3PZ4A

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10) in complex with bms3 and lipid substrate fpp
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Structure-Guided Development of Selective RabGGTase Inhibitors.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 117
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2010-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3pz4A00
3DSUA 2R2LA 3DRAA 2H6FA 4GTMA 4EHMA 1LTXA 1TNZA 3PZ2A 4LNBA 1FPPA 4GTPA 1D8EA 2ZISA 1LD8A 3DSVA 1SA5A 1SA4A 2F0YA 4GTVA 1O1SA 1X81A 2H6HA 1N4PA 3Q79A 1TN6A 4L9PA 3Q73A 3Q78A 1O1TA 1N4QA 1JCSA 1NI1A 3HXFA 1QBQA 4YDOA 3Q75A 4YDEA 1O5MA 3DSSA 4GTOA 3SFXA 2H6IA 1S64A 3DSWA 4LNGA 4GTQA 3HXCA 2IEJA 1TNBA 3PZ3A 1TN8A 1S63A 1N95A 3C72A 1FT2A 3E37A 1DCEA 1KZPA 3E33A 3Q7AA 3DSTA 3KSQA 3Q7FA 1N94A 3EU5A 3HXBA 1LD7A 3PZ4A 3E34A 3SFYA 2ZIRA 1TN7A 2H6GA 3DPYA 1KZOA 4MBGA 1JCRA 1JCQA 1FT1A 1MZCA 4GTTA 4GTSA 1TNYA 1N4SA 2BEDA 3E32A 1O1RA 1TNUA 3EUVA 3DSXA 3HXDA 1N9AA 4GTRA 3E30A 3HXEA 1N4RA 3PZ1A 1D8DA 1NL4A 1TNOA 3KSLA
chains in the Genus database with same CATH superfamily
4HFGA 2KCLA 4GTMA 1H6KA 2KC7A 1HG5A 3MV2B 4NACA 4K0RA 5AYWD 4GYYA 3JQ1A 4O1PA 4M7CA 4U04A 4B94A 3EHMA 1O1SA 4NQ0A 1TEZA 2P2CP 3SFZA 5CMWA 3NBNB 2XRYA 3CV0A 3UM2A 2VGYA 4L2YA 1HXIA 4UWLA 5FINA 4G23A 5G05C 1JWGA 3IKOB 2WM9A 3CVYA 3NF1A 4LERA 3ZKJA 2P9UG 2XEHA 3SBTB 3LVRE 1P5QA 4B93B 4HVBA 3J5PA 3TWQA 4J8DA 3S2AA 1FT2A 4I43A 4PS7A 4CGWA 4Q69A 3IHYA 1N94A 4RG9A 2ZGDA 4N2QA 2X6KA 3B7TA 2AJAA 3L82A 4CCAA 4XE0A 5B1AE 5FZQA 2B6CA 1JCRA 1XGWA 1YA0A 4DX6D 1H0AA 1TNYA 3FTXA 2BEDA 5ANRA 2RG8A 4F7AA 3LY7A 3AJIA 2PQNA 5G05J 2A5EA 1W3BA 3BUAA 2LSUA 3JQ0A 4J8EA 2LXMA 3ULQA 2WVIA 2XS8A 2ZGGA 4N3CA 3UX4A 2J49A 2WXHA 1BU9A 2IF4A 1OCOE 3CVNA 3OXFA 5ENOD 3FU3A 4AXHA 5ARFA 3CVVA 1UG3A 3Q49B 5HS0A 3EIQC 4UWGA 4JA9A 5IY5E 1OXJA 2GRMA 4YDEA 3JCKC 1O5MA 1N52A 4GTQA 4JEUA 2F8YA 3S7DA 2DWZA 1EDUA 3Q47B 4DK5A 1AWCB 3SBSA 5KWDA 1Z6TA 3FUMA 1AP7A 3RRUA 3E37A 4BY6A 4TXQA 3NB2A 5EX3A 4G8KA 3KSQA 3L16A 3BQOA 3BG1B 4A1GA 1BI8B 3KAEA 3QJZA 3W9GA 4JD2G 4YVQC 3MGBA 4EZJA 4GTTA 3ENEA 2WXNA 4G2VA 4G24A 4GZ3A 2VYIA 3PEVB 4BESA 3PRZA 1IQRA 1KPSB 3CGHA 1X5BA 3U3WA 5JMND 3D9MA 3Q5MA 4HOQA 2XENA 2KXPC 1ELWA 1Z3XA 2V0PA 4JA7A 2AW6A 3AS8A 4U95D 5ENQD 1S70B 2I1JA 4GMLA 3G2VA 3FTYA 3ZVVA 4BT9A 1DNPA 2LAIA 1NFIE 2IFUA 1N11A 1U3DA 4I1OB 2PL2A 1NI1A 3U64A 5KJLA 3DXKG 3HG0D 4YDOA 5JA4D 3AG2E 4WUYA 2VSXE 1KT0A 5AJLA 2FI7A 3B7UX 5AQBA 1MQSA 5B1BE 4DI4A 3C3RA 4I9CA 5C2YA 3CVPA 1IQUA 4UWFA 4LG6A 4GCNA 4HI8A 2GRRB 3ZYMA 2XRZA 2WPVA 3CSTA 4GPKA 3FFLA 4F53A 1B89A 4FJYA 5JJTA 3PREA 2J07A 2XCBA 3SD5A 3FUIA 4Z68A 5DIZA 3SHFA 5EIBE 2GRPB 5BNWA 5KNHD 3D9OA 4OVVA 3AS4A 1Z5SC 1OCCE 2IO3C 1WM5A 4O60A 2KCKA 5CRVA 3FP3A 4CEMA 4EBAA 3ZHEB 4ATGA 4CDMA 4BX8A 1WDYA 4U8HA 2FULA 3ZGQA 3MX3A 2Y1LE 3LEWA 1K1BA 3V31A 3UKRG 3S7BA 1JCSA 2NC9A 1UN8A 2VGXA 3IHVA 4UUCA 4CDNA 4MLPA 4GTOA 1QZ2A 4LNUD 3T8KA 5CECB 3CHSA 3SGHA 3OXGA 1TR4A 3DEPA 3FY4A 3GW4A 4P29A 4CT4A 3EDTB 3ASHA 2JABA 3TJPA 3FUKA 3T8MA 2VSYA 2X6IA 4W9RA 3CK7A 4R7LA 4Y6WA 1ELKA 3PS6A 2R59A 3E33A 3CVQA 4XIFA 3TAXA 4JHKA 3UPVA 3HXBA 4ACKA 2WQ6A 3E34A 2P9SG 3SFYA 2HYZA 3CHMA 2VSNA 4XKBA 4C48B 4MBGA 3FH5A 4EZLA 1N4SA 3EUVA 4HS2A 3ZRHA 2WXPA 3ABLE 4F6RD 2WQ7A 1XNFA 1HH8A 4GA1A 4GMRA 3OXLA 3P1UA 2V4LA 1PC2A 1MX6A 5EKQD 1HF8A 5BUZA 3RIBA 3PZ2A 2XHEA 2L0IA 2M63A 1WAO1 3JXJA 4AP2A 4GA0A 3SZ7A 3TG5A 1OWNA 3SQVA 1OWLA 1UOHA 3RK6A 3ULEG 2WMOA 4L9PA 3LCAA 2QYJA 1N4QA 3TWRA 3ULYA 3LY8A 3RAUA 2C2LA 4H7YA 1QBQA 4JPSA 3C98A 3L22A 1LF8A 3CQCB 3EHRA 4DLQA 1S64A 3OAWA 3FH8A 3J5QB 4ACLA 3ZYLA 1DCQA 4IN3B 4U0ZA 4ANXA 5JHAA 4AOFA 4GAAA 1TN8A 5CERB 3EHNA 4HRLA 4ILGA 3LXUX 4UWKA 2GW1A 1KZPA 3C3OA 4LRZA 2PZIA 3ABKE 2CHZA 4DRXE 4FJZA 1LD7A 2GRLA 2AXUA 4U07A 3F6QA 2MOWA 4DJAA 4B0ZA 2R17C 3UT7A 4HRMB 4KZ0A 1MZCA 5AENA 4TUUA 2L0TB 4DI3A 3B7RL 1G3NB 4G1TA 4APOA 1YYHA 3FTZA 2DZNA 1TYQG 1D8DA 3RRNB 3DRAA 3UMVA 5JJ6A 4EHMA 1SZ9A 2YINA 4AEZC 2XEEA 2PM7A 3EU9A 2ETAA 3PDNA 2AXZA 3FEYA 1SVXA 2MHKA 3LKUA 1TN6A 4RQIA 2IU1A 2NSZA 5LCWC 3SY2A 5T4YA 1Q2ZA 3I4GA 3QAQA 3FU5A 5G04C 2VGXB 4EPZA 2Y69E 1HS6A 3FTVA 2XPYA 3FWVA 4K5CA 4PUCA 2WXQA 2P9NG 1IYGA 2I2OA 3D9JA 1EPUA 3BG0B 4DPRA 1HZ4A 3KS2A 3APFA 3FUEA 4CDRA 3NOCD 2IOSA 1MX4A 4FADA 2KATA 2V5FA 3FTUA 3FULA 4C0EA 1HFAA 4MRUA 2WXIA 3K9IA 4IULA 5ANLA 2EILE 5LCWJ 3UQ3A 3QARA 2XZDG 3DWLG 4MKTA 5G04J 3ASDA 3TWWA 3VLDA 4H7XA 5AQ9A 4GTPA 1D8EA 4HQDA 3QWWA 2EQXA 5AAOA 4JB8P 3Q9NC 1HO8A 5LOZA 4BETA 2F0YA 5C1DA 1X81A 2KM4A 1E7UA 4CT0A 5H7PA 2EINE 5FZRA 3AG3E 3UM0A 2ZU6B 4I6JA 5AQ7A 2DYRE 3T5VA 2DIWA 2VTBA 3L6AA 5CHEE 3HVEA 2DYSE 5ENSD 4N2SA 4J6IA 4BEPA 2H6IA 2HO1A 4GZDA 2WXMA 5KCMA 5T3RA 4AIFA 4F1SA 3GZSA 1SQMA 5KJMA 5FWQA 3ABME 2CFZA 3MZLB 3Q15A 1A17A 2I6HA 3ONLA 1DCEA 2ETBA 2EIME 2VQ2A 5BXUA 4URKA 4HB5A 3EJNA 2V8SE 5EIDA 2JEKA 4N39A 5KNGA 4IRUA 3UM3A 5JJ7A 3PUKA 3G2UA 3FDHA 3TXMA 1SW6A 2X6JA 4ABNA 3ZU7B 2V4HC 3DSUA 3IBEA 2IJGX 3FU6A 2BF0X 4GMJA 5B3SE 1BPOA 4C9BB 5FT9A 4E6HA 3C5RA 4AY5A 4LEUA 4L7TA 3PZDA 2Q7FA 1DC2A 4GA2A 2IOLA 3O4ZA 1SA4A 3CHQA 5KJNA 3SI5A 1YMPA 4FULA 2J09A 4G25A 1TJCA 2E0IA 3CVXA 4ZFHA 3JUIA 4HBDA 1E8XA 3CKCA 3IV0A 4XKCA 3U4TA 4A3TA 5AARA 5CBOA 2DCPA 3FTWA 4EECA 3C3QA 2QYUA 4AM9A 1H6OA 3PZ3A 2UWJG 1OWPA 4KVOA 1DVPA 1ZB1A 4E85A 4AJWA 2VJ8A 3U66A 3AS5A 3NOGD 2X38A 2X6FA 2YNQA 4I1AA 5ENNA 4BERA 2WXRA 4J8SA 4KXKB 4FLBA 3L08A 4U96D 2EIJE 5EILA 1KLXA 5D0QD 2FO1E 3FU0A 5G2NA 4LCTA 2XEVA 1FVFA 2YQ8A 4KT6B 3PVLA 2MRIA 1LTXA 2KCVA 2DZOA 3B7BA 4K5AB 3N71A 5T8IA 4KYOB 3DSVA 4JEHA 4GB9A 2F37A 2J4DA 1RW2A 4HI9A 2I9CA 1JPLA 5AIJA 1PY1A 2X3MA 2BKGA 2CHXA 3ESLA 4XI0A 4HLLA 3LS8A 4HOSA 3GYZA 5JHBA 3UIPC 3ASOE 5FQ6A 2Y4UA 3ML8A 4WWPA 2FBNA 3ZIMA 4PS3A 4EQFA 3X2QE 2J4BA 3HIZA 3MKQA 5A7DB 2P9KG 2KZTA 3TWUA 4TXRA 2WMNA 2QC9A 1OCZE 3B13A 3FUNA 3QWPA 4AVXA 4AY6A 4ME2A 3KEZA 1UW4B 1BLXB 4GYOA 3CR3A 4JXTA 2DBAA 2J08A 5AQAA 4YDYA 4LUNU 1HX8A 3TG4A 4Y6CA 3FUHA 1GW6A 3P2BA 2RD0A 3DSXA 4BTBA 4U8VD 4FLHA 4UI9C 4XI9A 1TNOA 4WWNA 3R7RA 4BSZB 3V30A 3KSLA 5EDSA 2R2LA 2H6FA 1VDYA 2LAHA 1BI7B 4N5CA 3ZN3A 3HDXA 4HNAD 1NP7A 4B8AA 1N0RA 3UTMA 2E2EA 3LVQE 2GRNB 1LD8A 4CZ2D 2OV8A 4GTVA 3L54A 2R5SA 1IHBA 1S0PA 3B95A 3ASFA 4BX9A 3OTNA 4WNEA 5KBAA 3VLEA 1YCSB 2I1KA 3LJ3A 1UJKA 2J8SD 4J8YA 4UI9J 5A23A 3HXCA 4TUMA 3G2WA 4JZYA 2XS1A 3CKBA 2XQ0A 5G55A 1A5EA 1S63A 4ZHBA 3R9AB 2XGOA 3Q7AA 2FO7A 4N3BA 5CBNA 3EHQA 4F3VA 3PZ4A 1FVHA 3URZA 1Y8MA 2OEVA 2H6GA 4BFRA 1JCQA 1ZBPA 3RO2A 1O1RA 4OAVB 4G11A 4GTRA 3VTYA 3HXEA 3D3MA 3CHPA 1H6PA 1NL4A 2KBXA 1HE8A 3VLFA 4RLYA 2PNNA 5M72A 5LX8A 5AJDA 2A5UA 4WAFA 2RFMA 3AG4E 3MYVA 4U63A 3ZXPA 3R7QA 5CCMA 3KEAA 4OVUA 1Y6IA 2XPZA 1OWOA 3Q78A 4NIKA 4A3VA 2WXKA 3RKVA 1OWMA 1PAQA 2GROB 4QQIA 5CEAA 3DXMG 3DSSA 3QOUA 4Q96A 3DSWA 2WXLA 3Q4AB 2LUHA 2IO2C 3Q9UC 3CLJA 1RZ4A 1TNBA 5E75A 5J08A 3APCA 2OOEA 2GGFA 3D9IA 4LSZE 4GPMA 5HRYA 4GCOA 4FA6A 1U2VG 2AXVA 3PH0C 4KZCA 4DX5D 5FJYA 4GTSA 3MKRA 3ML9A 3D9HA 4UQYA 5FTPA 2WXJA 3ZFWA 3E30A 5D2MC 4KBQA 1KT1A 4UQZA 3VTXA 4APFA 3QKYA 3PZ1A 3TWVA 1MHQA 1N0QA 2J9QA 2L6BA 3FHEA 4WWOA 3RJVA 2OCCE 3G2SA 1WG0A 4X8QA 4O1OA 5CEDB 3D9PA 2MYOA 4ILHB 4C0MA 2XCCA 4CGVA 4HXIA 3Q73A 1K3ZD 3S7FA 3PNLB 3UIOC 5HI7A 2R02A 4GZ6A 3CHRA 4D10C 3UT8A 4I9EA 2WB2A 1JUQA 5HQ8A 3HHMA 5J90A 2OVFA 4DX7D 1H2VC 3WXXA 1NA0A 1FCHA 3RSEG 1SZAA 4JHJA 4ANVA 1E90A 2XZTG 2R05A 4A1SA 3ZXSA 3ZUVB 2L9BA 3FUFA 3UM1A 2CG2A 2LO6A 3SNXA 1EF1C 2IQCA 2V5QC 3ZHEA 1JWFA 1FT1A 3G2TA 4RSYA 4EBAG 3V2XA 3D9LA 5BV0A 3MA5A 3FTSA 4CYMD 3ZEFA 2NYJA 1OUVA 3SF4A 4CRWA 3RO3A 2FF4A 3TWSA 1BD8A 5EYLA 1E8YA 2C0LA 2C0MA 4JHRA 2RKKA 2HM8A 3CHOA 1TJFA 2ZISA 1H19A 3I5PA 4EZKA 4KMOA 1Z3YA 5BV1A 2VSOE 1N4PA 3Q79A 2ZXWE 4PS8A 5BPPA 3PE3A 1O1TA 2EIKE 3DPDA 2LNIA 3HXFA 3NZUA 2IY0C 3ZW3A 3FUJA 4YVOA 3BU8A 1OCRE 2IONA 3FUDA 3O48A 3ISMC 3SFXA 1K8KG 3L13A 4NRHB 1E96B 4DUIA 1EYHA 3WG7E 1D9SA 1U3CA 3I4RB 2IEJA 4QFVA 4BTAA 3AG1E 4M3OA 1N95A 2BTDA 4V3IA 4K5BA 4HORA 1QNFA 3AU4A 4G26A 3NZSA 2Y0BG 2LXLA 2GRQB 4J7WA 2Y4TA 2A4ZA 2QY7A 4OYSA 3NAWA 4Q94A 3CEQA 4GU5A 1E8ZA 4JL0A 4PDXA 4I6EA 2Y3AA 1TN7A 2OEWA 3DPYA 1OT8A 4RVBA 2FEZA 2XPIA 2WQHA 1N4RA 4FHJA 3HRAA 4B89A 4TRQA 4I17A 3MJWA 2QFCA 5FQ7A 5ITZF 2UY1A 5CRUA 3UINC 3U9WA 2HE0A 4DX1A 2HR2A 4DX2A 1SA5A 3RU0A 4U0UA 3DEOA 5LP0A 1NZNA 3ASNE 2XGSA 2NXPA 3JUEA 2F8XK 4G8LA 1MX2A 2LSVA 2XGMA 4JW1A 1V55E 4XEIG 4UI9K 1HG2A 4O6FA 4WNFA 2CHWA 3MCXA 4I2ZA 1UJJA 3LDZA 5DBKA 3CSFA 4XX5A 1WY6A 3CK8A 3PNTB 4BT8A 1H2TC 3QDNA 4ILIA 2VTBB 3KD7A 4ANWA 4UWHA 5ENTD 4AV7A 3ZPJA 3HVEB 3D9NA 3PUJA 5AN8A 2X6HA 5D0OD 3BEEA 2BUGA 4XZ4A 3EU5A 5EX0A 1E8WA 3IXEA 1OY3D 1KZOA 3MV3B 4ANUA 3UXGA 3CQGB 5EN5D 4RG6A 3R9MA 1IHGA 5ENPD 2ILRA 1UN9A 1L5JA 4GZCA 2CFUA 4U0SA 3T9KA 1QQEA 3IEGA 5CCLA 4LNBA 4NURA 2ETCA 3FH7A 2BKKB 2AWIA 3RRMB 3QC1A 3AU5A 1IKND 4YDWA 1E7VA 5D66A 5E76A 2RFAA 2PM6A 3UUXA 4DLOA 4WNDA 4PH4B 3W9FA 3DBSA 2ONDA 2WXOA 2JLBA 3QB2A 4N5QA 5FQ4A 4OAUC 3D9KA 4LNGA 2P58C 3TWXA 4J0UA 4B8CB 4FC8A 4HOTA 5EYPF 4A55A 3GZ1A 2QZAA 4FU3A 4L2LA 4I1MA 4L23A 5BT1A 5CMYA 1HU3A 3AAAC 3TWTA 3ONKA 2AVPA 3ZYQA 3Q7FA 4GZ5A 2P9IG 2OVBA 4FP7A 3SO8A 2L6JA 3ESKA 2YHCA 3B7SA 2ZIRA 5FIOA 4IYPA 1H2UA 5ENRD 3APDA 4TXPA 1ZU2A 2WXFA 3E32A 1TNUA 3NQPA 3HXDA 3PEUB 1V54E 4F1PA 3L9TA 3LY9A 1N9AA 4U8YD 4GYWA 4MS6A 2P9PG 5BXOA 5HKPA 3ZNGA 4TV3A 1TNZA 1N54A 5ARGA 2R03A 3FEXA 2YHEA 4WNGA 2DVWA 1FPPA 3QNKA 4HLEA 4J8FA 1INZA 4UQXA 4KVMA 2UY1B 3CVLA 4BWRA 1MJ0A 4JVSA 2WXGA 3ZYKA 3UKUG 2H6HA 3CK9A 2B0OE 3LJNA 3HYMB 4HOUA 4K03A 3QK0A 3UT4A 1QYMA 2CG3A 4A63B 5LFAA 3PE4A 3GZ2A 3EIJA 2VGEA 4BSXA 3MEKA 3Q75A 3UI2A 4N3AA 1IXVA 3S7JA 3I3NA 3CVUA 5A6CA 4L1BA 1K1AA 3CIAA 2PQRA 5BW8C 3E4BA 5KJKA 5FZSA 3C72A 3TGOA 3LYAA 3QWVA 3ASGA 3DSTA 3LPZA 4JC8A 3V79K 1MYOA 1ELRA 3TXNA 3V2OA 3CVWA 2P9LG 3MKQB 4U7EB 3T5XA 4I2WA 3JXIA 2KZTB 4YNDA 1NA3A 3L17A 3TL5A 4I6GA 4HRNA 5FQ8A 4ATZD 4FHKA 3JYSA
chains in the Genus database with same CATH topology
3DSUA 2R2LA 3DRAA 2H6FA 4GTMA 4EHMA 1LTXA 1TNZA 3PZ2A 4LNBA 1FPPA 4GTPA 1D8EA 2ZISA 1LD8A 3DSVA 1SA5A 1SA4A 2F0YA 4GTVA 1O1SA 1X81A 2H6HA 1N4PA 3Q79A 1TN6A 4L9PA 3Q73A 3Q78A 1O1TA 1N4QA 1JCSA 1NI1A 3HXFA 1QBQA 4YDOA 3Q75A 4YDEA 1O5MA 3DSSA 4GTOA 3SFXA 2H6IA 1S64A 3DSWA 4LNGA 4GTQA 3HXCA 2IEJA 1TNBA 3PZ3A 1TN8A 1S63A 1N95A 3C72A 1FT2A 3E37A 1DCEA 1KZPA 3E33A 3Q7AA 3DSTA 3KSQA 3Q7FA 1N94A 3EU5A 3HXBA 1LD7A 3PZ4A 3E34A 3SFYA 2ZIRA 1TN7A 2H6GA 3DPYA 1KZOA 4MBGA 1JCRA 1JCQA 1FT1A 1MZCA 4GTTA 4GTSA 1TNYA 1N4SA 2BEDA 3E32A 1O1RA 1TNUA 3EUVA 3DSXA 3HXDA 1N9AA 4GTRA 3E30A 3HXEA 1N4RA 3PZ1A 1D8DA 1NL4A 1TNOA 3KSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSU A;  2R2L A;  3DRA A;  2H6F A;  4GTM A;  4EHM A;  1LTX A;  1TNZ A;  3PZ2 A;  4LNB A;  1FPP A;  4GTP A;  1D8E A;  2ZIS A;  1LD8 A;  3DSV A;  1SA5 A;  1SA4 A;  2F0Y A;  4GTV A;  1O1S A;  1X81 A;  2H6H A;  1N4P A;  3Q79 A;  1TN6 A;  4L9P A;  3Q73 A;  3Q78 A;  1O1T A;  1N4Q A;  1JCS A;  1NI1 A;  3HXF A;  1QBQ A;  4YDO A;  3Q75 A;  4YDE A;  1O5M A;  3DSS A;  4GTO A;  3SFX A;  2H6I A;  1S64 A;  3DSW A;  4LNG A;  4GTQ A;  3HXC A;  2IEJ A;  1TNB A;  3PZ3 A;  1TN8 A;  1S63 A;  1N95 A;  3C72 A;  1FT2 A;  3E37 A;  1DCE A;  1KZP A;  3E33 A;  3Q7A A;  3DST A;  3KSQ A;  3Q7F A;  1N94 A;  3EU5 A;  3HXB A;  1LD7 A;  3PZ4 A;  3E34 A;  3SFY A;  2ZIR A;  1TN7 A;  2H6G A;  3DPY A;  1KZO A;  4MBG A;  1JCR A;  1JCQ A;  1FT1 A;  1MZC A;  4GTT A;  4GTS A;  1TNY A;  1N4S A;  2BED A;  3E32 A;  1O1R A;  1TNU A;  3EUV A;  3DSX A;  3HXD A;  1N9A A;  4GTR A;  3E30 A;  3HXE A;  1N4R A;  3PZ1 A;  1D8D A;  1NL4 A;  1TNO A;  3KSL A; 
#chains in the Genus database with same CATH topology
 4HFG A;  2KCL A;  4GTM A;  1H6K A;  2KC7 A;  1HG5 A;  3MV2 B;  4NAC A;  4K0R A;  5AYW D;  4GYY A;  3JQ1 A;  4O1P A;  4M7C A;  4U04 A;  4B94 A;  3EHM A;  1O1S A;  4NQ0 A;  1TEZ A;  2P2C P;  3SFZ A;  5CMW A;  3NBN B;  2XRY A;  3CV0 A;  3UM2 A;  2VGY A;  4L2Y A;  1HXI A;  4UWL A;  5FIN A;  4G23 A;  5G05 C;  1JWG A;  3IKO B;  2WM9 A;  3CVY A;  3NF1 A;  4LER A;  3ZKJ A;  2P9U G;  2XEH A;  3SBT B;  3LVR E;  1P5Q A;  4B93 B;  4HVB A;  3J5P A;  3TWQ A;  4J8D A;  3S2A A;  1FT2 A;  4I43 A;  4PS7 A;  4CGW A;  4Q69 A;  3IHY A;  1N94 A;  4RG9 A;  2ZGD A;  4N2Q A;  2X6K A;  3B7T A;  2AJA A;  3L82 A;  4CCA A;  4XE0 A;  5B1A E;  5FZQ A;  2B6C A;  1JCR A;  1XGW A;  1YA0 A;  4DX6 D;  1H0A A;  1TNY A;  3FTX A;  2BED A;  5ANR A;  2RG8 A;  4F7A A;  3LY7 A;  3AJI A;  2PQN A;  5G05 J;  2A5E A;  1W3B A;  3BUA A;  2LSU A;  3JQ0 A;  4J8E A;  2LXM A;  3ULQ A;  2WVI A;  2XS8 A;  2ZGG A;  4N3C A;  3UX4 A;  2J49 A;  2WXH A;  1BU9 A;  2IF4 A;  1OCO E;  3CVN A;  3OXF A;  5ENO D;  3FU3 A;  4AXH A;  5ARF A;  3CVV A;  1UG3 A;  3Q49 B;  5HS0 A;  3EIQ C;  4UWG A;  4JA9 A;  5IY5 E;  1OXJ A;  2GRM A;  4YDE A;  3JCK C;  1O5M A;  1N52 A;  4GTQ A;  4JEU A;  2F8Y A;  3S7D A;  2DWZ A;  1EDU A;  3Q47 B;  4DK5 A;  1AWC B;  3SBS A;  5KWD A;  1Z6T A;  3FUM A;  1AP7 A;  3RRU A;  3E37 A;  4BY6 A;  4TXQ A;  3NB2 A;  5EX3 A;  4G8K A;  3KSQ A;  3L16 A;  3BQO A;  3BG1 B;  4A1G A;  1BI8 B;  3KAE A;  3QJZ A;  3W9G A;  4JD2 G;  4YVQ C;  3MGB A;  4EZJ A;  4GTT A;  3ENE A;  2WXN A;  4G2V A;  4G24 A;  4GZ3 A;  2VYI A;  3PEV B;  4BES A;  3PRZ A;  1IQR A;  1KPS B;  3CGH A;  1X5B A;  3U3W A;  5JMN D;  3D9M A;  3Q5M A;  4HOQ A;  2XEN A;  2KXP C;  1ELW A;  1Z3X A;  2V0P A;  4JA7 A;  2AW6 A;  3AS8 A;  4U95 D;  5ENQ D;  1S70 B;  2I1J A;  4GML A;  3G2V A;  3FTY A;  3ZVV A;  4BT9 A;  1DNP A;  2LAI A;  1NFI E;  2IFU A;  1N11 A;  1U3D A;  4I1O B;  2PL2 A;  1NI1 A;  3U64 A;  5KJL A;  3DXK G;  3HG0 D;  4YDO A;  5JA4 D;  3AG2 E;  4WUY A;  2VSX E;  1KT0 A;  5AJL A;  2FI7 A;  3B7U X;  5AQB A;  1MQS A;  5B1B E;  4DI4 A;  3C3R A;  4I9C A;  5C2Y A;  3CVP A;  1IQU A;  4UWF A;  4LG6 A;  4GCN A;  4HI8 A;  2GRR B;  3ZYM A;  2XRZ A;  2WPV A;  3CST A;  4GPK A;  3FFL A;  4F53 A;  1B89 A;  4FJY A;  5JJT A;  3PRE A;  2J07 A;  2XCB A;  3SD5 A;  3FUI A;  4Z68 A;  5DIZ A;  3SHF A;  5EIB E;  2GRP B;  5BNW A;  5KNH D;  3D9O A;  4OVV A;  3AS4 A;  1Z5S C;  1OCC E;  2IO3 C;  1WM5 A;  4O60 A;  2KCK A;  5CRV A;  3FP3 A;  4CEM A;  4EBA A;  3ZHE B;  4ATG A;  4CDM A;  4BX8 A;  1WDY A;  4U8H A;  2FUL A;  3ZGQ A;  3MX3 A;  2Y1L E;  3LEW A;  1K1B A;  3V31 A;  3UKR G;  3S7B A;  1JCS A;  2NC9 A;  1UN8 A;  2VGX A;  3IHV A;  4UUC A;  4CDN A;  4MLP A;  4GTO A;  1QZ2 A;  4LNU D;  3T8K A;  5CEC B;  3CHS A;  3SGH A;  3OXG A;  1TR4 A;  3DEP A;  3FY4 A;  3GW4 A;  4P29 A;  4CT4 A;  3EDT B;  3ASH A;  2JAB A;  3TJP A;  3FUK A;  3T8M A;  2VSY A;  2X6I A;  4W9R A;  3CK7 A;  4R7L A;  4Y6W A;  1ELK A;  3PS6 A;  2R59 A;  3E33 A;  3CVQ A;  4XIF A;  3TAX A;  4JHK A;  3UPV A;  3HXB A;  4ACK A;  2WQ6 A;  3E34 A;  2P9S G;  3SFY A;  2HYZ A;  3CHM A;  2VSN A;  4XKB A;  4C48 B;  4MBG A;  3FH5 A;  4EZL A;  1N4S A;  3EUV A;  4HS2 A;  3ZRH A;  2WXP A;  3ABL E;  4F6R D;  2WQ7 A;  1XNF A;  1HH8 A;  4GA1 A;  4GMR A;  3OXL A;  3P1U A;  2V4L A;  1PC2 A;  1MX6 A;  5EKQ D;  1HF8 A;  5BUZ A;  3RIB A;  3PZ2 A;  2XHE A;  2L0I A;  2M63 A;  1WAO 1;  3JXJ A;  4AP2 A;  4GA0 A;  3SZ7 A;  3TG5 A;  1OWN A;  3SQV A;  1OWL A;  1UOH A;  3RK6 A;  3ULE G;  2WMO A;  4L9P A;  3LCA A;  2QYJ A;  1N4Q A;  3TWR A;  3ULY A;  3LY8 A;  3RAU A;  2C2L A;  4H7Y A;  1QBQ A;  4JPS A;  3C98 A;  3L22 A;  1LF8 A;  3CQC B;  3EHR A;  4DLQ A;  1S64 A;  3OAW A;  3FH8 A;  3J5Q B;  4ACL A;  3ZYL A;  1DCQ A;  4IN3 B;  4U0Z A;  4ANX A;  5JHA A;  4AOF A;  4GAA A;  1TN8 A;  5CER B;  3EHN A;  4HRL A;  4ILG A;  3LXU X;  4UWK A;  2GW1 A;  1KZP A;  3C3O A;  4LRZ A;  2PZI A;  3ABK E;  2CHZ A;  4DRX E;  4FJZ A;  1LD7 A;  2GRL A;  2AXU A;  4U07 A;  3F6Q A;  2MOW A;  4DJA A;  4B0Z A;  2R17 C;  3UT7 A;  4HRM B;  4KZ0 A;  1MZC A;  5AEN A;  4TUU A;  2L0T B;  4DI3 A;  3B7R L;  1G3N B;  4G1T A;  4APO A;  1YYH A;  3FTZ A;  2DZN A;  1TYQ G;  1D8D A;  3RRN B;  3DRA A;  3UMV A;  5JJ6 A;  4EHM A;  1SZ9 A;  2YIN A;  4AEZ C;  2XEE A;  2PM7 A;  3EU9 A;  2ETA A;  3PDN A;  2AXZ A;  3FEY A;  1SVX A;  2MHK A;  3LKU A;  1TN6 A;  4RQI A;  2IU1 A;  2NSZ A;  5LCW C;  3SY2 A;  5T4Y A;  1Q2Z A;  3I4G A;  3QAQ A;  3FU5 A;  5G04 C;  2VGX B;  4EPZ A;  2Y69 E;  1HS6 A;  3FTV A;  2XPY A;  3FWV A;  4K5C A;  4PUC A;  2WXQ A;  2P9N G;  1IYG A;  2I2O A;  3D9J A;  1EPU A;  3BG0 B;  4DPR A;  1HZ4 A;  3KS2 A;  3APF A;  3FUE A;  4CDR A;  3NOC D;  2IOS A;  1MX4 A;  4FAD A;  2KAT A;  2V5F A;  3FTU A;  3FUL A;  4C0E A;  1HFA A;  4MRU A;  2WXI A;  3K9I A;  4IUL A;  5ANL A;  2EIL E;  5LCW J;  3UQ3 A;  3QAR A;  2XZD G;  3DWL G;  4MKT A;  5G04 J;  3ASD A;  3TWW A;  3VLD A;  4H7X A;  5AQ9 A;  4GTP A;  1D8E A;  4HQD A;  3QWW A;  2EQX A;  5AAO A;  4JB8 P;  3Q9N C;  1HO8 A;  5LOZ A;  4BET A;  2F0Y A;  5C1D A;  1X81 A;  2KM4 A;  1E7U A;  4CT0 A;  5H7P A;  2EIN E;  5FZR A;  3AG3 E;  3UM0 A;  2ZU6 B;  4I6J A;  5AQ7 A;  2DYR E;  3T5V A;  2DIW A;  2VTB A;  3L6A A;  5CHE E;  3HVE A;  2DYS E;  5ENS D;  4N2S A;  4J6I A;  4BEP A;  2H6I A;  2HO1 A;  4GZD A;  2WXM A;  5KCM A;  5T3R A;  4AIF A;  4F1S A;  3GZS A;  1SQM A;  5KJM A;  5FWQ A;  3ABM E;  2CFZ A;  3MZL B;  3Q15 A;  1A17 A;  2I6H A;  3ONL A;  1DCE A;  2ETB A;  2EIM E;  2VQ2 A;  5BXU A;  4URK A;  4HB5 A;  3EJN A;  2V8S E;  5EID A;  2JEK A;  4N39 A;  5KNG A;  4IRU A;  3UM3 A;  5JJ7 A;  3PUK A;  3G2U A;  3FDH A;  3TXM A;  1SW6 A;  2X6J A;  4ABN A;  3ZU7 B;  2V4H C;  3DSU A;  3IBE A;  2IJG X;  3FU6 A;  2BF0 X;  4GMJ A;  5B3S E;  1BPO A;  4C9B B;  5FT9 A;  4E6H A;  3C5R A;  4AY5 A;  4LEU A;  4L7T A;  3PZD A;  2Q7F A;  1DC2 A;  4GA2 A;  2IOL A;  3O4Z A;  1SA4 A;  3CHQ A;  5KJN A;  3SI5 A;  1YMP A;  4FUL A;  2J09 A;  4G25 A;  1TJC A;  2E0I A;  3CVX A;  4ZFH A;  3JUI A;  4HBD A;  1E8X A;  3CKC A;  3IV0 A;  4XKC A;  3U4T A;  4A3T A;  5AAR A;  5CBO A;  2DCP A;  3FTW A;  4EEC A;  3C3Q A;  2QYU A;  4AM9 A;  1H6O A;  3PZ3 A;  2UWJ G;  1OWP A;  4KVO A;  1DVP A;  1ZB1 A;  4E85 A;  4AJW A;  2VJ8 A;  3U66 A;  3AS5 A;  3NOG D;  2X38 A;  2X6F A;  2YNQ A;  4I1A A;  5ENN A;  4BER A;  2WXR A;  4J8S A;  4KXK B;  4FLB A;  3L08 A;  4U96 D;  2EIJ E;  5EIL A;  1KLX A;  5D0Q D;  2FO1 E;  3FU0 A;  5G2N A;  4LCT A;  2XEV A;  1FVF A;  2YQ8 A;  4KT6 B;  3PVL A;  2MRI A;  1LTX A;  2KCV A;  2DZO A;  3B7B A;  4K5A B;  3N71 A;  5T8I A;  4KYO B;  3DSV A;  4JEH A;  4GB9 A;  2F37 A;  2J4D A;  1RW2 A;  4HI9 A;  2I9C A;  1JPL A;  5AIJ A;  1PY1 A;  2X3M A;  2BKG A;  2CHX A;  3ESL A;  4XI0 A;  4HLL A;  3LS8 A;  4HOS A;  3GYZ A;  5JHB A;  3UIP C;  3ASO E;  5FQ6 A;  2Y4U A;  3ML8 A;  4WWP A;  2FBN A;  3ZIM A;  4PS3 A;  4EQF A;  3X2Q E;  2J4B A;  3HIZ A;  3MKQ A;  5A7D B;  2P9K G;  2KZT A;  3TWU A;  4TXR A;  2WMN A;  2QC9 A;  1OCZ E;  3B13 A;  3FUN A;  3QWP A;  4AVX A;  4AY6 A;  4ME2 A;  3KEZ A;  1UW4 B;  1BLX B;  4GYO A;  3CR3 A;  4JXT A;  2DBA A;  2J08 A;  5AQA A;  4YDY A;  4LUN U;  1HX8 A;  3TG4 A;  4Y6C A;  3FUH A;  1GW6 A;  3P2B A;  2RD0 A;  3DSX A;  4BTB A;  4U8V D;  4FLH A;  4UI9 C;  4XI9 A;  1TNO A;  4WWN A;  3R7R A;  4BSZ B;  3V30 A;  3KSL A;  5EDS A;  2R2L A;  2H6F A;  1VDY A;  2LAH A;  1BI7 B;  4N5C A;  3ZN3 A;  3HDX A;  4HNA D;  1NP7 A;  4B8A A;  1N0R A;  3UTM A;  2E2E A;  3LVQ E;  2GRN B;  1LD8 A;  4CZ2 D;  2OV8 A;  4GTV A;  3L54 A;  2R5S A;  1IHB A;  1S0P A;  3B95 A;  3ASF A;  4BX9 A;  3OTN A;  4WNE A;  5KBA A;  3VLE A;  1YCS B;  2I1K A;  3LJ3 A;  1UJK A;  2J8S D;  4J8Y A;  4UI9 J;  5A23 A;  3HXC A;  4TUM A;  3G2W A;  4JZY A;  2XS1 A;  3CKB A;  2XQ0 A;  5G55 A;  1A5E A;  1S63 A;  4ZHB A;  3R9A B;  2XGO A;  3Q7A A;  2FO7 A;  4N3B A;  5CBN A;  3EHQ A;  4F3V A;  3PZ4 A;  1FVH A;  3URZ A;  1Y8M A;  2OEV A;  2H6G A;  4BFR A;  1JCQ A;  1ZBP A;  3RO2 A;  1O1R A;  4OAV B;  4G11 A;  4GTR A;  3VTY A;  3HXE A;  3D3M A;  3CHP A;  1H6P A;  1NL4 A;  2KBX A;  1HE8 A;  3VLF A;  4RLY A;  2PNN A;  5M72 A;  5LX8 A;  5AJD A;  2A5U A;  4WAF A;  2RFM A;  3AG4 E;  3MYV A;  4U63 A;  3ZXP A;  3R7Q A;  5CCM A;  3KEA A;  4OVU A;  1Y6I A;  2XPZ A;  1OWO A;  3Q78 A;  4NIK A;  4A3V A;  2WXK A;  3RKV A;  1OWM A;  1PAQ A;  2GRO B;  4QQI A;  5CEA A;  3DXM G;  3DSS A;  3QOU A;  4Q96 A;  3DSW A;  2WXL A;  3Q4A B;  2LUH A;  2IO2 C;  3Q9U C;  3CLJ A;  1RZ4 A;  1TNB A;  5E75 A;  5J08 A;  3APC A;  2OOE A;  2GGF A;  3D9I A;  4LSZ E;  4GPM A;  5HRY A;  4GCO A;  4FA6 A;  1U2V G;  2AXV A;  3PH0 C;  4KZC A;  4DX5 D;  5FJY A;  4GTS A;  3MKR A;  3ML9 A;  3D9H A;  4UQY A;  5FTP A;  2WXJ A;  3ZFW A;  3E30 A;  5D2M C;  4KBQ A;  1KT1 A;  4UQZ A;  3VTX A;  4APF A;  3QKY A;  3PZ1 A;  3TWV A;  1MHQ A;  1N0Q A;  2J9Q A;  2L6B A;  3FHE A;  4WWO A;  3RJV A;  2OCC E;  3G2S A;  1WG0 A;  4X8Q A;  4O1O A;  5CED B;  3D9P A;  2MYO A;  4ILH B;  4C0M A;  2XCC A;  4CGV A;  4HXI A;  3Q73 A;  1K3Z D;  3S7F A;  3PNL B;  3UIO C;  5HI7 A;  2R02 A;  4GZ6 A;  3CHR A;  4D10 C;  3UT8 A;  4I9E A;  2WB2 A;  1JUQ A;  5HQ8 A;  3HHM A;  5J90 A;  2OVF A;  4DX7 D;  1H2V C;  3WXX A;  1NA0 A;  1FCH A;  3RSE G;  1SZA A;  4JHJ A;  4ANV A;  1E90 A;  2XZT G;  2R05 A;  4A1S A;  3ZXS A;  3ZUV B;  2L9B A;  3FUF A;  3UM1 A;  2CG2 A;  2LO6 A;  3SNX A;  1EF1 C;  2IQC A;  2V5Q C;  3ZHE A;  1JWF A;  1FT1 A;  3G2T A;  4RSY A;  4EBA G;  3V2X A;  3D9L A;  5BV0 A;  3MA5 A;  3FTS A;  4CYM D;  3ZEF A;  2NYJ A;  1OUV A;  3SF4 A;  4CRW A;  3RO3 A;  2FF4 A;  3TWS A;  1BD8 A;  5EYL A;  1E8Y A;  2C0L A;  2C0M A;  4JHR A;  2RKK A;  2HM8 A;  3CHO A;  1TJF A;  2ZIS A;  1H19 A;  3I5P A;  4EZK A;  4KMO A;  1Z3Y A;  5BV1 A;  2VSO E;  1N4P A;  3Q79 A;  2ZXW E;  4PS8 A;  5BPP A;  3PE3 A;  1O1T A;  2EIK E;  3DPD A;  2LNI A;  3HXF A;  3NZU A;  2IY0 C;  3ZW3 A;  3FUJ A;  4YVO A;  3BU8 A;  1OCR E;  2ION A;  3FUD A;  3O48 A;  3ISM C;  3SFX A;  1K8K G;  3L13 A;  4NRH B;  1E96 B;  4DUI A;  1EYH A;  3WG7 E;  1D9S A;  1U3C A;  3I4R B;  2IEJ A;  4QFV A;  4BTA A;  3AG1 E;  4M3O A;  1N95 A;  2BTD A;  4V3I A;  4K5B A;  4HOR A;  1QNF A;  3AU4 A;  4G26 A;  3NZS A;  2Y0B G;  2LXL A;  2GRQ B;  4J7W A;  2Y4T A;  2A4Z A;  2QY7 A;  4OYS A;  3NAW A;  4Q94 A;  3CEQ A;  4GU5 A;  1E8Z A;  4JL0 A;  4PDX A;  4I6E A;  2Y3A A;  1TN7 A;  2OEW A;  3DPY A;  1OT8 A;  4RVB A;  2FEZ A;  2XPI A;  2WQH A;  1N4R A;  4FHJ A;  3HRA A;  4B89 A;  4TRQ A;  4I17 A;  3MJW A;  2QFC A;  5FQ7 A;  5ITZ F;  2UY1 A;  5CRU A;  3UIN C;  3U9W A;  2HE0 A;  4DX1 A;  2HR2 A;  4DX2 A;  1SA5 A;  3RU0 A;  4U0U A;  3DEO A;  5LP0 A;  1NZN A;  3ASN E;  2XGS A;  2NXP A;  3JUE A;  2F8X K;  4G8L A;  1MX2 A;  2LSV A;  2XGM A;  4JW1 A;  1V55 E;  4XEI G;  4UI9 K;  1HG2 A;  4O6F A;  4WNF A;  2CHW A;  3MCX A;  4I2Z A;  1UJJ A;  3LDZ A;  5DBK A;  3CSF A;  4XX5 A;  1WY6 A;  3CK8 A;  3PNT B;  4BT8 A;  1H2T C;  3QDN A;  4ILI A;  2VTB B;  3KD7 A;  4ANW A;  4UWH A;  5ENT D;  4AV7 A;  3ZPJ A;  3HVE B;  3D9N A;  3PUJ A;  5AN8 A;  2X6H A;  5D0O D;  3BEE A;  2BUG A;  4XZ4 A;  3EU5 A;  5EX0 A;  1E8W A;  3IXE A;  1OY3 D;  1KZO A;  3MV3 B;  4ANU A;  3UXG A;  3CQG B;  5EN5 D;  4RG6 A;  3R9M A;  1IHG A;  5ENP D;  2ILR A;  1UN9 A;  1L5J A;  4GZC A;  2CFU A;  4U0S A;  3T9K A;  1QQE A;  3IEG A;  5CCL A;  4LNB A;  4NUR A;  2ETC A;  3FH7 A;  2BKK B;  2AWI A;  3RRM B;  3QC1 A;  3AU5 A;  1IKN D;  4YDW A;  1E7V A;  5D66 A;  5E76 A;  2RFA A;  2PM6 A;  3UUX A;  4DLO A;  4WND A;  4PH4 B;  3W9F A;  3DBS A;  2OND A;  2WXO A;  2JLB A;  3QB2 A;  4N5Q A;  5FQ4 A;  4OAU C;  3D9K A;  4LNG A;  2P58 C;  3TWX A;  4J0U A;  4B8C B;  4FC8 A;  4HOT A;  5EYP F;  4A55 A;  3GZ1 A;  2QZA A;  4FU3 A;  4L2L A;  4I1M A;  4L23 A;  5BT1 A;  5CMY A;  1HU3 A;  3AAA C;  3TWT A;  3ONK A;  2AVP A;  3ZYQ A;  3Q7F A;  4GZ5 A;  2P9I G;  2OVB A;  4FP7 A;  3SO8 A;  2L6J A;  3ESK A;  2YHC A;  3B7S A;  2ZIR A;  5FIO A;  4IYP A;  1H2U A;  5ENR D;  3APD A;  4TXP A;  1ZU2 A;  2WXF A;  3E32 A;  1TNU A;  3NQP A;  3HXD A;  3PEU B;  1V54 E;  4F1P A;  3L9T A;  3LY9 A;  1N9A A;  4U8Y D;  4GYW A;  4MS6 A;  2P9P G;  5BXO A;  5HKP A;  3ZNG A;  4TV3 A;  1TNZ A;  1N54 A;  5ARG A;  2R03 A;  3FEX A;  2YHE A;  4WNG A;  2DVW A;  1FPP A;  3QNK A;  4HLE A;  4J8F A;  1INZ A;  4UQX A;  4KVM A;  2UY1 B;  3CVL A;  4BWR A;  1MJ0 A;  4JVS A;  2WXG A;  3ZYK A;  3UKU G;  2H6H A;  3CK9 A;  2B0O E;  3LJN A;  3HYM B;  4HOU A;  4K03 A;  3QK0 A;  3UT4 A;  1QYM A;  2CG3 A;  4A63 B;  5LFA A;  3PE4 A;  3GZ2 A;  3EIJ A;  2VGE A;  4BSX A;  3MEK A;  3Q75 A;  3UI2 A;  4N3A A;  1IXV A;  3S7J A;  3I3N A;  3CVU A;  5A6C A;  4L1B A;  1K1A A;  3CIA A;  2PQR A;  5BW8 C;  3E4B A;  5KJK A;  5FZS A;  3C72 A;  3TGO A;  3LYA A;  3QWV A;  3ASG A;  3DST A;  3LPZ A;  4JC8 A;  3V79 K;  1MYO A;  1ELR A;  3TXN A;  3V2O A;  3CVW A;  2P9L G;  3MKQ B;  4U7E B;  3T5X A;  4I2W A;  3JXI A;  2KZT B;  4YND A;  1NA3 A;  3L17 A;  3TL5 A;  4I6G A;  4HRN A;  5FQ8 A;  4ATZ D;  4FHK A;  3JYS A; 
#chains in the Genus database with same CATH homology
 3DSU A;  2R2L A;  3DRA A;  2H6F A;  4GTM A;  4EHM A;  1LTX A;  1TNZ A;  3PZ2 A;  4LNB A;  1FPP A;  4GTP A;  1D8E A;  2ZIS A;  1LD8 A;  3DSV A;  1SA5 A;  1SA4 A;  2F0Y A;  4GTV A;  1O1S A;  1X81 A;  2H6H A;  1N4P A;  3Q79 A;  1TN6 A;  4L9P A;  3Q73 A;  3Q78 A;  1O1T A;  1N4Q A;  1JCS A;  1NI1 A;  3HXF A;  1QBQ A;  4YDO A;  3Q75 A;  4YDE A;  1O5M A;  3DSS A;  4GTO A;  3SFX A;  2H6I A;  1S64 A;  3DSW A;  4LNG A;  4GTQ A;  3HXC A;  2IEJ A;  1TNB A;  3PZ3 A;  1TN8 A;  1S63 A;  1N95 A;  3C72 A;  1FT2 A;  3E37 A;  1DCE A;  1KZP A;  3E33 A;  3Q7A A;  3DST A;  3KSQ A;  3Q7F A;  1N94 A;  3EU5 A;  3HXB A;  1LD7 A;  3PZ4 A;  3E34 A;  3SFY A;  2ZIR A;  1TN7 A;  2H6G A;  3DPY A;  1KZO A;  4MBG A;  1JCR A;  1JCQ A;  1FT1 A;  1MZC A;  4GTT A;  4GTS A;  1TNY A;  1N4S A;  2BED A;  3E32 A;  1O1R A;  1TNU A;  3EUV A;  3DSX A;  3HXD A;  1N9A A;  4GTR A;  3E30 A;  3HXE A;  1N4R A;  3PZ1 A;  1D8D A;  1NL4 A;  1TNO A;  3KSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...