5B1AE

Bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title The Mg2+-containing Water Cluster of Mammalian Cytochrome c Oxidase Collects Four Pumping Proton Equivalents in Each Catalytic Cycle.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2015-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 5b1aE00
3AG1E 2EILE 3ASOE 2DYRE 3X2QE 3AG3E 3WG7E 2EIME 1V54E 2Y69E 1OCZE 5B3SE 1OCCE 3ABLE 3ABME 2DYSE 2ZXWE 5B1BE 2EINE 3AG2E 3AG4E 1V55E 1OCRE 2EIKE 3ASNE 5IY5E 5B1AE 1OCOE 2EIJE 2OCCE 3ABKE
chains in the Genus database with same CATH superfamily
3CHPA 1N0QA 3DSUA 2J09A 3JXJA 3J5PA 2I9CA 3IHVA 2AXZA 3ZUVB 4XE0A 3G2VA 2VSYA 1AP7A 1ELRA 1GW6A 3FH7A 5IY5E 3C5RA 4G2VA 4WWPA 1OWPA 2DBAA 4AM9A 4ACLA 4HI8A 4FP7A 4HRMB 1D8DA 2QYUA 1FVFA 3DBSA 1K1AA 4GTSA 4DI4A 3CR3A 3ML8A 4Y6WA 2XGSA 2IQCA 2C0LA 1V55E 4I43A 1HG5A 2ZU6B 4BSXA 3PE3A 3B7TA 3HHMA 1N9AA 4U8HA 1E8YA 4JZYA 2VTBB 3JUIA 5A6CA 5BV0A 3HXDA 5D0OD 3ZU7B 3MYVA 2LSUA 1IHBA 4GZCA 1OWNA 3IHYA 3QARA 1EYHA 3BU8A 3NAWA 3LXUX 4L1BA 4HOQA 3QJZA 3MKQB 2V5FA 3CSTA 2ZGGA 4BT9A 4KMOA 2B6CA 3CHSA 2BEDA 3FH8A 3PREA 2XS8A 3G2WA 1NFIE 5AARA 1YYHA 2AW6A 3ZPJA 4XX5A 3TG4A 3BUAA 4EPZA 5CCLA 3MKRA 3TXNA 2P9KG 1X5BA 4GTTA 1S0PA 5ARGA 3ZVVA 1EPUA 4QQIA 4KXKB 5CMYA 2Y4TA 4CGWA 3U64A 2CHZA 4GA0A 3SFXA 2MRIA 4GU5A 4G23A 4JEUA 3APCA 4GZ5A 3Q9NC 4A3TA 2M63A 3UMVA 5EILA 4HRLA 1OWMA 1ELWA 1HH8A 3CEQA 5HI7A 4KZ0A 3T5VA 4MS6A 4HBDA 3HIZA 5CRUA 4J8FA 3SBSA 5T8IA 1S63A 2NC9A 5AJLA 4GTQA 3MX3A 3FTZA 2WVIA 3UIPC 3SD5A 2P9SG 5LX8A 4JA9A 5B1BE 4TRQA 3SFYA 2ETAA 4I2WA 4OAUC 4NRHB 3PZ3A 5FJYA 3ZIMA 4FLBA 5ENRD 2VQ2A 3NZUA 3UM1A 3W9FA 4A63B 3T5XA 4APFA 3ASHA 3UT7A 2A4ZA 4C0MA 5DBKA 1SW6A 3FUEA 4L23A 1UJKA 4BT8A 3ML9A 4HNAD 2WPVA 4EQFA 2F8YA 1LF8A 1ZBPA 4I1MA 4IN3B 5CRVA 5G04J 3DPDA 3WXXA 3JCKC 1UW4B 3Q79A 2YNQA 5EX0A 1TYQG 4OVVA 3LS8A 4LNBA 3C98A 3UT8A 3E37A 2WXKA 4ME2A 4B0ZA 3L16A 3CSFA 4U8VD 4PUCA 1E7UA 3CVQA 3AU4A 3CHQA 1A5EA 4B94A 2IY0C 3SGHA 3ZYMA 1MHQA 4XKCA 3D9IA 4O1PA 1E8XA 3FWVA 3MCXA 5ENOD 1WDYA 3SI5A 3FTWA 2JLBA 3RK6A 1RZ4A 2P9UG 4MLPA 1H0AA 1SA5A 4YDOA 3V31A 3VLEA 4RVBA 2QFCA 3QWVA 4JVSA 4BSZB 4KZCA 3CKCA 5LOZA 2ZISA 3L17A 2RG8A 4A55A 1INZA 4CDNA 2V8SE 2GGFA 4HB5A 5G05J 5AYWD 2FEZA 4GPKA 5FWQA 3TWVA 4ACKA 1HFAA 5KNGA 4UI9K 2WM9A 1WG0A 2Y4UA 3LY7A 4F53A 3V2OA 2MOWA 1LD7A 5ENTD 3BG1B 5AQ7A 3EHMA 3ASFA 3I5PA 4NURA 3AG1E 3HVEA 3SHFA 4AOFA 4I1AA 2OOEA 2XGMA 4G1TA 4G24A 1N4PA 1JUQA 3SFZA 1YCSB 3UTMA 3V2XA 2I2OA 3D9JA 3EUVA 4TXRA 4DPRA 5AQAA 3OTNA 2EILE 2V4HC 1LD8A 3WG7E 4GPMA 2C0MA 4LNUD 3O48A 2P9NG 3TWRA 3HRAA 3OXLA 3L9TA 2ZGDA 3FP3A 4F1PA 2J4BA 3ZW3A 3FH5A 2CFZA 1ELKA 1TJFA 3FTSA 3C3QA 4JW1A 3N71A 2WXFA 3MJWA 3BEEA 3CVWA 5ANRA 2ZXWE 3MEKA 3KEAA 1KPSB 2HYZA 3RAUA 4AY5A 1K1BA 3B7UX 3ASOE 3K9IA 4N3AA 5KNHD 5CBOA 3MV2B 3MGBA 4DX5D 4Q69A 3B7SA 3TWTA 5KBAA 1YMPA 1H6KA 3TXMA 3ZHEA 3UQ3A 4AJWA 5KJKA 5BW8C 2DYRE 4R7LA 4ABNA 2WXJA 4NIKA 4YNDA 5EKQD 3ZXSA 4HS2A 1FPPA 3UM3A 4GCNA 3UI2A 1B89A 2CFUA 3PZ2A 4FLHA 3SY2A 4IYPA 5T3RA 2LAIA 4JL0A 4P29A 2LNIA 1OWOA 3TL5A 5E75A 3IEGA 4HVBA 3ZRHA 4FADA 4O60A 4J8YA 1VDYA 2VGXA 1OT8A 3VTXA 3ZNGA 3CK8A 5CEAA 4U0ZA 3PEVB 2KBXA 2XEHA 3W9GA 4LNGA 2VGEA 3AU5A 5G04C 2VSNA 3EIQC 1MYOA 1L5JA 2P58C 1SZAA 1Q2ZA 3ESKA 1NA3A 4GMLA 3G2UA 3CHRA 4GB9A 4L7TA 3PE4A 4LEUA 3U66A 4JD2G 2LAHA 4Q96A 3R7RA 2ETBA 3PUKA 4GTPA 4BTAA 1WAO1 4N2QA 2AJAA 4V3IA 4WNEA 3PDNA 4G25A 4KVOA 4ZHBA 4UQYA 3FU0A 2HR2A 2KCVA 2QZAA 1JPLA 1PAQA 4ATZD 3ABLE 3KAEA 5KWDA 5G55A 4BFRA 4UQZA 3MA5A 3ULQA 4LUNU 2P9LG 4GZ3A 3CVUA 2BF0X 4DLQA 3U9WA 2XEEA 4CYMD 2P9IG 1U2VG 3ZYKA 1MX4A 2I6HA 3HXFA 3I4RB 3CLJA 4K5AB 5G05C 3LJ3A 1OY3D 5CECB 1E8WA 3SO8A 1HS6A 3PVLA 1TN8A 3FTVA 4ANWA 1A17A 4U63A 2OV8A 4M3OA 5DIZA 2KC7A 2GRPB 4CRWA 1FVHA 2EQXA 3NOGD 3UPVA 4DX7D 4DK5A 1KZPA 4AP2A 3DSVA 1O1TA 2YINA 3CVYA 4ANXA 3TAXA 4H7XA 2UY1B 4GYWA 3BG0B 5AJDA 3JQ1A 3CQCB 1MX2A 1H6PA 4ILHB 5ENPD 5B1AE 4ATGA 4HORA 2HE0A 3ABKE 1K3ZD 3NOCD 1AWCB 3TG5A 4J6IA 2AVPA 5T4YA 1XGWA 4BETA 1YA0A 1MQSA 2LXLA 4J0UA 3RRNB 4ILGA 5FQ8A 3DRAA 3R9AB 2NSZA 2KCLA 4DJAA 2Y0BG 3Q5MA 2JEKA 3QDNA 4B89A 1IQRA 4WNFA 2Y1LE 5ITZF 5FQ6A 3LKUA 3QAQA 3DSWA 4DI3A 2QC9A 2L0IA 4YDWA 1HE8A 3CVVA 3E34A 2QYJA 3P2BA 2ILRA 4AIFA 4U7EB 1TJCA 4GZDA 2IOSA 3LJNA 1OCRE 4UWLA 4EBAG 1WY6A 2OVFA 2MYOA 3VLFA 2V0PA 3CVLA 3TWUA 2IJGX 3APFA 5BV1A 4CT4A 2XEVA 4HXIA 3AS8A 3TWSA 3D9MA 5CERB 1DNPA 5CHEE 3LDZA 4PH4B 4BESA 2DZOA 2H6FA 5JJ6A 4G8LA 4JA7A 4LCTA 5C1DA 4U0UA 4PDXA 5AQ9A 4CDMA 3OXGA 4DX6D 3T8MA 4XEIG 2VSOE 1TN6A 1H2TC 3AG2E 4E6HA 3C3RA 3ONKA 3HG0D 1IYGA 2OEWA 3ZYQA 3CVNA 1HO8A 5BXUA 1U3DA 1DC2A 2E2EA 4RQIA 3EJNA 3AS4A 2WXNA 3F6QA 4CGVA 2X6HA 2WXGA 3JYSA 4L2LA 3JQ0A 2IO3C 5FTPA 1QNFA 4KYOB 4CCAA 5BPPA 3CKBA 1TNUA 3PNLB 4HQDA 3S7BA 4TXPA 3FHEA 3QB2A 4QFVA 2WMNA 5FZRA 2IO2C 2WB2A 5KJMA 5BT1A 2EIJE 3QKYA 5FIOA 4BY6A 2RFAA 2WQHA 3EIJA 1HG2A 3RO3A 2XGOA 2X38A 4RG9A 4GTVA 4I1OB 3SBTB 3IBEA 2PQNA 3FUKA 4RG6A 3ENEA 3LEWA 2PQRA 4GTMA 5HS0A 2YHCA 5KJNA 3ULYA 2X6KA 2WXRA 4IULA 4Y6CA 2KZTA 2Y69E 2VGYA 1Z3YA 3HDXA 2C2LA 3NBNB 1RW2A 2A5UA 3U3WA 4JXTA 4TV3A 3LVQE 4I9CA 3PZ4A 1DCEA 3PS6A 2GRRB 1E90A 2WQ6A 5D2MC 4GYOA 4I2ZA 1G3NB 4ZFHA 2H6GA 5JA4D 4DX1A 2BKKB 2GW1A 3SZ7A 1BD8A 3UT4A 5EIDA 3AAAC 3IKOB 3S7JA 3V30A 3ISMC 4WAFA 5B3SE 5JJTA 3FU5A 3FTUA 3TWQA 2GRQB 3HXEA 2DYSE 1NI1A 1KT0A 3FU6A 1MX6A 3PNTB 3FUNA 4EHMA 3ZEFA 2DWZA 1N4SA 2CG3A 3KSQA 3Q7FA 2JABA 2MHKA 4N3CA 4WNDA 1UJJA 3NF1A 3TWXA 4JHKA 1EF1C 2VTBA 1OWLA 3NB2A 2WXLA 4FULA 5ARFA 3UUXA 1ZU2A 1LTXA 1XNFA 3CV0A 3MKQA 2E0IA 4I6JA 3EU9A 3LPZA 2HO1A 4BX9A 2FO7A 2FF4A 5AQBA 4D10C 4GMJA 3CVXA 4GCOA 2A5EA 2IONA 4G11A 2F0YA 4BEPA 4JB8P 1EDUA 5EIBE 2X6JA 3FTXA 2ONDA 1HXIA 4J8SA 1Z3XA 5FQ7A 4YVQC 4MBGA 2IFUA 2XPYA 3E4BA 1NZNA 5D0QD 3CK7A 1SA4A 1SQMA 2J4DA 4U04A 3Q15A 4N3BA 2HM8A 2FO1E 3B13A 5ANLA 2QY7A 3PUJA 4GTRA 3G2TA 1IHGA 3Q7AA 2BKGA 5A23A 4YDEA 4DX2A 2R2LA 3DPYA 1JCQA 4FJZA 3PRZA 4OYSA 5JJ7A 5BXOA 1JCRA 4BERA 4JHJA 3RU0A 2FI7A 3D3MA 4URKA 3UM2A 2FULA 5KCMA 5JMND 3B7RL 4C0EA 5H7PA 3VTYA 5FINA 2AWIA 1IKND 4CZ2D 3GZSA 4A1SA 3PZ1A 2FBNA 2DIWA 4I6EA 5LP0A 1TEZA 4F1SA 3SQVA 2R17C 2RFMA 4KBQA 2GRNB 3S2AA 5CBNA 1NA0A 1HX8A 3RRUA 4U0SA 5EDSA 2H6IA 4UUCA 1OUVA 2UWJG 2WMOA 4K0RA 2WXOA 1JCSA 4UI9J 4EZLA 3EHQA 4ILIA 4B8AA 1QBQA 1QZ2A 2KATA 2BUGA 5EN5D 2VSXE 3FDHA 5J90A 1E7VA 3NQPA 1JWGA 2LUHA 3ZYLA 3EHRA 5FZSA 2BTDA 4EBAA 3EHNA 3C3OA 3OAWA 5LCWJ 3HVEB 4X8QA 4LSZE 1S70B 3DEPA 5EYPF 2XZTG 3BQOA 5BNWA 1H6OA 3UIOC 2XPIA 3IXEA 2NYJA 4I17A 2OVBA 1MJ0A 3GW4A 2I1JA 3DWLG 1H2VC 2PL2A 4W9RA 2WXPA 4A3VA 3JUEA 3J5QB 2Q7FA 3RSEG 1UG3A 1N4RA 1TNYA 4I9EA 4U07A 3GZ1A 3G2SA 3GZ2A 4N5CA 4U95D 2V5QC 2DVWA 2P9PG 3QNKA 4HLLA 4ANUA 4FJYA 1S64A 3PZDA 4GA1A 4M7CA 3QC1A 3CHOA 4K5CA 2DZNA 5LFAA 3UINC 2YQ8A 4HFGA 2PM6A 5J08A 3JXIA 4Z68A 4JHRA 3OXFA 3AS5A 3RIBA 3MV3B 3L08A 4U96D 1SVXA 2WXMA 3ZHEB 1Y6IA 3KEZA 4FHKA 2EIKE 3ZGQA 3ULEG 4WNGA 1OCOE 2L9BA 3CGHA 3EDTB 3LY8A 3D9OA 4OVUA 4HI9A 3HXCA 4HRNA 2CHWA 2LSVA 4F7AA 2XS1A 3ASGA 3FTYA 3QWPA 4TUUA 4K03A 3SNXA 4CT0A 4GAAA 3S7DA 2L6JA 5AN8A 1Y8MA 1PC2A 3Q4AB 4XZ4A 2XRYA 3FULA 2XRZA 3ABME 3U4TA 2VGXB 2LO6A 1D9SA 1D8EA 3Q78A 4HLEA 3UX4A 5FZQA 3ZXPA 4DRXE 3FUIA 3O4ZA 2KCKA 3ZKJA 4CDRA 4XIFA 2NXPA 4GZ6A 1FCHA 5HQ8A 5HKPA 3AJIA 5ENQD 3ZFWA 3KS2A 1N94A 3IV0A 2X3MA 4UWHA 3Q49B 3UM0A 3Q9UC 4IRUA 2KXPC 4F6RD 4FHJA 1N95A 2VYIA 3PEUB 4EZJA 3DEOA 1Z6TA 2GRLA 3AG4E 4LERA 1UN8A 2X6FA 2VJ8A 3UKUG 2V4LA 4EZKA 4XKBA 2XZDG 2ZIRA 1QYMA 1E8ZA 5CCMA 1OCZE 3Q75A 4C48B 3GYZA 3FUDA 1FT1A 1TNZA 4AVXA 3D9KA 2OEVA 4N39A 1K8KG 1N54A 4RSYA 4U8YD 1N11A 5CMWA 5HRYA 4XI0A 4H7YA 3QOUA 2P2CP 3FY4A 1KZOA 4WUYA 1DCQA 4RLYA 2RKKA 3CVPA 3VLDA 3DSSA 3D9LA 1U3CA 3E32A 3L6AA 3FUHA 2B0OE 2X6IA 4KVMA 1O1SA 3T8KA 2XPZA 1P5QA 1E96B 4UI9C 1O1RA 2IEJA 2WXQA 2H6HA 4G8KA 4N2SA 2J07A 5KJLA 3I4GA 3QK0A 3URZA 5AENA 1NP7A 4BX8A 3E33A 4Q94A 3E30A 1ZB1A 3Q47B 5LCWC 5EYLA 5AAOA 5A7DB 3D9HA 2F37A 1FT2A 1WM5A 1H19A 2ETCA 3D9NA 4LRZA 4HOUA 2WQ7A 5AIJA 4F3VA 4PS3A 1N0RA 2DCPA 3C72A 1TNBA 5C2YA 2Y3AA 3PH0C 5E76A 4O6FA 1N52A 3D9PA 2J8SD 4NACA 4UWKA 4A1GA 4PS7A 5FT9A 2LXMA 3LYAA 3RKVA 4AV7A 4APOA 1X81A 1HZ4A 3CIAA 3TJPA 3DXMG 4GYYA 3S7FA 3L82A 3DSXA 2XCBA 4J8EA 1QQEA 2GROB 4HOSA 4G26A 2OCCE 4OAVB 4JC8A 1BPOA 1TR4A 2J49A 3L13A 3HXBA 3RJVA 1KT1A 4GMRA 4WWOA 3Q73A 1BI8B 2XHEA 3CQGB 4AEZC 2AXUA 4JPSA 4L9PA 1W3BA 3ASDA 5M72A 3RO2A 3UXGA 4AXHA 4B8CB 3X2QE 4UQXA 2R5SA 2XQ0A 2IOLA 2XENA 1O5MA 3TGOA 1SZ9A 4FU3A 4YDYA 4MKTA 3FFLA 1TNOA 4O1OA 5JHBA 4J8DA 2I1KA 5ENNA 4FC8A 2UY1A 3FU3A 1BU9A 3ASNE 2R59A 1JWFA 5CEDB 3L22A 3AG3E 5D66A 2EIME 4N5QA 3B95A 4E85A 3LY9A 3I3NA 4C9BB 5EX3A 4J7WA 2GRMA 1OCCE 3FUJA 3LCAA 4XI9A 2EINE 4LG6A 1N4QA 1UN9A 4TUMA 2RD0A 5G2NA 1TN7A 1H2UA 2L6BA 3L54A 4K5BA 2WXHA 4BWRA 2J08A 3T9KA 3SF4A 4YVOA 4I6GA 3TWWA 3CHMA 2KM4A 4MRUA 1IXVA 3ONLA 1NL4A 3R7QA 2CHXA 3FEXA 4JEHA 3APDA 1BLXB 2F8XK 2IF4A 3FUFA 3FUMA 3UKRG 4DLOA 1OXJA 3FEYA 3CK9A 3ESLA 4FA6A 1HF8A 4L2YA 4CEMA 4PS8A 4AY6A 3LVRE 3KD7A 3QWWA 2WXIA 2J9QA 4UWFA 3R9MA 4B93B 2R03A 4KT6B 2PZIA 3DXKG 4DUIA 4TXQA 4WWNA 5JHAA 4ANVA 3P1UA 1BI7B 2AXVA 1V54E 5ENSD 4EECA 3KSLA 2R05A 3ZN3A 4GTOA 3RRMB 3HYMB 1KLXA 2L0TB 2IU1A 2KZTB 4UWGA 2PM7A 2XCCA 2R02A 1PY1A 2PNNA 3EU5A 4HOTA 3DSTA 3MZLB 4GA2A 1HU3A 1UOHA 5FQ4A 5BUZA 1IQUA 2CG2A 1MZCA 2YHEA 1Z5SC 3NZSA 4NQ0A 1DVPA 3B7BA 4BTBA 3V79K
chains in the Genus database with same CATH topology
3AG1E 2EILE 3ASOE 2DYRE 3X2QE 3AG3E 3WG7E 2EIME 1V54E 2Y69E 1OCZE 5B3SE 1OCCE 3ABLE 3ABME 2DYSE 2ZXWE 5B1BE 2EINE 3AG2E 3AG4E 1V55E 1OCRE 2EIKE 3ASNE 5IY5E 5B1AE 1OCOE 2EIJE 2OCCE 3ABKE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG1 E;  2EIL E;  3ASO E;  2DYR E;  3X2Q E;  3AG3 E;  3WG7 E;  2EIM E;  1V54 E;  2Y69 E;  1OCZ E;  5B3S E;  1OCC E;  3ABL E;  3ABM E;  2DYS E;  2ZXW E;  5B1B E;  2EIN E;  3AG2 E;  3AG4 E;  1V55 E;  1OCR E;  2EIK E;  3ASN E;  5IY5 E;  5B1A E;  1OCO E;  2EIJ E;  2OCC E;  3ABK E; 
#chains in the Genus database with same CATH topology
 3CHP A;  1N0Q A;  3DSU A;  2J09 A;  3JXJ A;  3J5P A;  2I9C A;  3IHV A;  2AXZ A;  3ZUV B;  4XE0 A;  3G2V A;  2VSY A;  1AP7 A;  1ELR A;  1GW6 A;  3FH7 A;  5IY5 E;  3C5R A;  4G2V A;  4WWP A;  1OWP A;  2DBA A;  4AM9 A;  4ACL A;  4HI8 A;  4FP7 A;  4HRM B;  1D8D A;  2QYU A;  1FVF A;  3DBS A;  1K1A A;  4GTS A;  4DI4 A;  3CR3 A;  3ML8 A;  4Y6W A;  2XGS A;  2IQC A;  2C0L A;  1V55 E;  4I43 A;  1HG5 A;  2ZU6 B;  4BSX A;  3PE3 A;  3B7T A;  3HHM A;  1N9A A;  4U8H A;  1E8Y A;  4JZY A;  2VTB B;  3JUI A;  5A6C A;  5BV0 A;  3HXD A;  5D0O D;  3ZU7 B;  3MYV A;  2LSU A;  1IHB A;  4GZC A;  1OWN A;  3IHY A;  3QAR A;  1EYH A;  3BU8 A;  3NAW A;  3LXU X;  4L1B A;  4HOQ A;  3QJZ A;  3MKQ B;  2V5F A;  3CST A;  2ZGG A;  4BT9 A;  4KMO A;  2B6C A;  3CHS A;  2BED A;  3FH8 A;  3PRE A;  2XS8 A;  3G2W A;  1NFI E;  5AAR A;  1YYH A;  2AW6 A;  3ZPJ A;  4XX5 A;  3TG4 A;  3BUA A;  4EPZ A;  5CCL A;  3MKR A;  3TXN A;  2P9K G;  1X5B A;  4GTT A;  1S0P A;  5ARG A;  3ZVV A;  1EPU A;  4QQI A;  4KXK B;  5CMY A;  2Y4T A;  4CGW A;  3U64 A;  2CHZ A;  4GA0 A;  3SFX A;  2MRI A;  4GU5 A;  4G23 A;  4JEU A;  3APC A;  4GZ5 A;  3Q9N C;  4A3T A;  2M63 A;  3UMV A;  5EIL A;  4HRL A;  1OWM A;  1ELW A;  1HH8 A;  3CEQ A;  5HI7 A;  4KZ0 A;  3T5V A;  4MS6 A;  4HBD A;  3HIZ A;  5CRU A;  4J8F A;  3SBS A;  5T8I A;  1S63 A;  2NC9 A;  5AJL A;  4GTQ A;  3MX3 A;  3FTZ A;  2WVI A;  3UIP C;  3SD5 A;  2P9S G;  5LX8 A;  4JA9 A;  5B1B E;  4TRQ A;  3SFY A;  2ETA A;  4I2W A;  4OAU C;  4NRH B;  3PZ3 A;  5FJY A;  3ZIM A;  4FLB A;  5ENR D;  2VQ2 A;  3NZU A;  3UM1 A;  3W9F A;  4A63 B;  3T5X A;  4APF A;  3ASH A;  3UT7 A;  2A4Z A;  4C0M A;  5DBK A;  1SW6 A;  3FUE A;  4L23 A;  1UJK A;  4BT8 A;  3ML9 A;  4HNA D;  2WPV A;  4EQF A;  2F8Y A;  1LF8 A;  1ZBP A;  4I1M A;  4IN3 B;  5CRV A;  5G04 J;  3DPD A;  3WXX A;  3JCK C;  1UW4 B;  3Q79 A;  2YNQ A;  5EX0 A;  1TYQ G;  4OVV A;  3LS8 A;  4LNB A;  3C98 A;  3UT8 A;  3E37 A;  2WXK A;  4ME2 A;  4B0Z A;  3L16 A;  3CSF A;  4U8V D;  4PUC A;  1E7U A;  3CVQ A;  3AU4 A;  3CHQ A;  1A5E A;  4B94 A;  2IY0 C;  3SGH A;  3ZYM A;  1MHQ A;  4XKC A;  3D9I A;  4O1P A;  1E8X A;  3FWV A;  3MCX A;  5ENO D;  1WDY A;  3SI5 A;  3FTW A;  2JLB A;  3RK6 A;  1RZ4 A;  2P9U G;  4MLP A;  1H0A A;  1SA5 A;  4YDO A;  3V31 A;  3VLE A;  4RVB A;  2QFC A;  3QWV A;  4JVS A;  4BSZ B;  4KZC A;  3CKC A;  5LOZ A;  2ZIS A;  3L17 A;  2RG8 A;  4A55 A;  1INZ A;  4CDN A;  2V8S E;  2GGF A;  4HB5 A;  5G05 J;  5AYW D;  2FEZ A;  4GPK A;  5FWQ A;  3TWV A;  4ACK A;  1HFA A;  5KNG A;  4UI9 K;  2WM9 A;  1WG0 A;  2Y4U A;  3LY7 A;  4F53 A;  3V2O A;  2MOW A;  1LD7 A;  5ENT D;  3BG1 B;  5AQ7 A;  3EHM A;  3ASF A;  3I5P A;  4NUR A;  3AG1 E;  3HVE A;  3SHF A;  4AOF A;  4I1A A;  2OOE A;  2XGM A;  4G1T A;  4G24 A;  1N4P A;  1JUQ A;  3SFZ A;  1YCS B;  3UTM A;  3V2X A;  2I2O A;  3D9J A;  3EUV A;  4TXR A;  4DPR A;  5AQA A;  3OTN A;  2EIL E;  2V4H C;  1LD8 A;  3WG7 E;  4GPM A;  2C0M A;  4LNU D;  3O48 A;  2P9N G;  3TWR A;  3HRA A;  3OXL A;  3L9T A;  2ZGD A;  3FP3 A;  4F1P A;  2J4B A;  3ZW3 A;  3FH5 A;  2CFZ A;  1ELK A;  1TJF A;  3FTS A;  3C3Q A;  4JW1 A;  3N71 A;  2WXF A;  3MJW A;  3BEE A;  3CVW A;  5ANR A;  2ZXW E;  3MEK A;  3KEA A;  1KPS B;  2HYZ A;  3RAU A;  4AY5 A;  1K1B A;  3B7U X;  3ASO E;  3K9I A;  4N3A A;  5KNH D;  5CBO A;  3MV2 B;  3MGB A;  4DX5 D;  4Q69 A;  3B7S A;  3TWT A;  5KBA A;  1YMP A;  1H6K A;  3TXM A;  3ZHE A;  3UQ3 A;  4AJW A;  5KJK A;  5BW8 C;  2DYR E;  4R7L A;  4ABN A;  2WXJ A;  4NIK A;  4YND A;  5EKQ D;  3ZXS A;  4HS2 A;  1FPP A;  3UM3 A;  4GCN A;  3UI2 A;  1B89 A;  2CFU A;  3PZ2 A;  4FLH A;  3SY2 A;  4IYP A;  5T3R A;  2LAI A;  4JL0 A;  4P29 A;  2LNI A;  1OWO A;  3TL5 A;  5E75 A;  3IEG A;  4HVB A;  3ZRH A;  4FAD A;  4O60 A;  4J8Y A;  1VDY A;  2VGX A;  1OT8 A;  3VTX A;  3ZNG A;  3CK8 A;  5CEA A;  4U0Z A;  3PEV B;  2KBX A;  2XEH A;  3W9G A;  4LNG A;  2VGE A;  3AU5 A;  5G04 C;  2VSN A;  3EIQ C;  1MYO A;  1L5J A;  2P58 C;  1SZA A;  1Q2Z A;  3ESK A;  1NA3 A;  4GML A;  3G2U A;  3CHR A;  4GB9 A;  4L7T A;  3PE4 A;  4LEU A;  3U66 A;  4JD2 G;  2LAH A;  4Q96 A;  3R7R A;  2ETB A;  3PUK A;  4GTP A;  4BTA A;  1WAO 1;  4N2Q A;  2AJA A;  4V3I A;  4WNE A;  3PDN A;  4G25 A;  4KVO A;  4ZHB A;  4UQY A;  3FU0 A;  2HR2 A;  2KCV A;  2QZA A;  1JPL A;  1PAQ A;  4ATZ D;  3ABL E;  3KAE A;  5KWD A;  5G55 A;  4BFR A;  4UQZ A;  3MA5 A;  3ULQ A;  4LUN U;  2P9L G;  4GZ3 A;  3CVU A;  2BF0 X;  4DLQ A;  3U9W A;  2XEE A;  4CYM D;  2P9I G;  1U2V G;  3ZYK A;  1MX4 A;  2I6H A;  3HXF A;  3I4R B;  3CLJ A;  4K5A B;  5G05 C;  3LJ3 A;  1OY3 D;  5CEC B;  1E8W A;  3SO8 A;  1HS6 A;  3PVL A;  1TN8 A;  3FTV A;  4ANW A;  1A17 A;  4U63 A;  2OV8 A;  4M3O A;  5DIZ A;  2KC7 A;  2GRP B;  4CRW A;  1FVH A;  2EQX A;  3NOG D;  3UPV A;  4DX7 D;  4DK5 A;  1KZP A;  4AP2 A;  3DSV A;  1O1T A;  2YIN A;  3CVY A;  4ANX A;  3TAX A;  4H7X A;  2UY1 B;  4GYW A;  3BG0 B;  5AJD A;  3JQ1 A;  3CQC B;  1MX2 A;  1H6P A;  4ILH B;  5ENP D;  5B1A E;  4ATG A;  4HOR A;  2HE0 A;  3ABK E;  1K3Z D;  3NOC D;  1AWC B;  3TG5 A;  4J6I A;  2AVP A;  5T4Y A;  1XGW A;  4BET A;  1YA0 A;  1MQS A;  2LXL A;  4J0U A;  3RRN B;  4ILG A;  5FQ8 A;  3DRA A;  3R9A B;  2NSZ A;  2KCL A;  4DJA A;  2Y0B G;  3Q5M A;  2JEK A;  3QDN A;  4B89 A;  1IQR A;  4WNF A;  2Y1L E;  5ITZ F;  5FQ6 A;  3LKU A;  3QAQ A;  3DSW A;  4DI3 A;  2QC9 A;  2L0I A;  4YDW A;  1HE8 A;  3CVV A;  3E34 A;  2QYJ A;  3P2B A;  2ILR A;  4AIF A;  4U7E B;  1TJC A;  4GZD A;  2IOS A;  3LJN A;  1OCR E;  4UWL A;  4EBA G;  1WY6 A;  2OVF A;  2MYO A;  3VLF A;  2V0P A;  3CVL A;  3TWU A;  2IJG X;  3APF A;  5BV1 A;  4CT4 A;  2XEV A;  4HXI A;  3AS8 A;  3TWS A;  3D9M A;  5CER B;  1DNP A;  5CHE E;  3LDZ A;  4PH4 B;  4BES A;  2DZO A;  2H6F A;  5JJ6 A;  4G8L A;  4JA7 A;  4LCT A;  5C1D A;  4U0U A;  4PDX A;  5AQ9 A;  4CDM A;  3OXG A;  4DX6 D;  3T8M A;  4XEI G;  2VSO E;  1TN6 A;  1H2T C;  3AG2 E;  4E6H A;  3C3R A;  3ONK A;  3HG0 D;  1IYG A;  2OEW A;  3ZYQ A;  3CVN A;  1HO8 A;  5BXU A;  1U3D A;  1DC2 A;  2E2E A;  4RQI A;  3EJN A;  3AS4 A;  2WXN A;  3F6Q A;  4CGV A;  2X6H A;  2WXG A;  3JYS A;  4L2L A;  3JQ0 A;  2IO3 C;  5FTP A;  1QNF A;  4KYO B;  4CCA A;  5BPP A;  3CKB A;  1TNU A;  3PNL B;  4HQD A;  3S7B A;  4TXP A;  3FHE A;  3QB2 A;  4QFV A;  2WMN A;  5FZR A;  2IO2 C;  2WB2 A;  5KJM A;  5BT1 A;  2EIJ E;  3QKY A;  5FIO A;  4BY6 A;  2RFA A;  2WQH A;  3EIJ A;  1HG2 A;  3RO3 A;  2XGO A;  2X38 A;  4RG9 A;  4GTV A;  4I1O B;  3SBT B;  3IBE A;  2PQN A;  3FUK A;  4RG6 A;  3ENE A;  3LEW A;  2PQR A;  4GTM A;  5HS0 A;  2YHC A;  5KJN A;  3ULY A;  2X6K A;  2WXR A;  4IUL A;  4Y6C A;  2KZT A;  2Y69 E;  2VGY A;  1Z3Y A;  3HDX A;  2C2L A;  3NBN B;  1RW2 A;  2A5U A;  3U3W A;  4JXT A;  4TV3 A;  3LVQ E;  4I9C A;  3PZ4 A;  1DCE A;  3PS6 A;  2GRR B;  1E90 A;  2WQ6 A;  5D2M C;  4GYO A;  4I2Z A;  1G3N B;  4ZFH A;  2H6G A;  5JA4 D;  4DX1 A;  2BKK B;  2GW1 A;  3SZ7 A;  1BD8 A;  3UT4 A;  5EID A;  3AAA C;  3IKO B;  3S7J A;  3V30 A;  3ISM C;  4WAF A;  5B3S E;  5JJT A;  3FU5 A;  3FTU A;  3TWQ A;  2GRQ B;  3HXE A;  2DYS E;  1NI1 A;  1KT0 A;  3FU6 A;  1MX6 A;  3PNT B;  3FUN A;  4EHM A;  3ZEF A;  2DWZ A;  1N4S A;  2CG3 A;  3KSQ A;  3Q7F A;  2JAB A;  2MHK A;  4N3C A;  4WND A;  1UJJ A;  3NF1 A;  3TWX A;  4JHK A;  1EF1 C;  2VTB A;  1OWL A;  3NB2 A;  2WXL A;  4FUL A;  5ARF A;  3UUX A;  1ZU2 A;  1LTX A;  1XNF A;  3CV0 A;  3MKQ A;  2E0I A;  4I6J A;  3EU9 A;  3LPZ A;  2HO1 A;  4BX9 A;  2FO7 A;  2FF4 A;  5AQB A;  4D10 C;  4GMJ A;  3CVX A;  4GCO A;  2A5E A;  2ION A;  4G11 A;  2F0Y A;  4BEP A;  4JB8 P;  1EDU A;  5EIB E;  2X6J A;  3FTX A;  2OND A;  1HXI A;  4J8S A;  1Z3X A;  5FQ7 A;  4YVQ C;  4MBG A;  2IFU A;  2XPY A;  3E4B A;  1NZN A;  5D0Q D;  3CK7 A;  1SA4 A;  1SQM A;  2J4D A;  4U04 A;  3Q15 A;  4N3B A;  2HM8 A;  2FO1 E;  3B13 A;  5ANL A;  2QY7 A;  3PUJ A;  4GTR A;  3G2T A;  1IHG A;  3Q7A A;  2BKG A;  5A23 A;  4YDE A;  4DX2 A;  2R2L A;  3DPY A;  1JCQ A;  4FJZ A;  3PRZ A;  4OYS A;  5JJ7 A;  5BXO A;  1JCR A;  4BER A;  4JHJ A;  3RU0 A;  2FI7 A;  3D3M A;  4URK A;  3UM2 A;  2FUL A;  5KCM A;  5JMN D;  3B7R L;  4C0E A;  5H7P A;  3VTY A;  5FIN A;  2AWI A;  1IKN D;  4CZ2 D;  3GZS A;  4A1S A;  3PZ1 A;  2FBN A;  2DIW A;  4I6E A;  5LP0 A;  1TEZ A;  4F1S A;  3SQV A;  2R17 C;  2RFM A;  4KBQ A;  2GRN B;  3S2A A;  5CBN A;  1NA0 A;  1HX8 A;  3RRU A;  4U0S A;  5EDS A;  2H6I A;  4UUC A;  1OUV A;  2UWJ G;  2WMO A;  4K0R A;  2WXO A;  1JCS A;  4UI9 J;  4EZL A;  3EHQ A;  4ILI A;  4B8A A;  1QBQ A;  1QZ2 A;  2KAT A;  2BUG A;  5EN5 D;  2VSX E;  3FDH A;  5J90 A;  1E7V A;  3NQP A;  1JWG A;  2LUH A;  3ZYL A;  3EHR A;  5FZS A;  2BTD A;  4EBA A;  3EHN A;  3C3O A;  3OAW A;  5LCW J;  3HVE B;  4X8Q A;  4LSZ E;  1S70 B;  3DEP A;  5EYP F;  2XZT G;  3BQO A;  5BNW A;  1H6O A;  3UIO C;  2XPI A;  3IXE A;  2NYJ A;  4I17 A;  2OVB A;  1MJ0 A;  3GW4 A;  2I1J A;  3DWL G;  1H2V C;  2PL2 A;  4W9R A;  2WXP A;  4A3V A;  3JUE A;  3J5Q B;  2Q7F A;  3RSE G;  1UG3 A;  1N4R A;  1TNY A;  4I9E A;  4U07 A;  3GZ1 A;  3G2S A;  3GZ2 A;  4N5C A;  4U95 D;  2V5Q C;  2DVW A;  2P9P G;  3QNK A;  4HLL A;  4ANU A;  4FJY A;  1S64 A;  3PZD A;  4GA1 A;  4M7C A;  3QC1 A;  3CHO A;  4K5C A;  2DZN A;  5LFA A;  3UIN C;  2YQ8 A;  4HFG A;  2PM6 A;  5J08 A;  3JXI A;  4Z68 A;  4JHR A;  3OXF A;  3AS5 A;  3RIB A;  3MV3 B;  3L08 A;  4U96 D;  1SVX A;  2WXM A;  3ZHE B;  1Y6I A;  3KEZ A;  4FHK A;  2EIK E;  3ZGQ A;  3ULE G;  4WNG A;  1OCO E;  2L9B A;  3CGH A;  3EDT B;  3LY8 A;  3D9O A;  4OVU A;  4HI9 A;  3HXC A;  4HRN A;  2CHW A;  2LSV A;  4F7A A;  2XS1 A;  3ASG A;  3FTY A;  3QWP A;  4TUU A;  4K03 A;  3SNX A;  4CT0 A;  4GAA A;  3S7D A;  2L6J A;  5AN8 A;  1Y8M A;  1PC2 A;  3Q4A B;  4XZ4 A;  2XRY A;  3FUL A;  2XRZ A;  3ABM E;  3U4T A;  2VGX B;  2LO6 A;  1D9S A;  1D8E A;  3Q78 A;  4HLE A;  3UX4 A;  5FZQ A;  3ZXP A;  4DRX E;  3FUI A;  3O4Z A;  2KCK A;  3ZKJ A;  4CDR A;  4XIF A;  2NXP A;  4GZ6 A;  1FCH A;  5HQ8 A;  5HKP A;  3AJI A;  5ENQ D;  3ZFW A;  3KS2 A;  1N94 A;  3IV0 A;  2X3M A;  4UWH A;  3Q49 B;  3UM0 A;  3Q9U C;  4IRU A;  2KXP C;  4F6R D;  4FHJ A;  1N95 A;  2VYI A;  3PEU B;  4EZJ A;  3DEO A;  1Z6T A;  2GRL A;  3AG4 E;  4LER A;  1UN8 A;  2X6F A;  2VJ8 A;  3UKU G;  2V4L A;  4EZK A;  4XKB A;  2XZD G;  2ZIR A;  1QYM A;  1E8Z A;  5CCM A;  1OCZ E;  3Q75 A;  4C48 B;  3GYZ A;  3FUD A;  1FT1 A;  1TNZ A;  4AVX A;  3D9K A;  2OEV A;  4N39 A;  1K8K G;  1N54 A;  4RSY A;  4U8Y D;  1N11 A;  5CMW A;  5HRY A;  4XI0 A;  4H7Y A;  3QOU A;  2P2C P;  3FY4 A;  1KZO A;  4WUY A;  1DCQ A;  4RLY A;  2RKK A;  3CVP A;  3VLD A;  3DSS A;  3D9L A;  1U3C A;  3E32 A;  3L6A A;  3FUH A;  2B0O E;  2X6I A;  4KVM A;  1O1S A;  3T8K A;  2XPZ A;  1P5Q A;  1E96 B;  4UI9 C;  1O1R A;  2IEJ A;  2WXQ A;  2H6H A;  4G8K A;  4N2S A;  2J07 A;  5KJL A;  3I4G A;  3QK0 A;  3URZ A;  5AEN A;  1NP7 A;  4BX8 A;  3E33 A;  4Q94 A;  3E30 A;  1ZB1 A;  3Q47 B;  5LCW C;  5EYL A;  5AAO A;  5A7D B;  3D9H A;  2F37 A;  1FT2 A;  1WM5 A;  1H19 A;  2ETC A;  3D9N A;  4LRZ A;  4HOU A;  2WQ7 A;  5AIJ A;  4F3V A;  4PS3 A;  1N0R A;  2DCP A;  3C72 A;  1TNB A;  5C2Y A;  2Y3A A;  3PH0 C;  5E76 A;  4O6F A;  1N52 A;  3D9P A;  2J8S D;  4NAC A;  4UWK A;  4A1G A;  4PS7 A;  5FT9 A;  2LXM A;  3LYA A;  3RKV A;  4AV7 A;  4APO A;  1X81 A;  1HZ4 A;  3CIA A;  3TJP A;  3DXM G;  4GYY A;  3S7F A;  3L82 A;  3DSX A;  2XCB A;  4J8E A;  1QQE A;  2GRO B;  4HOS A;  4G26 A;  2OCC E;  4OAV B;  4JC8 A;  1BPO A;  1TR4 A;  2J49 A;  3L13 A;  3HXB A;  3RJV A;  1KT1 A;  4GMR A;  4WWO A;  3Q73 A;  1BI8 B;  2XHE A;  3CQG B;  4AEZ C;  2AXU A;  4JPS A;  4L9P A;  1W3B A;  3ASD A;  5M72 A;  3RO2 A;  3UXG A;  4AXH A;  4B8C B;  3X2Q E;  4UQX A;  2R5S A;  2XQ0 A;  2IOL A;  2XEN A;  1O5M A;  3TGO A;  1SZ9 A;  4FU3 A;  4YDY A;  4MKT A;  3FFL A;  1TNO A;  4O1O A;  5JHB A;  4J8D A;  2I1K A;  5ENN A;  4FC8 A;  2UY1 A;  3FU3 A;  1BU9 A;  3ASN E;  2R59 A;  1JWF A;  5CED B;  3L22 A;  3AG3 E;  5D66 A;  2EIM E;  4N5Q A;  3B95 A;  4E85 A;  3LY9 A;  3I3N A;  4C9B B;  5EX3 A;  4J7W A;  2GRM A;  1OCC E;  3FUJ A;  3LCA A;  4XI9 A;  2EIN E;  4LG6 A;  1N4Q A;  1UN9 A;  4TUM A;  2RD0 A;  5G2N A;  1TN7 A;  1H2U A;  2L6B A;  3L54 A;  4K5B A;  2WXH A;  4BWR A;  2J08 A;  3T9K A;  3SF4 A;  4YVO A;  4I6G A;  3TWW A;  3CHM A;  2KM4 A;  4MRU A;  1IXV A;  3ONL A;  1NL4 A;  3R7Q A;  2CHX A;  3FEX A;  4JEH A;  3APD A;  1BLX B;  2F8X K;  2IF4 A;  3FUF A;  3FUM A;  3UKR G;  4DLO A;  1OXJ A;  3FEY A;  3CK9 A;  3ESL A;  4FA6 A;  1HF8 A;  4L2Y A;  4CEM A;  4PS8 A;  4AY6 A;  3LVR E;  3KD7 A;  3QWW A;  2WXI A;  2J9Q A;  4UWF A;  3R9M A;  4B93 B;  2R03 A;  4KT6 B;  2PZI A;  3DXK G;  4DUI A;  4TXQ A;  4WWN A;  5JHA A;  4ANV A;  3P1U A;  1BI7 B;  2AXV A;  1V54 E;  5ENS D;  4EEC A;  3KSL A;  2R05 A;  3ZN3 A;  4GTO A;  3RRM B;  3HYM B;  1KLX A;  2L0T B;  2IU1 A;  2KZT B;  4UWG A;  2PM7 A;  2XCC A;  2R02 A;  1PY1 A;  2PNN A;  3EU5 A;  4HOT A;  3DST A;  3MZL B;  4GA2 A;  1HU3 A;  1UOH A;  5FQ4 A;  5BUZ A;  1IQU A;  2CG2 A;  1MZC A;  2YHE A;  1Z5S C;  3NZS A;  4NQ0 A;  1DVP A;  3B7B A;  4BTB A;  3V79 K; 
#chains in the Genus database with same CATH homology
 3AG1 E;  2EIL E;  3ASO E;  2DYR E;  3X2Q E;  3AG3 E;  3WG7 E;  2EIM E;  1V54 E;  2Y69 E;  1OCZ E;  5B3S E;  1OCC E;  3ABL E;  3ABM E;  2DYS E;  2ZXW E;  5B1B E;  2EIN E;  3AG2 E;  3AG4 E;  1V55 E;  1OCR E;  2EIK E;  3ASN E;  5IY5 E;  5B1A E;  1OCO E;  2EIJ E;  2OCC E;  3ABK E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...