2XCBA

Crystal structure of pcrh in complex with the chaperone binding region of popd
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
133
structure length
133
Chain Sequence
b'MLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords REGULATORY PROTEIN PCRH
publication title Structural Basis of Chaperone Recognition of Type III Secretion System Minor Translocator Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein binding
total genus 60
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xcbA00
3RIBA 4U04A 4XIFA 5FT9A 2KCLA 4U0UA 3RO3A 4ABNA 3ZHEB 4B94A 4BT8A 1ELRA 1HZ4A 5KJNA 4I9EA 3ASHA 3CVLA 1NZNA 4GCNA 3CK7A 4I1AA 4APOA 4AY6A 1P5QA 4GYWA 2UY1A 4N2QA 2KC7A 4CGVA 4YNDA 1W3BA 3BEEA 3GZ1A 2C0MA 4I2WA 2PQNA 5EX0A 4N3BA 3ZPJA 3SF4A 5LCWJ 2VGYA 3MV3B 5FJYA 5CHEE 4GZ3A 3AS8A 4H7YA 4AM9A 3GYZA 3VTXA 3RKVA 2R5SA 2KCKA 4NQ0A 3ESKA 4N3CA 5FZQA 4GZ5A 2XGSA 3KS2A 4G23A 5LCWC 3MEKA 4U07A 2VQ2A 3CVPA 4H7XA 3U4TA 3UPVA 3ASFA 3CK9A 1KT0A 3CKCA 4Y6WA 5A7DB 2XCBA 2UWJG 3S7DA 5BT1A 3S7BA 5ARGA 2FEZA 1A17A 3TAXA 3RU0A 1IHGA 2WQHA 2XGOA 2PZIA 2FO7A 5A6CA 3TG4A 3LPZA 3ZN3A 4GYOA 2LNIA 5D0QD 3LCAA 3KD7A 5KJLA 2ONDA 3Q49B 4XI9A 3K9IA 3E4BA 2IFUA 2XCCA 3OXGA 5DBKA 3FFLA 4GA1A 1FCHA 3UUXA 4JHRA 3LY7A 1NA3A 4UQYA 3MKRA 1ZU2A 4YVQC 4UQXA 3HYMB 4GZ6A 4BWRA 4UQZA 2FBNA 2QFCA 3CVQA 4YVOA 5AYWD 1ZBPA 3CEQA 4KXKB 3Q4AB 1KT1A 4U0ZA 5C1DA 5M72A 5JJ6A 2V5FA 2VSNA 3PDNA 2KATA 2XPIA 3LKUA 5G04C 4EQFA 2VYIA 3MV2B 4G24A 3VTYA 4HOTA 5ARFA 2OOEA 4GCOA 1QQEA 3MA5A 4N2SA 5JJTA 5FTPA 3RJVA 2VGXA 5BW8C 4I2ZA 4LEUA 2WPVA 4I9CA 2XGMA 4Y6CA 3GZ2A 2LSUA 4J8FA 4CGWA 4RG6A 5FZRA 1QZ2A 5EX3A 5CCLA 4WNFA 3S7FA 5CCMA 3QWPA 4WUYA 3OXFA 3QWWA 4UI9C 2PQRA 3LY9A 2HR2A 2UY1B 4J8EA 4HOQA 3CVNA 4G25A 1ELWA 3ZHEA 3CK8A 1IYGA 3U3WA 3CKBA 4N5CA 4HOUA 3EDTB 4GPKA 3ASGA 4N3AA 1NA0A 3AS5A 3CV0A 1HXIA 3ZGQA 3Q47B 1YA0A 4J8DA 4AIFA 3LYAA 4JL0A 3RO2A 2FI7A 2YHCA 4CDRA 4GA2A 3ULQA 1PC2A 4G1TA 2GW1A 5G04J 3FWVA 1TJCA 3JYSA 4RG9A 4F3VA 4U0SA 3ZFWA 4AY5A 2PL2A 3R9AB 3NF1A 5HQ8A 3QKYA 2Y4TA 3KAEA 4W9RA 5D0OD 3URZA 3OXLA 3LY8A 4A1SA 2E2EA 3PE4A 5KJKA 1B89A 4NRHB 1Y8MA 5HI7A 3UQ3A 1XNFA 4UI9J 2XEVA 4WNGA 3N71A 4G26A 4IN3B 4GA0A 5EKQD 4O6FA 4BTAA 5DIZA 3Q5MA 2LSVA 4HOSA 4KBQA 3TG5A 2L6JA 4WNDA 4KYOB 1E96B 2C2LA 3O48A 2HYZA 3S7JA 2Y4UA 3QOUA 2HO1A 4I17A 1HH8A 1WM5A 2KCVA 3QWVA 4XI0A 4UI9K 3WXXA 2DBAA 4WNEA 4BT9A 3FP3A 3TGOA 2YQ8A 4N39A 2J9QA 4BTBA 2JLBA 2NC9A 5G05J 2VGXB 3GW4A 5KJMA 1KLXA 2Q7FA 3ASDA 3QDNA 2AVPA 3IEGA 5BNWA 4JA7A 1WAO1 3PE3A 5FZSA 2VSYA 3Q15A 4J0UA 3AS4A 5JJ7A 4G2VA 3SZ7A 5G05C 2IF4A 2P58C 1OUVA 2MHKA 2BUGA 2FF4A 2C0LA 4JA9A 4GYYA 2I6HA 4HORA 4ME2A
chains in the Genus database with same CATH superfamily
4CT0A 2XHEA 4U0UA 3P2BA 3ZHEB 2L0IA 5LOZA 2EINE 1NZNA 4GCNA 5KBAA 4EECA 1HFAA 2IJGX 3ULYA 3D9HA 1MX4A 4N2QA 4ACKA 1N9AA 1G3NB 3BEEA 3SBTB 3DSWA 3UIPC 3W9FA 3SF4A 5LCWJ 3QB2A 5FJYA 1N52A 1TN8A 3MZLB 1OCZE 3FULA 2KCKA 3QC1A 1D8DA 5CBNA 4HI9A 3ESKA 4N3CA 4GZ5A 2VJ8A 3DEPA 1N4QA 3FTYA 3KS2A 4G23A 4GTOA 2RG8A 3ZU7B 2VGEA 2VSOE 3CVPA 2LAHA 4A3TA 3ASFA 5BUZA 3FH5A 3CKCA 1IXVA 2RFAA 4Y6WA 2NYJA 2XCBA 3S7DA 5BT1A 4JC8A 3ZKJA 4TV3A 2FEZA 1A17A 4B8AA 3RU0A 2WQHA 3FUJA 2AXUA 3G2SA 3PRZA 3TG4A 3T5XA 3FUDA 1K1AA 2IU1A 2F8YA 2J4BA 2ONDA 2WXNA 4XI9A 2IFUA 3IKOB 3OXGA 4XKBA 4DI3A 1FCHA 3ZYLA 2XQ0A 4UQYA 3AJIA 1NI1A 4UQXA 1MQSA 3AU4A 3TWXA 4WAFA 2FBNA 3RSEG 1TN6A 1FVHA 1E8WA 2RKKA 4LNUD 4L23A 2V8SE 3UINC 1S63A 4CRWA 3APDA 5M72A 4HXIA 3RK6A 2PNNA 4GPMA 4AJWA 5J90A 2V5FA 1HE8A 4L2LA 1QNFA 3PDNA 3TWUA 1KPSB 3ZVVA 3MV2B 5ARFA 2ZGGA 3UT8A 1SA5A 3J5PA 3DSUA 3EHNA 3L6AA 2XENA 3PEVB 4F6RD 3NOCD 3GZSA 1OT8A 4HS2A 2BKGA 3SFZA 3FUNA 3GZ2A 5CEDB 4KZCA 2X6JA 3CHRA 3APFA 1OXJA 1HG2A 3E34A 4C48B 4KT6B 1E90A 5CCLA 1HO8A 3JXJA 2V0PA 3T8MA 3CQGB 2VSXE 1K8KG 4OVUA 1KZOA 3OXFA 3EU5A 1KZPA 2PQRA 2GROB 2HR2A 4KVOA 3ASNE 3FU0A 4HOQA 1OCCE 4HRNA 2LO6A 3AG1E 5AQ7A 5CEAA 1TR4A 4LUNU 5ENSD 1U3DA 4G25A 4Q96A 1ELWA 3CK8A 1JCQA 4GMRA 2ZXWE 3EDTB 2DYRE 3CHMA 2IEJA 1MYOA 4J6IA 2WMOA 3TWVA 1L5JA 4BY6A 3L08A 4L9PA 4NURA 4AOFA 4J8DA 4UWKA 4JL0A 5JHAA 1WY6A 5CBOA 4TXRA 2X6HA 4G1TA 3I3NA 5G04J 3DSTA 3SD5A 4R7LA 4RG9A 4F3VA 3EHMA 4U0SA 3HXEA 3ZFWA 4OYSA 2EIKE 3FEXA 4DLOA 2PL2A 5EDSA 2WQ6A 5AN8A 4Q69A 5HQ8A 5EN5D 3CVWA 3JUIA 4O60A 5ANLA 5D0OD 3ML8A 3URZA 3TWWA 4MBGA 4A1GA 4GB9A 5G55A 1B89A 3MYVA 3DWLG 5FIOA 4EZKA 2ZU6B 5BV0A 3HVEB 3CQCB 3F6QA 1Y8MA 5ITZF 4RQIA 5HI7A 3UQ3A 4DX6D 4UI9J 1SQMA 4JEUA 3FU3A 2DWZA 2I1KA 4XKCA 4G26A 4IN3B 5DIZA 3PZ3A 4HOSA 3CSFA 3ENEA 2GRRB 3PZDA 4KBQA 2L6JA 4L2YA 3IHYA 1QBQA 4KYOB 2JEKA 4GTMA 2BEDA 4A3VA 3UKUG 5CERB 1JPLA 5CMWA 1N4SA 5JHBA 4GMLA 3DEOA 2L9BA 2HYZA 3UTMA 2Y4UA 3FHEA 3IXEA 2MYOA 3B13A 4L1BA 3DSVA 4U8VD 1NFIE 3UKRG 3AAAC 1TNUA 2DBAA 1WDYA 4WNEA 3D9PA 3PUJA 2XEHA 3ZUVB 3FP3A 3BG1B 5A23A 4HI8A 2YQ8A 4N39A 4DX5D 4CT4A 1H6KA 4IYPA 4UWFA 4G2VA 4ILGA 3JXIA 3V2XA 2MHKA 3RRUA 3ZRHA 2FF4A 5CMYA 3SY2A 3WG7E 4LCTA 3SBSA 3DXKG 3ZIMA 3FDHA 3ASHA 3W9GA 4XIFA 5FT9A 2KCLA 4BT8A 3PZ2A 1ELRA 4I9EA 4GZCA 3EHRA 3RAUA 4PH4B 2X6IA 4IRUA 2KZTB 4K03A 3B7RL 4GTSA 4AY6A 3OAWA 5BXOA 1TYQG 2L0TB 4K5BA 2KC7A 1W3BA 3GZ1A 4AVXA 1PY1A 2PQNA 4OAUC 4HLLA 3EIJA 3ZPJA 4APFA 2VGYA 5FQ7A 5CHEE 4JZYA 4GZ3A 4FC8A 4LNBA 4BESA 3VTXA 4KZ0A 3EU9A 4ANUA 2V4LA 3HXFA 1BLXB 4UWLA 4C0EA 3ZYKA 4UWGA 4CCAA 2R03A 3UM3A 3RRMB 4U96D 2QYUA 4FHJA 4PS3A 2X6KA 4U07A 4CDMA 1E8XA 4H7XA 2WXLA 3AG4E 3V30A 3HRAA 4PUCA 1KT0A 4BSZB 2WXPA 2V5QC 4GZDA 3APCA 4FJZA 2DZOA 3TWTA 3FY4A 2AXVA 5ARGA 3FU6A 3SO8A 4FULA 1S64A 4XZ4A 1LF8A 1D8EA 3KSQA 4ILHB 1YCSB 3IHVA 4YDOA 3FUMA 4ZFHA 2FO7A 1H2UA 4F1SA 2ZIRA 3CSTA 2BTDA 4UUCA 4FLBA 2Y3AA 3PH0C 3FUEA 5KJLA 3PNTB 3TWRA 3K9IA 3E4BA 3NB2A 4AEZC 2J49A 4IULA 3QNKA 5DBKA 4DUIA 1N0RA 3Q9UC 4JHRA 3HYMB 2QFCA 3CVQA 1MX2A 5ENOD 3CEQA 4A63B 4EZLA 1OCOE 3DRAA 3UM2A 3EIQC 5JJ6A 3TJPA 4UWHA 3LKUA 4I6EA 5G04C 4ANXA 4EQFA 2VYIA 4XX5A 4U95D 1HU3A 4G24A 3VTYA 3NAWA 4ANVA 3ZXSA 1QQEA 4QFVA 3E32A 3ASOE 5JJTA 2J08A 5BXUA 4CZ2D 4LEUA 4LERA 2WB2A 2DCPA 2H6IA 3ABLE 2IOSA 1SZAA 4TUMA 3D9IA 4WNFA 3Q73A 5CCMA 3QWPA 2Y1LE 1X81A 2Y0BG 1N54A 1RW2A 4UI9C 3CIAA 3LY9A 2UY1B 1TNZA 2I9CA 5D66A 3MGBA 4JW1A 2FULA 3LVQE 3ZHEA 5EIDA 4WWOA 1U3CA 3CVYA 4HOUA 3FUKA 5JA4D 4MRUA 1DVPA 4EBAA 4BX8A 5AENA 3IV0A 3V79K 1OY3D 3NQPA 4GTPA 4CYMD 1JCRA 1ELKA 3LYAA 1HS6A 1JWFA 2R59A 3D9KA 2GRMA 2QC9A 2FI7A 2X6FA 4CDRA 4GA2A 1PC2A 3Q78A 5AQ9A 3D9NA 4ANWA 1H0AA 3LXUX 2EILE 2WXFA 5ANRA 3VLFA 3JCKC 4XE0A 3PUKA 3NF1A 5E75A 2AJAA 3QJZA 4N5QA 4W9RA 4A1SA 2YNQA 3ZW3A 1BPOA 5J08A 5KJKA 3FU5A 4NRHB 4KMOA 2EQXA 1MHQA 3MCXA 5LP0A 4DRXE 4WNGA 2ZISA 1K3ZD 4BEPA 1TNBA 2IY0C 3N71A 2LXMA 5EKQD 3PVLA 4O6FA 5AQAA 3Q9NC 1OWMA 4TXQA 2WXRA 1E96B 2R2LA 2NSZA 1IQUA 1EPUA 2XRZA 3CGHA 2P9PG 3NOGD 2HM8A 4ACLA 2HO1A 5JMND 4I17A 2KXPC 3QWVA 1EDUA 2PM6A 2F0YA 4O1PA 4LG6A 4QQIA 4Z68A 1FT2A 3FTVA 4NACA 3Q7AA 4BTBA 2JLBA 2NC9A 2VGXB 4GTRA 4X8QA 4HRMB 4FLHA 2B0OE 3C3RA 2AW6A 2Q7FA 3QDNA 5LX8A 3ISMC 2AXZA 5D2MC 4K5CA 1WAO1 1BI7B 4TXPA 2P9IG 5FZSA 3AG2E 3R7QA 2XPYA 3UM0A 5JJ7A 2QY7A 2A5UA 3SZ7A 5G05C 2LXLA 4WWNA 1SW6A 4U8YD 2I6HA 5BV1A 4ME2A 1D9SA 4YDEA 4U04A 4DPRA 3R7RA 5KWDA 5KJNA 5EYPF 4EHMA 3CVLA 2IO2C 4ATZD 2H6GA 4I1AA 1Z3XA 5EILA 2R02A 1IQRA 4APOA 1P5QA 1U2VG 2M63A 4YNDA 4I2WA 5EX0A 4N3BA 2CG3A 4FJYA 4U8HA 4NIKA 3D9MA 5H7PA 4TUUA 4HBDA 4URKA 3AS8A 3ULEG 4AM9A 3GYZA 3MKQB 3RKVA 2XZDG 4NQ0A 3D9OA 2CFUA 3SI5A 3R9MA 2VTBB 2XGSA 4JD2G 4GAAA 4DLQA 5LCWC 3G2WA 1BU9A 4LRZA 5AQBA 5AJLA 4B8CB 2HE0A 5A7DB 2AWIA 2UWJG 2WMNA 5AAOA 3E30A 5EIBE 3TAXA 4JPSA 3L13A 1IKND 1UOHA 2XPZA 3CLJA 3O4ZA 2ETCA 2J09A 4M3OA 4WWPA 5ENQD 3MX3A 3SFXA 4I1OB 3UM1A 2GGFA 3LPZA 3ZN3A 4PS8A 1E8ZA 3HG0D 4B89A 3DPDA 4HVBA 3QAQA 3Q49B 3HVEA 2YINA 4K5AB 1UG3A 4BFRA 3FFLA 3ONLA 4FHKA 2H6FA 4MS6A 4EZJA 2LAIA 4ATGA 3LY7A 1ZU2A 2P9SG 4RSYA 3MJWA 4GZ6A 3UI2A 4BWRA 4UQZA 2XS8A 5AARA 4YVOA 2EIJE 4MKTA 1ZBPA 5EYLA 1JUQA 3Q4AB 1KT1A 4O1OA 1S70B 3G2VA 4A55A 5C1DA 4J8SA 2VSNA 3KSLA 3B95A 3J5QB 1LD8A 2F37A 2X3MA 3U66A 4HOTA 2OOEA 3CHSA 3DSSA 2J8SD 3C3OA 3LJ3A 5C2YA 4N2SA 3LDZA 5FTPA 3BU8A 1TNOA 3FUFA 5BW8C 4I2ZA 4EBAG 1H2VC 3B7UX 1N11A 2WPVA 4I9CA 4GMJA 3SQVA 3QK0A 4KVMA 4J8FA 4CGWA 5CRUA 4RG6A 2V4HC 3C98A 5FZRA 5EX3A 5T4YA 1QZ2A 2WXQA 3FEYA 3RRNB 4WUYA 3ZYMA 4HB5A 1JWGA 1WG0A 3FTSA 2J4DA 2WXIA 4HNAD 3L22A 1H6OA 3TL5A 3ZNGA 4AXHA 1IYGA 3U3WA 3P1UA 4GPKA 2KZTA 4HQDA 1S0PA 2WQ7A 3FTXA 1NA0A 3L54A 1O1SA 4D10C 3CV0A 1HXIA 1AP7A 1UJKA 3CHOA 3JQ0A 3I4RB 1N94A 3PEUB 3IBEA 2YHCA 1JCSA 4ZHBA 3ULQA 3OTNA 1FT1A 3FWVA 3TXMA 1TJCA 2KBXA 4F53A 2ETBA 2OEWA 2CHXA 2R17C 1V54E 4U63A 2R05A 5ENRD 3R9AB 3QKYA 2Y4TA 1OWNA 4RVBA 3X2QE 2IQCA 3OXLA 3LY8A 1E7UA 2P9NG 1UN9A 2P9UG 3PZ1A 4LSZE 3PE4A 3LS8A 4BERA 3U9WA 1HF8A 4HRLA 1ZB1A 1Z3YA 3Q79A 5ENPD 3KEAA 2XRYA 1XNFA 4FADA 5FQ8A 1DCEA 4OVVA 2WXHA 3SHFA 4GA0A 2OEVA 1Q2ZA 4BTAA 2IOLA 3Q5MA 2LSVA 2KM4A 2XS1A 3TG5A 2XZTG 4WNDA 3D3MA 3KEZA 2C2LA 5KCMA 3S7JA 2P2CP 3PZ4A 4Q94A 3DBSA 2CFZA 1HH8A 4I43A 4DX1A 3DSXA 2GRLA 3L82A 5T8IA 1YMPA 4XEIG 4J7WA 3FUHA 3L17A 2IO3C 2QZAA 5B1AE 3TGOA 5AIJA 1QYMA 2J9QA 3Q7FA 3CVUA 4GTTA 2XEEA 1KLXA 3E33A 3ASDA 1OWLA 3IEGA 3VLEA 2B6CA 2RFMA 4J0UA 3AS4A 3BQOA 3E37A 3NZSA 4HLEA 1Z5SC 2J07A 4GU5A 4JA9A 4GYYA 3C72A 2I2OA 4HORA 5AJDA 1XGWA 5KNHD 3SNXA 3RIBA 3RO3A 4ABNA 4B94A 1HZ4A 1H2TC 4PS7A 5FQ4A 5B1BE 4CDNA 4J8YA 3CK7A 4DX2A 3ESLA 3G2UA 4GYWA 1EYHA 2UY1A 2BF0X 5T3RA 3PS6A 3ZYQA 4CGVA 5FWQA 2WXOA 2C0MA 1OWOA 2RD0A 4U7EB 2Y69E 1NP7A 3MV3B 2CHWA 4B0ZA 2H6HA 4H7YA 1Z6TA 3LJNA 4B93B 2R5SA 1FPPA 2DVWA 5FZQA 3CVVA 4JHKA 3UX4A 4G8KA 3PNLB 1O5MA 3MEKA 3UIOC 2VQ2A 3HXDA 3U4TA 3UPVA 3CK9A 1OWPA 4AV7A 1LTXA 3LVRE 4OAVB 4FU3A 2ETAA 4JEHA 3S7BA 2WM9A 3G2TA 4GTQA 1HX8A 3TXNA 1N0QA 1E8YA 4P29A 1IHGA 3B7TA 1EF1C 5HKPA 2OV8A 2XGOA 3U64A 2PZIA 5A6CA 2LUHA 3HDXA 4GYOA 2LNIA 5D0QD 2EIME 2NXPA 3LCAA 2FO1E 3ONKA 1DNPA 4BETA 3CHQA 3KD7A 1TEZA 3AU5A 5IY5E 4BSXA 3FTUA 3HXBA 3TWSA 4F1PA 2XCCA 3FH8A 3CHPA 2I1JA 4GA1A 4DJAA 3UUXA 1NA3A 2YHEA 3MKRA 4YVQC 3DPYA 4FP7A 3HXCA 1O1RA 4LNGA 5AYWD 2E0IA 4HFGA 5HRYA 2L6BA 4KXKB 3I5PA 4U0ZA 4F7AA 3NBNB 3ZEFA 1BI8B 1OCRE 2KATA 2XPIA 4C0MA 3EHQA 4GCOA 3L16A 4JXTA 1Y6IA 2WXKA 1GW6A 3MA5A 3DXMG 3QARA 3RJVA 2VGXA 4RLYA 1AWCB 1NL4A 1H6PA 3C5RA 2XGMA 4Y6CA 1TNYA 3BUAA 2LSUA 5CRVA 4L7TA 1BD8A 2A5EA 4DX7D 3S7FA 1UN8A 2GRNB 1YYHA 2ZGDA 4CEMA 3FTWA 3QWWA 1H19A 3FTZA 2X38A 4PDXA 2OVFA 4J8EA 2MOWA 3I4GA 4EPZA 3CVNA 3AG3E 4K0RA 4YDWA 2IONA 4BX9A 1INZA 2WXGA 1O1TA 3CKBA 4N5CA 2F8XK 1FVFA 3ASGA 4DI4A 4JVSA 1IHBA 1V55E 3UXGA 3EJNA 1PAQA 4G8LA 4N3AA 2OVBA 1HG5A 3B7BA 3AS5A 1UW4B 3ABME 3ZGQA 3Q47B 1YA0A 2PM7A 4AIFA 4C9BB 1RZ4A 5FINA 3RO2A 5LFAA 3Q75A 3MKQA 3PREA 2GW1A 1K1BA 3B7SA 4G11A 4I6JA 4ILIA 2VTBA 3JYSA 3CVXA 1E7VA 3C3QA 4JHJA 1SA4A 2MRIA 4AY5A 5ENTD 3KAEA 4YDYA 3V2OA 3SFYA 2DYSE 2E2EA 2WXJA 2JABA 3ML9A 4I1MA 3S2AA 4GTVA 4E6HA 2P9KG 2A4ZA 2CHZA 3FUIA 2XEVA 1VDYA 3ZXPA 3JQ1A 1UJJA 4E85A 4I6GA 4TRQA 2CG2A 4JB8P 5KNGA 5B3SE 1MX6A 4MLPA 3UMVA 1N4PA 5ENNA 3CR3A 1N95A 3EUVA 4V3IA 3NZUA 3O48A 5E76A 3UT7A 3D9LA 1N4RA 3QOUA 1DCQA 3HIZA 4DK5A 1WM5A 3SGHA 2KCVA 2P9LG 4XI0A 5CECB 4UI9K 3T5VA 3WXXA 3TWQA 3BG0B 4M7CA 1SVXA 1DC2A 3VLDA 4BT9A 1TN7A 2WVIA 4AP2A 3JUEA 3UT4A 1MJ0A 3V31A 3T8KA 5G05J 1A5EA 1TJFA 3GW4A 5KJMA 5FQ6A 2WXMA 2AVPA 3D9JA 5BPPA 5BNWA 4JA7A 3ABKE 1SZ9A 2ILRA 3HHMA 3PE3A 2VSYA 3Q15A 2GRQB 2QYJA 3FH7A 2OCCE 5G2NA 2IF4A 2GRPB 2P58C 2DZNA 1OUVA 1LD7A 3L9TA 1X5BA 2BUGA 5HS0A 1MZCA 2C0LA 4FA6A 3T9KA 2BKKB 2DIWA 3LEWA
chains in the Genus database with same CATH topology
5AJDA 1XGWA 4CT0A 3SNXA 3RIBA 4U04A 4XIFA 2XHEA 5FT9A 4DPRA 2KCLA 4U0UA 3R7RA 3RO3A 4ABNA 3P2BA 3ZHEB 4B94A 2L0IA 4BT8A 1ELRA 1HZ4A 5KJNA 4I9EA 1H2TC 4GZCA 4PS7A 5FQ4A 4PH4B 5LOZA 4CDNA 2X6IA 3CVLA 1NZNA 4GCNA 4IRUA 2KZTB 4K03A 3CK7A 3B7RL 4EECA 4I1AA 1Z3XA 1IQRA 1HFAA 2IJGX 4APOA 4AY6A 3ESLA 1P5QA 3G2UA 3OAWA 4GYWA 1EYHA 2L0TB 2UY1A 4ME2A 2BF0X 5T3RA 4N2QA 2KC7A 2M63A 3PS6A 3ZYQA 4YNDA 4ACKA 4CGVA 1W3BA 5FWQA 2WXOA 3BEEA 3GZ1A 2C0MA 4AVXA 1PY1A 4I2WA 1OWOA 2PQNA 2RD0A 5EX0A 4N3BA 2CG3A 3SBTB 3EIJA 3ZPJA 3SF4A 4APFA 3QB2A 5LCWJ 4FJYA 2VGYA 1NP7A 4U8HA 3D9MA 3MV3B 5FQ7A 2CHWA 5CHEE 5FJYA 1N52A 4GZ3A 3MZLB 4FC8A 4JZYA 4TUUA 3AS8A 4B0ZA 4URKA 4H7YA 4AM9A 1Z6TA 3GYZA 3VTXA 4KZ0A 3MKQB 3RKVA 2R5SA 4ANUA 3FULA 2V4LA 2KCKA 4NQ0A 3D9OA 3QC1A 4UWLA 2CFUA 4C0EA 3ZYKA 3SI5A 4UWGA 3ESKA 4N3CA 5FZQA 4CCAA 4GZ5A 2XGSA 2VTBB 4JHKA 2VJ8A 3UX4A 4GAAA 3FTYA 3RRMB 3PNLB 3KS2A 4G23A 4DLQA 5LCWC 3MEKA 4FHJA 2RG8A 4PS3A 2X6KA 4U07A 3G2WA 4CDMA 2VSOE 1E8XA 2VQ2A 3CVPA 2WXLA 4H7XA 3U4TA 4LRZA 3UPVA 2LAHA 4PUCA 4A3TA 3ASFA 3CK9A 5BUZA 1KT0A 3FH5A 5AJLA 3CKCA 1OWPA 4B8CB 4AV7A 4Y6WA 2WXPA 3LVRE 4FU3A 4GZDA 5A7DB 2AWIA 2XCBA 2UWJG 3S7DA 2WMNA 5BT1A 4JEHA 3APCA 4FJZA 4JC8A 3S7BA 2WM9A 3FY4A 2AXVA 5ARGA 3G2TA 3FU6A 2FEZA 4TV3A 1HX8A 1A17A 4B8AA 4FULA 3TAXA 4XZ4A 3TXNA 4JPSA 1E8YA 3RU0A 3L13A 4P29A 1LF8A 1IHGA 2WQHA 2XPZA 3CLJA 3B7TA 1EF1C 2OV8A 4ILHB 3FUJA 2AXUA 3IHVA 2XGOA 3O4ZA 2J09A 4M3OA 3U64A 4WWPA 3G2SA 3MX3A 3PRZA 4I1OB 3FUMA 2PZIA 2FO7A 5A6CA 3TG4A 2GGFA 1H2UA 3LPZA 3FUDA 3T5XA 4F1SA 3HDXA 3ZN3A 4PS8A 1E8ZA 3CSTA 4GYOA 2LNIA 2BTDA 2NXPA 3LCAA 5D0QD 4B89A 3DPDA 4FLBA 3ONKA 4HVBA 1DNPA 2IU1A 3CHQA 2Y3AA 3KD7A 3PH0C 3FUEA 5KJLA 2J4BA 2ONDA 3QAQA 1TEZA 3AU5A 3Q49B 3PNTB 4BSXA 2WXNA 3FTUA 3HVEA 4XI9A 3K9IA 3E4BA 2IFUA 4AEZC 2XCCA 2YINA 3IKOB 3OXGA 2J49A 4IULA 3FH8A 1UG3A 3CHPA 3QNKA 4XKBA 5DBKA 4BFRA 4DI3A 3FFLA 3ONLA 2I1JA 4FHKA 4GA1A 1FCHA 4MS6A 4EZJA 3ZYLA 4DJAA 2XQ0A 2LAIA 3UUXA 4JHRA 1NA3A 2YHEA 3LY7A 3MKRA 1ZU2A 4UQYA 4ATGA 4YVQC 4UQXA 4FP7A 4RSYA 1MQSA 3HYMB 3AU4A 3MJWA 4GZ6A 4BWRA 4UQZA 4WAFA 2FBNA 2QFCA 3CVQA 4YVOA 5AYWD 1FVHA 1E8WA 4MKTA 2E0IA 2V8SE 4L23A 1ZBPA 3CEQA 4HFGA 1JUQA 4KXKB 4EZLA 3Q4AB 1KT1A 3I5PA 4CRWA 3APDA 4U0ZA 4F7AA 3EIQC 3G2VA 4A55A 5C1DA 5JJ6A 5M72A 4HXIA 3RK6A 4AJWA 5J90A 3TJPA 2V5FA 3ZEFA 4J8SA 1HE8A 2VSNA 4L2LA 4UWHA 1QNFA 3PDNA 2KATA 2XPIA 3LKUA 4I6EA 5G04C 3ZVVA 4ANXA 2VYIA 4XX5A 3MV2B 4EQFA 1HU3A 4G24A 3VTYA 4C0MA 2X3MA 4ANVA 5ARFA 3U66A 4HOTA 3UT8A 3ZXSA 2OOEA 3CHSA 4GCOA 1QQEA 3L16A 4JXTA 3EHNA 3L6AA 4QFVA 3LJ3A 1Y6IA 5C2YA 2WXKA 1GW6A 3LDZA 3MA5A 4N2SA 5JJTA 2J08A 5FTPA 3QARA 3FUFA 3RJVA 2VGXA 3PEVB 5BW8C 4I2ZA 4LEUA 1H2VC 3GZSA 4EBAG 3B7UX 4LERA 2WPVA 4HS2A 4I9CA 2XGMA 4GMJA 4Y6CA 2WB2A 2DCPA 3SFZA 3QK0A 3FUNA 3GZ2A 4KVMA 4KZCA 2LSUA 4J8FA 2X6JA 4CGWA 3CVVA 3CHRA 3APFA 1HG2A 4L7TA 4RG6A 3C98A 5FZRA 1QZ2A 1E90A 4KT6B 2IOSA 2WXQA 5EX3A 1HO8A 1SZAA 5T4YA 2V0PA 5CCLA 3D9IA 3T8MA 3FEYA 3CQGB 4WNFA 3S7FA 2VSXE 1UN8A 5CCMA 3QWPA 3RRNB 4OVUA 4WUYA 3OXFA 3ZYMA 4CEMA 1JWGA 3FTWA 1N54A 3QWWA 4UI9C 1H19A 3FTSA 2PQRA 3FTZA 3CIAA 2X38A 4PDXA 2OVFA 3LY9A 2HR2A 2UY1B 4KVOA 4J8EA 2MOWA 3I4GA 2J4DA 2I9CA 4EPZA 3FU0A 2WXIA 4HOQA 2LO6A 3L22A 3CVNA 3MGBA 4LUNU 3TL5A 1U3DA 4JW1A 2FULA 4G25A 3LVQE 4Q96A 1ELWA 3ZHEA 3CK8A 4K0RA 4AXHA 2IONA 4WWOA 4BX9A 1INZA 1IYGA 2WXGA 1U3CA 3CVYA 3U3WA 3P1UA 3CKBA 4N5CA 4HOUA 3EDTB 1FVFA 2KZTA 4GPKA 3ASGA 4DI4A 3FUKA 4JVSA 4MRUA 1DVPA 4EBAA 3CHMA 4BX8A 4J6IA 1S0PA 2WQ7A 3EJNA 2WMOA 1PAQA 3IV0A 5AENA 4N3AA 3FTXA 2OVBA 1L5JA 1NA0A 1HG5A 4BY6A 3L08A 3L54A 3AS5A 3NQPA 4NURA 1UW4B 4D10C 3CV0A 1HXIA 3ZGQA 4AOFA 3Q47B 1YA0A 1UJKA 1ELKA 3LEWA 4J8DA 4UWKA 2PM7A 4AIFA 3CHOA 3LYAA 4JL0A 4C9BB 5JHAA 1HS6A 1JWFA 2R59A 3I4RB 3JQ0A 1WY6A 3D9KA 3RO2A 3PEUB 5LFAA 3IBEA 2GRMA 2FI7A 2X6FA 2YHCA 4CDRA 4GA2A 2X6HA 3ULQA 3MKQA 1PC2A 3PREA 4G1TA 2GW1A 3I3NA 3OTNA 5G04J 3FWVA 3B7SA 3D9NA 4G11A 3TXMA 4ANWA 1TJCA 4F53A 4I6JA 3SD5A 4ILIA 4R7LA 1H0AA 2VTBA 3JYSA 4RG9A 3CVXA 3LXUX 1E7VA 4F3VA 2CHXA 3EHMA 2R17C 4JHJA 4U0SA 2WXFA 2MRIA 4U63A 3JCKC 5ANRA 3VLFA 3ZFWA 4OYSA 3FEXA 4XE0A 4DLOA 3PUKA 4AY5A 2PL2A 5EDSA 2WQ6A 3R9AB 3NF1A 4Q69A 5E75A 5HQ8A 3QKYA 2Y4TA 1OWNA 3QJZA 3JUIA 3KAEA 5ANLA 3CVWA 4W9RA 5D0OD 3ML8A 4RVBA 2IQCA 3URZA 3OXLA 3LY8A 4A1SA 1E7UA 2E2EA 2YNQA 3ZW3A 2WXJA 1UN9A 1BPOA 3ML9A 4I1MA 4GB9A 4A1GA 5J08A 3PE4A 5G55A 3S2AA 3FU5A 1B89A 4NRHB 5KJKA 3LS8A 4KMOA 3MYVA 4EZKA 3U9WA 2ZU6B 5BV0A 4E6HA 1HF8A 2EQXA 3HVEB 1MHQA 3CQCB 3MCXA 1Y8MA 2A4ZA 1Z3YA 2CHZA 5HI7A 3UQ3A 2XRYA 1XNFA 3FUIA 2XEVA 4UI9J 1VDYA 5LP0A 3FDHA 4WNGA 4FADA 3JQ1A 1UJJA 5FQ8A 1SQMA 4JEUA 4E85A 4I6GA 4OVVA 4TRQA 2CG2A 3FU3A 2I1KA 3N71A 4XKCA 2WXHA 3SHFA 4G26A 4IN3B 4MLPA 4GA0A 5EKQD 3PVLA 4O6FA 4BTAA 2IOLA 5DIZA 3Q5MA 2LSVA 2KM4A 4HOSA 3CSFA 3ENEA 3UMVA 3PZDA 4KBQA 3TG5A 2L6JA 5ENNA 1OWMA 4WNDA 3CR3A 4L2YA 3IHYA 4KYOB 2JEKA 2WXRA 4V3IA 3D3MA 3KEZA 4A3VA 3NZUA 1E96B 1JPLA 2C2LA 5CMWA 3O48A 5JHBA 2NSZA 4GMLA 5E76A 2L9BA 1IQUA 1EPUA 2HYZA 5KCMA 3CGHA 2XRZA 3S7JA 2Y4UA 3FHEA 2HM8A 3D9LA 3UT7A 4ACLA 3QOUA 3B13A 4Q94A 2HO1A 3HIZA 4L1BA 3DBSA 2CFZA 4I17A 1HH8A 1WM5A 4I43A 3SGHA 4DK5A 2KCVA 3QWVA 1EDUA 4XI0A 2GRLA 2PM6A 5T8IA 4UI9K 3T5VA 3WXXA 2DBAA 3BG0B 4WNEA 3D9PA 3PUJA 3VLDA 4BT9A 3FTVA 4NACA 3FP3A 3FUHA 3BG1B 3L17A 5A23A 2WVIA 4AP2A 3TGOA 3UT4A 2YQ8A 5AIJA 4N39A 2J9QA 4BTBA 3CVUA 2JLBA 4CT4A 2NC9A 5G05J 2VGXB 1TJFA 3GW4A 5KJMA 4FLHA 1KLXA 5FQ6A 2WXMA 2AW6A 2Q7FA 1H6KA 3ASDA 3QDNA 1OWLA 2AVPA 5LX8A 3D9JA 5BPPA 3IEGA 5BNWA 4JA7A 4IYPA 2AXZA 3VLEA 1SZ9A 2ILRA 3HHMA 1WAO1 3PE3A 5FZSA 3R7QA 2VSYA 2XPYA 3Q15A 4J0UA 3AS4A 5JJ7A 4UWFA 2QY7A 2A5UA 3FH7A 4G2VA 3SZ7A 5G05C 5G2NA 4ILGA 2IF4A 4WWNA 2P58C 1OUVA 2MHKA 3NZSA 3RRUA 3ZRHA 4HLEA 1X5BA 2BUGA 2FF4A 5CMYA 2J07A 2C0LA 4LCTA 3SBSA 4FA6A 4GU5A 4JA9A 2DIWA 4GYYA 3ZIMA 2I6HA 2I2OA 5BV1A 4HORA 3ASHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RIB A;  4U04 A;  4XIF A;  5FT9 A;  2KCL A;  4U0U A;  3RO3 A;  4ABN A;  3ZHE B;  4B94 A;  4BT8 A;  1ELR A;  1HZ4 A;  5KJN A;  4I9E A;  3ASH A;  3CVL A;  1NZN A;  4GCN A;  3CK7 A;  4I1A A;  4APO A;  4AY6 A;  1P5Q A;  4GYW A;  2UY1 A;  4N2Q A;  2KC7 A;  4CGV A;  4YND A;  1W3B A;  3BEE A;  3GZ1 A;  2C0M A;  4I2W A;  2PQN A;  5EX0 A;  4N3B A;  3ZPJ A;  3SF4 A;  5LCW J;  2VGY A;  3MV3 B;  5FJY A;  5CHE E;  4GZ3 A;  3AS8 A;  4H7Y A;  4AM9 A;  3GYZ A;  3VTX A;  3RKV A;  2R5S A;  2KCK A;  4NQ0 A;  3ESK A;  4N3C A;  5FZQ A;  4GZ5 A;  2XGS A;  3KS2 A;  4G23 A;  5LCW C;  3MEK A;  4U07 A;  2VQ2 A;  3CVP A;  4H7X A;  3U4T A;  3UPV A;  3ASF A;  3CK9 A;  1KT0 A;  3CKC A;  4Y6W A;  5A7D B;  2XCB A;  2UWJ G;  3S7D A;  5BT1 A;  3S7B A;  5ARG A;  2FEZ A;  1A17 A;  3TAX A;  3RU0 A;  1IHG A;  2WQH A;  2XGO A;  2PZI A;  2FO7 A;  5A6C A;  3TG4 A;  3LPZ A;  3ZN3 A;  4GYO A;  2LNI A;  5D0Q D;  3LCA A;  3KD7 A;  5KJL A;  2OND A;  3Q49 B;  4XI9 A;  3K9I A;  3E4B A;  2IFU A;  2XCC A;  3OXG A;  5DBK A;  3FFL A;  4GA1 A;  1FCH A;  3UUX A;  4JHR A;  3LY7 A;  1NA3 A;  4UQY A;  3MKR A;  1ZU2 A;  4YVQ C;  4UQX A;  3HYM B;  4GZ6 A;  4BWR A;  4UQZ A;  2FBN A;  2QFC A;  3CVQ A;  4YVO A;  5AYW D;  1ZBP A;  3CEQ A;  4KXK B;  3Q4A B;  1KT1 A;  4U0Z A;  5C1D A;  5M72 A;  5JJ6 A;  2V5F A;  2VSN A;  3PDN A;  2KAT A;  2XPI A;  3LKU A;  5G04 C;  4EQF A;  2VYI A;  3MV2 B;  4G24 A;  3VTY A;  4HOT A;  5ARF A;  2OOE A;  4GCO A;  1QQE A;  3MA5 A;  4N2S A;  5JJT A;  5FTP A;  3RJV A;  2VGX A;  5BW8 C;  4I2Z A;  4LEU A;  2WPV A;  4I9C A;  2XGM A;  4Y6C A;  3GZ2 A;  2LSU A;  4J8F A;  4CGW A;  4RG6 A;  5FZR A;  1QZ2 A;  5EX3 A;  5CCL A;  4WNF A;  3S7F A;  5CCM A;  3QWP A;  4WUY A;  3OXF A;  3QWW A;  4UI9 C;  2PQR A;  3LY9 A;  2HR2 A;  2UY1 B;  4J8E A;  4HOQ A;  3CVN A;  4G25 A;  1ELW A;  3ZHE A;  3CK8 A;  1IYG A;  3U3W A;  3CKB A;  4N5C A;  4HOU A;  3EDT B;  4GPK A;  3ASG A;  4N3A A;  1NA0 A;  3AS5 A;  3CV0 A;  1HXI A;  3ZGQ A;  3Q47 B;  1YA0 A;  4J8D A;  4AIF A;  3LYA A;  4JL0 A;  3RO2 A;  2FI7 A;  2YHC A;  4CDR A;  4GA2 A;  3ULQ A;  1PC2 A;  4G1T A;  2GW1 A;  5G04 J;  3FWV A;  1TJC A;  3JYS A;  4RG9 A;  4F3V A;  4U0S A;  3ZFW A;  4AY5 A;  2PL2 A;  3R9A B;  3NF1 A;  5HQ8 A;  3QKY A;  2Y4T A;  3KAE A;  4W9R A;  5D0O D;  3URZ A;  3OXL A;  3LY8 A;  4A1S A;  2E2E A;  3PE4 A;  5KJK A;  1B89 A;  4NRH B;  1Y8M A;  5HI7 A;  3UQ3 A;  1XNF A;  4UI9 J;  2XEV A;  4WNG A;  3N71 A;  4G26 A;  4IN3 B;  4GA0 A;  5EKQ D;  4O6F A;  4BTA A;  5DIZ A;  3Q5M A;  2LSV A;  4HOS A;  4KBQ A;  3TG5 A;  2L6J A;  4WND A;  4KYO B;  1E96 B;  2C2L A;  3O48 A;  2HYZ A;  3S7J A;  2Y4U A;  3QOU A;  2HO1 A;  4I17 A;  1HH8 A;  1WM5 A;  2KCV A;  3QWV A;  4XI0 A;  4UI9 K;  3WXX A;  2DBA A;  4WNE A;  4BT9 A;  3FP3 A;  3TGO A;  2YQ8 A;  4N39 A;  2J9Q A;  4BTB A;  2JLB A;  2NC9 A;  5G05 J;  2VGX B;  3GW4 A;  5KJM A;  1KLX A;  2Q7F A;  3ASD A;  3QDN A;  2AVP A;  3IEG A;  5BNW A;  4JA7 A;  1WAO 1;  3PE3 A;  5FZS A;  2VSY A;  3Q15 A;  4J0U A;  3AS4 A;  5JJ7 A;  4G2V A;  3SZ7 A;  5G05 C;  2IF4 A;  2P58 C;  1OUV A;  2MHK A;  2BUG A;  2FF4 A;  2C0L A;  4JA9 A;  4GYY A;  2I6H A;  4HOR A;  4ME2 A; 
#chains in the Genus database with same CATH topology
 4CT0 A;  2XHE A;  4U0U A;  3P2B A;  3ZHE B;  2L0I A;  5LOZ A;  2EIN E;  1NZN A;  4GCN A;  5KBA A;  4EEC A;  1HFA A;  2IJG X;  3ULY A;  3D9H A;  1MX4 A;  4N2Q A;  4ACK A;  1N9A A;  1G3N B;  3BEE A;  3SBT B;  3DSW A;  3UIP C;  3W9F A;  3SF4 A;  5LCW J;  3QB2 A;  5FJY A;  1N52 A;  1TN8 A;  3MZL B;  1OCZ E;  3FUL A;  2KCK A;  3QC1 A;  1D8D A;  5CBN A;  4HI9 A;  3ESK A;  4N3C A;  4GZ5 A;  2VJ8 A;  3DEP A;  1N4Q A;  3FTY A;  3KS2 A;  4G23 A;  4GTO A;  2RG8 A;  3ZU7 B;  2VGE A;  2VSO E;  3CVP A;  2LAH A;  4A3T A;  3ASF A;  5BUZ A;  3FH5 A;  3CKC A;  1IXV A;  2RFA A;  4Y6W A;  2NYJ A;  2XCB A;  3S7D A;  5BT1 A;  4JC8 A;  3ZKJ A;  4TV3 A;  2FEZ A;  1A17 A;  4B8A A;  3RU0 A;  2WQH A;  3FUJ A;  2AXU A;  3G2S A;  3PRZ A;  3TG4 A;  3T5X A;  3FUD A;  1K1A A;  2IU1 A;  2F8Y A;  2J4B A;  2OND A;  2WXN A;  4XI9 A;  2IFU A;  3IKO B;  3OXG A;  4XKB A;  4DI3 A;  1FCH A;  3ZYL A;  2XQ0 A;  4UQY A;  3AJI A;  1NI1 A;  4UQX A;  1MQS A;  3AU4 A;  3TWX A;  4WAF A;  2FBN A;  3RSE G;  1TN6 A;  1FVH A;  1E8W A;  2RKK A;  4LNU D;  4L23 A;  2V8S E;  3UIN C;  1S63 A;  4CRW A;  3APD A;  5M72 A;  4HXI A;  3RK6 A;  2PNN A;  4GPM A;  4AJW A;  5J90 A;  2V5F A;  1HE8 A;  4L2L A;  1QNF A;  3PDN A;  3TWU A;  1KPS B;  3ZVV A;  3MV2 B;  5ARF A;  2ZGG A;  3UT8 A;  1SA5 A;  3J5P A;  3DSU A;  3EHN A;  3L6A A;  2XEN A;  3PEV B;  4F6R D;  3NOC D;  3GZS A;  1OT8 A;  4HS2 A;  2BKG A;  3SFZ A;  3FUN A;  3GZ2 A;  5CED B;  4KZC A;  2X6J A;  3CHR A;  3APF A;  1OXJ A;  1HG2 A;  3E34 A;  4C48 B;  4KT6 B;  1E90 A;  5CCL A;  1HO8 A;  3JXJ A;  2V0P A;  3T8M A;  3CQG B;  2VSX E;  1K8K G;  4OVU A;  1KZO A;  3OXF A;  3EU5 A;  1KZP A;  2PQR A;  2GRO B;  2HR2 A;  4KVO A;  3ASN E;  3FU0 A;  4HOQ A;  1OCC E;  4HRN A;  2LO6 A;  3AG1 E;  5AQ7 A;  5CEA A;  1TR4 A;  4LUN U;  5ENS D;  1U3D A;  4G25 A;  4Q96 A;  1ELW A;  3CK8 A;  1JCQ A;  4GMR A;  2ZXW E;  3EDT B;  2DYR E;  3CHM A;  2IEJ A;  1MYO A;  4J6I A;  2WMO A;  3TWV A;  1L5J A;  4BY6 A;  3L08 A;  4L9P A;  4NUR A;  4AOF A;  4J8D A;  4UWK A;  4JL0 A;  5JHA A;  1WY6 A;  5CBO A;  4TXR A;  2X6H A;  4G1T A;  3I3N A;  5G04 J;  3DST A;  3SD5 A;  4R7L A;  4RG9 A;  4F3V A;  3EHM A;  4U0S A;  3HXE A;  3ZFW A;  4OYS A;  2EIK E;  3FEX A;  4DLO A;  2PL2 A;  5EDS A;  2WQ6 A;  5AN8 A;  4Q69 A;  5HQ8 A;  5EN5 D;  3CVW A;  3JUI A;  4O60 A;  5ANL A;  5D0O D;  3ML8 A;  3URZ A;  3TWW A;  4MBG A;  4A1G A;  4GB9 A;  5G55 A;  1B89 A;  3MYV A;  3DWL G;  5FIO A;  4EZK A;  2ZU6 B;  5BV0 A;  3HVE B;  3CQC B;  3F6Q A;  1Y8M A;  5ITZ F;  4RQI A;  5HI7 A;  3UQ3 A;  4DX6 D;  4UI9 J;  1SQM A;  4JEU A;  3FU3 A;  2DWZ A;  2I1K A;  4XKC A;  4G26 A;  4IN3 B;  5DIZ A;  3PZ3 A;  4HOS A;  3CSF A;  3ENE A;  2GRR B;  3PZD A;  4KBQ A;  2L6J A;  4L2Y A;  3IHY A;  1QBQ A;  4KYO B;  2JEK A;  4GTM A;  2BED A;  4A3V A;  3UKU G;  5CER B;  1JPL A;  5CMW A;  1N4S A;  5JHB A;  4GML A;  3DEO A;  2L9B A;  2HYZ A;  3UTM A;  2Y4U A;  3FHE A;  3IXE A;  2MYO A;  3B13 A;  4L1B A;  3DSV A;  4U8V D;  1NFI E;  3UKR G;  3AAA C;  1TNU A;  2DBA A;  1WDY A;  4WNE A;  3D9P A;  3PUJ A;  2XEH A;  3ZUV B;  3FP3 A;  3BG1 B;  5A23 A;  4HI8 A;  2YQ8 A;  4N39 A;  4DX5 D;  4CT4 A;  1H6K A;  4IYP A;  4UWF A;  4G2V A;  4ILG A;  3JXI A;  3V2X A;  2MHK A;  3RRU A;  3ZRH A;  2FF4 A;  5CMY A;  3SY2 A;  3WG7 E;  4LCT A;  3SBS A;  3DXK G;  3ZIM A;  3FDH A;  3ASH A;  3W9G A;  4XIF A;  5FT9 A;  2KCL A;  4BT8 A;  3PZ2 A;  1ELR A;  4I9E A;  4GZC A;  3EHR A;  3RAU A;  4PH4 B;  2X6I A;  4IRU A;  2KZT B;  4K03 A;  3B7R L;  4GTS A;  4AY6 A;  3OAW A;  5BXO A;  1TYQ G;  2L0T B;  4K5B A;  2KC7 A;  1W3B A;  3GZ1 A;  4AVX A;  1PY1 A;  2PQN A;  4OAU C;  4HLL A;  3EIJ A;  3ZPJ A;  4APF A;  2VGY A;  5FQ7 A;  5CHE E;  4JZY A;  4GZ3 A;  4FC8 A;  4LNB A;  4BES A;  3VTX A;  4KZ0 A;  3EU9 A;  4ANU A;  2V4L A;  3HXF A;  1BLX B;  4UWL A;  4C0E A;  3ZYK A;  4UWG A;  4CCA A;  2R03 A;  3UM3 A;  3RRM B;  4U96 D;  2QYU A;  4FHJ A;  4PS3 A;  2X6K A;  4U07 A;  4CDM A;  1E8X A;  4H7X A;  2WXL A;  3AG4 E;  3V30 A;  3HRA A;  4PUC A;  1KT0 A;  4BSZ B;  2WXP A;  2V5Q C;  4GZD A;  3APC A;  4FJZ A;  2DZO A;  3TWT A;  3FY4 A;  2AXV A;  5ARG A;  3FU6 A;  3SO8 A;  4FUL A;  1S64 A;  4XZ4 A;  1LF8 A;  1D8E A;  3KSQ A;  4ILH B;  1YCS B;  3IHV A;  4YDO A;  3FUM A;  4ZFH A;  2FO7 A;  1H2U A;  4F1S A;  2ZIR A;  3CST A;  2BTD A;  4UUC A;  4FLB A;  2Y3A A;  3PH0 C;  3FUE A;  5KJL A;  3PNT B;  3TWR A;  3K9I A;  3E4B A;  3NB2 A;  4AEZ C;  2J49 A;  4IUL A;  3QNK A;  5DBK A;  4DUI A;  1N0R A;  3Q9U C;  4JHR A;  3HYM B;  2QFC A;  3CVQ A;  1MX2 A;  5ENO D;  3CEQ A;  4A63 B;  4EZL A;  1OCO E;  3DRA A;  3UM2 A;  3EIQ C;  5JJ6 A;  3TJP A;  4UWH A;  3LKU A;  4I6E A;  5G04 C;  4ANX A;  4EQF A;  2VYI A;  4XX5 A;  4U95 D;  1HU3 A;  4G24 A;  3VTY A;  3NAW A;  4ANV A;  3ZXS A;  1QQE A;  4QFV A;  3E32 A;  3ASO E;  5JJT A;  2J08 A;  5BXU A;  4CZ2 D;  4LEU A;  4LER A;  2WB2 A;  2DCP A;  2H6I A;  3ABL E;  2IOS A;  1SZA A;  4TUM A;  3D9I A;  4WNF A;  3Q73 A;  5CCM A;  3QWP A;  2Y1L E;  1X81 A;  2Y0B G;  1N54 A;  1RW2 A;  4UI9 C;  3CIA A;  3LY9 A;  2UY1 B;  1TNZ A;  2I9C A;  5D66 A;  3MGB A;  4JW1 A;  2FUL A;  3LVQ E;  3ZHE A;  5EID A;  4WWO A;  1U3C A;  3CVY A;  4HOU A;  3FUK A;  5JA4 D;  4MRU A;  1DVP A;  4EBA A;  4BX8 A;  5AEN A;  3IV0 A;  3V79 K;  1OY3 D;  3NQP A;  4GTP A;  4CYM D;  1JCR A;  1ELK A;  3LYA A;  1HS6 A;  1JWF A;  2R59 A;  3D9K A;  2GRM A;  2QC9 A;  2FI7 A;  2X6F A;  4CDR A;  4GA2 A;  1PC2 A;  3Q78 A;  5AQ9 A;  3D9N A;  4ANW A;  1H0A A;  3LXU X;  2EIL E;  2WXF A;  5ANR A;  3VLF A;  3JCK C;  4XE0 A;  3PUK A;  3NF1 A;  5E75 A;  2AJA A;  3QJZ A;  4N5Q A;  4W9R A;  4A1S A;  2YNQ A;  3ZW3 A;  1BPO A;  5J08 A;  5KJK A;  3FU5 A;  4NRH B;  4KMO A;  2EQX A;  1MHQ A;  3MCX A;  5LP0 A;  4DRX E;  4WNG A;  2ZIS A;  1K3Z D;  4BEP A;  1TNB A;  2IY0 C;  3N71 A;  2LXM A;  5EKQ D;  3PVL A;  4O6F A;  5AQA A;  3Q9N C;  1OWM A;  4TXQ A;  2WXR A;  1E96 B;  2R2L A;  2NSZ A;  1IQU A;  1EPU A;  2XRZ A;  3CGH A;  2P9P G;  3NOG D;  2HM8 A;  4ACL A;  2HO1 A;  5JMN D;  4I17 A;  2KXP C;  3QWV A;  1EDU A;  2PM6 A;  2F0Y A;  4O1P A;  4LG6 A;  4QQI A;  4Z68 A;  1FT2 A;  3FTV A;  4NAC A;  3Q7A A;  4BTB A;  2JLB A;  2NC9 A;  2VGX B;  4GTR A;  4X8Q A;  4HRM B;  4FLH A;  2B0O E;  3C3R A;  2AW6 A;  2Q7F A;  3QDN A;  5LX8 A;  3ISM C;  2AXZ A;  5D2M C;  4K5C A;  1WAO 1;  1BI7 B;  4TXP A;  2P9I G;  5FZS A;  3AG2 E;  3R7Q A;  2XPY A;  3UM0 A;  5JJ7 A;  2QY7 A;  2A5U A;  3SZ7 A;  5G05 C;  2LXL A;  4WWN A;  1SW6 A;  4U8Y D;  2I6H A;  5BV1 A;  4ME2 A;  1D9S A;  4YDE A;  4U04 A;  4DPR A;  3R7R A;  5KWD A;  5KJN A;  5EYP F;  4EHM A;  3CVL A;  2IO2 C;  4ATZ D;  2H6G A;  4I1A A;  1Z3X A;  5EIL A;  2R02 A;  1IQR A;  4APO A;  1P5Q A;  1U2V G;  2M63 A;  4YND A;  4I2W A;  5EX0 A;  4N3B A;  2CG3 A;  4FJY A;  4U8H A;  4NIK A;  3D9M A;  5H7P A;  4TUU A;  4HBD A;  4URK A;  3AS8 A;  3ULE G;  4AM9 A;  3GYZ A;  3MKQ B;  3RKV A;  2XZD G;  4NQ0 A;  3D9O A;  2CFU A;  3SI5 A;  3R9M A;  2VTB B;  2XGS A;  4JD2 G;  4GAA A;  4DLQ A;  5LCW C;  3G2W A;  1BU9 A;  4LRZ A;  5AQB A;  5AJL A;  4B8C B;  2HE0 A;  5A7D B;  2AWI A;  2UWJ G;  2WMN A;  5AAO A;  3E30 A;  5EIB E;  3TAX A;  4JPS A;  3L13 A;  1IKN D;  1UOH A;  2XPZ A;  3CLJ A;  3O4Z A;  2ETC A;  2J09 A;  4M3O A;  4WWP A;  5ENQ D;  3MX3 A;  3SFX A;  4I1O B;  3UM1 A;  2GGF A;  3LPZ A;  3ZN3 A;  4PS8 A;  1E8Z A;  3HG0 D;  4B89 A;  3DPD A;  4HVB A;  3QAQ A;  3Q49 B;  3HVE A;  2YIN A;  4K5A B;  1UG3 A;  4BFR A;  3FFL A;  3ONL A;  4FHK A;  2H6F A;  4MS6 A;  4EZJ A;  2LAI A;  4ATG A;  3LY7 A;  1ZU2 A;  2P9S G;  4RSY A;  3MJW A;  4GZ6 A;  3UI2 A;  4BWR A;  4UQZ A;  2XS8 A;  5AAR A;  4YVO A;  2EIJ E;  4MKT A;  1ZBP A;  5EYL A;  1JUQ A;  3Q4A B;  1KT1 A;  4O1O A;  1S70 B;  3G2V A;  4A55 A;  5C1D A;  4J8S A;  2VSN A;  3KSL A;  3B95 A;  3J5Q B;  1LD8 A;  2F37 A;  2X3M A;  3U66 A;  4HOT A;  2OOE A;  3CHS A;  3DSS A;  2J8S D;  3C3O A;  3LJ3 A;  5C2Y A;  4N2S A;  3LDZ A;  5FTP A;  3BU8 A;  1TNO A;  3FUF A;  5BW8 C;  4I2Z A;  4EBA G;  1H2V C;  3B7U X;  1N11 A;  2WPV A;  4I9C A;  4GMJ A;  3SQV A;  3QK0 A;  4KVM A;  4J8F A;  4CGW A;  5CRU A;  4RG6 A;  2V4H C;  3C98 A;  5FZR A;  5EX3 A;  5T4Y A;  1QZ2 A;  2WXQ A;  3FEY A;  3RRN B;  4WUY A;  3ZYM A;  4HB5 A;  1JWG A;  1WG0 A;  3FTS A;  2J4D A;  2WXI A;  4HNA D;  3L22 A;  1H6O A;  3TL5 A;  3ZNG A;  4AXH A;  1IYG A;  3U3W A;  3P1U A;  4GPK A;  2KZT A;  4HQD A;  1S0P A;  2WQ7 A;  3FTX A;  1NA0 A;  3L54 A;  1O1S A;  4D10 C;  3CV0 A;  1HXI A;  1AP7 A;  1UJK A;  3CHO A;  3JQ0 A;  3I4R B;  1N94 A;  3PEU B;  3IBE A;  2YHC A;  1JCS A;  4ZHB A;  3ULQ A;  3OTN A;  1FT1 A;  3FWV A;  3TXM A;  1TJC A;  2KBX A;  4F53 A;  2ETB A;  2OEW A;  2CHX A;  2R17 C;  1V54 E;  4U63 A;  2R05 A;  5ENR D;  3R9A B;  3QKY A;  2Y4T A;  1OWN A;  4RVB A;  3X2Q E;  2IQC A;  3OXL A;  3LY8 A;  1E7U A;  2P9N G;  1UN9 A;  2P9U G;  3PZ1 A;  4LSZ E;  3PE4 A;  3LS8 A;  4BER A;  3U9W A;  1HF8 A;  4HRL A;  1ZB1 A;  1Z3Y A;  3Q79 A;  5ENP D;  3KEA A;  2XRY A;  1XNF A;  4FAD A;  5FQ8 A;  1DCE A;  4OVV A;  2WXH A;  3SHF A;  4GA0 A;  2OEV A;  1Q2Z A;  4BTA A;  2IOL A;  3Q5M A;  2LSV A;  2KM4 A;  2XS1 A;  3TG5 A;  2XZT G;  4WND A;  3D3M A;  3KEZ A;  2C2L A;  5KCM A;  3S7J A;  2P2C P;  3PZ4 A;  4Q94 A;  3DBS A;  2CFZ A;  1HH8 A;  4I43 A;  4DX1 A;  3DSX A;  2GRL A;  3L82 A;  5T8I A;  1YMP A;  4XEI G;  4J7W A;  3FUH A;  3L17 A;  2IO3 C;  2QZA A;  5B1A E;  3TGO A;  5AIJ A;  1QYM A;  2J9Q A;  3Q7F A;  3CVU A;  4GTT A;  2XEE A;  1KLX A;  3E33 A;  3ASD A;  1OWL A;  3IEG A;  3VLE A;  2B6C A;  2RFM A;  4J0U A;  3AS4 A;  3BQO A;  3E37 A;  3NZS A;  4HLE A;  1Z5S C;  2J07 A;  4GU5 A;  4JA9 A;  4GYY A;  3C72 A;  2I2O A;  4HOR A;  5AJD A;  1XGW A;  5KNH D;  3SNX A;  3RIB A;  3RO3 A;  4ABN A;  4B94 A;  1HZ4 A;  1H2T C;  4PS7 A;  5FQ4 A;  5B1B E;  4CDN A;  4J8Y A;  3CK7 A;  4DX2 A;  3ESL A;  3G2U A;  4GYW A;  1EYH A;  2UY1 A;  2BF0 X;  5T3R A;  3PS6 A;  3ZYQ A;  4CGV A;  5FWQ A;  2WXO A;  2C0M A;  1OWO A;  2RD0 A;  4U7E B;  2Y69 E;  1NP7 A;  3MV3 B;  2CHW A;  4B0Z A;  2H6H A;  4H7Y A;  1Z6T A;  3LJN A;  4B93 B;  2R5S A;  1FPP A;  2DVW A;  5FZQ A;  3CVV A;  4JHK A;  3UX4 A;  4G8K A;  3PNL B;  1O5M A;  3MEK A;  3UIO C;  2VQ2 A;  3HXD A;  3U4T A;  3UPV A;  3CK9 A;  1OWP A;  4AV7 A;  1LTX A;  3LVR E;  4OAV B;  4FU3 A;  2ETA A;  4JEH A;  3S7B A;  2WM9 A;  3G2T A;  4GTQ A;  1HX8 A;  3TXN A;  1N0Q A;  1E8Y A;  4P29 A;  1IHG A;  3B7T A;  1EF1 C;  5HKP A;  2OV8 A;  2XGO A;  3U64 A;  2PZI A;  5A6C A;  2LUH A;  3HDX A;  4GYO A;  2LNI A;  5D0Q D;  2EIM E;  2NXP A;  3LCA A;  2FO1 E;  3ONK A;  1DNP A;  4BET A;  3CHQ A;  3KD7 A;  1TEZ A;  3AU5 A;  5IY5 E;  4BSX A;  3FTU A;  3HXB A;  3TWS A;  4F1P A;  2XCC A;  3FH8 A;  3CHP A;  2I1J A;  4GA1 A;  4DJA A;  3UUX A;  1NA3 A;  2YHE A;  3MKR A;  4YVQ C;  3DPY A;  4FP7 A;  3HXC A;  1O1R A;  4LNG A;  5AYW D;  2E0I A;  4HFG A;  5HRY A;  2L6B A;  4KXK B;  3I5P A;  4U0Z A;  4F7A A;  3NBN B;  3ZEF A;  1BI8 B;  1OCR E;  2KAT A;  2XPI A;  4C0M A;  3EHQ A;  4GCO A;  3L16 A;  4JXT A;  1Y6I A;  2WXK A;  1GW6 A;  3MA5 A;  3DXM G;  3QAR A;  3RJV A;  2VGX A;  4RLY A;  1AWC B;  1NL4 A;  1H6P A;  3C5R A;  2XGM A;  4Y6C A;  1TNY A;  3BUA A;  2LSU A;  5CRV A;  4L7T A;  1BD8 A;  2A5E A;  4DX7 D;  3S7F A;  1UN8 A;  2GRN B;  1YYH A;  2ZGD A;  4CEM A;  3FTW A;  3QWW A;  1H19 A;  3FTZ A;  2X38 A;  4PDX A;  2OVF A;  4J8E A;  2MOW A;  3I4G A;  4EPZ A;  3CVN A;  3AG3 E;  4K0R A;  4YDW A;  2ION A;  4BX9 A;  1INZ A;  2WXG A;  1O1T A;  3CKB A;  4N5C A;  2F8X K;  1FVF A;  3ASG A;  4DI4 A;  4JVS A;  1IHB A;  1V55 E;  3UXG A;  3EJN A;  1PAQ A;  4G8L A;  4N3A A;  2OVB A;  1HG5 A;  3B7B A;  3AS5 A;  1UW4 B;  3ABM E;  3ZGQ A;  3Q47 B;  1YA0 A;  2PM7 A;  4AIF A;  4C9B B;  1RZ4 A;  5FIN A;  3RO2 A;  5LFA A;  3Q75 A;  3MKQ A;  3PRE A;  2GW1 A;  1K1B A;  3B7S A;  4G11 A;  4I6J A;  4ILI A;  2VTB A;  3JYS A;  3CVX A;  1E7V A;  3C3Q A;  4JHJ A;  1SA4 A;  2MRI A;  4AY5 A;  5ENT D;  3KAE A;  4YDY A;  3V2O A;  3SFY A;  2DYS E;  2E2E A;  2WXJ A;  2JAB A;  3ML9 A;  4I1M A;  3S2A A;  4GTV A;  4E6H A;  2P9K G;  2A4Z A;  2CHZ A;  3FUI A;  2XEV A;  1VDY A;  3ZXP A;  3JQ1 A;  1UJJ A;  4E85 A;  4I6G A;  4TRQ A;  2CG2 A;  4JB8 P;  5KNG A;  5B3S E;  1MX6 A;  4MLP A;  3UMV A;  1N4P A;  5ENN A;  3CR3 A;  1N95 A;  3EUV A;  4V3I A;  3NZU A;  3O48 A;  5E76 A;  3UT7 A;  3D9L A;  1N4R A;  3QOU A;  1DCQ A;  3HIZ A;  4DK5 A;  1WM5 A;  3SGH A;  2KCV A;  2P9L G;  4XI0 A;  5CEC B;  4UI9 K;  3T5V A;  3WXX A;  3TWQ A;  3BG0 B;  4M7C A;  1SVX A;  1DC2 A;  3VLD A;  4BT9 A;  1TN7 A;  2WVI A;  4AP2 A;  3JUE A;  3UT4 A;  1MJ0 A;  3V31 A;  3T8K A;  5G05 J;  1A5E A;  1TJF A;  3GW4 A;  5KJM A;  5FQ6 A;  2WXM A;  2AVP A;  3D9J A;  5BPP A;  5BNW A;  4JA7 A;  3ABK E;  1SZ9 A;  2ILR A;  3HHM A;  3PE3 A;  2VSY A;  3Q15 A;  2GRQ B;  2QYJ A;  3FH7 A;  2OCC E;  5G2N A;  2IF4 A;  2GRP B;  2P58 C;  2DZN A;  1OUV A;  1LD7 A;  3L9T A;  1X5B A;  2BUG A;  5HS0 A;  1MZC A;  2C0L A;  4FA6 A;  3T9K A;  2BKK B;  2DIW A;  3LEW A; 
#chains in the Genus database with same CATH homology
 5AJD A;  1XGW A;  4CT0 A;  3SNX A;  3RIB A;  4U04 A;  4XIF A;  2XHE A;  5FT9 A;  4DPR A;  2KCL A;  4U0U A;  3R7R A;  3RO3 A;  4ABN A;  3P2B A;  3ZHE B;  4B94 A;  2L0I A;  4BT8 A;  1ELR A;  1HZ4 A;  5KJN A;  4I9E A;  1H2T C;  4GZC A;  4PS7 A;  5FQ4 A;  4PH4 B;  5LOZ A;  4CDN A;  2X6I A;  3CVL A;  1NZN A;  4GCN A;  4IRU A;  2KZT B;  4K03 A;  3CK7 A;  3B7R L;  4EEC A;  4I1A A;  1Z3X A;  1IQR A;  1HFA A;  2IJG X;  4APO A;  4AY6 A;  3ESL A;  1P5Q A;  3G2U A;  3OAW A;  4GYW A;  1EYH A;  2L0T B;  2UY1 A;  4ME2 A;  2BF0 X;  5T3R A;  4N2Q A;  2KC7 A;  2M63 A;  3PS6 A;  3ZYQ A;  4YND A;  4ACK A;  4CGV A;  1W3B A;  5FWQ A;  2WXO A;  3BEE A;  3GZ1 A;  2C0M A;  4AVX A;  1PY1 A;  4I2W A;  1OWO A;  2PQN A;  2RD0 A;  5EX0 A;  4N3B A;  2CG3 A;  3SBT B;  3EIJ A;  3ZPJ A;  3SF4 A;  4APF A;  3QB2 A;  5LCW J;  4FJY A;  2VGY A;  1NP7 A;  4U8H A;  3D9M A;  3MV3 B;  5FQ7 A;  2CHW A;  5CHE E;  5FJY A;  1N52 A;  4GZ3 A;  3MZL B;  4FC8 A;  4JZY A;  4TUU A;  3AS8 A;  4B0Z A;  4URK A;  4H7Y A;  4AM9 A;  1Z6T A;  3GYZ A;  3VTX A;  4KZ0 A;  3MKQ B;  3RKV A;  2R5S A;  4ANU A;  3FUL A;  2V4L A;  2KCK A;  4NQ0 A;  3D9O A;  3QC1 A;  4UWL A;  2CFU A;  4C0E A;  3ZYK A;  3SI5 A;  4UWG A;  3ESK A;  4N3C A;  5FZQ A;  4CCA A;  4GZ5 A;  2XGS A;  2VTB B;  4JHK A;  2VJ8 A;  3UX4 A;  4GAA A;  3FTY A;  3RRM B;  3PNL B;  3KS2 A;  4G23 A;  4DLQ A;  5LCW C;  3MEK A;  4FHJ A;  2RG8 A;  4PS3 A;  2X6K A;  4U07 A;  3G2W A;  4CDM A;  2VSO E;  1E8X A;  2VQ2 A;  3CVP A;  2WXL A;  4H7X A;  3U4T A;  4LRZ A;  3UPV A;  2LAH A;  4PUC A;  4A3T A;  3ASF A;  3CK9 A;  5BUZ A;  1KT0 A;  3FH5 A;  5AJL A;  3CKC A;  1OWP A;  4B8C B;  4AV7 A;  4Y6W A;  2WXP A;  3LVR E;  4FU3 A;  4GZD A;  5A7D B;  2AWI A;  2XCB A;  2UWJ G;  3S7D A;  2WMN A;  5BT1 A;  4JEH A;  3APC A;  4FJZ A;  4JC8 A;  3S7B A;  2WM9 A;  3FY4 A;  2AXV A;  5ARG A;  3G2T A;  3FU6 A;  2FEZ A;  4TV3 A;  1HX8 A;  1A17 A;  4B8A A;  4FUL A;  3TAX A;  4XZ4 A;  3TXN A;  4JPS A;  1E8Y A;  3RU0 A;  3L13 A;  4P29 A;  1LF8 A;  1IHG A;  2WQH A;  2XPZ A;  3CLJ A;  3B7T A;  1EF1 C;  2OV8 A;  4ILH B;  3FUJ A;  2AXU A;  3IHV A;  2XGO A;  3O4Z A;  2J09 A;  4M3O A;  3U64 A;  4WWP A;  3G2S A;  3MX3 A;  3PRZ A;  4I1O B;  3FUM A;  2PZI A;  2FO7 A;  5A6C A;  3TG4 A;  2GGF A;  1H2U A;  3LPZ A;  3FUD A;  3T5X A;  4F1S A;  3HDX A;  3ZN3 A;  4PS8 A;  1E8Z A;  3CST A;  4GYO A;  2LNI A;  2BTD A;  2NXP A;  3LCA A;  5D0Q D;  4B89 A;  3DPD A;  4FLB A;  3ONK A;  4HVB A;  1DNP A;  2IU1 A;  3CHQ A;  2Y3A A;  3KD7 A;  3PH0 C;  3FUE A;  5KJL A;  2J4B A;  2OND A;  3QAQ A;  1TEZ A;  3AU5 A;  3Q49 B;  3PNT B;  4BSX A;  2WXN A;  3FTU A;  3HVE A;  4XI9 A;  3K9I A;  3E4B A;  2IFU A;  4AEZ C;  2XCC A;  2YIN A;  3IKO B;  3OXG A;  2J49 A;  4IUL A;  3FH8 A;  1UG3 A;  3CHP A;  3QNK A;  4XKB A;  5DBK A;  4BFR A;  4DI3 A;  3FFL A;  3ONL A;  2I1J A;  4FHK A;  4GA1 A;  1FCH A;  4MS6 A;  4EZJ A;  3ZYL A;  4DJA A;  2XQ0 A;  2LAI A;  3UUX A;  4JHR A;  1NA3 A;  2YHE A;  3LY7 A;  3MKR A;  1ZU2 A;  4UQY A;  4ATG A;  4YVQ C;  4UQX A;  4FP7 A;  4RSY A;  1MQS A;  3HYM B;  3AU4 A;  3MJW A;  4GZ6 A;  4BWR A;  4UQZ A;  4WAF A;  2FBN A;  2QFC A;  3CVQ A;  4YVO A;  5AYW D;  1FVH A;  1E8W A;  4MKT A;  2E0I A;  2V8S E;  4L23 A;  1ZBP A;  3CEQ A;  4HFG A;  1JUQ A;  4KXK B;  4EZL A;  3Q4A B;  1KT1 A;  3I5P A;  4CRW A;  3APD A;  4U0Z A;  4F7A A;  3EIQ C;  3G2V A;  4A55 A;  5C1D A;  5JJ6 A;  5M72 A;  4HXI A;  3RK6 A;  4AJW A;  5J90 A;  3TJP A;  2V5F A;  3ZEF A;  4J8S A;  1HE8 A;  2VSN A;  4L2L A;  4UWH A;  1QNF A;  3PDN A;  2KAT A;  2XPI A;  3LKU A;  4I6E A;  5G04 C;  3ZVV A;  4ANX A;  2VYI A;  4XX5 A;  3MV2 B;  4EQF A;  1HU3 A;  4G24 A;  3VTY A;  4C0M A;  2X3M A;  4ANV A;  5ARF A;  3U66 A;  4HOT A;  3UT8 A;  3ZXS A;  2OOE A;  3CHS A;  4GCO A;  1QQE A;  3L16 A;  4JXT A;  3EHN A;  3L6A A;  4QFV A;  3LJ3 A;  1Y6I A;  5C2Y A;  2WXK A;  1GW6 A;  3LDZ A;  3MA5 A;  4N2S A;  5JJT A;  2J08 A;  5FTP A;  3QAR A;  3FUF A;  3RJV A;  2VGX A;  3PEV B;  5BW8 C;  4I2Z A;  4LEU A;  1H2V C;  3GZS A;  4EBA G;  3B7U X;  4LER A;  2WPV A;  4HS2 A;  4I9C A;  2XGM A;  4GMJ A;  4Y6C A;  2WB2 A;  2DCP A;  3SFZ A;  3QK0 A;  3FUN A;  3GZ2 A;  4KVM A;  4KZC A;  2LSU A;  4J8F A;  2X6J A;  4CGW A;  3CVV A;  3CHR A;  3APF A;  1HG2 A;  4L7T A;  4RG6 A;  3C98 A;  5FZR A;  1QZ2 A;  1E90 A;  4KT6 B;  2IOS A;  2WXQ A;  5EX3 A;  1HO8 A;  1SZA A;  5T4Y A;  2V0P A;  5CCL A;  3D9I A;  3T8M A;  3FEY A;  3CQG B;  4WNF A;  3S7F A;  2VSX E;  1UN8 A;  5CCM A;  3QWP A;  3RRN B;  4OVU A;  4WUY A;  3OXF A;  3ZYM A;  4CEM A;  1JWG A;  3FTW A;  1N54 A;  3QWW A;  4UI9 C;  1H19 A;  3FTS A;  2PQR A;  3FTZ A;  3CIA A;  2X38 A;  4PDX A;  2OVF A;  3LY9 A;  2HR2 A;  2UY1 B;  4KVO A;  4J8E A;  2MOW A;  3I4G A;  2J4D A;  2I9C A;  4EPZ A;  3FU0 A;  2WXI A;  4HOQ A;  2LO6 A;  3L22 A;  3CVN A;  3MGB A;  4LUN U;  3TL5 A;  1U3D A;  4JW1 A;  2FUL A;  4G25 A;  3LVQ E;  4Q96 A;  1ELW A;  3ZHE A;  3CK8 A;  4K0R A;  4AXH A;  2ION A;  4WWO A;  4BX9 A;  1INZ A;  1IYG A;  2WXG A;  1U3C A;  3CVY A;  3U3W A;  3P1U A;  3CKB A;  4N5C A;  4HOU A;  3EDT B;  1FVF A;  2KZT A;  4GPK A;  3ASG A;  4DI4 A;  3FUK A;  4JVS A;  4MRU A;  1DVP A;  4EBA A;  3CHM A;  4BX8 A;  4J6I A;  1S0P A;  2WQ7 A;  3EJN A;  2WMO A;  1PAQ A;  3IV0 A;  5AEN A;  4N3A A;  3FTX A;  2OVB A;  1L5J A;  1NA0 A;  1HG5 A;  4BY6 A;  3L08 A;  3L54 A;  3AS5 A;  3NQP A;  4NUR A;  1UW4 B;  4D10 C;  3CV0 A;  1HXI A;  3ZGQ A;  4AOF A;  3Q47 B;  1YA0 A;  1UJK A;  1ELK A;  3LEW A;  4J8D A;  4UWK A;  2PM7 A;  4AIF A;  3CHO A;  3LYA A;  4JL0 A;  4C9B B;  5JHA A;  1HS6 A;  1JWF A;  2R59 A;  3I4R B;  3JQ0 A;  1WY6 A;  3D9K A;  3RO2 A;  3PEU B;  5LFA A;  3IBE A;  2GRM A;  2FI7 A;  2X6F A;  2YHC A;  4CDR A;  4GA2 A;  2X6H A;  3ULQ A;  3MKQ A;  1PC2 A;  3PRE A;  4G1T A;  2GW1 A;  3I3N A;  3OTN A;  5G04 J;  3FWV A;  3B7S A;  3D9N A;  4G11 A;  3TXM A;  4ANW A;  1TJC A;  4F53 A;  4I6J A;  3SD5 A;  4ILI A;  4R7L A;  1H0A A;  2VTB A;  3JYS A;  4RG9 A;  3CVX A;  3LXU X;  1E7V A;  4F3V A;  2CHX A;  3EHM A;  2R17 C;  4JHJ A;  4U0S A;  2WXF A;  2MRI A;  4U63 A;  3JCK C;  5ANR A;  3VLF A;  3ZFW A;  4OYS A;  3FEX A;  4XE0 A;  4DLO A;  3PUK A;  4AY5 A;  2PL2 A;  5EDS A;  2WQ6 A;  3R9A B;  3NF1 A;  4Q69 A;  5E75 A;  5HQ8 A;  3QKY A;  2Y4T A;  1OWN A;  3QJZ A;  3JUI A;  3KAE A;  5ANL A;  3CVW A;  4W9R A;  5D0O D;  3ML8 A;  4RVB A;  2IQC A;  3URZ A;  3OXL A;  3LY8 A;  4A1S A;  1E7U A;  2E2E A;  2YNQ A;  3ZW3 A;  2WXJ A;  1UN9 A;  1BPO A;  3ML9 A;  4I1M A;  4GB9 A;  4A1G A;  5J08 A;  3PE4 A;  5G55 A;  3S2A A;  3FU5 A;  1B89 A;  4NRH B;  5KJK A;  3LS8 A;  4KMO A;  3MYV A;  4EZK A;  3U9W A;  2ZU6 B;  5BV0 A;  4E6H A;  1HF8 A;  2EQX A;  3HVE B;  1MHQ A;  3CQC B;  3MCX A;  1Y8M A;  2A4Z A;  1Z3Y A;  2CHZ A;  5HI7 A;  3UQ3 A;  2XRY A;  1XNF A;  3FUI A;  2XEV A;  4UI9 J;  1VDY A;  5LP0 A;  3FDH A;  4WNG A;  4FAD A;  3JQ1 A;  1UJJ A;  5FQ8 A;  1SQM A;  4JEU A;  4E85 A;  4I6G A;  4OVV A;  4TRQ A;  2CG2 A;  3FU3 A;  2I1K A;  3N71 A;  4XKC A;  2WXH A;  3SHF A;  4G26 A;  4IN3 B;  4MLP A;  4GA0 A;  5EKQ D;  3PVL A;  4O6F A;  4BTA A;  2IOL A;  5DIZ A;  3Q5M A;  2LSV A;  2KM4 A;  4HOS A;  3CSF A;  3ENE A;  3UMV A;  3PZD A;  4KBQ A;  3TG5 A;  2L6J A;  5ENN A;  1OWM A;  4WND A;  3CR3 A;  4L2Y A;  3IHY A;  4KYO B;  2JEK A;  2WXR A;  4V3I A;  3D3M A;  3KEZ A;  4A3V A;  3NZU A;  1E96 B;  1JPL A;  2C2L A;  5CMW A;  3O48 A;  5JHB A;  2NSZ A;  4GML A;  5E76 A;  2L9B A;  1IQU A;  1EPU A;  2HYZ A;  5KCM A;  3CGH A;  2XRZ A;  3S7J A;  2Y4U A;  3FHE A;  2HM8 A;  3D9L A;  3UT7 A;  4ACL A;  3QOU A;  3B13 A;  4Q94 A;  2HO1 A;  3HIZ A;  4L1B A;  3DBS A;  2CFZ A;  4I17 A;  1HH8 A;  1WM5 A;  4I43 A;  3SGH A;  4DK5 A;  2KCV A;  3QWV A;  1EDU A;  4XI0 A;  2GRL A;  2PM6 A;  5T8I A;  4UI9 K;  3T5V A;  3WXX A;  2DBA A;  3BG0 B;  4WNE A;  3D9P A;  3PUJ A;  3VLD A;  4BT9 A;  3FTV A;  4NAC A;  3FP3 A;  3FUH A;  3BG1 B;  3L17 A;  5A23 A;  2WVI A;  4AP2 A;  3TGO A;  3UT4 A;  2YQ8 A;  5AIJ A;  4N39 A;  2J9Q A;  4BTB A;  3CVU A;  2JLB A;  4CT4 A;  2NC9 A;  5G05 J;  2VGX B;  1TJF A;  3GW4 A;  5KJM A;  4FLH A;  1KLX A;  5FQ6 A;  2WXM A;  2AW6 A;  2Q7F A;  1H6K A;  3ASD A;  3QDN A;  1OWL A;  2AVP A;  5LX8 A;  3D9J A;  5BPP A;  3IEG A;  5BNW A;  4JA7 A;  4IYP A;  2AXZ A;  3VLE A;  1SZ9 A;  2ILR A;  3HHM A;  1WAO 1;  3PE3 A;  5FZS A;  3R7Q A;  2VSY A;  2XPY A;  3Q15 A;  4J0U A;  3AS4 A;  5JJ7 A;  4UWF A;  2QY7 A;  2A5U A;  3FH7 A;  4G2V A;  3SZ7 A;  5G05 C;  5G2N A;  4ILG A;  2IF4 A;  4WWN A;  2P58 C;  1OUV A;  2MHK A;  3NZS A;  3RRU A;  3ZRH A;  4HLE A;  1X5B A;  2BUG A;  2FF4 A;  5CMY A;  2J07 A;  2C0L A;  4LCT A;  3SBS A;  4FA6 A;  4GU5 A;  4JA9 A;  2DIW A;  4GYY A;  3ZIM A;  2I6H A;  2I2O A;  5BV1 A;  4HOR A;  3ASH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...