2XCBA

Crystal structure of pcrh in complex with the chaperone binding region of popd
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
133
structure length
133
Chain Sequence
MLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Chaperone Recognition of Type III Secretion System Minor Translocator Proteins.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Protein binding
molecule keywords REGULATORY PROTEIN PCRH
total genus 60
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2xcbA00
2HO1A 5JJTA 3FP3A 4UI9K 3SF4A 1QZ2A 3ASGA 3RIBA 3S7FA 3S7BA 5G05C 4U0SA 1ZBPA 1XNFA 4RG6A 5BT1A 2VGXB 2C2LA 4UQZA 3Q5MA 4WNEA 3RKVA 4APOA 4U0UA 1YA0A 3IEGA 4XI9A 1NA3A 4Y6WA 5KJKA 3UQ3A 3S7DA 5BNWA 4KYOB 2KCLA 2FI7A 5CHEE 3LY7A 4G1TA 2PL2A 3K9IA 4N5CA 5FT9A 5BW8C 2Y4UA 3TG4A 2UWJG 3MV2B 2VGYA 3MV3B 4J8FA 4I1AA 2MHKA 4XIFA 3CK9A 3JYSA 4CGVA 5JJ7A 2VYIA 2KCKA 2PQRA 1ELWA 2XCCA 3TGOA 4I9EA 2UY1B 3QWVA 4JA9A 4XI0A 3UPVA 5ARFA 2VSYA 3WXXA 3LCAA 1IHGA 5KJMA 5LCWC 3AS4A 1TJCA 4IN3B 1KLXA 2GW1A 2ONDA 3EDTB 4GZ6A 4N2QA 3LYAA 1ZU2A 2IFUA 4N3CA 3RU0A 4G25A 5C1DA 2YHCA 3U3WA 4WNGA 4RG9A 4B94A 2KC7A 3O48A 4N39A 2WQHA 5DBKA 4UI9J 2R5SA 3HYMB 1HZ4A 4KBQA 1IYGA 5FZRA 2XCBA 3ZN3A 4AIFA 4HOSA 3QKYA 4ME2A 1E96B 4WUYA 4G23A 2KATA 1WM5A 4BTAA 3OXGA 1OUVA 1WAO1 3QWPA 4J0UA 4YVQC 3URZA 3UUXA 1P5QA 4CDRA 3CVQA 1W3BA 3CKBA 5DIZA 3Q47B 3ASDA 4I17A 2WPVA 2XPIA 4N3AA 5ARGA 4GYWA 2PQNA 3VTYA 5LCWJ 4LEUA 4KXKB 2LSUA 1NA0A 4JL0A 2V5FA 3CVNA 3KS2A 3ZPJA 1A17A 1KT1A 5HI7A 4GYYA 2LSVA 4O6FA 1PC2A 4J8DA 1B89A 3MEKA 1ELRA 2FF4A 3PE3A 3N71A 5EKQD 2YQ8A 3MA5A 5D0OD 2VQ2A 4G26A 4GCNA 5A7DB 2VGXA 5FTPA 5HQ8A 4HOTA 3CVLA 2VSNA 2PZIA 2Y4TA 3CEQA 3LPZA 4H7YA 2XGMA 3QDNA 3ULQA 5KJLA 4W9RA 1NZNA 3AS8A 5FJYA 4I2ZA 3Q15A 2QFCA 3ZHEA 4U04A 5EX3A 5G04C 4HOUA 4HORA 4JHRA 2AVPA 3CVPA 3KD7A 3Q49B 3CK7A 1HXIA 3FFLA 5KJNA 2OOEA 2XEVA 3CKCA 3R9AB 4GA2A 2XGSA 2HYZA 3GZ1A 2C0LA 3LY8A 4I2WA 4WNFA 5G05J 5AYWD 3TG5A 3LKUA 4AM9A 2UY1A 4BTBA 4CGWA 3OXLA 4AY6A 4GA1A 2E2EA 4F3VA 1Y8MA 1HH8A 3OXFA 4U0ZA 5FZQA 3ESKA 2Q7FA 5EX0A 3PE4A 3PDNA 3RJVA 3ZGQA 2DBAA 3KAEA 2I6HA 5M72A 3SZ7A 3RO2A 3GZ2A 1QQEA 4GZ5A 2LNIA 3E4BA 4GZ3A 4UQYA 3BEEA 3FWVA 4GYOA 4UI9C 3RO3A 3ASFA 3MKRA 4H7XA 5JJ6A 2JLBA 5CCMA 4UQXA 3GYZA 3AS5A 4GCOA 4I9CA 4N3BA 4JA7A 4BWRA 5A6CA 3ASHA 5CCLA 3CK8A 4G24A 2FO7A 4YNDA 1KT0A 2FBNA 3NF1A 3Q4AB 5G04J 4A1SA 3VTXA 4J8EA 4AY5A 3U4TA 4WNDA 2J9QA 5FZSA 4ABNA 2KCVA 4GPKA 4GA0A 2L6JA 2XGOA 3ZFWA 4N2SA 3S7JA 3QOUA 2P58C 4NRHB 3TAXA 2IF4A 4HOQA 5D0QD 2FEZA 4NQ0A 4EQFA 3ZHEB 2BUGA 1FCHA 2NC9A 3GW4A 3QWWA 4U07A 4BT9A 4Y6CA 4G2VA 3CV0A 4BT8A 3LY9A 4YVOA 2HR2A 2C0MA
chains in the Genus database with same CATH superfamily
3PEVB 4TRQA 2GRLA 2KZTB 3Q5MA 2CHWA 5AENA 3IEGA 4JHJA 3K9IA 2KM4A 1UN8A 2WXFA 3FULA 3CK9A 1LTXA 3HHMA 4EECA 5LCWC 4IN3B 2ONDA 2WXRA 2J08A 5C1DA 4FULA 4FC8A 2F8XK 2I2OA 1H19A 1YYHA 2GRNB 5BXOA 1E96B 4HI8A 3CKBA 2VJ8A 4GYWA 3TWXA 1JUQA 4HB5A 3CVNA 2LSVA 3D9NA 3ZXPA 1ELRA 2YQ8A 3FUFA 3KSLA 3CVYA 1OCOE 2H6GA 3LVRE 3AG1E 1ELKA 3D9IA 5CERB 4FP7A 2XENA 5AIJA 1BI8B 2GRMA 2P9UG 2E2EA 1Y8MA 2X3MA 1OWPA 1D9SA 3E33A 3Q9UC 3RJVA 4GZ5A 2MOWA 2AXUA 4TUMA 3GYZA 3AS5A 2XEHA 4GB9A 4ILGA 3ZYMA 1VDYA 2CHXA 5E75A 2P9IG 3GW4A 4U07A 4G8LA 2QY7A 3B13A 5AQAA 4L1BA 3SY2A 3TWUA 2KZTA 5BT1A 4ANVA 4WNEA 1N54A 2CHZA 2WVIA 3E32A 3LVQE 4AVXA 4OYSA 3DRAA 3ZUVB 5AQ9A 3ZVVA 2GGFA 2XS1A 5KJMA 5CRUA 3CIAA 1BD8A 3VLEA 3U3WA 4BFRA 4EZLA 1TNOA 4ME2A 1HU3A 1INZA 3AU4A 3URZA 3RRMB 1HE8A 3EHRA 5AQ7A 3IKOB 5T8IA 3KEAA 5CEDB 2VQ2A 2E0IA 3CEQA 3DSSA 3PEUB 5FQ4A 3Q15A 1OWMA 3UINC 3AAAC 4L2YA 5CEAA 3UIPC 3J5QB 2OOEA 3R7RA 3TG5A 2X6JA 2X38A 4YDOA 3CHSA 1RZ4A 3PDNA 2V4HC 2VSXE 3ABME 4GCOA 4IULA 4LG6A 4CEMA 4JHKA 3E37A 2VTBB 4HOTA 5EN5D 2MYOA 3ZFWA 1IKND 4NRHB 1JWFA 5G55A 1IHBA 5FQ8A 1XNFA 3KSQA 2C2LA 2OEVA 3ZNGA 3BUAA 3PZ1A 2J8SD 3UI2A 4G8KA 2KCKA 3CHPA 2BKKB 3UM2A 3DPDA 4K5CA 3G2SA 3O48A 2R5SA 4BESA 3ML8A 1IYGA 3QKYA 2A5UA 2KATA 2CFUA 2IY0C 4U63A 3UXGA 3C3QA 1DCEA 3G2WA 2WXJA 5IY5E 4OVVA 1PC2A 3AG3E 1E8WA 3MEKA 3JUEA 1HG2A 4C0EA 2Y4TA 4H7YA 2WXMA 4RSYA 3PREA 4W9RA 3NZUA 1OT8A 4BERA 4TV3A 5G04C 1O1SA 3FFLA 2PM6A 5LP0A 3EHMA 2R59A 3SHFA 4GU5A 4AY6A 2QZAA 1BLXB 2DIWA 5AJDA 3NOCD 3RSEG 4EBAG 4URKA 2ZIRA 3G2VA 2L6BA 3ZU7B 4D10C 5JJ6A 4I9CA 1Q2ZA 3ASHA 3IXEA 2AJAA 4I6JA 2XRZA 3VTXA 3ZYKA 2WM9A 4MS6A 4AEZC 2FULA 3RIBA 4YVOA 3FP3A 4U0SA 4IYPA 5ENOD 2KBXA 1IQRA 2A4ZA 2L9BA 4GTOA 3TL5A 3MV3B 3APFA 2CFZA 4I9EA 3BG0B 2VSYA 5AAOA 3NQPA 1ZU2A 3C98A 4YDYA 3FUDA 1SW6A 5FZRA 1OY3D 5CBNA 2H6IA 3JXIA 1N4QA 1E8XA 4DX6D 1EPUA 3Q47B 3ABLE 4HI9A 4MKTA 4HS2A 4KXKB 3FU6A 3UM0A 3B7UX 1KZOA 5HI7A 4GYYA 1KPSB 3MA5A 4IRUA 5HQ8A 3D9PA 5EDSA 1NL4A 2NXPA 3L22A 1H2UA 1OCZE 5LFAA 4I2WA 3FTYA 2EINE 3I3NA 3OXLA 1D8DA 5FZQA 4DLOA 5KNGA 2BKGA 1X81A 3FH8A 3OTNA 4JA7A 4KVMA 3FHEA 3HDXA 1TNBA 2OV8A 2XGOA 3QC1A 3FEXA 3CV0A 1H6OA 3S7FA 4Z68A 1Z3XA 1TNUA 2B0OE 1E8ZA 5CMWA 3L6AA 2EIME 5BW8C 2PL2A 2Y4UA 3MV2B 3DEPA 2XCCA 2I1KA 1UOHA 3AS4A 3EDTB 3FU5A 2X6HA 3NB2A 4UI9J 3HYMB 4BY6A 2AXVA 5BXUA 2P9LG 4J0UA 5ARGA 3I4RB 1JCQA 1OXJA 3HXBA 1NA0A 1B89A 3UPVA 1K8KG 1Z5SC 3HXDA 4GCNA 3LEWA 4I6EA 4I2ZA 5EX3A 3QAQA 2LXMA 1TN6A 2IOLA 4CT4A 2RFMA 5ENQD 4LRZA 3JUIA 4GTPA 4DPRA 3B7RL 3SZ7A 3BEEA 4UI9C 5KCMA 3V30A 4B93B 2IOSA 2IONA 2WQ6A 4G24A 1K1BA 3Q4AB 2F8YA 3B7TA 3TAXA 1FCHA 4WWOA 3Q9NC 2Y3AA 3PRZA 4EZKA 4XE0A 4U0UA 3ZRHA 5BNWA 3D9OA 2LAHA 2P9SG 3JYSA 3T5VA 3UM1A 1O5MA 4K5BA 3RU0A 2YHCA 1SQMA 4N39A 3BG1B 5FIOA 3LJ3A 3DSUA 3MX3A 4HXIA 5KJKA 4O1OA 2B6CA 2XPIA 2LSUA 4FU3A 1K3ZD 3PNLB 5FQ7A 3FTXA 3CQGB 3EHQA 4Q94A 2ZU6B 5KWDA 3ZPJA 3Q78A 1IXVA 5AN8A 4JB8P 3G2UA 5EX0A 4AP2A 3LS8A 5AJLA 4GTTA 3EIQC 1JCSA 2VSOE 3ISMC 3W9FA 1LD8A 4J8EA 3U4TA 3IV0A 2J9QA 4WNDA 4ABNA 3DSWA 1UN9A 3ULYA 2HR2A 3L08A 4AM9A 3UT4A 2IU1A 1ZBPA 1RW2A 4RQIA 1YA0A 4GTMA 3IHYA 3QNKA 5JMND 5AQBA 4GMJA 2BEDA 2EILE 1OCCE 5JJ7A 3RAUA 1N95A 3EIJA 4XZ4A 4LUNU 4XI0A 1MX4A 1TJFA 3KEZA 4G25A 1UJJA 1WG0A 4EZJA 1HX8A 4GPMA 3I5PA 3HG0D 4KMOA 4CDRA 4ANUA 2EIKE 1TN7A 4F7AA 4B8AA 4WWNA 1SA5A 1N0QA 4J8DA 2L0TB 4AV7A 4F53A 3ONLA 3D9KA 5AYWD 1H6PA 2NSZA 3VLDA 4ILIA 1S70B 2BF0X 3ULEG 3DPYA 3E4BA 2R03A 4H7XA 2JLBA 3L54A 4K03A 4GTSA 5J90A 3NZSA 4YNDA 4UWGA 4GAAA 4U8YD 3HRAA 2GRRB 1OWLA 5EYPF 4GA0A 4X8QA 2GROB 2YHEA 5D0QD 4NQ0A 2H6HA 4HRLA 2OVFA 4AXHA 2X6IA 4O60A 4EBAA 1N4RA 1SVXA 4APOA 3FU0A 1SZ9A 2LXLA 5LOZA 3SFYA 5JA4D 4WAFA 3EHNA 4UUCA 1IHGA 3MGBA 5FWQA 3MJWA 2XQ0A 2KC7A 4MRUA 1HZ4A 4G23A 4O1PA 3QWPA 3DXKG 3T8KA 3UUXA 4U96D 5ENTD 5LX8A 2PQNA 3UMVA 2JEKA 2FF4A 5CCLA 4CCAA 4U7EB 3LPZA 5CECB 3AS8A 2QYJA 5FJYA 3SBTB 3TWQA 3R9AB 1WDYA 4WNFA 2AXZA 3LKUA 3JQ0A 3SQVA 1S0PA 4ZFHA 3QK0A 4UWLA 2XRYA 4Q96A 4OAVB 4QFVA 3NF1A 2FBNA 1YMPA 2KCVA 2ZGDA 3SGHA 3L13A 4BT9A 2XPZA 2HE0A 3B7SA 5KBAA 2HO1A 1JPLA 4UWHA 2XZTG 4L7TA 3JCKC 3ZXSA 4GTVA 3FTSA 4DRXE 2V5QC 2H6FA 3BU8A 3TG4A 5HRYA 4I1AA 4KZCA 2UY1B 3ENEA 3LCAA 3F6QA 5D2MC 3R9MA 3DXMG 4F1SA 4N2QA 2WXLA 4B94A 3MCXA 4GTRA 4F1PA 1O1RA 3NAWA 1OUVA 1WAO1 3AG2E 3OXGA 4EHMA 2DVWA 2ZGGA 1UG3A 2XS8A 1TNYA 4LNUD 2V5FA 5HKPA 3FUMA 4HOSA 3CVLA 3MYVA 3ULQA 2XGMA 4APFA 1HG5A 4CYMD 4M7CA 1OCRE 5ANRA 4DX1A 2AVPA 3GZ1A 3ZHEA 3AG4E 4MLPA 3LJNA 2V0PA 1HH8A 2ILRA 2LUHA 1EDUA 2LNIA 3E30A 5JHBA 4J6IA 1Z6TA 4KT6B 1KT0A 2J09A 3Q7FA 3ZIMA 3ZKJA 1YCSB 1G3NB 3S7BA 4U95D 3L16A 4UQZA 4J8YA 3NBNB 3ASOE 2EIJE 4E6HA 2FI7A 2ZXWE 2IEJA 4DK5A 4CGVA 1O1TA 3C72A 3APDA 3QB2A 4JC8A 3U66A 3IBEA 3NOGD 1AWCB 2IO3C 4FLHA 2L0IA 4DJAA 4NACA 5D66A 2M63A 4DI3A 3W9GA 1K1AA 4F6RD 4ANXA 2XPYA 3J5PA 4KBQA 4HRNA 3C5RA 3PNTB 1W3BA 2R17C 5DIZA 4N3AA 3CLJA 4A55A 4O6FA 3FY4A 5EKQD 4DX5D 5EIBE 5D0OD 2J4BA 3UT7A 3DSXA 5E76A 1X5BA 1MHQA 3V31A 3KD7A 2FO1E 1HXIA 4DI4A 2QC9A 1H2VC 3CQCB 4CGWA 5KNHD 4XX5A 4ATZD 3UT8A 3ZGQA 3GZ2A 3ASFA 4KZ0A 2WXIA 3ZW3A 3TWTA 3TWRA 3PS6A 4AY5A 3PZ3A 1U3CA 3S7JA 4DX2A 4BT8A 4I6GA 4PH4B 3UKUG 2DCPA 4J8SA 3EJNA 2WQ7A 1HFAA 2EQXA 2VGXB 3CVUA 1E8YA 5ENNA 2AW6A 3CHQA 3UQ3A 3BQOA 5BV0A 4RVBA 2DYRE 4QQIA 4PS3A 4J8FA 1DNPA 3V2OA 4HQDA 2F37A 4FHKA 5C2YA 1MYOA 4RLYA 2P9NG 2R2LA 3DWLG 5CRVA 3TWSA 3SO8A 2WB2A 4JL0A 4ZHBA 3FU3A 3X2QE 3D9HA 2J07A 3P2BA 3PE3A 4B0ZA 1FT1A 3FH5A 1LF8A 5FTPA 3U64A 3PUJA 4HLEA 4HORA 1OWNA 5BPPA 3PUKA 2XGSA 1V54E 3DSVA 2XZDG 2OEWA 2P9PG 4WWPA 3T9KA 4FLBA 1Y6IA 3ESKA 3I4GA 5BUZA 3Q75A 2DBAA 3KAEA 1QQEA 1DVPA 4GYOA 1FVHA 4I1MA 3VLFA 2V8SE 4U8HA 2A5EA 3PVLA 5G04J 4EQFA 2IF4A 2ETCA 3AU5A 1N4PA 2C0MA 4BEPA 2WXKA 3SF4A 3HXFA 5ENPD 4ANWA 4BSZB 1LD7A 5ENRD 4KYOB 5CHEE 4JEUA 3PZDA 4A3TA 2UWJG 2VGYA 3FUKA 1UJKA 4XIFA 4GZCA 2PQRA 1XGWA 4GZDA 2GRQB 1WY6A 2ZISA 2IFUA 3EU9A 3HVEA 2J49A 1DC2A 4JXTA 1TN8A 1WM5A 2DWZA 4UWKA 3CVXA 2NYJA 3ASDA 4EPZA 2WPVA 2X6KA 4I17A 2P2CP 3VTYA 5LCWJ 4TXPA 4K5AB 1KT1A 1A17A 3T8MA 1HO8A 4JZYA 4E85A 4PDXA 3P1UA 4U04A 2WXOA 4DLQA 3JQ1A 3RRNB 1MX2A 3CKCA 3LXUX 3FH7A 3C3RA 2GRPB 5EILA 3PE4A 1E90A 2I6HA 1FVFA 4BWRA 3CK8A 1NP7A 3O4ZA 2BTDA 1S63A 4A3VA 3D9MA 4NURA 4HOQA 3ZEFA 3TXNA 4Y6CA 3MKQB 3LY9A 4FADA 2XCBA 3D9LA 4UI9K 4BETA 3TJPA 4TXRA 5ITZF 3L82A 4LERA 4HVBA 4LCTA 2VTBA 4NIKA 5B1BE 1UW4B 4HLLA 3S7DA 1S64A 3SFZA 1SA4A 3LY7A 5T4YA 1N94A 4C48B 4L9PA 4FJYA 1BPOA 5ARFA 3PH0C 3CSTA 1NI1A 3LYAA 4LNGA 1IQUA 2KXPC 1TR4A 4N3CA 3B95A 1AP7A 1D8EA 2WMNA 4XKCA 3DSTA 3KS2A 3N71A 3QJZA 3ESLA 2PM7A 3Q7AA 1NZNA 2P9KG 3ZYQA 3FDHA 2QFCA 2DYSE 3CVPA 3Q49B 3C3OA 3L9TA 5KJNA 4A63B 3LY8A 4CZ2D 4OVUA 2UY1A 5FQ6A 3FUHA 4F3VA 3G2TA 3AJIA 3D3MA 4JPSA 4I1OB 4CT0A 2RKKA 3FWVA 3RO3A 1MX6A 5EIDA 1FPPA 4HRMB 4YDWA 3CSFA 2RD0A 2DZOA 3SD5A 3HXCA 3PZ4A 3ML9A 3FTUA 4ACLA 2WXQA 5BV1A 2Y1LE 3Q73A 3ASGA 2LO6A 4FA6A 3RRUA 3MZLB 4DX7D 2WXPA 3RKVA 4JW1A 4XI9A 5AARA 2IJGX 1Z3YA 2Y69E 1E7VA 4JEHA 5CMYA 5FT9A 1EYHA 4N5CA 3ASNE 3EU5A 5ANLA 2VYIA 4YDEA 3TGOA 1KZPA 2F0YA 1A5EA 3WXXA 1U3DA 3FEYA 5JHAA 4ILHB 4WNGA 4V3IA 3PZ2A 1JCRA 3Q79A 1H6KA 4PUCA 3SNXA 3CHMA 1HF8A 2WXNA 2YNQA 4FJZA 4YVQC 1P5QA 3CVQA 2I9CA 4MBGA 3S2AA 3UM3A 4K0RA 4LNBA 2WXGA 2VGEA 1QBQA 4TXQA 4G26A 1BU9A 2PZIA 3QDNA 1QNFA 4HOUA 4AOFA 4M3OA 3CK7A 1PAQA 2XEVA 4P29A 5G05J 3ABKE 4CRWA 4DUIA 3FTVA 1BI7B 3D9JA 3FUJA 3UKRG 2IO2C 5M72A 4JVSA 4GZ3A 2RFAA 3MKRA 2CG3A 3HVEB 4HFGA 5A6CA 4L23A 2DZNA 4A1GA 4TUUA 4A1SA 4GPKA 4XKBA 4N2SA 3QOUA 5G2NA 2NC9A 4GTQA 5HS0A 4N5QA 1N11A 3R7QA 1QZ2A 3UTMA 1ZB1A 5G05C 1PY1A 4RG6A 2HM8A 4OAUC 1GW6A 2Y0BG 4C0MA 3CR3A 3FUIA 4PS8A 4Y6WA 4HBDA 4BX9A 3FTZA 4G1TA 1L5JA 4UWFA 4Q69A 2R02A 1ELWA 4JA9A 3FTWA 3IHVA 4FHJA 1V55E 1TJCA 2MRIA 4GZ6A 1HS6A 2I1JA 4RG9A 3LDZA 5EYLA 4WUYA 2J4DA 3SI5A 4ACKA 1JWGA 3MKQA 5B3SE 4J7WA 3CGHA 1MZCA 4R7LA 4G11A 4GMRA 1N52A 4BSXA 2VGXA 5KJLA 4AJWA 4ATGA 5J08A 1DCQA 4GA2A 2C0LA 5ENSD 3APCA 2XHEA 4GA1A 3V2XA 2X6FA 1EF1C 2Q7FA 2JABA 3ZYLA 2YINA 3CVWA 4I43A 5CCMA 4C9BB 1TNZA 2OVBA 3EUVA 1N9AA 4N3BA 4UQXA 4XEIG 5FZSA 3QARA 2P58C 4CDNA 2LAIA 1MJ0A 2FEZA 3TWWA 4G2VA 1QYMA 3FUNA 5JJTA 2V4LA 5H7PA 3CVVA 1SZAA 4CDMA 3UIOC 1NA3A 1FT2A 3CHOA 2KCLA 3GZSA 3B7BA 4BTAA 2MHKA 2OCCE 1TYQG 3FUEA 3QWVA 3E34A 1OWOA 1KLXA 2GW1A 3T5XA 5B1AE 4L2LA 4LSZE 3WG7E 4B8CB 3TXMA 1H2TC 2IQCA 2WQHA 5DBKA 3TWVA 1N0RA 1MQSA 4HNAD 1TEZA 3ONKA 3ZN3A 4B89A 4AIFA 2CG2A 2QYUA 5CBOA 3DBSA 1E7UA 3L17A 1NFIE 4LEUA 4GMLA 3U9WA 5FINA 3SBSA 5A7DB 2VSNA 3OAWA 2R05A 5A23A 4JHRA 2AWIA 3DEOA 2HYZA 2WMOA 1N4SA 4BTBA 4KVOA 3OXFA 4U0ZA 5T3RA 4JD2G 3RO2A 4UQYA 2ETBA 3SFXA 3HXEA 2ETAA 4PS7A 2PNNA 3HIZA 2XEEA 2FO7A 4U8VD 2WXHA 3CHRA 3RK6A 2L6JA 3UX4A 3JXJA 1H0AA 4BX8A 3ZHEB 2BUGA 3QWWA 2RG8A 3V79K 1U2VG
chains in the Genus database with same CATH topology
2HO1A 1JPLA 3D9LA 3PEVB 4UI9K 4UWHA 4TRQA 3TJPA 3S7FA 4L7TA 1Z3XA 3JCKC 2GRLA 1E8ZA 3ZXSA 4HVBA 2KZTB 3Q5MA 2CHWA 3FTSA 4LERA 5CMWA 5AENA 3IEGA 4LCTA 2VTBA 3L6AA 1UW4B 3S7DA 4JHJA 3SFZA 3LY7A 5BW8C 2PL2A 2KM4A 3K9IA 3TG4A 2Y4UA 1UN8A 3MV2B 2WXFA 4I1AA 3FULA 3CK9A 4KZCA 5T4YA 2XCCA 2UY1B 3HHMA 4FJYA 2I1KA 1BPOA 3ENEA 5ARFA 3PH0C 3CSTA 3LCAA 4EECA 5LCWC 3AS4A 4IN3B 3EDTB 2ONDA 4F1SA 2WXRA 4N2QA 3LYAA 2WXLA 2J08A 1IQUA 4N3CA 5C1DA 4FULA 3FU5A 2X6HA 3MCXA 4FC8A 2I2OA 4B94A 4UI9J 3HYMB 1H19A 4BY6A 2AXVA 1E96B 2WMNA 3OXGA 1OUVA 1WAO1 4J0UA 1UG3A 3CKBA 5ARGA 2VJ8A 3I4RB 4GYWA 4XKCA 1JUQA 1NA0A 2V5FA 3CVNA 3KS2A 2LSVA 3FUMA 3D9NA 1B89A 3UPVA 1ELRA 3N71A 4HOSA 2YQ8A 3QJZA 3ESLA 4GCNA 2PM7A 3LEWA 3FUFA 3CVLA 3MYVA 3ULQA 3CVYA 2XGMA 4I6EA 1NZNA 1HG5A 4APFA 3ZYQA 5ANRA 3FDHA 3LVRE 4I2ZA 2QFCA 1ELKA 5EX3A 3D9IA 2AVPA 3CVPA 3Q49B 3QAQA 2IOLA 5KJNA 4CT4A 3GZ1A 3ZHEA 4FP7A 3LY8A 4MLPA 5AIJA 2GRMA 4OVUA 2UY1A 2V0PA 4LRZA 5FQ6A 3FUHA 3JUIA 2E2EA 4F3VA 1Y8MA 1HH8A 2X3MA 3G2TA 2ILRA 1OWPA 3B7RL 4DPRA 3D3MA 4JPSA 3RJVA 1EDUA 3SZ7A 4GZ5A 2LNIA 4I1OB 3BEEA 4CT0A 3FWVA 3RO3A 4UI9C 5KCMA 2IOSA 2MOWA 2AXUA 5JHBA 2IONA 1Z6TA 3GYZA 3AS5A 4J6IA 4GB9A 2WQ6A 4ILGA 3ZYMA 4G24A 4KT6B 3CSFA 1KT0A 1VDYA 2J09A 2RD0A 2CHXA 3Q4AB 3ZIMA 3SD5A 3B7TA 3TAXA 5E75A 3ML9A 1FCHA 3FTUA 3GW4A 4U07A 4WWOA 4ACLA 2WXQA 2QY7A 5BV1A 3B13A 3ASGA 2LO6A 4L1BA 3S7BA 2Y3AA 4FA6A 3RRUA 3MZLB 3PRZA 2KZTA 5BT1A 4EZKA 3L16A 4UQZA 2WXPA 4ANVA 4WNEA 3RKVA 4XE0A 4JW1A 4U0UA 4XI9A 3ZRHA 1N54A 2CHZA 2WVIA 3LVQE 5BNWA 2IJGX 4AVXA 4D10C 4E6HA 1Z3YA 2FI7A 1E7VA 3D9OA 4JEHA 5CMYA 4OYSA 5FT9A 1EYHA 4N5CA 4DK5A 2LAHA 4CGVA 5ANLA 3JYSA 2VYIA 3TGOA 3T5VA 3APDA 3QB2A 4JC8A 3ZVVA 2GGFA 3WXXA 5KJMA 3U66A 3IBEA 1U3DA 3CIAA 3FEYA 4FLHA 3VLEA 2L0IA 3RU0A 4DJAA 2YHCA 4ILHB 2M63A 4NACA 4BFRA 4WNGA 4DI3A 4V3IA 1SQMA 5JHAA 4N39A 4ANXA 4EZLA 2XPYA 3BG1B 1H6KA 4PUCA 3SNXA 4KBQA 3LJ3A 3MX3A 4ME2A 3PNTB 1HU3A 3CHMA 4HXIA 5KJKA 1INZA 1HF8A 2WXNA 3AU4A 2YNQA 4FJZA 4YVQC 3RRMB 3URZA 1P5QA 3CVQA 1W3BA 2R17C 1HE8A 5DIZA 2I9CA 4N3AA 2XPIA 3S2AA 3IKOB 4K0RA 2LSUA 3CLJA 2WXGA 4FU3A 4A55A 5T8IA 3PNLB 4O6FA 5FQ7A 3FTXA 3FY4A 5EKQD 5D0OD 2VQ2A 2J4BA 4G26A 3UT7A 5E76A 3CQGB 2E0IA 1X5BA 2PZIA 3CEQA 3QDNA 4Q94A 2ZU6B 1QNFA 3PEUB 5FQ4A 3Q15A 1OWMA 1MHQA 4HOUA 4L2YA 4AOFA 3KD7A 4M3OA 3CK7A 1HXIA 1PAQA 2OOEA 2XEVA 3R7RA 3CQCB 1H2VC 4P29A 5G05J 3TG5A 3ZPJA 4DI4A 4CGWA 4XX5A 4CRWA 2X6JA 2X38A 3CHSA 3UT8A 3FTVA 3D9JA 3G2UA 5EX0A 3FUJA 3PDNA 4AP2A 3LS8A 3ZGQA 5M72A 4JVSA 3GZ2A 4GZ3A 5AJLA 3ASFA 3MKRA 2CG3A 3HVEB 4HFGA 4KZ0A 2VSXE 4GCOA 3EIQC 2WXIA 4IULA 4L23A 3ZW3A 5A6CA 4A1GA 4CEMA 2VSOE 4JHKA 4TUUA 4HOTA 2VTBB 4A1SA 3PS6A 4J8EA 4AY5A 3U4TA 3IV0A 2J9QA 1U3CA 4WNDA 4XKBA 4ABNA 4GPKA 3ZFWA 4N2SA 3S7JA 3QOUA 4NRHB 1JWFA 5G2NA 2NC9A 1UN9A 5G55A 4BT8A 4I6GA 4PH4B 2HR2A 3L08A 2DCPA 4AM9A 3R7QA 4J8SA 3EJNA 5FQ8A 2WQ7A 1QZ2A 5G05C 3UT4A 2IU1A 1HFAA 1PY1A 1ZBPA 1XNFA 4RG6A 2HM8A 2EQXA 2VGXB 2C2LA 1YA0A 1GW6A 3CVUA 3CR3A 3FUIA 1E8YA 4PS8A 5ENNA 3IHYA 3QNKA 2AW6A 4Y6WA 4C0MA 3CHQA 3UQ3A 4GMJA 4BX9A 3FTZA 5BV0A 4G1TA 4RVBA 1L5JA 4PS3A 4UWFA 4J8FA 1DNPA 4Q69A 5JJ7A 3EIJA 4XZ4A 2KCKA 1ELWA 3CHPA 4JA9A 4LUNU 4XI0A 3FTWA 4FHKA 3IHVA 4FHJA 5C2YA 1TJCA 2MRIA 3DPDA 4GZ6A 1TJFA 3KEZA 1HS6A 2I1JA 4G25A 1UJJA 4RG9A 3G2SA 3O48A 3LDZA 2R5SA 4EZJA 1HX8A 3ML8A 1IYGA 3QKYA 2A5UA 4WUYA 2J4DA 2CFUA 2KATA 3I5PA 4U63A 4KMOA 3SI5A 4ANUA 4ACKA 4CDRA 1JWGA 4F7AA 2WB2A 4B8AA 3MKQA 3G2WA 2WXJA 4JL0A 3CGHA 4R7LA 4WWNA 4G11A 4OVVA 3FU3A 1PC2A 2J07A 1E8WA 3MEKA 2L0TB 1HG2A 3P2BA 3PE3A 1N52A 4J8DA 3FH5A 4B0ZA 4AV7A 1LF8A 4BSXA 2VGXA 5FTPA 3U64A 4C0EA 4F53A 3PUJA 3U3WA 4HLEA 2Y4TA 3ONLA 4H7YA 2WXMA 4RSYA 5KJLA 3PREA 3D9KA 4W9RA 4ATGA 3NZUA 4AJWA 4TV3A 5G04C 4HORA 5J08A 1OWNA 5BPPA 3PUKA 3FFLA 2PM6A 5LP0A 4GA2A 2XGSA 5AYWD 2C0LA 2NSZA 3EHMA 2R59A 3VLDA 3APCA 4ILIA 3SHFA 4GU5A 4AY6A 2XHEA 4GA1A 2X6FA 2BF0X 2DIWA 4WWPA 5AJDA 4FLBA 1Y6IA 1EF1C 3ESKA 2Q7FA 3I4GA 4EBAG 4URKA 5BUZA 3G2VA 2DBAA 3KAEA 1QQEA 3E4BA 1DVPA 4GYOA 3ZYLA 2YINA 3CVWA 4I43A 4H7XA 1FVHA 5JJ6A 2JLBA 4I1MA 3VLFA 4UQXA 2OVBA 4C9BB 4I9CA 5CCMA 3L54A 4N3BA 4K03A 3ASHA 5J90A 3NZSA 2V8SE 4U8HA 4YNDA 4UWGA 4GAAA 3PVLA 4I6JA 1OWLA 5G04J 2XRZA 3VTXA 5FZSA 3ZYKA 4GA0A 2WM9A 3QARA 2P58C 4CDNA 2LAIA 2IF4A 2YHEA 4MS6A 2FEZA 4NQ0A 5D0QD 4EQFA 4AEZC 3AU5A 2FULA 4G2VA 3FUNA 3RIBA 4YVOA 2C0MA 5JJTA 3FP3A 2WXKA 3SF4A 2V4LA 2OVFA 4AXHA 4U0SA 4IYPA 3CVVA 2X6IA 1SZAA 4CDMA 4EBAA 4APOA 4ANWA 3FU0A 1IQRA 1NA3A 1SZ9A 5LOZA 3CHOA 2KCLA 2A4ZA 3GZSA 4JEUA 4KYOB 4WAFA 5CHEE 3PZDA 2L9BA 4A3TA 4BTAA 2UWJG 2VGYA 3FUKA 1UJKA 3MV3B 2MHKA 4XIFA 3EHNA 3TL5A 4GZCA 3APFA 2CFZA 2PQRA 1XGWA 3FUEA 4GZDA 4I9EA 3QWVA 3BG0B 2VSYA 1IHGA 1WY6A 1OWOA 3NQPA 1KLXA 2GW1A 3MGBA 3T5XA 5FWQA 1ZU2A 3MJWA 4L2LA 2IFUA 2XQ0A 3C98A 4B8CB 3TXMA 1H2TC 2IQCA 3FUDA 2KC7A 2WQHA 5DBKA 3HVEA 1MQSA 2J49A 1TEZA 3ONKA 1HZ4A 4MRUA 5FZRA 3ZN3A 4B89A 4AIFA 4JXTA 4G23A 1WM5A 2CG2A 3QWPA 4UWKA 3UUXA 1E8XA 3CVXA 3DBSA 1EPUA 1E7UA 3L17A 3Q47B 3ASDA 4I17A 2WPVA 2X6KA 4EPZA 4MKTA 2PQNA 5LX8A 3VTYA 4HS2A 5LCWJ 4LEUA 4KXKB 3FU6A 4GMLA 3B7UX 1A17A 1KT1A 5HI7A 3UMVA 4GYYA 3U9WA 2JEKA 3T8MA 2FF4A 3SBSA 5CCLA 3MA5A 4IRUA 4CCAA 1HO8A 5A7DB 4JZYA 4E85A 5HQ8A 3D9PA 2VSNA 3OAWA 3LPZA 5EDSA 4PDXA 3AS8A 5FJYA 3SBTB 3P1UA 2NXPA 5A23A 3L22A 4U04A 2WXOA 4JHRA 4DLQA 3JQ1A 3RRNB 1H2UA 2AWIA 3CKCA 3LXUX 3R9AB 5LFAA 2HYZA 4I2WA 2WMOA 3FTYA 4WNFA 2AXZA 3I3NA 3LKUA 3FH7A 3JQ0A 3OXLA 4BTBA 4KVOA 3OXFA 4U0ZA 5T3RA 5FZQA 4DLOA 1S0PA 3PE4A 3QK0A 4UWLA 2XRYA 1E90A 4Q96A 3FH8A 2I6HA 3RO2A 4UQYA 1FVFA 3OTNA 4BWRA 4PS7A 4JA7A 4KVMA 3CK8A 3FHEA 3HDXA 1NP7A 3HIZA 2FO7A 4QFVA 3NF1A 2FBNA 3O4ZA 2BTDA 4A3VA 2WXHA 3D9MA 2KCVA 2OV8A 3CHRA 2L6JA 2XGOA 4NURA 3RK6A 3UX4A 3QC1A 3SGHA 1H0AA 4HOQA 4BX8A 3FEXA 3L13A 2BUGA 3QWWA 3TXNA 3ZEFA 3ZHEB 4BT9A 4Y6CA 2RG8A 2XPZA 3MKQB 3CV0A 3B7SA 3LY9A 4FADA 2XCBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HO1 A;  5JJT A;  3FP3 A;  4UI9 K;  3SF4 A;  1QZ2 A;  3ASG A;  3RIB A;  3S7F A;  3S7B A;  5G05 C;  4U0S A;  1ZBP A;  1XNF A;  4RG6 A;  5BT1 A;  2VGX B;  2C2L A;  4UQZ A;  3Q5M A;  4WNE A;  3RKV A;  4APO A;  4U0U A;  1YA0 A;  3IEG A;  4XI9 A;  1NA3 A;  4Y6W A;  5KJK A;  3UQ3 A;  3S7D A;  5BNW A;  4KYO B;  2KCL A;  2FI7 A;  5CHE E;  3LY7 A;  4G1T A;  2PL2 A;  3K9I A;  4N5C A;  5FT9 A;  5BW8 C;  2Y4U A;  3TG4 A;  2UWJ G;  3MV2 B;  2VGY A;  3MV3 B;  4J8F A;  4I1A A;  2MHK A;  4XIF A;  3CK9 A;  3JYS A;  4CGV A;  5JJ7 A;  2VYI A;  2KCK A;  2PQR A;  1ELW A;  2XCC A;  3TGO A;  4I9E A;  2UY1 B;  3QWV A;  4JA9 A;  4XI0 A;  3UPV A;  5ARF A;  2VSY A;  3WXX A;  3LCA A;  1IHG A;  5KJM A;  5LCW C;  3AS4 A;  1TJC A;  4IN3 B;  1KLX A;  2GW1 A;  2OND A;  3EDT B;  4GZ6 A;  4N2Q A;  3LYA A;  1ZU2 A;  2IFU A;  4N3C A;  3RU0 A;  4G25 A;  5C1D A;  2YHC A;  3U3W A;  4WNG A;  4RG9 A;  4B94 A;  2KC7 A;  3O48 A;  4N39 A;  2WQH A;  5DBK A;  4UI9 J;  2R5S A;  3HYM B;  1HZ4 A;  4KBQ A;  1IYG A;  5FZR A;  2XCB A;  3ZN3 A;  4AIF A;  4HOS A;  3QKY A;  4ME2 A;  1E96 B;  4WUY A;  4G23 A;  2KAT A;  1WM5 A;  4BTA A;  3OXG A;  1OUV A;  1WAO 1;  3QWP A;  4J0U A;  4YVQ C;  3URZ A;  3UUX A;  1P5Q A;  4CDR A;  3CVQ A;  1W3B A;  3CKB A;  5DIZ A;  3Q47 B;  3ASD A;  4I17 A;  2WPV A;  2XPI A;  4N3A A;  5ARG A;  4GYW A;  2PQN A;  3VTY A;  5LCW J;  4LEU A;  4KXK B;  2LSU A;  1NA0 A;  4JL0 A;  2V5F A;  3CVN A;  3KS2 A;  3ZPJ A;  1A17 A;  1KT1 A;  5HI7 A;  4GYY A;  2LSV A;  4O6F A;  1PC2 A;  4J8D A;  1B89 A;  3MEK A;  1ELR A;  2FF4 A;  3PE3 A;  3N71 A;  5EKQ D;  2YQ8 A;  3MA5 A;  5D0O D;  2VQ2 A;  4G26 A;  4GCN A;  5A7D B;  2VGX A;  5FTP A;  5HQ8 A;  4HOT A;  3CVL A;  2VSN A;  2PZI A;  2Y4T A;  3CEQ A;  3LPZ A;  4H7Y A;  2XGM A;  3QDN A;  3ULQ A;  5KJL A;  4W9R A;  1NZN A;  3AS8 A;  5FJY A;  4I2Z A;  3Q15 A;  2QFC A;  3ZHE A;  4U04 A;  5EX3 A;  5G04 C;  4HOU A;  4HOR A;  4JHR A;  2AVP A;  3CVP A;  3KD7 A;  3Q49 B;  3CK7 A;  1HXI A;  3FFL A;  5KJN A;  2OOE A;  2XEV A;  3CKC A;  3R9A B;  4GA2 A;  2XGS A;  2HYZ A;  3GZ1 A;  2C0L A;  3LY8 A;  4I2W A;  4WNF A;  5G05 J;  5AYW D;  3TG5 A;  3LKU A;  4AM9 A;  2UY1 A;  4BTB A;  4CGW A;  3OXL A;  4AY6 A;  4GA1 A;  2E2E A;  4F3V A;  1Y8M A;  1HH8 A;  3OXF A;  4U0Z A;  5FZQ A;  3ESK A;  2Q7F A;  5EX0 A;  3PE4 A;  3PDN A;  3RJV A;  3ZGQ A;  2DBA A;  3KAE A;  2I6H A;  5M72 A;  3SZ7 A;  3RO2 A;  3GZ2 A;  1QQE A;  4GZ5 A;  2LNI A;  3E4B A;  4GZ3 A;  4UQY A;  3BEE A;  3FWV A;  4GYO A;  4UI9 C;  3RO3 A;  3ASF A;  3MKR A;  4H7X A;  5JJ6 A;  2JLB A;  5CCM A;  4UQX A;  3GYZ A;  3AS5 A;  4GCO A;  4I9C A;  4N3B A;  4JA7 A;  4BWR A;  5A6C A;  3ASH A;  5CCL A;  3CK8 A;  4G24 A;  2FO7 A;  4YND A;  1KT0 A;  2FBN A;  3NF1 A;  3Q4A B;  5G04 J;  4A1S A;  3VTX A;  4J8E A;  4AY5 A;  3U4T A;  4WND A;  2J9Q A;  5FZS A;  4ABN A;  2KCV A;  4GPK A;  4GA0 A;  2L6J A;  2XGO A;  3ZFW A;  4N2S A;  3S7J A;  3QOU A;  2P58 C;  4NRH B;  3TAX A;  2IF4 A;  4HOQ A;  5D0Q D;  2FEZ A;  4NQ0 A;  4EQF A;  3ZHE B;  2BUG A;  1FCH A;  2NC9 A;  3GW4 A;  3QWW A;  4U07 A;  4BT9 A;  4Y6C A;  4G2V A;  3CV0 A;  4BT8 A;  3LY9 A;  4YVO A;  2HR2 A;  2C0M A; 
#chains in the Genus database with same CATH topology
 3PEV B;  4TRQ A;  2GRL A;  2KZT B;  3Q5M A;  2CHW A;  5AEN A;  3IEG A;  4JHJ A;  3K9I A;  2KM4 A;  1UN8 A;  2WXF A;  3FUL A;  3CK9 A;  1LTX A;  3HHM A;  4EEC A;  5LCW C;  4IN3 B;  2OND A;  2WXR A;  2J08 A;  5C1D A;  4FUL A;  4FC8 A;  2F8X K;  2I2O A;  1H19 A;  1YYH A;  2GRN B;  5BXO A;  1E96 B;  4HI8 A;  3CKB A;  2VJ8 A;  4GYW A;  3TWX A;  1JUQ A;  4HB5 A;  3CVN A;  2LSV A;  3D9N A;  3ZXP A;  1ELR A;  2YQ8 A;  3FUF A;  3KSL A;  3CVY A;  1OCO E;  2H6G A;  3LVR E;  3AG1 E;  1ELK A;  3D9I A;  5CER B;  4FP7 A;  2XEN A;  5AIJ A;  1BI8 B;  2GRM A;  2P9U G;  2E2E A;  1Y8M A;  2X3M A;  1OWP A;  1D9S A;  3E33 A;  3Q9U C;  3RJV A;  4GZ5 A;  2MOW A;  2AXU A;  4TUM A;  3GYZ A;  3AS5 A;  2XEH A;  4GB9 A;  4ILG A;  3ZYM A;  1VDY A;  2CHX A;  5E75 A;  2P9I G;  3GW4 A;  4U07 A;  4G8L A;  2QY7 A;  3B13 A;  5AQA A;  4L1B A;  3SY2 A;  3TWU A;  2KZT A;  5BT1 A;  4ANV A;  4WNE A;  1N54 A;  2CHZ A;  2WVI A;  3E32 A;  3LVQ E;  4AVX A;  4OYS A;  3DRA A;  3ZUV B;  5AQ9 A;  3ZVV A;  2GGF A;  2XS1 A;  5KJM A;  5CRU A;  3CIA A;  1BD8 A;  3VLE A;  3U3W A;  4BFR A;  4EZL A;  1TNO A;  4ME2 A;  1HU3 A;  1INZ A;  3AU4 A;  3URZ A;  3RRM B;  1HE8 A;  3EHR A;  5AQ7 A;  3IKO B;  5T8I A;  3KEA A;  5CED B;  2VQ2 A;  2E0I A;  3CEQ A;  3DSS A;  3PEU B;  5FQ4 A;  3Q15 A;  1OWM A;  3UIN C;  3AAA C;  4L2Y A;  5CEA A;  3UIP C;  3J5Q B;  2OOE A;  3R7R A;  3TG5 A;  2X6J A;  2X38 A;  4YDO A;  3CHS A;  1RZ4 A;  3PDN A;  2V4H C;  2VSX E;  3ABM E;  4GCO A;  4IUL A;  4LG6 A;  4CEM A;  4JHK A;  3E37 A;  2VTB B;  4HOT A;  5EN5 D;  2MYO A;  3ZFW A;  1IKN D;  4NRH B;  1JWF A;  5G55 A;  1IHB A;  5FQ8 A;  1XNF A;  3KSQ A;  2C2L A;  2OEV A;  3ZNG A;  3BUA A;  3PZ1 A;  2J8S D;  3UI2 A;  4G8K A;  2KCK A;  3CHP A;  2BKK B;  3UM2 A;  3DPD A;  4K5C A;  3G2S A;  3O48 A;  2R5S A;  4BES A;  3ML8 A;  1IYG A;  3QKY A;  2A5U A;  2KAT A;  2CFU A;  2IY0 C;  4U63 A;  3UXG A;  3C3Q A;  1DCE A;  3G2W A;  2WXJ A;  5IY5 E;  4OVV A;  1PC2 A;  3AG3 E;  1E8W A;  3MEK A;  3JUE A;  1HG2 A;  4C0E A;  2Y4T A;  4H7Y A;  2WXM A;  4RSY A;  3PRE A;  4W9R A;  3NZU A;  1OT8 A;  4BER A;  4TV3 A;  5G04 C;  1O1S A;  3FFL A;  2PM6 A;  5LP0 A;  3EHM A;  2R59 A;  3SHF A;  4GU5 A;  4AY6 A;  2QZA A;  1BLX B;  2DIW A;  5AJD A;  3NOC D;  3RSE G;  4EBA G;  4URK A;  2ZIR A;  3G2V A;  2L6B A;  3ZU7 B;  4D10 C;  5JJ6 A;  4I9C A;  1Q2Z A;  3ASH A;  3IXE A;  2AJA A;  4I6J A;  2XRZ A;  3VTX A;  3ZYK A;  2WM9 A;  4MS6 A;  4AEZ C;  2FUL A;  3RIB A;  4YVO A;  3FP3 A;  4U0S A;  4IYP A;  5ENO D;  2KBX A;  1IQR A;  2A4Z A;  2L9B A;  4GTO A;  3TL5 A;  3MV3 B;  3APF A;  2CFZ A;  4I9E A;  3BG0 B;  2VSY A;  5AAO A;  3NQP A;  1ZU2 A;  3C98 A;  4YDY A;  3FUD A;  1SW6 A;  5FZR A;  1OY3 D;  5CBN A;  2H6I A;  3JXI A;  1N4Q A;  1E8X A;  4DX6 D;  1EPU A;  3Q47 B;  3ABL E;  4HI9 A;  4MKT A;  4HS2 A;  4KXK B;  3FU6 A;  3UM0 A;  3B7U X;  1KZO A;  5HI7 A;  4GYY A;  1KPS B;  3MA5 A;  4IRU A;  5HQ8 A;  3D9P A;  5EDS A;  1NL4 A;  2NXP A;  3L22 A;  1H2U A;  1OCZ E;  5LFA A;  4I2W A;  3FTY A;  2EIN E;  3I3N A;  3OXL A;  1D8D A;  5FZQ A;  4DLO A;  5KNG A;  2BKG A;  1X81 A;  3FH8 A;  3OTN A;  4JA7 A;  4KVM A;  3FHE A;  3HDX A;  1TNB A;  2OV8 A;  2XGO A;  3QC1 A;  3FEX A;  3CV0 A;  1H6O A;  3S7F A;  4Z68 A;  1Z3X A;  1TNU A;  2B0O E;  1E8Z A;  5CMW A;  3L6A A;  2EIM E;  5BW8 C;  2PL2 A;  2Y4U A;  3MV2 B;  3DEP A;  2XCC A;  2I1K A;  1UOH A;  3AS4 A;  3EDT B;  3FU5 A;  2X6H A;  3NB2 A;  4UI9 J;  3HYM B;  4BY6 A;  2AXV A;  5BXU A;  2P9L G;  4J0U A;  5ARG A;  3I4R B;  1JCQ A;  1OXJ A;  3HXB A;  1NA0 A;  1B89 A;  3UPV A;  1K8K G;  1Z5S C;  3HXD A;  4GCN A;  3LEW A;  4I6E A;  4I2Z A;  5EX3 A;  3QAQ A;  2LXM A;  1TN6 A;  2IOL A;  4CT4 A;  2RFM A;  5ENQ D;  4LRZ A;  3JUI A;  4GTP A;  4DPR A;  3B7R L;  3SZ7 A;  3BEE A;  4UI9 C;  5KCM A;  3V30 A;  4B93 B;  2IOS A;  2ION A;  2WQ6 A;  4G24 A;  1K1B A;  3Q4A B;  2F8Y A;  3B7T A;  3TAX A;  1FCH A;  4WWO A;  3Q9N C;  2Y3A A;  3PRZ A;  4EZK A;  4XE0 A;  4U0U A;  3ZRH A;  5BNW A;  3D9O A;  2LAH A;  2P9S G;  3JYS A;  3T5V A;  3UM1 A;  1O5M A;  4K5B A;  3RU0 A;  2YHC A;  1SQM A;  4N39 A;  3BG1 B;  5FIO A;  3LJ3 A;  3DSU A;  3MX3 A;  4HXI A;  5KJK A;  4O1O A;  2B6C A;  2XPI A;  2LSU A;  4FU3 A;  1K3Z D;  3PNL B;  5FQ7 A;  3FTX A;  3CQG B;  3EHQ A;  4Q94 A;  2ZU6 B;  5KWD A;  3ZPJ A;  3Q78 A;  1IXV A;  5AN8 A;  4JB8 P;  3G2U A;  5EX0 A;  4AP2 A;  3LS8 A;  5AJL A;  4GTT A;  3EIQ C;  1JCS A;  2VSO E;  3ISM C;  3W9F A;  1LD8 A;  4J8E A;  3U4T A;  3IV0 A;  2J9Q A;  4WND A;  4ABN A;  3DSW A;  1UN9 A;  3ULY A;  2HR2 A;  3L08 A;  4AM9 A;  3UT4 A;  2IU1 A;  1ZBP A;  1RW2 A;  4RQI A;  1YA0 A;  4GTM A;  3IHY A;  3QNK A;  5JMN D;  5AQB A;  4GMJ A;  2BED A;  2EIL E;  1OCC E;  5JJ7 A;  3RAU A;  1N95 A;  3EIJ A;  4XZ4 A;  4LUN U;  4XI0 A;  1MX4 A;  1TJF A;  3KEZ A;  4G25 A;  1UJJ A;  1WG0 A;  4EZJ A;  1HX8 A;  4GPM A;  3I5P A;  3HG0 D;  4KMO A;  4CDR A;  4ANU A;  2EIK E;  1TN7 A;  4F7A A;  4B8A A;  4WWN A;  1SA5 A;  1N0Q A;  4J8D A;  2L0T B;  4AV7 A;  4F53 A;  3ONL A;  3D9K A;  5AYW D;  1H6P A;  2NSZ A;  3VLD A;  4ILI A;  1S70 B;  2BF0 X;  3ULE G;  3DPY A;  3E4B A;  2R03 A;  4H7X A;  2JLB A;  3L54 A;  4K03 A;  4GTS A;  5J90 A;  3NZS A;  4YND A;  4UWG A;  4GAA A;  4U8Y D;  3HRA A;  2GRR B;  1OWL A;  5EYP F;  4GA0 A;  4X8Q A;  2GRO B;  2YHE A;  5D0Q D;  4NQ0 A;  2H6H A;  4HRL A;  2OVF A;  4AXH A;  2X6I A;  4O60 A;  4EBA A;  1N4R A;  1SVX A;  4APO A;  3FU0 A;  1SZ9 A;  2LXL A;  5LOZ A;  3SFY A;  5JA4 D;  4WAF A;  3EHN A;  4UUC A;  1IHG A;  3MGB A;  5FWQ A;  3MJW A;  2XQ0 A;  2KC7 A;  4MRU A;  1HZ4 A;  4G23 A;  4O1P A;  3QWP A;  3DXK G;  3T8K A;  3UUX A;  4U96 D;  5ENT D;  5LX8 A;  2PQN A;  3UMV A;  2JEK A;  2FF4 A;  5CCL A;  4CCA A;  4U7E B;  3LPZ A;  5CEC B;  3AS8 A;  2QYJ A;  5FJY A;  3SBT B;  3TWQ A;  3R9A B;  1WDY A;  4WNF A;  2AXZ A;  3LKU A;  3JQ0 A;  3SQV A;  1S0P A;  4ZFH A;  3QK0 A;  4UWL A;  2XRY A;  4Q96 A;  4OAV B;  4QFV A;  3NF1 A;  2FBN A;  1YMP A;  2KCV A;  2ZGD A;  3SGH A;  3L13 A;  4BT9 A;  2XPZ A;  2HE0 A;  3B7S A;  5KBA A;  2HO1 A;  1JPL A;  4UWH A;  2XZT G;  4L7T A;  3JCK C;  3ZXS A;  4GTV A;  3FTS A;  4DRX E;  2V5Q C;  2H6F A;  3BU8 A;  3TG4 A;  5HRY A;  4I1A A;  4KZC A;  2UY1 B;  3ENE A;  3LCA A;  3F6Q A;  5D2M C;  3R9M A;  3DXM G;  4F1S A;  4N2Q A;  2WXL A;  4B94 A;  3MCX A;  4GTR A;  4F1P A;  1O1R A;  3NAW A;  1OUV A;  1WAO 1;  3AG2 E;  3OXG A;  4EHM A;  2DVW A;  2ZGG A;  1UG3 A;  2XS8 A;  1TNY A;  4LNU D;  2V5F A;  5HKP A;  3FUM A;  4HOS A;  3CVL A;  3MYV A;  3ULQ A;  2XGM A;  4APF A;  1HG5 A;  4CYM D;  4M7C A;  1OCR E;  5ANR A;  4DX1 A;  2AVP A;  3GZ1 A;  3ZHE A;  3AG4 E;  4MLP A;  3LJN A;  2V0P A;  1HH8 A;  2ILR A;  2LUH A;  1EDU A;  2LNI A;  3E30 A;  5JHB A;  4J6I A;  1Z6T A;  4KT6 B;  1KT0 A;  2J09 A;  3Q7F A;  3ZIM A;  3ZKJ A;  1YCS B;  1G3N B;  3S7B A;  4U95 D;  3L16 A;  4UQZ A;  4J8Y A;  3NBN B;  3ASO E;  2EIJ E;  4E6H A;  2FI7 A;  2ZXW E;  2IEJ A;  4DK5 A;  4CGV A;  1O1T A;  3C72 A;  3APD A;  3QB2 A;  4JC8 A;  3U66 A;  3IBE A;  3NOG D;  1AWC B;  2IO3 C;  4FLH A;  2L0I A;  4DJA A;  4NAC A;  5D66 A;  2M63 A;  4DI3 A;  3W9G A;  1K1A A;  4F6R D;  4ANX A;  2XPY A;  3J5P A;  4KBQ A;  4HRN A;  3C5R A;  3PNT B;  1W3B A;  2R17 C;  5DIZ A;  4N3A A;  3CLJ A;  4A55 A;  4O6F A;  3FY4 A;  5EKQ D;  4DX5 D;  5EIB E;  5D0O D;  2J4B A;  3UT7 A;  3DSX A;  5E76 A;  1X5B A;  1MHQ A;  3V31 A;  3KD7 A;  2FO1 E;  1HXI A;  4DI4 A;  2QC9 A;  1H2V C;  3CQC B;  4CGW A;  5KNH D;  4XX5 A;  4ATZ D;  3UT8 A;  3ZGQ A;  3GZ2 A;  3ASF A;  4KZ0 A;  2WXI A;  3ZW3 A;  3TWT A;  3TWR A;  3PS6 A;  4AY5 A;  3PZ3 A;  1U3C A;  3S7J A;  4DX2 A;  4BT8 A;  4I6G A;  4PH4 B;  3UKU G;  2DCP A;  4J8S A;  3EJN A;  2WQ7 A;  1HFA A;  2EQX A;  2VGX B;  3CVU A;  1E8Y A;  5ENN A;  2AW6 A;  3CHQ A;  3UQ3 A;  3BQO A;  5BV0 A;  4RVB A;  2DYR E;  4QQI A;  4PS3 A;  4J8F A;  1DNP A;  3V2O A;  4HQD A;  2F37 A;  4FHK A;  5C2Y A;  1MYO A;  4RLY A;  2P9N G;  2R2L A;  3DWL G;  5CRV A;  3TWS A;  3SO8 A;  2WB2 A;  4JL0 A;  4ZHB A;  3FU3 A;  3X2Q E;  3D9H A;  2J07 A;  3P2B A;  3PE3 A;  4B0Z A;  1FT1 A;  3FH5 A;  1LF8 A;  5FTP A;  3U64 A;  3PUJ A;  4HLE A;  4HOR A;  1OWN A;  5BPP A;  3PUK A;  2XGS A;  1V54 E;  3DSV A;  2XZD G;  2OEW A;  2P9P G;  4WWP A;  3T9K A;  4FLB A;  1Y6I A;  3ESK A;  3I4G A;  5BUZ A;  3Q75 A;  2DBA A;  3KAE A;  1QQE A;  1DVP A;  4GYO A;  1FVH A;  4I1M A;  3VLF A;  2V8S E;  4U8H A;  2A5E A;  3PVL A;  5G04 J;  4EQF A;  2IF4 A;  2ETC A;  3AU5 A;  1N4P A;  2C0M A;  4BEP A;  2WXK A;  3SF4 A;  3HXF A;  5ENP D;  4ANW A;  4BSZ B;  1LD7 A;  5ENR D;  4KYO B;  5CHE E;  4JEU A;  3PZD A;  4A3T A;  2UWJ G;  2VGY A;  3FUK A;  1UJK A;  4XIF A;  4GZC A;  2PQR A;  1XGW A;  4GZD A;  2GRQ B;  1WY6 A;  2ZIS A;  2IFU A;  3EU9 A;  3HVE A;  2J49 A;  1DC2 A;  4JXT A;  1TN8 A;  1WM5 A;  2DWZ A;  4UWK A;  3CVX A;  2NYJ A;  3ASD A;  4EPZ A;  2WPV A;  2X6K A;  4I17 A;  2P2C P;  3VTY A;  5LCW J;  4TXP A;  4K5A B;  1KT1 A;  1A17 A;  3T8M A;  1HO8 A;  4JZY A;  4E85 A;  4PDX A;  3P1U A;  4U04 A;  2WXO A;  4DLQ A;  3JQ1 A;  3RRN B;  1MX2 A;  3CKC A;  3LXU X;  3FH7 A;  3C3R A;  2GRP B;  5EIL A;  3PE4 A;  1E90 A;  2I6H A;  1FVF A;  4BWR A;  3CK8 A;  1NP7 A;  3O4Z A;  2BTD A;  1S63 A;  4A3V A;  3D9M A;  4NUR A;  4HOQ A;  3ZEF A;  3TXN A;  4Y6C A;  3MKQ B;  3LY9 A;  4FAD A;  2XCB A;  3D9L A;  4UI9 K;  4BET A;  3TJP A;  4TXR A;  5ITZ F;  3L82 A;  4LER A;  4HVB A;  4LCT A;  2VTB A;  4NIK A;  5B1B E;  1UW4 B;  4HLL A;  3S7D A;  1S64 A;  3SFZ A;  1SA4 A;  3LY7 A;  5T4Y A;  1N94 A;  4C48 B;  4L9P A;  4FJY A;  1BPO A;  5ARF A;  3PH0 C;  3CST A;  1NI1 A;  3LYA A;  4LNG A;  1IQU A;  2KXP C;  1TR4 A;  4N3C A;  3B95 A;  1AP7 A;  1D8E A;  2WMN A;  4XKC A;  3DST A;  3KS2 A;  3N71 A;  3QJZ A;  3ESL A;  2PM7 A;  3Q7A A;  1NZN A;  2P9K G;  3ZYQ A;  3FDH A;  2QFC A;  2DYS E;  3CVP A;  3Q49 B;  3C3O A;  3L9T A;  5KJN A;  4A63 B;  3LY8 A;  4CZ2 D;  4OVU A;  2UY1 A;  5FQ6 A;  3FUH A;  4F3V A;  3G2T A;  3AJI A;  3D3M A;  4JPS A;  4I1O B;  4CT0 A;  2RKK A;  3FWV A;  3RO3 A;  1MX6 A;  5EID A;  1FPP A;  4HRM B;  4YDW A;  3CSF A;  2RD0 A;  2DZO A;  3SD5 A;  3HXC A;  3PZ4 A;  3ML9 A;  3FTU A;  4ACL A;  2WXQ A;  5BV1 A;  2Y1L E;  3Q73 A;  3ASG A;  2LO6 A;  4FA6 A;  3RRU A;  3MZL B;  4DX7 D;  2WXP A;  3RKV A;  4JW1 A;  4XI9 A;  5AAR A;  2IJG X;  1Z3Y A;  2Y69 E;  1E7V A;  4JEH A;  5CMY A;  5FT9 A;  1EYH A;  4N5C A;  3ASN E;  3EU5 A;  5ANL A;  2VYI A;  4YDE A;  3TGO A;  1KZP A;  2F0Y A;  1A5E A;  3WXX A;  1U3D A;  3FEY A;  5JHA A;  4ILH B;  4WNG A;  4V3I A;  3PZ2 A;  1JCR A;  3Q79 A;  1H6K A;  4PUC A;  3SNX A;  3CHM A;  1HF8 A;  2WXN A;  2YNQ A;  4FJZ A;  4YVQ C;  1P5Q A;  3CVQ A;  2I9C A;  4MBG A;  3S2A A;  3UM3 A;  4K0R A;  4LNB A;  2WXG A;  2VGE A;  1QBQ A;  4TXQ A;  4G26 A;  1BU9 A;  2PZI A;  3QDN A;  1QNF A;  4HOU A;  4AOF A;  4M3O A;  3CK7 A;  1PAQ A;  2XEV A;  4P29 A;  5G05 J;  3ABK E;  4CRW A;  4DUI A;  3FTV A;  1BI7 B;  3D9J A;  3FUJ A;  3UKR G;  2IO2 C;  5M72 A;  4JVS A;  4GZ3 A;  2RFA A;  3MKR A;  2CG3 A;  3HVE B;  4HFG A;  5A6C A;  4L23 A;  2DZN A;  4A1G A;  4TUU A;  4A1S A;  4GPK A;  4XKB A;  4N2S A;  3QOU A;  5G2N A;  2NC9 A;  4GTQ A;  5HS0 A;  4N5Q A;  1N11 A;  3R7Q A;  1QZ2 A;  3UTM A;  1ZB1 A;  5G05 C;  1PY1 A;  4RG6 A;  2HM8 A;  4OAU C;  1GW6 A;  2Y0B G;  4C0M A;  3CR3 A;  3FUI A;  4PS8 A;  4Y6W A;  4HBD A;  4BX9 A;  3FTZ A;  4G1T A;  1L5J A;  4UWF A;  4Q69 A;  2R02 A;  1ELW A;  4JA9 A;  3FTW A;  3IHV A;  4FHJ A;  1V55 E;  1TJC A;  2MRI A;  4GZ6 A;  1HS6 A;  2I1J A;  4RG9 A;  3LDZ A;  5EYL A;  4WUY A;  2J4D A;  3SI5 A;  4ACK A;  1JWG A;  3MKQ A;  5B3S E;  4J7W A;  3CGH A;  1MZC A;  4R7L A;  4G11 A;  4GMR A;  1N52 A;  4BSX A;  2VGX A;  5KJL A;  4AJW A;  4ATG A;  5J08 A;  1DCQ A;  4GA2 A;  2C0L A;  5ENS D;  3APC A;  2XHE A;  4GA1 A;  3V2X A;  2X6F A;  1EF1 C;  2Q7F A;  2JAB A;  3ZYL A;  2YIN A;  3CVW A;  4I43 A;  5CCM A;  4C9B B;  1TNZ A;  2OVB A;  3EUV A;  1N9A A;  4N3B A;  4UQX A;  4XEI G;  5FZS A;  3QAR A;  2P58 C;  4CDN A;  2LAI A;  1MJ0 A;  2FEZ A;  3TWW A;  4G2V A;  1QYM A;  3FUN A;  5JJT A;  2V4L A;  5H7P A;  3CVV A;  1SZA A;  4CDM A;  3UIO C;  1NA3 A;  1FT2 A;  3CHO A;  2KCL A;  3GZS A;  3B7B A;  4BTA A;  2MHK A;  2OCC E;  1TYQ G;  3FUE A;  3QWV A;  3E34 A;  1OWO A;  1KLX A;  2GW1 A;  3T5X A;  5B1A E;  4L2L A;  4LSZ E;  3WG7 E;  4B8C B;  3TXM A;  1H2T C;  2IQC A;  2WQH A;  5DBK A;  3TWV A;  1N0R A;  1MQS A;  4HNA D;  1TEZ A;  3ONK A;  3ZN3 A;  4B89 A;  4AIF A;  2CG2 A;  2QYU A;  5CBO A;  3DBS A;  1E7U A;  3L17 A;  1NFI E;  4LEU A;  4GML A;  3U9W A;  5FIN A;  3SBS A;  5A7D B;  2VSN A;  3OAW A;  2R05 A;  5A23 A;  4JHR A;  2AWI A;  3DEO A;  2HYZ A;  2WMO A;  1N4S A;  4BTB A;  4KVO A;  3OXF A;  4U0Z A;  5T3R A;  4JD2 G;  3RO2 A;  4UQY A;  2ETB A;  3SFX A;  3HXE A;  2ETA A;  4PS7 A;  2PNN A;  3HIZ A;  2XEE A;  2FO7 A;  4U8V D;  2WXH A;  3CHR A;  3RK6 A;  2L6J A;  3UX4 A;  3JXJ A;  1H0A A;  4BX8 A;  3ZHE B;  2BUG A;  3QWW A;  2RG8 A;  3V79 K;  1U2V G; 
#chains in the Genus database with same CATH homology
 2HO1 A;  1JPL A;  3D9L A;  3PEV B;  4UI9 K;  4UWH A;  4TRQ A;  3TJP A;  3S7F A;  4L7T A;  1Z3X A;  3JCK C;  2GRL A;  1E8Z A;  3ZXS A;  4HVB A;  2KZT B;  3Q5M A;  2CHW A;  3FTS A;  4LER A;  5CMW A;  5AEN A;  3IEG A;  4LCT A;  2VTB A;  3L6A A;  1UW4 B;  3S7D A;  4JHJ A;  3SFZ A;  3LY7 A;  5BW8 C;  2PL2 A;  2KM4 A;  3K9I A;  3TG4 A;  2Y4U A;  1UN8 A;  3MV2 B;  2WXF A;  4I1A A;  3FUL A;  3CK9 A;  4KZC A;  5T4Y A;  2XCC A;  2UY1 B;  3HHM A;  4FJY A;  2I1K A;  1BPO A;  3ENE A;  5ARF A;  3PH0 C;  3CST A;  3LCA A;  4EEC A;  5LCW C;  3AS4 A;  4IN3 B;  3EDT B;  2OND A;  4F1S A;  2WXR A;  4N2Q A;  3LYA A;  2WXL A;  2J08 A;  1IQU A;  4N3C A;  5C1D A;  4FUL A;  3FU5 A;  2X6H A;  3MCX A;  4FC8 A;  2I2O A;  4B94 A;  4UI9 J;  3HYM B;  1H19 A;  4BY6 A;  2AXV A;  1E96 B;  2WMN A;  3OXG A;  1OUV A;  1WAO 1;  4J0U A;  1UG3 A;  3CKB A;  5ARG A;  2VJ8 A;  3I4R B;  4GYW A;  4XKC A;  1JUQ A;  1NA0 A;  2V5F A;  3CVN A;  3KS2 A;  2LSV A;  3FUM A;  3D9N A;  1B89 A;  3UPV A;  1ELR A;  3N71 A;  4HOS A;  2YQ8 A;  3QJZ A;  3ESL A;  4GCN A;  2PM7 A;  3LEW A;  3FUF A;  3CVL A;  3MYV A;  3ULQ A;  3CVY A;  2XGM A;  4I6E A;  1NZN A;  1HG5 A;  4APF A;  3ZYQ A;  5ANR A;  3FDH A;  3LVR E;  4I2Z A;  2QFC A;  1ELK A;  5EX3 A;  3D9I A;  2AVP A;  3CVP A;  3Q49 B;  3QAQ A;  2IOL A;  5KJN A;  4CT4 A;  3GZ1 A;  3ZHE A;  4FP7 A;  3LY8 A;  4MLP A;  5AIJ A;  2GRM A;  4OVU A;  2UY1 A;  2V0P A;  4LRZ A;  5FQ6 A;  3FUH A;  3JUI A;  2E2E A;  4F3V A;  1Y8M A;  1HH8 A;  2X3M A;  3G2T A;  2ILR A;  1OWP A;  3B7R L;  4DPR A;  3D3M A;  4JPS A;  3RJV A;  1EDU A;  3SZ7 A;  4GZ5 A;  2LNI A;  4I1O B;  3BEE A;  4CT0 A;  3FWV A;  3RO3 A;  4UI9 C;  5KCM A;  2IOS A;  2MOW A;  2AXU A;  5JHB A;  2ION A;  1Z6T A;  3GYZ A;  3AS5 A;  4J6I A;  4GB9 A;  2WQ6 A;  4ILG A;  3ZYM A;  4G24 A;  4KT6 B;  3CSF A;  1KT0 A;  1VDY A;  2J09 A;  2RD0 A;  2CHX A;  3Q4A B;  3ZIM A;  3SD5 A;  3B7T A;  3TAX A;  5E75 A;  3ML9 A;  1FCH A;  3FTU A;  3GW4 A;  4U07 A;  4WWO A;  4ACL A;  2WXQ A;  2QY7 A;  5BV1 A;  3B13 A;  3ASG A;  2LO6 A;  4L1B A;  3S7B A;  2Y3A A;  4FA6 A;  3RRU A;  3MZL B;  3PRZ A;  2KZT A;  5BT1 A;  4EZK A;  3L16 A;  4UQZ A;  2WXP A;  4ANV A;  4WNE A;  3RKV A;  4XE0 A;  4JW1 A;  4U0U A;  4XI9 A;  3ZRH A;  1N54 A;  2CHZ A;  2WVI A;  3LVQ E;  5BNW A;  2IJG X;  4AVX A;  4D10 C;  4E6H A;  1Z3Y A;  2FI7 A;  1E7V A;  3D9O A;  4JEH A;  5CMY A;  4OYS A;  5FT9 A;  1EYH A;  4N5C A;  4DK5 A;  2LAH A;  4CGV A;  5ANL A;  3JYS A;  2VYI A;  3TGO A;  3T5V A;  3APD A;  3QB2 A;  4JC8 A;  3ZVV A;  2GGF A;  3WXX A;  5KJM A;  3U66 A;  3IBE A;  1U3D A;  3CIA A;  3FEY A;  4FLH A;  3VLE A;  2L0I A;  3RU0 A;  4DJA A;  2YHC A;  4ILH B;  2M63 A;  4NAC A;  4BFR A;  4WNG A;  4DI3 A;  4V3I A;  1SQM A;  5JHA A;  4N39 A;  4ANX A;  4EZL A;  2XPY A;  3BG1 B;  1H6K A;  4PUC A;  3SNX A;  4KBQ A;  3LJ3 A;  3MX3 A;  4ME2 A;  3PNT B;  1HU3 A;  3CHM A;  4HXI A;  5KJK A;  1INZ A;  1HF8 A;  2WXN A;  3AU4 A;  2YNQ A;  4FJZ A;  4YVQ C;  3RRM B;  3URZ A;  1P5Q A;  3CVQ A;  1W3B A;  2R17 C;  1HE8 A;  5DIZ A;  2I9C A;  4N3A A;  2XPI A;  3S2A A;  3IKO B;  4K0R A;  2LSU A;  3CLJ A;  2WXG A;  4FU3 A;  4A55 A;  5T8I A;  3PNL B;  4O6F A;  5FQ7 A;  3FTX A;  3FY4 A;  5EKQ D;  5D0O D;  2VQ2 A;  2J4B A;  4G26 A;  3UT7 A;  5E76 A;  3CQG B;  2E0I A;  1X5B A;  2PZI A;  3CEQ A;  3QDN A;  4Q94 A;  2ZU6 B;  1QNF A;  3PEU B;  5FQ4 A;  3Q15 A;  1OWM A;  1MHQ A;  4HOU A;  4L2Y A;  4AOF A;  3KD7 A;  4M3O A;  3CK7 A;  1HXI A;  1PAQ A;  2OOE A;  2XEV A;  3R7R A;  3CQC B;  1H2V C;  4P29 A;  5G05 J;  3TG5 A;  3ZPJ A;  4DI4 A;  4CGW A;  4XX5 A;  4CRW A;  2X6J A;  2X38 A;  3CHS A;  3UT8 A;  3FTV A;  3D9J A;  3G2U A;  5EX0 A;  3FUJ A;  3PDN A;  4AP2 A;  3LS8 A;  3ZGQ A;  5M72 A;  4JVS A;  3GZ2 A;  4GZ3 A;  5AJL A;  3ASF A;  3MKR A;  2CG3 A;  3HVE B;  4HFG A;  4KZ0 A;  2VSX E;  4GCO A;  3EIQ C;  2WXI A;  4IUL A;  4L23 A;  3ZW3 A;  5A6C A;  4A1G A;  4CEM A;  2VSO E;  4JHK A;  4TUU A;  4HOT A;  2VTB B;  4A1S A;  3PS6 A;  4J8E A;  4AY5 A;  3U4T A;  3IV0 A;  2J9Q A;  1U3C A;  4WND A;  4XKB A;  4ABN A;  4GPK A;  3ZFW A;  4N2S A;  3S7J A;  3QOU A;  4NRH B;  1JWF A;  5G2N A;  2NC9 A;  1UN9 A;  5G55 A;  4BT8 A;  4I6G A;  4PH4 B;  2HR2 A;  3L08 A;  2DCP A;  4AM9 A;  3R7Q A;  4J8S A;  3EJN A;  5FQ8 A;  2WQ7 A;  1QZ2 A;  5G05 C;  3UT4 A;  2IU1 A;  1HFA A;  1PY1 A;  1ZBP A;  1XNF A;  4RG6 A;  2HM8 A;  2EQX A;  2VGX B;  2C2L A;  1YA0 A;  1GW6 A;  3CVU A;  3CR3 A;  3FUI A;  1E8Y A;  4PS8 A;  5ENN A;  3IHY A;  3QNK A;  2AW6 A;  4Y6W A;  4C0M A;  3CHQ A;  3UQ3 A;  4GMJ A;  4BX9 A;  3FTZ A;  5BV0 A;  4G1T A;  4RVB A;  1L5J A;  4PS3 A;  4UWF A;  4J8F A;  1DNP A;  4Q69 A;  5JJ7 A;  3EIJ A;  4XZ4 A;  2KCK A;  1ELW A;  3CHP A;  4JA9 A;  4LUN U;  4XI0 A;  3FTW A;  4FHK A;  3IHV A;  4FHJ A;  5C2Y A;  1TJC A;  2MRI A;  3DPD A;  4GZ6 A;  1TJF A;  3KEZ A;  1HS6 A;  2I1J A;  4G25 A;  1UJJ A;  4RG9 A;  3G2S A;  3O48 A;  3LDZ A;  2R5S A;  4EZJ A;  1HX8 A;  3ML8 A;  1IYG A;  3QKY A;  2A5U A;  4WUY A;  2J4D A;  2CFU A;  2KAT A;  3I5P A;  4U63 A;  4KMO A;  3SI5 A;  4ANU A;  4ACK A;  4CDR A;  1JWG A;  4F7A A;  2WB2 A;  4B8A A;  3MKQ A;  3G2W A;  2WXJ A;  4JL0 A;  3CGH A;  4R7L A;  4WWN A;  4G11 A;  4OVV A;  3FU3 A;  1PC2 A;  2J07 A;  1E8W A;  3MEK A;  2L0T B;  1HG2 A;  3P2B A;  3PE3 A;  1N52 A;  4J8D A;  3FH5 A;  4B0Z A;  4AV7 A;  1LF8 A;  4BSX A;  2VGX A;  5FTP A;  3U64 A;  4C0E A;  4F53 A;  3PUJ A;  3U3W A;  4HLE A;  2Y4T A;  3ONL A;  4H7Y A;  2WXM A;  4RSY A;  5KJL A;  3PRE A;  3D9K A;  4W9R A;  4ATG A;  3NZU A;  4AJW A;  4TV3 A;  5G04 C;  4HOR A;  5J08 A;  1OWN A;  5BPP A;  3PUK A;  3FFL A;  2PM6 A;  5LP0 A;  4GA2 A;  2XGS A;  5AYW D;  2C0L A;  2NSZ A;  3EHM A;  2R59 A;  3VLD A;  3APC A;  4ILI A;  3SHF A;  4GU5 A;  4AY6 A;  2XHE A;  4GA1 A;  2X6F A;  2BF0 X;  2DIW A;  4WWP A;  5AJD A;  4FLB A;  1Y6I A;  1EF1 C;  3ESK A;  2Q7F A;  3I4G A;  4EBA G;  4URK A;  5BUZ A;  3G2V A;  2DBA A;  3KAE A;  1QQE A;  3E4B A;  1DVP A;  4GYO A;  3ZYL A;  2YIN A;  3CVW A;  4I43 A;  4H7X A;  1FVH A;  5JJ6 A;  2JLB A;  4I1M A;  3VLF A;  4UQX A;  2OVB A;  4C9B B;  4I9C A;  5CCM A;  3L54 A;  4N3B A;  4K03 A;  3ASH A;  5J90 A;  3NZS A;  2V8S E;  4U8H A;  4YND A;  4UWG A;  4GAA A;  3PVL A;  4I6J A;  1OWL A;  5G04 J;  2XRZ A;  3VTX A;  5FZS A;  3ZYK A;  4GA0 A;  2WM9 A;  3QAR A;  2P58 C;  4CDN A;  2LAI A;  2IF4 A;  2YHE A;  4MS6 A;  2FEZ A;  4NQ0 A;  5D0Q D;  4EQF A;  4AEZ C;  3AU5 A;  2FUL A;  4G2V A;  3FUN A;  3RIB A;  4YVO A;  2C0M A;  5JJT A;  3FP3 A;  2WXK A;  3SF4 A;  2V4L A;  2OVF A;  4AXH A;  4U0S A;  4IYP A;  3CVV A;  2X6I A;  1SZA A;  4CDM A;  4EBA A;  4APO A;  4ANW A;  3FU0 A;  1IQR A;  1NA3 A;  1SZ9 A;  5LOZ A;  3CHO A;  2KCL A;  2A4Z A;  3GZS A;  4JEU A;  4KYO B;  4WAF A;  5CHE E;  3PZD A;  2L9B A;  4A3T A;  4BTA A;  2UWJ G;  2VGY A;  3FUK A;  1UJK A;  3MV3 B;  2MHK A;  4XIF A;  3EHN A;  3TL5 A;  4GZC A;  3APF A;  2CFZ A;  2PQR A;  1XGW A;  3FUE A;  4GZD A;  4I9E A;  3QWV A;  3BG0 B;  2VSY A;  1IHG A;  1WY6 A;  1OWO A;  3NQP A;  1KLX A;  2GW1 A;  3MGB A;  3T5X A;  5FWQ A;  1ZU2 A;  3MJW A;  4L2L A;  2IFU A;  2XQ0 A;  3C98 A;  4B8C B;  3TXM A;  1H2T C;  2IQC A;  3FUD A;  2KC7 A;  2WQH A;  5DBK A;  3HVE A;  1MQS A;  2J49 A;  1TEZ A;  3ONK A;  1HZ4 A;  4MRU A;  5FZR A;  3ZN3 A;  4B89 A;  4AIF A;  4JXT A;  4G23 A;  1WM5 A;  2CG2 A;  3QWP A;  4UWK A;  3UUX A;  1E8X A;  3CVX A;  3DBS A;  1EPU A;  1E7U A;  3L17 A;  3Q47 B;  3ASD A;  4I17 A;  2WPV A;  2X6K A;  4EPZ A;  4MKT A;  2PQN A;  5LX8 A;  3VTY A;  4HS2 A;  5LCW J;  4LEU A;  4KXK B;  3FU6 A;  4GML A;  3B7U X;  1A17 A;  1KT1 A;  5HI7 A;  3UMV A;  4GYY A;  3U9W A;  2JEK A;  3T8M A;  2FF4 A;  3SBS A;  5CCL A;  3MA5 A;  4IRU A;  4CCA A;  1HO8 A;  5A7D B;  4JZY A;  4E85 A;  5HQ8 A;  3D9P A;  2VSN A;  3OAW A;  3LPZ A;  5EDS A;  4PDX A;  3AS8 A;  5FJY A;  3SBT B;  3P1U A;  2NXP A;  5A23 A;  3L22 A;  4U04 A;  2WXO A;  4JHR A;  4DLQ A;  3JQ1 A;  3RRN B;  1H2U A;  2AWI A;  3CKC A;  3LXU X;  3R9A B;  5LFA A;  2HYZ A;  4I2W A;  2WMO A;  3FTY A;  4WNF A;  2AXZ A;  3I3N A;  3LKU A;  3FH7 A;  3JQ0 A;  3OXL A;  4BTB A;  4KVO A;  3OXF A;  4U0Z A;  5T3R A;  5FZQ A;  4DLO A;  1S0P A;  3PE4 A;  3QK0 A;  4UWL A;  2XRY A;  1E90 A;  4Q96 A;  3FH8 A;  2I6H A;  3RO2 A;  4UQY A;  1FVF A;  3OTN A;  4BWR A;  4PS7 A;  4JA7 A;  4KVM A;  3CK8 A;  3FHE A;  3HDX A;  1NP7 A;  3HIZ A;  2FO7 A;  4QFV A;  3NF1 A;  2FBN A;  3O4Z A;  2BTD A;  4A3V A;  2WXH A;  3D9M A;  2KCV A;  2OV8 A;  3CHR A;  2L6J A;  2XGO A;  4NUR A;  3RK6 A;  3UX4 A;  3QC1 A;  3SGH A;  1H0A A;  4HOQ A;  4BX8 A;  3FEX A;  3L13 A;  2BUG A;  3QWW A;  3TXN A;  3ZEF A;  3ZHE B;  4BT9 A;  4Y6C A;  2RG8 A;  2XPZ A;  3MKQ B;  3CV0 A;  3B7S A;  3LY9 A;  4FAD A;  2XCB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...