3PZ4A

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10) in complex with bms3 and lipid substrate fpp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure-Guided Development of Selective RabGGTase Inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase/transferase inhibitor
total genus 117
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3pz4A00
3C72A 3E33A 1FT1A 4LNGA 3DSXA 4L9PA 3DSWA 3HXEA 3Q79A 1N4RA 3PZ3A 1KZPA 4GTSA 2IEJA 4GTMA 3Q78A 3E37A 3PZ2A 1O1SA 1TNYA 1N4QA 1D8EA 3DSUA 3HXCA 1TN6A 2BEDA 1JCQA 1O5MA 2ZIRA 3HXDA 1QBQA 1LD8A 1TNUA 2H6IA 3Q7AA 3DPYA 2H6GA 4GTOA 2H6HA 3PZ4A 1N95A 1SA4A 1DCEA 1X81A 4GTTA 1SA5A 1O1TA 1LTXA 4YDEA 1FPPA 3KSLA 3SFXA 1S63A 1NL4A 1N4PA 1NI1A 3KSQA 3DSTA 1N94A 3E30A 4GTVA 4YDOA 1TNBA 3DRAA 3EU5A 4GTPA 2F0YA 3HXFA 4LNBA 1S64A 1TNOA 3DSVA 1D8DA 2ZISA 1N9AA 3Q75A 2H6FA 1TNZA 1JCSA 3HXBA 4MBGA 2R2LA 1N4SA 1TN8A 3DSSA 3PZ1A 1KZOA 3EUVA 3SFYA 1FT2A 1MZCA 3E32A 1LD7A 1O1RA 3E34A 1JCRA 4GTRA 1TN7A 4GTQA 4EHMA 3Q7FA 3Q73A
chains in the Genus database with same CATH superfamily
3O48A 2VYIA 1FT1A 2I2OA 3CGHA 4AIFA 1HU3A 1QQEA 3PEVB 3DSWA 3G2TA 1N4RA 3FTUA 1AWCB 1EF1C 1P5QA 1Z3XA 3FDHA 5BNWA 2L0IA 3PREA 3NZSA 3FEXA 3UUXA 4C48B 3TXMA 1H6OA 5B3SE 2PQRA 5ITZF 3W9GA 2OVFA 4GTOA 1L5JA 2LSUA 1SA4A 3RKVA 4UQZA 2XPIA 3DXMG 3NBNB 4J8EA 3CK8A 3FTSA 2BKGA 2VGEA 2YNQA 4FLHA 2WXKA 2GRNB 2R05A 2XEHA 4O1PA 3MZLB 4EQFA 3UM2A 1HFAA 1HH8A 3P1UA 3X2QE 3RRMB 4JXTA 1E8ZA 5CRUA 3ONKA 3V2XA 3HXFA 1OUVA 5BPPA 3PZDA 4Z68A 3QDNA 1N9AA 1DNPA 2J07A 2RKKA 2V4LA 3D9PA 4HLLA 2WXFA 1JWFA 4PUCA 3PRZA 4PH4B 3LY9A 4AVXA 4N3CA 2DWZA 5HS0A 3E34A 2UWJG 3SNXA 5D0OD 3PUKA 3ZIMA 2J4BA 3TWWA 3WG7E 4G8LA 1S70B 5FIOA 3UM3A 4HRNA 5ARGA 4K0RA 4ATZD 1DC2A 1O1SA 3QNKA 4EBAG 4WUYA 2BEDA 3ASGA 2NYJA 2PNNA 3I4GA 3GZ1A 3NOGD 2KBXA 4Q96A 4JD2G 4HXIA 5JJ7A 3CVNA 3B95A 4OYSA 2H6HA 2AWIA 1N52A 1X81A 4HOQA 4HOTA 4GYWA 3QARA 4BSXA 3R7QA 2FBNA 1OCOE 5FWQA 4GZ5A 3RO2A 1XNFA 2R5SA 3DRAA 3OXFA 4LNBA 3F6QA 2YINA 2IO2C 1D8DA 4J7WA 2EIKE 4FC8A 1ZB1A 1SVXA 4MBGA 1MJ0A 2XPZA 3UX4A 5G05J 5AQ9A 2L6BA 2J8SD 2PM7A 3QJZA 2V5QC 1X5BA 1FCHA 5FJYA 1VDYA 5JA4D 1UN8A 1U2VG 3MKRA 3CHOA 2P9SG 4C0MA 3C72A 2RG8A 4GZDA 3EIQC 1V54E 3FTVA 5EKQD 3FUHA 2HM8A 3ZEFA 5BT1A 2IEJA 3RJVA 2WPVA 3CVPA 1H6PA 4PS8A 3B7TA 2YHEA 1OWOA 3D9IA 5ENTD 1TN6A 2CHZA 5G55A 1MHQA 2WMNA 3SD5A 4W9RA 3L82A 4P29A 3C3OA 4ACLA 3V30A 3UM0A 4L7TA 3CSFA 5BXOA 1OWMA 1YYHA 4L2YA 4R7LA 3BG1B 4YVQC 3EDTB 4EZJA 4A3TA 2XQ0A 4MRUA 4A3VA 3ASFA 3KSQA 4HNAD 4JC8A 3E30A 4DPRA 4GA1A 5CCLA 3PUJA 5A7DB 5LFAA 2A5UA 3ULQA 2PL2A 4JB8P 2X38A 3U3WA 3EIJA 3ZXPA 3G2UA 3ZW3A 3FTWA 2ONDA 1TN8A 1U3CA 2LO6A 4U0SA 1KPSB 4CDMA 2BF0X 1IKND 2CFZA 5LP0A 5AJLA 4UI9C 4GZCA 5ARFA 4ZFHA 5A6CA 4YDWA 2DVWA 3Q47B 2WB2A 2NSZA 3JQ1A 3ZHEB 3EHNA 3FULA 1QZ2A 3B7BA 3UQ3A 4Q94A 1EDUA 4UQXA 3PZ2A 1IQRA 3MA5A 4B93B 3HXCA 3ESLA 3ASNE 3CVVA 3UT8A 1E96B 3CHRA 2DZOA 3HRAA 1BLXB 5LCWC 2KXPC 4CGWA 3QWVA 1H19A 3CSTA 5FQ4A 2AJAA 5KCMA 5FZSA 3EJNA 1H0AA 3ML8A 4KXKB 4IULA 4FLBA 4BSZB 4BERA 3B7SA 3FP3A 1NZNA 1WM5A 2CHXA 2WXMA 2XHEA 4HRMB 3IXEA 4DUIA 4UQYA 4AJWA 3VLFA 4JEUA 4NIKA 2H6FA 1E90A 2JEKA 4HRLA 5EYPF 4Y6WA 3AG3E 3Q15A 2VSOE 3ABLE 5ENQD 5FZQA 3DBSA 5H7PA 4J8YA 3N71A 2F8YA 1TN7A 1N0RA 2QZAA 4F1SA 1WAO1 3L54A 4G26A 4F53A 3FUKA 5CCMA 5FQ8A 1OCZE 4EZKA 4HI9A 2MRIA 4N5QA 1HXIA 1KT0A 4JZYA 3V31A 3LCAA 3E37A 4U0UA 2R02A 2X6FA 2BUGA 3AU4A 1RZ4A 4D10C 3ZYKA 5ANLA 4A1GA 4M7CA 3HXDA 3IHVA 5CRVA 3S7JA 3I5PA 2LXMA 3SBTB 2KZTA 3B7UX 4OAUC 1YMPA 4C9BB 2WVIA 1DCEA 4BX9A 3L9TA 3RRNB 5CBOA 1Z5SC 3UKRG 2B0OE 4GU5A 3RO3A 2IOSA 1E7VA 4IRUA 3I4RB 3SI5A 2OEWA 4FULA 5FTPA 3ULEG 5CBNA 3CV0A 3KEAA 1LF8A 3CKBA 4GTPA 5G04C 3BEEA 2WXOA 3AG2E 3SGHA 2YHCA 2NC9A 4A1SA 4DX2A 4IN3B 3L22A 3PZ1A 3ZRHA 5D0QD 2VGXB 3GYZA 2DZNA 1LD7A 1Z3YA 3D9JA 1DCQA 5JHBA 1PAQA 3CLJA 2QYUA 3CVQA 1JUQA 2J9QA 3V79K 4I6EA 5E76A 4RQIA 3RRUA 2J09A 3Q79A 4GTSA 4PS3A 5LOZA 3TXNA 1V55E 3GZ2A 1TNYA 4G23A 3PEUB 2RFAA 3ZHEA 2IO3C 2LUHA 5ENSD 3ZYLA 3ZYQA 2H6IA 3TWRA 1TR4A 2H6GA 4FU3A 2IF4A 4ZHBA 3IKOB 2X6KA 2WXLA 2MOWA 1BD8A 4ANXA 4YDEA 3KSLA 4I9EA 4RSYA 3ZUVB 4XZ4A 2FULA 1N4PA 2P2CP 1KLXA 2BKKB 4PDXA 5KBAA 4GCOA 2WMOA 4LCTA 4HI8A 4TUUA 2JABA 4K5CA 2J08A 2FI7A 3MV2B 4CZ2D 3AJIA 4U8YD 2GGFA 4I9CA 4B0ZA 3HG0D 4HORA 2VQ2A 4LG6A 3TGOA 1Y6IA 3OXLA 1HX8A 4RG6A 1MX2A 4U63A 4FJZA 3URZA 3AS4A 3SFYA 4APFA 1NFIE 2DIWA 1MZCA 3TG5A 2X6HA 2CFUA 3QB2A 2BTDA 4JHRA 3CHQA 3L13A 4JEHA 5EN5D 1UG3A 2Y3AA 1OCCE 2HR2A 4DX6D 4OAVB 4KZCA 4UWLA 1OCRE 2ILRA 4WNGA 3UM1A 3V2OA 4U07A 2AXVA 2GRQB 4F6RD 2RFMA 1JPLA 2XZTG 3ZYMA 3JUEA 2HO1A 3T5VA 3CIAA 4NQ0A 4UI9J 4U96D 3ZXSA 1PC2A 3APCA 2LNIA 4J8DA 2WQ6A 4U8HA 3CHPA 1O1TA 2WXQA 1N0QA 5A23A 2WQ7A 1HG5A 3U64A 1BI8B 1IQUA 2E0IA 4MKTA 4FA6A 1G3NB 2FF4A 3JYSA 1TYQG 4TRQA 4CDRA 4N2SA 3B13A 4DJAA 3APDA 2VSXE 2OVBA 3APFA 4JVSA 1D9SA 2ZISA 4B94A 3D9KA 4DI3A 5LCWJ 3EHQA 2HE0A 4CGVA 3DEOA 3GZSA 1EPUA 4YNDA 3G2SA 5FZRA 3R9MA 3D9OA 4XEIG 4EZLA 3FWVA 4PS7A 3CVXA 3KS2A 1XGWA 4I1MA 5FQ6A 4N39A 1ZU2A 3DSXA 2XEEA 4KYOB 3EHRA 2AW6A 2OCCE 1ELRA 3PZ3A 2C0LA 3FTZA 2I9CA 1MQSA 4HOUA 3U9WA 2A5EA 4E85A 4NACA 3L17A 3ASOE 3LVQE 3CKCA 3MV3B 5CMYA 4XIFA 4MS6A 2X3MA 2DYRE 5BW8C 3QKYA 1OWNA 4JHKA 1QYMA 2ZU6B 4GPKA 2Y4TA 3FFLA 4C0EA 4XI9A 3DEPA 2L6JA 4ANVA 2VSNA 3SFXA 2Y69E 3G2WA 1MX6A 5ENOD 4RLYA 1NI1A 3T8MA 3W9FA 5D2MC 3Q4AB 2FO7A 4YDOA 2CG3A 2FO1E 3EU5A 3CK9A 3ESKA 4DK5A 1NA0A 1TNOA 5EIBE 4O1OA 4ANWA 1HE8A 3LY7A 5BV1A 2NXPA 4CDNA 4XKBA 3Q9NC 4EPZA 3QK0A 3LYAA 1N4SA 3DSSA 2RD0A 4F7AA 1H6KA 4HQDA 4G8KA 5B1BE 4JW1A 4K03A 5ENNA 2GRLA 3Q5MA 1O1RA 3S7FA 3KEZA 4I17A 1JCRA 5KWDA 3UKUG 3TWUA 3FH5A 4BTBA 1N11A 3B7RL 3JXIA 2KCLA 4K5AB 4N3AA 3FUMA 4DX5D 5JJ6A 4CT0A 4AV7A 5HRYA 4GAAA 1UJJA 1IXVA 2OEVA 3FH8A 4HFGA 2KM4A 5KJMA 2Y0BG 4HB5A 5FT9A 2XRZA 4AOFA 2PZIA 3IHYA 2L9BA 2X6JA 4UI9K 1ELKA 3CVLA 4ACKA 4GPMA 2WXHA 2VTBB 4DX1A 3IV0A 4CEMA 3ONLA 3FU0A 1PY1A 3U4TA 1A17A 2Y4UA 2LXLA 3KAEA 4GCNA 2OOEA 5BUZA 3MGBA 5AAOA 4CRWA 4RG9A 2C0MA 1IHGA 2F8XK 5J08A 3D9MA 2KCKA 3LVRE 5FQ7A 3AU5A 2JLBA 4WNEA 5EX3A 2AXUA 3LY8A 3AG1E 4I2ZA 3QAQA 3PNLB 3ZKJA 4H7XA 2CG2A 2MHKA 2EILE 3UINC 4GTRA 3BG0B 2WXIA 2XENA 3PDNA 4ILHB 2P58C 4J8FA 3HXEA 4UWFA 4L2LA 2XRYA 3CR3A 3OXGA 5KNGA 3TWVA 5HKPA 5G05C 1HO8A 3ENEA 3ZPJA 4BESA 4UUCA 3TL5A 3RU0A 3D9NA 1UN9A 4ILGA 1SQMA 1N54A 4AY5A 4DI4A 1HS6A 1K1BA 5CERB 5T8IA 4HVBA 3PH0C 3NOCD 3T9KA 4IYPA 1S63A 1Z6TA 5EILA 1BU9A 3FH7A 1OWPA 3SO8A 1TNBA 3ZVVA 2XGOA 3DSVA 4JL0A 4N3BA 3SHFA 3NF1A 1A5EA 4UWGA 2KC7A 4V3IA 4YDYA 4GMRA 2V0PA 1HF8A 5AQBA 3QOUA 2IONA 5CECB 2DBAA 4GTQA 3TAXA 4FADA 5AQ7A 3E33A 3PNTB 1SZ9A 4KBQA 3PE4A 5CEAA 4X8QA 2QC9A 2IU1A 3FUJA 2WXGA 3OTNA 2WXJA 4Q69A 3Q78A 3PVLA 4MLPA 1N4QA 2EIJE 3DSUA 4I6GA 3T5XA 2CHWA 3J5PA 1LD8A 4OVUA 5AENA 4AXHA 3L16A 3QC1A 5AIJA 3JXJA 1TJFA 1BI7B 2P9LG 2IY0C 4YVOA 4AY6A 3RIBA 3UT7A 3ASHA 4GYOA 2LAIA 3VTYA 3WXXA 5C1DA 3D9LA 1Y8MA 1K8KG 4BTAA 4DLQA 1EYHA 1N94A 2PQNA 1IYGA 2VTBA 4GZ6A 1WDYA 4GA0A 3R9AB 5D66A 2X6IA 3UT4A 2R17C 4A63B 3FUNA 2VSYA 2WM9A 1B89A 4LUNU 3LXUX 4TXPA 3U66A 5DBKA 5CHEE 1KZOA 3EUVA 3T8KA 4XI0A 4LEUA 3PS6A 1E8WA 2QY7A 2HYZA 1MYOA 1ZBPA 1FVHA 4WWPA 3IBEA 1HG2A 2XCCA 3S2AA 1IHBA 2XGMA 4AEZC 2ETCA 4G11A 4F1PA 3FUDA 4EHMA 3HIZA 3CVUA 5AYWD 2XZDG 3TJPA 3HYMB 4O60A 5EDSA 2Y1LE 4FHKA 1KZPA 1MX4A 1H2UA 4LRZA 4GTMA 4U95D 1BPOA 1O5MA 3D9HA 3UXGA 3Q7AA 3MKQB 2EIME 4I1AA 4BX8A 4Y6CA 3FY4A 2OV8A 4AM9A 3ISMC 1E7UA 1TJCA 2XEVA 4CT4A 5BV0A 3ZNGA 2IQCA 5ENPD 4DX7D 4DRXE 3LKUA 4M3OA 4RVBA 5C2YA 4BT8A 2E2EA 1SZAA 5CMWA 5AARA 3NZUA 2I1JA 4HOSA 2GRRB 3AAAC 4UWHA 3AS5A 2MYOA 3CEQA 2YQ8A 2C2LA 3LJNA 4G24A 3ZN3A 2F37A 4HLEA 3JCKC 3CK7A 1S0PA 4WAFA 4N2QA 3ASDA 5JHAA 3FU3A 1AP7A 2XGSA 3TWSA 4OVVA 3BUAA 4CYMD 4GMJA 4LSZE 1E8XA 3HHMA 3ZGQA 3Q9UC 3D3MA 3MJWA 1UOHA 1WG0A 3FHEA 3NAWA 2VGXA 1INZA 1QBQA 3UPVA 1SW6A 3CVWA 3LPZA 1OY3D 3C98A 3CHMA 4F3VA 5FINA 1FPPA 2GW1A 2ETAA 4K5BA 2IOLA 4BY6A 4E6HA 4U8VD 2WXNA 5HQ8A 3QWPA 4BWRA 4B8AA 4I1OB 1OWLA 2GRPB 1UW4B 2F0YA 1S64A 5T3RA 3Q75A 5JJTA 4QQIA 3HXBA 3C3RA 4B89A 1NA3A 2AXZA 4KZ0A 5KJNA 3EU9A 3E4BA 1KT1A 4EECA 3ABKE 3LS8A 1ELWA 4BT9A 1WY6A 2A4ZA 3KD7A 4B8CB 2KZTB 3QWWA 4TXQA 3RSEG 3VTXA 2WXRA 4FHJA 1Q2ZA 2UY1B 4I43A 3EHMA 3CHSA 2GRMA 3VLDA 3SFZA 2ZXWE 2M63A 3DPDA 3NQPA 1YCSB 5KJLA 4I2WA 3BQOA 3R7RA 3HVEB 2XPYA 3MX3A 4ATGA 2DYSE 2ZIRA 5G04J 4CCAA 4ILIA 3CQCB 3UTMA 2J49A 3DPYA 4L23A 3CQGB 3CVYA 4ANUA 4GYYA 3IEGA 3PZ4A 4KVOA 4GTTA 1SA5A 2EQXA 3MKQA 1K1AA 5J90A 3AS8A 4O6FA 4G1TA 3C5RA 3DSTA 3FTYA 4U0ZA 5DIZA 5M72A 1UJKA 4FP7A 2P9KG 3VLEA 5LX8A 4WWNA 4U7EB 3SY2A 4ME2A 1NP7A 3UIOC 4QFVA 1JCSA 4HS2A 2I1KA 2R2LA 3LJ3A 2KCVA 3DWLG 3L08A 4GA2A 2Q7FA 4BFRA 3JUIA 5B1AE 4G2VA 4WWOA 2IFUA 2ZGGA 3FU6A 2WXPA 2VGYA 1JWGA 5EX0A 4JA7A 3ZU7B 3FTXA 4LNGA 4A55A 2WQHA 3TG4A 4L9PA 1TEZA 5CEDB 3S7DA 3GW4A 1GW6A 5EYLA 4NRHB 5ANRA 1JCQA 3SF4A 2J4DA 4KMOA 5JMND 4GB9A 3ML9A 3ULYA 3ABME 3FU5A 3TWTA 3UI2A 1N95A 2B6CA 4GMLA 3FUFA 1LTXA 3I3NA 3L6AA 2P9IG 2ETBA 2LSVA 3MYVA 4JPSA 3FUIA 3TWQA 2VJ8A 4KT6B 2QFCA 4WNFA 3LDZA 3TWXA 3ZFWA 2R59A 4JA9A 1K3ZD 3FUEA 4FJYA 2V4HC 2P9PG 3OAWA 4L1BA 5KJKA 4JHJA 1H2VC 1TNZA 3S7BA 4LNUD 3Q49B 4G25A 1H2TC 2P9UG 4TUMA 4TV3A 5G2NA 1OXJA 2XS1A 3E32A 4BETA 3Q7FA 3NB2A 4XX5A 3P2BA 4NURA 4LERA 2AVPA 2V5FA 3PE3A 1RW2A 3HDXA 4BEPA 3LEWA 2EINE 3C3QA 3JQ0A 3K9IA 5AN8A 3RK6A 2DCPA 2IJGX 4URKA 4UWKA 1W3BA 2R03A 2I6HA 4DLOA 2GROB 2V8SE 5ENRD 1D8EA 4J0UA 5IY5E 4KVMA 2FEZA 1YA0A 2UY1A 3G2VA 4XE0A 4N5CA 1TNUA 4J8SA 4EBAA 5T4YA 4ABNA 1HZ4A 1U3DA 3J5QB 2ZGDA 4J6IA 3HVEA 3BU8A 4H7YA 4GZ3A 5KNHD 4AP2A 4WNDA 4I6JA 1NL4A 3MCXA 4APOA 2XS8A 1FVFA 3SBSA 3SZ7A 4TXRA 4XKCA 5HI7A 4GTVA 5EIDA 2L0TB 4HBDA 5E75A 3RAUA 2LAHA 2KATA 3DXKG 2QYJA 5AJDA 2P9NG 3AG4E 2XCBA 2PM6A 1OT8A 1FT2A 3O4ZA 5AQAA 1QNFA 1E8YA 3UIPC 3UMVA 3FEYA 1DVPA 3MEKA 3SQVA 3Q73A 4U04A 5BXUA
chains in the Genus database with same CATH topology
3C72A 3E33A 1FT1A 4LNGA 3DSXA 4L9PA 3DSWA 3HXEA 3Q79A 1N4RA 3PZ3A 1KZPA 4GTSA 2IEJA 4GTMA 3Q78A 3E37A 3PZ2A 1O1SA 1TNYA 1N4QA 1D8EA 3DSUA 3HXCA 1TN6A 2BEDA 1JCQA 1O5MA 2ZIRA 3HXDA 1QBQA 1LD8A 1TNUA 2H6IA 3Q7AA 3DPYA 2H6GA 4GTOA 2H6HA 3PZ4A 1N95A 1SA4A 1DCEA 1X81A 4GTTA 1SA5A 1O1TA 1LTXA 4YDEA 1FPPA 3KSLA 3SFXA 1S63A 1NL4A 1N4PA 1NI1A 3KSQA 3DSTA 1N94A 3E30A 4GTVA 4YDOA 1TNBA 3DRAA 3EU5A 4GTPA 2F0YA 3HXFA 4LNBA 1S64A 1TNOA 3DSVA 1D8DA 2ZISA 1N9AA 3Q75A 2H6FA 1TNZA 1JCSA 3HXBA 4MBGA 2R2LA 1N4SA 1TN8A 3DSSA 3PZ1A 1KZOA 3EUVA 3SFYA 1FT2A 1MZCA 3E32A 1LD7A 1O1RA 3E34A 1JCRA 4GTRA 1TN7A 4GTQA 4EHMA 3Q7FA 3Q73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C72 A;  3E33 A;  1FT1 A;  4LNG A;  3DSX A;  4L9P A;  3DSW A;  3HXE A;  3Q79 A;  1N4R A;  3PZ3 A;  1KZP A;  4GTS A;  2IEJ A;  4GTM A;  3Q78 A;  3E37 A;  3PZ2 A;  1O1S A;  1TNY A;  1N4Q A;  1D8E A;  3DSU A;  3HXC A;  1TN6 A;  2BED A;  1JCQ A;  1O5M A;  2ZIR A;  3HXD A;  1QBQ A;  1LD8 A;  1TNU A;  2H6I A;  3Q7A A;  3DPY A;  2H6G A;  4GTO A;  2H6H A;  3PZ4 A;  1N95 A;  1SA4 A;  1DCE A;  1X81 A;  4GTT A;  1SA5 A;  1O1T A;  1LTX A;  4YDE A;  1FPP A;  3KSL A;  3SFX A;  1S63 A;  1NL4 A;  1N4P A;  1NI1 A;  3KSQ A;  3DST A;  1N94 A;  3E30 A;  4GTV A;  4YDO A;  1TNB A;  3DRA A;  3EU5 A;  4GTP A;  2F0Y A;  3HXF A;  4LNB A;  1S64 A;  1TNO A;  3DSV A;  1D8D A;  2ZIS A;  1N9A A;  3Q75 A;  2H6F A;  1TNZ A;  1JCS A;  3HXB A;  4MBG A;  2R2L A;  1N4S A;  1TN8 A;  3DSS A;  3PZ1 A;  1KZO A;  3EUV A;  3SFY A;  1FT2 A;  1MZC A;  3E32 A;  1LD7 A;  1O1R A;  3E34 A;  1JCR A;  4GTR A;  1TN7 A;  4GTQ A;  4EHM A;  3Q7F A;  3Q73 A; 
#chains in the Genus database with same CATH topology
 3O48 A;  2VYI A;  1FT1 A;  2I2O A;  3CGH A;  4AIF A;  1HU3 A;  1QQE A;  3PEV B;  3DSW A;  3G2T A;  1N4R A;  3FTU A;  1AWC B;  1EF1 C;  1P5Q A;  1Z3X A;  3FDH A;  5BNW A;  2L0I A;  3PRE A;  3NZS A;  3FEX A;  3UUX A;  4C48 B;  3TXM A;  1H6O A;  5B3S E;  2PQR A;  5ITZ F;  3W9G A;  2OVF A;  4GTO A;  1L5J A;  2LSU A;  1SA4 A;  3RKV A;  4UQZ A;  2XPI A;  3DXM G;  3NBN B;  4J8E A;  3CK8 A;  3FTS A;  2BKG A;  2VGE A;  2YNQ A;  4FLH A;  2WXK A;  2GRN B;  2R05 A;  2XEH A;  4O1P A;  3MZL B;  4EQF A;  3UM2 A;  1HFA A;  1HH8 A;  3P1U A;  3X2Q E;  3RRM B;  4JXT A;  1E8Z A;  5CRU A;  3ONK A;  3V2X A;  3HXF A;  1OUV A;  5BPP A;  3PZD A;  4Z68 A;  3QDN A;  1N9A A;  1DNP A;  2J07 A;  2RKK A;  2V4L A;  3D9P A;  4HLL A;  2WXF A;  1JWF A;  4PUC A;  3PRZ A;  4PH4 B;  3LY9 A;  4AVX A;  4N3C A;  2DWZ A;  5HS0 A;  3E34 A;  2UWJ G;  3SNX A;  5D0O D;  3PUK A;  3ZIM A;  2J4B A;  3TWW A;  3WG7 E;  4G8L A;  1S70 B;  5FIO A;  3UM3 A;  4HRN A;  5ARG A;  4K0R A;  4ATZ D;  1DC2 A;  1O1S A;  3QNK A;  4EBA G;  4WUY A;  2BED A;  3ASG A;  2NYJ A;  2PNN A;  3I4G A;  3GZ1 A;  3NOG D;  2KBX A;  4Q96 A;  4JD2 G;  4HXI A;  5JJ7 A;  3CVN A;  3B95 A;  4OYS A;  2H6H A;  2AWI A;  1N52 A;  1X81 A;  4HOQ A;  4HOT A;  4GYW A;  3QAR A;  4BSX A;  3R7Q A;  2FBN A;  1OCO E;  5FWQ A;  4GZ5 A;  3RO2 A;  1XNF A;  2R5S A;  3DRA A;  3OXF A;  4LNB A;  3F6Q A;  2YIN A;  2IO2 C;  1D8D A;  4J7W A;  2EIK E;  4FC8 A;  1ZB1 A;  1SVX A;  4MBG A;  1MJ0 A;  2XPZ A;  3UX4 A;  5G05 J;  5AQ9 A;  2L6B A;  2J8S D;  2PM7 A;  3QJZ A;  2V5Q C;  1X5B A;  1FCH A;  5FJY A;  1VDY A;  5JA4 D;  1UN8 A;  1U2V G;  3MKR A;  3CHO A;  2P9S G;  4C0M A;  3C72 A;  2RG8 A;  4GZD A;  3EIQ C;  1V54 E;  3FTV A;  5EKQ D;  3FUH A;  2HM8 A;  3ZEF A;  5BT1 A;  2IEJ A;  3RJV A;  2WPV A;  3CVP A;  1H6P A;  4PS8 A;  3B7T A;  2YHE A;  1OWO A;  3D9I A;  5ENT D;  1TN6 A;  2CHZ A;  5G55 A;  1MHQ A;  2WMN A;  3SD5 A;  4W9R A;  3L82 A;  4P29 A;  3C3O A;  4ACL A;  3V30 A;  3UM0 A;  4L7T A;  3CSF A;  5BXO A;  1OWM A;  1YYH A;  4L2Y A;  4R7L A;  3BG1 B;  4YVQ C;  3EDT B;  4EZJ A;  4A3T A;  2XQ0 A;  4MRU A;  4A3V A;  3ASF A;  3KSQ A;  4HNA D;  4JC8 A;  3E30 A;  4DPR A;  4GA1 A;  5CCL A;  3PUJ A;  5A7D B;  5LFA A;  2A5U A;  3ULQ A;  2PL2 A;  4JB8 P;  2X38 A;  3U3W A;  3EIJ A;  3ZXP A;  3G2U A;  3ZW3 A;  3FTW A;  2OND A;  1TN8 A;  1U3C A;  2LO6 A;  4U0S A;  1KPS B;  4CDM A;  2BF0 X;  1IKN D;  2CFZ A;  5LP0 A;  5AJL A;  4UI9 C;  4GZC A;  5ARF A;  4ZFH A;  5A6C A;  4YDW A;  2DVW A;  3Q47 B;  2WB2 A;  2NSZ A;  3JQ1 A;  3ZHE B;  3EHN A;  3FUL A;  1QZ2 A;  3B7B A;  3UQ3 A;  4Q94 A;  1EDU A;  4UQX A;  3PZ2 A;  1IQR A;  3MA5 A;  4B93 B;  3HXC A;  3ESL A;  3ASN E;  3CVV A;  3UT8 A;  1E96 B;  3CHR A;  2DZO A;  3HRA A;  1BLX B;  5LCW C;  2KXP C;  4CGW A;  3QWV A;  1H19 A;  3CST A;  5FQ4 A;  2AJA A;  5KCM A;  5FZS A;  3EJN A;  1H0A A;  3ML8 A;  4KXK B;  4IUL A;  4FLB A;  4BSZ B;  4BER A;  3B7S A;  3FP3 A;  1NZN A;  1WM5 A;  2CHX A;  2WXM A;  2XHE A;  4HRM B;  3IXE A;  4DUI A;  4UQY A;  4AJW A;  3VLF A;  4JEU A;  4NIK A;  2H6F A;  1E90 A;  2JEK A;  4HRL A;  5EYP F;  4Y6W A;  3AG3 E;  3Q15 A;  2VSO E;  3ABL E;  5ENQ D;  5FZQ A;  3DBS A;  5H7P A;  4J8Y A;  3N71 A;  2F8Y A;  1TN7 A;  1N0R A;  2QZA A;  4F1S A;  1WAO 1;  3L54 A;  4G26 A;  4F53 A;  3FUK A;  5CCM A;  5FQ8 A;  1OCZ E;  4EZK A;  4HI9 A;  2MRI A;  4N5Q A;  1HXI A;  1KT0 A;  4JZY A;  3V31 A;  3LCA A;  3E37 A;  4U0U A;  2R02 A;  2X6F A;  2BUG A;  3AU4 A;  1RZ4 A;  4D10 C;  3ZYK A;  5ANL A;  4A1G A;  4M7C A;  3HXD A;  3IHV A;  5CRV A;  3S7J A;  3I5P A;  2LXM A;  3SBT B;  2KZT A;  3B7U X;  4OAU C;  1YMP A;  4C9B B;  2WVI A;  1DCE A;  4BX9 A;  3L9T A;  3RRN B;  5CBO A;  1Z5S C;  3UKR G;  2B0O E;  4GU5 A;  3RO3 A;  2IOS A;  1E7V A;  4IRU A;  3I4R B;  3SI5 A;  2OEW A;  4FUL A;  5FTP A;  3ULE G;  5CBN A;  3CV0 A;  3KEA A;  1LF8 A;  3CKB A;  4GTP A;  5G04 C;  3BEE A;  2WXO A;  3AG2 E;  3SGH A;  2YHC A;  2NC9 A;  4A1S A;  4DX2 A;  4IN3 B;  3L22 A;  3PZ1 A;  3ZRH A;  5D0Q D;  2VGX B;  3GYZ A;  2DZN A;  1LD7 A;  1Z3Y A;  3D9J A;  1DCQ A;  5JHB A;  1PAQ A;  3CLJ A;  2QYU A;  3CVQ A;  1JUQ A;  2J9Q A;  3V79 K;  4I6E A;  5E76 A;  4RQI A;  3RRU A;  2J09 A;  3Q79 A;  4GTS A;  4PS3 A;  5LOZ A;  3TXN A;  1V55 E;  3GZ2 A;  1TNY A;  4G23 A;  3PEU B;  2RFA A;  3ZHE A;  2IO3 C;  2LUH A;  5ENS D;  3ZYL A;  3ZYQ A;  2H6I A;  3TWR A;  1TR4 A;  2H6G A;  4FU3 A;  2IF4 A;  4ZHB A;  3IKO B;  2X6K A;  2WXL A;  2MOW A;  1BD8 A;  4ANX A;  4YDE A;  3KSL A;  4I9E A;  4RSY A;  3ZUV B;  4XZ4 A;  2FUL A;  1N4P A;  2P2C P;  1KLX A;  2BKK B;  4PDX A;  5KBA A;  4GCO A;  2WMO A;  4LCT A;  4HI8 A;  4TUU A;  2JAB A;  4K5C A;  2J08 A;  2FI7 A;  3MV2 B;  4CZ2 D;  3AJI A;  4U8Y D;  2GGF A;  4I9C A;  4B0Z A;  3HG0 D;  4HOR A;  2VQ2 A;  4LG6 A;  3TGO A;  1Y6I A;  3OXL A;  1HX8 A;  4RG6 A;  1MX2 A;  4U63 A;  4FJZ A;  3URZ A;  3AS4 A;  3SFY A;  4APF A;  1NFI E;  2DIW A;  1MZC A;  3TG5 A;  2X6H A;  2CFU A;  3QB2 A;  2BTD A;  4JHR A;  3CHQ A;  3L13 A;  4JEH A;  5EN5 D;  1UG3 A;  2Y3A A;  1OCC E;  2HR2 A;  4DX6 D;  4OAV B;  4KZC A;  4UWL A;  1OCR E;  2ILR A;  4WNG A;  3UM1 A;  3V2O A;  4U07 A;  2AXV A;  2GRQ B;  4F6R D;  2RFM A;  1JPL A;  2XZT G;  3ZYM A;  3JUE A;  2HO1 A;  3T5V A;  3CIA A;  4NQ0 A;  4UI9 J;  4U96 D;  3ZXS A;  1PC2 A;  3APC A;  2LNI A;  4J8D A;  2WQ6 A;  4U8H A;  3CHP A;  1O1T A;  2WXQ A;  1N0Q A;  5A23 A;  2WQ7 A;  1HG5 A;  3U64 A;  1BI8 B;  1IQU A;  2E0I A;  4MKT A;  4FA6 A;  1G3N B;  2FF4 A;  3JYS A;  1TYQ G;  4TRQ A;  4CDR A;  4N2S A;  3B13 A;  4DJA A;  3APD A;  2VSX E;  2OVB A;  3APF A;  4JVS A;  1D9S A;  2ZIS A;  4B94 A;  3D9K A;  4DI3 A;  5LCW J;  3EHQ A;  2HE0 A;  4CGV A;  3DEO A;  3GZS A;  1EPU A;  4YND A;  3G2S A;  5FZR A;  3R9M A;  3D9O A;  4XEI G;  4EZL A;  3FWV A;  4PS7 A;  3CVX A;  3KS2 A;  1XGW A;  4I1M A;  5FQ6 A;  4N39 A;  1ZU2 A;  3DSX A;  2XEE A;  4KYO B;  3EHR A;  2AW6 A;  2OCC E;  1ELR A;  3PZ3 A;  2C0L A;  3FTZ A;  2I9C A;  1MQS A;  4HOU A;  3U9W A;  2A5E A;  4E85 A;  4NAC A;  3L17 A;  3ASO E;  3LVQ E;  3CKC A;  3MV3 B;  5CMY A;  4XIF A;  4MS6 A;  2X3M A;  2DYR E;  5BW8 C;  3QKY A;  1OWN A;  4JHK A;  1QYM A;  2ZU6 B;  4GPK A;  2Y4T A;  3FFL A;  4C0E A;  4XI9 A;  3DEP A;  2L6J A;  4ANV A;  2VSN A;  3SFX A;  2Y69 E;  3G2W A;  1MX6 A;  5ENO D;  4RLY A;  1NI1 A;  3T8M A;  3W9F A;  5D2M C;  3Q4A B;  2FO7 A;  4YDO A;  2CG3 A;  2FO1 E;  3EU5 A;  3CK9 A;  3ESK A;  4DK5 A;  1NA0 A;  1TNO A;  5EIB E;  4O1O A;  4ANW A;  1HE8 A;  3LY7 A;  5BV1 A;  2NXP A;  4CDN A;  4XKB A;  3Q9N C;  4EPZ A;  3QK0 A;  3LYA A;  1N4S A;  3DSS A;  2RD0 A;  4F7A A;  1H6K A;  4HQD A;  4G8K A;  5B1B E;  4JW1 A;  4K03 A;  5ENN A;  2GRL A;  3Q5M A;  1O1R A;  3S7F A;  3KEZ A;  4I17 A;  1JCR A;  5KWD A;  3UKU G;  3TWU A;  3FH5 A;  4BTB A;  1N11 A;  3B7R L;  3JXI A;  2KCL A;  4K5A B;  4N3A A;  3FUM A;  4DX5 D;  5JJ6 A;  4CT0 A;  4AV7 A;  5HRY A;  4GAA A;  1UJJ A;  1IXV A;  2OEV A;  3FH8 A;  4HFG A;  2KM4 A;  5KJM A;  2Y0B G;  4HB5 A;  5FT9 A;  2XRZ A;  4AOF A;  2PZI A;  3IHY A;  2L9B A;  2X6J A;  4UI9 K;  1ELK A;  3CVL A;  4ACK A;  4GPM A;  2WXH A;  2VTB B;  4DX1 A;  3IV0 A;  4CEM A;  3ONL A;  3FU0 A;  1PY1 A;  3U4T A;  1A17 A;  2Y4U A;  2LXL A;  3KAE A;  4GCN A;  2OOE A;  5BUZ A;  3MGB A;  5AAO A;  4CRW A;  4RG9 A;  2C0M A;  1IHG A;  2F8X K;  5J08 A;  3D9M A;  2KCK A;  3LVR E;  5FQ7 A;  3AU5 A;  2JLB A;  4WNE A;  5EX3 A;  2AXU A;  3LY8 A;  3AG1 E;  4I2Z A;  3QAQ A;  3PNL B;  3ZKJ A;  4H7X A;  2CG2 A;  2MHK A;  2EIL E;  3UIN C;  4GTR A;  3BG0 B;  2WXI A;  2XEN A;  3PDN A;  4ILH B;  2P58 C;  4J8F A;  3HXE A;  4UWF A;  4L2L A;  2XRY A;  3CR3 A;  3OXG A;  5KNG A;  3TWV A;  5HKP A;  5G05 C;  1HO8 A;  3ENE A;  3ZPJ A;  4BES A;  4UUC A;  3TL5 A;  3RU0 A;  3D9N A;  1UN9 A;  4ILG A;  1SQM A;  1N54 A;  4AY5 A;  4DI4 A;  1HS6 A;  1K1B A;  5CER B;  5T8I A;  4HVB A;  3PH0 C;  3NOC D;  3T9K A;  4IYP A;  1S63 A;  1Z6T A;  5EIL A;  1BU9 A;  3FH7 A;  1OWP A;  3SO8 A;  1TNB A;  3ZVV A;  2XGO A;  3DSV A;  4JL0 A;  4N3B A;  3SHF A;  3NF1 A;  1A5E A;  4UWG A;  2KC7 A;  4V3I A;  4YDY A;  4GMR A;  2V0P A;  1HF8 A;  5AQB A;  3QOU A;  2ION A;  5CEC B;  2DBA A;  4GTQ A;  3TAX A;  4FAD A;  5AQ7 A;  3E33 A;  3PNT B;  1SZ9 A;  4KBQ A;  3PE4 A;  5CEA A;  4X8Q A;  2QC9 A;  2IU1 A;  3FUJ A;  2WXG A;  3OTN A;  2WXJ A;  4Q69 A;  3Q78 A;  3PVL A;  4MLP A;  1N4Q A;  2EIJ E;  3DSU A;  4I6G A;  3T5X A;  2CHW A;  3J5P A;  1LD8 A;  4OVU A;  5AEN A;  4AXH A;  3L16 A;  3QC1 A;  5AIJ A;  3JXJ A;  1TJF A;  1BI7 B;  2P9L G;  2IY0 C;  4YVO A;  4AY6 A;  3RIB A;  3UT7 A;  3ASH A;  4GYO A;  2LAI A;  3VTY A;  3WXX A;  5C1D A;  3D9L A;  1Y8M A;  1K8K G;  4BTA A;  4DLQ A;  1EYH A;  1N94 A;  2PQN A;  1IYG A;  2VTB A;  4GZ6 A;  1WDY A;  4GA0 A;  3R9A B;  5D66 A;  2X6I A;  3UT4 A;  2R17 C;  4A63 B;  3FUN A;  2VSY A;  2WM9 A;  1B89 A;  4LUN U;  3LXU X;  4TXP A;  3U66 A;  5DBK A;  5CHE E;  1KZO A;  3EUV A;  3T8K A;  4XI0 A;  4LEU A;  3PS6 A;  1E8W A;  2QY7 A;  2HYZ A;  1MYO A;  1ZBP A;  1FVH A;  4WWP A;  3IBE A;  1HG2 A;  2XCC A;  3S2A A;  1IHB A;  2XGM A;  4AEZ C;  2ETC A;  4G11 A;  4F1P A;  3FUD A;  4EHM A;  3HIZ A;  3CVU A;  5AYW D;  2XZD G;  3TJP A;  3HYM B;  4O60 A;  5EDS A;  2Y1L E;  4FHK A;  1KZP A;  1MX4 A;  1H2U A;  4LRZ A;  4GTM A;  4U95 D;  1BPO A;  1O5M A;  3D9H A;  3UXG A;  3Q7A A;  3MKQ B;  2EIM E;  4I1A A;  4BX8 A;  4Y6C A;  3FY4 A;  2OV8 A;  4AM9 A;  3ISM C;  1E7U A;  1TJC A;  2XEV A;  4CT4 A;  5BV0 A;  3ZNG A;  2IQC A;  5ENP D;  4DX7 D;  4DRX E;  3LKU A;  4M3O A;  4RVB A;  5C2Y A;  4BT8 A;  2E2E A;  1SZA A;  5CMW A;  5AAR A;  3NZU A;  2I1J A;  4HOS A;  2GRR B;  3AAA C;  4UWH A;  3AS5 A;  2MYO A;  3CEQ A;  2YQ8 A;  2C2L A;  3LJN A;  4G24 A;  3ZN3 A;  2F37 A;  4HLE A;  3JCK C;  3CK7 A;  1S0P A;  4WAF A;  4N2Q A;  3ASD A;  5JHA A;  3FU3 A;  1AP7 A;  2XGS A;  3TWS A;  4OVV A;  3BUA A;  4CYM D;  4GMJ A;  4LSZ E;  1E8X A;  3HHM A;  3ZGQ A;  3Q9U C;  3D3M A;  3MJW A;  1UOH A;  1WG0 A;  3FHE A;  3NAW A;  2VGX A;  1INZ A;  1QBQ A;  3UPV A;  1SW6 A;  3CVW A;  3LPZ A;  1OY3 D;  3C98 A;  3CHM A;  4F3V A;  5FIN A;  1FPP A;  2GW1 A;  2ETA A;  4K5B A;  2IOL A;  4BY6 A;  4E6H A;  4U8V D;  2WXN A;  5HQ8 A;  3QWP A;  4BWR A;  4B8A A;  4I1O B;  1OWL A;  2GRP B;  1UW4 B;  2F0Y A;  1S64 A;  5T3R A;  3Q75 A;  5JJT A;  4QQI A;  3HXB A;  3C3R A;  4B89 A;  1NA3 A;  2AXZ A;  4KZ0 A;  5KJN A;  3EU9 A;  3E4B A;  1KT1 A;  4EEC A;  3ABK E;  3LS8 A;  1ELW A;  4BT9 A;  1WY6 A;  2A4Z A;  3KD7 A;  4B8C B;  2KZT B;  3QWW A;  4TXQ A;  3RSE G;  3VTX A;  2WXR A;  4FHJ A;  1Q2Z A;  2UY1 B;  4I43 A;  3EHM A;  3CHS A;  2GRM A;  3VLD A;  3SFZ A;  2ZXW E;  2M63 A;  3DPD A;  3NQP A;  1YCS B;  5KJL A;  4I2W A;  3BQO A;  3R7R A;  3HVE B;  2XPY A;  3MX3 A;  4ATG A;  2DYS E;  2ZIR A;  5G04 J;  4CCA A;  4ILI A;  3CQC B;  3UTM A;  2J49 A;  3DPY A;  4L23 A;  3CQG B;  3CVY A;  4ANU A;  4GYY A;  3IEG A;  3PZ4 A;  4KVO A;  4GTT A;  1SA5 A;  2EQX A;  3MKQ A;  1K1A A;  5J90 A;  3AS8 A;  4O6F A;  4G1T A;  3C5R A;  3DST A;  3FTY A;  4U0Z A;  5DIZ A;  5M72 A;  1UJK A;  4FP7 A;  2P9K G;  3VLE A;  5LX8 A;  4WWN A;  4U7E B;  3SY2 A;  4ME2 A;  1NP7 A;  3UIO C;  4QFV A;  1JCS A;  4HS2 A;  2I1K A;  2R2L A;  3LJ3 A;  2KCV A;  3DWL G;  3L08 A;  4GA2 A;  2Q7F A;  4BFR A;  3JUI A;  5B1A E;  4G2V A;  4WWO A;  2IFU A;  2ZGG A;  3FU6 A;  2WXP A;  2VGY A;  1JWG A;  5EX0 A;  4JA7 A;  3ZU7 B;  3FTX A;  4LNG A;  4A55 A;  2WQH A;  3TG4 A;  4L9P A;  1TEZ A;  5CED B;  3S7D A;  3GW4 A;  1GW6 A;  5EYL A;  4NRH B;  5ANR A;  1JCQ A;  3SF4 A;  2J4D A;  4KMO A;  5JMN D;  4GB9 A;  3ML9 A;  3ULY A;  3ABM E;  3FU5 A;  3TWT A;  3UI2 A;  1N95 A;  2B6C A;  4GML A;  3FUF A;  1LTX A;  3I3N A;  3L6A A;  2P9I G;  2ETB A;  2LSV A;  3MYV A;  4JPS A;  3FUI A;  3TWQ A;  2VJ8 A;  4KT6 B;  2QFC A;  4WNF A;  3LDZ A;  3TWX A;  3ZFW A;  2R59 A;  4JA9 A;  1K3Z D;  3FUE A;  4FJY A;  2V4H C;  2P9P G;  3OAW A;  4L1B A;  5KJK A;  4JHJ A;  1H2V C;  1TNZ A;  3S7B A;  4LNU D;  3Q49 B;  4G25 A;  1H2T C;  2P9U G;  4TUM A;  4TV3 A;  5G2N A;  1OXJ A;  2XS1 A;  3E32 A;  4BET A;  3Q7F A;  3NB2 A;  4XX5 A;  3P2B A;  4NUR A;  4LER A;  2AVP A;  2V5F A;  3PE3 A;  1RW2 A;  3HDX A;  4BEP A;  3LEW A;  2EIN E;  3C3Q A;  3JQ0 A;  3K9I A;  5AN8 A;  3RK6 A;  2DCP A;  2IJG X;  4URK A;  4UWK A;  1W3B A;  2R03 A;  2I6H A;  4DLO A;  2GRO B;  2V8S E;  5ENR D;  1D8E A;  4J0U A;  5IY5 E;  4KVM A;  2FEZ A;  1YA0 A;  2UY1 A;  3G2V A;  4XE0 A;  4N5C A;  1TNU A;  4J8S A;  4EBA A;  5T4Y A;  4ABN A;  1HZ4 A;  1U3D A;  3J5Q B;  2ZGD A;  4J6I A;  3HVE A;  3BU8 A;  4H7Y A;  4GZ3 A;  5KNH D;  4AP2 A;  4WND A;  4I6J A;  1NL4 A;  3MCX A;  4APO A;  2XS8 A;  1FVF A;  3SBS A;  3SZ7 A;  4TXR A;  4XKC A;  5HI7 A;  4GTV A;  5EID A;  2L0T B;  4HBD A;  5E75 A;  3RAU A;  2LAH A;  2KAT A;  3DXK G;  2QYJ A;  5AJD A;  2P9N G;  3AG4 E;  2XCB A;  2PM6 A;  1OT8 A;  1FT2 A;  3O4Z A;  5AQA A;  1QNF A;  1E8Y A;  3UIP C;  3UMV A;  3FEY A;  1DVP A;  3MEK A;  3SQV A;  3Q73 A;  4U04 A;  5BXU A; 
#chains in the Genus database with same CATH homology
 3C72 A;  3E33 A;  1FT1 A;  4LNG A;  3DSX A;  4L9P A;  3DSW A;  3HXE A;  3Q79 A;  1N4R A;  3PZ3 A;  1KZP A;  4GTS A;  2IEJ A;  4GTM A;  3Q78 A;  3E37 A;  3PZ2 A;  1O1S A;  1TNY A;  1N4Q A;  1D8E A;  3DSU A;  3HXC A;  1TN6 A;  2BED A;  1JCQ A;  1O5M A;  2ZIR A;  3HXD A;  1QBQ A;  1LD8 A;  1TNU A;  2H6I A;  3Q7A A;  3DPY A;  2H6G A;  4GTO A;  2H6H A;  3PZ4 A;  1N95 A;  1SA4 A;  1DCE A;  1X81 A;  4GTT A;  1SA5 A;  1O1T A;  1LTX A;  4YDE A;  1FPP A;  3KSL A;  3SFX A;  1S63 A;  1NL4 A;  1N4P A;  1NI1 A;  3KSQ A;  3DST A;  1N94 A;  3E30 A;  4GTV A;  4YDO A;  1TNB A;  3DRA A;  3EU5 A;  4GTP A;  2F0Y A;  3HXF A;  4LNB A;  1S64 A;  1TNO A;  3DSV A;  1D8D A;  2ZIS A;  1N9A A;  3Q75 A;  2H6F A;  1TNZ A;  1JCS A;  3HXB A;  4MBG A;  2R2L A;  1N4S A;  1TN8 A;  3DSS A;  3PZ1 A;  1KZO A;  3EUV A;  3SFY A;  1FT2 A;  1MZC A;  3E32 A;  1LD7 A;  1O1R A;  3E34 A;  1JCR A;  4GTR A;  1TN7 A;  4GTQ A;  4EHM A;  3Q7F A;  3Q73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...