1NL4A

Crystal structure of rat farnesyl transferase in complex with a potent biphenyl inhibitor
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase alpha subunit
publication title Novel and Selective Imidazole-containing Biphenyl Inhibitors of Protein Farnesyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
total genus 125
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1nl4A00
1TNYA 4LNGA 3PZ2A 1LTXA 3DSXA 4GTPA 3Q73A 1O1RA 3HXEA 3Q79A 1TNOA 1JCRA 1TNZA 4GTRA 1FT1A 1O5MA 2R2LA 1TN6A 1N9AA 1SA5A 2H6HA 1NI1A 3E32A 3KSLA 2IEJA 3PZ1A 3DSWA 1JCQA 4L9PA 2BEDA 1DCEA 3KSQA 3DSUA 4EHMA 4YDOA 3HXBA 1N4QA 3SFYA 3E37A 2H6FA 4GTMA 2H6IA 3PZ4A 1N4PA 4GTVA 4GTTA 1N95A 3E33A 3PZ3A 3E34A 1JCSA 1O1SA 1KZPA 4YDEA 1S64A 3DSVA 2H6GA 2ZISA 1N4RA 1MZCA 1D8EA 1KZOA 1TN7A 1QBQA 1NL4A 3Q78A 1FT2A 1FPPA 4LNBA 1LD7A 1N94A 3HXFA 3DPYA 1X81A 3C72A 3Q7FA 1S63A 3DSTA 3Q7AA 1TNUA 1O1TA 3DSSA 3E30A 4GTQA 4GTOA 3EUVA 1TNBA 1N4SA 1LD8A 4GTSA 1TN8A 1SA4A 2F0YA 4MBGA 3HXCA 1D8DA 3EU5A 3SFXA 2ZIRA 3HXDA 3Q75A 3DRAA
chains in the Genus database with same CATH superfamily
3PZ2A 4B0ZA 5CMYA 1LTXA 5C2YA 3L17A 1OUVA 1WDYA 3UKRG 4I2WA 5B1BE 5KWDA 1MJ0A 3ZVVA 2GRPB 1OT8A 2KM4A 1KPSB 4LCTA 4AY6A 1PC2A 2I6HA 3B95A 3LJ3A 1D9SA 1U3DA 4B94A 2WXPA 5AAOA 3LY9A 3LEWA 4TUUA 3TG4A 3U4TA 2CHWA 3JYSA 2WM9A 2MOWA 3UM3A 5JJTA 3LJNA 2PZIA 3L13A 3IHVA 4G26A 2EIJE 5FZQA 4NQ0A 1JWGA 1SQMA 4U8VD 1UOHA 3GYZA 2PM7A 1E96B 4J6IA 5DBKA 2DIWA 4GCNA 2QC9A 3Q7AA 5G05C 2WXMA 3L82A 3QOUA 3ONKA 3D9PA 3KD7A 2DYSE 3SBTB 2J4BA 3KEZA 3V2OA 3E30A 4GTQA 2XQ0A 3S2AA 4BT9A 1LD8A 3D3MA 4DI3A 2AJAA 1HFAA 2XGSA 2XEHA 4CDNA 1MX6A 3ZPJA 3LXUX 4J7WA 1E8ZA 4KMOA 5T3RA 3CK9A 4HFGA 3ENEA 3VTXA 4F6RD 3E4BA 5CECB 3FU0A 2X38A 3UXGA 2XCCA 3FWVA 4E6HA 2VGYA 3QDNA 3WXXA 2FI7A 4DPRA 5G55A 5JJ6A 1TN6A 2DZOA 1IKND 4JW1A 5E76A 3LY8A 2XHEA 5FT9A 4EBAG 2DCPA 4L9PA 3LVRE 3ONLA 4K5BA 3ASFA 4CDRA 5AARA 4F1PA 2H6FA 4KBQA 1FVHA 2FO1E 3NAWA 3VLEA 3CV0A 4P29A 5CCLA 1MZCA 4UQYA 4I6EA 2I1KA 4BSXA 4I1AA 4UI9K 3ASNE 4YVOA 2CFZA 3DPYA 3T8MA 3C72A 4L2YA 2LNIA 3TGOA 1OXJA 5EKQD 3FU6A 3ML8A 2CG2A 4WNFA 4JEUA 1ZU2A 2VTBB 2XGMA 3HVEB 3MEKA 1IHBA 1SVXA 3DWLG 5CRUA 1SZ9A 4GMJA 3CKBA 5FTPA 2VTBA 4IN3B 1DCQA 2OOEA 3DXMG 1V55E 4ANWA 3L16A 4C9BB 2AWIA 4GTPA 3HXEA 3Q79A 2WMNA 4O1OA 5LFAA 1NA0A 2UY1B 4APOA 2R2LA 4YVQC 3J5QB 2QYUA 2X6JA 4U63A 3URZA 3CHMA 4LNUD 3NOCD 5CBOA 1TJCA 3DSWA 2UY1A 1DCEA 3ZU7B 4HOQA 4CT0A 2P9SG 2F8XK 1H2TC 4RVBA 2WXHA 2VSXE 1YCSB 3G2TA 4PS8A 4DUIA 3CHRA 3CVYA 2RFAA 1KZPA 1ELWA 4CZ2D 5B1AE 3D9OA 5AYWD 4UWKA 3SZ7A 1FPPA 3SI5A 2R03A 2Q7FA 4ANXA 3Q7FA 5BV1A 3FH7A 3NZUA 4KT6B 5FJYA 5ENRD 3PDNA 1TR4A 3CIAA 4LG6A 3I4GA 1N4SA 3CK8A 2WB2A 1HXIA 4GA0A 3AG2E 3RK6A 2XPYA 2WXKA 1W3BA 2CHXA 3L22A 4XEIG 4YDWA 5LCWJ 2P9KG 2VGXB 3ZEFA 2EINE 5EX3A 3IHYA 3FUJA 2VYIA 3NZSA 2P9PG 5DIZA 4JA9A 3S7BA 4OYSA 3S7JA 1H6OA 1MYOA 5HQ8A 3APDA 4URKA 3AG1E 5EN5D 4BT8A 2C0LA 4YNDA 2I9CA 4L1BA 5FQ8A 4HI8A 4BEPA 3RO2A 3RRMB 5D2MC 5ARGA 5BV0A 2WXOA 2L6BA 4OAUC 2A5EA 3E33A 1UJJA 1MHQA 4CRWA 1UW4B 1HU3A 4I2ZA 3B7TA 4GU5A 1N4RA 4B89A 4K03A 4AVXA 4C48B 5AJDA 5B3SE 3RO3A 1H6KA 3QAQA 4TV3A 3P2BA 4CGVA 4DX5D 3CK7A 4ACKA 5CCMA 2Y3AA 2KZTA 3ABME 4HBDA 3FUDA 5ANLA 3TWSA 4I17A 3R7RA 4JHKA 4NIKA 3R9AB 4AP2A 3S7FA 4LERA 3PE3A 3AG4E 1SA4A 4JD2G 4E85A 2VSOE 2LAIA 2X6FA 1D8DA 2WQ6A 3TAXA 3CEQA 4TRQA 2LXMA 2GRLA 4CDMA 3ZUVB 4DRXE 3EJNA 4XE0A 5KJLA 3FFLA 3IEGA 5H7PA 4JEHA 4AIFA 4ANVA 1RW2A 3NB2A 3LY7A 4BX8A 2LSUA 2F8YA 2JLBA 3EHQA 3B7SA 3PEVB 5J08A 4G2VA 5AQAA 4EHMA 4YDOA 3FTUA 2RD0A 5CBNA 3MGBA 2WXFA 4O1PA 3T9KA 1NP7A 4BWRA 3BG0B 2IFUA 5AQ9A 3C3QA 5A23A 2RKKA 4BFRA 5ANRA 5FIOA 4GA2A 1BLXB 4N2QA 1NL4A 3I4RB 5JHBA 3UUXA 4N5CA 3HXFA 4RQIA 1HX8A 2WXGA 5EYPF 3DSTA 3U64A 4DJAA 3ZYMA 3CGHA 3LCAA 4U8HA 5LOZA 3UIOC 3RJVA 4C0MA 5KJNA 3ULYA 3ABKE 3V2XA 1X5BA 4WWOA 1PY1A 3RSEG 2J09A 2OVBA 1HF8A 3C3RA 4J8DA 4RSYA 3D9HA 1KT1A 5D0OD 4G25A 3CVNA 4ME2A 5CMWA 1O5MA 3CVVA 3S7DA 1TEZA 4GZCA 3FUNA 1EYHA 5KJKA 5C1DA 2XZTG 2IJGX 4PS3A 3KSLA 3TWUA 2AVPA 2KCKA 4IRUA 4N39A 2WXNA 3TL5A 4FP7A 3SFYA 4N3CA 5BXUA 3E37A 3D9NA 1NFIE 1RZ4A 4GPMA 3JQ0A 4JL0A 5JMND 3DSVA 1XGWA 4AXHA 3FP3A 3RKVA 1S63A 1BD8A 2WXLA 5BW8C 2NXPA 4DX6D 2ILRA 5EYLA 1WG0A 3FUFA 2OEWA 3CHPA 2L0IA 4FHJA 5HI7A 3EHRA 1HG2A 5E75A 1A17A 4Q96A 4WUYA 1E8XA 3BQOA 3SD5A 1BI7B 4X8QA 2IO2C 4DX7D 5CERB 2ZGGA 5ENQD 3AU4A 5BXOA 4K5CA 3HG0D 4OVVA 4CT4A 3FTYA 3UM1A 3FTVA 4XZ4A 1TNOA 3SFZA 5EDSA 4AM9A 3KS2A 3LS8A 3QNKA 2GGFA 4ATZD 5LP0A 3D9LA 4GA1A 4GMRA 3CVPA 3SY2A 2YHCA 3MV3B 3LKUA 3UINC 2I2OA 1JCQA 3EU9A 4XKCA 4BESA 3PUJA 1K8KG 3UT7A 3HXBA 3ULEG 5ENOD 3ZYLA 3T5VA 4HORA 3FY4A 4GTVA 5G04C 3PZ3A 4LUNU 3UIPC 2R05A 4UQXA 3FULA 1HO8A 4KVMA 1S64A 3QWWA 1D8EA 2ZXWE 5KNHD 2J8SD 1LD7A 3PNLB 2GRQB 3FTSA 1QNFA 4W9RA 3APCA 4MRUA 1N11A 2KCLA 4JHRA 3UI2A 2BTDA 4FJYA 3FUKA 1O1TA 1B89A 2E0IA 3QC1A 5ENTD 2R17C 3SHFA 2CFUA 3UM0A 4ANUA 3CQGB 2ONDA 4K0RA 5CEAA 3HIZA 3C3OA 3U66A 2WQHA 4LEUA 4HLEA 3MCXA 5ITZF 4J8SA 3DSXA 3Q73A 4J0UA 1H6PA 3EIQC 1TNZA 1E7UA 2L0TB 1UN8A 3UT8A 1NI1A 1OCCE 1YA0A 1IQRA 4WWPA 3HVEA 4Y6CA 3JCKC 3ZN3A 4HS2A 2ZU6B 4AV7A 4N3BA 2PQRA 5AN8A 3PZ4A 4HOTA 5FWQA 3E34A 2XS1A 1U2VG 3GZ2A 3CVWA 3FEXA 1AP7A 4LRZA 3APFA 5G05J 4EQFA 2A4ZA 1X81A 3ASHA 2Y4TA 2V8SE 3MJWA 3LPZA 4GZ6A 3NF1A 4KYOB 4APFA 3PE4A 3W9FA 4Q94A 3BU8A 4R7LA 4UI9C 4A3VA 2XGOA 3PRZA 2GROB 5BT1A 4PS7A 3B7RL 3SF4A 4U07A 2V4HC 4G23A 3UKUG 2LUHA 3RRUA 4TXQA 2HO1A 3CVXA 3RRNB 2Y1LE 4FULA 5ARFA 3B7UX 1OY3D 3LVQE 1JCRA 2M63A 2XZDG 4I43A 3W9GA 3FHEA 4JC8A 2AXUA 4B8AA 3MYVA 2MYOA 2NYJA 2H6HA 2IQCA 2WVIA 1ZB1A 5EIBE 1IYGA 3Q49B 2BKGA 3OTNA 4GZ5A 3TXMA 3V30A 3AU5A 5AQBA 3ZIMA 4F53A 1WAO1 2VGXA 4A55A 1SZAA 4U95D 4D10C 3HRAA 4FHKA 4FA6A 5T4YA 3N71A 3DPDA 3IKOB 4BY6A 3I3NA 4N2SA 4HRLA 4DK5A 4EZLA 4NRHB 4UQZA 4G8LA 4G24A 3NOGD 1OWPA 2IO3C 2IF4A 4DI4A 4L23A 2XRZA 2RFMA 3SBSA 3PVLA 4U0UA 3MKQB 3Q9UC 4MKTA 2WQ7A 3FUEA 4ATGA 4HRNA 3PH0C 5LX8A 3T8KA 4WAFA 3GZSA 1SW6A 3MKQA 4L2LA 1XNFA 1YYHA 4B93B 4CEMA 3CHSA 4ZHBA 3D9IA 5A7DB 1INZA 2FULA 1Z3XA 4ILGA 3ESLA 1SA5A 2IU1A 4XX5A 3OXLA 1QZ2A 4QQIA 3FUHA 3DSUA 3FU5A 2I1JA 2F37A 4GTMA 4EZKA 3FTXA 4HRMB 3U3WA 1S0PA 2KBXA 3MKRA 4U7EB 2H6GA 4GB9A 2V0PA 4UWHA 1TN7A 1QBQA 2BKKB 2VGEA 3I5PA 5BUZA 1N94A 2OCCE 4I9EA 4C0EA 1FVFA 1OCOE 2KCVA 2OVFA 3UT4A 1TYQG 2FEZA 3EHNA 4GMLA 1L5JA 4WNDA 4AY5A 2VQ2A 2WPVA 4OAVB 4GPKA 1K1AA 3FTWA 2PNNA 4GYOA 3AS8A 3ZRHA 1HZ4A 3CR3A 2DBAA 3OAWA 3ULQA 4H7YA 4ILIA 5AENA 1TNUA 1JPLA 2J4DA 3DEOA 4K5AB 3UTMA 3JUIA 1KT0A 4Q69A 4FJZA 2YHEA 4BX9A 3ZXPA 1FT1A 2CHZA 2XPIA 4QFVA 4TUMA 1H2UA 1OWOA 2EQXA 2CG3A 2DYRE 3L6AA 4M7CA 2LXLA 3UX4A 1Z3YA 2B0OE 2FF4A 4AEZC 1Q2ZA 4F3VA 2BEDA 2ETCA 3CKCA 3UMVA 3OXFA 1VDYA 5EIDA 4BTBA 4DX2A 2BUGA 1OWNA 1OCZE 4I1OB 4Y6WA 2E2EA 3TWXA 1JCSA 1O1SA 3LDZA 5A6CA 4KZCA 1G3NB 1DNPA 4CGWA 4M3OA 4BSZB 4AJWA 3NBNB 3MV2B 4J8FA 2EILE 3CVLA 4BERA 3O4ZA 3OXGA 4HXIA 2FO7A 2L6JA 3Q5MA 2Y4UA 1BI8B 5JHAA 4JB8P 5CRVA 2OEVA 4GTSA 2F0YA 4MBGA 3FU3A 3FH8A 4A1SA 3V79K 5ENSD 5KCMA 2UWJG 1NA3A 4UWLA 2P2CP 1UJKA 5HS0A 3L9TA 2V5FA 3TWRA 2VSNA 4XKBA 1E8WA 3D9JA 4MLPA 2P9UG 3TXNA 3TWTA 2DVWA 3CHOA 4A1GA 1N9AA 1S70B 4XI9A 2Y0BG 3EHMA 4ZFHA 3ZXSA 3PZ1A 1OCRE 3PS6A 5BPPA 3KSQA 3DBSA 4KVOA 2KXPC 4GYWA 2XEVA 4MS6A 5ENNA 2RG8A 2YNQA 4GTTA 1PAQA 3CSTA 2MRIA 4G1TA 4I1MA 1QQEA 3U9WA 4YDEA 4FLHA 4WNEA 2KATA 5G2NA 1OWMA 4AOFA 4LSZE 5D0QD 3GZ1A 3Q9NC 1K1BA 5FZRA 3B7BA 3UPVA 2VSYA 3L54A 2XRYA 2QFCA 4JPSA 1DC2A 4HQDA 3QARA 3PUKA 3O48A 5JJ7A 3CLJA 2IONA 4OVUA 3D9MA 3ZW3A 4G8KA 2L9BA 3Q75A 2A5UA 3QWVA 5KNGA 3QWPA 4I6GA 4PH4B 2LO6A 4CYMD 4NACA 3DRAA 4N3AA 3QB2A 4I6JA 4KZ0A 4Z68A 3J5PA 3ZNGA 2XCBA 2WXRA 5LCWC 3HDXA 3DEPA 2XENA 1AWCB 3GW4A 5FQ7A 4GTRA 2IOSA 2XEEA 2GRNB 3G2WA 4O6FA 5AJLA 1MQSA 1EDUA 2IEJA 4XIFA 1ZBPA 2GRRB 3CQCB 4JXTA 4U8YD 4EBAA 4JA7A 2YQ8A 2AW6A 5HKPA 2AXVA 4TXPA 1WY6A 2H6IA 3FTZA 3AAAC 1KLXA 1BU9A 3BUAA 5T8IA 3TWWA 3JQ1A 4ILHB 4LNBA 2C2LA 1HE8A 4GAAA 1GW6A 3ML9A 2X6IA 2P9LG 4YDYA 2J07A 2HE0A 4U96D 3BEEA 4RLYA 3AS5A 4HOSA 3ISMC 3RAUA 2R5SA 3KEAA 4BTAA 2V4LA 1WM5A 3DSSA 3EDTB 1YMPA 1K3ZD 3EUVA 4J8YA 2ZGDA 3UM2A 4RG6A 4DLOA 3ESKA 3HXCA 3EU5A 4A63B 3HXDA 5IY5E 5HRYA 1ELKA 3LYAA 3VTYA 3C98A 3JXIA 3ZKJA 2X3MA 3MX3A 5FINA 1P5QA 2JABA 2WXQA 5D66A 3CHQA 3CSFA 3CVUA 2XS8A 3PREA 2QY7A 3QKYA 3ZYKA 2HYZA 1FCHA 3Q4AB 2LAHA 1N0RA 5CEDB 1JUQA 5M72A 3T5XA 2WXIA 2WMOA 2C0MA 3C5RA 3FUIA 2NC9A 1ELRA 5AIJA 3ZFWA 4HOUA 5G04J 1N4QA 1H19A 5BNWA 3Q47B 2PM6A 2MHKA 1EPUA 2DZNA 2J9QA 4F7AA 3R7QA 4HI9A 4HLLA 3JUEA 2IY0C 5AQ7A 1N52A 2BF0X 3AG3E 2P58C 1KZOA 1HS6A 1H2VC 4GZ3A 3PZDA 1UG3A 4U0SA 2EIKE 1JWFA 2XPZA 4RG9A 4FC8A 1IXVA 3BG1B 2J49A 1E7VA 3X2QE 3G2UA 2Y69E 1Z5SC 3PEUB 4JVSA 1Z6TA 2ZIRA 3WG7E 4JZYA 2V5QC 4U0ZA 2J08A 3NQPA 3SQVA 1V54E 1TNYA 4CCAA 4GZDA 1A5EA 4KXKB 2B6CA 4DX1A 1IHGA 1Y6IA 2R59A 5KBAA 4IULA 4PUCA 1HH8A 4TXRA 3DXKG 3FUMA 3FDHA 3L08A 4ACLA 1NZNA 4UWFA 3B13A 1DVPA 2LSVA 5FZSA 3V31A 4U04A 4GYYA 2PQNA 4F1SA 3G2SA 2GRMA 2ETAA 4ABNA 2KZTB 1MX4A 4EZJA 3TG5A 3D9KA 3IV0A 3RIBA 3Q15A 3ZYQA 4EPZA 3R9MA 1N54A 1TJFA 2HM8A 1E90A 5FQ4A 2ZISA 5ENPD 3TWQA 3ZGQA 4FU3A 3UQ3A 4N5QA 5JA4D 1OWLA 2IOLA 2KC7A 3MA5A 2X6KA 3MZLB 4B8CB 1LF8A 4L7TA 1IQUA 2YINA 4UI9J 5FQ6A 4BETA 4V3IA 2P9IG 4GTOA 1TNBA 4GCOA 5EILA 4NURA 1TN8A 1Y8MA 2HR2A 2OV8A 1U3CA 1UN9A 3ZHEB 2FBNA 3G2VA 2VJ8A 1HG5A 1EF1C 1N0QA 4O60A 4J8EA 5EX0A 3RU0A 3HHMA 3TWVA 3IBEA 2X6HA 4LNGA 3PNTB 5CHEE 2QYJA 3ZHEA 4WWNA 1O1RA 5J90A 3ASGA 2P9NG 4FLBA 4A3TA 3ABLE 1H0AA 4G11A 4IYPA 3VLFA 2WXJA 1QYMA 3AS4A 4HVBA 3E32A 4FADA 4JHJA 4HB5A 3CVQA 5KJMA 1N4PA 1N95A 4DLQA 2PL2A 2R02A 1MX2A 3QJZA 2GW1A 3FH5A 4UWGA 3Q78A 3TJPA 3HYMB 1FT2A 3KAEA 3QK0A 2QZAA 4PDXA 3VLDA 2ETBA 4H7XA 3SGHA 2EIME 2JEKA 1E8YA 3FEYA 2NSZA 3EIJA 3F6QA 1BPOA 3P1UA 3AJIA 4HNAD 3ASOE 4XI0A 4WNGA 2AXZA 4EECA 3ASDA 3SNXA 3K9IA 3SO8A 4I9CA 3SFXA 3JXJA 2DWZA 3IXEA 4UUCA
chains in the Genus database with same CATH topology
1TNYA 4LNGA 3PZ2A 1LTXA 3DSXA 4GTPA 3Q73A 1O1RA 3HXEA 3Q79A 1TNOA 1JCRA 1TNZA 4GTRA 1FT1A 1O5MA 2R2LA 1TN6A 1N9AA 1SA5A 2H6HA 1NI1A 3E32A 3KSLA 2IEJA 3PZ1A 3DSWA 1JCQA 4L9PA 2BEDA 1DCEA 3KSQA 3DSUA 4EHMA 4YDOA 3HXBA 1N4QA 3SFYA 3E37A 2H6FA 4GTMA 2H6IA 3PZ4A 1N4PA 4GTVA 4GTTA 1N95A 3E33A 3PZ3A 3E34A 1JCSA 1O1SA 1KZPA 4YDEA 1S64A 3DSVA 2H6GA 2ZISA 1N4RA 1MZCA 1D8EA 1KZOA 1TN7A 1QBQA 1NL4A 3Q78A 1FT2A 1FPPA 4LNBA 1LD7A 1N94A 3HXFA 3DPYA 1X81A 3C72A 3Q7FA 1S63A 3DSTA 3Q7AA 1TNUA 1O1TA 3DSSA 3E30A 4GTQA 4GTOA 3EUVA 1TNBA 1N4SA 1LD8A 4GTSA 1TN8A 1SA4A 2F0YA 4MBGA 3HXCA 1D8DA 3EU5A 3SFXA 2ZIRA 3HXDA 3Q75A 3DRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNY A;  4LNG A;  3PZ2 A;  1LTX A;  3DSX A;  4GTP A;  3Q73 A;  1O1R A;  3HXE A;  3Q79 A;  1TNO A;  1JCR A;  1TNZ A;  4GTR A;  1FT1 A;  1O5M A;  2R2L A;  1TN6 A;  1N9A A;  1SA5 A;  2H6H A;  1NI1 A;  3E32 A;  3KSL A;  2IEJ A;  3PZ1 A;  3DSW A;  1JCQ A;  4L9P A;  2BED A;  1DCE A;  3KSQ A;  3DSU A;  4EHM A;  4YDO A;  3HXB A;  1N4Q A;  3SFY A;  3E37 A;  2H6F A;  4GTM A;  2H6I A;  3PZ4 A;  1N4P A;  4GTV A;  4GTT A;  1N95 A;  3E33 A;  3PZ3 A;  3E34 A;  1JCS A;  1O1S A;  1KZP A;  4YDE A;  1S64 A;  3DSV A;  2H6G A;  2ZIS A;  1N4R A;  1MZC A;  1D8E A;  1KZO A;  1TN7 A;  1QBQ A;  1NL4 A;  3Q78 A;  1FT2 A;  1FPP A;  4LNB A;  1LD7 A;  1N94 A;  3HXF A;  3DPY A;  1X81 A;  3C72 A;  3Q7F A;  1S63 A;  3DST A;  3Q7A A;  1TNU A;  1O1T A;  3DSS A;  3E30 A;  4GTQ A;  4GTO A;  3EUV A;  1TNB A;  1N4S A;  1LD8 A;  4GTS A;  1TN8 A;  1SA4 A;  2F0Y A;  4MBG A;  3HXC A;  1D8D A;  3EU5 A;  3SFX A;  2ZIR A;  3HXD A;  3Q75 A;  3DRA A; 
#chains in the Genus database with same CATH topology
 3PZ2 A;  4B0Z A;  5CMY A;  1LTX A;  5C2Y A;  3L17 A;  1OUV A;  1WDY A;  3UKR G;  4I2W A;  5B1B E;  5KWD A;  1MJ0 A;  3ZVV A;  2GRP B;  1OT8 A;  2KM4 A;  1KPS B;  4LCT A;  4AY6 A;  1PC2 A;  2I6H A;  3B95 A;  3LJ3 A;  1D9S A;  1U3D A;  4B94 A;  2WXP A;  5AAO A;  3LY9 A;  3LEW A;  4TUU A;  3TG4 A;  3U4T A;  2CHW A;  3JYS A;  2WM9 A;  2MOW A;  3UM3 A;  5JJT A;  3LJN A;  2PZI A;  3L13 A;  3IHV A;  4G26 A;  2EIJ E;  5FZQ A;  4NQ0 A;  1JWG A;  1SQM A;  4U8V D;  1UOH A;  3GYZ A;  2PM7 A;  1E96 B;  4J6I A;  5DBK A;  2DIW A;  4GCN A;  2QC9 A;  3Q7A A;  5G05 C;  2WXM A;  3L82 A;  3QOU A;  3ONK A;  3D9P A;  3KD7 A;  2DYS E;  3SBT B;  2J4B A;  3KEZ A;  3V2O A;  3E30 A;  4GTQ A;  2XQ0 A;  3S2A A;  4BT9 A;  1LD8 A;  3D3M A;  4DI3 A;  2AJA A;  1HFA A;  2XGS A;  2XEH A;  4CDN A;  1MX6 A;  3ZPJ A;  3LXU X;  4J7W A;  1E8Z A;  4KMO A;  5T3R A;  3CK9 A;  4HFG A;  3ENE A;  3VTX A;  4F6R D;  3E4B A;  5CEC B;  3FU0 A;  2X38 A;  3UXG A;  2XCC A;  3FWV A;  4E6H A;  2VGY A;  3QDN A;  3WXX A;  2FI7 A;  4DPR A;  5G55 A;  5JJ6 A;  1TN6 A;  2DZO A;  1IKN D;  4JW1 A;  5E76 A;  3LY8 A;  2XHE A;  5FT9 A;  4EBA G;  2DCP A;  4L9P A;  3LVR E;  3ONL A;  4K5B A;  3ASF A;  4CDR A;  5AAR A;  4F1P A;  2H6F A;  4KBQ A;  1FVH A;  2FO1 E;  3NAW A;  3VLE A;  3CV0 A;  4P29 A;  5CCL A;  1MZC A;  4UQY A;  4I6E A;  2I1K A;  4BSX A;  4I1A A;  4UI9 K;  3ASN E;  4YVO A;  2CFZ A;  3DPY A;  3T8M A;  3C72 A;  4L2Y A;  2LNI A;  3TGO A;  1OXJ A;  5EKQ D;  3FU6 A;  3ML8 A;  2CG2 A;  4WNF A;  4JEU A;  1ZU2 A;  2VTB B;  2XGM A;  3HVE B;  3MEK A;  1IHB A;  1SVX A;  3DWL G;  5CRU A;  1SZ9 A;  4GMJ A;  3CKB A;  5FTP A;  2VTB A;  4IN3 B;  1DCQ A;  2OOE A;  3DXM G;  1V55 E;  4ANW A;  3L16 A;  4C9B B;  2AWI A;  4GTP A;  3HXE A;  3Q79 A;  2WMN A;  4O1O A;  5LFA A;  1NA0 A;  2UY1 B;  4APO A;  2R2L A;  4YVQ C;  3J5Q B;  2QYU A;  2X6J A;  4U63 A;  3URZ A;  3CHM A;  4LNU D;  3NOC D;  5CBO A;  1TJC A;  3DSW A;  2UY1 A;  1DCE A;  3ZU7 B;  4HOQ A;  4CT0 A;  2P9S G;  2F8X K;  1H2T C;  4RVB A;  2WXH A;  2VSX E;  1YCS B;  3G2T A;  4PS8 A;  4DUI A;  3CHR A;  3CVY A;  2RFA A;  1KZP A;  1ELW A;  4CZ2 D;  5B1A E;  3D9O A;  5AYW D;  4UWK A;  3SZ7 A;  1FPP A;  3SI5 A;  2R03 A;  2Q7F A;  4ANX A;  3Q7F A;  5BV1 A;  3FH7 A;  3NZU A;  4KT6 B;  5FJY A;  5ENR D;  3PDN A;  1TR4 A;  3CIA A;  4LG6 A;  3I4G A;  1N4S A;  3CK8 A;  2WB2 A;  1HXI A;  4GA0 A;  3AG2 E;  3RK6 A;  2XPY A;  2WXK A;  1W3B A;  2CHX A;  3L22 A;  4XEI G;  4YDW A;  5LCW J;  2P9K G;  2VGX B;  3ZEF A;  2EIN E;  5EX3 A;  3IHY A;  3FUJ A;  2VYI A;  3NZS A;  2P9P G;  5DIZ A;  4JA9 A;  3S7B A;  4OYS A;  3S7J A;  1H6O A;  1MYO A;  5HQ8 A;  3APD A;  4URK A;  3AG1 E;  5EN5 D;  4BT8 A;  2C0L A;  4YND A;  2I9C A;  4L1B A;  5FQ8 A;  4HI8 A;  4BEP A;  3RO2 A;  3RRM B;  5D2M C;  5ARG A;  5BV0 A;  2WXO A;  2L6B A;  4OAU C;  2A5E A;  3E33 A;  1UJJ A;  1MHQ A;  4CRW A;  1UW4 B;  1HU3 A;  4I2Z A;  3B7T A;  4GU5 A;  1N4R A;  4B89 A;  4K03 A;  4AVX A;  4C48 B;  5AJD A;  5B3S E;  3RO3 A;  1H6K A;  3QAQ A;  4TV3 A;  3P2B A;  4CGV A;  4DX5 D;  3CK7 A;  4ACK A;  5CCM A;  2Y3A A;  2KZT A;  3ABM E;  4HBD A;  3FUD A;  5ANL A;  3TWS A;  4I17 A;  3R7R A;  4JHK A;  4NIK A;  3R9A B;  4AP2 A;  3S7F A;  4LER A;  3PE3 A;  3AG4 E;  1SA4 A;  4JD2 G;  4E85 A;  2VSO E;  2LAI A;  2X6F A;  1D8D A;  2WQ6 A;  3TAX A;  3CEQ A;  4TRQ A;  2LXM A;  2GRL A;  4CDM A;  3ZUV B;  4DRX E;  3EJN A;  4XE0 A;  5KJL A;  3FFL A;  3IEG A;  5H7P A;  4JEH A;  4AIF A;  4ANV A;  1RW2 A;  3NB2 A;  3LY7 A;  4BX8 A;  2LSU A;  2F8Y A;  2JLB A;  3EHQ A;  3B7S A;  3PEV B;  5J08 A;  4G2V A;  5AQA A;  4EHM A;  4YDO A;  3FTU A;  2RD0 A;  5CBN A;  3MGB A;  2WXF A;  4O1P A;  3T9K A;  1NP7 A;  4BWR A;  3BG0 B;  2IFU A;  5AQ9 A;  3C3Q A;  5A23 A;  2RKK A;  4BFR A;  5ANR A;  5FIO A;  4GA2 A;  1BLX B;  4N2Q A;  1NL4 A;  3I4R B;  5JHB A;  3UUX A;  4N5C A;  3HXF A;  4RQI A;  1HX8 A;  2WXG A;  5EYP F;  3DST A;  3U64 A;  4DJA A;  3ZYM A;  3CGH A;  3LCA A;  4U8H A;  5LOZ A;  3UIO C;  3RJV A;  4C0M A;  5KJN A;  3ULY A;  3ABK E;  3V2X A;  1X5B A;  4WWO A;  1PY1 A;  3RSE G;  2J09 A;  2OVB A;  1HF8 A;  3C3R A;  4J8D A;  4RSY A;  3D9H A;  1KT1 A;  5D0O D;  4G25 A;  3CVN A;  4ME2 A;  5CMW A;  1O5M A;  3CVV A;  3S7D A;  1TEZ A;  4GZC A;  3FUN A;  1EYH A;  5KJK A;  5C1D A;  2XZT G;  2IJG X;  4PS3 A;  3KSL A;  3TWU A;  2AVP A;  2KCK A;  4IRU A;  4N39 A;  2WXN A;  3TL5 A;  4FP7 A;  3SFY A;  4N3C A;  5BXU A;  3E37 A;  3D9N A;  1NFI E;  1RZ4 A;  4GPM A;  3JQ0 A;  4JL0 A;  5JMN D;  3DSV A;  1XGW A;  4AXH A;  3FP3 A;  3RKV A;  1S63 A;  1BD8 A;  2WXL A;  5BW8 C;  2NXP A;  4DX6 D;  2ILR A;  5EYL A;  1WG0 A;  3FUF A;  2OEW A;  3CHP A;  2L0I A;  4FHJ A;  5HI7 A;  3EHR A;  1HG2 A;  5E75 A;  1A17 A;  4Q96 A;  4WUY A;  1E8X A;  3BQO A;  3SD5 A;  1BI7 B;  4X8Q A;  2IO2 C;  4DX7 D;  5CER B;  2ZGG A;  5ENQ D;  3AU4 A;  5BXO A;  4K5C A;  3HG0 D;  4OVV A;  4CT4 A;  3FTY A;  3UM1 A;  3FTV A;  4XZ4 A;  1TNO A;  3SFZ A;  5EDS A;  4AM9 A;  3KS2 A;  3LS8 A;  3QNK A;  2GGF A;  4ATZ D;  5LP0 A;  3D9L A;  4GA1 A;  4GMR A;  3CVP A;  3SY2 A;  2YHC A;  3MV3 B;  3LKU A;  3UIN C;  2I2O A;  1JCQ A;  3EU9 A;  4XKC A;  4BES A;  3PUJ A;  1K8K G;  3UT7 A;  3HXB A;  3ULE G;  5ENO D;  3ZYL A;  3T5V A;  4HOR A;  3FY4 A;  4GTV A;  5G04 C;  3PZ3 A;  4LUN U;  3UIP C;  2R05 A;  4UQX A;  3FUL A;  1HO8 A;  4KVM A;  1S64 A;  3QWW A;  1D8E A;  2ZXW E;  5KNH D;  2J8S D;  1LD7 A;  3PNL B;  2GRQ B;  3FTS A;  1QNF A;  4W9R A;  3APC A;  4MRU A;  1N11 A;  2KCL A;  4JHR A;  3UI2 A;  2BTD A;  4FJY A;  3FUK A;  1O1T A;  1B89 A;  2E0I A;  3QC1 A;  5ENT D;  2R17 C;  3SHF A;  2CFU A;  3UM0 A;  4ANU A;  3CQG B;  2OND A;  4K0R A;  5CEA A;  3HIZ A;  3C3O A;  3U66 A;  2WQH A;  4LEU A;  4HLE A;  3MCX A;  5ITZ F;  4J8S A;  3DSX A;  3Q73 A;  4J0U A;  1H6P A;  3EIQ C;  1TNZ A;  1E7U A;  2L0T B;  1UN8 A;  3UT8 A;  1NI1 A;  1OCC E;  1YA0 A;  1IQR A;  4WWP A;  3HVE A;  4Y6C A;  3JCK C;  3ZN3 A;  4HS2 A;  2ZU6 B;  4AV7 A;  4N3B A;  2PQR A;  5AN8 A;  3PZ4 A;  4HOT A;  5FWQ A;  3E34 A;  2XS1 A;  1U2V G;  3GZ2 A;  3CVW A;  3FEX A;  1AP7 A;  4LRZ A;  3APF A;  5G05 J;  4EQF A;  2A4Z A;  1X81 A;  3ASH A;  2Y4T A;  2V8S E;  3MJW A;  3LPZ A;  4GZ6 A;  3NF1 A;  4KYO B;  4APF A;  3PE4 A;  3W9F A;  4Q94 A;  3BU8 A;  4R7L A;  4UI9 C;  4A3V A;  2XGO A;  3PRZ A;  2GRO B;  5BT1 A;  4PS7 A;  3B7R L;  3SF4 A;  4U07 A;  2V4H C;  4G23 A;  3UKU G;  2LUH A;  3RRU A;  4TXQ A;  2HO1 A;  3CVX A;  3RRN B;  2Y1L E;  4FUL A;  5ARF A;  3B7U X;  1OY3 D;  3LVQ E;  1JCR A;  2M63 A;  2XZD G;  4I43 A;  3W9G A;  3FHE A;  4JC8 A;  2AXU A;  4B8A A;  3MYV A;  2MYO A;  2NYJ A;  2H6H A;  2IQC A;  2WVI A;  1ZB1 A;  5EIB E;  1IYG A;  3Q49 B;  2BKG A;  3OTN A;  4GZ5 A;  3TXM A;  3V30 A;  3AU5 A;  5AQB A;  3ZIM A;  4F53 A;  1WAO 1;  2VGX A;  4A55 A;  1SZA A;  4U95 D;  4D10 C;  3HRA A;  4FHK A;  4FA6 A;  5T4Y A;  3N71 A;  3DPD A;  3IKO B;  4BY6 A;  3I3N A;  4N2S A;  4HRL A;  4DK5 A;  4EZL A;  4NRH B;  4UQZ A;  4G8L A;  4G24 A;  3NOG D;  1OWP A;  2IO3 C;  2IF4 A;  4DI4 A;  4L23 A;  2XRZ A;  2RFM A;  3SBS A;  3PVL A;  4U0U A;  3MKQ B;  3Q9U C;  4MKT A;  2WQ7 A;  3FUE A;  4ATG A;  4HRN A;  3PH0 C;  5LX8 A;  3T8K A;  4WAF A;  3GZS A;  1SW6 A;  3MKQ A;  4L2L A;  1XNF A;  1YYH A;  4B93 B;  4CEM A;  3CHS A;  4ZHB A;  3D9I A;  5A7D B;  1INZ A;  2FUL A;  1Z3X A;  4ILG A;  3ESL A;  1SA5 A;  2IU1 A;  4XX5 A;  3OXL A;  1QZ2 A;  4QQI A;  3FUH A;  3DSU A;  3FU5 A;  2I1J A;  2F37 A;  4GTM A;  4EZK A;  3FTX A;  4HRM B;  3U3W A;  1S0P A;  2KBX A;  3MKR A;  4U7E B;  2H6G A;  4GB9 A;  2V0P A;  4UWH A;  1TN7 A;  1QBQ A;  2BKK B;  2VGE A;  3I5P A;  5BUZ A;  1N94 A;  2OCC E;  4I9E A;  4C0E A;  1FVF A;  1OCO E;  2KCV A;  2OVF A;  3UT4 A;  1TYQ G;  2FEZ A;  3EHN A;  4GML A;  1L5J A;  4WND A;  4AY5 A;  2VQ2 A;  2WPV A;  4OAV B;  4GPK A;  1K1A A;  3FTW A;  2PNN A;  4GYO A;  3AS8 A;  3ZRH A;  1HZ4 A;  3CR3 A;  2DBA A;  3OAW A;  3ULQ A;  4H7Y A;  4ILI A;  5AEN A;  1TNU A;  1JPL A;  2J4D A;  3DEO A;  4K5A B;  3UTM A;  3JUI A;  1KT0 A;  4Q69 A;  4FJZ A;  2YHE A;  4BX9 A;  3ZXP A;  1FT1 A;  2CHZ A;  2XPI A;  4QFV A;  4TUM A;  1H2U A;  1OWO A;  2EQX A;  2CG3 A;  2DYR E;  3L6A A;  4M7C A;  2LXL A;  3UX4 A;  1Z3Y A;  2B0O E;  2FF4 A;  4AEZ C;  1Q2Z A;  4F3V A;  2BED A;  2ETC A;  3CKC A;  3UMV A;  3OXF A;  1VDY A;  5EID A;  4BTB A;  4DX2 A;  2BUG A;  1OWN A;  1OCZ E;  4I1O B;  4Y6W A;  2E2E A;  3TWX A;  1JCS A;  1O1S A;  3LDZ A;  5A6C A;  4KZC A;  1G3N B;  1DNP A;  4CGW A;  4M3O A;  4BSZ B;  4AJW A;  3NBN B;  3MV2 B;  4J8F A;  2EIL E;  3CVL A;  4BER A;  3O4Z A;  3OXG A;  4HXI A;  2FO7 A;  2L6J A;  3Q5M A;  2Y4U A;  1BI8 B;  5JHA A;  4JB8 P;  5CRV A;  2OEV A;  4GTS A;  2F0Y A;  4MBG A;  3FU3 A;  3FH8 A;  4A1S A;  3V79 K;  5ENS D;  5KCM A;  2UWJ G;  1NA3 A;  4UWL A;  2P2C P;  1UJK A;  5HS0 A;  3L9T A;  2V5F A;  3TWR A;  2VSN A;  4XKB A;  1E8W A;  3D9J A;  4MLP A;  2P9U G;  3TXN A;  3TWT A;  2DVW A;  3CHO A;  4A1G A;  1N9A A;  1S70 B;  4XI9 A;  2Y0B G;  3EHM A;  4ZFH A;  3ZXS A;  3PZ1 A;  1OCR E;  3PS6 A;  5BPP A;  3KSQ A;  3DBS A;  4KVO A;  2KXP C;  4GYW A;  2XEV A;  4MS6 A;  5ENN A;  2RG8 A;  2YNQ A;  4GTT A;  1PAQ A;  3CST A;  2MRI A;  4G1T A;  4I1M A;  1QQE A;  3U9W A;  4YDE A;  4FLH A;  4WNE A;  2KAT A;  5G2N A;  1OWM A;  4AOF A;  4LSZ E;  5D0Q D;  3GZ1 A;  3Q9N C;  1K1B A;  5FZR A;  3B7B A;  3UPV A;  2VSY A;  3L54 A;  2XRY A;  2QFC A;  4JPS A;  1DC2 A;  4HQD A;  3QAR A;  3PUK A;  3O48 A;  5JJ7 A;  3CLJ A;  2ION A;  4OVU A;  3D9M A;  3ZW3 A;  4G8K A;  2L9B A;  3Q75 A;  2A5U A;  3QWV A;  5KNG A;  3QWP A;  4I6G A;  4PH4 B;  2LO6 A;  4CYM D;  4NAC A;  3DRA A;  4N3A A;  3QB2 A;  4I6J A;  4KZ0 A;  4Z68 A;  3J5P A;  3ZNG A;  2XCB A;  2WXR A;  5LCW C;  3HDX A;  3DEP A;  2XEN A;  1AWC B;  3GW4 A;  5FQ7 A;  4GTR A;  2IOS A;  2XEE A;  2GRN B;  3G2W A;  4O6F A;  5AJL A;  1MQS A;  1EDU A;  2IEJ A;  4XIF A;  1ZBP A;  2GRR B;  3CQC B;  4JXT A;  4U8Y D;  4EBA A;  4JA7 A;  2YQ8 A;  2AW6 A;  5HKP A;  2AXV A;  4TXP A;  1WY6 A;  2H6I A;  3FTZ A;  3AAA C;  1KLX A;  1BU9 A;  3BUA A;  5T8I A;  3TWW A;  3JQ1 A;  4ILH B;  4LNB A;  2C2L A;  1HE8 A;  4GAA A;  1GW6 A;  3ML9 A;  2X6I A;  2P9L G;  4YDY A;  2J07 A;  2HE0 A;  4U96 D;  3BEE A;  4RLY A;  3AS5 A;  4HOS A;  3ISM C;  3RAU A;  2R5S A;  3KEA A;  4BTA A;  2V4L A;  1WM5 A;  3DSS A;  3EDT B;  1YMP A;  1K3Z D;  3EUV A;  4J8Y A;  2ZGD A;  3UM2 A;  4RG6 A;  4DLO A;  3ESK A;  3HXC A;  3EU5 A;  4A63 B;  3HXD A;  5IY5 E;  5HRY A;  1ELK A;  3LYA A;  3VTY A;  3C98 A;  3JXI A;  3ZKJ A;  2X3M A;  3MX3 A;  5FIN A;  1P5Q A;  2JAB A;  2WXQ A;  5D66 A;  3CHQ A;  3CSF A;  3CVU A;  2XS8 A;  3PRE A;  2QY7 A;  3QKY A;  3ZYK A;  2HYZ A;  1FCH A;  3Q4A B;  2LAH A;  1N0R A;  5CED B;  1JUQ A;  5M72 A;  3T5X A;  2WXI A;  2WMO A;  2C0M A;  3C5R A;  3FUI A;  2NC9 A;  1ELR A;  5AIJ A;  3ZFW A;  4HOU A;  5G04 J;  1N4Q A;  1H19 A;  5BNW A;  3Q47 B;  2PM6 A;  2MHK A;  1EPU A;  2DZN A;  2J9Q A;  4F7A A;  3R7Q A;  4HI9 A;  4HLL A;  3JUE A;  2IY0 C;  5AQ7 A;  1N52 A;  2BF0 X;  3AG3 E;  2P58 C;  1KZO A;  1HS6 A;  1H2V C;  4GZ3 A;  3PZD A;  1UG3 A;  4U0S A;  2EIK E;  1JWF A;  2XPZ A;  4RG9 A;  4FC8 A;  1IXV A;  3BG1 B;  2J49 A;  1E7V A;  3X2Q E;  3G2U A;  2Y69 E;  1Z5S C;  3PEU B;  4JVS A;  1Z6T A;  2ZIR A;  3WG7 E;  4JZY A;  2V5Q C;  4U0Z A;  2J08 A;  3NQP A;  3SQV A;  1V54 E;  1TNY A;  4CCA A;  4GZD A;  1A5E A;  4KXK B;  2B6C A;  4DX1 A;  1IHG A;  1Y6I A;  2R59 A;  5KBA A;  4IUL A;  4PUC A;  1HH8 A;  4TXR A;  3DXK G;  3FUM A;  3FDH A;  3L08 A;  4ACL A;  1NZN A;  4UWF A;  3B13 A;  1DVP A;  2LSV A;  5FZS A;  3V31 A;  4U04 A;  4GYY A;  2PQN A;  4F1S A;  3G2S A;  2GRM A;  2ETA A;  4ABN A;  2KZT B;  1MX4 A;  4EZJ A;  3TG5 A;  3D9K A;  3IV0 A;  3RIB A;  3Q15 A;  3ZYQ A;  4EPZ A;  3R9M A;  1N54 A;  1TJF A;  2HM8 A;  1E90 A;  5FQ4 A;  2ZIS A;  5ENP D;  3TWQ A;  3ZGQ A;  4FU3 A;  3UQ3 A;  4N5Q A;  5JA4 D;  1OWL A;  2IOL A;  2KC7 A;  3MA5 A;  2X6K A;  3MZL B;  4B8C B;  1LF8 A;  4L7T A;  1IQU A;  2YIN A;  4UI9 J;  5FQ6 A;  4BET A;  4V3I A;  2P9I G;  4GTO A;  1TNB A;  4GCO A;  5EIL A;  4NUR A;  1TN8 A;  1Y8M A;  2HR2 A;  2OV8 A;  1U3C A;  1UN9 A;  3ZHE B;  2FBN A;  3G2V A;  2VJ8 A;  1HG5 A;  1EF1 C;  1N0Q A;  4O60 A;  4J8E A;  5EX0 A;  3RU0 A;  3HHM A;  3TWV A;  3IBE A;  2X6H A;  4LNG A;  3PNT B;  5CHE E;  2QYJ A;  3ZHE A;  4WWN A;  1O1R A;  5J90 A;  3ASG A;  2P9N G;  4FLB A;  4A3T A;  3ABL E;  1H0A A;  4G11 A;  4IYP A;  3VLF A;  2WXJ A;  1QYM A;  3AS4 A;  4HVB A;  3E32 A;  4FAD A;  4JHJ A;  4HB5 A;  3CVQ A;  5KJM A;  1N4P A;  1N95 A;  4DLQ A;  2PL2 A;  2R02 A;  1MX2 A;  3QJZ A;  2GW1 A;  3FH5 A;  4UWG A;  3Q78 A;  3TJP A;  3HYM B;  1FT2 A;  3KAE A;  3QK0 A;  2QZA A;  4PDX A;  3VLD A;  2ETB A;  4H7X A;  3SGH A;  2EIM E;  2JEK A;  1E8Y A;  3FEY A;  2NSZ A;  3EIJ A;  3F6Q A;  1BPO A;  3P1U A;  3AJI A;  4HNA D;  3ASO E;  4XI0 A;  4WNG A;  2AXZ A;  4EEC A;  3ASD A;  3SNX A;  3K9I A;  3SO8 A;  4I9C A;  3SFX A;  3JXJ A;  2DWZ A;  3IXE A;  4UUC A; 
#chains in the Genus database with same CATH homology
 1TNY A;  4LNG A;  3PZ2 A;  1LTX A;  3DSX A;  4GTP A;  3Q73 A;  1O1R A;  3HXE A;  3Q79 A;  1TNO A;  1JCR A;  1TNZ A;  4GTR A;  1FT1 A;  1O5M A;  2R2L A;  1TN6 A;  1N9A A;  1SA5 A;  2H6H A;  1NI1 A;  3E32 A;  3KSL A;  2IEJ A;  3PZ1 A;  3DSW A;  1JCQ A;  4L9P A;  2BED A;  1DCE A;  3KSQ A;  3DSU A;  4EHM A;  4YDO A;  3HXB A;  1N4Q A;  3SFY A;  3E37 A;  2H6F A;  4GTM A;  2H6I A;  3PZ4 A;  1N4P A;  4GTV A;  4GTT A;  1N95 A;  3E33 A;  3PZ3 A;  3E34 A;  1JCS A;  1O1S A;  1KZP A;  4YDE A;  1S64 A;  3DSV A;  2H6G A;  2ZIS A;  1N4R A;  1MZC A;  1D8E A;  1KZO A;  1TN7 A;  1QBQ A;  1NL4 A;  3Q78 A;  1FT2 A;  1FPP A;  4LNB A;  1LD7 A;  1N94 A;  3HXF A;  3DPY A;  1X81 A;  3C72 A;  3Q7F A;  1S63 A;  3DST A;  3Q7A A;  1TNU A;  1O1T A;  3DSS A;  3E30 A;  4GTQ A;  4GTO A;  3EUV A;  1TNB A;  1N4S A;  1LD8 A;  4GTS A;  1TN8 A;  1SA4 A;  2F0Y A;  4MBG A;  3HXC A;  1D8D A;  3EU5 A;  3SFX A;  2ZIR A;  3HXD A;  3Q75 A;  3DRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...