1NL4A

Crystal structure of rat farnesyl transferase in complex with a potent biphenyl inhibitor
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
312
structure length
312
Chain Sequence
b'FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Novel and Selective Imidazole-containing Biphenyl Inhibitors of Protein Farnesyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 125
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1nl4A00
4GTQA 3HXEA 4YDOA 3Q79A 1N4RA 1O1TA 3Q7AA 3KSQA 3PZ1A 1FT2A 3SFXA 3DPYA 3Q73A 2H6HA 3E32A 1KZOA 2ZISA 1X81A 1TN6A 1S63A 3DSUA 1O1RA 1N4QA 2BEDA 4MBGA 4YDEA 3DSSA 1FT1A 1N95A 1JCSA 1NL4A 3DSXA 4EHMA 2H6FA 3E34A 3EUVA 3SFYA 1LTXA 1N9AA 1N4PA 1FPPA 1SA4A 4LNBA 1SA5A 4GTMA 1TNOA 3Q7FA 3KSLA 1JCRA 1TNBA 3Q75A 2ZIRA 1LD8A 1S64A 2H6IA 3HXDA 3PZ4A 3Q78A 2R2LA 3DSVA 1LD7A 4GTVA 2H6GA 3HXCA 4GTRA 3DSWA 4GTTA 1TN8A 3E33A 3DRAA 3C72A 3HXFA 1DCEA 1NI1A 1D8EA 3PZ3A 1MZCA 4LNGA 1O1SA 1TNZA 3EU5A 1D8DA 3E30A 1O5MA 3DSTA 4L9PA 2IEJA 1JCQA 3E37A 2F0YA 1TNUA 3PZ2A 4GTPA 1N4SA 1QBQA 1TNYA 4GTSA 1N94A 1KZPA 4GTOA 1TN7A 3HXBA
chains in the Genus database with same CATH superfamily
4GTQA 1IKND 4A3VA 4GU5A 5JA4D 4YDOA 3ZRHA 3FU3A 2XEHA 3ESLA 3UQ3A 1ELWA 1JUQA 5ENQD 4GZ6A 4FC8A 2H6HA 4J0UA 4OAUC 1TN6A 4V3IA 2BEDA 4FHJA 2XPYA 4B94A 2LO6A 3CR3A 4EHMA 4MS6A 1P5QA 4F7AA 2FULA 3SBSA 1FPPA 5BXOA 2NYJA 3S7BA 2NC9A 3L54A 4HOTA 5EYPF 3AS5A 3CVXA 4TUMA 2Y4TA 1OWOA 2A4ZA 1E90A 3Q49B 2V5FA 2GRQB 4H7XA 2YNQA 3QKYA 4UUCA 3ULEG 5B3SE 2HM8A 4J7WA 2XHEA 3E33A 4XI0A 3PE3A 5EIBE 5EKQD 3ZPJA 5EDSA 1KT1A 2XGOA 3TL5A 3D9KA 3RAUA 2GRPB 2FF4A 4NURA 4ANXA 3B7SA 3KS2A 4C0EA 5AYWD 2FO1E 2DYRE 2J08A 1Y8MA 2X6JA 3I4GA 3PRZA 4BY6A 3CHQA 2OEWA 2UY1B 3HXBA 4I6JA 2LXLA 4JL0A 3OXFA 3B7RL 5FINA 4XE0A 1N4RA 2VGXB 2WXOA 3CHOA 2Y1LE 3AG2E 3ZYMA 3URZA 3FU0A 2VSNA 3UM3A 3BUAA 2WXNA 3E32A 2HYZA 3FTVA 3L17A 3UM0A 3BG0B 4U04A 3DSUA 3JQ1A 3CHPA 4CDMA 1JCSA 2VJ8A 3O4ZA 3TWRA 3ASDA 3LY7A 2PQNA 3FUMA 3QWWA 1Y6IA 4DX2A 1YMPA 3AJIA 2EINE 1JWFA 5T8IA 2R2LA 3CHSA 3FWVA 1SZAA 3L13A 4KZ0A 4AY6A 4DX7D 4E85A 1NA3A 2MRIA 3PUKA 1X5BA 3UT8A 2CHZA 3TWXA 4CT4A 1SQMA 5CRVA 1O1SA 5CBOA 5FIOA 4I6GA 4OVVA 5AQAA 1HE8A 4CYMD 3FY4A 4XKBA 3QWPA 1BI7B 2YINA 2L0IA 3GZ1A 2R5SA 3HVEA 1EF1C 2WXJA 4I43A 4XZ4A 1MX6A 3UMVA 1BI8B 5B1BE 4K5BA 2PM7A 1KLXA 3Q73A 4GB9A 3AAAC 4MBGA 1YCSB 4KZCA 2R02A 1XNFA 3FTZA 3MCXA 3N71A 2NXPA 3ZYLA 1JWGA 2IJGX 5H7PA 4FLBA 3RRNB 3IV0A 1OCZE 3ABLE 4M7CA 2IF4A 3U9WA 3LYAA 3Q7FA 3T5VA 4OVUA 4AP2A 4FU3A 3JUEA 2XPIA 2PM6A 4RQIA 5LCWJ 1IQRA 3ULQA 3FFLA 2XCCA 4JW1A 3RU0A 2C0LA 3EJNA 3UKUG 4IULA 2ETCA 4MRUA 3CIAA 3R7RA 1IHGA 3NQPA 3QNKA 3D9HA 4DPRA 3CHRA 3JXIA 3UTMA 2HO1A 4H7YA 1N52A 3CVPA 4CCAA 3R9MA 1UN9A 1N4SA 5CHEE 3OXGA 2KZTA 2WM9A 4GTSA 2QYJA 2WMOA 2L6BA 2ETBA 3LCAA 3WG7E 2WQHA 4WNGA 2Y4UA 3SNXA 5AQBA 4G1TA 5KJLA 3HIZA 2I9CA 3PZ1A 3TWVA 4HRNA 5J90A 4I1AA 3VTYA 1AWCB 3DWLG 2BF0X 3FP3A 3L16A 5CEDB 4G2VA 2M63A 4GA1A 1FT1A 1MX2A 4N3CA 4TXQA 2FBNA 3P2BA 1LTXA 1MX4A 5E75A 1SA4A 4LNBA 5EX3A 4BEPA 4ILGA 2ZU6B 3V31A 4GPKA 2RKKA 5FZSA 4UQXA 2QZAA 5CBNA 3TWWA 5IY5E 2IOLA 3HXCA 5KCMA 4GTRA 2WXRA 4HLLA 1NA0A 3MV3B 3JUIA 4BTBA 1A17A 1H0AA 4OYSA 3L82A 1DCEA 4BFRA 3FTXA 4GMJA 4XEIG 2RG8A 3TWQA 2Q7FA 4B0ZA 3EHQA 1E7VA 3U66A 2I1JA 4URKA 4UWKA 4WUYA 5JJ6A 5ENNA 3ASGA 4WNEA 5G2NA 2RFMA 3TWSA 3ZXPA 2IONA 3HXEA 5BUZA 3ZGQA 5AENA 3NBNB 4ACLA 2LSVA 1WAO1 1ZBPA 2DWZA 2CFUA 4F1PA 4ILIA 1KPSB 4GCOA 3NAWA 5EILA 3D3MA 4I9CA 3FUHA 2KCLA 4TUUA 4CDNA 1JPLA 4FJZA 3X2QE 4DRXE 3HHMA 1HZ4A 3LKUA 5KJKA 2I1KA 3S7FA 3MKQA 4JC8A 4JZYA 3MZLB 2CG3A 4JA7A 1LD7A 3UIOC 1K1BA 4GTVA 3J5PA 3QC1A 2Y69E 5C2YA 1YA0A 4Q69A 4U0UA 1UJJA 2IY0C 3D9MA 3NF1A 3W9FA 4E6HA 3VLFA 5KNHD 2LUHA 2I2OA 3NZUA 2HE0A 4ANVA 4JD2G 3LPZA 2DVWA 2R05A 3CEQA 1EDUA 3JXJA 4RSYA 4G8KA 2WMNA 2IU1A 3FULA 2F0YA 3FUFA 4UI9J 2J49A 4GTPA 4EPZA 4EZLA 3O48A 5FQ7A 4A1SA 3LJ3A 2VSYA 5AQ9A 2XS1A 3PE4A 3RRUA 5T4YA 4C0MA 3RK6A 3S7DA 4ABNA 4U8HA 4NIKA 3KEZA 3D9JA 4U96D 4PUCA 3EDTB 4FHKA 4BTAA 5ARGA 2L9BA 4APFA 3ZXSA 4AV7A 4BERA 5CMWA 3ONLA 3LJNA 3NOCD 3J5QB 1ZU2A 4LCTA 2EIJE 4KVOA 3PNLB 2C0MA 3HVEB 4FULA 4UWLA 5BV1A 3EUVA 2BKKB 4ANWA 4WNFA 3AG1E 1SW6A 3ZKJA 2DCPA 3Q75A 1OXJA 5FZRA 5JHBA 4QQIA 4DK5A 2J07A 3CQCB 3MX3A 2OOEA 1OCRE 3IHYA 3EHNA 2P9UG 4F53A 2WPVA 3K9IA 2GROB 2WXQA 1INZA 5ENRD 5A23A 2ONDA 4LG6A 3CK8A 5BNWA 4EECA 2WXLA 5FQ4A 1WDYA 2DZOA 4YDYA 4J6IA 3ASNE 4HOSA 2GRRB 4GTOA 1EPUA 1N11A 3ABKE 3PNTB 3DXMG 3NB2A 3ONKA 3TXMA 2MHKA 3LDZA 2F8YA 2E0IA 5DBKA 4A1GA 3DXKG 4O1OA 1BD8A 2XZDG 3PDNA 3IKOB 2WVIA 3FTYA 4FLHA 1E8WA 3IXEA 2KZTB 1K8KG 2QFCA 3UT7A 2EQXA 2OEVA 1ELKA 1HS6A 2LAHA 2RFAA 2P9NG 5FQ8A 5ENTD 1PC2A 3PH0C 3TJPA 3FUJA 4GYWA 3CVNA 4KMOA 3HYMB 4CT0A 4KVMA 1NZNA 2X6IA 4TV3A 5ITZF 4UI9C 1S64A 1WG0A 4L23A 4B89A 4PS7A 1Z3YA 1OT8A 2ZGGA 3NOGD 4NQ0A 4J8FA 1FCHA 1TYQG 1IHBA 3CSFA 4BX8A 3VTXA 4I2WA 3L08A 4UWGA 3SBTB 2AVPA 2DYSE 2IFUA 2KC7A 1QQEA 5HKPA 1TNZA 1W3BA 4HRLA 3ULYA 2R17C 3CK9A 4G11A 3GYZA 3FTSA 2VGYA 3LXUX 3NZSA 1TN7A 1PY1A 3LEWA 4ZHBA 2WQ6A 4WAFA 2R03A 3MGBA 5E76A 5EN5D 5AARA 3V30A 3QDNA 3CVWA 4FA6A 2FI7A 3APCA 4EBAG 4N2QA 3QJZA 1ZB1A 3CKCA 5BXUA 3T9KA 4DX6D 3EHRA 2XGMA 1E8YA 1N4QA 1OWMA 3PUJA 3UKRG 3IHVA 2QC9A 3D9IA 1RW2A 5LX8A 3SFYA 1N4PA 3LVQE 3PEVB 1SA5A 3UPVA 3ZNGA 3CK7A 4AY5A 2JEKA 3KSLA 2L6JA 3D9NA 1LD8A 2GRLA 3Q78A 3P1UA 1H2UA 3CVYA 1IYGA 4YNDA 4JA9A 4FADA 1G3NB 2J09A 3C3OA 4GTTA 5T3RA 3CVQA 4BT8A 2J9QA 4AOFA 3C72A 2R59A 1OWLA 5AJLA 4DJAA 5D66A 3CLJA 3ZVVA 5CCMA 3CSTA 4EZKA 5J08A 3L9TA 3ZFWA 5HI7A 2RD0A 2WQ7A 1QYMA 4GMRA 4Y6CA 4G25A 2JLBA 3MKQB 3FUKA 4AXHA 2Y0BG 5A7DB 2PNNA 1QBQA 2B0OE 1N94A 4HFGA 2XEEA 5JJTA 3U3WA 2WXPA 3DBSA 1BLXB 3B7BA 4BWRA 2P9KG 2P9SG 3Q79A 2YHEA 4A55A 1HG2A 1N0RA 3AG3E 2J4BA 3G2VA 1FT2A 4N5CA 2XENA 4OAVB 2PZIA 3ZYQA 3QWVA 5ANRA 3OTNA 3RIBA 3SFZA 4XI9A 3OAWA 3FUIA 3UM2A 1H6PA 2XEVA 2DIWA 3ASOE 3OXLA 3LY9A 2H6FA 2WXHA 5FZQA 5CMYA 4DI3A 4JEHA 3ZW3A 4GZDA 3FH7A 3RRMB 2NSZA 4GZ3A 5B1AE 3Q47B 4XKCA 4GYOA 4JHRA 3AS4A 5CECB 5CRUA 4I6EA 4BX9A 3HXDA 1DNPA 1H2VC 3Q5MA 3S7JA 2VQ2A 3ZUVB 2GRNB 3BQOA 1SZ9A 1Z3XA 2VTBB 2BUGA 3QK0A 2XPZA 3S2AA 2QY7A 4DI4A 4N3BA 1PAQA 2C2LA 3ISMC 4WWOA 3SF4A 3I3NA 2HR2A 1QZ2A 5KJMA 3E30A 2E2EA 4LUNU 1HFAA 4CGVA 5HQ8A 2VGEA 4XX5A 1L5JA 4GMLA 5CERB 3T5XA 5M72A 3MA5A 3RKVA 4WWPA 4IYPA 4DUIA 2WXIA 2VSXE 4GCNA 2P58C 2P9IG 2IOSA 1BU9A 3V2OA 4HI9A 1E96B 3UIPC 4L7TA 2KCVA 4A3TA 4RLYA 2KATA 3DSSA 2ETAA 3GZSA 4L2YA 1D9SA 3C3RA 3E34A 4U63A 3C5RA 1TJCA 1UJKA 4U8VD 4GTMA 3U4TA 1Z6TA 4WWNA 5LCWC 2X6KA 4HNAD 1KT0A 2XRYA 4JVSA 3ASHA 4A63B 3ML9A 4F6RD 4F1SA 4N3AA 3IEGA 5AJDA 2WXFA 3FU6A 4PDXA 2IO3C 3TWTA 4FP7A 2KM4A 5AIJA 3EIQC 3PREA 5KBAA 3QOUA 2FEZA 4BSZB 4LNUD 3AS8A 4U07A 3ABME 3ZYKA 4Z68A 4WNDA 1KZPA 3UT4A 1N54A 1UOHA 3L6AA 4KBQA 4JB8P 4HOQA 1GW6A 3HRAA 4LRZA 1XGWA 3FEYA 3Q7AA 3KSQA 4LSZE 4I1OB 2CFZA 3FUNA 3MJWA 4JXTA 1KZOA 2ZISA 3PEUB 2YHCA 4U0SA 1BPOA 4YDEA 3EU9A 3E4BA 4U95D 2DZNA 3G2WA 3I4RB 3DSXA 4RG6A 3CGHA 1S0PA 3V79K 1WY6A 2OVBA 4G24A 5AQ7A 5LP0A 5BW8C 4FJYA 1TNOA 3PS6A 1TJFA 4PH4B 2CG2A 3CV0A 3SHFA 3ZHEA 2X6FA 2OCCE 4YVQC 2VTBA 1TN8A 2WXKA 4JHKA 4HQDA 3FHEA 4QFVA 3C3QA 4AJWA 1DCQA 4L2LA 1OWNA 1HXIA 2XCBA 2ZXWE 1UW4B 2GW1A 3EU5A 3CVUA 1S70B 4IN3B 5ARFA 4EQFA 5CEAA 3JYSA 4JPSA 2XS8A 3UX4A 2CHWA 3QAQA 4K5CA 4GPMA 2KCKA 4KT6B 2QYUA 4DLOA 1Z5SC 4U7EB 3MYVA 1V55E 5EIDA 5FJYA 5FTPA 2BTDA 3APDA 1OWPA 3KAEA 4J8SA 4K03A 4YDWA 5ENSD 4X8QA 3MV2B 3QB2A 2GRMA 3FH8A 3UXGA 5BT1A 1VDYA 4K0RA 4DX5D 4APOA 4HOUA 1K1AA 3CHMA 3AU5A 3FEXA 4J8EA 5FQ6A 1IXVA 2V4HC 2V0PA 4LERA 1JCRA 1OY3D 2ZIRA 4J8YA 4K5AB 4B8AA 5KNGA 2H6GA 4M3OA 3D9LA 5LFAA 3RJVA 4G23A 3DSWA 3DRAA 2J4DA 3MEKA 2AXUA 3HG0D 5LOZA 4O60A 1FVHA 5ENPD 5FWQA 4LEUA 4AVXA 3CQGB 1DVPA 2L0TB 2B6CA 5JHAA 2AXZA 5ENOD 1HH8A 2WB2A 3R7QA 3PZ2A 1N0QA 2X3MA 2J8SD 2VSOE 2ZGDA 3EHMA 2PL2A 4UQZA 5AN8A 4Y6WA 5HS0A 4C9BB 4UI9K 1HX8A 1LF8A 3G2TA 3B13A 1SVXA 1U2VG 3CVLA 3RSEG 3BG1B 3DPYA 5D0QD 4UWHA 1X81A 1E7UA 2OV8A 4ZFHA 4I2ZA 1NL4A 2KBXA 3Q4AB 3RO3A 3F6QA 1RZ4A 3GW4A 3V2XA 4B8CB 4BT9A 3SD5A 1TR4A 3ZIMA 3SGHA 4I17A 4ATGA 2UWJG 4C48B 3FUEA 3JQ0A 3W9GA 4W9RA 4F3VA 4GZCA 1HU3A 5G55A 2V8SE 4HXIA 5G04J 2MOWA 4J8DA 3SZ7A 2A5UA 4BESA 2F8XK 2WXMA 2KXPC 4GA0A 4IRUA 3ZN3A 3TG4A 4U8YD 3TGOA 4HB5A 5EYLA 1A5EA 2CHXA 3G2SA 5AAOA 4L9PA 2IEJA 3E37A 4P29A 2AWIA 4U0ZA 1V54E 5D2MC 4B93B 1HO8A 4I1MA 3IBEA 3LY8A 1H6OA 4GYYA 4HBDA 4UQYA 4O1PA 4BSXA 4PS3A 1O1TA 3B7TA 2BKGA 3FTWA 3SFXA 5KWDA 2IQCA 2P9PG 4NRHB 1B89A 3TG5A 5FT9A 4ME2A 5JJ7A 1O1RA 2WXGA 5CCLA 5G05J 1E8XA 2PQRA 4PS8A 1E8ZA 3Q9UC 5BPPA 1DC2A 3RO2A 4G26A 4HLEA 4I9EA 3PZ4A 2LSUA 4EBAA 4GA2A 4HVBA 4UWFA 2F37A 3SI5A 4Q94A 2A5EA 3HXFA 2UY1A 4TXPA 2GGFA 4GZ5A 1H19A 1NI1A 1MQSA 4NACA 4Q96A 4L1BA 2VGXA 4AIFA 1D8DA 1MHQA 4O6FA 3UUXA 3ZHEB 2LAIA 4RVBA 2VYIA 2X38A 1U3CA 2P9LG 3KEAA 1K3ZD 1H6KA 4HRMB 3Q9NC 3CVVA 3BU8A 2EILE 2AJAA 4DX1A 2V4LA 3Q15A 4ILHB 4HI8A 3MKRA 2OVFA 2DBAA 3UINC 3AG4E 3JCKC 5G04C 3TWUA 4CGWA 1N95A 4KYOB 4ATZD 2XZTG 3B95A 5A6CA 3CKBA 4G8LA 3PVLA 3ML8A 1N9AA 4D10C 5D0OD 2AW6A 2LXMA 4TRQA 1NFIE 4AM9A 3C98A 2LNIA 3BEEA 4CRWA 4HS2A 3EIJA 3FTUA 5ANLA 3DSVA 2MYOA 1U3DA 5EX0A 4CDRA 3APFA 4GAAA 2X6HA 3ZEFA 2AXVA 1OCCE 2XGSA 3PZ3A 1MZCA 3LVRE 3L22A 4JEUA 3G2UA 3DSTA 4BETA 3LS8A 4XIFA 3SY2A 4CZ2D 1MYOA 1JCQA 4AEZC 1TNUA 2V5QC 2EIKE 2XQ0A 3PZDA 1FVFA 5G05C 2YQ8A 1EYHA 4DLQA 3DEOA 3D9PA 4JHJA 5DIZA 3FH5A 2FO7A 3QARA 2EIME 3TXNA 3I5PA 5HRYA 5JMND 4EZJA 1OCOE 3GZ2A 1S63A 1MJ0A 3SQVA 2XRZA 3T8MA 2P2CP 1ELRA 3SO8A 3HDXA 1H2TC 4KXKB 1QNFA 3ESKA 1HG5A 3ZU7B 3VLDA 2I6HA 4N39A 4N2SA 3ASFA 1NP7A 3FU5A 1UN8A 3DPDA 1TNBA 4ANUA 2JABA 2H6IA 5C1DA 4HORA 4RG9A 3B7UX 1IQUA 3DEPA 5KJNA 4YVOA 2Y3AA 3WXXA 1Q2ZA 3D9OA 3TAXA 3UI2A 3AU4A 1HF8A 4MLPA 3FDHA 1D8EA 3UM1A 3KD7A 3VLEA 1WM5A 4LNGA 3U64A 4CEMA 5BV0A 4MKTA 1O5MA 3T8KA 3FUDA 4TXRA 1YYHA 1AP7A 1OUVA 4N5QA 2IO2C 3R9AB 1TNYA 1UG3A 3ENEA 4ACKA 2ILRA 1TEZA 4R7LA
chains in the Genus database with same CATH topology
4GTQA 3HXEA 4YDOA 3Q79A 1N4RA 1O1TA 3Q7AA 3KSQA 3PZ1A 1FT2A 3SFXA 3DPYA 3Q73A 2H6HA 3E32A 1KZOA 2ZISA 1X81A 1TN6A 1S63A 3DSUA 1O1RA 1N4QA 2BEDA 4MBGA 4YDEA 3DSSA 1FT1A 1N95A 1JCSA 1NL4A 3DSXA 4EHMA 2H6FA 3E34A 3EUVA 3SFYA 1LTXA 1N9AA 1N4PA 1FPPA 1SA4A 4LNBA 1SA5A 4GTMA 1TNOA 3Q7FA 3KSLA 1JCRA 1TNBA 3Q75A 2ZIRA 1LD8A 1S64A 2H6IA 3HXDA 3PZ4A 3Q78A 2R2LA 3DSVA 1LD7A 4GTVA 2H6GA 3HXCA 4GTRA 3DSWA 4GTTA 1TN8A 3E33A 3DRAA 3C72A 3HXFA 1DCEA 1NI1A 1D8EA 3PZ3A 1MZCA 4LNGA 1O1SA 1TNZA 3EU5A 1D8DA 3E30A 1O5MA 3DSTA 4L9PA 2IEJA 1JCQA 3E37A 2F0YA 1TNUA 3PZ2A 4GTPA 1N4SA 1QBQA 1TNYA 4GTSA 1N94A 1KZPA 4GTOA 1TN7A 3HXBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GTQ A;  3HXE A;  4YDO A;  3Q79 A;  1N4R A;  1O1T A;  3Q7A A;  3KSQ A;  3PZ1 A;  1FT2 A;  3SFX A;  3DPY A;  3Q73 A;  2H6H A;  3E32 A;  1KZO A;  2ZIS A;  1X81 A;  1TN6 A;  1S63 A;  3DSU A;  1O1R A;  1N4Q A;  2BED A;  4MBG A;  4YDE A;  3DSS A;  1FT1 A;  1N95 A;  1JCS A;  1NL4 A;  3DSX A;  4EHM A;  2H6F A;  3E34 A;  3EUV A;  3SFY A;  1LTX A;  1N9A A;  1N4P A;  1FPP A;  1SA4 A;  4LNB A;  1SA5 A;  4GTM A;  1TNO A;  3Q7F A;  3KSL A;  1JCR A;  1TNB A;  3Q75 A;  2ZIR A;  1LD8 A;  1S64 A;  2H6I A;  3HXD A;  3PZ4 A;  3Q78 A;  2R2L A;  3DSV A;  1LD7 A;  4GTV A;  2H6G A;  3HXC A;  4GTR A;  3DSW A;  4GTT A;  1TN8 A;  3E33 A;  3DRA A;  3C72 A;  3HXF A;  1DCE A;  1NI1 A;  1D8E A;  3PZ3 A;  1MZC A;  4LNG A;  1O1S A;  1TNZ A;  3EU5 A;  1D8D A;  3E30 A;  1O5M A;  3DST A;  4L9P A;  2IEJ A;  1JCQ A;  3E37 A;  2F0Y A;  1TNU A;  3PZ2 A;  4GTP A;  1N4S A;  1QBQ A;  1TNY A;  4GTS A;  1N94 A;  1KZP A;  4GTO A;  1TN7 A;  3HXB A; 
#chains in the Genus database with same CATH topology
 4GTQ A;  1IKN D;  4A3V A;  4GU5 A;  5JA4 D;  4YDO A;  3ZRH A;  3FU3 A;  2XEH A;  3ESL A;  3UQ3 A;  1ELW A;  1JUQ A;  5ENQ D;  4GZ6 A;  4FC8 A;  2H6H A;  4J0U A;  4OAU C;  1TN6 A;  4V3I A;  2BED A;  4FHJ A;  2XPY A;  4B94 A;  2LO6 A;  3CR3 A;  4EHM A;  4MS6 A;  1P5Q A;  4F7A A;  2FUL A;  3SBS A;  1FPP A;  5BXO A;  2NYJ A;  3S7B A;  2NC9 A;  3L54 A;  4HOT A;  5EYP F;  3AS5 A;  3CVX A;  4TUM A;  2Y4T A;  1OWO A;  2A4Z A;  1E90 A;  3Q49 B;  2V5F A;  2GRQ B;  4H7X A;  2YNQ A;  3QKY A;  4UUC A;  3ULE G;  5B3S E;  2HM8 A;  4J7W A;  2XHE A;  3E33 A;  4XI0 A;  3PE3 A;  5EIB E;  5EKQ D;  3ZPJ A;  5EDS A;  1KT1 A;  2XGO A;  3TL5 A;  3D9K A;  3RAU A;  2GRP B;  2FF4 A;  4NUR A;  4ANX A;  3B7S A;  3KS2 A;  4C0E A;  5AYW D;  2FO1 E;  2DYR E;  2J08 A;  1Y8M A;  2X6J A;  3I4G A;  3PRZ A;  4BY6 A;  3CHQ A;  2OEW A;  2UY1 B;  3HXB A;  4I6J A;  2LXL A;  4JL0 A;  3OXF A;  3B7R L;  5FIN A;  4XE0 A;  1N4R A;  2VGX B;  2WXO A;  3CHO A;  2Y1L E;  3AG2 E;  3ZYM A;  3URZ A;  3FU0 A;  2VSN A;  3UM3 A;  3BUA A;  2WXN A;  3E32 A;  2HYZ A;  3FTV A;  3L17 A;  3UM0 A;  3BG0 B;  4U04 A;  3DSU A;  3JQ1 A;  3CHP A;  4CDM A;  1JCS A;  2VJ8 A;  3O4Z A;  3TWR A;  3ASD A;  3LY7 A;  2PQN A;  3FUM A;  3QWW A;  1Y6I A;  4DX2 A;  1YMP A;  3AJI A;  2EIN E;  1JWF A;  5T8I A;  2R2L A;  3CHS A;  3FWV A;  1SZA A;  3L13 A;  4KZ0 A;  4AY6 A;  4DX7 D;  4E85 A;  1NA3 A;  2MRI A;  3PUK A;  1X5B A;  3UT8 A;  2CHZ A;  3TWX A;  4CT4 A;  1SQM A;  5CRV A;  1O1S A;  5CBO A;  5FIO A;  4I6G A;  4OVV A;  5AQA A;  1HE8 A;  4CYM D;  3FY4 A;  4XKB A;  3QWP A;  1BI7 B;  2YIN A;  2L0I A;  3GZ1 A;  2R5S A;  3HVE A;  1EF1 C;  2WXJ A;  4I43 A;  4XZ4 A;  1MX6 A;  3UMV A;  1BI8 B;  5B1B E;  4K5B A;  2PM7 A;  1KLX A;  3Q73 A;  4GB9 A;  3AAA C;  4MBG A;  1YCS B;  4KZC A;  2R02 A;  1XNF A;  3FTZ A;  3MCX A;  3N71 A;  2NXP A;  3ZYL A;  1JWG A;  2IJG X;  5H7P A;  4FLB A;  3RRN B;  3IV0 A;  1OCZ E;  3ABL E;  4M7C A;  2IF4 A;  3U9W A;  3LYA A;  3Q7F A;  3T5V A;  4OVU A;  4AP2 A;  4FU3 A;  3JUE A;  2XPI A;  2PM6 A;  4RQI A;  5LCW J;  1IQR A;  3ULQ A;  3FFL A;  2XCC A;  4JW1 A;  3RU0 A;  2C0L A;  3EJN A;  3UKU G;  4IUL A;  2ETC A;  4MRU A;  3CIA A;  3R7R A;  1IHG A;  3NQP A;  3QNK A;  3D9H A;  4DPR A;  3CHR A;  3JXI A;  3UTM A;  2HO1 A;  4H7Y A;  1N52 A;  3CVP A;  4CCA A;  3R9M A;  1UN9 A;  1N4S A;  5CHE E;  3OXG A;  2KZT A;  2WM9 A;  4GTS A;  2QYJ A;  2WMO A;  2L6B A;  2ETB A;  3LCA A;  3WG7 E;  2WQH A;  4WNG A;  2Y4U A;  3SNX A;  5AQB A;  4G1T A;  5KJL A;  3HIZ A;  2I9C A;  3PZ1 A;  3TWV A;  4HRN A;  5J90 A;  4I1A A;  3VTY A;  1AWC B;  3DWL G;  2BF0 X;  3FP3 A;  3L16 A;  5CED B;  4G2V A;  2M63 A;  4GA1 A;  1FT1 A;  1MX2 A;  4N3C A;  4TXQ A;  2FBN A;  3P2B A;  1LTX A;  1MX4 A;  5E75 A;  1SA4 A;  4LNB A;  5EX3 A;  4BEP A;  4ILG A;  2ZU6 B;  3V31 A;  4GPK A;  2RKK A;  5FZS A;  4UQX A;  2QZA A;  5CBN A;  3TWW A;  5IY5 E;  2IOL A;  3HXC A;  5KCM A;  4GTR A;  2WXR A;  4HLL A;  1NA0 A;  3MV3 B;  3JUI A;  4BTB A;  1A17 A;  1H0A A;  4OYS A;  3L82 A;  1DCE A;  4BFR A;  3FTX A;  4GMJ A;  4XEI G;  2RG8 A;  3TWQ A;  2Q7F A;  4B0Z A;  3EHQ A;  1E7V A;  3U66 A;  2I1J A;  4URK A;  4UWK A;  4WUY A;  5JJ6 A;  5ENN A;  3ASG A;  4WNE A;  5G2N A;  2RFM A;  3TWS A;  3ZXP A;  2ION A;  3HXE A;  5BUZ A;  3ZGQ A;  5AEN A;  3NBN B;  4ACL A;  2LSV A;  1WAO 1;  1ZBP A;  2DWZ A;  2CFU A;  4F1P A;  4ILI A;  1KPS B;  4GCO A;  3NAW A;  5EIL A;  3D3M A;  4I9C A;  3FUH A;  2KCL A;  4TUU A;  4CDN A;  1JPL A;  4FJZ A;  3X2Q E;  4DRX E;  3HHM A;  1HZ4 A;  3LKU A;  5KJK A;  2I1K A;  3S7F A;  3MKQ A;  4JC8 A;  4JZY A;  3MZL B;  2CG3 A;  4JA7 A;  1LD7 A;  3UIO C;  1K1B A;  4GTV A;  3J5P A;  3QC1 A;  2Y69 E;  5C2Y A;  1YA0 A;  4Q69 A;  4U0U A;  1UJJ A;  2IY0 C;  3D9M A;  3NF1 A;  3W9F A;  4E6H A;  3VLF A;  5KNH D;  2LUH A;  2I2O A;  3NZU A;  2HE0 A;  4ANV A;  4JD2 G;  3LPZ A;  2DVW A;  2R05 A;  3CEQ A;  1EDU A;  3JXJ A;  4RSY A;  4G8K A;  2WMN A;  2IU1 A;  3FUL A;  2F0Y A;  3FUF A;  4UI9 J;  2J49 A;  4GTP A;  4EPZ A;  4EZL A;  3O48 A;  5FQ7 A;  4A1S A;  3LJ3 A;  2VSY A;  5AQ9 A;  2XS1 A;  3PE4 A;  3RRU A;  5T4Y A;  4C0M A;  3RK6 A;  3S7D A;  4ABN A;  4U8H A;  4NIK A;  3KEZ A;  3D9J A;  4U96 D;  4PUC A;  3EDT B;  4FHK A;  4BTA A;  5ARG A;  2L9B A;  4APF A;  3ZXS A;  4AV7 A;  4BER A;  5CMW A;  3ONL A;  3LJN A;  3NOC D;  3J5Q B;  1ZU2 A;  4LCT A;  2EIJ E;  4KVO A;  3PNL B;  2C0M A;  3HVE B;  4FUL A;  4UWL A;  5BV1 A;  3EUV A;  2BKK B;  4ANW A;  4WNF A;  3AG1 E;  1SW6 A;  3ZKJ A;  2DCP A;  3Q75 A;  1OXJ A;  5FZR A;  5JHB A;  4QQI A;  4DK5 A;  2J07 A;  3CQC B;  3MX3 A;  2OOE A;  1OCR E;  3IHY A;  3EHN A;  2P9U G;  4F53 A;  2WPV A;  3K9I A;  2GRO B;  2WXQ A;  1INZ A;  5ENR D;  5A23 A;  2OND A;  4LG6 A;  3CK8 A;  5BNW A;  4EEC A;  2WXL A;  5FQ4 A;  1WDY A;  2DZO A;  4YDY A;  4J6I A;  3ASN E;  4HOS A;  2GRR B;  4GTO A;  1EPU A;  1N11 A;  3ABK E;  3PNT B;  3DXM G;  3NB2 A;  3ONK A;  3TXM A;  2MHK A;  3LDZ A;  2F8Y A;  2E0I A;  5DBK A;  4A1G A;  3DXK G;  4O1O A;  1BD8 A;  2XZD G;  3PDN A;  3IKO B;  2WVI A;  3FTY A;  4FLH A;  1E8W A;  3IXE A;  2KZT B;  1K8K G;  2QFC A;  3UT7 A;  2EQX A;  2OEV A;  1ELK A;  1HS6 A;  2LAH A;  2RFA A;  2P9N G;  5FQ8 A;  5ENT D;  1PC2 A;  3PH0 C;  3TJP A;  3FUJ A;  4GYW A;  3CVN A;  4KMO A;  3HYM B;  4CT0 A;  4KVM A;  1NZN A;  2X6I A;  4TV3 A;  5ITZ F;  4UI9 C;  1S64 A;  1WG0 A;  4L23 A;  4B89 A;  4PS7 A;  1Z3Y A;  1OT8 A;  2ZGG A;  3NOG D;  4NQ0 A;  4J8F A;  1FCH A;  1TYQ G;  1IHB A;  3CSF A;  4BX8 A;  3VTX A;  4I2W A;  3L08 A;  4UWG A;  3SBT B;  2AVP A;  2DYS E;  2IFU A;  2KC7 A;  1QQE A;  5HKP A;  1TNZ A;  1W3B A;  4HRL A;  3ULY A;  2R17 C;  3CK9 A;  4G11 A;  3GYZ A;  3FTS A;  2VGY A;  3LXU X;  3NZS A;  1TN7 A;  1PY1 A;  3LEW A;  4ZHB A;  2WQ6 A;  4WAF A;  2R03 A;  3MGB A;  5E76 A;  5EN5 D;  5AAR A;  3V30 A;  3QDN A;  3CVW A;  4FA6 A;  2FI7 A;  3APC A;  4EBA G;  4N2Q A;  3QJZ A;  1ZB1 A;  3CKC A;  5BXU A;  3T9K A;  4DX6 D;  3EHR A;  2XGM A;  1E8Y A;  1N4Q A;  1OWM A;  3PUJ A;  3UKR G;  3IHV A;  2QC9 A;  3D9I A;  1RW2 A;  5LX8 A;  3SFY A;  1N4P A;  3LVQ E;  3PEV B;  1SA5 A;  3UPV A;  3ZNG A;  3CK7 A;  4AY5 A;  2JEK A;  3KSL A;  2L6J A;  3D9N A;  1LD8 A;  2GRL A;  3Q78 A;  3P1U A;  1H2U A;  3CVY A;  1IYG A;  4YND A;  4JA9 A;  4FAD A;  1G3N B;  2J09 A;  3C3O A;  4GTT A;  5T3R A;  3CVQ A;  4BT8 A;  2J9Q A;  4AOF A;  3C72 A;  2R59 A;  1OWL A;  5AJL A;  4DJA A;  5D66 A;  3CLJ A;  3ZVV A;  5CCM A;  3CST A;  4EZK A;  5J08 A;  3L9T A;  3ZFW A;  5HI7 A;  2RD0 A;  2WQ7 A;  1QYM A;  4GMR A;  4Y6C A;  4G25 A;  2JLB A;  3MKQ B;  3FUK A;  4AXH A;  2Y0B G;  5A7D B;  2PNN A;  1QBQ A;  2B0O E;  1N94 A;  4HFG A;  2XEE A;  5JJT A;  3U3W A;  2WXP A;  3DBS A;  1BLX B;  3B7B A;  4BWR A;  2P9K G;  2P9S G;  3Q79 A;  2YHE A;  4A55 A;  1HG2 A;  1N0R A;  3AG3 E;  2J4B A;  3G2V A;  1FT2 A;  4N5C A;  2XEN A;  4OAV B;  2PZI A;  3ZYQ A;  3QWV A;  5ANR A;  3OTN A;  3RIB A;  3SFZ A;  4XI9 A;  3OAW A;  3FUI A;  3UM2 A;  1H6P A;  2XEV A;  2DIW A;  3ASO E;  3OXL A;  3LY9 A;  2H6F A;  2WXH A;  5FZQ A;  5CMY A;  4DI3 A;  4JEH A;  3ZW3 A;  4GZD A;  3FH7 A;  3RRM B;  2NSZ A;  4GZ3 A;  5B1A E;  3Q47 B;  4XKC A;  4GYO A;  4JHR A;  3AS4 A;  5CEC B;  5CRU A;  4I6E A;  4BX9 A;  3HXD A;  1DNP A;  1H2V C;  3Q5M A;  3S7J A;  2VQ2 A;  3ZUV B;  2GRN B;  3BQO A;  1SZ9 A;  1Z3X A;  2VTB B;  2BUG A;  3QK0 A;  2XPZ A;  3S2A A;  2QY7 A;  4DI4 A;  4N3B A;  1PAQ A;  2C2L A;  3ISM C;  4WWO A;  3SF4 A;  3I3N A;  2HR2 A;  1QZ2 A;  5KJM A;  3E30 A;  2E2E A;  4LUN U;  1HFA A;  4CGV A;  5HQ8 A;  2VGE A;  4XX5 A;  1L5J A;  4GML A;  5CER B;  3T5X A;  5M72 A;  3MA5 A;  3RKV A;  4WWP A;  4IYP A;  4DUI A;  2WXI A;  2VSX E;  4GCN A;  2P58 C;  2P9I G;  2IOS A;  1BU9 A;  3V2O A;  4HI9 A;  1E96 B;  3UIP C;  4L7T A;  2KCV A;  4A3T A;  4RLY A;  2KAT A;  3DSS A;  2ETA A;  3GZS A;  4L2Y A;  1D9S A;  3C3R A;  3E34 A;  4U63 A;  3C5R A;  1TJC A;  1UJK A;  4U8V D;  4GTM A;  3U4T A;  1Z6T A;  4WWN A;  5LCW C;  2X6K A;  4HNA D;  1KT0 A;  2XRY A;  4JVS A;  3ASH A;  4A63 B;  3ML9 A;  4F6R D;  4F1S A;  4N3A A;  3IEG A;  5AJD A;  2WXF A;  3FU6 A;  4PDX A;  2IO3 C;  3TWT A;  4FP7 A;  2KM4 A;  5AIJ A;  3EIQ C;  3PRE A;  5KBA A;  3QOU A;  2FEZ A;  4BSZ B;  4LNU D;  3AS8 A;  4U07 A;  3ABM E;  3ZYK A;  4Z68 A;  4WND A;  1KZP A;  3UT4 A;  1N54 A;  1UOH A;  3L6A A;  4KBQ A;  4JB8 P;  4HOQ A;  1GW6 A;  3HRA A;  4LRZ A;  1XGW A;  3FEY A;  3Q7A A;  3KSQ A;  4LSZ E;  4I1O B;  2CFZ A;  3FUN A;  3MJW A;  4JXT A;  1KZO A;  2ZIS A;  3PEU B;  2YHC A;  4U0S A;  1BPO A;  4YDE A;  3EU9 A;  3E4B A;  4U95 D;  2DZN A;  3G2W A;  3I4R B;  3DSX A;  4RG6 A;  3CGH A;  1S0P A;  3V79 K;  1WY6 A;  2OVB A;  4G24 A;  5AQ7 A;  5LP0 A;  5BW8 C;  4FJY A;  1TNO A;  3PS6 A;  1TJF A;  4PH4 B;  2CG2 A;  3CV0 A;  3SHF A;  3ZHE A;  2X6F A;  2OCC E;  4YVQ C;  2VTB A;  1TN8 A;  2WXK A;  4JHK A;  4HQD A;  3FHE A;  4QFV A;  3C3Q A;  4AJW A;  1DCQ A;  4L2L A;  1OWN A;  1HXI A;  2XCB A;  2ZXW E;  1UW4 B;  2GW1 A;  3EU5 A;  3CVU A;  1S70 B;  4IN3 B;  5ARF A;  4EQF A;  5CEA A;  3JYS A;  4JPS A;  2XS8 A;  3UX4 A;  2CHW A;  3QAQ A;  4K5C A;  4GPM A;  2KCK A;  4KT6 B;  2QYU A;  4DLO A;  1Z5S C;  4U7E B;  3MYV A;  1V55 E;  5EID A;  5FJY A;  5FTP A;  2BTD A;  3APD A;  1OWP A;  3KAE A;  4J8S A;  4K03 A;  4YDW A;  5ENS D;  4X8Q A;  3MV2 B;  3QB2 A;  2GRM A;  3FH8 A;  3UXG A;  5BT1 A;  1VDY A;  4K0R A;  4DX5 D;  4APO A;  4HOU A;  1K1A A;  3CHM A;  3AU5 A;  3FEX A;  4J8E A;  5FQ6 A;  1IXV A;  2V4H C;  2V0P A;  4LER A;  1JCR A;  1OY3 D;  2ZIR A;  4J8Y A;  4K5A B;  4B8A A;  5KNG A;  2H6G A;  4M3O A;  3D9L A;  5LFA A;  3RJV A;  4G23 A;  3DSW A;  3DRA A;  2J4D A;  3MEK A;  2AXU A;  3HG0 D;  5LOZ A;  4O60 A;  1FVH A;  5ENP D;  5FWQ A;  4LEU A;  4AVX A;  3CQG B;  1DVP A;  2L0T B;  2B6C A;  5JHA A;  2AXZ A;  5ENO D;  1HH8 A;  2WB2 A;  3R7Q A;  3PZ2 A;  1N0Q A;  2X3M A;  2J8S D;  2VSO E;  2ZGD A;  3EHM A;  2PL2 A;  4UQZ A;  5AN8 A;  4Y6W A;  5HS0 A;  4C9B B;  4UI9 K;  1HX8 A;  1LF8 A;  3G2T A;  3B13 A;  1SVX A;  1U2V G;  3CVL A;  3RSE G;  3BG1 B;  3DPY A;  5D0Q D;  4UWH A;  1X81 A;  1E7U A;  2OV8 A;  4ZFH A;  4I2Z A;  1NL4 A;  2KBX A;  3Q4A B;  3RO3 A;  3F6Q A;  1RZ4 A;  3GW4 A;  3V2X A;  4B8C B;  4BT9 A;  3SD5 A;  1TR4 A;  3ZIM A;  3SGH A;  4I17 A;  4ATG A;  2UWJ G;  4C48 B;  3FUE A;  3JQ0 A;  3W9G A;  4W9R A;  4F3V A;  4GZC A;  1HU3 A;  5G55 A;  2V8S E;  4HXI A;  5G04 J;  2MOW A;  4J8D A;  3SZ7 A;  2A5U A;  4BES A;  2F8X K;  2WXM A;  2KXP C;  4GA0 A;  4IRU A;  3ZN3 A;  3TG4 A;  4U8Y D;  3TGO A;  4HB5 A;  5EYL A;  1A5E A;  2CHX A;  3G2S A;  5AAO A;  4L9P A;  2IEJ A;  3E37 A;  4P29 A;  2AWI A;  4U0Z A;  1V54 E;  5D2M C;  4B93 B;  1HO8 A;  4I1M A;  3IBE A;  3LY8 A;  1H6O A;  4GYY A;  4HBD A;  4UQY A;  4O1P A;  4BSX A;  4PS3 A;  1O1T A;  3B7T A;  2BKG A;  3FTW A;  3SFX A;  5KWD A;  2IQC A;  2P9P G;  4NRH B;  1B89 A;  3TG5 A;  5FT9 A;  4ME2 A;  5JJ7 A;  1O1R A;  2WXG A;  5CCL A;  5G05 J;  1E8X A;  2PQR A;  4PS8 A;  1E8Z A;  3Q9U C;  5BPP A;  1DC2 A;  3RO2 A;  4G26 A;  4HLE A;  4I9E A;  3PZ4 A;  2LSU A;  4EBA A;  4GA2 A;  4HVB A;  4UWF A;  2F37 A;  3SI5 A;  4Q94 A;  2A5E A;  3HXF A;  2UY1 A;  4TXP A;  2GGF A;  4GZ5 A;  1H19 A;  1NI1 A;  1MQS A;  4NAC A;  4Q96 A;  4L1B A;  2VGX A;  4AIF A;  1D8D A;  1MHQ A;  4O6F A;  3UUX A;  3ZHE B;  2LAI A;  4RVB A;  2VYI A;  2X38 A;  1U3C A;  2P9L G;  3KEA A;  1K3Z D;  1H6K A;  4HRM B;  3Q9N C;  3CVV A;  3BU8 A;  2EIL E;  2AJA A;  4DX1 A;  2V4L A;  3Q15 A;  4ILH B;  4HI8 A;  3MKR A;  2OVF A;  2DBA A;  3UIN C;  3AG4 E;  3JCK C;  5G04 C;  3TWU A;  4CGW A;  1N95 A;  4KYO B;  4ATZ D;  2XZT G;  3B95 A;  5A6C A;  3CKB A;  4G8L A;  3PVL A;  3ML8 A;  1N9A A;  4D10 C;  5D0O D;  2AW6 A;  2LXM A;  4TRQ A;  1NFI E;  4AM9 A;  3C98 A;  2LNI A;  3BEE A;  4CRW A;  4HS2 A;  3EIJ A;  3FTU A;  5ANL A;  3DSV A;  2MYO A;  1U3D A;  5EX0 A;  4CDR A;  3APF A;  4GAA A;  2X6H A;  3ZEF A;  2AXV A;  1OCC E;  2XGS A;  3PZ3 A;  1MZC A;  3LVR E;  3L22 A;  4JEU A;  3G2U A;  3DST A;  4BET A;  3LS8 A;  4XIF A;  3SY2 A;  4CZ2 D;  1MYO A;  1JCQ A;  4AEZ C;  1TNU A;  2V5Q C;  2EIK E;  2XQ0 A;  3PZD A;  1FVF A;  5G05 C;  2YQ8 A;  1EYH A;  4DLQ A;  3DEO A;  3D9P A;  4JHJ A;  5DIZ A;  3FH5 A;  2FO7 A;  3QAR A;  2EIM E;  3TXN A;  3I5P A;  5HRY A;  5JMN D;  4EZJ A;  1OCO E;  3GZ2 A;  1S63 A;  1MJ0 A;  3SQV A;  2XRZ A;  3T8M A;  2P2C P;  1ELR A;  3SO8 A;  3HDX A;  1H2T C;  4KXK B;  1QNF A;  3ESK A;  1HG5 A;  3ZU7 B;  3VLD A;  2I6H A;  4N39 A;  4N2S A;  3ASF A;  1NP7 A;  3FU5 A;  1UN8 A;  3DPD A;  1TNB A;  4ANU A;  2JAB A;  2H6I A;  5C1D A;  4HOR A;  4RG9 A;  3B7U X;  1IQU A;  3DEP A;  5KJN A;  4YVO A;  2Y3A A;  3WXX A;  1Q2Z A;  3D9O A;  3TAX A;  3UI2 A;  3AU4 A;  1HF8 A;  4MLP A;  3FDH A;  1D8E A;  3UM1 A;  3KD7 A;  3VLE A;  1WM5 A;  4LNG A;  3U64 A;  4CEM A;  5BV0 A;  4MKT A;  1O5M A;  3T8K A;  3FUD A;  4TXR A;  1YYH A;  1AP7 A;  1OUV A;  4N5Q A;  2IO2 C;  3R9A B;  1TNY A;  1UG3 A;  3ENE A;  4ACK A;  2ILR A;  1TEZ A;  4R7L A; 
#chains in the Genus database with same CATH homology
 4GTQ A;  3HXE A;  4YDO A;  3Q79 A;  1N4R A;  1O1T A;  3Q7A A;  3KSQ A;  3PZ1 A;  1FT2 A;  3SFX A;  3DPY A;  3Q73 A;  2H6H A;  3E32 A;  1KZO A;  2ZIS A;  1X81 A;  1TN6 A;  1S63 A;  3DSU A;  1O1R A;  1N4Q A;  2BED A;  4MBG A;  4YDE A;  3DSS A;  1FT1 A;  1N95 A;  1JCS A;  1NL4 A;  3DSX A;  4EHM A;  2H6F A;  3E34 A;  3EUV A;  3SFY A;  1LTX A;  1N9A A;  1N4P A;  1FPP A;  1SA4 A;  4LNB A;  1SA5 A;  4GTM A;  1TNO A;  3Q7F A;  3KSL A;  1JCR A;  1TNB A;  3Q75 A;  2ZIR A;  1LD8 A;  1S64 A;  2H6I A;  3HXD A;  3PZ4 A;  3Q78 A;  2R2L A;  3DSV A;  1LD7 A;  4GTV A;  2H6G A;  3HXC A;  4GTR A;  3DSW A;  4GTT A;  1TN8 A;  3E33 A;  3DRA A;  3C72 A;  3HXF A;  1DCE A;  1NI1 A;  1D8E A;  3PZ3 A;  1MZC A;  4LNG A;  1O1S A;  1TNZ A;  3EU5 A;  1D8D A;  3E30 A;  1O5M A;  3DST A;  4L9P A;  2IEJ A;  1JCQ A;  3E37 A;  2F0Y A;  1TNU A;  3PZ2 A;  4GTP A;  1N4S A;  1QBQ A;  1TNY A;  4GTS A;  1N94 A;  1KZP A;  4GTO A;  1TN7 A;  3HXB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...