1NL4A

Crystal structure of rat farnesyl transferase in complex with a potent biphenyl inhibitor
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Novel and Selective Imidazole-containing Biphenyl Inhibitors of Protein Farnesyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 125
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1nl4A00
1N4SA 1QBQA 1KZOA 1TNZA 4GTRA 2R2LA 4EHMA 1N4QA 3KSLA 1O1RA 1TNUA 1JCSA 1X81A 3PZ3A 4MBGA 1FT2A 1DCEA 3HXBA 3Q73A 1S63A 2ZISA 3E32A 3DSXA 2H6HA 4LNGA 1FT1A 2BEDA 3DSWA 3EUVA 4GTQA 1LD8A 3Q7FA 3Q75A 1TN6A 1D8DA 2H6IA 1S64A 3DRAA 1D8EA 3EU5A 1TNBA 3DSVA 4L9PA 1TN7A 1TNYA 1FPPA 3DSTA 1N9AA 3E33A 3PZ2A 3Q79A 3PZ4A 4GTVA 1SA4A 1N95A 1NL4A 2H6GA 3HXFA 4LNBA 3PZ1A 3DSUA 4GTSA 3HXCA 2H6FA 1TNOA 3Q78A 3DSSA 4GTPA 1O1TA 1N4PA 3HXDA 3E30A 4YDEA 1JCQA 1LD7A 3DPYA 4YDOA 1KZPA 3E34A 1O1SA 4GTOA 1NI1A 3SFXA 2IEJA 4GTMA 1N4RA 1N94A 1O5MA 3HXEA 3C72A 1LTXA 3SFYA 1MZCA 3E37A 4GTTA 3KSQA 2ZIRA 1SA5A 3Q7AA 1TN8A 1JCRA 2F0YA
chains in the Genus database with same CATH superfamily
2BKGA 5HKPA 5D66A 4FHKA 3U66A 2XQ0A 3LDZA 1A17A 5B1AE 3FTUA 2R59A 3AS5A 1TNZA 2R2LA 3TWSA 4B94A 3TWRA 2GRNB 3D3MA 5CECB 2ONDA 3MKQB 5ANRA 3O48A 2J49A 2V4LA 2C2LA 5BXOA 2ETBA 3DBSA 2R5SA 3D9PA 4G26A 3IKOB 3VTYA 4ILGA 3VLFA 3SZ7A 2DIWA 1K1BA 2IU1A 1TN7A 2OEVA 2LSUA 5H7PA 3J5PA 3QNKA 3SNXA 1FVHA 3CHOA 3PH0C 3FEYA 3B13A 1OWLA 3HXCA 4HVBA 1OCCE 3EJNA 3CVNA 4GA0A 3ESLA 2HM8A 1UG3A 4M3OA 2L9BA 4NIKA 3TWTA 1TEZA 3MZLB 4DPRA 4GTOA 3AG1E 3IBEA 4GYWA 3CIAA 2WXRA 2IOLA 2GRLA 4HOUA 2VJ8A 5JHBA 5EIDA 1KT1A 4A1GA 5B1BE 2F0YA 4FJZA 5CBNA 5ENRD 2LNIA 2AXZA 3MGBA 4GZDA 1BPOA 5FINA 3ZFWA 3EU9A 4N3AA 2XPYA 4WUYA 4UWFA 4YVOA 1DCEA 3TAXA 3HXBA 4NRHB 2Y3AA 2ZISA 3CHPA 4J7WA 4LNGA 5EKQD 4FULA 3HG0D 4GCOA 2EIJE 2Y1LE 2VYIA 3Q7FA 3I4GA 2KM4A 1WY6A 1E8YA 1HG2A 3UM0A 4BY6A 2RG8A 5D0QD 1FPPA 3UUXA 3L17A 3PE4A 5G05J 4NACA 2YQ8A 2WXJA 2BF0X 2UWJG 1NL4A 2XZTG 3F6QA 3CQGB 4C9BB 4XX5A 2WXHA 4GB9A 5HQ8A 2IO2C 5BW8C 4XE0A 5KCMA 3Q78A 3JYSA 2B0OE 4GTPA 4IULA 3TJPA 4PDXA 5LCWJ 3G2VA 4LUNU 2WQ7A 4PS8A 3TL5A 3FU0A 4K5BA 3WXXA 3NOGD 4PH4B 3KEZA 4A1SA 3RJVA 5A23A 2EIME 1H2VC 3Q7AA 3ZHEA 2VGXA 4CDMA 3APDA 2Y4TA 2QC9A 3FWVA 4LERA 1RZ4A 1GW6A 2HR2A 5T8IA 3CEQA 2BKKB 1G3NB 1SVXA 2A5EA 1OT8A 4TXRA 4DUIA 1E90A 4B0ZA 4L2YA 1D8DA 4N5CA 5ENTD 2V0PA 1OUVA 3FUHA 3EU5A 3MV3B 2XS1A 4N5QA 4B8AA 2ZGDA 2PM7A 1B89A 3PE3A 2DBAA 3ESKA 4PS7A 5FQ8A 1JWFA 4GZ6A 2CHXA 3CLJA 5FTPA 1INZA 4RQIA 4CZ2D 4KVMA 2LUHA 3R9AB 3SF4A 3DXMG 1BU9A 1FCHA 4FP7A 4HXIA 2CFUA 2IOSA 3CVPA 4DX6D 4BT8A 3BU8A 4I17A 3ASHA 3KSQA 4DX2A 4RSYA 4UQYA 4HLLA 3HRAA 4ANXA 1JCRA 4ILIA 3CVXA 4WWPA 3CHQA 3VLEA 4L23A 2WXGA 3DXKG 1N4QA 3KSLA 3AG4E 3E4BA 1E8ZA 3FH7A 3TWVA 4OVUA 2NC9A 3MV2B 3FTVA 3NBNB 2FO1E 4A63B 1N0RA 4JW1A 3FFLA 3EUVA 1TR4A 4WWOA 2A5UA 2XHEA 4GZCA 5KWDA 4BTBA 3VTXA 2VSOE 4F6RD 4UUCA 5DBKA 3RO2A 5G05C 3DRAA 1D8EA 4K0RA 3KD7A 1TNBA 4WNDA 4MLPA 1XNFA 1HZ4A 2V5FA 3EHNA 4FJYA 3L54A 2HYZA 2F8YA 4O1PA 5LCWC 3QB2A 2OV8A 1NZNA 1D9SA 2J8SD 3FUIA 1K3ZD 2RKKA 3CVLA 1MYOA 1HFAA 4H7YA 2CFZA 2I9CA 3QAQA 1N4RA 1O5MA 3C72A 2QYJA 4I6JA 4F53A 1MZCA 5ENNA 3B7RL 4Q69A 1NFIE 1SA5A 5ENQD 4TUMA 1OWMA 3TGOA 1HX8A 3KEAA 4Y6WA 4UQZA 4ATZD 3OXGA 1JCSA 2WVIA 3PZ3A 4U04A 2P9IG 4HS2A 3BEEA 4B89A 4DI3A 4J6IA 3QWWA 2WXLA 5KJMA 4G8LA 3S7FA 5AENA 5CMWA 3OXFA 3URZA 2LXLA 5ENPD 4GMRA 4APFA 5AIJA 3UIPC 5KNGA 5C2YA 5KNHD 2XZDG 4HI8A 4FLHA 4GPKA 3D9IA 3HHMA 3V31A 5ITZF 3G2TA 3I5PA 2J09A 5KJLA 3D9JA 3PZ1A 4CEMA 3RSEG 3SQVA 3I3NA 4I6EA 2L6BA 2V8SE 3QKYA 4RVBA 3Q4AB 2GGFA 2WXKA 2FO7A 1LF8A 1KZPA 3U9WA 1WG0A 3BG0B 5AJDA 2IEJA 2JEKA 4DX1A 2AXUA 3LJNA 4EPZA 1AP7A 4CDNA 3FUKA 4CYMD 3V30A 1BI8B 3FY4A 4HQDA 1ZU2A 2C0LA 3NZSA 3QC1A 2DVWA 3FUFA 2P2CP 4O1OA 1ELWA 4J8SA 1QBQA 2Y69E 4U0SA 4HLEA 2WB2A 3AJIA 3PREA 5T3RA 1O1RA 2KCLA 4PUCA 3EHQA 4Z68A 1S63A 2H6HA 1HG5A 5HS0A 4ILHB 5LFAA 3UPVA 2JABA 4HBDA 2CG2A 2EQXA 5CBOA 3Q47B 1S64A 4C48B 3D9LA 1Z3XA 5BUZA 1E8XA 3S7JA 4LRZA 1K8KG 1TNYA 3K9IA 2A4ZA 5AYWD 3OTNA 2MYOA 3UINC 3OAWA 1UN9A 2H6GA 3HXFA 2ZXWE 1N0QA 3V2XA 3ZHEB 4BFRA 4JPSA 3DSSA 2VSYA 4A3VA 4KXKB 2VGXB 3ABLE 5JA4D 1E7UA 3DPYA 4JHJA 3Q15A 2X6HA 1MX4A 4UI9K 3E34A 4N2SA 5EIBE 3BUAA 3SFXA 4EBAG 4GTMA 5FT9A 2XRYA 1N52A 2OVFA 3AU4A 3FU6A 3SD5A 3ZIMA 3AU5A 4IN3B 4K5CA 2OEWA 3AS8A 3LKUA 1IYGA 5FQ6A 3QOUA 1MJ0A 2AW6A 4IYPA 3BQOA 4U7EB 3QJZA 3PNTB 3DPDA 2X6FA 1X5BA 4F1PA 3ZW3A 2VQ2A 4U95D 4AOFA 1H0AA 3IXEA 2NSZA 4UWKA 5JJTA 1FT1A 3FUNA 4CT0A 1HO8A 4TV3A 2NXPA 3V2OA 4HRMB 4U0UA 3G2UA 3JQ0A 3RU0A 4GA2A 2CG3A 5J08A 3L08A 1TJCA 2KXPC 2QFCA 2R05A 1RW2A 1U3CA 4GYOA 2KBXA 3DWLG 4XKBA 1OCZE 1SA4A 2LXMA 3CHMA 3IEGA 4GMJA 4FHJA 3HYMB 4XZ4A 5ANLA 5EILA 2VGEA 4FLBA 3ZVVA 2P9SG 3FU3A 3RRMB 5E76A 1O1SA 3KS2A 5JJ6A 4FA6A 1SZAA 4J8YA 3PS6A 3LY9A 1NA0A 4BSZB 4CDRA 2GROB 4JA9A 1OXJA 1N54A 3UX4A 3IHVA 4AEZC 4L2LA 3ZU7B 1JPLA 1OY3D 1SZ9A 3TWXA 1H19A 4LNUD 1KZOA 4BT9A 3CQCB 3LJ3A 4YNDA 2YHCA 4GA1A 4WNEA 4U8VD 3U64A 2XENA 3T9KA 4CGWA 1MQSA 4FU3A 2Y0BG 3S7DA 5CRVA 4HOQA 3TWWA 4EECA 2LSVA 3FP3A 4YDWA 2I1JA 3EIQC 4KZCA 4OAUC 3PVLA 4DLQA 2GRMA 1QNFA 4C0MA 5CERB 4G2VA 5JJ7A 2IO3C 1EDUA 1V55E 3C3QA 3L9TA 3JXJA 1N95A 1OCRE 2X6KA 5G55A 3DEOA 3CKCA 4PS3A 3MX3A 4BSXA 2P9UG 1O1TA 4JA7A 2R02A 4A3TA 1N4PA 2KZTA 4QFVA 2DYSE 2J9QA 3UT7A 4OVVA 4YDYA 4YDOA 2B6CA 3T5VA 4JEHA 2PNNA 3SBTB 2CHZA 3FUDA 4CT4A 3SGHA 1Y8MA 3S7BA 4V3IA 5HI7A 4I2ZA 3MEKA 1YYHA 2J4BA 4R7LA 5EX3A 3FDHA 1HH8A 3ULYA 3SI5A 4B93B 4EZJA 2NYJA 3FEXA 1KT0A 3CVQA 4RLYA 3HIZA 3L16A 2DYRE 4KYOB 1PY1A 4HRNA 3D9MA 2LO6A 1IKND 5AN8A 2ETAA 3DSWA 2PL2A 3ZYQA 4BESA 3LVQE 5AARA 3AAAC 3FTWA 2XCBA 3ASFA 5AQAA 2H6IA 3NF1A 3DSVA 4G23A 2XPIA 4JHRA 1W3BA 3ZKJA 5BV0A 3PZ4A 4F1SA 3IHYA 2Y4UA 5EYLA 2KC7A 4U63A 2M63A 4JVSA 3E30A 4GMLA 2XS8A 4U0ZA 1DVPA 2P58C 3MKRA 4J0UA 3FTZA 4AXHA 5G2NA 2I2OA 2WXMA 2IONA 4ACLA 3RK6A 4H7XA 4URKA 1UOHA 5LOZA 3E37A 1FVFA 3MJWA 2LAHA 1IHBA 3PZDA 4AM9A 2AWIA 1H6OA 3LPZA 3QWPA 2HE0A 3NB2A 2ZGGA 3TXNA 3V79K 3FU5A 2I1KA 5A6CA 2WQHA 2Q7FA 3QARA 4EHMA 5FZRA 4QQIA 1WM5A 5AQBA 3UM2A 3PUJA 1U2VG 3ISMC 2DZNA 4G11A 4BEPA 5JMND 3UTMA 4JZYA 3DSXA 1SW6A 3D9OA 2HO1A 3AG3E 2BEDA 1QQEA 4WWNA 3UXGA 5DIZA 2P9LG 4ANUA 3CV0A 4L7TA 3LXUX 1HU3A 2EINE 5E75A 4J8DA 2WM9A 3ONKA 3TG5A 2EILE 2XPZA 3ZYKA 1WAO1 1ELRA 3B7SA 3P2BA 4U07A 4ATGA 3PZ2A 3PEVB 3APFA 4D10C 4GTVA 1HS6A 2YNQA 4EBAA 1IHGA 2VSNA 3L22A 3JUEA 3JXIA 4HI9A 1TNOA 3D9KA 4DJAA 4JL0A 1MX6A 3HXDA 2VGYA 3UT4A 2P9PG 1S70B 4X8QA 3RAUA 3U4TA 4I43A 2XGMA 4G8KA 2X6JA 2FI7A 4U96D 3CK9A 3J5QB 2X6IA 4GPMA 5HRYA 3U3WA 2P9KG 1Z3YA 3UM3A 3GYZA 4ACKA 2BTDA 3Q49B 2V5QC 2R03A 1YCSB 1A5EA 2IFUA 3UIOC 3ASOE 4BX8A 1L5JA 2KCVA 4DK5A 2RFMA 3E32A 4I1MA 4AV7A 3LEWA 5BV1A 2WXQA 2WXOA 2IY0C 3ASDA 5J90A 3PUKA 4B8CB 3ULEG 2OCCE 3VLDA 2PQNA 2MOWA 1N9AA 3ASGA 3TG4A 4KZ0A 4BX9A 2PM6A 1AWCB 2WXFA 1UW4B 4JHKA 3LCAA 4XI0A 4N3BA 4P29A 1H2UA 4FC8A 3NQPA 3UQ3A 1OWPA 3R9MA 3AG2E 1EF1C 2UY1A 3P1UA 5BXUA 1TN8A 4KVOA 5FQ4A 4CGVA 1N11A 5KJNA 4AIFA 3ZN3A 1WDYA 3T8MA 4GYYA 3CVUA 2KCKA 1BLXB 3UI2A 1KPSB 3HVEA 3X2QE 4K5AB 3MYVA 5EYPF 4BWRA 1OWOA 3Q73A 4Q94A 3MA5A 1HXIA 1YA0A 2PQRA 1BD8A 3ZUVB 2KZTB 3FTSA 3CKBA 4I2WA 4AY6A 3CSFA 4UQXA 2WXIA 2E0IA 4MS6A 1ZB1A 3ML8A 3C5RA 2AVPA 5FZSA 2LAIA 2WQ6A 3KAEA 3L13A 4UWLA 2GRPB 1Z5SC 3RRUA 3PEUB 3ONLA 4LNBA 4JB8P 3DEPA 4N2QA 2IF4A 1H2TC 5M72A 4GTSA 4DX7D 5D2MC 3I4RB 4U8HA 3LYAA 1MX2A 3FH8A 4N39A 2L0IA 2XGSA 3ZEFA 2RD0A 4TUUA 2GRRB 2GW1A 5EN5D 5CRUA 1P5QA 4OAVB 4ZFHA 1YMPA 3ABKE 4LCTA 3UMVA 3C98A 2YINA 3QDNA 2J08A 3B95A 5FJYA 2FF4A 3APCA 3EDTB 4TXPA 2PZIA 3B7BA 3CHSA 5JHAA 4BERA 2F8XK 2DWZA 3PRZA 4GCNA 3NZUA 3EHMA 3ZGQA 2OOEA 4HFGA 3GW4A 3NAWA 4EZKA 3FUJA 2VTBB 3HDXA 4APOA 1K1AA 4Q96A 3EHRA 1IQRA 3CHRA 1BI7B 4NQ0A 5B3SE 1DNPA 4LG6A 5CHEE 3JCKC 3JUIA 4E6HA 2CHWA 2IJGX 1QZ2A 3MKQA 4C0EA 1SQMA 4WAFA 5FQ7A 4DX5D 5LP0A 4UWGA 2JLBA 5CCLA 4YDEA 5BT1A 2DCPA 3ZYLA 3RKVA 4JC8A 4UWHA 3FUEA 4G25A 1DCQA 1EYHA 3AS4A 4XI9A 3ZYMA 3Q9NC 4WNGA 5ARGA 4LEUA 1PC2A 4HOTA 4DI4A 3SY2A 3S2AA 4AVXA 5AQ7A 2QY7A 4FADA 4I1OB 1UJJA 1E8WA 3FTXA 5AQ9A 3ZNGA 4UI9J 4ANVA 4E85A 3SO8A 1TYQG 4N3CA 2X38A 1HE8A 3EIJA 2KATA 4MRUA 3ZRHA 1X81A 2XCCA 1NA3A 4I9CA 5A7DB 4JXTA 2FEZA 2ILRA 2J4DA 4OYSA 3WG7E 4F3VA 1ELKA 3T5XA 4EZLA 4M7CA 4GTQA 5CEAA 3NOCD 3Q75A 1TN6A 4DRXE 3W9GA 4BETA 3SBSA 4MKTA 3CK7A 1OCOE 1KLXA 4L9PA 3CGHA 5ENOD 2XRZA 3FTYA 3L6AA 3E33A 3ML9A 3CR3A 3L82A 4W9RA 2H6FA 4TRQA 4RG9A 5D0OD 3LS8A 3LY7A 3RO3A 3TXMA 1JCQA 2YHEA 5BPPA 1UJKA 3CVYA 1XGWA 4YVQC 4XEIG 2E2EA 3HXEA 3TWUA 1LTXA 4WNFA 3SHFA 4ZHBA 2VTBA 3O4ZA 3MCXA 4AY5A 5AAOA 4G24A 4O6FA 3CVWA 2V4HC 5FIOA 4KT6B 2C0MA 4CCAA 3RIBA 4J8FA 1EPUA 4HB5A 4EQFA 4O60A 3UT8A 4ABNA 3ASNE 1DC2A 4CRWA 4GU5A 3LY8A 2R17C 5G04J 3W9FA 3BG1B 2RFAA 3GZ2A 3FHEA 2L0TB 1ZBPA 1FT2A 1Q2ZA 3B7TA 1S0PA 5LX8A 2MRIA 5AJLA 1IQUA 1U3DA 2P9NG 2AXVA 2J07A 2XEHA 1NP7A 3OXLA 1E96B 4HNAD 3Q9UC 1LD8A 3QWVA 3ENEA 2ETCA 4AJWA 4U8YD 3ZPJA 1V54E 3ZXSA 4GAAA 4RG6A 4HORA 2FULA 4DLOA 1IXVA 3DSTA 4J8EA 3QK0A 3B7UX 5CCMA 4AP2A 4XIFA 2UY1B 4GZ5A 2WMNA 3CSTA 2FBNA 3FUMA 3FULA 3JQ1A 3ULQA 5FZQA 2QZAA 4K03A 3GZSA 1QYMA 4JEUA 1H6PA 1LD7A 4GZ3A 4ANWA 1Z6TA 3HVEB 3SFYA 4Y6CA 3ABME 3T8KA 4GTTA 5EDSA 4HOSA 5ARFA 1JUQA 3CK8A 4UI9C 4G1TA 1UN8A 3SFZA 2VSXE 1N4SA 1Y6IA 2XEVA 4I9EA 3LVRE 3UM1A 4GTRA 4IRUA 2OVBA 2ZU6B 3D9HA 5IY5E 1VDYA 2WXNA 1MHQA 4HRLA 5C1DA 1TNUA 5CMYA 2IQCA 4MBGA 3UKUG 4NURA 4A55A 3D9NA 5ENSD 3UKRG 4KBQA 5EX0A 5T4YA 3TWQA 2I6HA 2WXPA 2BUGA 2EIKE 5KJKA 5FWQA 1TJFA 4XKCA 3GZ1A 4L1BA 3RRNB 2GRQB 2MHKA 4I6GA 3R7RA 3CVVA 5KBAA 3PNLB 3N71A 3Q79A 3C3OA 3PDNA 2XEEA 1HF8A 3FH5A 3DSUA 2DZOA 2X3MA 3Q5MA 4ME2A 1OWNA 5CEDB 3G2SA 4F7AA 2XGOA 1E7VA 2AJAA 5BNWA 3C3RA 4I1AA 1NI1A 4LSZE 2WMOA 1N94A 3IV0A 1PAQA 3G2WA 3R7QA 4BTAA 2WPVA 2F37A 2ZIRA 2L6JA 2QYUA 1JWGA 4KMOA 5G04C 4JD2G 1H6KA 3ZXPA 4TXQA
chains in the Genus database with same CATH topology
1N4SA 1QBQA 1KZOA 1TNZA 4GTRA 2R2LA 4EHMA 1N4QA 3KSLA 1O1RA 1TNUA 1JCSA 1X81A 3PZ3A 4MBGA 1FT2A 1DCEA 3HXBA 3Q73A 1S63A 2ZISA 3E32A 3DSXA 2H6HA 4LNGA 1FT1A 2BEDA 3DSWA 3EUVA 4GTQA 1LD8A 3Q7FA 3Q75A 1TN6A 1D8DA 2H6IA 1S64A 3DRAA 1D8EA 3EU5A 1TNBA 3DSVA 4L9PA 1TN7A 1TNYA 1FPPA 3DSTA 1N9AA 3E33A 3PZ2A 3Q79A 3PZ4A 4GTVA 1SA4A 1N95A 1NL4A 2H6GA 3HXFA 4LNBA 3PZ1A 3DSUA 4GTSA 3HXCA 2H6FA 1TNOA 3Q78A 3DSSA 4GTPA 1O1TA 1N4PA 3HXDA 3E30A 4YDEA 1JCQA 1LD7A 3DPYA 4YDOA 1KZPA 3E34A 1O1SA 4GTOA 1NI1A 3SFXA 2IEJA 4GTMA 1N4RA 1N94A 1O5MA 3HXEA 3C72A 1LTXA 3SFYA 1MZCA 3E37A 4GTTA 3KSQA 2ZIRA 1SA5A 3Q7AA 1TN8A 1JCRA 2F0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N4S A;  1QBQ A;  1KZO A;  1TNZ A;  4GTR A;  2R2L A;  4EHM A;  1N4Q A;  3KSL A;  1O1R A;  1TNU A;  1JCS A;  1X81 A;  3PZ3 A;  4MBG A;  1FT2 A;  1DCE A;  3HXB A;  3Q73 A;  1S63 A;  2ZIS A;  3E32 A;  3DSX A;  2H6H A;  4LNG A;  1FT1 A;  2BED A;  3DSW A;  3EUV A;  4GTQ A;  1LD8 A;  3Q7F A;  3Q75 A;  1TN6 A;  1D8D A;  2H6I A;  1S64 A;  3DRA A;  1D8E A;  3EU5 A;  1TNB A;  3DSV A;  4L9P A;  1TN7 A;  1TNY A;  1FPP A;  3DST A;  1N9A A;  3E33 A;  3PZ2 A;  3Q79 A;  3PZ4 A;  4GTV A;  1SA4 A;  1N95 A;  1NL4 A;  2H6G A;  3HXF A;  4LNB A;  3PZ1 A;  3DSU A;  4GTS A;  3HXC A;  2H6F A;  1TNO A;  3Q78 A;  3DSS A;  4GTP A;  1O1T A;  1N4P A;  3HXD A;  3E30 A;  4YDE A;  1JCQ A;  1LD7 A;  3DPY A;  4YDO A;  1KZP A;  3E34 A;  1O1S A;  4GTO A;  1NI1 A;  3SFX A;  2IEJ A;  4GTM A;  1N4R A;  1N94 A;  1O5M A;  3HXE A;  3C72 A;  1LTX A;  3SFY A;  1MZC A;  3E37 A;  4GTT A;  3KSQ A;  2ZIR A;  1SA5 A;  3Q7A A;  1TN8 A;  1JCR A;  2F0Y A; 
#chains in the Genus database with same CATH topology
 2BKG A;  5HKP A;  5D66 A;  4FHK A;  3U66 A;  2XQ0 A;  3LDZ A;  1A17 A;  5B1A E;  3FTU A;  2R59 A;  3AS5 A;  1TNZ A;  2R2L A;  3TWS A;  4B94 A;  3TWR A;  2GRN B;  3D3M A;  5CEC B;  2OND A;  3MKQ B;  5ANR A;  3O48 A;  2J49 A;  2V4L A;  2C2L A;  5BXO A;  2ETB A;  3DBS A;  2R5S A;  3D9P A;  4G26 A;  3IKO B;  3VTY A;  4ILG A;  3VLF A;  3SZ7 A;  2DIW A;  1K1B A;  2IU1 A;  1TN7 A;  2OEV A;  2LSU A;  5H7P A;  3J5P A;  3QNK A;  3SNX A;  1FVH A;  3CHO A;  3PH0 C;  3FEY A;  3B13 A;  1OWL A;  3HXC A;  4HVB A;  1OCC E;  3EJN A;  3CVN A;  4GA0 A;  3ESL A;  2HM8 A;  1UG3 A;  4M3O A;  2L9B A;  4NIK A;  3TWT A;  1TEZ A;  3MZL B;  4DPR A;  4GTO A;  3AG1 E;  3IBE A;  4GYW A;  3CIA A;  2WXR A;  2IOL A;  2GRL A;  4HOU A;  2VJ8 A;  5JHB A;  5EID A;  1KT1 A;  4A1G A;  5B1B E;  2F0Y A;  4FJZ A;  5CBN A;  5ENR D;  2LNI A;  2AXZ A;  3MGB A;  4GZD A;  1BPO A;  5FIN A;  3ZFW A;  3EU9 A;  4N3A A;  2XPY A;  4WUY A;  4UWF A;  4YVO A;  1DCE A;  3TAX A;  3HXB A;  4NRH B;  2Y3A A;  2ZIS A;  3CHP A;  4J7W A;  4LNG A;  5EKQ D;  4FUL A;  3HG0 D;  4GCO A;  2EIJ E;  2Y1L E;  2VYI A;  3Q7F A;  3I4G A;  2KM4 A;  1WY6 A;  1E8Y A;  1HG2 A;  3UM0 A;  4BY6 A;  2RG8 A;  5D0Q D;  1FPP A;  3UUX A;  3L17 A;  3PE4 A;  5G05 J;  4NAC A;  2YQ8 A;  2WXJ A;  2BF0 X;  2UWJ G;  1NL4 A;  2XZT G;  3F6Q A;  3CQG B;  4C9B B;  4XX5 A;  2WXH A;  4GB9 A;  5HQ8 A;  2IO2 C;  5BW8 C;  4XE0 A;  5KCM A;  3Q78 A;  3JYS A;  2B0O E;  4GTP A;  4IUL A;  3TJP A;  4PDX A;  5LCW J;  3G2V A;  4LUN U;  2WQ7 A;  4PS8 A;  3TL5 A;  3FU0 A;  4K5B A;  3WXX A;  3NOG D;  4PH4 B;  3KEZ A;  4A1S A;  3RJV A;  5A23 A;  2EIM E;  1H2V C;  3Q7A A;  3ZHE A;  2VGX A;  4CDM A;  3APD A;  2Y4T A;  2QC9 A;  3FWV A;  4LER A;  1RZ4 A;  1GW6 A;  2HR2 A;  5T8I A;  3CEQ A;  2BKK B;  1G3N B;  1SVX A;  2A5E A;  1OT8 A;  4TXR A;  4DUI A;  1E90 A;  4B0Z A;  4L2Y A;  1D8D A;  4N5C A;  5ENT D;  2V0P A;  1OUV A;  3FUH A;  3EU5 A;  3MV3 B;  2XS1 A;  4N5Q A;  4B8A A;  2ZGD A;  2PM7 A;  1B89 A;  3PE3 A;  2DBA A;  3ESK A;  4PS7 A;  5FQ8 A;  1JWF A;  4GZ6 A;  2CHX A;  3CLJ A;  5FTP A;  1INZ A;  4RQI A;  4CZ2 D;  4KVM A;  2LUH A;  3R9A B;  3SF4 A;  3DXM G;  1BU9 A;  1FCH A;  4FP7 A;  4HXI A;  2CFU A;  2IOS A;  3CVP A;  4DX6 D;  4BT8 A;  3BU8 A;  4I17 A;  3ASH A;  3KSQ A;  4DX2 A;  4RSY A;  4UQY A;  4HLL A;  3HRA A;  4ANX A;  1JCR A;  4ILI A;  3CVX A;  4WWP A;  3CHQ A;  3VLE A;  4L23 A;  2WXG A;  3DXK G;  1N4Q A;  3KSL A;  3AG4 E;  3E4B A;  1E8Z A;  3FH7 A;  3TWV A;  4OVU A;  2NC9 A;  3MV2 B;  3FTV A;  3NBN B;  2FO1 E;  4A63 B;  1N0R A;  4JW1 A;  3FFL A;  3EUV A;  1TR4 A;  4WWO A;  2A5U A;  2XHE A;  4GZC A;  5KWD A;  4BTB A;  3VTX A;  2VSO E;  4F6R D;  4UUC A;  5DBK A;  3RO2 A;  5G05 C;  3DRA A;  1D8E A;  4K0R A;  3KD7 A;  1TNB A;  4WND A;  4MLP A;  1XNF A;  1HZ4 A;  2V5F A;  3EHN A;  4FJY A;  3L54 A;  2HYZ A;  2F8Y A;  4O1P A;  5LCW C;  3QB2 A;  2OV8 A;  1NZN A;  1D9S A;  2J8S D;  3FUI A;  1K3Z D;  2RKK A;  3CVL A;  1MYO A;  1HFA A;  4H7Y A;  2CFZ A;  2I9C A;  3QAQ A;  1N4R A;  1O5M A;  3C72 A;  2QYJ A;  4I6J A;  4F53 A;  1MZC A;  5ENN A;  3B7R L;  4Q69 A;  1NFI E;  1SA5 A;  5ENQ D;  4TUM A;  1OWM A;  3TGO A;  1HX8 A;  3KEA A;  4Y6W A;  4UQZ A;  4ATZ D;  3OXG A;  1JCS A;  2WVI A;  3PZ3 A;  4U04 A;  2P9I G;  4HS2 A;  3BEE A;  4B89 A;  4DI3 A;  4J6I A;  3QWW A;  2WXL A;  5KJM A;  4G8L A;  3S7F A;  5AEN A;  5CMW A;  3OXF A;  3URZ A;  2LXL A;  5ENP D;  4GMR A;  4APF A;  5AIJ A;  3UIP C;  5KNG A;  5C2Y A;  5KNH D;  2XZD G;  4HI8 A;  4FLH A;  4GPK A;  3D9I A;  3HHM A;  3V31 A;  5ITZ F;  3G2T A;  3I5P A;  2J09 A;  5KJL A;  3D9J A;  3PZ1 A;  4CEM A;  3RSE G;  3SQV A;  3I3N A;  4I6E A;  2L6B A;  2V8S E;  3QKY A;  4RVB A;  3Q4A B;  2GGF A;  2WXK A;  2FO7 A;  1LF8 A;  1KZP A;  3U9W A;  1WG0 A;  3BG0 B;  5AJD A;  2IEJ A;  2JEK A;  4DX1 A;  2AXU A;  3LJN A;  4EPZ A;  1AP7 A;  4CDN A;  3FUK A;  4CYM D;  3V30 A;  1BI8 B;  3FY4 A;  4HQD A;  1ZU2 A;  2C0L A;  3NZS A;  3QC1 A;  2DVW A;  3FUF A;  2P2C P;  4O1O A;  1ELW A;  4J8S A;  1QBQ A;  2Y69 E;  4U0S A;  4HLE A;  2WB2 A;  3AJI A;  3PRE A;  5T3R A;  1O1R A;  2KCL A;  4PUC A;  3EHQ A;  4Z68 A;  1S63 A;  2H6H A;  1HG5 A;  5HS0 A;  4ILH B;  5LFA A;  3UPV A;  2JAB A;  4HBD A;  2CG2 A;  2EQX A;  5CBO A;  3Q47 B;  1S64 A;  4C48 B;  3D9L A;  1Z3X A;  5BUZ A;  1E8X A;  3S7J A;  4LRZ A;  1K8K G;  1TNY A;  3K9I A;  2A4Z A;  5AYW D;  3OTN A;  2MYO A;  3UIN C;  3OAW A;  1UN9 A;  2H6G A;  3HXF A;  2ZXW E;  1N0Q A;  3V2X A;  3ZHE B;  4BFR A;  4JPS A;  3DSS A;  2VSY A;  4A3V A;  4KXK B;  2VGX B;  3ABL E;  5JA4 D;  1E7U A;  3DPY A;  4JHJ A;  3Q15 A;  2X6H A;  1MX4 A;  4UI9 K;  3E34 A;  4N2S A;  5EIB E;  3BUA A;  3SFX A;  4EBA G;  4GTM A;  5FT9 A;  2XRY A;  1N52 A;  2OVF A;  3AU4 A;  3FU6 A;  3SD5 A;  3ZIM A;  3AU5 A;  4IN3 B;  4K5C A;  2OEW A;  3AS8 A;  3LKU A;  1IYG A;  5FQ6 A;  3QOU A;  1MJ0 A;  2AW6 A;  4IYP A;  3BQO A;  4U7E B;  3QJZ A;  3PNT B;  3DPD A;  2X6F A;  1X5B A;  4F1P A;  3ZW3 A;  2VQ2 A;  4U95 D;  4AOF A;  1H0A A;  3IXE A;  2NSZ A;  4UWK A;  5JJT A;  1FT1 A;  3FUN A;  4CT0 A;  1HO8 A;  4TV3 A;  2NXP A;  3V2O A;  4HRM B;  4U0U A;  3G2U A;  3JQ0 A;  3RU0 A;  4GA2 A;  2CG3 A;  5J08 A;  3L08 A;  1TJC A;  2KXP C;  2QFC A;  2R05 A;  1RW2 A;  1U3C A;  4GYO A;  2KBX A;  3DWL G;  4XKB A;  1OCZ E;  1SA4 A;  2LXM A;  3CHM A;  3IEG A;  4GMJ A;  4FHJ A;  3HYM B;  4XZ4 A;  5ANL A;  5EIL A;  2VGE A;  4FLB A;  3ZVV A;  2P9S G;  3FU3 A;  3RRM B;  5E76 A;  1O1S A;  3KS2 A;  5JJ6 A;  4FA6 A;  1SZA A;  4J8Y A;  3PS6 A;  3LY9 A;  1NA0 A;  4BSZ B;  4CDR A;  2GRO B;  4JA9 A;  1OXJ A;  1N54 A;  3UX4 A;  3IHV A;  4AEZ C;  4L2L A;  3ZU7 B;  1JPL A;  1OY3 D;  1SZ9 A;  3TWX A;  1H19 A;  4LNU D;  1KZO A;  4BT9 A;  3CQC B;  3LJ3 A;  4YND A;  2YHC A;  4GA1 A;  4WNE A;  4U8V D;  3U64 A;  2XEN A;  3T9K A;  4CGW A;  1MQS A;  4FU3 A;  2Y0B G;  3S7D A;  5CRV A;  4HOQ A;  3TWW A;  4EEC A;  2LSV A;  3FP3 A;  4YDW A;  2I1J A;  3EIQ C;  4KZC A;  4OAU C;  3PVL A;  4DLQ A;  2GRM A;  1QNF A;  4C0M A;  5CER B;  4G2V A;  5JJ7 A;  2IO3 C;  1EDU A;  1V55 E;  3C3Q A;  3L9T A;  3JXJ A;  1N95 A;  1OCR E;  2X6K A;  5G55 A;  3DEO A;  3CKC A;  4PS3 A;  3MX3 A;  4BSX A;  2P9U G;  1O1T A;  4JA7 A;  2R02 A;  4A3T A;  1N4P A;  2KZT A;  4QFV A;  2DYS E;  2J9Q A;  3UT7 A;  4OVV A;  4YDY A;  4YDO A;  2B6C A;  3T5V A;  4JEH A;  2PNN A;  3SBT B;  2CHZ A;  3FUD A;  4CT4 A;  3SGH A;  1Y8M A;  3S7B A;  4V3I A;  5HI7 A;  4I2Z A;  3MEK A;  1YYH A;  2J4B A;  4R7L A;  5EX3 A;  3FDH A;  1HH8 A;  3ULY A;  3SI5 A;  4B93 B;  4EZJ A;  2NYJ A;  3FEX A;  1KT0 A;  3CVQ A;  4RLY A;  3HIZ A;  3L16 A;  2DYR E;  4KYO B;  1PY1 A;  4HRN A;  3D9M A;  2LO6 A;  1IKN D;  5AN8 A;  2ETA A;  3DSW A;  2PL2 A;  3ZYQ A;  4BES A;  3LVQ E;  5AAR A;  3AAA C;  3FTW A;  2XCB A;  3ASF A;  5AQA A;  2H6I A;  3NF1 A;  3DSV A;  4G23 A;  2XPI A;  4JHR A;  1W3B A;  3ZKJ A;  5BV0 A;  3PZ4 A;  4F1S A;  3IHY A;  2Y4U A;  5EYL A;  2KC7 A;  4U63 A;  2M63 A;  4JVS A;  3E30 A;  4GML A;  2XS8 A;  4U0Z A;  1DVP A;  2P58 C;  3MKR A;  4J0U A;  3FTZ A;  4AXH A;  5G2N A;  2I2O A;  2WXM A;  2ION A;  4ACL A;  3RK6 A;  4H7X A;  4URK A;  1UOH A;  5LOZ A;  3E37 A;  1FVF A;  3MJW A;  2LAH A;  1IHB A;  3PZD A;  4AM9 A;  2AWI A;  1H6O A;  3LPZ A;  3QWP A;  2HE0 A;  3NB2 A;  2ZGG A;  3TXN A;  3V79 K;  3FU5 A;  2I1K A;  5A6C A;  2WQH A;  2Q7F A;  3QAR A;  4EHM A;  5FZR A;  4QQI A;  1WM5 A;  5AQB A;  3UM2 A;  3PUJ A;  1U2V G;  3ISM C;  2DZN A;  4G11 A;  4BEP A;  5JMN D;  3UTM A;  4JZY A;  3DSX A;  1SW6 A;  3D9O A;  2HO1 A;  3AG3 E;  2BED A;  1QQE A;  4WWN A;  3UXG A;  5DIZ A;  2P9L G;  4ANU A;  3CV0 A;  4L7T A;  3LXU X;  1HU3 A;  2EIN E;  5E75 A;  4J8D A;  2WM9 A;  3ONK A;  3TG5 A;  2EIL E;  2XPZ A;  3ZYK A;  1WAO 1;  1ELR A;  3B7S A;  3P2B A;  4U07 A;  4ATG A;  3PZ2 A;  3PEV B;  3APF A;  4D10 C;  4GTV A;  1HS6 A;  2YNQ A;  4EBA A;  1IHG A;  2VSN A;  3L22 A;  3JUE A;  3JXI A;  4HI9 A;  1TNO A;  3D9K A;  4DJA A;  4JL0 A;  1MX6 A;  3HXD A;  2VGY A;  3UT4 A;  2P9P G;  1S70 B;  4X8Q A;  3RAU A;  3U4T A;  4I43 A;  2XGM A;  4G8K A;  2X6J A;  2FI7 A;  4U96 D;  3CK9 A;  3J5Q B;  2X6I A;  4GPM A;  5HRY A;  3U3W A;  2P9K G;  1Z3Y A;  3UM3 A;  3GYZ A;  4ACK A;  2BTD A;  3Q49 B;  2V5Q C;  2R03 A;  1YCS B;  1A5E A;  2IFU A;  3UIO C;  3ASO E;  4BX8 A;  1L5J A;  2KCV A;  4DK5 A;  2RFM A;  3E32 A;  4I1M A;  4AV7 A;  3LEW A;  5BV1 A;  2WXQ A;  2WXO A;  2IY0 C;  3ASD A;  5J90 A;  3PUK A;  4B8C B;  3ULE G;  2OCC E;  3VLD A;  2PQN A;  2MOW A;  1N9A A;  3ASG A;  3TG4 A;  4KZ0 A;  4BX9 A;  2PM6 A;  1AWC B;  2WXF A;  1UW4 B;  4JHK A;  3LCA A;  4XI0 A;  4N3B A;  4P29 A;  1H2U A;  4FC8 A;  3NQP A;  3UQ3 A;  1OWP A;  3R9M A;  3AG2 E;  1EF1 C;  2UY1 A;  3P1U A;  5BXU A;  1TN8 A;  4KVO A;  5FQ4 A;  4CGV A;  1N11 A;  5KJN A;  4AIF A;  3ZN3 A;  1WDY A;  3T8M A;  4GYY A;  3CVU A;  2KCK A;  1BLX B;  3UI2 A;  1KPS B;  3HVE A;  3X2Q E;  4K5A B;  3MYV A;  5EYP F;  4BWR A;  1OWO A;  3Q73 A;  4Q94 A;  3MA5 A;  1HXI A;  1YA0 A;  2PQR A;  1BD8 A;  3ZUV B;  2KZT B;  3FTS A;  3CKB A;  4I2W A;  4AY6 A;  3CSF A;  4UQX A;  2WXI A;  2E0I A;  4MS6 A;  1ZB1 A;  3ML8 A;  3C5R A;  2AVP A;  5FZS A;  2LAI A;  2WQ6 A;  3KAE A;  3L13 A;  4UWL A;  2GRP B;  1Z5S C;  3RRU A;  3PEU B;  3ONL A;  4LNB A;  4JB8 P;  3DEP A;  4N2Q A;  2IF4 A;  1H2T C;  5M72 A;  4GTS A;  4DX7 D;  5D2M C;  3I4R B;  4U8H A;  3LYA A;  1MX2 A;  3FH8 A;  4N39 A;  2L0I A;  2XGS A;  3ZEF A;  2RD0 A;  4TUU A;  2GRR B;  2GW1 A;  5EN5 D;  5CRU A;  1P5Q A;  4OAV B;  4ZFH A;  1YMP A;  3ABK E;  4LCT A;  3UMV A;  3C98 A;  2YIN A;  3QDN A;  2J08 A;  3B95 A;  5FJY A;  2FF4 A;  3APC A;  3EDT B;  4TXP A;  2PZI A;  3B7B A;  3CHS A;  5JHA A;  4BER A;  2F8X K;  2DWZ A;  3PRZ A;  4GCN A;  3NZU A;  3EHM A;  3ZGQ A;  2OOE A;  4HFG A;  3GW4 A;  3NAW A;  4EZK A;  3FUJ A;  2VTB B;  3HDX A;  4APO A;  1K1A A;  4Q96 A;  3EHR A;  1IQR A;  3CHR A;  1BI7 B;  4NQ0 A;  5B3S E;  1DNP A;  4LG6 A;  5CHE E;  3JCK C;  3JUI A;  4E6H A;  2CHW A;  2IJG X;  1QZ2 A;  3MKQ A;  4C0E A;  1SQM A;  4WAF A;  5FQ7 A;  4DX5 D;  5LP0 A;  4UWG A;  2JLB A;  5CCL A;  4YDE A;  5BT1 A;  2DCP A;  3ZYL A;  3RKV A;  4JC8 A;  4UWH A;  3FUE A;  4G25 A;  1DCQ A;  1EYH A;  3AS4 A;  4XI9 A;  3ZYM A;  3Q9N C;  4WNG A;  5ARG A;  4LEU A;  1PC2 A;  4HOT A;  4DI4 A;  3SY2 A;  3S2A A;  4AVX A;  5AQ7 A;  2QY7 A;  4FAD A;  4I1O B;  1UJJ A;  1E8W A;  3FTX A;  5AQ9 A;  3ZNG A;  4UI9 J;  4ANV A;  4E85 A;  3SO8 A;  1TYQ G;  4N3C A;  2X38 A;  1HE8 A;  3EIJ A;  2KAT A;  4MRU A;  3ZRH A;  1X81 A;  2XCC A;  1NA3 A;  4I9C A;  5A7D B;  4JXT A;  2FEZ A;  2ILR A;  2J4D A;  4OYS A;  3WG7 E;  4F3V A;  1ELK A;  3T5X A;  4EZL A;  4M7C A;  4GTQ A;  5CEA A;  3NOC D;  3Q75 A;  1TN6 A;  4DRX E;  3W9G A;  4BET A;  3SBS A;  4MKT A;  3CK7 A;  1OCO E;  1KLX A;  4L9P A;  3CGH A;  5ENO D;  2XRZ A;  3FTY A;  3L6A A;  3E33 A;  3ML9 A;  3CR3 A;  3L82 A;  4W9R A;  2H6F A;  4TRQ A;  4RG9 A;  5D0O D;  3LS8 A;  3LY7 A;  3RO3 A;  3TXM A;  1JCQ A;  2YHE A;  5BPP A;  1UJK A;  3CVY A;  1XGW A;  4YVQ C;  4XEI G;  2E2E A;  3HXE A;  3TWU A;  1LTX A;  4WNF A;  3SHF A;  4ZHB A;  2VTB A;  3O4Z A;  3MCX A;  4AY5 A;  5AAO A;  4G24 A;  4O6F A;  3CVW A;  2V4H C;  5FIO A;  4KT6 B;  2C0M A;  4CCA A;  3RIB A;  4J8F A;  1EPU A;  4HB5 A;  4EQF A;  4O60 A;  3UT8 A;  4ABN A;  3ASN E;  1DC2 A;  4CRW A;  4GU5 A;  3LY8 A;  2R17 C;  5G04 J;  3W9F A;  3BG1 B;  2RFA A;  3GZ2 A;  3FHE A;  2L0T B;  1ZBP A;  1FT2 A;  1Q2Z A;  3B7T A;  1S0P A;  5LX8 A;  2MRI A;  5AJL A;  1IQU A;  1U3D A;  2P9N G;  2AXV A;  2J07 A;  2XEH A;  1NP7 A;  3OXL A;  1E96 B;  4HNA D;  3Q9U C;  1LD8 A;  3QWV A;  3ENE A;  2ETC A;  4AJW A;  4U8Y D;  3ZPJ A;  1V54 E;  3ZXS A;  4GAA A;  4RG6 A;  4HOR A;  2FUL A;  4DLO A;  1IXV A;  3DST A;  4J8E A;  3QK0 A;  3B7U X;  5CCM A;  4AP2 A;  4XIF A;  2UY1 B;  4GZ5 A;  2WMN A;  3CST A;  2FBN A;  3FUM A;  3FUL A;  3JQ1 A;  3ULQ A;  5FZQ A;  2QZA A;  4K03 A;  3GZS A;  1QYM A;  4JEU A;  1H6P A;  1LD7 A;  4GZ3 A;  4ANW A;  1Z6T A;  3HVE B;  3SFY A;  4Y6C A;  3ABM E;  3T8K A;  4GTT A;  5EDS A;  4HOS A;  5ARF A;  1JUQ A;  3CK8 A;  4UI9 C;  4G1T A;  1UN8 A;  3SFZ A;  2VSX E;  1N4S A;  1Y6I A;  2XEV A;  4I9E A;  3LVR E;  3UM1 A;  4GTR A;  4IRU A;  2OVB A;  2ZU6 B;  3D9H A;  5IY5 E;  1VDY A;  2WXN A;  1MHQ A;  4HRL A;  5C1D A;  1TNU A;  5CMY A;  2IQC A;  4MBG A;  3UKU G;  4NUR A;  4A55 A;  3D9N A;  5ENS D;  3UKR G;  4KBQ A;  5EX0 A;  5T4Y A;  3TWQ A;  2I6H A;  2WXP A;  2BUG A;  2EIK E;  5KJK A;  5FWQ A;  1TJF A;  4XKC A;  3GZ1 A;  4L1B A;  3RRN B;  2GRQ B;  2MHK A;  4I6G A;  3R7R A;  3CVV A;  5KBA A;  3PNL B;  3N71 A;  3Q79 A;  3C3O A;  3PDN A;  2XEE A;  1HF8 A;  3FH5 A;  3DSU A;  2DZO A;  2X3M A;  3Q5M A;  4ME2 A;  1OWN A;  5CED B;  3G2S A;  4F7A A;  2XGO A;  1E7V A;  2AJA A;  5BNW A;  3C3R A;  4I1A A;  1NI1 A;  4LSZ E;  2WMO A;  1N94 A;  3IV0 A;  1PAQ A;  3G2W A;  3R7Q A;  4BTA A;  2WPV A;  2F37 A;  2ZIR A;  2L6J A;  2QYU A;  1JWG A;  4KMO A;  5G04 C;  4JD2 G;  1H6K A;  3ZXP A;  4TXQ A; 
#chains in the Genus database with same CATH homology
 1N4S A;  1QBQ A;  1KZO A;  1TNZ A;  4GTR A;  2R2L A;  4EHM A;  1N4Q A;  3KSL A;  1O1R A;  1TNU A;  1JCS A;  1X81 A;  3PZ3 A;  4MBG A;  1FT2 A;  1DCE A;  3HXB A;  3Q73 A;  1S63 A;  2ZIS A;  3E32 A;  3DSX A;  2H6H A;  4LNG A;  1FT1 A;  2BED A;  3DSW A;  3EUV A;  4GTQ A;  1LD8 A;  3Q7F A;  3Q75 A;  1TN6 A;  1D8D A;  2H6I A;  1S64 A;  3DRA A;  1D8E A;  3EU5 A;  1TNB A;  3DSV A;  4L9P A;  1TN7 A;  1TNY A;  1FPP A;  3DST A;  1N9A A;  3E33 A;  3PZ2 A;  3Q79 A;  3PZ4 A;  4GTV A;  1SA4 A;  1N95 A;  1NL4 A;  2H6G A;  3HXF A;  4LNB A;  3PZ1 A;  3DSU A;  4GTS A;  3HXC A;  2H6F A;  1TNO A;  3Q78 A;  3DSS A;  4GTP A;  1O1T A;  1N4P A;  3HXD A;  3E30 A;  4YDE A;  1JCQ A;  1LD7 A;  3DPY A;  4YDO A;  1KZP A;  3E34 A;  1O1S A;  4GTO A;  1NI1 A;  3SFX A;  2IEJ A;  4GTM A;  1N4R A;  1N94 A;  1O5M A;  3HXE A;  3C72 A;  1LTX A;  3SFY A;  1MZC A;  3E37 A;  4GTT A;  3KSQ A;  2ZIR A;  1SA5 A;  3Q7A A;  1TN8 A;  1JCR A;  2F0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...