5B1AE

Bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 5b1aE00
3AG2E 5IY5E 3WG7E 2EIJE 3ASOE 2Y69E 3ABLE 2EINE 2EILE 2OCCE 3ASNE 3ABKE 2ZXWE 2DYSE 1OCCE 2EIKE 2DYRE 1OCOE 3AG1E 1OCRE 1V54E 1V55E 1OCZE 5B1AE 3AG3E 3X2QE 3AG4E 2EIME 5B1BE 5B3SE 3ABME
chains in the Genus database with same CATH superfamily
3PEVB 4F1PA 4L2LA 4B93B 4FADA 4N3CA 4I43A 4IULA 3C5RA 3TXNA 1QYMA 5KJNA 5KWDA 2AXUA 4ATGA 3ULQA 3ZYMA 4CDRA 4HFGA 4UQXA 2L0TB 1IXVA 5FZQA 4HQDA 1JPLA 3CSFA 3ABKE 4DLOA 4ILGA 3RU0A 1EF1C 3CHPA 3RO3A 2A5UA 2WMOA 4Y6CA 3CVXA 3OTNA 4UWKA 3SFXA 4BSXA 3FTXA 3FUFA 4HLEA 3FTWA 3FTYA 1EYHA 2HYZA 3HIZA 5JMND 4WNFA 3TWWA 4UWHA 1N54A 5CHEE 2P2CP 1OWMA 3KD7A 2Y4TA 4APOA 2J8SD 3TG5A 2ZIRA 1FT1A 2DZOA 2GROB 2I6HA 3UX4A 5KJMA 2X6HA 3LPZA 3L6AA 3QKYA 4Q69A 3MV2B 2VSOE 3CK8A 3FTUA 2YHCA 3TJPA 3SFZA 3L82A 4A1SA 4HOTA 3JQ0A 3B95A 3TL5A 5G05J 3EDTB 4GTMA 3IXEA 2IO3C 1LF8A 4JVSA 5KCMA 4HVBA 1O1TA 3GYZA 4GTOA 4WNEA 3RJVA 3PZ2A 4GYOA 2IOLA 3CLJA 3I4RB 3AU5A 3F6QA 5ENQD 2PQNA 5ENSD 2I1KA 2P9NG 2XZDG 3D9NA 4RSYA 1AWCB 1MJ0A 1NA0A 5JJ7A 1BD8A 1E7UA 4A55A 5A23A 4U63A 3FFLA 2Y0BG 3EHRA 5HKPA 2ZXWE 5BW8C 5ARGA 3HXFA 3OXLA 4PS3A 5D66A 3DSTA 4B94A 2C0MA 3CHOA 4CCAA 1K1AA 2CG3A 2LSUA 2VGYA 1HX8A 4ME2A 3C3QA 2VSYA 1IKND 3ZRHA 2I9CA 4GZ3A 1INZA 3ESLA 4EQFA 5EKQD 3KEAA 5BNWA 3ZUVB 1KZOA 3FH8A 5E75A 3ZVVA 5BXUA 2B6CA 2KCLA 2LAIA 1E8YA 4Y6WA 3IKOB 3Q9NC 2VGEA 2XPYA 5DIZA 3PUKA 4KT6B 3NOCD 2LNIA 3UT7A 3Q7AA 3CVNA 3FEYA 2FI7A 3CK9A 1GW6A 1OWOA 4F3VA 3ASNE 3QARA 3Q15A 4JW1A 3IBEA 5CBOA 2AVPA 1Z3YA 3B7RL 4I6EA 1IHBA 1YCSB 3CV0A 5BUZA 2YQ8A 3DEOA 1OWNA 1DCQA 4MS6A 4FLBA 3T5VA 1DC2A 4GPKA 5ENRD 4U07A 4APFA 1WDYA 3L16A 4JPSA 5JJ6A 3UT4A 5KJKA 2XCCA 4HBDA 1MYOA 5LCWC 3DPDA 4GTTA 5KNGA 1KZPA 1WAO1 4RG6A 1QQEA 4WNGA 1O1RA 4W9RA 4JD2G 3P2BA 4KVOA 3TWTA 4GTSA 4CT0A 1OCRE 1IHGA 2V4HC 4EBAG 3ZYQA 3V30A 4EZLA 4GTQA 2JABA 2YINA 3LEWA 3CHMA 2XZTG 2Y1LE 1N11A 2LSVA 1N4RA 5G2NA 2WXJA 4GA2A 1N4PA 3D9PA 3GW4A 3OXFA 4OYSA 3MX3A 4BX8A 3MV3B 5AJDA 5HI7A 2R05A 4G24A 2OVFA 4NQ0A 5FIOA 1RZ4A 2FF4A 5D0OD 1NI1A 3NF1A 4B0ZA 1OCOE 4B89A 1H2VC 3ZW3A 2P9SG 3AG3E 3Q7FA 4AP2A 2XCBA 3UIPC 4OVUA 4L2YA 3W9FA 3FU3A 3RRMB 5AQ7A 4CT4A 4O1OA 1OT8A 3UXGA 3HXCA 1OY3D 1O5MA 1DVPA 4NIKA 4B8CB 1N95A 4XE0A 2X6FA 3LDZA 4A63B 3P1UA 2WXFA 4FHKA 2V4LA 3I5PA 1WM5A 3ZN3A 4N2QA 4AXHA 4EHMA 2IY0C 1OCZE 3RO2A 4PS8A 2CG2A 2OEVA 3PNTB 4BWRA 2L6JA 3D9LA 2ZGGA 2L6BA 1IYGA 3D3MA 5LCWJ 1E90A 4J7WA 4RVBA 4ATZD 2V5QC 3UM1A 5ENTD 5T4YA 4I2ZA 3LJ3A 2H6IA 4MRUA 3UT8A 3ZGQA 1N0QA 2QYJA 1KT1A 3FHEA 1A17A 3NBNB 1MX4A 2WXHA 1OWPA 3B7UX 2FO7A 4A3VA 1U3DA 2LUHA 3IV0A 5CEDB 3E34A 4K5CA 3FUKA 4E6HA 2WXRA 1FVHA 3Q47B 3JXIA 4GCNA 2KBXA 1NA3A 4BEPA 5AARA 3CVPA 4DX6D 4HRNA 1HFAA 4K0RA 4O1PA 4GMRA 2PQRA 4CZ2D 3CKBA 4I2WA 5FQ7A 1H6KA 1BI7B 3TWUA 5C2YA 4AVXA 4MBGA 5AENA 2IO2C 5A7DB 4LSZE 2AXZA 3BG0B 2DYSE 1Y6IA 1KT0A 4AV7A 2J4BA 1JWFA 3AG1E 4MLPA 1FPPA 1V54E 5BT1A 4U8YD 5AIJA 4GYWA 4KBQA 3CR3A 3B7SA 4Q96A 3SF4A 4X8QA 3V79K 4BSZB 3DXKG 3R9AB 4L23A 5FTPA 4U0ZA 4IRUA 4YVOA 1D8DA 2DYRE 3CVLA 5JHBA 1K1BA 4YDOA 3SGHA 2BTDA 4I6JA 5EDSA 4J8DA 4LNUD 2P9LG 4QFVA 3MJWA 3FUMA 2E2EA 4KZCA 1YMPA 4QQIA 1KLXA 2XGMA 3ML8A 4G25A 2Y3AA 2E0IA 1HG2A 3ISMC 5EN5D 2X6JA 3HRAA 2HE0A 2ZGDA 3EU5A 3QB2A 4K03A 2GRRB 2X6KA 2EILE 2P9KG 5ANLA 3JUEA 4G8LA 4XEIG 4IN3B 1Y8MA 2IQCA 1OXJA 2EIKE 3DSVA 3FU5A 4BT9A 4C48B 3PZ4A 1TNUA 1OUVA 3FTZA 3ASDA 3D9OA 1N94A 1L5JA 1QZ2A 3DBSA 5CCLA 5A6CA 5DBKA 5BXOA 4JEUA 2WXIA 4JA9A 3L13A 4ACLA 1H6OA 2OVBA 5CCMA 4PH4B 3ASOE 2UWJG 4UUCA 4LNGA 3CHRA 3ASHA 3HXBA 2J4DA 1TN7A 1DNPA 4DRXE 2FO1E 2BEDA 3G2UA 4CDMA 2ONDA 1PC2A 3HXEA 3BEEA 4HORA 3Q73A 3O48A 3CSTA 3FDHA 2DZNA 2H6GA 3MYVA 2CFZA 2F0YA 3L08A 1N52A 3E32A 2JEKA 4N5CA 3D9KA 1LD8A 2GRPB 4DX2A 3E33A 3CKCA 4XKCA 4BTAA 1SZ9A 3Q4AB 1H19A 4G26A 1TR4A 1N0RA 3BU8A 3CGHA 2PL2A 2VJ8A 3OAWA 3V2OA 3ONLA 2MRIA 4I9EA 4YDYA 3E30A 3LKUA 3TAXA 4J8EA 2P9UG 4CYMD 2KZTB 2VSXE 4I1AA 2XRZA 2KM4A 2WXGA 3PS6A 4U04A 2FBNA 5AQAA 2LXLA 5FQ6A 3E4BA 2L0IA 2CHXA 2YNQA 4N3AA 5CBNA 3ZXSA 3QWWA 4DUIA 3PZ1A 4HOQA 5G55A 4BFRA 3N71A 3T5XA 1UG3A 4CEMA 2WVIA 3LS8A 4HS2A 4U0SA 5AQ9A 2V8SE 3JCKC 3R7QA 1MX6A 4WWPA 4GPMA 4C0EA 3ABLE 2J09A 4DX7D 3FUNA 4RLYA 1EPUA 2WM9A 2VGXB 3ZHEB 4JHJA 3CHQA 3V2XA 2F8YA 1DCEA 2VGXA 3ZHEA 3UI2A 2XEEA 2QC9A 1FCHA 4LUNU 4AEZC 4R7LA 1JCRA 4L1BA 5B1AE 5FZSA 4FJYA 2VQ2A 1HU3A 1JWGA 4YVQC 2CHZA 2DIWA 3ULEG 3EHNA 2EIJE 1H2UA 5ARFA 1XNFA 1BI8B 2XEVA 3JYSA 4XKBA 5E76A 3DEPA 5CERB 3NOGD 2WXNA 3FH5A 3BUAA 1YA0A 5ENPD 5KNHD 4HRMB 4AOFA 3MCXA 3HYMB 4LRZA 1B89A 4HI9A 4K5AB 5HRYA 3QDNA 1JCSA 2A4ZA 3PZDA 3PRZA 4RG9A 2XPIA 2MOWA 4KZ0A 4UQYA 3ZNGA 3KEZA 3TGOA 4GZ5A 3Q5MA 4FP7A 3MA5A 3ZXPA 3AG4E 1FT2A 2P58C 4DI3A 4J8FA 4DX5D 5CMWA 4H7YA 4DPRA 4I9CA 3LVQE 2ZISA 3CVYA 5FQ4A 2PM6A 1H2TC 1Z5SC 3AJIA 3LJNA 4J6IA 1NFIE 4HLLA 3CIAA 3UM0A 5M72A 4XIFA 1OWLA 4GTRA 3CVUA 1ELKA 3FH7A 1Q2ZA 1HO8A 4DLQA 2GRNB 3PREA 1S63A 3FUJA 1D9SA 4WNDA 1LD7A 3MEKA 3TWXA 2XRYA 2IJGX 4GZDA 3T8KA 3UTMA 2PNNA 4XZ4A 2X3MA 2XGOA 4N3BA 5BV1A 4EZJA 4U8VD 5C1DA 2RFAA 1W3BA 2VTBB 3NAWA 4DK5A 1E8XA 3TG4A 3HXDA 3TWSA 3TXMA 4TUUA 3ASGA 3SBSA 4Z68A 5CEAA 3S7BA 4WWOA 3B7TA 3D9IA 4LERA 3HHMA 3DSWA 1TN8A 1TJCA 2XENA 3EHMA 4UI9K 3RK6A 3E37A 4N39A 1N4QA 3WG7E 2X6IA 4L7TA 2FEZA 4G23A 3EIQC 3QC1A 3TWVA 5CRUA 4WAFA 4OVVA 3UUXA 4NRHB 4OAVB 3BQOA 4ILHB 1Z3XA 4CRWA 2P9IG 4AJWA 4KMOA 3C98A 1IQUA 1MX2A 3RSEG 4B8AA 1MQSA 3LXUX 1KPSB 4U7EB 2Q7FA 4BT8A 4HOSA 2WQ7A 3DSSA 3VTYA 1ELWA 4M7CA 1ZB1A 2QFCA 3AS8A 4FU3A 1YYHA 1NP7A 1SZAA 3UPVA 5T3RA 3JUIA 3G2WA 3ML9A 3U64A 3Q49B 4NURA 1E8ZA 3PE3A 2IU1A 3GZ2A 4HI8A 3FTVA 3S7DA 4GYYA 3HG0D 2WMNA 4UWFA 5LX8A 3SO8A 1BLXB 3Q9UC 5ITZF 2BUGA 1TJFA 2DWZA 4XX5A 3RKVA 2LXMA 3FUIA 3OXGA 4F7AA 2R5SA 1WY6A 4EPZA 4V3IA 4JC8A 3ENEA 1V55E 4GAAA 1RW2A 4FC8A 1HXIA 3PEUB 1U3CA 2WQ6A 2RG8A 3URZA 4UI9C 2GW1A 3ZPJA 1FVFA 3G2VA 5FJYA 3ZIMA 3PUJA 2WQHA 2GGFA 4ZHBA 2J9QA 4L9PA 4LCTA 4U0UA 3RRNB 3MGBA 3SFYA 1H6PA 2H6HA 3PZ3A 2VYIA 4GTPA 1S70B 2NC9A 3PE4A 3RIBA 1S64A 4GA0A 5LP0A 2NXPA 3S7FA 5JHAA 4O6FA 2ILRA 3QNKA 4I1MA 3B7BA 3FEXA 3UM2A 4G1TA 1X81A 3C72A 3L22A 3G2SA 3U9WA 1K8KG 3ZYLA 2BKKB 3Q78A 2IONA 3LYAA 3S7JA 4J0UA 2UY1B 4I6GA 3LVRE 3QWVA 3SD5A 4UQZA 1MHQA 1QNFA 5J08A 3KSLA 2X38A 2UY1A 3V31A 5D0QD 4D10C 4JB8P 3PDNA 4GTVA 5JA4D 3CVVA 3AG2E 5G04C 2WXQA 4P29A 2ETCA 2KC7A 1Z6TA 1ZU2A 3DRAA 3UINC 2KCVA 3EUVA 1HH8A 2HR2A 2NSZA 4HXIA 2YHEA 3DSXA 1UOHA 4XI0A 4GMLA 2IOSA 4JXTA 4TXPA 2HM8A 4N2SA 2A5EA 3RAUA 1HF8A 4A3TA 2EINE 4KXKB 1HZ4A 3DPYA 4GZ6A 5FWQA 4UI9J 2V5FA 1TNZA 5HS0A 4TXQA 3Q79A 3SBTB 3PNLB 5D2MC 4JHKA 3SI5A 4HRLA 1HS6A 4N5QA 4DI4A 3ZFWA 3SNXA 3EIJA 3UQ3A 2OV8A 2R03A 1UJJA 3ASFA 3ZYKA 2QY7A 1UN9A 4CGVA 3U4TA 1NZNA 3T9KA 3KAEA 1TNOA 3G2TA 3I3NA 2VSNA 4F1SA 4JHRA 3D9HA 4M3OA 2KZTA 3QWPA 1SA4A 1ZBPA 4YDEA 2EQXA 4GMJA 2XGSA 2WPVA 3AAAC 3WXXA 5B1BE 3SHFA 3LY9A 3FY4A 4G11A 5HQ8A 3C3OA 1TNBA 5J90A 4PDXA 2LAHA 5ENNA 2ETBA 3B13A 1E8WA 3SY2A 3J5PA 2JLBA 3O4ZA 5FT9A 3AS4A 2IEJA 2HO1A 2PM7A 1TYQG 3ABME 2CFUA 3KS2A 5BV0A 4Q94A 3R7RA 4I17A 4WUYA 3I4GA 3BG1B 2F8XK 5G04J 3IHVA 1P5QA 1MZCA 4LNBA 3CVWA 1NL4A 5EIDA 4TXRA 2IF4A 2GRLA 2LO6A 2EIME 4UWGA 4KYOB 5FINA 3U3WA 4A1GA 4GB9A 3JXJA 2J49A 1UN8A 5FZRA 2KCKA 4JEHA 4BESA 3TWRA 2XHEA 3APDA 4JZYA 3VTXA 3QJZA 2MYOA 2C0LA 3R9MA 5KBAA 1N4SA 1SQMA 4YNDA 3VLFA 3W9GA 5EYLA 4FA6A 5KJLA 1H0AA 3LCAA 4FULA 3AS5A 3NZSA 3UKUG 3IEGA 2AW6A 5EILA 3D9MA 5AYWD 4IYPA 1O1SA 2GRQB 2J07A 4XI9A 4K5BA 3ZEFA 2BKGA 3ZKJA 4EZKA 4PS7A 5EX0A 3UM3A 4BTBA 1HG5A 4AIFA 2R2LA 4DX1A 2H6FA 3PVLA 2I2OA 4BY6A 1BU9A 3CHSA 2RD0A 2KXPC 2NYJA 1WG0A 3SQVA 3ONKA 3EHQA 3FUDA 4ACKA 4GCOA 3T8MA 2OCCE 3U66A 2DCPA 5LFAA 2XPZA 4C9BB 3K9IA 1IQRA 4U95D 3CEQA 5AAOA 5EX3A 1G3NB 5B3SE 1N9AA 4GA1A 5ANRA 2WXLA 1S0PA 4U8HA 3QOUA 5IY5E 2XEHA 2DBAA 3D9JA 4TV3A 1TNYA 3MKQB 3HVEB 3MKRA 4O60A 1EDUA 4TRQA 3ULYA 5H7PA 1OCCE 5AQBA 4F53A 5CECB 5AN8A 3C3RA 2WXKA 3MKQA 2AJAA 3HVEA 3TWQA 3LY7A 2J08A 2XS8A 3ESKA 4JA7A 3UKRG 4HB5A 2MHKA 4AM9A 3FU0A 2VTBA 3QAQA 4GZCA 1ELRA 4MKTA 1SW6A 4ANUA 4ABNA 3CK7A 3KSQA 4BERA 1E7VA 1PY1A 1SA5A 5BPPA 4EBAA 3UMVA 1VDYA 1UJKA 3CQGB 1JCQA 4J8SA 4CDNA 2RKKA 2CHWA 2WB2A 2AXVA 5EIBE 1HE8A 1A5EA 3EJNA 3QK0A 1PAQA 3APCA 5EYPF 2XS1A 2C2LA 4ANVA 4J8YA 2FULA 2B0OE 4FJZA 4JL0A 1UW4B 4HNAD 1BPOA 2KATA 2WXOA 2WXPA 5ENOD 4DJAA 3EU9A 4BX9A 3FU6A 1QBQA 4ANWA 5CRVA 1LTXA 1E96B 3FP3A 4OAUC 3LY8A 4NACA 2AWIA 4CGWA 2L9BA 3PH0C 4G2VA 5JJTA 1JUQA 3Q75A 5LOZA 3L54A 4BETA 3CVQA 3JQ1A 2QZAA 4RQIA 3FWVA 3DWLG 3L9TA 3FUHA 2DVWA 4FHJA 2QYUA 2P9PG 4WWNA 4URKA 2R02A 3MZLB 3IHYA 1TN6A 4LEUA 2IFUA 3NZUA 2RFMA 4ANXA 1U2VG 4LG6A 3RRUA 5T8IA 2BF0X 1SVXA 2V0PA 1AP7A 3DSUA 2Y69E 2GRMA 1K3ZD 5CMYA 4E85A 4U96D 3S2AA 3FTSA 2OEWA 2R59A 1TEZA 3CQCB 3UIOC 3X2QE 3FULA 4UWLA 4AY5A 3NB2A 3NQPA 3GZSA 4YDWA 4PUCA 2XQ0A 1XGWA 2OOEA 4C0MA 4EECA 3HDXA 4TUMA 5FQ8A 2F37A 2WXMA 3ZU7B 4I1OB 3GZ1A 2R17C 4AY6A 5G05C 5AJLA 3VLDA 3APFA 2ZU6B 4H7XA 4FLHA 2M63A 3SZ7A 4ZFHA 3L17A 4F6RD 4ILIA 2ETAA 2PZIA 4G8KA 3VLEA 1D8EA 2I1JA 3J5QB 1X5BA 3AU4A 2Y4UA 3FUEA 3DXMG 4GU5A 4HOUA 4KVMA
chains in the Genus database with same CATH topology
3AG2E 5IY5E 3WG7E 2EIJE 3ASOE 2Y69E 3ABLE 2EINE 2EILE 2OCCE 3ASNE 3ABKE 2ZXWE 2DYSE 1OCCE 2EIKE 2DYRE 1OCOE 3AG1E 1OCRE 1V54E 1V55E 1OCZE 5B1AE 3AG3E 3X2QE 3AG4E 2EIME 5B1BE 5B3SE 3ABME
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG2 E;  5IY5 E;  3WG7 E;  2EIJ E;  3ASO E;  2Y69 E;  3ABL E;  2EIN E;  2EIL E;  2OCC E;  3ASN E;  3ABK E;  2ZXW E;  2DYS E;  1OCC E;  2EIK E;  2DYR E;  1OCO E;  3AG1 E;  1OCR E;  1V54 E;  1V55 E;  1OCZ E;  5B1A E;  3AG3 E;  3X2Q E;  3AG4 E;  2EIM E;  5B1B E;  5B3S E;  3ABM E; 
#chains in the Genus database with same CATH topology
 3PEV B;  4F1P A;  4L2L A;  4B93 B;  4FAD A;  4N3C A;  4I43 A;  4IUL A;  3C5R A;  3TXN A;  1QYM A;  5KJN A;  5KWD A;  2AXU A;  4ATG A;  3ULQ A;  3ZYM A;  4CDR A;  4HFG A;  4UQX A;  2L0T B;  1IXV A;  5FZQ A;  4HQD A;  1JPL A;  3CSF A;  3ABK E;  4DLO A;  4ILG A;  3RU0 A;  1EF1 C;  3CHP A;  3RO3 A;  2A5U A;  2WMO A;  4Y6C A;  3CVX A;  3OTN A;  4UWK A;  3SFX A;  4BSX A;  3FTX A;  3FUF A;  4HLE A;  3FTW A;  3FTY A;  1EYH A;  2HYZ A;  3HIZ A;  5JMN D;  4WNF A;  3TWW A;  4UWH A;  1N54 A;  5CHE E;  2P2C P;  1OWM A;  3KD7 A;  2Y4T A;  4APO A;  2J8S D;  3TG5 A;  2ZIR A;  1FT1 A;  2DZO A;  2GRO B;  2I6H A;  3UX4 A;  5KJM A;  2X6H A;  3LPZ A;  3L6A A;  3QKY A;  4Q69 A;  3MV2 B;  2VSO E;  3CK8 A;  3FTU A;  2YHC A;  3TJP A;  3SFZ A;  3L82 A;  4A1S A;  4HOT A;  3JQ0 A;  3B95 A;  3TL5 A;  5G05 J;  3EDT B;  4GTM A;  3IXE A;  2IO3 C;  1LF8 A;  4JVS A;  5KCM A;  4HVB A;  1O1T A;  3GYZ A;  4GTO A;  4WNE A;  3RJV A;  3PZ2 A;  4GYO A;  2IOL A;  3CLJ A;  3I4R B;  3AU5 A;  3F6Q A;  5ENQ D;  2PQN A;  5ENS D;  2I1K A;  2P9N G;  2XZD G;  3D9N A;  4RSY A;  1AWC B;  1MJ0 A;  1NA0 A;  5JJ7 A;  1BD8 A;  1E7U A;  4A55 A;  5A23 A;  4U63 A;  3FFL A;  2Y0B G;  3EHR A;  5HKP A;  2ZXW E;  5BW8 C;  5ARG A;  3HXF A;  3OXL A;  4PS3 A;  5D66 A;  3DST A;  4B94 A;  2C0M A;  3CHO A;  4CCA A;  1K1A A;  2CG3 A;  2LSU A;  2VGY A;  1HX8 A;  4ME2 A;  3C3Q A;  2VSY A;  1IKN D;  3ZRH A;  2I9C A;  4GZ3 A;  1INZ A;  3ESL A;  4EQF A;  5EKQ D;  3KEA A;  5BNW A;  3ZUV B;  1KZO A;  3FH8 A;  5E75 A;  3ZVV A;  5BXU A;  2B6C A;  2KCL A;  2LAI A;  1E8Y A;  4Y6W A;  3IKO B;  3Q9N C;  2VGE A;  2XPY A;  5DIZ A;  3PUK A;  4KT6 B;  3NOC D;  2LNI A;  3UT7 A;  3Q7A A;  3CVN A;  3FEY A;  2FI7 A;  3CK9 A;  1GW6 A;  1OWO A;  4F3V A;  3ASN E;  3QAR A;  3Q15 A;  4JW1 A;  3IBE A;  5CBO A;  2AVP A;  1Z3Y A;  3B7R L;  4I6E A;  1IHB A;  1YCS B;  3CV0 A;  5BUZ A;  2YQ8 A;  3DEO A;  1OWN A;  1DCQ A;  4MS6 A;  4FLB A;  3T5V A;  1DC2 A;  4GPK A;  5ENR D;  4U07 A;  4APF A;  1WDY A;  3L16 A;  4JPS A;  5JJ6 A;  3UT4 A;  5KJK A;  2XCC A;  4HBD A;  1MYO A;  5LCW C;  3DPD A;  4GTT A;  5KNG A;  1KZP A;  1WAO 1;  4RG6 A;  1QQE A;  4WNG A;  1O1R A;  4W9R A;  4JD2 G;  3P2B A;  4KVO A;  3TWT A;  4GTS A;  4CT0 A;  1OCR E;  1IHG A;  2V4H C;  4EBA G;  3ZYQ A;  3V30 A;  4EZL A;  4GTQ A;  2JAB A;  2YIN A;  3LEW A;  3CHM A;  2XZT G;  2Y1L E;  1N11 A;  2LSV A;  1N4R A;  5G2N A;  2WXJ A;  4GA2 A;  1N4P A;  3D9P A;  3GW4 A;  3OXF A;  4OYS A;  3MX3 A;  4BX8 A;  3MV3 B;  5AJD A;  5HI7 A;  2R05 A;  4G24 A;  2OVF A;  4NQ0 A;  5FIO A;  1RZ4 A;  2FF4 A;  5D0O D;  1NI1 A;  3NF1 A;  4B0Z A;  1OCO E;  4B89 A;  1H2V C;  3ZW3 A;  2P9S G;  3AG3 E;  3Q7F A;  4AP2 A;  2XCB A;  3UIP C;  4OVU A;  4L2Y A;  3W9F A;  3FU3 A;  3RRM B;  5AQ7 A;  4CT4 A;  4O1O A;  1OT8 A;  3UXG A;  3HXC A;  1OY3 D;  1O5M A;  1DVP A;  4NIK A;  4B8C B;  1N95 A;  4XE0 A;  2X6F A;  3LDZ A;  4A63 B;  3P1U A;  2WXF A;  4FHK A;  2V4L A;  3I5P A;  1WM5 A;  3ZN3 A;  4N2Q A;  4AXH A;  4EHM A;  2IY0 C;  1OCZ E;  3RO2 A;  4PS8 A;  2CG2 A;  2OEV A;  3PNT B;  4BWR A;  2L6J A;  3D9L A;  2ZGG A;  2L6B A;  1IYG A;  3D3M A;  5LCW J;  1E90 A;  4J7W A;  4RVB A;  4ATZ D;  2V5Q C;  3UM1 A;  5ENT D;  5T4Y A;  4I2Z A;  3LJ3 A;  2H6I A;  4MRU A;  3UT8 A;  3ZGQ A;  1N0Q A;  2QYJ A;  1KT1 A;  3FHE A;  1A17 A;  3NBN B;  1MX4 A;  2WXH A;  1OWP A;  3B7U X;  2FO7 A;  4A3V A;  1U3D A;  2LUH A;  3IV0 A;  5CED B;  3E34 A;  4K5C A;  3FUK A;  4E6H A;  2WXR A;  1FVH A;  3Q47 B;  3JXI A;  4GCN A;  2KBX A;  1NA3 A;  4BEP A;  5AAR A;  3CVP A;  4DX6 D;  4HRN A;  1HFA A;  4K0R A;  4O1P A;  4GMR A;  2PQR A;  4CZ2 D;  3CKB A;  4I2W A;  5FQ7 A;  1H6K A;  1BI7 B;  3TWU A;  5C2Y A;  4AVX A;  4MBG A;  5AEN A;  2IO2 C;  5A7D B;  4LSZ E;  2AXZ A;  3BG0 B;  2DYS E;  1Y6I A;  1KT0 A;  4AV7 A;  2J4B A;  1JWF A;  3AG1 E;  4MLP A;  1FPP A;  1V54 E;  5BT1 A;  4U8Y D;  5AIJ A;  4GYW A;  4KBQ A;  3CR3 A;  3B7S A;  4Q96 A;  3SF4 A;  4X8Q A;  3V79 K;  4BSZ B;  3DXK G;  3R9A B;  4L23 A;  5FTP A;  4U0Z A;  4IRU A;  4YVO A;  1D8D A;  2DYR E;  3CVL A;  5JHB A;  1K1B A;  4YDO A;  3SGH A;  2BTD A;  4I6J A;  5EDS A;  4J8D A;  4LNU D;  2P9L G;  4QFV A;  3MJW A;  3FUM A;  2E2E A;  4KZC A;  1YMP A;  4QQI A;  1KLX A;  2XGM A;  3ML8 A;  4G25 A;  2Y3A A;  2E0I A;  1HG2 A;  3ISM C;  5EN5 D;  2X6J A;  3HRA A;  2HE0 A;  2ZGD A;  3EU5 A;  3QB2 A;  4K03 A;  2GRR B;  2X6K A;  2EIL E;  2P9K G;  5ANL A;  3JUE A;  4G8L A;  4XEI G;  4IN3 B;  1Y8M A;  2IQC A;  1OXJ A;  2EIK E;  3DSV A;  3FU5 A;  4BT9 A;  4C48 B;  3PZ4 A;  1TNU A;  1OUV A;  3FTZ A;  3ASD A;  3D9O A;  1N94 A;  1L5J A;  1QZ2 A;  3DBS A;  5CCL A;  5A6C A;  5DBK A;  5BXO A;  4JEU A;  2WXI A;  4JA9 A;  3L13 A;  4ACL A;  1H6O A;  2OVB A;  5CCM A;  4PH4 B;  3ASO E;  2UWJ G;  4UUC A;  4LNG A;  3CHR A;  3ASH A;  3HXB A;  2J4D A;  1TN7 A;  1DNP A;  4DRX E;  2FO1 E;  2BED A;  3G2U A;  4CDM A;  2OND A;  1PC2 A;  3HXE A;  3BEE A;  4HOR A;  3Q73 A;  3O48 A;  3CST A;  3FDH A;  2DZN A;  2H6G A;  3MYV A;  2CFZ A;  2F0Y A;  3L08 A;  1N52 A;  3E32 A;  2JEK A;  4N5C A;  3D9K A;  1LD8 A;  2GRP B;  4DX2 A;  3E33 A;  3CKC A;  4XKC A;  4BTA A;  1SZ9 A;  3Q4A B;  1H19 A;  4G26 A;  1TR4 A;  1N0R A;  3BU8 A;  3CGH A;  2PL2 A;  2VJ8 A;  3OAW A;  3V2O A;  3ONL A;  2MRI A;  4I9E A;  4YDY A;  3E30 A;  3LKU A;  3TAX A;  4J8E A;  2P9U G;  4CYM D;  2KZT B;  2VSX E;  4I1A A;  2XRZ A;  2KM4 A;  2WXG A;  3PS6 A;  4U04 A;  2FBN A;  5AQA A;  2LXL A;  5FQ6 A;  3E4B A;  2L0I A;  2CHX A;  2YNQ A;  4N3A A;  5CBN A;  3ZXS A;  3QWW A;  4DUI A;  3PZ1 A;  4HOQ A;  5G55 A;  4BFR A;  3N71 A;  3T5X A;  1UG3 A;  4CEM A;  2WVI A;  3LS8 A;  4HS2 A;  4U0S A;  5AQ9 A;  2V8S E;  3JCK C;  3R7Q A;  1MX6 A;  4WWP A;  4GPM A;  4C0E A;  3ABL E;  2J09 A;  4DX7 D;  3FUN A;  4RLY A;  1EPU A;  2WM9 A;  2VGX B;  3ZHE B;  4JHJ A;  3CHQ A;  3V2X A;  2F8Y A;  1DCE A;  2VGX A;  3ZHE A;  3UI2 A;  2XEE A;  2QC9 A;  1FCH A;  4LUN U;  4AEZ C;  4R7L A;  1JCR A;  4L1B A;  5B1A E;  5FZS A;  4FJY A;  2VQ2 A;  1HU3 A;  1JWG A;  4YVQ C;  2CHZ A;  2DIW A;  3ULE G;  3EHN A;  2EIJ E;  1H2U A;  5ARF A;  1XNF A;  1BI8 B;  2XEV A;  3JYS A;  4XKB A;  5E76 A;  3DEP A;  5CER B;  3NOG D;  2WXN A;  3FH5 A;  3BUA A;  1YA0 A;  5ENP D;  5KNH D;  4HRM B;  4AOF A;  3MCX A;  3HYM B;  4LRZ A;  1B89 A;  4HI9 A;  4K5A B;  5HRY A;  3QDN A;  1JCS A;  2A4Z A;  3PZD A;  3PRZ A;  4RG9 A;  2XPI A;  2MOW A;  4KZ0 A;  4UQY A;  3ZNG A;  3KEZ A;  3TGO A;  4GZ5 A;  3Q5M A;  4FP7 A;  3MA5 A;  3ZXP A;  3AG4 E;  1FT2 A;  2P58 C;  4DI3 A;  4J8F A;  4DX5 D;  5CMW A;  4H7Y A;  4DPR A;  4I9C A;  3LVQ E;  2ZIS A;  3CVY A;  5FQ4 A;  2PM6 A;  1H2T C;  1Z5S C;  3AJI A;  3LJN A;  4J6I A;  1NFI E;  4HLL A;  3CIA A;  3UM0 A;  5M72 A;  4XIF A;  1OWL A;  4GTR A;  3CVU A;  1ELK A;  3FH7 A;  1Q2Z A;  1HO8 A;  4DLQ A;  2GRN B;  3PRE A;  1S63 A;  3FUJ A;  1D9S A;  4WND A;  1LD7 A;  3MEK A;  3TWX A;  2XRY A;  2IJG X;  4GZD A;  3T8K A;  3UTM A;  2PNN A;  4XZ4 A;  2X3M A;  2XGO A;  4N3B A;  5BV1 A;  4EZJ A;  4U8V D;  5C1D A;  2RFA A;  1W3B A;  2VTB B;  3NAW A;  4DK5 A;  1E8X A;  3TG4 A;  3HXD A;  3TWS A;  3TXM A;  4TUU A;  3ASG A;  3SBS A;  4Z68 A;  5CEA A;  3S7B A;  4WWO A;  3B7T A;  3D9I A;  4LER A;  3HHM A;  3DSW A;  1TN8 A;  1TJC A;  2XEN A;  3EHM A;  4UI9 K;  3RK6 A;  3E37 A;  4N39 A;  1N4Q A;  3WG7 E;  2X6I A;  4L7T A;  2FEZ A;  4G23 A;  3EIQ C;  3QC1 A;  3TWV A;  5CRU A;  4WAF A;  4OVV A;  3UUX A;  4NRH B;  4OAV B;  3BQO A;  4ILH B;  1Z3X A;  4CRW A;  2P9I G;  4AJW A;  4KMO A;  3C98 A;  1IQU A;  1MX2 A;  3RSE G;  4B8A A;  1MQS A;  3LXU X;  1KPS B;  4U7E B;  2Q7F A;  4BT8 A;  4HOS A;  2WQ7 A;  3DSS A;  3VTY A;  1ELW A;  4M7C A;  1ZB1 A;  2QFC A;  3AS8 A;  4FU3 A;  1YYH A;  1NP7 A;  1SZA A;  3UPV A;  5T3R A;  3JUI A;  3G2W A;  3ML9 A;  3U64 A;  3Q49 B;  4NUR A;  1E8Z A;  3PE3 A;  2IU1 A;  3GZ2 A;  4HI8 A;  3FTV A;  3S7D A;  4GYY A;  3HG0 D;  2WMN A;  4UWF A;  5LX8 A;  3SO8 A;  1BLX B;  3Q9U C;  5ITZ F;  2BUG A;  1TJF A;  2DWZ A;  4XX5 A;  3RKV A;  2LXM A;  3FUI A;  3OXG A;  4F7A A;  2R5S A;  1WY6 A;  4EPZ A;  4V3I A;  4JC8 A;  3ENE A;  1V55 E;  4GAA A;  1RW2 A;  4FC8 A;  1HXI A;  3PEU B;  1U3C A;  2WQ6 A;  2RG8 A;  3URZ A;  4UI9 C;  2GW1 A;  3ZPJ A;  1FVF A;  3G2V A;  5FJY A;  3ZIM A;  3PUJ A;  2WQH A;  2GGF A;  4ZHB A;  2J9Q A;  4L9P A;  4LCT A;  4U0U A;  3RRN B;  3MGB A;  3SFY A;  1H6P A;  2H6H A;  3PZ3 A;  2VYI A;  4GTP A;  1S70 B;  2NC9 A;  3PE4 A;  3RIB A;  1S64 A;  4GA0 A;  5LP0 A;  2NXP A;  3S7F A;  5JHA A;  4O6F A;  2ILR A;  3QNK A;  4I1M A;  3B7B A;  3FEX A;  3UM2 A;  4G1T A;  1X81 A;  3C72 A;  3L22 A;  3G2S A;  3U9W A;  1K8K G;  3ZYL A;  2BKK B;  3Q78 A;  2ION A;  3LYA A;  3S7J A;  4J0U A;  2UY1 B;  4I6G A;  3LVR E;  3QWV A;  3SD5 A;  4UQZ A;  1MHQ A;  1QNF A;  5J08 A;  3KSL A;  2X38 A;  2UY1 A;  3V31 A;  5D0Q D;  4D10 C;  4JB8 P;  3PDN A;  4GTV A;  5JA4 D;  3CVV A;  3AG2 E;  5G04 C;  2WXQ A;  4P29 A;  2ETC A;  2KC7 A;  1Z6T A;  1ZU2 A;  3DRA A;  3UIN C;  2KCV A;  3EUV A;  1HH8 A;  2HR2 A;  2NSZ A;  4HXI A;  2YHE A;  3DSX A;  1UOH A;  4XI0 A;  4GML A;  2IOS A;  4JXT A;  4TXP A;  2HM8 A;  4N2S A;  2A5E A;  3RAU A;  1HF8 A;  4A3T A;  2EIN E;  4KXK B;  1HZ4 A;  3DPY A;  4GZ6 A;  5FWQ A;  4UI9 J;  2V5F A;  1TNZ A;  5HS0 A;  4TXQ A;  3Q79 A;  3SBT B;  3PNL B;  5D2M C;  4JHK A;  3SI5 A;  4HRL A;  1HS6 A;  4N5Q A;  4DI4 A;  3ZFW A;  3SNX A;  3EIJ A;  3UQ3 A;  2OV8 A;  2R03 A;  1UJJ A;  3ASF A;  3ZYK A;  2QY7 A;  1UN9 A;  4CGV A;  3U4T A;  1NZN A;  3T9K A;  3KAE A;  1TNO A;  3G2T A;  3I3N A;  2VSN A;  4F1S A;  4JHR A;  3D9H A;  4M3O A;  2KZT A;  3QWP A;  1SA4 A;  1ZBP A;  4YDE A;  2EQX A;  4GMJ A;  2XGS A;  2WPV A;  3AAA C;  3WXX A;  5B1B E;  3SHF A;  3LY9 A;  3FY4 A;  4G11 A;  5HQ8 A;  3C3O A;  1TNB A;  5J90 A;  4PDX A;  2LAH A;  5ENN A;  2ETB A;  3B13 A;  1E8W A;  3SY2 A;  3J5P A;  2JLB A;  3O4Z A;  5FT9 A;  3AS4 A;  2IEJ A;  2HO1 A;  2PM7 A;  1TYQ G;  3ABM E;  2CFU A;  3KS2 A;  5BV0 A;  4Q94 A;  3R7R A;  4I17 A;  4WUY A;  3I4G A;  3BG1 B;  2F8X K;  5G04 J;  3IHV A;  1P5Q A;  1MZC A;  4LNB A;  3CVW A;  1NL4 A;  5EID A;  4TXR A;  2IF4 A;  2GRL A;  2LO6 A;  2EIM E;  4UWG A;  4KYO B;  5FIN A;  3U3W A;  4A1G A;  4GB9 A;  3JXJ A;  2J49 A;  1UN8 A;  5FZR A;  2KCK A;  4JEH A;  4BES A;  3TWR A;  2XHE A;  3APD A;  4JZY A;  3VTX A;  3QJZ A;  2MYO A;  2C0L A;  3R9M A;  5KBA A;  1N4S A;  1SQM A;  4YND A;  3VLF A;  3W9G A;  5EYL A;  4FA6 A;  5KJL A;  1H0A A;  3LCA A;  4FUL A;  3AS5 A;  3NZS A;  3UKU G;  3IEG A;  2AW6 A;  5EIL A;  3D9M A;  5AYW D;  4IYP A;  1O1S A;  2GRQ B;  2J07 A;  4XI9 A;  4K5B A;  3ZEF A;  2BKG A;  3ZKJ A;  4EZK A;  4PS7 A;  5EX0 A;  3UM3 A;  4BTB A;  1HG5 A;  4AIF A;  2R2L A;  4DX1 A;  2H6F A;  3PVL A;  2I2O A;  4BY6 A;  1BU9 A;  3CHS A;  2RD0 A;  2KXP C;  2NYJ A;  1WG0 A;  3SQV A;  3ONK A;  3EHQ A;  3FUD A;  4ACK A;  4GCO A;  3T8M A;  2OCC E;  3U66 A;  2DCP A;  5LFA A;  2XPZ A;  4C9B B;  3K9I A;  1IQR A;  4U95 D;  3CEQ A;  5AAO A;  5EX3 A;  1G3N B;  5B3S E;  1N9A A;  4GA1 A;  5ANR A;  2WXL A;  1S0P A;  4U8H A;  3QOU A;  5IY5 E;  2XEH A;  2DBA A;  3D9J A;  4TV3 A;  1TNY A;  3MKQ B;  3HVE B;  3MKR A;  4O60 A;  1EDU A;  4TRQ A;  3ULY A;  5H7P A;  1OCC E;  5AQB A;  4F53 A;  5CEC B;  5AN8 A;  3C3R A;  2WXK A;  3MKQ A;  2AJA A;  3HVE A;  3TWQ A;  3LY7 A;  2J08 A;  2XS8 A;  3ESK A;  4JA7 A;  3UKR G;  4HB5 A;  2MHK A;  4AM9 A;  3FU0 A;  2VTB A;  3QAQ A;  4GZC A;  1ELR A;  4MKT A;  1SW6 A;  4ANU A;  4ABN A;  3CK7 A;  3KSQ A;  4BER A;  1E7V A;  1PY1 A;  1SA5 A;  5BPP A;  4EBA A;  3UMV A;  1VDY A;  1UJK A;  3CQG B;  1JCQ A;  4J8S A;  4CDN A;  2RKK A;  2CHW A;  2WB2 A;  2AXV A;  5EIB E;  1HE8 A;  1A5E A;  3EJN A;  3QK0 A;  1PAQ A;  3APC A;  5EYP F;  2XS1 A;  2C2L A;  4ANV A;  4J8Y A;  2FUL A;  2B0O E;  4FJZ A;  4JL0 A;  1UW4 B;  4HNA D;  1BPO A;  2KAT A;  2WXO A;  2WXP A;  5ENO D;  4DJA A;  3EU9 A;  4BX9 A;  3FU6 A;  1QBQ A;  4ANW A;  5CRV A;  1LTX A;  1E96 B;  3FP3 A;  4OAU C;  3LY8 A;  4NAC A;  2AWI A;  4CGW A;  2L9B A;  3PH0 C;  4G2V A;  5JJT A;  1JUQ A;  3Q75 A;  5LOZ A;  3L54 A;  4BET A;  3CVQ A;  3JQ1 A;  2QZA A;  4RQI A;  3FWV A;  3DWL G;  3L9T A;  3FUH A;  2DVW A;  4FHJ A;  2QYU A;  2P9P G;  4WWN A;  4URK A;  2R02 A;  3MZL B;  3IHY A;  1TN6 A;  4LEU A;  2IFU A;  3NZU A;  2RFM A;  4ANX A;  1U2V G;  4LG6 A;  3RRU A;  5T8I A;  2BF0 X;  1SVX A;  2V0P A;  1AP7 A;  3DSU A;  2Y69 E;  2GRM A;  1K3Z D;  5CMY A;  4E85 A;  4U96 D;  3S2A A;  3FTS A;  2OEW A;  2R59 A;  1TEZ A;  3CQC B;  3UIO C;  3X2Q E;  3FUL A;  4UWL A;  4AY5 A;  3NB2 A;  3NQP A;  3GZS A;  4YDW A;  4PUC A;  2XQ0 A;  1XGW A;  2OOE A;  4C0M A;  4EEC A;  3HDX A;  4TUM A;  5FQ8 A;  2F37 A;  2WXM A;  3ZU7 B;  4I1O B;  3GZ1 A;  2R17 C;  4AY6 A;  5G05 C;  5AJL A;  3VLD A;  3APF A;  2ZU6 B;  4H7X A;  4FLH A;  2M63 A;  3SZ7 A;  4ZFH A;  3L17 A;  4F6R D;  4ILI A;  2ETA A;  2PZI A;  4G8K A;  3VLE A;  1D8E A;  2I1J A;  3J5Q B;  1X5B A;  3AU4 A;  2Y4U A;  3FUE A;  3DXM G;  4GU5 A;  4HOU A;  4KVM A; 
#chains in the Genus database with same CATH homology
 3AG2 E;  5IY5 E;  3WG7 E;  2EIJ E;  3ASO E;  2Y69 E;  3ABL E;  2EIN E;  2EIL E;  2OCC E;  3ASN E;  3ABK E;  2ZXW E;  2DYS E;  1OCC E;  2EIK E;  2DYR E;  1OCO E;  3AG1 E;  1OCR E;  1V54 E;  1V55 E;  1OCZ E;  5B1A E;  3AG3 E;  3X2Q E;  3AG4 E;  2EIM E;  5B1B E;  5B3S E;  3ABM E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...