG2 A;  5BUZ A;  4CT4 A;  5FT9 A;  4GAA A;  1E8X A;  3FUM A;  2FEZ A;  4GA0 A;  5FQ7 A;  4GZ5 A;  4WNF A;  4B89 A;  4GML A;  1DC2 A;  4HOU A;  5DIZ A;  4MRU A;  3MKQ B;  2OVB A;  5KBA A;  1ZB1 A;  1NP7 A;  3UUX A;  2P9P G;  4I1M A;  4AJW A;  1TYQ G;  2FUL A;  3DWL G;  3PZ1 A;  2ZU6 B;  1TEZ A;  5D66 A;  3CGH A;  3S2A A;  3MKR A;  5EIB E;  5LP0 A;  4LEU A;  2XCB A;  1PAQ A;  2VTB A;  4J8S A;  3PEV B;  3PUJ A;  4LER A;  3I5P A;  3UM3 A;  4FU3 A;  5ENP D;  4BX9 A;  1HFA A;  1WAO 1;  4JPS A;  1V55 E;  2GRL A;  4HI8 A;  3RK6 A;  3W9G A;  1O1S A;  1MHQ A;  1LTX A;  2HE0 A;  2IY0 C;  3E30 A;  5CHE E;  2QY7 A;  2VTB B;  3KD7 A;  3N71 A;  3FTY A;  3P2B A;  4UQY A;  2LSV A;  3SHF A;  2KM4 A;  3AS8 A;  1OT8 A;  5CEC B;  4U0Z A;  2XEH A;  1VDY A;  2KZT A;  3BUA A;  2MHK A;  1TN6 A;  3HRA A;  5B3S E;  3UI2 A;  2BKK B;  2JLB A;  1D9S A;  4I2Z A;  3TGO A;  4BET A;  5AQA A;  3PEU B;  3Q7F A;  4BTB A;  4C48 B;  2KZT B;  3JQ1 A;  4HVB A;  4UUC A;  4WAF A;  3CHQ A;  4HFG A;  3U64 A;  4JEU A;  2EIL E;  4XEI G;  3PVL A;  4JEH A;  5FTP A;  4EZK A;  1A5E A;  2KCV A;  2KAT A;  3PDN A;  3D9H A;  3RJV A;  2R05 A;  1MZC A;  3DSU A;  4LUN U;  2BTD A;  4N3A A;  3MEK A;  3ASH A;  3QAR A;  4CEM A;  3ISM C;  3LEW A;  3LJN A;  5FZR A;  1BD8 A;  3L22 A;  1DCE A;  2LNI A;  3GZ2 A;  3L17 A;  3DPY A;  3CSF A;  4L9P A;  2QYU A;  2WXG A;  3EDT B;  3B13 A;  3S7B A;  5FJY A;  3MX3 A;  3SO8 A;  4J7W A;  3ZEF A;  5A6C A;  3S7D A;  1IXV A;  1FT1 A;  1N4R A;  2GW1 A;  3C72 A;  1LF8 A;  1QZ2 A;  3FUD A;  4C0E A;  3ONK A;  3L08 A;  4N3C A;  3HXE A;  4YDE A;  3T8M A;  3IHV A;  2BUG A;  3JXJ A;  1OWM A;  4BES A;  2GGF A;  3ZXP A;  3B7T A;  3C3Q A;  3LYA A;  3G2T A;  1H6P A;  2PQN A;  3OAW A;  4NIK A;  2CG2 A;  3QOU A;  2PNN A;  4M7C A;  3Q15 A;  2MOW A;  4AVX A;  2OEV A;  3P1U A;  3LVR E;  3G2S A;  4PS3 A;  4BSX A;  2AVP A;  4DI3 A;  4BEP A;  1PC2 A;  1QYM A;  3E4B A;  1BI7 B;  3TG5 A;  2DYR E;  3CHO A;  2KCK A;  3LVQ E;  1U2V G;  2KCL A;  4DRX E;  4UWF A;  4BFR A;  2A5E A;  3F6Q A;  2CFZ A;  4WNE A;  1INZ A;  3RO2 A;  4RG6 A;  1K1B A;  2UWJ G;  3PS6 A;  1HF8 A;  2JEK A;  3FFL A;  1O5M A;  3NAW A;  1HXI A;  4AIF A;  3R9A B;  4IYP A;  4YDY A;  5AJL A;  4HXI A;  3SFZ A;  3DSX A;  4N39 A;  4A3V A;  3TAX A;  2WXR A;  4JD2 G;  5BPP A;  3URZ A;  3ZVV A;  3ZYK A;  3PRE A;  4GTM A;  2Y1L E;  3VLF A;  2V0P A;  4G11 A;  4XX5 A;  3ABL E;  2R17 C;  2XGO A;  3SD5 A;  1QQE A;  2Y0B G;  4Y6C A;  4WND A;  2DWZ A;  3WG7 E;  5CBO A;  1N9A A;  3Q9N C;  4G1T A;  1FPP A;  3TWR A;  4U95 D;  4G23 A;  2WXH A;  4GMJ A;  3CLJ A;  3D3M A;  1IKN D;  4KVM A;  3ML8 A;  3CVU A;  4WWP A;  3T8K A;  5LOZ A;  2IO2 C;  1OUV A;  4PUC A;  3GYZ A;  2R59 A;  4XI0 A;  4I2W A;  2Y3A A;  4ILG A;  4MS6 A;  3CHS A;  2VGY A;  3MV2 B;  4CDR A;  4TUM A;  3FTW A;  4E85 A;  2WXK A;  2UY1 A;  1N4S A;  4TRQ A;  3TWS A;  2IFU A;  4TUU A;  2C0L A;  2X6J A;  4XE0 A;  4IRU A;  3Q47 B;  1TJF A;  2YNQ A;  5ENQ D;  3UPV A;  4NQ0 A;  1OCO E;  4HRM B; 
#chains in the Genus database with same CATH homology
 3R7R A;  4FHJ A;  4CCA A;  4ANV A;  4I6E A;  2XHE A;  4KBQ A;  2CHZ A;  3T5V A;  4AP2 A;  2VGX B;  2UY1 B;  4EZJ A;  1UN9 A;  3JCK C;  5G55 A;  2WXN A;  4J8E A;  4J6I A;  5DBK A;  3WXX A;  4AM9 A;  3SI5 A;  3QAQ A;  3UT8 A;  4ACK A;  3ZN3 A;  5AEN A;  5JJT A;  4FLH A;  1WM5 A;  3ZFW A;  2VSN A;  2XGS A;  4OYS A;  4UWL A;  3MA5 A;  3LCA A;  1HH8 A;  5BW8 C;  2WXQ A;  3FTS A;  1DNP A;  2KC7 A;  4H7X A;  4GPK A;  5ANL A;  1OWN A;  3TJP A;  3UT7 A;  4APO A;  2X6I A;  2Y4U A;  1SZA A;  1EF1 C;  3NZU A;  4ANU A;  2V4L A;  3D9M A;  3LY9 A;  5JJ7 A;  3ASF A;  2IF4 A;  3QWP A;  3PNT B;  3ZXS A;  1N54 A;  3FH7 A;  4PH4 B;  2J08 A;  3FUE A;  3DPD A;  1XNF A;  5G05 C;  1E90 A;  2Q7F A;  4K03 A;  5D0O D;  4RG9 A;  3PNL B;  2VYI A;  4JA9 A;  2OV8 A;  3JQ0 A;  2FI7 A;  2LAI A;  4CT0 A;  2E0I A;  4I1A A;  3CVL A;  4F53 A;  3ZRH A;  3KEZ A;  1HZ4 A;  3FUN A;  4FA6 A;  2XQ0 A;  5AIJ A;  3U3W A;  4OVU A;  1FVH A;  4AY6 A;  5J90 A;  4HOS A;  3OXF A;  4GU5 A;  4LRZ A;  3RU0 A;  4D10 C;  3FU5 A;  3LKU A;  5A23 A;  5CMW A;  4IUL A;  3MKQ A;  1HX8 A;  5HQ8 A;  2CFU A;  4H7Y A;  3ESL A;  2V8S E;  5G04 C;  4Q69 A;  5T4Y A;  5KJM A;  2VJ8 A;  5G05 J;  5JJ6 A;  4F7A A;  1HG2 A;  5BUZ A;  2IQC A;  2WXM A;  3I4G A;  3SBS A;  4CT4 A;  3TXM A;  3UQ3 A;  3BG1 B;  3ZPJ A;  2YQ8 A;  5FT9 A;  3APC A;  4GAA A;  5ANR A;  1E8X A;  2C0M A;  3EHM A;  3AS4 A;  3FUM A;  3PH0 C;  3CST A;  3D9J A;  3LPZ A;  2FEZ A;  2I6H A;  3FU3 A;  3CEQ A;  4GA0 A;  5FQ7 A;  4AXH A;  2ILR A;  2WQ7 A;  3CVP A;  3ML9 A;  5T8I A;  1X5B A;  4GZ5 A;  2FF4 A;  4WNF A;  5EDS A;  4B89 A;  4GML A;  2CHW A;  1UN8 A;  4HOU A;  4RVB A;  5DIZ A;  4MRU A;  2J07 A;  3MKQ B;  1A17 A;  2OVB A;  1H6K A;  1NP7 A;  3UUX A;  4WNG A;  4CGV A;  4I1M A;  3QNK A;  5FZS A;  4AJW A;  2VSO E;  5G04 J;  4KT6 B;  4EPZ A;  2FUL A;  3SBT B;  4HOT A;  4GZD A;  3CK7 A;  4U04 A;  1KLX A;  3MZL B;  3ZYQ A;  4C0M A;  4IN3 B;  3D9I A;  3DBS A;  2ZU6 B;  2HO1 A;  3SF4 A;  3OXL A;  1TEZ A;  3CGH A;  1BPO A;  3OXG A;  4UWH A;  4UI9 J;  3S2A A;  3MKR A;  4DJA A;  1WY6 A;  3HVE A;  4I9E A;  3B7S A;  2X6H A;  2XRZ A;  5LP0 A;  4LEU A;  2XCB A;  3GW4 A;  3FU6 A;  2PZI A;  4YVQ C;  3MV3 B;  1PAQ A;  1IYG A;  4DPR A;  4KZC A;  3LXU X;  2VTB A;  2HR2 A;  3CVY A;  4J8S A;  4N2S A;  4JHR A;  3PEV B;  3FP3 A;  3B7U X;  3PUJ A;  4LER A;  3FEY A;  4E6H A;  2J4B A;  3I5P A;  3I4R B;  3L13 A;  4FU3 A;  1HU3 A;  2WQH A;  3T5X A;  4ME2 A;  1HFA A;  4BX9 A;  2ION A;  1WAO 1;  2NXP A;  4JPS A;  4CRW A;  4BT9 A;  2GRL A;  1KT0 A;  3RK6 A;  2J4D A;  3CHP A;  5G2N A;  2WXO A;  3ZIM A;  1IQU A;  1MHQ A;  3VLE A;  2WB2 A;  4HOR A;  2FO7 A;  3HVE B;  2A4Z A;  4JZY A;  3QDN A;  1DVP A;  2Y4T A;  3R7Q A;  1PY1 A;  5CMY A;  2HM8 A;  5CHE E;  4ILI A;  4CDN A;  4DI4 A;  3O48 A;  3CQC B;  1MQS A;  2QY7 A;  2YHE A;  2VTB B;  2DBA A;  3KD7 A;  4I17 A;  4FJY A;  3EHN A;  2E2E A;  2AXV A;  1OWO A;  3N71 A;  3IKO B;  2P58 C;  3APF A;  4MKT A;  1E8Z A;  4XKC A;  4URK A;  4L23 A;  3FTY A;  5FQ6 A;  2OND A;  5E75 A;  5AJD A;  3P2B A;  3NZS A;  2WXP A;  4UQY A;  5T3R A;  3TL5 A;  5CCM A;  2YHC A;  2LSV A;  1Z6T A;  3SHF A;  2KM4 A;  2WM9 A;  3CIA A;  3AS8 A;  4U0S A;  4I6G A;  3APD A;  3QJZ A;  2XPY A;  4TV3 A;  4WWO A;  2I1K A;  2L9B A;  4AY5 A;  3FEX A;  3HIZ A;  3QC1 A;  4ILH B;  3UX4 A;  4U0Z A;  1E8W A;  1ZBP A;  4A3T A;  1VDY A;  2KZT A;  2PM6 A;  2XRY A;  3SGH A;  5J08 A;  2MHK A;  4EZL A;  3LY7 A;  2IOS A;  2X38 A;  3TG4 A;  5JHB A;  2AWI A;  4O6F A;  3SZ7 A;  5D0Q D;  1SZ9 A;  5FQ4 A;  3U9W A;  3FUF A;  4NUR A;  4JC8 A;  2PQR A;  1Z3X A;  4L2Y A;  3EJN A;  3O4Z A;  2FBN A;  3HDX A;  4L7T A;  2JLB A;  4GCO A;  3CK9 A;  2DIW A;  4GZ3 A;  4I2Z A;  4U0U A;  3TGO A;  4FAD A;  1Y6I A;  3PEU B;  4A1G A;  4BTB A;  2KZT B;  5BV0 A;  4M3O A;  2LSU A;  3U4T A;  1UG3 A;  3JQ1 A;  3UT4 A;  4HOQ A;  1JPL A;  4HVB A;  2J09 A;  3ZW3 A;  4WAF A;  5M72 A;  3SNX A;  1Y8M A;  2L6J A;  3CHQ A;  4HFG A;  3U64 A;  4JEU A;  5JHA A;  4ANX A;  3D9K A;  3PVL A;  4JEH A;  5FTP A;  5HI7 A;  4GYW A;  4EZK A;  3S7J A;  2KCV A;  2LO6 A;  2KAT A;  4XIF A;  3D9L A;  3NQP A;  3PDN A;  5KCM A;  1UW4 B;  3RJV A;  4LUN U;  3BG0 B;  2BTD A;  4N3A A;  4UI9 C;  4EBA A;  3MEK A;  2R5S A;  3ASH A;  4GYY A;  3LS8 A;  4EBA G;  3QAR A;  4G24 A;  4CEM A;  3LEW A;  4GYO A;  3EIJ A;  4UWK A;  2J49 A;  5FZR A;  3NF1 A;  3L22 A;  1NZN A;  4MLP A;  2WXJ A;  1NA0 A;  3S7F A;  5CCL A;  4UQX A;  3CK8 A;  1H19 A;  2L0I A;  3FTV A;  4B0Z A;  4JHJ A;  1HO8 A;  2LNI A;  3GZ2 A;  5FWQ A;  3L17 A;  3QWV A;  4JW1 A;  4I43 A;  4C9B B;  1HG5 A;  3CSF A;  1B89 A;  4BY6 A;  2X6K A;  5A7D B;  4F1S A;  2HYZ A;  2WXG A;  3FTU A;  5KJN A;  4YVO A;  5KJK A;  2L0T B;  2AW6 A;  1KT1 A;  1P5Q A;  2CHX A;  3FUJ A;  4FUL A;  4U63 A;  3RRM B;  4Q96 A;  1TJC A;  3FUL A;  3EDT B;  3L16 A;  3QB2 A;  1HE8 A;  3B13 A;  3CVX A;  3S7B A;  4APF A;  3QWW A;  1UJJ A;  4JHK A;  4ACL A;  5FJY A;  3MX3 A;  3FWV A;  4ATG A;  3BEE A;  3ZEF A;  3LJ3 A;  2YIN A;  5A6C A;  3S7D A;  3MCX A;  4I1O B;  3IHY A;  2DCP A;  3QKY A;  2GW1 A;  1ELW A;  1Z3Y A;  4OVV A;  2NC9 A;  1LF8 A;  2WXI A;  4GCN A;  1QZ2 A;  2I1J A;  3FUD A;  2XCC A;  4C0E A;  2I9C A;  3ONK A;  3D9O A;  4V3I A;  2X3M A;  3GZS A;  3L08 A;  2CG3 A;  4G25 A;  4N3C A;  4QFV A;  4UI9 K;  3ASG A;  3T8M A;  4Q94 A;  3IHV A;  2BUG A;  1OWM A;  1JWG A;  2GGF A;  3B7T A;  1E7V A;  3LYA A;  1H0A A;  3G2T A;  2BF0 X;  1E7U A;  4FP7 A;  3FH8 A;  2PQN A;  3OAW A;  3B7R L;  4JL0 A;  3CVQ A;  4KXK B;  3CKB A;  1XGW A;  3VTX A;  2MRI A;  2C2L A;  4KMO A;  3G2V A;  3Q49 B;  2CG2 A;  3QOU A;  1H2U A;  4FJZ A;  3RRN B;  1SQM A;  2WXF A;  1UJK A;  3CHR A;  3JYS A;  3ULQ A;  1H2T C;  4N2Q A;  3Q5M A;  4FHK A;  1ZU2 A;  5FZQ A;  3Q15 A;  3CVN A;  4A55 A;  2EQX A;  2XEV A;  2MOW A;  5EX3 A;  3JUI A;  4AVX A;  3UMV A;  4BTA A;  3P1U A;  3PE3 A;  5LFA A;  3IV0 A;  3LVR E;  3G2S A;  4PS3 A;  1FCH A;  3RO3 A;  3VLD A;  3FU0 A;  4BSX A;  5BT1 A;  3KS2 A;  2AVP A;  3CKC A;  3FUI A;  1N52 A;  4B94 A;  3ZGQ A;  4DI3 A;  5LCW C;  3ENE A;  1JUQ A;  3ZHE A;  2PM7 A;  3AS5 A;  1PC2 A;  5LX8 A;  3ZYL A;  3CHM A;  3FH5 A;  4J8F A;  3E4B A;  3K9I A;  4WUY A;  3TG5 A;  4WWN A;  1FVF A;  2XGM A;  3CHO A;  4GA2 A;  3OTN A;  2KCK A;  4NRH B;  2X6F A;  3LVQ E;  3ASD A;  1JWF A;  2KCL A;  3FTZ A;  2WQ6 A;  4UWF A;  5ENN A;  5BV1 A;  4BFR A;  4J0U A;  2J9Q A;  2LAH A;  3RKV A;  4NAC A;  2CFZ A;  4J8D A;  4XI9 A;  4WNE A;  4B8A A;  1INZ A;  3RO2 A;  4RG6 A;  1OWP A;  4PS7 A;  3QK0 A;  4DK5 A;  2UWJ G;  3ZHE B;  3PS6 A;  3MGB A;  3ZYM A;  5LCW J;  1HF8 A;  5FQ8 A;  4KVO A;  3EIQ C;  4RSY A;  4CGW A;  2JEK A;  3KAE A;  2IOL A;  3FFL A;  4XKB A;  3LY8 A;  4JVS A;  1ELR A;  1HXI A;  4AIF A;  5ARG A;  5E76 A;  3R9A B;  4IYP A;  3FUK A;  5AJL A;  3TXN A;  4HXI A;  4XZ4 A;  4N39 A;  3SFZ A;  3MJW A;  4GZC A;  2GRM A;  2RD0 A;  3CV0 A;  4GB9 A;  2PL2 A;  4A3V A;  3RRU A;  4UWG A;  2WXR A;  3TAX A;  4EQF A;  3G2U A;  3FUH A;  5BPP A;  3URZ A;  3ZVV A;  2AXZ A;  2IJG X;  2WXL A;  2NSZ A;  3G2W A;  1IQR A;  3PRE A;  3RIB A;  3ZYK A;  5EX0 A;  4BWR A;  4DLQ A;  4AV7 A;  3AU5 A;  1E96 B;  4YND A;  2QFC A;  5KJL A;  3VLF A;  3PRZ A;  1EPU A;  4FC8 A;  2VSY A;  4AOF A;  2V0P A;  3ONL A;  2WPV A;  3CR3 A;  4G11 A;  4XX5 A;  4CDM A;  3CVW A;  2R17 C;  3FTX A;  2XGO A;  4DLO A;  3SD5 A;  1OWL A;  1QQE A;  3U66 A;  1W3B A;  4K0R A;  4G26 A;  4Y6C A;  4BT8 A;  4BX8 A;  4WND A;  2WVI A;  2VSX E;  3PZD A;  4HS2 A;  4FLB A;  2XPI A;  3PE4 A;  3MYV A;  4N5C A;  4W9R A;  3Q4A B;  4PS8 A;  5C2Y A;  4GZ6 A;  2OOE A;  4KYO B;  1HS6 A;  1YA0 A;  4G1T A;  4EEC A;  2AXU A;  3FHE A;  5AYW D;  4G2V A;  2IU1 A;  4G23 A;  2WXH A;  3HYM B;  2M63 A;  3GZ1 A;  4U07 A;  2A5U A;  3LDZ A;  1NA3 A;  3CQG B;  3D9P A;  4U8H A;  5EKQ D;  2I2O A;  3CLJ A;  2XPZ A;  4GMJ A;  3D3M A;  4KVM A;  3ML8 A;  3CVU A;  4WWP A;  5LOZ A;  3I3N A;  4B8C B;  1S0P A;  4LCT A;  3L54 A;  1OUV A;  4PUC A;  4PDX A;  3GYZ A;  4GA1 A;  4KZ0 A;  2RG8 A;  3C98 A;  2R59 A;  3HHM A;  4I2W A;  2Y3A A;  4XI0 A;  4A1S A;  3IEG A;  4ILG A;  5BNW A;  4JA7 A;  4MS6 A;  1H2V C;  2VGY A;  3CHS A;  3MV2 B;  4CDR A;  3FTW A;  1EDU A;  3L6A A;  4L1B A;  4E85 A;  2WMO A;  2VGX A;  2UY1 A;  2WXK A;  2VQ2 A;  4TRQ A;  4ANW A;  3AU4 A;  3CVV A;  2IFU A;  4HLE A;  1E8Y A;  2OVF A;  5C1D A;  3IBE A;  4TUU A;  3VTY A;  1ELK A;  4AEZ C;  2C0L A;  2X6J A;  1QNF A;  4I6J A;  4N3B A;  4ABN A;  5ARF A;  1L5J A;  4P29 A;  4XE0 A;  1U3D A;  4R7L A;  4IRU A;  3Q47 B;  1IHG A;  3ESK A;  1TJF A;  4L2L A;  4Y6W A;  1U3C A;  4F3V A;  2V5F A;  2WMN A;  3D9N A;  3PUK A;  1GW6 A;  2YNQ A;  4I9C A;  3FY4 A;  4UQZ A;  3UPV A;  4NQ0 A;  4JXT A;  3FDH A;  1EYH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...