2XCBA

Crystal structure of pcrh in complex with the chaperone binding region of popd
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
133
structure length
133
Chain Sequence
MLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords REGULATORY PROTEIN PCRH
publication title Structural Basis of Chaperone Recognition of Type III Secretion System Minor Translocator Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 60
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xcbA00
3VTYA 4N2QA 2FEZA 2KATA 3LY9A 4U07A 1A17A 1E96B 3GW4A 4O6FA 4G26A 2KCKA 3FFLA 4W9RA 4BTBA 4A1SA 2VGXB 4WNFA 2ONDA 2XPIA 3QWPA 4U0SA 4N3BA 2XEVA 3KAEA 1ELWA 4WNEA 3OXLA 3RO2A 4WNGA 2DBAA 1YA0A 2WQHA 3RKVA 4EQFA 3Q5MA 3TG4A 3UUXA 5JJ7A 4G24A 4JA9A 1NZNA 4XI9A 4JL0A 1XNFA 3HYMB 4BT8A 3QKYA 2C0MA 2FI7A 2VYIA 4I9EA 4NRHB 4WNDA 3KS2A 5BT1A 4G2VA 3ESKA 3U3WA 2YHCA 4HOSA 2FO7A 3ZHEA 3UQ3A 4UI9C 3Q47B 1ZBPA 2PZIA 3E4BA 2VSYA 5CCMA 3CVQA 3S7DA 2R5SA 1HZ4A 2VSNA 4KXKB 5CCLA 4H7XA 3Q49B 1KT0A 2IF4A 4APOA 4I17A 5FJYA 5A6CA 4CGWA 4G1TA 1HH8A 4GA0A 4IN3B 4HORA 3PE4A 4KBQA 1OUVA 2I6HA 5JJTA 4HOUA 3LY8A 3CKBA 2Y4TA 1QZ2A 4AM9A 4GZ3A 4XI0A 3KD7A 2YQ8A 5JJ6A 5ARGA 3UPVA 4NQ0A 4UQXA 3MV2B 5HQ8A 3QWVA 2V5FA 3CVNA 2KC7A 2NC9A 4ME2A 4Y6WA 2C0LA 4GYOA 4B94A 2XGSA 2WPVA 4N3CA 3CEQA 4J0UA 3ASHA 1HXIA 2KCVA 1NA3A 3RIBA 2OOEA 2VGYA 3WXXA 5CHEE 3CV0A 4G25A 4I2WA 4JHRA 5EX0A 2XCCA 4GA1A 4GZ5A 4U0UA 3S7JA 2KCLA 3TGOA 4UI9K 5KJKA 4Y6CA 5FTPA 3ULQA 4UI9J 3CK8A 3CKCA 5KJMA 3R9AB 3QDNA 5BW8C 2BUGA 1B89A 2UY1A 2L6JA 4JA7A 3RO3A 5DBKA 4AY6A 4AIFA 3OXFA 3U4TA 5M72A 3Q4AB 1IHGA 3NF1A 4XIFA 1TJCA 3K9IA 3AS5A 4U0ZA 3FWVA 4GCNA 4WUYA 3SZ7A 4UQYA 4G23A 5D0OD 4F3VA 4I2ZA 1ELRA 5D0QD 4RG9A 3O48A 1FCHA 5FZRA 5KJLA 3S7FA 3ASGA 1WAO1 4I9CA 1KLXA 5FT9A 5EX3A 2XGOA 2VQ2A 4LEUA 2Q7FA 2GW1A 2QFCA 4J8FA 1QQEA 2MHKA 4GCOA 1IYGA 3QOUA 2UY1B 3QWWA 4GYWA 4N2SA 5G04C 3TAXA 2PQRA 5BNWA 4GZ6A 3MA5A 3IEGA 3LY7A 2FBNA 5HI7A 3ZHEB 3OXGA 1NA0A 3TG5A 1WM5A 3RU0A 4GA2A 5G05C 4YNDA 2HO1A 4GPKA 3LCAA 4U04A 1ZU2A 2IFUA 3PDNA 4BT9A 3ASFA 1Y8MA 5FZQA 3FP3A 4HOQA 1P5QA 3MKRA 4UQZA 5FZSA 5KJNA 5LCWJ 4CGVA 4BTAA 3Q15A 4N3AA 3JYSA 3BEEA 2HR2A 2J9QA 2AVPA 2JLBA 2PL2A 4J8DA 5AYWD 4N5CA 1W3BA 3GZ1A 2XCBA 4I1AA 3MEKA 4RG6A 4J8EA 3VTXA 3LPZA 3ZN3A 4BWRA 2VGXA 2E2EA 3CK9A 5LCWC 3CVLA 4H7YA 3ZGQA 3GYZA 3EDTB 3AS4A 2PQNA 4CDRA 2LSVA 3LYAA 1KT1A 2XGMA 5A7DB 1PC2A 2LNIA 3RJVA 4HOTA 5G04J 5EKQD 3PE3A 3LKUA 2P58C 3AS8A 4N39A 3S7BA 3CK7A 4ABNA 4YVOA 3ZPJA 4AY5A 2C2LA 3CVPA 2LSUA 2UWJG 5C1DA 2HYZA 2Y4UA 4GYYA 4YVQC 4KYOB 3GZ2A 3URZA 5G05J 3ASDA 3N71A 3ZFWA 3SF4A 5ARFA 5DIZA 2FF4A 3MV3B
chains in the Genus database with same CATH superfamily
3VTYA 3EIJA 3LY9A 1A17A 3NB2A 1NP7A 3PZDA 2KCKA 3EHMA 2NYJA 3DEOA 1H2VC 3FUHA 4P29A 4CEMA 1DC2A 5AQ9A 3SBSA 4AV7A 4ILGA 4O1PA 4I6GA 2P9SG 1UJJA 4UUCA 2WQHA 3RKVA 3G2SA 3LVQE 3Q5MA 3UUXA 3D9JA 2YINA 2X6JA 4G24A 5ANLA 1NZNA 4XI9A 4URKA 4JEUA 3HYMB 2VYIA 3RRUA 3DWLG 4C48B 5AIJA 4G2VA 2AXVA 2LO6A 4FA6A 3UQ3A 1EDUA 3E4BA 2DCPA 4BY6A 4DX5D 1TNUA 4BX8A 2P9IG 3UIOC 1Q2ZA 3S7DA 4DRXE 2VSNA 3O4ZA 4TUUA 4H7XA 5FINA 2IF4A 3CHOA 4APOA 3V79K 1S63A 2GRLA 5FJYA 5A6CA 4RSYA 4YDYA 1EPUA 4G1TA 4U8YD 4EECA 5BXOA 4UWKA 2P9UG 5FQ8A 3PZ3A 5JJTA 3CKBA 3JQ0A 2IEJA 4I1MA 5KWDA 4GZ3A 3AG2E 3KD7A 4JXTA 4NQ0A 3R7QA 2R17C 1JWFA 4HRNA 4KVMA 1K1BA 3DSVA 2KC7A 1Z5SC 4F6RD 1D8DA 5FWQA 4C0MA 2PM7A 2XGSA 1SQMA 3CEQA 4B8CB 1JPLA 4WWNA 4PS7A 2OOEA 4HXIA 2J09A 2ZXWE 3SI5A 3WXXA 2XZTG 5CHEE 3CR3A 4JPSA 3HVEA 3SFZA 4U0UA 3CVWA 3J5PA 1X81A 3AU4A 1MX6A 3CKCA 1ZB1A 1IHBA 2OEVA 1B89A 3F6QA 4LERA 1D8EA 1LF8A 4L23A 4L2LA 5B1BE 3MX3A 3C3RA 3ZVVA 1IHGA 1NI1A 4XIFA 1VDYA 2I1JA 1OCRE 1TJCA 2HE0A 2WQ6A 3K9IA 1LTXA 1H0AA 2P9LG 3HRAA 3UT7A 2RFMA 2KBXA 3DSSA 3B13A 3FY4A 1DCQA 2WXJA 3T8KA 3L82A 4IYPA 4APFA 4RG9A 3AAAC 3O48A 3LJNA 4JZYA 3AG4E 3AG1E 3RAUA 1KZPA 5LFAA 3QJZA 5AQ7A 4HBDA 4I9CA 3UMVA 4ANVA 4I43A 2VQ2A 4BSZB 3B7TA 4C0EA 3CSFA 3D9LA 5HRYA 3T5XA 2QFCA 4ATZD 2R03A 4PUCA 3NAWA 2ZISA 4LUNU 3ULYA 4WWPA 3LVRE 5G04C 2FBNA 3D9MA 4GTMA 3PNTB 3E30A 2DVWA 5HI7A 3FTYA 3G2TA 2J08A 3L13A 4FHKA 1NA0A 1WM5A 3ZNGA 4GMLA 5EYPF 1OCZE 3PZ4A 5G05C 4YNDA 1HX8A 3LCAA 3ZRHA 1WY6A 4GTVA 1BD8A 3D9PA 5FZSA 2P9PG 3TWSA 5LCWJ 1E7VA 1OT8A 2LXMA 2XENA 4TXPA 2WMNA 3DEPA 3VLFA 3EU9A 5KBAA 4G8KA 2JLBA 2GRPB 1ELKA 5B1AE 1U3CA 1W3BA 3T9KA 2R02A 4RG6A 3HXEA 2VGXA 2E2EA 3IXEA 3CK9A 3C5RA 3CVLA 3RK6A 1K3ZD 2WXHA 3ZYLA 4B89A 3GYZA 4U96D 1MZCA 3AS4A 3L9TA 3QNKA 4CDRA 1UJKA 1E90A 2F8YA 4J6IA 5J90A 2R59A 2IU1A 3W9FA 2I1KA 2RD0A 5EIBE 3FU5A 4PS8A 2DIWA 2CHZA 4A63B 3S7BA 2ZIRA 2QYUA 4CYMD 2C2LA 2J4DA 2LSUA 4EZLA 4CT4A 4GMJA 2ZGDA 4GYYA 5CMYA 3LJ3A 1FT2A 3KEAA 4KYOB 5LOZA 4K5CA 1HU3A 1HF8A 3L08A 4Q69A 3P1UA 3CHPA 3SNXA 2V5QC 4GZCA 1E96B 3GW4A 4G26A 3PEVB 3FH8A 3Q79A 2WXPA 1BU9A 4WNFA 2LUHA 2ONDA 2QY7A 3QWPA 3FTZA 1TNYA 5FQ6A 3KAEA 3L16A 3OXLA 3PUKA 3MKQB 4YDOA 1YA0A 4EQFA 4D10C 2IOLA 3ISMC 1RW2A 5BPPA 1N0QA 2WXQA 3LEWA 5JJ7A 1JUQA 3NZSA 4BT8A 4K5AB 3FUEA 2XQ0A 1TN6A 4NRHB 4WNDA 1LD7A 3ESKA 2XZDG 4PDXA 4HI8A 5JA4D 2FO7A 3ZHEA 3TXMA 5D2MC 1UOHA 5AQAA 1ZBPA 3B95A 2X6HA 5E75A 2VSYA 4ATGA 3ZKJA 1G3NB 2H6HA 4E85A 4KXKB 3ABLE 3ABME 2F0YA 4CGWA 1OCOE 1H19A 1HH8A 4HORA 2CG3A 3PE4A 4B93B 1OUVA 4KMOA 1N95A 3WG7E 2GRMA 3HIZA 1QZ2A 4AM9A 3FUMA 3G2VA 3UPVA 3NBNB 1UG3A 4LRZA 4UQXA 3MV2B 3PVLA 4UWLA 3ZYQA 3CVNA 3R7RA 4EPZA 4A1GA 2NC9A 4ME2A 2H6GA 3L17A 3CGHA 5D66A 4B94A 1QBQA 2WPVA 4DX2A 1TJFA 1HXIA 1GW6A 2KCVA 2R2LA 3CQGB 5BUZA 3ASOE 3T5VA 2MRIA 4XE0A 1MX2A 4OAUC 3UKRG 2CG2A 3PH0C 1N11A 1DNPA 1S64A 4JHRA 4GA1A 4LNGA 4GZ5A 3S7JA 3TGOA 4Y6CA 5FTPA 4UI9J 3CK8A 1QNFA 2EIJE 5KJMA 3JXIA 3DRAA 4AP2A 3D9HA 2UY1A 4RQIA 4DX6D 1FPPA 3OXFA 3U4TA 2BKGA 1AP7A 4JC8A 3I5PA 1INZA 3NF1A 3AJIA 3L22A 3BQOA 3B7BA 2GRQB 4HS2A 4UQYA 4ANWA 4GTPA 4FP7A 3EIQC 4HLEA 1TNOA 4I2ZA 1RZ4A 2XRZA 1U3DA 3EHNA 2P9NG 3LXUX 3OTNA 3B7SA 1BPOA 2DZOA 5CECB 3EJNA 4HVBA 3DSWA 3HVEB 1H6PA 3UIPC 1O5MA 1KLXA 4Q96A 5FT9A 2VTBA 3R9MA 4KVOA 4LEUA 4DLQA 4OYSA 4JW1A 5LP0A 3TWUA 2GW1A 4CT0A 2FULA 2MHKA 2Y3AA 3QWWA 2Y69E 4BX9A 1TYQG 2RFAA 4HI9A 2PQRA 5BNWA 3MA5A 4F7AA 4U63A 3B7RL 1MJ0A 4JEHA 1JCQA 1E8ZA 3ESLA 3D9NA 4UWFA 5B3SE 3AG3E 1E7UA 2XS1A 4LSZE 4Q94A 2WXMA 2P2CP 1TN8A 4U04A 2X6IA 2IFUA 4U7EB 2QZAA 4NURA 4BESA 1KPSB 4C9BB 3FP3A 4HOQA 1P5QA 3MKRA 3L6AA 5ENSD 4DJAA 3KEZA 4CGVA 4BTAA 4N3AA 3BEEA 3T8MA 2BKKB 1N4PA 2JEKA 2AVPA 2PL2A 2J4BA 4EZKA 2L6BA 2EILE 4J8EA 3VTXA 5ENTD 5IY5E 1EF1C 3UM1A 3FTWA 2F8XK 2FO1E 3Q9NC 3EDTB 1O1TA 3BUAA 4LG6A 4IULA 1SZAA 2XGMA 1JWGA 3APCA 1FVHA 3TXNA 3EU5A 5AN8A 2LNIA 3RJVA 5H7PA 1DCEA 5AAOA 1UN9A 1K1AA 2V8SE 3FEYA 2P58C 4DK5A 2ETBA 3AS8A 2R05A 4I1OB 5T8IA 4AY5A 3IKOB 3CVPA 2UWJG 3UM0A 2HYZA 3G2WA 4YVQC 3E34A 3CHMA 5FQ4A 2BTDA 3HXFA 4GU5A 4A55A 3URZA 4XEIG 2YNQA 3ASDA 3ZFWA 4L7TA 3MCXA 5LX8A 4F1SA 5DIZA 4MKTA 3DXMG 1SZ9A 4N2QA 2KATA 2NXPA 4U07A 3I4RB 4XX5A 4TXQA 3ZW3A 5ENPD 4LCTA 3FFLA 4A1SA 2VGXB 1LD8A 3EHRA 1JCSA 2Y1LE 2KM4A 3CHSA 4RLYA 4U0SA 4GTRA 3FU3A 2XEVA 1N4SA 3FDHA 3MJWA 4WNEA 3DPDA 3ABKE 2E0IA 4HFGA 4WNGA 3BU8A 2X6FA 3SBTB 3SO8A 3S2AA 2XS8A 5EILA 3C72A 4EHMA 4B0ZA 2OVFA 2OVBA 2J07A 3FUDA 3ML8A 4AEZC 4JL0A 1XNFA 3QKYA 4JD2G 2V0PA 3KS2A 3NOGD 4BETA 3PUJA 3HXBA 2HM8A 4TXRA 4TUMA 2GGFA 4WAFA 3MYVA 1OWPA 4I6EA 2I2OA 4UI9C 2VSOE 5EIDA 2LXLA 2PZIA 3ZXSA 3NZUA 5CCMA 3CVQA 3PS6A 3GZSA 3V31A 2KZTA 5ITZF 3W9GA 3SD5A 5AENA 4LNUD 3TWXA 1FVFA 4G8LA 4HOUA 2NSZA 2XRYA 3QARA 2Y4TA 1BI8B 2WB2A 5JJ6A 5ARGA 1S0PA 2XEHA 3C98A 3FUNA 4CCAA 5HQ8A 3QWVA 4GTOA 3UT8A 1MYOA 3FTXA 2WXOA 4EZJA 4G11A 3IV0A 1IQRA 4Y6WA 5CBNA 2C0LA 4GYOA 1WDYA 3LS8A 2DZNA 3ZXPA 3RRMB 4F1PA 2AW6A 1NA3A 3RIBA 4CDMA 4ANXA 3FU6A 4DI4A 5G2NA 2MOWA 5BV0A 2XCCA 2EINE 3ULQA 4L9PA 4O60A 5ANRA 1UN8A 3QDNA 5HS0A 3AU5A 3HXCA 5FIOA 5KNGA 2BUGA 2L6JA 4JA7A 2OCCE 3RO3A 3TWTA 4AY6A 1OY3D 4HRMB 3ZIMA 4AIFA 5M72A 4UWHA 4OVVA 3UI2A 2Y0BG 3C3OA 1N94A 3AS5A 3HDXA 4U0ZA 4XKCA 2EIME 3ML9A 3SFXA 2XPYA 2WMOA 5G55A 3PZ2A 3TJPA 4FU3A 1N54A 3U66A 1TNZA 5E76A 2IY0C 1FCHA 1NL4A 5FZRA 5KJLA 3S7FA 4FC8A 3ASGA 3FUFA 3Q73A 2L0IA 4DX1A 3V30A 4ACKA 1WAO1 4M3OA 4FLBA 4Z68A 3TWWA 2J8SD 4J7WA 5EX3A 2XGOA 5CBOA 4LNBA 4JVSA 4A3TA 3V2XA 3FUKA 5CMWA 1QQEA 2IOSA 2RG8A 3QK0A 2UY1B 1YCSB 1OWNA 1SA5A 3ONLA 2BF0X 3TAXA 4GZ6A 2WQ7A 4L2YA 3HXDA 4KT6B 4KZCA 2JABA 3SQVA 3CVUA 4K5BA 3TG5A 5JMND 4GA2A 4ZFHA 1L5JA 2ZU6B 4AJWA 2X38A 4BSXA 2PM6A 2HO1A 1IKND 4GPMA 4RVBA 2RKKA 3HHMA 3C3QA 3PREA 1KZOA 1Y8MA 3UT4A 5JHBA 2MYOA 5KJNA 3VLEA 3Q78A 5AJDA 3JYSA 5AQBA 4AOFA 4HB5A 2HR2A 2VTBB 2J9QA 3FULA 3E33A 3ZYMA 4MS6A 4ANUA 2QYJA 4J8DA 5AYWD 4N5CA 3DSTA 3MEKA 2XPZA 3LPZA 4DPRA 5LCWC 4TV3A 2V4HC 3ZGQA 4GTTA 4JB8P 5A23A 2PQNA 3IHVA 2LSVA 2CFZA 3LYAA 4UWGA 1HG2A 5HKPA 2A4ZA 2P9KG 4A3VA 3QC1A 5T3RA 1A5EA 3I3NA 2A5EA 2KXPC 2X6KA 4HOTA 2AXUA 1U2VG 3LKUA 5EYLA 5CRUA 2DYRE 3DSXA 3CK7A 3PRZA 4YVOA 4FULA 1OWMA 4OVUA 3ZYKA 4DX7D 2IJGX 5C1DA 2WXKA 4R7LA 1N9AA 1E8XA 4FJYA 4YDWA 2PNNA 3APFA 2WXRA 2ILRA 4TRQA 4QQIA 3JUIA 2WXGA 4OAVB 3GZ2A 1TN7A 4EBAG 1Z3XA 3N71A 5BXUA 2AXZA 4HQDA 5ARFA 1S70B 2FF4A 4BERA 3MV3B 2FEZA 2WXIA 4GZDA 1IQUA 2F37A 4GAAA 4FJZA 4O6FA 1FT1A 4JHJA 3OAWA 3ULEG 2CFUA 4W9RA 4BTBA 4PH4B 2OEWA 2XPIA 3ZU7B 2ETCA 3RRNB 2L0TB 3FH7A 4N3BA 2LAIA 4DUIA 1OCCE 2H6FA 3UM2A 1WG0A 1ELWA 3RO2A 2DYSE 3IHYA 2DBAA 2VJ8A 4GTSA 1K8KG 3TG4A 3LDZA 4I6JA 4DI3A 5KCMA 4JA9A 3BG0B 4WWOA 4L1BA 1Z3YA 5ENQD 2C0MA 2FI7A 2I9CA 3FTVA 4I9EA 4E6HA 1H2UA 1TR4A 5BT1A 3FEXA 3U3WA 2YHCA 4HOSA 1SA4A 2J49A 1HG5A 3Q47B 4MLPA 2ZGGA 3UTMA 5EDSA 4ILHB 3UKUG 2R5SA 4CRWA 3SGHA 3TWVA 1HZ4A 3E37A 5CCLA 2B6CA 3Q49B 1KT0A 1MQSA 3PNLB 4I17A 4NIKA 1PY1A 2WVIA 4XKBA 2CHWA 4GA0A 4IN3B 4KBQA 3KSLA 2B0OE 2I6HA 3LY8A 1XGWA 2EQXA 4ACLA 5CRVA 3UINC 3L54A 4XI0A 2YQ8A 3UXGA 3FTSA 3D9KA 4CDNA 2XEEA 2V5FA 4ILIA 1QYMA 3G2UA 3E32A 2VSXE 1TEZA 3TL5A 1V55E 1HO8A 4N3CA 1DVPA 2L9BA 4J0UA 5EN5D 2LAHA 1E8WA 5CEDB 3ASHA 3KSQA 3PEUB 2GROB 4GB9A 4U8VD 1D9SA 3CLJA 2VGYA 5ENOD 3CVYA 3NOCD 2M63A 3CV0A 1OWOA 4G25A 4HNAD 4I2WA 3FU0A 5EX0A 1V54E 2KCLA 3SHFA 4UI9K 3JUEA 2KZTB 4B8AA 4BEPA 5KJKA 3ENEA 1BI7B 3DXKG 3R9AB 3V2OA 1O1SA 4HLLA 5BW8C 5AARA 4XZ4A 5DBKA 1HS6A 1MX4A 3Q4AB 3DBSA 2IO2C 4ZHBA 3FTUA 1OXJA 3CHRA 3J5QB 5KNHD 4QFVA 2XHEA 3FWVA 4GCNA 4WUYA 3D9OA 4YDEA 3JQ1A 4FADA 1MHQA 1OWLA 3SZ7A 4G23A 3DPYA 4MBGA 5D0OD 1N0RA 2H6IA 4J8SA 4F3VA 2AWIA 1ELRA 5D0QD 1N52A 3D3MA 3UM3A 1YMPA 2WXLA 3D9IA 4EBAA 3IBEA 2EIKE 3ASNE 1SVXA 1NFIE 4K0RA 5CERB 3U64A 3EUVA 3PZ1A 3FH5A 4AXHA 1Z6TA 2DWZA 3CHQA 4PS3A 2Q7FA 4J8FA 4U8HA 2IO3C 4GMRA 3JCKC 4GCOA 1IYGA 3QOUA 3P2BA 3MGBA 4GYWA 3JXJA 4N2SA 4N5QA 1Y6IA 3APDA 4J8YA 3IEGA 3LY7A 3U9WA 4M7CA 4DLOA 3Q9UC 3TWQA 3X2QE 4FHJA 1N4RA 3ZHEB 3DSUA 3HG0D 2CHXA 4V3IA 2IONA 3OXGA 3CVXA 2OV8A 2QC9A 2WXFA 4HRLA 3RU0A 1EYHA 2YHEA 1HFAA 1O1RA 4MRUA 4GTQA 1HE8A 4GPKA 5BV1A 1ZU2A 4BT9A 3PDNA 3ASFA 1SW6A 2ETAA 5FZQA 1H6KA 3Q7AA 4K03A 4UQZA 4KZ0A 2AJAA 3CIAA 3B7UX 3UX4A 1N4QA 1X5BA 3MZLB 5AJLA 2GRNB 2IQCA 1H2TC 3Q15A 4IRUA 4F53A 3CQCB 1JCRA 3QB2A 3TWRA 4CZ2D 3GZ1A 2XCBA 1H6OA 2WM9A 3BG1B 4I1AA 3CVVA 5ENRD 5FQ7A 3ZN3A 5JHAA 4BWRA 3ZUVB 5CEAA 3QAQA 4O1OA 3FUIA 4BFRA 1IXVA 4H7YA 1UW4B 3FUJA 2BEDA 3SFYA 5J08A 1TNBA 2GRRB 1KT1A 3Q75A 3FHEA 3ONKA 4FLHA 3EHQA 1AWCB 5A7DB 3MKQA 1PC2A 2WXNA 3I4GA 5ENNA 2X3MA 1E8YA 3ZEFA 3CSTA 4X8QA 4JHKA 5G04J 5T4YA 5EKQD 2VGEA 3PE3A 1PAQA 4N39A 4AVXA 4ABNA 3ZPJA 3NQPA 4U95D 5C2YA 3VLDA 3RSEG 2Y4UA 3Q7FA 3SY2A 2V4LA 1YYHA 5G05J 2A5UA 3SF4A 1BLXB 4NACA
chains in the Genus database with same CATH topology
1SZ9A 3VTYA 4N2QA 2FEZA 2KATA 2NXPA 3EIJA 3LY9A 4U07A 2WXIA 1A17A 4GZCA 4GZDA 1E96B 1IQUA 4GAAA 4FJZA 1NP7A 3GW4A 3I4RB 4XX5A 4O6FA 4G26A 3PEVB 3ZW3A 3PZDA 2KCKA 3FH8A 4JHJA 3EHMA 3OAWA 2CFUA 4LCTA 3FFLA 4W9RA 4BTBA 1H2VC 4A1SA 4PH4B 2VGXB 2WXPA 3FUHA 4P29A 4WNFA 4CEMA 2ONDA 3SBSA 2XPIA 4AV7A 3RRNB 2QY7A 2L0TB 3FH7A 3QWPA 4ILGA 2KM4A 3CHSA 4U0SA 4I6GA 3FTZA 3FU3A 4N3BA 2LAIA 2XEVA 3KAEA 5FQ6A 3FDHA 1ELWA 3MJWA 4WNEA 3DPDA 2E0IA 3L16A 3OXLA 3PUKA 1UJJA 3MKQB 4HFGA 3RO2A 4WNGA 3IHYA 2DBAA 1YA0A 2WQHA 3RKVA 2VJ8A 4EQFA 2X6FA 3G2SA 3LVQE 2IOLA 3Q5MA 3SBTB 3TG4A 4D10C 3S2AA 3LDZA 4I6JA 5BPPA 3UUXA 2WXQA 5KCMA 4DI3A 3LEWA 3D9JA 4B0ZA 2YINA 5JJ7A 2X6JA 4G24A 4JA9A 3BG0B 1JUQA 5ANLA 1NZNA 2OVFA 2OVBA 2J07A 3FUDA 3ML8A 4WWOA 4XI9A 4AEZC 4L1BA 4JL0A 4URKA 1Z3YA 4JEUA 1XNFA 3NZSA 3HYMB 4BT8A 3QKYA 2C0MA 2FI7A 3FUEA 2I9CA 2XQ0A 2VYIA 3FTVA 3RRUA 2V0PA 4I9EA 4NRHB 4WNDA 3KS2A 4E6HA 5AIJA 1H2UA 5BT1A 3PUJA 4G2VA 2AXVA 3FEXA 2HM8A 3ESKA 2LO6A 4FA6A 4PDXA 2GGFA 4WAFA 3MYVA 3U3WA 2YHCA 1OWPA 4I6EA 4HOSA 2I2OA 2FO7A 3ZHEA 3TXMA 3UQ3A 1EDUA 4UI9C 2VSOE 2J49A 1HG5A 3Q47B 1ZBPA 2PZIA 3E4BA 4MLPA 2DCPA 4BY6A 3ZXSA 2X6HA 5E75A 3NZUA 2VSYA 5CCMA 4ATGA 4BX8A 5EDSA 3CVQA 4ILHB 3S7DA 2R5SA 4CRWA 3SGHA 1HZ4A 4E85A 2VSNA 3O4ZA 3PS6A 4KXKB 5CCLA 3GZSA 4TUUA 4H7XA 3Q49B 1KT0A 1MQSA 2IF4A 2KZTA 3CHOA 4APOA 3PNLB 4I17A 4NACA 2GRLA 5FJYA 5A6CA 4RSYA 4CGWA 1EPUA 1PY1A 2WVIA 1H19A 1HH8A 4G1TA 2CHWA 4XKBA 3SD5A 4GA0A 4EECA 4IN3B 5AENA 4HORA 2CG3A 4UWKA 3PE4A 4KBQA 1FVFA 1OUVA 5FQ8A 2I6HA 5JJTA 4HOUA 3LY8A 4KMOA 1XGWA 2NSZA 2EQXA 4ACLA 2GRMA 2XRYA 3CKBA 3HIZA 3QARA 3JQ0A 2Y4TA 1QZ2A 4I1MA 2WB2A 4AM9A 4GZ3A 3FUMA 3L54A 4XI0A 3KD7A 2YQ8A 4JXTA 5JJ6A 3G2VA 5ARGA 3UPVA 1UG3A 4LRZA 3FTSA 4NQ0A 3D9KA 4UQXA 4CDNA 3MV2B 1S0PA 3FUNA 3C98A 3PVLA 4CCAA 5HQ8A 3QWVA 2V5FA 3UT8A 4UWLA 3R7QA 4ILIA 2R17C 3ZYQA 1JWFA 3G2UA 3CVNA 4KVMA 3R7RA 2KC7A 3FTXA 2WXOA 4EPZA 4EZJA 4A1GA 2NC9A 2VSXE 4ME2A 3L17A 4G11A 3IV0A 1IQRA 3CGHA 1TEZA 4Y6WA 5FWQA 2C0LA 4GYOA 3TL5A 4C0MA 2PM7A 4B94A 3LS8A 2XGSA 1SQMA 3RRMB 2WPVA 1HO8A 4N3CA 1DVPA 2L9BA 3CEQA 4J0UA 1TJFA 4B8CB 1JPLA 1E8WA 2LAHA 3ASHA 1HXIA 3PEUB 2AW6A 1GW6A 2KCVA 4GB9A 4WWNA 1NA3A 4PS7A 3RIBA 3CLJA 3CQGB 2OOEA 5BUZA 4HXIA 2J09A 3SNXA 4CDMA 3T5VA 2VGYA 2MRIA 4ANXA 3SI5A 3WXXA 4XE0A 3FU6A 3CVYA 2M63A 5CHEE 3CV0A 3CR3A 1OWOA 4G25A 4DI4A 5G2NA 2CG2A 2MOWA 3PH0C 3HVEA 4I2WA 1DNPA 3FU0A 4JPSA 5BV0A 4JHRA 5EX0A 2XCCA 4GA1A 3SFZA 4GZ5A 4U0UA 3CVWA 3S7JA 2KCLA 3SHFA 3TGOA 4UI9K 3AU4A 2KZTB 4B8AA 5KJKA 4Y6CA 5FTPA 3ULQA 4UI9J 3CK8A 1QNFA 3CKCA 5KJMA 5ANRA 1UN8A 3ENEA 4AP2A 3R9AB 3QDNA 3AU5A 5BW8C 2BUGA 1B89A 4LERA 2UY1A 2L6JA 4JA7A 1LF8A 3RO3A 4L23A 4XZ4A 5DBKA 4AY6A 3ZIMA 4L2LA 4AIFA 3OXFA 3U4TA 5M72A 1HS6A 3MX3A 4JC8A 3ZVVA 3I5PA 3Q4AB 1INZA 1IHGA 3NF1A 3DBSA 3L22A 4XIFA 3FTUA 4UWHA 1VDYA 2I1JA 4OVVA 1TJCA 3CHRA 2WQ6A 4QFVA 2XHEA 3K9IA 3AS5A 3HDXA 4U0ZA 3FWVA 4GCNA 4WUYA 4HS2A 3D9OA 4XKCA 3JQ1A 4FADA 1MHQA 1OWLA 3SZ7A 1H0AA 3ML9A 4UQYA 4ANWA 4G23A 3UT7A 2XPYA 5D0OD 2WMOA 4FP7A 4J8SA 4F3VA 5G55A 3B13A 3EIQC 3TJPA 3FY4A 4HLEA 2WXJA 4I2ZA 4FU3A 2AWIA 1N54A 3U66A 1ELRA 2XRZA 4IYPA 5D0QD 1U3DA 1N52A 3EHNA 4APFA 4RG9A 5E76A 3O48A 3D3MA 1FCHA 3LXUX 3OTNA 3B7SA 4JZYA 2WXLA 5FZRA 5KJLA 3S7FA 4FC8A 3ASGA 1BPOA 3FUFA 3D9IA 2L0IA 4EBAA 5LFAA 3QJZA 4ACKA 1WAO1 3EJNA 3IBEA 4M3OA 4FLBA 4HVBA 3HVEB 4I9CA 4K0RA 3UMVA 4ANVA 1KLXA 3U64A 4Q96A 4I43A 5FT9A 2VTBA 3FH5A 2XGOA 4KVOA 5EX3A 2VQ2A 4AXHA 1Z6TA 3B7TA 3CHQA 4C0EA 4LEUA 4DLQA 4JVSA 3CSFA 4OYSA 3D9LA 4JW1A 2Q7FA 4PS3A 4A3TA 5LP0A 2GW1A 3T5XA 2QFCA 4J8FA 4U8HA 4CT0A 2FULA 3JCKC 4PUCA 3FUKA 5CMWA 1QQEA 2IOSA 2MHKA 2RG8A 2Y3AA 3QK0A 4GCOA 4LUNU 3QOUA 1IYGA 2UY1B 3P2BA 3QWWA 3MGBA 4GYWA 1OWNA 4BX9A 4N2SA 4WWPA 1Y6IA 3APDA 3LVRE 3ONLA 5G04C 2BF0X 3TAXA 2PQRA 5BNWA 4GZ6A 3MA5A 3IEGA 4F7AA 3LY7A 2FBNA 3D9MA 4L2YA 2WQ7A 4U63A 3U9WA 4KT6B 4DLOA 3PNTB 4KZCA 5HI7A 3FTYA 4FHJA 3B7RL 4JEHA 3ZHEB 3G2TA 2J08A 3L13A 2CHXA 4V3IA 1E8ZA 2IONA 3ESLA 3CVUA 3D9NA 3OXGA 4FHKA 2OV8A 3CVXA 1NA0A 2WXFA 4UWFA 3TG5A 1WM5A 3RU0A 1E7UA 4GMLA 1EYHA 2YHEA 1HFAA 4GA2A 4Q94A 2WXMA 5G05C 1L5JA 2ZU6B 4YNDA 2X38A 4MRUA 4AJWA 4BSXA 1HE8A 1HX8A 2HO1A 2PM6A 4RVBA 4GPKA 3HHMA 3LCAA 5BV1A 4U04A 2X6IA 1ZU2A 2IFUA 3PDNA 3PREA 4BT9A 4NURA 3ZRHA 3ASFA 1Y8MA 1WY6A 5FZQA 3UT4A 1H6KA 4C9BB 5JHBA 3FP3A 4HOQA 4K03A 1P5QA 3D9PA 3MKRA 3L6AA 4KZ0A 4UQZA 5FZSA 5KJNA 3CIAA 5LCWJ 3B7UX 3UX4A 1E7VA 1X5BA 3VLEA 3MZLB 5AJLA 4DJAA 3KEZA 2IQCA 4CGVA 1H2TC 4BTAA 3Q15A 5AJDA 4N3AA 3JYSA 3BEEA 2WMNA 3T8MA 3VLFA 4IRUA 4AOFA 4F53A 2HR2A 2VTBB 3CQCB 2J9QA 3QB2A 2JEKA 2AVPA 3FULA 2JLBA 3ZYMA 2PL2A 2J4BA 4MS6A 1ELKA 4ANUA 4J8DA 5AYWD 1U3CA 4N5CA 4EZKA 1W3BA 3GZ1A 2XCBA 2WM9A 3BG1B 3CVVA 4I1AA 3MEKA 4RG6A 2XPZA 4J8EA 3VTXA 3LPZA 5FQ7A 3ZN3A 5JHAA 4BWRA 2VGXA 2E2EA 3CK9A 3QAQA 1EF1C 3FTWA 4DPRA 3CVLA 3FUIA 4TV3A 3RK6A 4BFRA 4H7YA 3ZGQA 5LCWC 2WXHA 3ZYLA 1UW4B 3FUJA 3GYZA 4B89A 5A23A 3EDTB 3AS4A 2PQNA 3IHVA 3QNKA 4IULA 4CDRA 1UJKA 5J08A 1E90A 1SZAA 2LSVA 2CFZA 3LYAA 1KT1A 3FHEA 2XGMA 3ONKA 4UWGA 1JWGA 4FLHA 3APCA 1FVHA 4J6IA 3TXNA 5J90A 5A7DB 1HG2A 3MKQA 1PC2A 2A4ZA 4A3VA 3QC1A 2WXNA 5T3RA 2LNIA 2R59A 2IU1A 3I4GA 2X3MA 1E8YA 2I1KA 5ENNA 2RD0A 3ZEFA 3CSTA 3I3NA 3RJVA 2X6KA 4HOTA 4JHKA 5G04J 2AXUA 3FU5A 1UN9A 5T4YA 4PS8A 2DIWA 5EKQD 2V8SE 3FEYA 3PE3A 3LKUA 2CHZA 2P58C 4DK5A 3AS8A 1PAQA 4N39A 3S7BA 4I1OB 5T8IA 4AVXA 3CK7A 3PRZA 4ABNA 4YVOA 3ZPJA 4FULA 4AY5A 1OWMA 4OVUA 3IKOB 3ZYKA 2C2LA 2J4DA 2LSUA 3CVPA 3NQPA 5C2YA 3VLDA 2IJGX 4CT4A 2UWJG 4EZLA 4GMJA 5C1DA 2WXKA 2HYZA 4R7LA 1E8XA 3G2WA 4FJYA 3APFA 2WXRA 2ILRA 2Y4UA 4TRQA 4GYYA 3JUIA 5CMYA 4YVQC 2V4LA 2WXGA 3LJ3A 4KYOB 3CHMA 3GZ2A 2BTDA 5FQ4A 4GU5A 5LOZA 4A55A 4EBAG 3URZA 1Z3XA 2YNQA 5G05J 3ASDA 1HU3A 3N71A 2AXZA 3ZFWA 1HF8A 2A5UA 3L08A 4L7TA 3SF4A 3MCXA 4Q69A 5ARFA 5LX8A 4F1SA 5DIZA 2FF4A 4MKTA 3P1UA 3CHPA 3MV3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTY A;  4N2Q A;  2FEZ A;  2KAT A;  3LY9 A;  4U07 A;  1A17 A;  1E96 B;  3GW4 A;  4O6F A;  4G26 A;  2KCK A;  3FFL A;  4W9R A;  4BTB A;  4A1S A;  2VGX B;  4WNF A;  2OND A;  2XPI A;  3QWP A;  4U0S A;  4N3B A;  2XEV A;  3KAE A;  1ELW A;  4WNE A;  3OXL A;  3RO2 A;  4WNG A;  2DBA A;  1YA0 A;  2WQH A;  3RKV A;  4EQF A;  3Q5M A;  3TG4 A;  3UUX A;  5JJ7 A;  4G24 A;  4JA9 A;  1NZN A;  4XI9 A;  4JL0 A;  1XNF A;  3HYM B;  4BT8 A;  3QKY A;  2C0M A;  2FI7 A;  2VYI A;  4I9E A;  4NRH B;  4WND A;  3KS2 A;  5BT1 A;  4G2V A;  3ESK A;  3U3W A;  2YHC A;  4HOS A;  2FO7 A;  3ZHE A;  3UQ3 A;  4UI9 C;  3Q47 B;  1ZBP A;  2PZI A;  3E4B A;  2VSY A;  5CCM A;  3CVQ A;  3S7D A;  2R5S A;  1HZ4 A;  2VSN A;  4KXK B;  5CCL A;  4H7X A;  3Q49 B;  1KT0 A;  2IF4 A;  4APO A;  4I17 A;  5FJY A;  5A6C A;  4CGW A;  4G1T A;  1HH8 A;  4GA0 A;  4IN3 B;  4HOR A;  3PE4 A;  4KBQ A;  1OUV A;  2I6H A;  5JJT A;  4HOU A;  3LY8 A;  3CKB A;  2Y4T A;  1QZ2 A;  4AM9 A;  4GZ3 A;  4XI0 A;  3KD7 A;  2YQ8 A;  5JJ6 A;  5ARG A;  3UPV A;  4NQ0 A;  4UQX A;  3MV2 B;  5HQ8 A;  3QWV A;  2V5F A;  3CVN A;  2KC7 A;  2NC9 A;  4ME2 A;  4Y6W A;  2C0L A;  4GYO A;  4B94 A;  2XGS A;  2WPV A;  4N3C A;  3CEQ A;  4J0U A;  3ASH A;  1HXI A;  2KCV A;  1NA3 A;  3RIB A;  2OOE A;  2VGY A;  3WXX A;  5CHE E;  3CV0 A;  4G25 A;  4I2W A;  4JHR A;  5EX0 A;  2XCC A;  4GA1 A;  4GZ5 A;  4U0U A;  3S7J A;  2KCL A;  3TGO A;  4UI9 K;  5KJK A;  4Y6C A;  5FTP A;  3ULQ A;  4UI9 J;  3CK8 A;  3CKC A;  5KJM A;  3R9A B;  3QDN A;  5BW8 C;  2BUG A;  1B89 A;  2UY1 A;  2L6J A;  4JA7 A;  3RO3 A;  5DBK A;  4AY6 A;  4AIF A;  3OXF A;  3U4T A;  5M72 A;  3Q4A B;  1IHG A;  3NF1 A;  4XIF A;  1TJC A;  3K9I A;  3AS5 A;  4U0Z A;  3FWV A;  4GCN A;  4WUY A;  3SZ7 A;  4UQY A;  4G23 A;  5D0O D;  4F3V A;  4I2Z A;  1ELR A;  5D0Q D;  4RG9 A;  3O48 A;  1FCH A;  5FZR A;  5KJL A;  3S7F A;  3ASG A;  1WAO 1;  4I9C A;  1KLX A;  5FT9 A;  5EX3 A;  2XGO A;  2VQ2 A;  4LEU A;  2Q7F A;  2GW1 A;  2QFC A;  4J8F A;  1QQE A;  2MHK A;  4GCO A;  1IYG A;  3QOU A;  2UY1 B;  3QWW A;  4GYW A;  4N2S A;  5G04 C;  3TAX A;  2PQR A;  5BNW A;  4GZ6 A;  3MA5 A;  3IEG A;  3LY7 A;  2FBN A;  5HI7 A;  3ZHE B;  3OXG A;  1NA0 A;  3TG5 A;  1WM5 A;  3RU0 A;  4GA2 A;  5G05 C;  4YND A;  2HO1 A;  4GPK A;  3LCA A;  4U04 A;  1ZU2 A;  2IFU A;  3PDN A;  4BT9 A;  3ASF A;  1Y8M A;  5FZQ A;  3FP3 A;  4HOQ A;  1P5Q A;  3MKR A;  4UQZ A;  5FZS A;  5KJN A;  5LCW J;  4CGV A;  4BTA A;  3Q15 A;  4N3A A;  3JYS A;  3BEE A;  2HR2 A;  2J9Q A;  2AVP A;  2JLB A;  2PL2 A;  4J8D A;  5AYW D;  4N5C A;  1W3B A;  3GZ1 A;  2XCB A;  4I1A A;  3MEK A;  4RG6 A;  4J8E A;  3VTX A;  3LPZ A;  3ZN3 A;  4BWR A;  2VGX A;  2E2E A;  3CK9 A;  5LCW C;  3CVL A;  4H7Y A;  3ZGQ A;  3GYZ A;  3EDT B;  3AS4 A;  2PQN A;  4CDR A;  2LSV A;  3LYA A;  1KT1 A;  2XGM A;  5A7D B;  1PC2 A;  2LNI A;  3RJV A;  4HOT A;  5G04 J;  5EKQ D;  3PE3 A;  3LKU A;  2P58 C;  3AS8 A;  4N39 A;  3S7B A;  3CK7 A;  4ABN A;  4YVO A;  3ZPJ A;  4AY5 A;  2C2L A;  3CVP A;  2LSU A;  2UWJ G;  5C1D A;  2HYZ A;  2Y4U A;  4GYY A;  4YVQ C;  4KYO B;  3GZ2 A;  3URZ A;  5G05 J;  3ASD A;  3N71 A;  3ZFW A;  3SF4 A;  5ARF A;  5DIZ A;  2FF4 A;  3MV3 B; 
#chains in the Genus database with same CATH topology
 3VTY A;  3EIJ A;  3LY9 A;  1A17 A;  3NB2 A;  1NP7 A;  3PZD A;  2KCK A;  3EHM A;  2NYJ A;  3DEO A;  1H2V C;  3FUH A;  4P29 A;  4CEM A;  1DC2 A;  5AQ9 A;  3SBS A;  4AV7 A;  4ILG A;  4O1P A;  4I6G A;  2P9S G;  1UJJ A;  4UUC A;  2WQH A;  3RKV A;  3G2S A;  3LVQ E;  3Q5M A;  3UUX A;  3D9J A;  2YIN A;  2X6J A;  4G24 A;  5ANL A;  1NZN A;  4XI9 A;  4URK A;  4JEU A;  3HYM B;  2VYI A;  3RRU A;  3DWL G;  4C48 B;  5AIJ A;  4G2V A;  2AXV A;  2LO6 A;  4FA6 A;  3UQ3 A;  1EDU A;  3E4B A;  2DCP A;  4BY6 A;  4DX5 D;  1TNU A;  4BX8 A;  2P9I G;  3UIO C;  1Q2Z A;  3S7D A;  4DRX E;  2VSN A;  3O4Z A;  4TUU A;  4H7X A;  5FIN A;  2IF4 A;  3CHO A;  4APO A;  3V79 K;  1S63 A;  2GRL A;  5FJY A;  5A6C A;  4RSY A;  4YDY A;  1EPU A;  4G1T A;  4U8Y D;  4EEC A;  5BXO A;  4UWK A;  2P9U G;  5FQ8 A;  3PZ3 A;  5JJT A;  3CKB A;  3JQ0 A;  2IEJ A;  4I1M A;  5KWD A;  4GZ3 A;  3AG2 E;  3KD7 A;  4JXT A;  4NQ0 A;  3R7Q A;  2R17 C;  1JWF A;  4HRN A;  4KVM A;  1K1B A;  3DSV A;  2KC7 A;  1Z5S C;  4F6R D;  1D8D A;  5FWQ A;  4C0M A;  2PM7 A;  2XGS A;  1SQM A;  3CEQ A;  4B8C B;  1JPL A;  4WWN A;  4PS7 A;  2OOE A;  4HXI A;  2J09 A;  2ZXW E;  3SI5 A;  3WXX A;  2XZT G;  5CHE E;  3CR3 A;  4JPS A;  3HVE A;  3SFZ A;  4U0U A;  3CVW A;  3J5P A;  1X81 A;  3AU4 A;  1MX6 A;  3CKC A;  1ZB1 A;  1IHB A;  2OEV A;  1B89 A;  3F6Q A;  4LER A;  1D8E A;  1LF8 A;  4L23 A;  4L2L A;  5B1B E;  3MX3 A;  3C3R A;  3ZVV A;  1IHG A;  1NI1 A;  4XIF A;  1VDY A;  2I1J A;  1OCR E;  1TJC A;  2HE0 A;  2WQ6 A;  3K9I A;  1LTX A;  1H0A A;  2P9L G;  3HRA A;  3UT7 A;  2RFM A;  2KBX A;  3DSS A;  3B13 A;  3FY4 A;  1DCQ A;  2WXJ A;  3T8K A;  3L82 A;  4IYP A;  4APF A;  4RG9 A;  3AAA C;  3O48 A;  3LJN A;  4JZY A;  3AG4 E;  3AG1 E;  3RAU A;  1KZP A;  5LFA A;  3QJZ A;  5AQ7 A;  4HBD A;  4I9C A;  3UMV A;  4ANV A;  4I43 A;  2VQ2 A;  4BSZ B;  3B7T A;  4C0E A;  3CSF A;  3D9L A;  5HRY A;  3T5X A;  2QFC A;  4ATZ D;  2R03 A;  4PUC A;  3NAW A;  2ZIS A;  4LUN U;  3ULY A;  4WWP A;  3LVR E;  5G04 C;  2FBN A;  3D9M A;  4GTM A;  3PNT B;  3E30 A;  2DVW A;  5HI7 A;  3FTY A;  3G2T A;  2J08 A;  3L13 A;  4FHK A;  1NA0 A;  1WM5 A;  3ZNG A;  4GML A;  5EYP F;  1OCZ E;  3PZ4 A;  5G05 C;  4YND A;  1HX8 A;  3LCA A;  3ZRH A;  1WY6 A;  4GTV A;  1BD8 A;  3D9P A;  5FZS A;  2P9P G;  3TWS A;  5LCW J;  1E7V A;  1OT8 A;  2LXM A;  2XEN A;  4TXP A;  2WMN A;  3DEP A;  3VLF A;  3EU9 A;  5KBA A;  4G8K A;  2JLB A;  2GRP B;  1ELK A;  5B1A E;  1U3C A;  1W3B A;  3T9K A;  2R02 A;  4RG6 A;  3HXE A;  2VGX A;  2E2E A;  3IXE A;  3CK9 A;  3C5R A;  3CVL A;  3RK6 A;  1K3Z D;  2WXH A;  3ZYL A;  4B89 A;  3GYZ A;  4U96 D;  1MZC A;  3AS4 A;  3L9T A;  3QNK A;  4CDR A;  1UJK A;  1E90 A;  2F8Y A;  4J6I A;  5J90 A;  2R59 A;  2IU1 A;  3W9F A;  2I1K A;  2RD0 A;  5EIB E;  3FU5 A;  4PS8 A;  2DIW A;  2CHZ A;  4A63 B;  3S7B A;  2ZIR A;  2QYU A;  4CYM D;  2C2L A;  2J4D A;  2LSU A;  4EZL A;  4CT4 A;  4GMJ A;  2ZGD A;  4GYY A;  5CMY A;  3LJ3 A;  1FT2 A;  3KEA A;  4KYO B;  5LOZ A;  4K5C A;  1HU3 A;  1HF8 A;  3L08 A;  4Q69 A;  3P1U A;  3CHP A;  3SNX A;  2V5Q C;  4GZC A;  1E96 B;  3GW4 A;  4G26 A;  3PEV B;  3FH8 A;  3Q79 A;  2WXP A;  1BU9 A;  4WNF A;  2LUH A;  2OND A;  2QY7 A;  3QWP A;  3FTZ A;  1TNY A;  5FQ6 A;  3KAE A;  3L16 A;  3OXL A;  3PUK A;  3MKQ B;  4YDO A;  1YA0 A;  4EQF A;  4D10 C;  2IOL A;  3ISM C;  1RW2 A;  5BPP A;  1N0Q A;  2WXQ A;  3LEW A;  5JJ7 A;  1JUQ A;  3NZS A;  4BT8 A;  4K5A B;  3FUE A;  2XQ0 A;  1TN6 A;  4NRH B;  4WND A;  1LD7 A;  3ESK A;  2XZD G;  4PDX A;  4HI8 A;  5JA4 D;  2FO7 A;  3ZHE A;  3TXM A;  5D2M C;  1UOH A;  5AQA A;  1ZBP A;  3B95 A;  2X6H A;  5E75 A;  2VSY A;  4ATG A;  3ZKJ A;  1G3N B;  2H6H A;  4E85 A;  4KXK B;  3ABL E;  3ABM E;  2F0Y A;  4CGW A;  1OCO E;  1H19 A;  1HH8 A;  4HOR A;  2CG3 A;  3PE4 A;  4B93 B;  1OUV A;  4KMO A;  1N95 A;  3WG7 E;  2GRM A;  3HIZ A;  1QZ2 A;  4AM9 A;  3FUM A;  3G2V A;  3UPV A;  3NBN B;  1UG3 A;  4LRZ A;  4UQX A;  3MV2 B;  3PVL A;  4UWL A;  3ZYQ A;  3CVN A;  3R7R A;  4EPZ A;  4A1G A;  2NC9 A;  4ME2 A;  2H6G A;  3L17 A;  3CGH A;  5D66 A;  4B94 A;  1QBQ A;  2WPV A;  4DX2 A;  1TJF A;  1HXI A;  1GW6 A;  2KCV A;  2R2L A;  3CQG B;  5BUZ A;  3ASO E;  3T5V A;  2MRI A;  4XE0 A;  1MX2 A;  4OAU C;  3UKR G;  2CG2 A;  3PH0 C;  1N11 A;  1DNP A;  1S64 A;  4JHR A;  4GA1 A;  4LNG A;  4GZ5 A;  3S7J A;  3TGO A;  4Y6C A;  5FTP A;  4UI9 J;  3CK8 A;  1QNF A;  2EIJ E;  5KJM A;  3JXI A;  3DRA A;  4AP2 A;  3D9H A;  2UY1 A;  4RQI A;  4DX6 D;  1FPP A;  3OXF A;  3U4T A;  2BKG A;  1AP7 A;  4JC8 A;  3I5P A;  1INZ A;  3NF1 A;  3AJI A;  3L22 A;  3BQO A;  3B7B A;  2GRQ B;  4HS2 A;  4UQY A;  4ANW A;  4GTP A;  4FP7 A;  3EIQ C;  4HLE A;  1TNO A;  4I2Z A;  1RZ4 A;  2XRZ A;  1U3D A;  3EHN A;  2P9N G;  3LXU X;  3OTN A;  3B7S A;  1BPO A;  2DZO A;  5CEC B;  3EJN A;  4HVB A;  3DSW A;  3HVE B;  1H6P A;  3UIP C;  1O5M A;  1KLX A;  4Q96 A;  5FT9 A;  2VTB A;  3R9M A;  4KVO A;  4LEU A;  4DLQ A;  4OYS A;  4JW1 A;  5LP0 A;  3TWU A;  2GW1 A;  4CT0 A;  2FUL A;  2MHK A;  2Y3A A;  3QWW A;  2Y69 E;  4BX9 A;  1TYQ G;  2RFA A;  4HI9 A;  2PQR A;  5BNW A;  3MA5 A;  4F7A A;  4U63 A;  3B7R L;  1MJ0 A;  4JEH A;  1JCQ A;  1E8Z A;  3ESL A;  3D9N A;  4UWF A;  5B3S E;  3AG3 E;  1E7U A;  2XS1 A;  4LSZ E;  4Q94 A;  2WXM A;  2P2C P;  1TN8 A;  4U04 A;  2X6I A;  2IFU A;  4U7E B;  2QZA A;  4NUR A;  4BES A;  1KPS B;  4C9B B;  3FP3 A;  4HOQ A;  1P5Q A;  3MKR A;  3L6A A;  5ENS D;  4DJA A;  3KEZ A;  4CGV A;  4BTA A;  4N3A A;  3BEE A;  3T8M A;  2BKK B;  1N4P A;  2JEK A;  2AVP A;  2PL2 A;  2J4B A;  4EZK A;  2L6B A;  2EIL E;  4J8E A;  3VTX A;  5ENT D;  5IY5 E;  1EF1 C;  3UM1 A;  3FTW A;  2F8X K;  2FO1 E;  3Q9N C;  3EDT B;  1O1T A;  3BUA A;  4LG6 A;  4IUL A;  1SZA A;  2XGM A;  1JWG A;  3APC A;  1FVH A;  3TXN A;  3EU5 A;  5AN8 A;  2LNI A;  3RJV A;  5H7P A;  1DCE A;  5AAO A;  1UN9 A;  1K1A A;  2V8S E;  3FEY A;  2P58 C;  4DK5 A;  2ETB A;  3AS8 A;  2R05 A;  4I1O B;  5T8I A;  4AY5 A;  3IKO B;  3CVP A;  2UWJ G;  3UM0 A;  2HYZ A;  3G2W A;  4YVQ C;  3E34 A;  3CHM A;  5FQ4 A;  2BTD A;  3HXF A;  4GU5 A;  4A55 A;  3URZ A;  4XEI G;  2YNQ A;  3ASD A;  3ZFW A;  4L7T A;  3MCX A;  5LX8 A;  4F1S A;  5DIZ A;  4MKT A;  3DXM G;  1SZ9 A;  4N2Q A;  2KAT A;  2NXP A;  4U07 A;  3I4R B;  4XX5 A;  4TXQ A;  3ZW3 A;  5ENP D;  4LCT A;  3FFL A;  4A1S A;  2VGX B;  1LD8 A;  3EHR A;  1JCS A;  2Y1L E;  2KM4 A;  3CHS A;  4RLY A;  4U0S A;  4GTR A;  3FU3 A;  2XEV A;  1N4S A;  3FDH A;  3MJW A;  4WNE A;  3DPD A;  3ABK E;  2E0I A;  4HFG A;  4WNG A;  3BU8 A;  2X6F A;  3SBT B;  3SO8 A;  3S2A A;  2XS8 A;  5EIL A;  3C72 A;  4EHM A;  4B0Z A;  2OVF A;  2OVB A;  2J07 A;  3FUD A;  3ML8 A;  4AEZ C;  4JL0 A;  1XNF A;  3QKY A;  4JD2 G;  2V0P A;  3KS2 A;  3NOG D;  4BET A;  3PUJ A;  3HXB A;  2HM8 A;  4TXR A;  4TUM A;  2GGF A;  4WAF A;  3MYV A;  1OWP A;  4I6E A;  2I2O A;  4UI9 C;  2VSO E;  5EID A;  2LXL A;  2PZI A;  3ZXS A;  3NZU A;  5CCM A;  3CVQ A;  3PS6 A;  3GZS A;  3V31 A;  2KZT A;  5ITZ F;  3W9G A;  3SD5 A;  5AEN A;  4LNU D;  3TWX A;  1FVF A;  4G8L A;  4HOU A;  2NSZ A;  2XRY A;  3QAR A;  2Y4T A;  1BI8 B;  2WB2 A;  5JJ6 A;  5ARG A;  1S0P A;  2XEH A;  3C98 A;  3FUN A;  4CCA A;  5HQ8 A;  3QWV A;  4GTO A;  3UT8 A;  1MYO A;  3FTX A;  2WXO A;  4EZJ A;  4G11 A;  3IV0 A;  1IQR A;  4Y6W A;  5CBN A;  2C0L A;  4GYO A;  1WDY A;  3LS8 A;  2DZN A;  3ZXP A;  3RRM B;  4F1P A;  2AW6 A;  1NA3 A;  3RIB A;  4CDM A;  4ANX A;  3FU6 A;  4DI4 A;  5G2N A;  2MOW A;  5BV0 A;  2XCC A;  2EIN E;  3ULQ A;  4L9P A;  4O60 A;  5ANR A;  1UN8 A;  3QDN A;  5HS0 A;  3AU5 A;  3HXC A;  5FIO A;  5KNG A;  2BUG A;  2L6J A;  4JA7 A;  2OCC E;  3RO3 A;  3TWT A;  4AY6 A;  1OY3 D;  4HRM B;  3ZIM A;  4AIF A;  5M72 A;  4UWH A;  4OVV A;  3UI2 A;  2Y0B G;  3C3O A;  1N94 A;  3AS5 A;  3HDX A;  4U0Z A;  4XKC A;  2EIM E;  3ML9 A;  3SFX A;  2XPY A;  2WMO A;  5G55 A;  3PZ2 A;  3TJP A;  4FU3 A;  1N54 A;  3U66 A;  1TNZ A;  5E76 A;  2IY0 C;  1FCH A;  1NL4 A;  5FZR A;  5KJL A;  3S7F A;  4FC8 A;  3ASG A;  3FUF A;  3Q73 A;  2L0I A;  4DX1 A;  3V30 A;  4ACK A;  1WAO 1;  4M3O A;  4FLB A;  4Z68 A;  3TWW A;  2J8S D;  4J7W A;  5EX3 A;  2XGO A;  5CBO A;  4LNB A;  4JVS A;  4A3T A;  3V2X A;  3FUK A;  5CMW A;  1QQE A;  2IOS A;  2RG8 A;  3QK0 A;  2UY1 B;  1YCS B;  1OWN A;  1SA5 A;  3ONL A;  2BF0 X;  3TAX A;  4GZ6 A;  2WQ7 A;  4L2Y A;  3HXD A;  4KT6 B;  4KZC A;  2JAB A;  3SQV A;  3CVU A;  4K5B A;  3TG5 A;  5JMN D;  4GA2 A;  4ZFH A;  1L5J A;  2ZU6 B;  4AJW A;  2X38 A;  4BSX A;  2PM6 A;  2HO1 A;  1IKN D;  4GPM A;  4RVB A;  2RKK A;  3HHM A;  3C3Q A;  3PRE A;  1KZO A;  1Y8M A;  3UT4 A;  5JHB A;  2MYO A;  5KJN A;  3VLE A;  3Q78 A;  5AJD A;  3JYS A;  5AQB A;  4AOF A;  4HB5 A;  2HR2 A;  2VTB B;  2J9Q A;  3FUL A;  3E33 A;  3ZYM A;  4MS6 A;  4ANU A;  2QYJ A;  4J8D A;  5AYW D;  4N5C A;  3DST A;  3MEK A;  2XPZ A;  3LPZ A;  4DPR A;  5LCW C;  4TV3 A;  2V4H C;  3ZGQ A;  4GTT A;  4JB8 P;  5A23 A;  2PQN A;  3IHV A;  2LSV A;  2CFZ A;  3LYA A;  4UWG A;  1HG2 A;  5HKP A;  2A4Z A;  2P9K G;  4A3V A;  3QC1 A;  5T3R A;  1A5E A;  3I3N A;  2A5E A;  2KXP C;  2X6K A;  4HOT A;  2AXU A;  1U2V G;  3LKU A;  5EYL A;  5CRU A;  2DYR E;  3DSX A;  3CK7 A;  3PRZ A;  4YVO A;  4FUL A;  1OWM A;  4OVU A;  3ZYK A;  4DX7 D;  2IJG X;  5C1D A;  2WXK A;  4R7L A;  1N9A A;  1E8X A;  4FJY A;  4YDW A;  2PNN A;  3APF A;  2WXR A;  2ILR A;  4TRQ A;  4QQI A;  3JUI A;  2WXG A;  4OAV B;  3GZ2 A;  1TN7 A;  4EBA G;  1Z3X A;  3N71 A;  5BXU A;  2AXZ A;  4HQD A;  5ARF A;  1S70 B;  2FF4 A;  4BER A;  3MV3 B;  2FEZ A;  2WXI A;  4GZD A;  1IQU A;  2F37 A;  4GAA A;  4FJZ A;  4O6F A;  1FT1 A;  4JHJ A;  3OAW A;  3ULE G;  2CFU A;  4W9R A;  4BTB A;  4PH4 B;  2OEW A;  2XPI A;  3ZU7 B;  2ETC A;  3RRN B;  2L0T B;  3FH7 A;  4N3B A;  2LAI A;  4DUI A;  1OCC E;  2H6F A;  3UM2 A;  1WG0 A;  1ELW A;  3RO2 A;  2DYS E;  3IHY A;  2DBA A;  2VJ8 A;  4GTS A;  1K8K G;  3TG4 A;  3LDZ A;  4I6J A;  4DI3 A;  5KCM A;  4JA9 A;  3BG0 B;  4WWO A;  4L1B A;  1Z3Y A;  5ENQ D;  2C0M A;  2FI7 A;  2I9C A;  3FTV A;  4I9E A;  4E6H A;  1H2U A;  1TR4 A;  5BT1 A;  3FEX A;  3U3W A;  2YHC A;  4HOS A;  1SA4 A;  2J49 A;  1HG5 A;  3Q47 B;  4MLP A;  2ZGG A;  3UTM A;  5EDS A;  4ILH B;  3UKU G;  2R5S A;  4CRW A;  3SGH A;  3TWV A;  1HZ4 A;  3E37 A;  5CCL A;  2B6C A;  3Q49 B;  1KT0 A;  1MQS A;  3PNL B;  4I17 A;  4NIK A;  1PY1 A;  2WVI A;  4XKB A;  2CHW A;  4GA0 A;  4IN3 B;  4KBQ A;  3KSL A;  2B0O E;  2I6H A;  3LY8 A;  1XGW A;  2EQX A;  4ACL A;  5CRV A;  3UIN C;  3L54 A;  4XI0 A;  2YQ8 A;  3UXG A;  3FTS A;  3D9K A;  4CDN A;  2XEE A;  2V5F A;  4ILI A;  1QYM A;  3G2U A;  3E32 A;  2VSX E;  1TEZ A;  3TL5 A;  1V55 E;  1HO8 A;  4N3C A;  1DVP A;  2L9B A;  4J0U A;  5EN5 D;  2LAH A;  1E8W A;  5CED B;  3ASH A;  3KSQ A;  3PEU B;  2GRO B;  4GB9 A;  4U8V D;  1D9S A;  3CLJ A;  2VGY A;  5ENO D;  3CVY A;  3NOC D;  2M63 A;  3CV0 A;  1OWO A;  4G25 A;  4HNA D;  4I2W A;  3FU0 A;  5EX0 A;  1V54 E;  2KCL A;  3SHF A;  4UI9 K;  3JUE A;  2KZT B;  4B8A A;  4BEP A;  5KJK A;  3ENE A;  1BI7 B;  3DXK G;  3R9A B;  3V2O A;  1O1S A;  4HLL A;  5BW8 C;  5AAR A;  4XZ4 A;  5DBK A;  1HS6 A;  1MX4 A;  3Q4A B;  3DBS A;  2IO2 C;  4ZHB A;  3FTU A;  1OXJ A;  3CHR A;  3J5Q B;  5KNH D;  4QFV A;  2XHE A;  3FWV A;  4GCN A;  4WUY A;  3D9O A;  4YDE A;  3JQ1 A;  4FAD A;  1MHQ A;  1OWL A;  3SZ7 A;  4G23 A;  3DPY A;  4MBG A;  5D0O D;  1N0R A;  2H6I A;  4J8S A;  4F3V A;  2AWI A;  1ELR A;  5D0Q D;  1N52 A;  3D3M A;  3UM3 A;  1YMP A;  2WXL A;  3D9I A;  4EBA A;  3IBE A;  2EIK E;  3ASN E;  1SVX A;  1NFI E;  4K0R A;  5CER B;  3U64 A;  3EUV A;  3PZ1 A;  3FH5 A;  4AXH A;  1Z6T A;  2DWZ A;  3CHQ A;  4PS3 A;  2Q7F A;  4J8F A;  4U8H A;  2IO3 C;  4GMR A;  3JCK C;  4GCO A;  1IYG A;  3QOU A;  3P2B A;  3MGB A;  4GYW A;  3JXJ A;  4N2S A;  4N5Q A;  1Y6I A;  3APD A;  4J8Y A;  3IEG A;  3LY7 A;  3U9W A;  4M7C A;  4DLO A;  3Q9U C;  3TWQ A;  3X2Q E;  4FHJ A;  1N4R A;  3ZHE B;  3DSU A;  3HG0 D;  2CHX A;  4V3I A;  2ION A;  3OXG A;  3CVX A;  2OV8 A;  2QC9 A;  2WXF A;  4HRL A;  3RU0 A;  1EYH A;  2YHE A;  1HFA A;  1O1R A;  4MRU A;  4GTQ A;  1HE8 A;  4GPK A;  5BV1 A;  1ZU2 A;  4BT9 A;  3PDN A;  3ASF A;  1SW6 A;  2ETA A;  5FZQ A;  1H6K A;  3Q7A A;  4K03 A;  4UQZ A;  4KZ0 A;  2AJA A;  3CIA A;  3B7U X;  3UX4 A;  1N4Q A;  1X5B A;  3MZL B;  5AJL A;  2GRN B;  2IQC A;  1H2T C;  3Q15 A;  4IRU A;  4F53 A;  3CQC B;  1JCR A;  3QB2 A;  3TWR A;  4CZ2 D;  3GZ1 A;  2XCB A;  1H6O A;  2WM9 A;  3BG1 B;  4I1A A;  3CVV A;  5ENR D;  5FQ7 A;  3ZN3 A;  5JHA A;  4BWR A;  3ZUV B;  5CEA A;  3QAQ A;  4O1O A;  3FUI A;  4BFR A;  1IXV A;  4H7Y A;  1UW4 B;  3FUJ A;  2BED A;  3SFY A;  5J08 A;  1TNB A;  2GRR B;  1KT1 A;  3Q75 A;  3FHE A;  3ONK A;  4FLH A;  3EHQ A;  1AWC B;  5A7D B;  3MKQ A;  1PC2 A;  2WXN A;  3I4G A;  5ENN A;  2X3M A;  1E8Y A;  3ZEF A;  3CST A;  4X8Q A;  4JHK A;  5G04 J;  5T4Y A;  5EKQ D;  2VGE A;  3PE3 A;  1PAQ A;  4N39 A;  4AVX A;  4ABN A;  3ZPJ A;  3NQP A;  4U95 D;  5C2Y A;  3VLD A;  3RSE G;  2Y4U A;  3Q7F A;  3SY2 A;  2V4L A;  1YYH A;  5G05 J;  2A5U A;  3SF4 A;  1BLX B;  4NAC A; 
#chains in the Genus database with same CATH homology
 1SZ9 A;  3VTY A;  4N2Q A;  2FEZ A;  2KAT A;  2NXP A;  3EIJ A;  3LY9 A;  4U07 A;  2WXI A;  1A17 A;  4GZC A;  4GZD A;  1E96 B;  1IQU A;  4GAA A;  4FJZ A;  1NP7 A;  3GW4 A;  3I4R B;  4XX5 A;  4O6F A;  4G26 A;  3PEV B;  3ZW3 A;  3PZD A;  2KCK A;  3FH8 A;  4JHJ A;  3EHM A;  3OAW A;  2CFU A;  4LCT A;  3FFL A;  4W9R A;  4BTB A;  1H2V C;  4A1S A;  4PH4 B;  2VGX B;  2WXP A;  3FUH A;  4P29 A;  4WNF A;  4CEM A;  2OND A;  3SBS A;  2XPI A;  4AV7 A;  3RRN B;  2QY7 A;  2L0T B;  3FH7 A;  3QWP A;  4ILG A;  2KM4 A;  3CHS A;  4U0S A;  4I6G A;  3FTZ A;  3FU3 A;  4N3B A;  2LAI A;  2XEV A;  3KAE A;  5FQ6 A;  3FDH A;  1ELW A;  3MJW A;  4WNE A;  3DPD A;  2E0I A;  3L16 A;  3OXL A;  3PUK A;  1UJJ A;  3MKQ B;  4HFG A;  3RO2 A;  4WNG A;  3IHY A;  2DBA A;  1YA0 A;  2WQH A;  3RKV A;  2VJ8 A;  4EQF A;  2X6F A;  3G2S A;  3LVQ E;  2IOL A;  3Q5M A;  3SBT B;  3TG4 A;  4D10 C;  3S2A A;  3LDZ A;  4I6J A;  5BPP A;  3UUX A;  2WXQ A;  5KCM A;  4DI3 A;  3LEW A;  3D9J A;  4B0Z A;  2YIN A;  5JJ7 A;  2X6J A;  4G24 A;  4JA9 A;  3BG0 B;  1JUQ A;  5ANL A;  1NZN A;  2OVF A;  2OVB A;  2J07 A;  3FUD A;  3ML8 A;  4WWO A;  4XI9 A;  4AEZ C;  4L1B A;  4JL0 A;  4URK A;  1Z3Y A;  4JEU A;  1XNF A;  3NZS A;  3HYM B;  4BT8 A;  3QKY A;  2C0M A;  2FI7 A;  3FUE A;  2I9C A;  2XQ0 A;  2VYI A;  3FTV A;  3RRU A;  2V0P A;  4I9E A;  4NRH B;  4WND A;  3KS2 A;  4E6H A;  5AIJ A;  1H2U A;  5BT1 A;  3PUJ A;  4G2V A;  2AXV A;  3FEX A;  2HM8 A;  3ESK A;  2LO6 A;  4FA6 A;  4PDX A;  2GGF A;  4WAF A;  3MYV A;  3U3W A;  2YHC A;  1OWP A;  4I6E A;  4HOS A;  2I2O A;  2FO7 A;  3ZHE A;  3TXM A;  3UQ3 A;  1EDU A;  4UI9 C;  2VSO E;  2J49 A;  1HG5 A;  3Q47 B;  1ZBP A;  2PZI A;  3E4B A;  4MLP A;  2DCP A;  4BY6 A;  3ZXS A;  2X6H A;  5E75 A;  3NZU A;  2VSY A;  5CCM A;  4ATG A;  4BX8 A;  5EDS A;  3CVQ A;  4ILH B;  3S7D A;  2R5S A;  4CRW A;  3SGH A;  1HZ4 A;  4E85 A;  2VSN A;  3O4Z A;  3PS6 A;  4KXK B;  5CCL A;  3GZS A;  4TUU A;  4H7X A;  3Q49 B;  1KT0 A;  1MQS A;  2IF4 A;  2KZT A;  3CHO A;  4APO A;  3PNL B;  4I17 A;  4NAC A;  2GRL A;  5FJY A;  5A6C A;  4RSY A;  4CGW A;  1EPU A;  1PY1 A;  2WVI A;  1H19 A;  1HH8 A;  4G1T A;  2CHW A;  4XKB A;  3SD5 A;  4GA0 A;  4EEC A;  4IN3 B;  5AEN A;  4HOR A;  2CG3 A;  4UWK A;  3PE4 A;  4KBQ A;  1FVF A;  1OUV A;  5FQ8 A;  2I6H A;  5JJT A;  4HOU A;  3LY8 A;  4KMO A;  1XGW A;  2NSZ A;  2EQX A;  4ACL A;  2GRM A;  2XRY A;  3CKB A;  3HIZ A;  3QAR A;  3JQ0 A;  2Y4T A;  1QZ2 A;  4I1M A;  2WB2 A;  4AM9 A;  4GZ3 A;  3FUM A;  3L54 A;  4XI0 A;  3KD7 A;  2YQ8 A;  4JXT A;  5JJ6 A;  3G2V A;  5ARG A;  3UPV A;  1UG3 A;  4LRZ A;  3FTS A;  4NQ0 A;  3D9K A;  4UQX A;  4CDN A;  3MV2 B;  1S0P A;  3FUN A;  3C98 A;  3PVL A;  4CCA A;  5HQ8 A;  3QWV A;  2V5F A;  3UT8 A;  4UWL A;  3R7Q A;  4ILI A;  2R17 C;  3ZYQ A;  1JWF A;  3G2U A;  3CVN A;  4KVM A;  3R7R A;  2KC7 A;  3FTX A;  2WXO A;  4EPZ A;  4EZJ A;  4A1G A;  2NC9 A;  2VSX E;  4ME2 A;  3L17 A;  4G11 A;  3IV0 A;  1IQR A;  3CGH A;  1TEZ A;  4Y6W A;  5FWQ A;  2C0L A;  4GYO A;  3TL5 A;  4C0M A;  2PM7 A;  4B94 A;  3LS8 A;  2XGS A;  1SQM A;  3RRM B;  2WPV A;  1HO8 A;  4N3C A;  1DVP A;  2L9B A;  3CEQ A;  4J0U A;  1TJF A;  4B8C B;  1JPL A;  1E8W A;  2LAH A;  3ASH A;  1HXI A;  3PEU B;  2AW6 A;  1GW6 A;  2KCV A;  4GB9 A;  4WWN A;  1NA3 A;  4PS7 A;  3RIB A;  3CLJ A;  3CQG B;  2OOE A;  5BUZ A;  4HXI A;  2J09 A;  3SNX A;  4CDM A;  3T5V A;  2VGY A;  2MRI A;  4ANX A;  3SI5 A;  3WXX A;  4XE0 A;  3FU6 A;  3CVY A;  2M63 A;  5CHE E;  3CV0 A;  3CR3 A;  1OWO A;  4G25 A;  4DI4 A;  5G2N A;  2CG2 A;  2MOW A;  3PH0 C;  3HVE A;  4I2W A;  1DNP A;  3FU0 A;  4JPS A;  5BV0 A;  4JHR A;  5EX0 A;  2XCC A;  4GA1 A;  3SFZ A;  4GZ5 A;  4U0U A;  3CVW A;  3S7J A;  2KCL A;  3SHF A;  3TGO A;  4UI9 K;  3AU4 A;  2KZT B;  4B8A A;  5KJK A;  4Y6C A;  5FTP A;  3ULQ A;  4UI9 J;  3CK8 A;  1QNF A;  3CKC A;  5KJM A;  5ANR A;  1UN8 A;  3ENE A;  4AP2 A;  3R9A B;  3QDN A;  3AU5 A;  5BW8 C;  2BUG A;  1B89 A;  4LER A;  2UY1 A;  2L6J A;  4JA7 A;  1LF8 A;  3RO3 A;  4L23 A;  4XZ4 A;  5DBK A;  4AY6 A;  3ZIM A;  4L2L A;  4AIF A;  3OXF A;  3U4T A;  5M72 A;  1HS6 A;  3MX3 A;  4JC8 A;  3ZVV A;  3I5P A;  3Q4A B;  1INZ A;  1IHG A;  3NF1 A;  3DBS A;  3L22 A;  4XIF A;  3FTU A;  4UWH A;  1VDY A;  2I1J A;  4OVV A;  1TJC A;  3CHR A;  2WQ6 A;  4QFV A;  2XHE A;  3K9I A;  3AS5 A;  3HDX A;  4U0Z A;  3FWV A;  4GCN A;  4WUY A;  4HS2 A;  3D9O A;  4XKC A;  3JQ1 A;  4FAD A;  1MHQ A;  1OWL A;  3SZ7 A;  1H0A A;  3ML9 A;  4UQY A;  4ANW A;  4G23 A;  3UT7 A;  2XPY A;  5D0O D;  2WMO A;  4FP7 A;  4J8S A;  4F3V A;  5G55 A;  3B13 A;  3EIQ C;  3TJP A;  3FY4 A;  4HLE A;  2WXJ A;  4I2Z A;  4FU3 A;  2AWI A;  1N54 A;  3U66 A;  1ELR A;  2XRZ A;  4IYP A;  5D0Q D;  1U3D A;  1N52 A;  3EHN A;  4APF A;  4RG9 A;  5E76 A;  3O48 A;  3D3M A;  1FCH A;  3LXU X;  3OTN A;  3B7S A;  4JZY A;  2WXL A;  5FZR A;  5KJL A;  3S7F A;  4FC8 A;  3ASG A;  1BPO A;  3FUF A;  3D9I A;  2L0I A;  4EBA A;  5LFA A;  3QJZ A;  4ACK A;  1WAO 1;  3EJN A;  3IBE A;  4M3O A;  4FLB A;  4HVB A;  3HVE B;  4I9C A;  4K0R A;  3UMV A;  4ANV A;  1KLX A;  3U64 A;  4Q96 A;  4I43 A;  5FT9 A;  2VTB A;  3FH5 A;  2XGO A;  4KVO A;  5EX3 A;  2VQ2 A;  4AXH A;  1Z6T A;  3B7T A;  3CHQ A;  4C0E A;  4LEU A;  4DLQ A;  4JVS A;  3CSF A;  4OYS A;  3D9L A;  4JW1 A;  2Q7F A;  4PS3 A;  4A3T A;  5LP0 A;  2GW1 A;  3T5X A;  2QFC A;  4J8F A;  4U8H A;  4CT0 A;  2FUL A;  3JCK C;  4PUC A;  3FUK A;  5CMW A;  1QQE A;  2IOS A;  2MHK A;  2RG8 A;  2Y3A A;  3QK0 A;  4GCO A;  4LUN U;  3QOU A;  1IYG A;  2UY1 B;  3P2B A;  3QWW A;  3MGB A;  4GYW A;  1OWN A;  4BX9 A;  4N2S A;  4WWP A;  1Y6I A;  3APD A;  3LVR E;  3ONL A;  5G04 C;  2BF0 X;  3TAX A;  2PQR A;  5BNW A;  4GZ6 A;  3MA5 A;  3IEG A;  4F7A A;  3LY7 A;  2FBN A;  3D9M A;  4L2Y A;  2WQ7 A;  4U63 A;  3U9W A;  4KT6 B;  4DLO A;  3PNT B;  4KZC A;  5HI7 A;  3FTY A;  4FHJ A;  3B7R L;  4JEH A;  3ZHE B;  3G2T A;  2J08 A;  3L13 A;  2CHX A;  4V3I A;  1E8Z A;  2ION A;  3ESL A;  3CVU A;  3D9N A;  3OXG A;  4FHK A;  2OV8 A;  3CVX A;  1NA0 A;  2WXF A;  4UWF A;  3TG5 A;  1WM5 A;  3RU0 A;  1E7U A;  4GML A;  1EYH A;  2YHE A;  1HFA A;  4GA2 A;  4Q94 A;  2WXM A;  5G05 C;  1L5J A;  2ZU6 B;  4YND A;  2X38 A;  4MRU A;  4AJW A;  4BSX A;  1HE8 A;  1HX8 A;  2HO1 A;  2PM6 A;  4RVB A;  4GPK A;  3HHM A;  3LCA A;  5BV1 A;  4U04 A;  2X6I A;  1ZU2 A;  2IFU A;  3PDN A;  3PRE A;  4BT9 A;  4NUR A;  3ZRH A;  3ASF A;  1Y8M A;  1WY6 A;  5FZQ A;  3UT4 A;  1H6K A;  4C9B B;  5JHB A;  3FP3 A;  4HOQ A;  4K03 A;  1P5Q A;  3D9P A;  3MKR A;  3L6A A;  4KZ0 A;  4UQZ A;  5FZS A;  5KJN A;  3CIA A;  5LCW J;  3B7U X;  3UX4 A;  1E7V A;  1X5B A;  3VLE A;  3MZL B;  5AJL A;  4DJA A;  3KEZ A;  2IQC A;  4CGV A;  1H2T C;  4BTA A;  3Q15 A;  5AJD A;  4N3A A;  3JYS A;  3BEE A;  2WMN A;  3T8M A;  3VLF A;  4IRU A;  4AOF A;  4F53 A;  2HR2 A;  2VTB B;  3CQC B;  2J9Q A;  3QB2 A;  2JEK A;  2AVP A;  3FUL A;  2JLB A;  3ZYM A;  2PL2 A;  2J4B A;  4MS6 A;  1ELK A;  4ANU A;  4J8D A;  5AYW D;  1U3C A;  4N5C A;  4EZK A;  1W3B A;  3GZ1 A;  2XCB A;  2WM9 A;  3BG1 B;  3CVV A;  4I1A A;  3MEK A;  4RG6 A;  2XPZ A;  4J8E A;  3VTX A;  3LPZ A;  5FQ7 A;  3ZN3 A;  5JHA A;  4BWR A;  2VGX A;  2E2E A;  3CK9 A;  3QAQ A;  1EF1 C;  3FTW A;  4DPR A;  3CVL A;  3FUI A;  4TV3 A;  3RK6 A;  4BFR A;  4H7Y A;  3ZGQ A;  5LCW C;  2WXH A;  3ZYL A;  1UW4 B;  3FUJ A;  3GYZ A;  4B89 A;  5A23 A;  3EDT B;  3AS4 A;  2PQN A;  3IHV A;  3QNK A;  4IUL A;  4CDR A;  1UJK A;  5J08 A;  1E90 A;  1SZA A;  2LSV A;  2CFZ A;  3LYA A;  1KT1 A;  3FHE A;  2XGM A;  3ONK A;  4UWG A;  1JWG A;  4FLH A;  3APC A;  1FVH A;  4J6I A;  3TXN A;  5J90 A;  5A7D B;  1HG2 A;  3MKQ A;  1PC2 A;  2A4Z A;  4A3V A;  3QC1 A;  2WXN A;  5T3R A;  2LNI A;  2R59 A;  2IU1 A;  3I4G A;  2X3M A;  1E8Y A;  2I1K A;  5ENN A;  2RD0 A;  3ZEF A;  3CST A;  3I3N A;  3RJV A;  2X6K A;  4HOT A;  4JHK A;  5G04 J;  2AXU A;  3FU5 A;  1UN9 A;  5T4Y A;  4PS8 A;  2DIW A;  5EKQ D;  2V8S E;  3FEY A;  3PE3 A;  3LKU A;  2CHZ A;  2P58 C;  4DK5 A;  3AS8 A;  1PAQ A;  4N39 A;  3S7B A;  4I1O B;  5T8I A;  4AVX A;  3CK7 A;  3PRZ A;  4ABN A;  4YVO A;  3ZPJ A;  4FUL A;  4AY5 A;  1OWM A;  4OVU A;  3IKO B;  3ZYK A;  2C2L A;  2J4D A;  2LSU A;  3CVP A;  3NQP A;  5C2Y A;  3VLD A;  2IJG X;  4CT4 A;  2UWJ G;  4EZL A;  4GMJ A;  5C1D A;  2WXK A;  2HYZ A;  4R7L A;  1E8X A;  3G2W A;  4FJY A;  3APF A;  2WXR A;  2ILR A;  2Y4U A;  4TRQ A;  4GYY A;  3JUI A;  5CMY A;  4YVQ C;  2V4L A;  2WXG A;  3LJ3 A;  4KYO B;  3CHM A;  3GZ2 A;  2BTD A;  5FQ4 A;  4GU5 A;  5LOZ A;  4A55 A;  4EBA G;  3URZ A;  1Z3X A;  2YNQ A;  5G05 J;  3ASD A;  1HU3 A;  3N71 A;  2AXZ A;  3ZFW A;  1HF8 A;  2A5U A;  3L08 A;  4L7T A;  3SF4 A;  3MCX A;  4Q69 A;  5ARF A;  5LX8 A;  4F1S A;  5DIZ A;  2FF4 A;  4MKT A;  3P1U A;  3CHP A;  3MV3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...