3PZ4A

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10) in complex with bms3 and lipid substrate fpp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Guided Development of Selective RabGGTase Inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 117
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3pz4A00
3C72A 3SFXA 1D8EA 1NL4A 1O5MA 3EU5A 3Q7FA 3DSSA 4YDOA 3Q79A 4EHMA 3KSQA 1LTXA 3DRAA 4YDEA 3DSWA 4LNGA 1TNUA 1TNZA 1TN6A 3HXBA 4GTRA 3EUVA 4L9PA 3E32A 1JCSA 4MBGA 3KSLA 3DSXA 3Q73A 2R2LA 1TN7A 3E30A 2H6HA 3E34A 3HXDA 1N4PA 1N4QA 1O1TA 2IEJA 4GTQA 1S63A 1SA4A 4GTPA 2H6GA 2H6FA 4GTMA 3E37A 1S64A 1N94A 1TN8A 4LNBA 3E33A 3HXFA 1TNOA 1FT2A 1QBQA 1TNBA 2BEDA 4GTOA 1SA5A 3PZ3A 1LD8A 2F0YA 1MZCA 1N4RA 3Q78A 1FT1A 1KZPA 3DPYA 3PZ4A 2ZISA 1O1RA 4GTSA 1JCQA 1NI1A 1DCEA 3Q7AA 4GTTA 1D8DA 3HXCA 3DSVA 3Q75A 3DSTA 1N4SA 3PZ1A 1FPPA 1X81A 3DSUA 1JCRA 1N9AA 1TNYA 1LD7A 3HXEA 2H6IA 3SFYA 3PZ2A 4GTVA 1O1SA 1N95A 2ZIRA 1KZOA
chains in the Genus database with same CATH superfamily
3TG4A 3EDTB 4FHJA 2XPZA 4I1MA 2LAHA 3MCXA 5G04C 1TYQG 4M3OA 2XQ0A 4J8YA 3E30A 5CMWA 5CERB 2RD0A 2XHEA 4CT4A 3HXDA 4KZ0A 4K5BA 3ZGQA 4NQ0A 4RVBA 3OXFA 4R7LA 2GRNB 4UQZA 4IYPA 4F3VA 4L7TA 2WMOA 5C2YA 3GZ2A 3J5QB 2RFMA 1EDUA 4N5CA 2IQCA 3G2WA 1N94A 1L5JA 3CHPA 3D9NA 3F6QA 1AWCB 3C3RA 3HYMB 3SHFA 4GU5A 4U07A 4ANXA 5AJDA 4JL0A 4G8LA 5G55A 4CT0A 3RRMB 4FADA 3ZUVB 5EX0A 5ARGA 4TXQA 1HO8A 2X6JA 4AP2A 4F1PA 5EYLA 2ONDA 2R05A 2VGEA 2AWIA 3GZ1A 3TWVA 3EU5A 4G11A 2XS8A 4ILIA 3G2TA 3T5VA 3ONLA 2FBNA 3B7BA 1UN8A 4GTRA 4LRZA 3VLEA 1N54A 4BERA 4ATZD 1BPOA 3FFLA 1Y8MA 4FC8A 4N5QA 3LXUX 4H7YA 1IKND 1WG0A 1WY6A 4BTAA 5JA4D 4GYOA 4ILGA 5FIOA 2OEVA 3UUXA 5BPPA 3CK8A 4JW1A 4U04A 1Y6IA 2JEKA 4HRMB 4TXPA 3AU4A 3UT8A 3MX3A 2P58C 4RG9A 4MS6A 2BKKB 3SBTB 3LDZA 1G3NB 2XS1A 1FVFA 2YHEA 3FH7A 1TNBA 1H6OA 3AS4A 4RSYA 4PH4B 4G26A 1FVHA 2J09A 2AJAA 4U0SA 3D9LA 2XEHA 1PC2A 3LY8A 1JCQA 3D9IA 2F8YA 2DVWA 5KJMA 2FO1E 3TWWA 1N4SA 2CHXA 5JHAA 1WDYA 4Z68A 4GPMA 3MA5A 2Q7FA 4XI0A 4GB9A 4KMOA 3EHQA 2B0OE 1EPUA 4RQIA 2RFAA 3KD7A 4HS2A 4HORA 3CK7A 5ENPD 5CBNA 4APFA 2L0TB 3MEKA 3FUEA 4F1SA 3V2OA 2P9NG 1TN6A 4I6GA 4U8YD 1HG2A 3AG3E 4YDWA 3R7RA 3EHRA 5C1DA 3ENEA 4BSXA 3UT7A 3B95A 3ZXPA 4DX1A 3SGHA 2WQ6A 4JHRA 2XGMA 3C3OA 1VDYA 1OCRE 2KATA 3T9KA 5HQ8A 2PM7A 2WXOA 1Z3XA 3PREA 4GCOA 2ZU6B 1MJ0A 3AU5A 2IF4A 3VLDA 3KAEA 4LNBA 4O6FA 3ULYA 3PUKA 2PNNA 4FULA 1INZA 5G05J 4LSZE 4C0MA 2OCCE 3IKOB 3ZXSA 3RU0A 4UUCA 3LVRE 1N0RA 3EHMA 1LD8A 4WNEA 2QZAA 1FCHA 4BESA 1KLXA 5LFAA 3FHEA 3DPYA 4L1BA 5AQBA 2LO6A 2GRMA 1D9SA 2VGXB 1UN9A 1JCRA 4U95D 4KYOB 2J4DA 3BU8A 4X8QA 2WXPA 5BT1A 4ATGA 3BUAA 4Y6WA 2XCCA 5ENNA 1DC2A 3ASFA 4EBAG 2C2LA 4GMRA 2IY0C 1LTXA 1P5QA 3WXXA 5FINA 2X6HA 3ISMC 4I6EA 4L9PA 3E32A 3Q9UC 3CVQA 4A1SA 4MBGA 3VLFA 4PUCA 2FI7A 1IQRA 4KVOA 2PQNA 3AS8A 3IXEA 3UM0A 3ZKJA 5IY5E 2NXPA 4MLPA 5CMYA 3HHMA 4G25A 3CHQA 1H19A 5A23A 4AVXA 5D0QD 4LERA 3IEGA 3FEYA 4D10C 3L08A 1K3ZD 4C0EA 2H6FA 3FP3A 5AJLA 1OWPA 3T8KA 4DX6D 3W9FA 3NF1A 4FJYA 3HVEB 2J9QA 3TWUA 3IHVA 3BEEA 1E7UA 1OWOA 5HI7A 2WXGA 3ZEFA 3Q15A 3PE4A 4ILHB 2VGYA 1HE8A 3APCA 4CGVA 5HKPA 3PZ4A 2P9UG 5CCMA 3ZYKA 2DYRE 4BWRA 4FJZA 5ANLA 4EQFA 2AVPA 3Q75A 1OT8A 4GZ3A 3PRZA 5JJ7A 2UY1A 1HFAA 3FU0A 3CHRA 2BTDA 1MYOA 1WM5A 2LXMA 3ZN3A 4GYWA 4HOUA 4HRLA 4HBDA 2X3MA 3RSEG 2WQ7A 4JXTA 3K9IA 4XZ4A 3AG1E 1KZOA 1OUVA 4A1GA 1D8EA 4WWNA 1NL4A 3O4ZA 3S7JA 4YDYA 4K5AB 3CIAA 4YDEA 2R03A 3DSWA 2VTBB 1U2VG 2GRQB 5CBOA 1TNZA 3I5PA 3L13A 5J90A 1E8XA 2I1JA 3V31A 4HQDA 4HNAD 2WXLA 5JJ6A 2V4HC 5CEDB 5AQAA 2Y4UA 3ASHA 3FH8A 2PL2A 4H7XA 4EBAA 4LCTA 1S63A 2JABA 2WM9A 3JUIA 2C0MA 3E4BA 3LS8A 3E37A 4XKCA 1TN8A 3S7FA 1YCSB 5D0OD 3UINC 4ZFHA 1HX8A 3UQ3A 2WVIA 4FA6A 5CCLA 3BG0B 2OOEA 2XZDG 1N0QA 2X6IA 2EIKE 3Q78A 4UI9C 4EZLA 1FT1A 4G2VA 2I1KA 4APOA 2OEWA 3Q9NC 4CGWA 1BU9A 2ETAA 1KT0A 5FZQA 1NZNA 3SZ7A 5KNGA 3SFYA 2VSNA 1O1SA 1JPLA 2NSZA 2XRYA 3SFXA 3UX4A 1HS6A 3DRAA 5AYWD 3ZFWA 4DRXE 2B6CA 2KZTB 4XKBA 3SBSA 1JCSA 3U4TA 4JEUA 4GZDA 3R9MA 4G23A 3D3MA 5KJNA 1IHGA 3JQ1A 3CHMA 4TRQA 3FTSA 5JMND 3FUKA 2KZTA 4GYYA 4HI9A 4HOTA 4MKTA 4MRUA 3B13A 2QYUA 4GTPA 4A3TA 4UWLA 3NZUA 3P1UA 1SZ9A 4EECA 4GMLA 3ZHEB 3E33A 2GRPB 1UOHA 4UQXA 3CGHA 2I9CA 2P9PG 3CSTA 5ENQD 4WNGA 2A5UA 4OAUC 2F37A 5H7PA 4GPKA 1HZ4A 4HVBA 1FPPA 2HM8A 4YVOA 3CKCA 3ZU7B 1LD7A 3RAUA 4J8SA 1RZ4A 4BTBA 3SY2A 4GTVA 1HU3A 3RJVA 3RRNB 1K1BA 3FTUA 1Q2ZA 1MX2A 3MGBA 4BX8A 2WXIA 3J5PA 3UKUG 4OVVA 3CVVA 2ZXWE 3FUDA 4TUUA 2VSYA 5EIBE 4B94A 1LF8A 2GRLA 4GA1A 1HF8A 3RRUA 4AM9A 5E76A 4ACLA 3L16A 2DWZA 3PH0C 3E34A 2DYSE 3JYSA 4KZCA 3ZVVA 4W9RA 4XE0A 4JC8A 4N2QA 2L6JA 4JB8P 3X2QE 3SFZA 2IEJA 2HYZA 4A3VA 1H2VC 4C48B 1QYMA 2RG8A 2LUHA 2P9LG 3MV2B 2OV8A 3HXFA 4I9EA 1KPSB 4RG6A 4I6JA 1X5BA 3UPVA 5LX8A 5DBKA 1V55E 4LUNU 2VSXE 4NIKA 3QJZA 2C0LA 3SD5A 3LEWA 3D9MA 3APDA 2J8SD 4B8AA 4DJAA 1D8DA 1Z5SC 1IHBA 3TL5A 1MQSA 3CK9A 3EIQC 4CDNA 4PS8A 2IFUA 3MKQA 3IHYA 4Y6CA 4LEUA 2AXUA 2PZIA 2E2EA 3C72A 4K0RA 4WUYA 4XIFA 3ULEG 3JUEA 3UM2A 2FEZA 1PAQA 4U0ZA 3SNXA 3Q79A 4IN3B 1BI8B 4ANVA 3ABME 4BSZB 4PS7A 2V4LA 3S7BA 5JJTA 3ZPJA 1SVXA 3FEXA 3VTXA 4CCAA 1IXVA 3MV3B 3QAQA 2XGOA 2GW1A 1Z6TA 5B3SE 3GZSA 5AN8A 4LNUD 3CSFA 3MYVA 3NAWA 3APFA 5G04J 3FTWA 3CR3A 2DIWA 1UJKA 2I6HA 4ANUA 2BF0X 3B7TA 5BV0A 3PEUB 3OXGA 1MX6A 4DX5D 1EYHA 3G2VA 1U3DA 3QWWA 1K1AA 3L82A 3SO8A 3I4RB 3G2SA 1NA3A 3AAAC 3PZ3A 3DEPA 3C98A 3DPDA 3ABKE 4C9BB 2ETCA 2DZOA 4I1OB 5BUZA 1ELRA 5E75A 4DPRA 3UXGA 5HS0A 4CDRA 2QC9A 2XEEA 3DSTA 5EKQD 2L6BA 4I2WA 4BX9A 2WXJA 4HI8A 3UM3A 2VTBA 2H6IA 2PM6A 1H2UA 5T3RA 5FT9A 4I2ZA 2XPIA 2ZIRA 4TXRA 3D9JA 3PZDA 2YINA 1OWLA 2Y4TA 4XI9A 3RKVA 4LNGA 2IO3C 2AXZA 3TWSA 4AY6A 3PUJA 3KSLA 2R2LA 1H6KA 4EPZA 2CG2A 1ELWA 1ZU2A 3G2UA 2KCVA 1UW4B 2XGSA 4PS3A 2WXRA 2R02A 4GTQA 2Y0BG 3DWLG 2KBXA 2H6GA 3ASDA 3UIPC 4NURA 4YNDA 4E6HA 4URKA 2WB2A 1DNPA 2VJ8A 3PDNA 1MHQA 4OYSA 1FT2A 4N3AA 3NQPA 4GA2A 4Q96A 3IBEA 1AP7A 3ULQA 3UKRG 2F0YA 4U7EB 3CVNA 2HR2A 1BI7B 3L22A 4JEHA 5FQ4A 3JXIA 4U8HA 4JHKA 4GTTA 3FUHA 2MHKA 2MYOA 5BXUA 1X81A 4NRHB 3Q47B 1N9AA 1E90A 3C5RA 3HRAA 3FTVA 3D9KA 2PQRA 3Q7FA 3HIZA 4UQYA 3CQCB 2LSVA 3FWVA 3RIBA 3HXBA 4QQIA 1OWMA 3CLJA 4DUIA 2J07A 2R59A 2QYJA 2LNIA 1MX4A 5HRYA 3AS5A 1JWGA 3FULA 3T5XA 1YYHA 1SA4A 2R5SA 3PVLA 1QNFA 3JCKC 3B7RL 4ACKA 4FLHA 2WQHA 1S0PA 3JXJA 3ESKA 2V5QC 3EHNA 3WG7E 4LG6A 3DXKG 2IOLA 1RW2A 3QWVA 4GTOA 4GZ6A 5KWDA 2NYJA 3GYZA 4JHJA 1QZ2A 1IQUA 5KJKA 1H6PA 3CVYA 5G05C 4A55A 3RO2A 4BFRA 4FP7A 1NI1A 2HE0A 4J8EA 3HG0D 1OCCE 4N3CA 1KT1A 2XENA 4GCNA 1Z3YA 2CG3A 1YMPA 4I43A 2XCBA 5BNWA 4DI4A 1BD8A 1ZB1A 2WXFA 4DK5A 3PNLB 4EZKA 4G24A 5BW8C 2KCKA 1O5MA 4OVUA 2OVFA 2VYIA 3L54A 4AEZC 2AXVA 3MJWA 3FTXA 5T8IA 4GAAA 3QOUA 3T8MA 3U64A 3V30A 4OAVB 3R9AB 4DX2A 1QQEA 1TN7A 2H6HA 2J49A 3FUJA 4F6RD 2P2CP 5FTPA 3CHSA 2P9IG 2JLBA 5AQ7A 5FQ8A 4CZ2D 5D66A 3FH5A 4U0UA 5KNHD 3ZRHA 4NACA 3TXNA 2EINE 3QWPA 4DLQA 1K8KG 1GW6A 4J6IA 2V5FA 3TWTA 3ZW3A 3CVPA 1MZCA 4HOQA 4O1PA 2ZISA 3KEZA 3TXMA 1DCEA 3V79K 5LP0A 5ENSD 4HLEA 3DSVA 1BLXB 2LSUA 5AQ9A 1N11A 5KBAA 4F53A 3HXEA 5CEAA 2I2OA 1NP7A 5EX3A 4N2SA 3I3NA 5EILA 3QB2A 1NA0A 5EIDA 3C3QA 1XGWA 1OY3D 3KSQA 4AY5A 3PNTB 1PY1A 2FF4A 1TNUA 4BY6A 2WPVA 2FO7A 2IJGX 5EDSA 2WXNA 4WAFA 4Q69A 3AG4E 2XZTG 4L23A 5FZSA 3N71A 4L2YA 3QKYA 4N3BA 3ZHEA 5LOZA 1WAO1 4J8DA 2DBAA 4K03A 4GTMA 4WWPA 4AV7A 2ILRA 3TWXA 1A5EA 3S7DA 4G1TA 1TNOA 2X6FA 5FWQA 2P9SG 4HLLA 3ZYQA 3L17A 2DCPA 1N4RA 4DLOA 4U63A 1E8WA 2X38A 4B93B 4JA9A 3Q7AA 5BV1A 3HXCA 4U96D 3FU3A 3QDNA 2NC9A 4FU3A 4DI3A 2Y1LE 2J08A 2IO2C 5ENTD 3S2AA 2UWJG 3L6AA 5KCMA 1ZBPA 3KS2A 3LJNA 1TEZA 3Q5MA 3LYAA 2KC7A 3UM1A 1W3BA 3FU6A 3RO3A 4YDOA 4EHMA 1A17A 4KVMA 3R7QA 2QFCA 3ESLA 4GZ5A 3V2XA 3P2BA 4FLBA 3SQVA 5JHBA 4TV3A 4CEMA 1OCZE 3ASGA 2R17C 3EUVA 2CHZA 4HRNA 3FTZA 1E8YA 5ENRD 5B1AE 4V3IA 4BETA 3UT4A 5EYPF 1DCQA 4WNFA 2L0IA 3ML8A 1TR4A 4J8FA 3TG5A 5FQ6A 2EILE 4UWKA 3ZYMA 3CKBA 5FZRA 4UWFA 5ITZF 3MKQB 4BEPA 4WNDA 1HXIA 3URZA 4UWGA 4QFVA 3OXLA 3UMVA 3BG1B 3U9WA 4EZJA 2BUGA 2YQ8A 2VGXA 2XEVA 4JA7A 1H0AA 5ENOD 1SW6A 4G8KA 3ASNE 3DXMG 2ZGGA 1TJCA 4ME2A 2BKGA 1OXJA 5A6CA 3ONKA 4IULA 3EJNA 1TNYA 1HG5A 4RLYA 4I9CA 3PZ2A 3RK6A 4AOFA 2QY7A 1SQMA 2EIME 1N95A 2IU1A 2RKKA 3ZNGA 3PE3A 3TJPA 2WXHA 3ZIMA 3EU9A 4HFGA 4ANWA 2AW6A 2L9BA 4CRWA 4F7AA 2DZNA 2WXMA 3UI2A 3ABLE 3OTNA 1HH8A 4B89A 5AIJA 2Y69E 2CFZA 3LJ3A 2KXPC 2FULA 4FHKA 4WWOA 3FUFA 3GW4A 3Q49B 5LCWC 2XPYA 2A4ZA 4PDXA 5ANRA 5M72A 1S64A 3LVQE 3HVEA 5B1BE 2GRRB 1SZAA 5FQ7A 4BT8A 4TUMA 2WMNA 3KEAA 5AARA 1SA5A 1NFIE 3TAXA 2M63A 2A5EA 3MKRA 1O1RA 3D9OA 4M7CA 3B7SA 5ARFA 2LAIA 3PZ1A 4U8VD 2IONA 3NB2A 5CRUA 1UG3A 4B8CB 4O1OA 5CECB 3D9HA 1XNFA 1OWNA 3QC1A 3CVXA 5DIZA 5KJLA 5AAOA 3UIOC 2ETBA 2KCLA 4AXHA 4L2LA 2YHCA 4KT6B 3ZYLA 5BXOA 4KXKB 1JUQA 3CQGB 4UI9J 3QARA 3CHOA 4GMJA 1JWFA 3FDHA 4O60A 3LCAA 3DSXA 3W9GA 2IOSA 3FUNA 3FU5A 4I17A 4BT9A 3FUIA 4KBQA 1S70B 5T4YA 4JVSA 2VSOE 4N39A 3LY9A 4CYMD 4JZYA 2V0PA 2X6KA 2GROB 2J4BA 1O1TA 4I1AA 5G2NA 3QK0A 1YA0A 2KM4A 5LCWJ 3EIJA 3D9PA 1OCOE 1U3CA 4GZCA 3U3WA 3SI5A 3SF4A 3IV0A 4ABNA 4UWHA 3PS6A 3NBNB 4DX7D 3FUMA 1QBQA 4AJWA 2Y3AA 3HDXA 3UTMA 3VTYA 3TWQA 4Q94A 3O48A 2HO1A 3LKUA 1KZPA 2OVBA 2EQXA 3CVLA 3Q4AB 1N52A 3FTYA 3CV0A 3DBSA 2WXQA 2EIJE 3BQOA 5FJYA 3ML9A 5A7DB 3AJIA 2MOWA 3CEQA 4YVQC 3CVWA 5D2MC 3FY4A 4A63B 4IRUA 3LY7A 3DSSA 3NOGD 3TGOA 4JPSA 3I4GA 3LPZA 1UJJA 1B89A 2YNQA 2F8XK 4HOSA 3QNKA 4GA0A 2WXKA 3Q73A 1V54E 1E8ZA 4UI9K 2UY1B 1N4PA 3PEVB 3B7UX 1N4QA 4XX5A 4J0UA 5AENA 2CFUA 4JD2G 5J08A 3TWRA 4HXIA 1E7VA 3CVUA 4E85A 4K5CA 1ELKA 4ZHBA 2P9KG 2VQ2A 4HB5A 1IYGA 1E96B 3U66A 2GGFA 4AIFA 1TJFA 5CHEE 3AG2E 2BEDA 4CDMA 2V8SE 2XRZA 1EF1C 2MRIA 2CHWA 3MZLB 2LXLA 2ZGDA 3DEOA 5CRVA 4GTSA 5EN5D 1DVPA 3NOCD 4P29A 4XEIG 3DSUA 3L9TA 4B0ZA 3OAWA 3ASOE 1H2TC 2E0IA 4J7WA 3NZSA 3JQ0A
chains in the Genus database with same CATH topology
3C72A 3SFXA 1D8EA 1NL4A 1O5MA 3EU5A 3Q7FA 3DSSA 4YDOA 3Q79A 4EHMA 3KSQA 1LTXA 3DRAA 4YDEA 3DSWA 4LNGA 1TNUA 1TNZA 1TN6A 3HXBA 4GTRA 3EUVA 4L9PA 3E32A 1JCSA 4MBGA 3KSLA 3DSXA 3Q73A 2R2LA 1TN7A 3E30A 2H6HA 3E34A 3HXDA 1N4PA 1N4QA 1O1TA 2IEJA 4GTQA 1S63A 1SA4A 4GTPA 2H6GA 2H6FA 4GTMA 3E37A 1S64A 1N94A 1TN8A 4LNBA 3E33A 3HXFA 1TNOA 1FT2A 1QBQA 1TNBA 2BEDA 4GTOA 1SA5A 3PZ3A 1LD8A 2F0YA 1MZCA 1N4RA 3Q78A 1FT1A 1KZPA 3DPYA 3PZ4A 2ZISA 1O1RA 4GTSA 1JCQA 1NI1A 1DCEA 3Q7AA 4GTTA 1D8DA 3HXCA 3DSVA 3Q75A 3DSTA 1N4SA 3PZ1A 1FPPA 1X81A 3DSUA 1JCRA 1N9AA 1TNYA 1LD7A 3HXEA 2H6IA 3SFYA 3PZ2A 4GTVA 1O1SA 1N95A 2ZIRA 1KZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C72 A;  3SFX A;  1D8E A;  1NL4 A;  1O5M A;  3EU5 A;  3Q7F A;  3DSS A;  4YDO A;  3Q79 A;  4EHM A;  3KSQ A;  1LTX A;  3DRA A;  4YDE A;  3DSW A;  4LNG A;  1TNU A;  1TNZ A;  1TN6 A;  3HXB A;  4GTR A;  3EUV A;  4L9P A;  3E32 A;  1JCS A;  4MBG A;  3KSL A;  3DSX A;  3Q73 A;  2R2L A;  1TN7 A;  3E30 A;  2H6H A;  3E34 A;  3HXD A;  1N4P A;  1N4Q A;  1O1T A;  2IEJ A;  4GTQ A;  1S63 A;  1SA4 A;  4GTP A;  2H6G A;  2H6F A;  4GTM A;  3E37 A;  1S64 A;  1N94 A;  1TN8 A;  4LNB A;  3E33 A;  3HXF A;  1TNO A;  1FT2 A;  1QBQ A;  1TNB A;  2BED A;  4GTO A;  1SA5 A;  3PZ3 A;  1LD8 A;  2F0Y A;  1MZC A;  1N4R A;  3Q78 A;  1FT1 A;  1KZP A;  3DPY A;  3PZ4 A;  2ZIS A;  1O1R A;  4GTS A;  1JCQ A;  1NI1 A;  1DCE A;  3Q7A A;  4GTT A;  1D8D A;  3HXC A;  3DSV A;  3Q75 A;  3DST A;  1N4S A;  3PZ1 A;  1FPP A;  1X81 A;  3DSU A;  1JCR A;  1N9A A;  1TNY A;  1LD7 A;  3HXE A;  2H6I A;  3SFY A;  3PZ2 A;  4GTV A;  1O1S A;  1N95 A;  2ZIR A;  1KZO A; 
#chains in the Genus database with same CATH topology
 3TG4 A;  3EDT B;  4FHJ A;  2XPZ A;  4I1M A;  2LAH A;  3MCX A;  5G04 C;  1TYQ G;  4M3O A;  2XQ0 A;  4J8Y A;  3E30 A;  5CMW A;  5CER B;  2RD0 A;  2XHE A;  4CT4 A;  3HXD A;  4KZ0 A;  4K5B A;  3ZGQ A;  4NQ0 A;  4RVB A;  3OXF A;  4R7L A;  2GRN B;  4UQZ A;  4IYP A;  4F3V A;  4L7T A;  2WMO A;  5C2Y A;  3GZ2 A;  3J5Q B;  2RFM A;  1EDU A;  4N5C A;  2IQC A;  3G2W A;  1N94 A;  1L5J A;  3CHP A;  3D9N A;  3F6Q A;  1AWC B;  3C3R A;  3HYM B;  3SHF A;  4GU5 A;  4U07 A;  4ANX A;  5AJD A;  4JL0 A;  4G8L A;  5G55 A;  4CT0 A;  3RRM B;  4FAD A;  3ZUV B;  5EX0 A;  5ARG A;  4TXQ A;  1HO8 A;  2X6J A;  4AP2 A;  4F1P A;  5EYL A;  2OND A;  2R05 A;  2VGE A;  2AWI A;  3GZ1 A;  3TWV A;  3EU5 A;  4G11 A;  2XS8 A;  4ILI A;  3G2T A;  3T5V A;  3ONL A;  2FBN A;  3B7B A;  1UN8 A;  4GTR A;  4LRZ A;  3VLE A;  1N54 A;  4BER A;  4ATZ D;  1BPO A;  3FFL A;  1Y8M A;  4FC8 A;  4N5Q A;  3LXU X;  4H7Y A;  1IKN D;  1WG0 A;  1WY6 A;  4BTA A;  5JA4 D;  4GYO A;  4ILG A;  5FIO A;  2OEV A;  3UUX A;  5BPP A;  3CK8 A;  4JW1 A;  4U04 A;  1Y6I A;  2JEK A;  4HRM B;  4TXP A;  3AU4 A;  3UT8 A;  3MX3 A;  2P58 C;  4RG9 A;  4MS6 A;  2BKK B;  3SBT B;  3LDZ A;  1G3N B;  2XS1 A;  1FVF A;  2YHE A;  3FH7 A;  1TNB A;  1H6O A;  3AS4 A;  4RSY A;  4PH4 B;  4G26 A;  1FVH A;  2J09 A;  2AJA A;  4U0S A;  3D9L A;  2XEH A;  1PC2 A;  3LY8 A;  1JCQ A;  3D9I A;  2F8Y A;  2DVW A;  5KJM A;  2FO1 E;  3TWW A;  1N4S A;  2CHX A;  5JHA A;  1WDY A;  4Z68 A;  4GPM A;  3MA5 A;  2Q7F A;  4XI0 A;  4GB9 A;  4KMO A;  3EHQ A;  2B0O E;  1EPU A;  4RQI A;  2RFA A;  3KD7 A;  4HS2 A;  4HOR A;  3CK7 A;  5ENP D;  5CBN A;  4APF A;  2L0T B;  3MEK A;  3FUE A;  4F1S A;  3V2O A;  2P9N G;  1TN6 A;  4I6G A;  4U8Y D;  1HG2 A;  3AG3 E;  4YDW A;  3R7R A;  3EHR A;  5C1D A;  3ENE A;  4BSX A;  3UT7 A;  3B95 A;  3ZXP A;  4DX1 A;  3SGH A;  2WQ6 A;  4JHR A;  2XGM A;  3C3O A;  1VDY A;  1OCR E;  2KAT A;  3T9K A;  5HQ8 A;  2PM7 A;  2WXO A;  1Z3X A;  3PRE A;  4GCO A;  2ZU6 B;  1MJ0 A;  3AU5 A;  2IF4 A;  3VLD A;  3KAE A;  4LNB A;  4O6F A;  3ULY A;  3PUK A;  2PNN A;  4FUL A;  1INZ A;  5G05 J;  4LSZ E;  4C0M A;  2OCC E;  3IKO B;  3ZXS A;  3RU0 A;  4UUC A;  3LVR E;  1N0R A;  3EHM A;  1LD8 A;  4WNE A;  2QZA A;  1FCH A;  4BES A;  1KLX A;  5LFA A;  3FHE A;  3DPY A;  4L1B A;  5AQB A;  2LO6 A;  2GRM A;  1D9S A;  2VGX B;  1UN9 A;  1JCR A;  4U95 D;  4KYO B;  2J4D A;  3BU8 A;  4X8Q A;  2WXP A;  5BT1 A;  4ATG A;  3BUA A;  4Y6W A;  2XCC A;  5ENN A;  1DC2 A;  3ASF A;  4EBA G;  2C2L A;  4GMR A;  2IY0 C;  1LTX A;  1P5Q A;  3WXX A;  5FIN A;  2X6H A;  3ISM C;  4I6E A;  4L9P A;  3E32 A;  3Q9U C;  3CVQ A;  4A1S A;  4MBG A;  3VLF A;  4PUC A;  2FI7 A;  1IQR A;  4KVO A;  2PQN A;  3AS8 A;  3IXE A;  3UM0 A;  3ZKJ A;  5IY5 E;  2NXP A;  4MLP A;  5CMY A;  3HHM A;  4G25 A;  3CHQ A;  1H19 A;  5A23 A;  4AVX A;  5D0Q D;  4LER A;  3IEG A;  3FEY A;  4D10 C;  3L08 A;  1K3Z D;  4C0E A;  2H6F A;  3FP3 A;  5AJL A;  1OWP A;  3T8K A;  4DX6 D;  3W9F A;  3NF1 A;  4FJY A;  3HVE B;  2J9Q A;  3TWU A;  3IHV A;  3BEE A;  1E7U A;  1OWO A;  5HI7 A;  2WXG A;  3ZEF A;  3Q15 A;  3PE4 A;  4ILH B;  2VGY A;  1HE8 A;  3APC A;  4CGV A;  5HKP A;  3PZ4 A;  2P9U G;  5CCM A;  3ZYK A;  2DYR E;  4BWR A;  4FJZ A;  5ANL A;  4EQF A;  2AVP A;  3Q75 A;  1OT8 A;  4GZ3 A;  3PRZ A;  5JJ7 A;  2UY1 A;  1HFA A;  3FU0 A;  3CHR A;  2BTD A;  1MYO A;  1WM5 A;  2LXM A;  3ZN3 A;  4GYW A;  4HOU A;  4HRL A;  4HBD A;  2X3M A;  3RSE G;  2WQ7 A;  4JXT A;  3K9I A;  4XZ4 A;  3AG1 E;  1KZO A;  1OUV A;  4A1G A;  1D8E A;  4WWN A;  1NL4 A;  3O4Z A;  3S7J A;  4YDY A;  4K5A B;  3CIA A;  4YDE A;  2R03 A;  3DSW A;  2VTB B;  1U2V G;  2GRQ B;  5CBO A;  1TNZ A;  3I5P A;  3L13 A;  5J90 A;  1E8X A;  2I1J A;  3V31 A;  4HQD A;  4HNA D;  2WXL A;  5JJ6 A;  2V4H C;  5CED B;  5AQA A;  2Y4U A;  3ASH A;  3FH8 A;  2PL2 A;  4H7X A;  4EBA A;  4LCT A;  1S63 A;  2JAB A;  2WM9 A;  3JUI A;  2C0M A;  3E4B A;  3LS8 A;  3E37 A;  4XKC A;  1TN8 A;  3S7F A;  1YCS B;  5D0O D;  3UIN C;  4ZFH A;  1HX8 A;  3UQ3 A;  2WVI A;  4FA6 A;  5CCL A;  3BG0 B;  2OOE A;  2XZD G;  1N0Q A;  2X6I A;  2EIK E;  3Q78 A;  4UI9 C;  4EZL A;  1FT1 A;  4G2V A;  2I1K A;  4APO A;  2OEW A;  3Q9N C;  4CGW A;  1BU9 A;  2ETA A;  1KT0 A;  5FZQ A;  1NZN A;  3SZ7 A;  5KNG A;  3SFY A;  2VSN A;  1O1S A;  1JPL A;  2NSZ A;  2XRY A;  3SFX A;  3UX4 A;  1HS6 A;  3DRA A;  5AYW D;  3ZFW A;  4DRX E;  2B6C A;  2KZT B;  4XKB A;  3SBS A;  1JCS A;  3U4T A;  4JEU A;  4GZD A;  3R9M A;  4G23 A;  3D3M A;  5KJN A;  1IHG A;  3JQ1 A;  3CHM A;  4TRQ A;  3FTS A;  5JMN D;  3FUK A;  2KZT A;  4GYY A;  4HI9 A;  4HOT A;  4MKT A;  4MRU A;  3B13 A;  2QYU A;  4GTP A;  4A3T A;  4UWL A;  3NZU A;  3P1U A;  1SZ9 A;  4EEC A;  4GML A;  3ZHE B;  3E33 A;  2GRP B;  1UOH A;  4UQX A;  3CGH A;  2I9C A;  2P9P G;  3CST A;  5ENQ D;  4WNG A;  2A5U A;  4OAU C;  2F37 A;  5H7P A;  4GPK A;  1HZ4 A;  4HVB A;  1FPP A;  2HM8 A;  4YVO A;  3CKC A;  3ZU7 B;  1LD7 A;  3RAU A;  4J8S A;  1RZ4 A;  4BTB A;  3SY2 A;  4GTV A;  1HU3 A;  3RJV A;  3RRN B;  1K1B A;  3FTU A;  1Q2Z A;  1MX2 A;  3MGB A;  4BX8 A;  2WXI A;  3J5P A;  3UKU G;  4OVV A;  3CVV A;  2ZXW E;  3FUD A;  4TUU A;  2VSY A;  5EIB E;  4B94 A;  1LF8 A;  2GRL A;  4GA1 A;  1HF8 A;  3RRU A;  4AM9 A;  5E76 A;  4ACL A;  3L16 A;  2DWZ A;  3PH0 C;  3E34 A;  2DYS E;  3JYS A;  4KZC A;  3ZVV A;  4W9R A;  4XE0 A;  4JC8 A;  4N2Q A;  2L6J A;  4JB8 P;  3X2Q E;  3SFZ A;  2IEJ A;  2HYZ A;  4A3V A;  1H2V C;  4C48 B;  1QYM A;  2RG8 A;  2LUH A;  2P9L G;  3MV2 B;  2OV8 A;  3HXF A;  4I9E A;  1KPS B;  4RG6 A;  4I6J A;  1X5B A;  3UPV A;  5LX8 A;  5DBK A;  1V55 E;  4LUN U;  2VSX E;  4NIK A;  3QJZ A;  2C0L A;  3SD5 A;  3LEW A;  3D9M A;  3APD A;  2J8S D;  4B8A A;  4DJA A;  1D8D A;  1Z5S C;  1IHB A;  3TL5 A;  1MQS A;  3CK9 A;  3EIQ C;  4CDN A;  4PS8 A;  2IFU A;  3MKQ A;  3IHY A;  4Y6C A;  4LEU A;  2AXU A;  2PZI A;  2E2E A;  3C72 A;  4K0R A;  4WUY A;  4XIF A;  3ULE G;  3JUE A;  3UM2 A;  2FEZ A;  1PAQ A;  4U0Z A;  3SNX A;  3Q79 A;  4IN3 B;  1BI8 B;  4ANV A;  3ABM E;  4BSZ B;  4PS7 A;  2V4L A;  3S7B A;  5JJT A;  3ZPJ A;  1SVX A;  3FEX A;  3VTX A;  4CCA A;  1IXV A;  3MV3 B;  3QAQ A;  2XGO A;  2GW1 A;  1Z6T A;  5B3S E;  3GZS A;  5AN8 A;  4LNU D;  3CSF A;  3MYV A;  3NAW A;  3APF A;  5G04 J;  3FTW A;  3CR3 A;  2DIW A;  1UJK A;  2I6H A;  4ANU A;  2BF0 X;  3B7T A;  5BV0 A;  3PEU B;  3OXG A;  1MX6 A;  4DX5 D;  1EYH A;  3G2V A;  1U3D A;  3QWW A;  1K1A A;  3L82 A;  3SO8 A;  3I4R B;  3G2S A;  1NA3 A;  3AAA C;  3PZ3 A;  3DEP A;  3C98 A;  3DPD A;  3ABK E;  4C9B B;  2ETC A;  2DZO A;  4I1O B;  5BUZ A;  1ELR A;  5E75 A;  4DPR A;  3UXG A;  5HS0 A;  4CDR A;  2QC9 A;  2XEE A;  3DST A;  5EKQ D;  2L6B A;  4I2W A;  4BX9 A;  2WXJ A;  4HI8 A;  3UM3 A;  2VTB A;  2H6I A;  2PM6 A;  1H2U A;  5T3R A;  5FT9 A;  4I2Z A;  2XPI A;  2ZIR A;  4TXR A;  3D9J A;  3PZD A;  2YIN A;  1OWL A;  2Y4T A;  4XI9 A;  3RKV A;  4LNG A;  2IO3 C;  2AXZ A;  3TWS A;  4AY6 A;  3PUJ A;  3KSL A;  2R2L A;  1H6K A;  4EPZ A;  2CG2 A;  1ELW A;  1ZU2 A;  3G2U A;  2KCV A;  1UW4 B;  2XGS A;  4PS3 A;  2WXR A;  2R02 A;  4GTQ A;  2Y0B G;  3DWL G;  2KBX A;  2H6G A;  3ASD A;  3UIP C;  4NUR A;  4YND A;  4E6H A;  4URK A;  2WB2 A;  1DNP A;  2VJ8 A;  3PDN A;  1MHQ A;  4OYS A;  1FT2 A;  4N3A A;  3NQP A;  4GA2 A;  4Q96 A;  3IBE A;  1AP7 A;  3ULQ A;  3UKR G;  2F0Y A;  4U7E B;  3CVN A;  2HR2 A;  1BI7 B;  3L22 A;  4JEH A;  5FQ4 A;  3JXI A;  4U8H A;  4JHK A;  4GTT A;  3FUH A;  2MHK A;  2MYO A;  5BXU A;  1X81 A;  4NRH B;  3Q47 B;  1N9A A;  1E90 A;  3C5R A;  3HRA A;  3FTV A;  3D9K A;  2PQR A;  3Q7F A;  3HIZ A;  4UQY A;  3CQC B;  2LSV A;  3FWV A;  3RIB A;  3HXB A;  4QQI A;  1OWM A;  3CLJ A;  4DUI A;  2J07 A;  2R59 A;  2QYJ A;  2LNI A;  1MX4 A;  5HRY A;  3AS5 A;  1JWG A;  3FUL A;  3T5X A;  1YYH A;  1SA4 A;  2R5S A;  3PVL A;  1QNF A;  3JCK C;  3B7R L;  4ACK A;  4FLH A;  2WQH A;  1S0P A;  3JXJ A;  3ESK A;  2V5Q C;  3EHN A;  3WG7 E;  4LG6 A;  3DXK G;  2IOL A;  1RW2 A;  3QWV A;  4GTO A;  4GZ6 A;  5KWD A;  2NYJ A;  3GYZ A;  4JHJ A;  1QZ2 A;  1IQU A;  5KJK A;  1H6P A;  3CVY A;  5G05 C;  4A55 A;  3RO2 A;  4BFR A;  4FP7 A;  1NI1 A;  2HE0 A;  4J8E A;  3HG0 D;  1OCC E;  4N3C A;  1KT1 A;  2XEN A;  4GCN A;  1Z3Y A;  2CG3 A;  1YMP A;  4I43 A;  2XCB A;  5BNW A;  4DI4 A;  1BD8 A;  1ZB1 A;  2WXF A;  4DK5 A;  3PNL B;  4EZK A;  4G24 A;  5BW8 C;  2KCK A;  1O5M A;  4OVU A;  2OVF A;  2VYI A;  3L54 A;  4AEZ C;  2AXV A;  3MJW A;  3FTX A;  5T8I A;  4GAA A;  3QOU A;  3T8M A;  3U64 A;  3V30 A;  4OAV B;  3R9A B;  4DX2 A;  1QQE A;  1TN7 A;  2H6H A;  2J49 A;  3FUJ A;  4F6R D;  2P2C P;  5FTP A;  3CHS A;  2P9I G;  2JLB A;  5AQ7 A;  5FQ8 A;  4CZ2 D;  5D66 A;  3FH5 A;  4U0U A;  5KNH D;  3ZRH A;  4NAC A;  3TXN A;  2EIN E;  3QWP A;  4DLQ A;  1K8K G;  1GW6 A;  4J6I A;  2V5F A;  3TWT A;  3ZW3 A;  3CVP A;  1MZC A;  4HOQ A;  4O1P A;  2ZIS A;  3KEZ A;  3TXM A;  1DCE A;  3V79 K;  5LP0 A;  5ENS D;  4HLE A;  3DSV A;  1BLX B;  2LSU A;  5AQ9 A;  1N11 A;  5KBA A;  4F53 A;  3HXE A;  5CEA A;  2I2O A;  1NP7 A;  5EX3 A;  4N2S A;  3I3N A;  5EIL A;  3QB2 A;  1NA0 A;  5EID A;  3C3Q A;  1XGW A;  1OY3 D;  3KSQ A;  4AY5 A;  3PNT B;  1PY1 A;  2FF4 A;  1TNU A;  4BY6 A;  2WPV A;  2FO7 A;  2IJG X;  5EDS A;  2WXN A;  4WAF A;  4Q69 A;  3AG4 E;  2XZT G;  4L23 A;  5FZS A;  3N71 A;  4L2Y A;  3QKY A;  4N3B A;  3ZHE A;  5LOZ A;  1WAO 1;  4J8D A;  2DBA A;  4K03 A;  4GTM A;  4WWP A;  4AV7 A;  2ILR A;  3TWX A;  1A5E A;  3S7D A;  4G1T A;  1TNO A;  2X6F A;  5FWQ A;  2P9S G;  4HLL A;  3ZYQ A;  3L17 A;  2DCP A;  1N4R A;  4DLO A;  4U63 A;  1E8W A;  2X38 A;  4B93 B;  4JA9 A;  3Q7A A;  5BV1 A;  3HXC A;  4U96 D;  3FU3 A;  3QDN A;  2NC9 A;  4FU3 A;  4DI3 A;  2Y1L E;  2J08 A;  2IO2 C;  5ENT D;  3S2A A;  2UWJ G;  3L6A A;  5KCM A;  1ZBP A;  3KS2 A;  3LJN A;  1TEZ A;  3Q5M A;  3LYA A;  2KC7 A;  3UM1 A;  1W3B A;  3FU6 A;  3RO3 A;  4YDO A;  4EHM A;  1A17 A;  4KVM A;  3R7Q A;  2QFC A;  3ESL A;  4GZ5 A;  3V2X A;  3P2B A;  4FLB A;  3SQV A;  5JHB A;  4TV3 A;  4CEM A;  1OCZ E;  3ASG A;  2R17 C;  3EUV A;  2CHZ A;  4HRN A;  3FTZ A;  1E8Y A;  5ENR D;  5B1A E;  4V3I A;  4BET A;  3UT4 A;  5EYP F;  1DCQ A;  4WNF A;  2L0I A;  3ML8 A;  1TR4 A;  4J8F A;  3TG5 A;  5FQ6 A;  2EIL E;  4UWK A;  3ZYM A;  3CKB A;  5FZR A;  4UWF A;  5ITZ F;  3MKQ B;  4BEP A;  4WND A;  1HXI A;  3URZ A;  4UWG A;  4QFV A;  3OXL A;  3UMV A;  3BG1 B;  3U9W A;  4EZJ A;  2BUG A;  2YQ8 A;  2VGX A;  2XEV A;  4JA7 A;  1H0A A;  5ENO D;  1SW6 A;  4G8K A;  3ASN E;  3DXM G;  2ZGG A;  1TJC A;  4ME2 A;  2BKG A;  1OXJ A;  5A6C A;  3ONK A;  4IUL A;  3EJN A;  1TNY A;  1HG5 A;  4RLY A;  4I9C A;  3PZ2 A;  3RK6 A;  4AOF A;  2QY7 A;  1SQM A;  2EIM E;  1N95 A;  2IU1 A;  2RKK A;  3ZNG A;  3PE3 A;  3TJP A;  2WXH A;  3ZIM A;  3EU9 A;  4HFG A;  4ANW A;  2AW6 A;  2L9B A;  4CRW A;  4F7A A;  2DZN A;  2WXM A;  3UI2 A;  3ABL E;  3OTN A;  1HH8 A;  4B89 A;  5AIJ A;  2Y69 E;  2CFZ A;  3LJ3 A;  2KXP C;  2FUL A;  4FHK A;  4WWO A;  3FUF A;  3GW4 A;  3Q49 B;  5LCW C;  2XPY A;  2A4Z A;  4PDX A;  5ANR A;  5M72 A;  1S64 A;  3LVQ E;  3HVE A;  5B1B E;  2GRR B;  1SZA A;  5FQ7 A;  4BT8 A;  4TUM A;  2WMN A;  3KEA A;  5AAR A;  1SA5 A;  1NFI E;  3TAX A;  2M63 A;  2A5E A;  3MKR A;  1O1R A;  3D9O A;  4M7C A;  3B7S A;  5ARF A;  2LAI A;  3PZ1 A;  4U8V D;  2ION A;  3NB2 A;  5CRU A;  1UG3 A;  4B8C B;  4O1O A;  5CEC B;  3D9H A;  1XNF A;  1OWN A;  3QC1 A;  3CVX A;  5DIZ A;  5KJL A;  5AAO A;  3UIO C;  2ETB A;  2KCL A;  4AXH A;  4L2L A;  2YHC A;  4KT6 B;  3ZYL A;  5BXO A;  4KXK B;  1JUQ A;  3CQG B;  4UI9 J;  3QAR A;  3CHO A;  4GMJ A;  1JWF A;  3FDH A;  4O60 A;  3LCA A;  3DSX A;  3W9G A;  2IOS A;  3FUN A;  3FU5 A;  4I17 A;  4BT9 A;  3FUI A;  4KBQ A;  1S70 B;  5T4Y A;  4JVS A;  2VSO E;  4N39 A;  3LY9 A;  4CYM D;  4JZY A;  2V0P A;  2X6K A;  2GRO B;  2J4B A;  1O1T A;  4I1A A;  5G2N A;  3QK0 A;  1YA0 A;  2KM4 A;  5LCW J;  3EIJ A;  3D9P A;  1OCO E;  1U3C A;  4GZC A;  3U3W A;  3SI5 A;  3SF4 A;  3IV0 A;  4ABN A;  4UWH A;  3PS6 A;  3NBN B;  4DX7 D;  3FUM A;  1QBQ A;  4AJW A;  2Y3A A;  3HDX A;  3UTM A;  3VTY A;  3TWQ A;  4Q94 A;  3O48 A;  2HO1 A;  3LKU A;  1KZP A;  2OVB A;  2EQX A;  3CVL A;  3Q4A B;  1N52 A;  3FTY A;  3CV0 A;  3DBS A;  2WXQ A;  2EIJ E;  3BQO A;  5FJY A;  3ML9 A;  5A7D B;  3AJI A;  2MOW A;  3CEQ A;  4YVQ C;  3CVW A;  5D2M C;  3FY4 A;  4A63 B;  4IRU A;  3LY7 A;  3DSS A;  3NOG D;  3TGO A;  4JPS A;  3I4G A;  3LPZ A;  1UJJ A;  1B89 A;  2YNQ A;  2F8X K;  4HOS A;  3QNK A;  4GA0 A;  2WXK A;  3Q73 A;  1V54 E;  1E8Z A;  4UI9 K;  2UY1 B;  1N4P A;  3PEV B;  3B7U X;  1N4Q A;  4XX5 A;  4J0U A;  5AEN A;  2CFU A;  4JD2 G;  5J08 A;  3TWR A;  4HXI A;  1E7V A;  3CVU A;  4E85 A;  4K5C A;  1ELK A;  4ZHB A;  2P9K G;  2VQ2 A;  4HB5 A;  1IYG A;  1E96 B;  3U66 A;  2GGF A;  4AIF A;  1TJF A;  5CHE E;  3AG2 E;  2BED A;  4CDM A;  2V8S E;  2XRZ A;  1EF1 C;  2MRI A;  2CHW A;  3MZL B;  2LXL A;  2ZGD A;  3DEO A;  5CRV A;  4GTS A;  5EN5 D;  1DVP A;  3NOC D;  4P29 A;  4XEI G;  3DSU A;  3L9T A;  4B0Z A;  3OAW A;  3ASO E;  1H2T C;  2E0I A;  4J7W A;  3NZS A;  3JQ0 A; 
#chains in the Genus database with same CATH homology
 3C72 A;  3SFX A;  1D8E A;  1NL4 A;  1O5M A;  3EU5 A;  3Q7F A;  3DSS A;  4YDO A;  3Q79 A;  4EHM A;  3KSQ A;  1LTX A;  3DRA A;  4YDE A;  3DSW A;  4LNG A;  1TNU A;  1TNZ A;  1TN6 A;  3HXB A;  4GTR A;  3EUV A;  4L9P A;  3E32 A;  1JCS A;  4MBG A;  3KSL A;  3DSX A;  3Q73 A;  2R2L A;  1TN7 A;  3E30 A;  2H6H A;  3E34 A;  3HXD A;  1N4P A;  1N4Q A;  1O1T A;  2IEJ A;  4GTQ A;  1S63 A;  1SA4 A;  4GTP A;  2H6G A;  2H6F A;  4GTM A;  3E37 A;  1S64 A;  1N94 A;  1TN8 A;  4LNB A;  3E33 A;  3HXF A;  1TNO A;  1FT2 A;  1QBQ A;  1TNB A;  2BED A;  4GTO A;  1SA5 A;  3PZ3 A;  1LD8 A;  2F0Y A;  1MZC A;  1N4R A;  3Q78 A;  1FT1 A;  1KZP A;  3DPY A;  3PZ4 A;  2ZIS A;  1O1R A;  4GTS A;  1JCQ A;  1NI1 A;  1DCE A;  3Q7A A;  4GTT A;  1D8D A;  3HXC A;  3DSV A;  3Q75 A;  3DST A;  1N4S A;  3PZ1 A;  1FPP A;  1X81 A;  3DSU A;  1JCR A;  1N9A A;  1TNY A;  1LD7 A;  3HXE A;  2H6I A;  3SFY A;  3PZ2 A;  4GTV A;  1O1S A;  1N95 A;  2ZIR A;  1KZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...