1NL4A

Crystal structure of rat farnesyl transferase in complex with a potent biphenyl inhibitor
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
312
structure length
312
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase alpha subunit
publication title Novel and Selective Imidazole-containing Biphenyl Inhibitors of Protein Farnesyltransferase
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 125
structure length 312
sequence length 312
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2003-01-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 1nl4A00
1TNZA 2IEJA 1FPPA 4GTSA 3E37A 1JCQA 3DSSA 1JCSA 4GTRA 1D8EA 1N4RA 3EUVA 1X81A 3SFXA 4EHMA 1FT2A 1QBQA 2H6GA 2ZISA 2ZIRA 1FT1A 1LD8A 1NL4A 4GTOA 4YDEA 1S63A 3Q78A 3C72A 3DRAA 3KSQA 2F0YA 3DSXA 1KZPA 3DPYA 3Q7FA 4GTQA 1N94A 1NI1A 3PZ4A 3KSLA 1D8DA 4LNBA 3DSVA 1DCEA 3PZ3A 1N95A 1LD7A 1SA4A 1TN6A 3HXEA 3HXBA 1TN7A 3DSWA 4YDOA 3PZ2A 1KZOA 1O1RA 4LNGA 3Q73A 3E33A 1N4SA 2H6FA 4GTTA 1TNBA 4GTPA 3EU5A 4GTVA 1N9AA 3HXDA 1MZCA 1S64A 4GTMA 3E34A 3Q7AA 1TN8A 3HXFA 1LTXA 3SFYA 3DSUA 4MBGA 1TNUA 3E32A 1TNYA 3E30A 3Q79A 1O1SA 3HXCA 4L9PA 1N4PA 3PZ1A 1O5MA 1O1TA 1N4QA 3Q75A 2R2LA 3DSTA 1JCRA 2BEDA 1SA5A 1TNOA 2H6HA 2H6IA
chains in the Genus database with same CATH superfamily
1FPPA 2EIME 4KMOA 2KC7A 2A5EA 4E85A 4LNUD 2L9BA 4F3VA 5CCMA 3OTNA 3JXJA 4JL0A 2R59A 5BV0A 4GA1A 3U3WA 4J8FA 3CQGB 4PS7A 2VJ8A 4HOTA 3FEXA 3TAXA 4C9BB 3CGHA 1HH8A 2R02A 3MEKA 5A7DB 5B3SE 2CHZA 2VSNA 4LNBA 3DSVA 4B8AA 3AG3E 1U3DA 5AARA 3FUEA 1AP7A 5FQ4A 1WDYA 3NAWA 4B93B 3X2QE 3T9KA 3KD7A 4KVOA 3C98A 4GTPA 3ASFA 4J8SA 1E96B 4EQFA 2LNIA 4IN3B 3TWWA 2IONA 3UT4A 3RKVA 2C2LA 3PH0C 4APFA 4DX5D 2OEVA 3APDA 3CVQA 4LERA 1OWMA 2P9NG 5ARGA 5JHAA 5ENTD 2WXHA 4HRMB 3E30A 3Q79A 5LOZA 4HI9A 1ZU2A 3CK9A 3D9JA 2AXVA 5BXUA 3LXUX 4F1SA 4GYYA 3HRAA 4EZKA 2XGMA 5HRYA 5G05C 1TNZA 4XX5A 3V31A 3NBNB 4HOUA 4WNGA 4FJZA 3MX3A 3ESLA 4UWHA 3B7BA 1P5QA 4HOQA 5CRVA 2J4BA 3HHMA 1NA0A 5EYPF 2WQ7A 3CK8A 2J4DA 2AVPA 2GRQB 3ZHEA 3FU5A 3Q7FA 4WWNA 2XZDG 2ETBA 3JYSA 3PZ4A 3MGBA 3FTXA 1IHBA 1DCEA 4A1SA 3D9OA 3CV0A 2BF0X 1HF8A 3TG5A 3IHYA 2UY1B 3SF4A 1K1AA 3MZLB 3ASNE 3EU5A 2XRZA 1YCSB 4GZ3A 4F7AA 3MYVA 1HFAA 4DX2A 2WQ6A 5ENOD 3TG4A 4X8QA 4H7XA 4RG9A 2GGFA 4I6JA 3FWVA 3T8MA 5CEDB 1Z3YA 2Y4TA 1HX8A 3DSTA 3LVRE 3QKYA 3U64A 2FBNA 4GMLA 1E8ZA 1NFIE 2EIJE 4L7TA 1PC2A 4HBDA 3TXMA 3UKUG 4L2LA 1D8EA 2XQ0A 3ZN3A 2WXIA 4U0SA 3VLEA 3ESKA 4BT8A 4BERA 1D9SA 2QFCA 3ISMC 1SQMA 4TXQA 3ZIMA 1ZB1A 4XZ4A 3L9TA 3PUJA 3PEUB 1ELWA 4GA2A 2P58C 1H6PA 4KZCA 1OWOA 4I43A 4U8HA 3TWRA 1NA3A 2DIWA 2NYJA 5G2NA 4ILGA 2XRYA 4G26A 2LO6A 4JEUA 5ANLA 2DZNA 3CVYA 4EZJA 2P9KG 1ELRA 2WXPA 5FZRA 1IXVA 3ZXSA 1AWCB 2UWJG 2KXPC 1E8YA 3EJNA 3IEGA 4GZ5A 3FUHA 4WAFA 2R5SA 4K5CA 1N52A 1RW2A 1E7VA 3RRMB 1O1SA 2IOLA 4PUCA 5AJDA 2Q7FA 3D9HA 2R2LA 2Y69E 2LXLA 2P2CP 4F6RD 3CKBA 1Z3XA 1GW6A 1DVPA 1TNOA 4O1PA 5ENNA 3BQOA 3O4ZA 5KNHD 5A23A 2IO2C 1H6OA 1JCQA 2PQRA 4XIFA 3CVPA 3SFXA 3JXIA 4CT0A 2I6HA 4ANXA 3SD5A 5AENA 5HI7A 4L1BA 3PZDA 2PM7A 4C0EA 3BU8A 4AY6A 4U04A 5HQ8A 4G11A 4GMRA 4U8YD 3DPYA 2VTBB 3ULEG 3CQCB 2MOWA 2XEEA 4JXTA 3CSTA 4JD2G 2WB2A 5LP0A 5CEAA 3V79K 4QFVA 5KJKA 1H2VC 3SI5A 2HM8A 3R9MA 1Y6IA 1TYQG 5D0QD 4U0UA 4D10C 1EYHA 4CT4A 1TR4A 3FU0A 1TNBA 3PREA 4G25A 5AQBA 5CBNA 5FZSA 1Y8MA 3HXDA 4GCOA 3TWVA 3FTYA 5ENSD 3LPZA 2QYJA 3Q15A 1L5JA 1N0RA 1JWGA 3C5RA 3SBSA 3JQ1A 2XGSA 3U9WA 2XPYA 5BNWA 2IF4A 3AG4E 4IRUA 1OWPA 3DBSA 3ML9A 5LFAA 3ZUVB 3T5XA 4J0UA 3SGHA 4YVOA 3NZUA 3LEWA 3FH5A 3CHQA 4HRNA 1E90A 4P29A 2QZAA 4DI3A 4B89A 4AVXA 3FY4A 4HB5A 4XKBA 3DSXA 4XI0A 3UM0A 3MV2B 3ENEA 5ENRD 4HQDA 4IYPA 3MA5A 1SZAA 3WXXA 3LCAA 3C3RA 3CHPA 4DPRA 2HR2A 4JA9A 3PZ2A 2B6CA 4U8VD 1N4SA 4BWRA 4NRHB 5ARFA 2PL2A 2X6IA 2KM4A 2GROB 3ZGQA 1MZCA 2X6HA 5A6CA 4GTMA 3SBTB 3J5PA 4AXHA 2WM9A 4GAAA 1H6KA 5CERB 3B7TA 3APFA 1IQRA 4BY6A 4DX1A 2GRPB 4BTBA 4I2ZA 1N4PA 4HS2A 1E8XA 2VTBA 3LJ3A 1V55E 3U4TA 3FTZA 5FWQA 3TGOA 1OT8A 4AY5A 1SA5A 2H6HA 2J07A 2ZGDA 4AOFA 2EILE 1KLXA 4MLPA 4GZCA 3Q9UC 4ZHBA 2F37A 3Q9NC 3IBEA 3CLJA 1NZNA 4UQYA 1U3CA 3DRAA 4JC8A 2LAIA 2DWZA 4GB9A 4DK5A 5KJLA 2RKKA 3R7QA 4N3CA 3UT8A 1RZ4A 1N94A 1NI1A 4DLQA 1HE8A 2XPIA 4Q96A 3OXLA 5E76A 2X38A 3I3NA 3LKUA 2GRMA 4HNAD 1HS6A 1UW4B 4O1OA 2WXMA 3TWTA 2XCCA 3D9NA 2IJGX 1O1RA 4LNGA 4FHJA 2A4ZA 4ATGA 4GTTA 4Q69A 4EPZA 3K9IA 5EX0A 3ZU7B 3W9GA 3S2AA 4AJWA 1DCQA 2XZTG 5BV1A 4A55A 3B7RL 3CVLA 3NB2A 5BXOA 4GZ6A 2XS1A 1EPUA 4CZ2D 4J6IA 3DEOA 3AG2E 2RFMA 3ZRHA 2WMOA 3CSFA 5G04C 4E6HA 4NQ0A 4U07A 2XPZA 3C3OA 3S7BA 4I9CA 2L6JA 4XE0A 1N4QA 3KEZA 3JCKC 4CDNA 2ETCA 2XEHA 4U63A 5CHEE 5AQ9A 3UUXA 2WXRA 3WG7E 1JCSA 2HO1A 4ME2A 3VLDA 4K0RA 1OWNA 1H2UA 3B7UX 2Y3AA 3QK0A 4CGWA 2OV8A 1HU3A 2JLBA 1MX6A 4HVBA 2YHCA 2BUGA 4AV7A 3C72A 4DX7D 3RRUA 2C0MA 4TRQA 4PS3A 4BX8A 3QNKA 2WXLA 4EECA 2CHXA 2VGXA 4URKA 2AW6A 4PDXA 4WNDA 2NC9A 1S70B 2KCKA 5FQ8A 1MJ0A 3KS2A 2PQNA 4OYSA 2FO7A 4I1AA 3FHEA 2ZU6B 3R7RA 2WXQA 2MHKA 3DXKG 2IY0C 3FUKA 3AU4A 4CDMA 4BFRA 3I5PA 3LVQE 1OCRE 1TN8A 3UTMA 1UN8A 4HRLA 1K1BA 5AQ7A 1QNFA 4GYWA 2GRRB 2LUHA 3G2VA 1BI8B 4MRUA 1Z5SC 3RAUA 1O1TA 3IKOB 4XI9A 4KT6B 2LXMA 5BPPA 4R7LA 4TXRA 2YNQA 3TJPA 2BEDA 5HS0A 5EIBE 3PNTB 4A63B 5G55A 3FFLA 1QQEA 4CDRA 2IO3C 2QC9A 3AS8A 3UM2A 3URZA 5FQ7A 1HZ4A 3G2SA 1NL4A 3BG1B 2J8SD 3O48A 2F0YA 4GYOA 3UM3A 2YQ8A 2AXUA 3GZ1A 3ZPJA 2J09A 3FUNA 2CG2A 5G04J 4BETA 3QWWA 3ZVVA 4I2WA 4CEMA 5KJNA 1WM5A 4J8YA 3AJIA 3ABME 3MCXA 3ZYMA 4G8KA 5EX3A 2QYUA 4DLOA 1MYOA 4DRXE 2RFAA 4XEIG 1EDUA 3CVXA 4N5QA 5J90A 2IOSA 3DPDA 1BD8A 2BKGA 3E34A 2WXFA 1OCCE 2RG8A 3B7SA 2WVIA 2LSVA 5DIZA 2XEVA 5CBOA 3S7FA 2V0PA 2NXPA 3PEVB 2MYOA 2R17C 3NOGD 2LSUA 2H6IA 4UUCA 3L22A 2KCLA 5KNGA 2M63A 1X5BA 3DSSA 3UIPC 4ACLA 5IY5E 1B89A 4YVQC 4ILIA 4BEPA 4M3OA 1X81A 4JHRA 4A1GA 4N39A 2BKKB 1WY6A 1LD8A 3Q78A 4I17A 4A3VA 3AS5A 1WAO1 1K8KG 3FUJA 3L08A 4WWOA 3ULQA 3BEEA 2J9QA 2EIKE 2C0LA 2LAHA 1D8DA 3LY8A 3AU5A 2V4HC 3ABKE 2EQXA 5H7PA 2RD0A 5CMYA 5ITZF 3GZ2A 3UM1A 5CCLA 3E4BA 2V5FA 4QQIA 4CGVA 1N9AA 2ZXWE 1UG3A 1HXIA 4PS8A 3I4RB 3IHVA 1Z6TA 3HIZA 1BU9A 3OAWA 5LX8A 4AIFA 3APCA 4JZYA 3E32A 3GZSA 3ZYKA 5B1AE 5LCWC 1V54E 4RSYA 1JUQA 4YNDA 1QZ2A 2PZIA 4BSXA 4WWPA 3CVVA 5JJTA 3ASGA 3D9PA 4LRZA 4K03A 4AEZC 4RLYA 4Z68A 3EDTB 5KCMA 3PRZA 3U66A 3V2OA 3D9IA 4UQXA 1TJFA 4GPMA 2X6FA 2B0OE 4EHMA 1QBQA 5BW8C 3AS4A 3UINC 3QWPA 1BPOA 1FT1A 3B95A 3FTWA 3JUEA 4FLHA 4GTOA 4YDEA 3UQ3A 3RO2A 1S63A 3ZKJA 1KZPA 2VGEA 5D0OD 3QDNA 4BT9A 1OCOE 4JEHA 5T4YA 5C1DA 1QYMA 2I9CA 3AG1E 5FT9A 3QAQA 3MJWA 4NURA 1OY3D 1DC2A 1KZOA 4WNFA 2V8SE 3JUIA 5JHBA 2PM6A 3PS6A 2DZOA 5T8IA 3QARA 2X3MA 1VDYA 3D9MA 4H7YA 4GPKA 4V3IA 1HO8A 4ANVA 4FA6A 3L6AA 3PE3A 3HXFA 4HXIA 3ZNGA 3I4GA 4EZLA 4UWKA 3SNXA 2R05A 3Q75A 4JPSA 2WQHA 4OAUC 3SY2A 2WPVA 5T3RA 3TWSA 3RO3A 4FP7A 3ZYLA 3IV0A 3KAEA 3ZEFA 3T5VA 3ASHA 2L6BA 4U0ZA 4I9EA 3FEYA 4DUIA 4N5CA 4GZDA 4U96D 2OOEA 4LCTA 4ANUA 1LF8A 2VGXB 2ZIRA 3QWVA 4MS6A 1A17A 3Q4AB 5BT1A 3CKCA 1W3BA 3L13A 5EKQD 3CVNA 3J5QB 3P1UA 3FH8A 3HYMB 2L0IA 2WMNA 3NOCD 5LCWJ 4OVVA 3AAAC 4KVMA 4TV3A 1KT0A 4UWLA 3LYAA 1A5EA 2XGOA 5EDSA 2I1JA 5KBAA 4KXKB 1SW6A 4BESA 2E2EA 3UMVA 2ONDA 4G2VA 3NQPA 2NSZA 3RSEG 3CVUA 3Q49B 3ZFWA 2VGYA 1KPSB 4CCAA 2GW1A 3CK7A 1ELKA 1LTXA 3DSUA 4B0ZA 4C48B 3D9KA 3T8KA 1NP7A 4UWGA 3SO8A 1E8WA 2BTDA 2OCCE 4N3AA 3C3QA 2P9LG 3GYZA 2VSXE 4GCNA 4AP2A 2IU1A 3PE4A 3F6QA 5CMWA 4LEUA 4Q94A 3SHFA 3PDNA 2FULA 1DNPA 1FT2A 3TWUA 2WXJA 3TL5A 1FCHA 4U95D 3EHRA 2CFZA 2XCBA 3L17A 3IXEA 4G23A 4HOSA 5JJ6A 2IQCA 4WNEA 2DYSE 2WXNA 1N95A 2X6KA 3PZ3A 3CHOA 2XENA 4TUMA 3FDHA 2F8XK 3FTUA 4WUYA 3Q73A 2GRLA 1N54A 5JA4D 2ILRA 1N11A 5AAOA 3L54A 1OCZE 3UX4A 3EHQA 3LDZA 1S64A 2OVBA 4CRWA 3QOUA 2P9UG 2KATA 3SFZA 4ZFHA 4KBQA 3FUFA 3FUDA 2WXOA 2P9IG 4NACA 1TNYA 1H0AA 2WXGA 4TXPA 5ENPD 3PZ1A 4APOA 1Q2ZA 2CHWA 4DI4A 4FULA 2EINE 5FINA 2MRIA 5ANRA 3CVWA 4ILHB 3UT7A 3UPVA 3FUIA 2IEJA 4Y6WA 3W9FA 4GTRA 2KZTB 3VTXA 1N4RA 3EUVA 2FO1E 1XGWA 3Q47B 4RVBA 1N0QA 2ETAA 1H2TC 3SZ7A 3CHRA 4U7EB 2AJAA 4ABNA 3VTYA 4BX9A 1TEZA 2WXKA 1IQUA 4KYOB 3FTVA 1U2VG 3ZXPA 3TWXA 2CFUA 4J8EA 5AJLA 3LY7A 4G1TA 2YHEA 3E33A 2L0TB 4K5AB 3HDXA 4O60A 3BG0B 1XNFA 1BI7B 2Y1LE 3CR3A 4GTVA 4I6GA 5EN5D 5FJYA 3S7DA 1MQSA 1MX4A 2DCPA 3DXMG 3S7JA 1YMPA 4B8CB 1JPLA 2IFUA 1G3NB 5AYWD 4OVUA 5C2YA 5D66A 3DWLG 2AWIA 2XHEA 2X6JA 4I6EA 5CRUA 5KWDA 3G2UA 4W9RA 1JCRA 1K3ZD 4MKTA 3D3MA 4GTSA 3D9LA 1TJCA 3HG0D 3G2TA 4LG6A 4GU5A 4TUUA 2XS8A 1IHGA 4FHKA 4UI9C 5EILA 2E0IA 2FEZA 3ABLE 3GW4A 3TXNA 5G05J 2FF4A 3CEQA 3EHMA 2J49A 3CHSA 1YYHA 2GRNB 4B94A 3EIJA 1OXJA 3RIBA 3QB2A 4IULA 5FIOA 4N3BA 3KEAA 1FVHA 4J7WA 4DX6D 1PAQA 3MKRA 5AN8A 4N2SA 1FVFA 5EIDA 4Y6CA 3Q5MA 1IKND 4G8LA 4K5BA 5D2MC 3LS8A 3L82A 2KZTA 4ANWA 4HLEA 1WG0A 2A5UA 5CECB 4FLBA 3EHNA 3Q7AA 3LY9A 4UQZA 4ATZD 3SFYA 3G2WA 2CG3A 4MBGA 1TNUA 3MKQB 3QC1A 3FU6A 3UIOC 1UN9A 3L16A 2UY1A 3SQVA 3NZSA 3RJVA 1O5MA 4JW1A 3ULYA 3CIAA 4HI8A 2HYZA 2DBAA 4EBAG 1OUVA 3FULA 4FADA 3FTSA 2HE0A 3EU9A 3E37A 3QJZA 3NF1A 4BTAA 3FH7A 3HVEB 3TWQA 4HFGA 3VLFA 5AQAA 5ENQD 2Y4UA 1MX2A 2JABA 2ZISA 3ZYQA 1OWLA 1UOHA 3UXGA 3RK6A 1YA0A 4J8DA 3ASOE 3ASDA 3CHMA 3KSQA 4HLLA 3JQ0A 2P9PG 1S0PA 5E75A 4GTQA 4N2QA 4RQIA 5KJMA 4JA7A 3BUAA 2Y0BG 1E7UA 4KZ0A 5AIJA 5B1BE 1LD7A 3FP3A 1INZA 2V5QC 3ONLA 1H19A 1SVXA 3DSWA 4YDOA 3N71A 4LSZE 4A3TA 4LUNU 2H6FA 4XKCA 4L2YA 1UJKA 4YDWA 5JMND 2FI7A 2QY7A 4BSZB 2DVWA 2I2OA 4UI9J 1IYGA 4NIKA 4EBAA 2OVFA 1EF1C 3V2XA 3LJNA 2DYRE 1UJJA 2ZGGA 3HXCA 4L9PA 5HKPA 4OAVB 5J08A 4FC8A 1HG5A 4L23A 4DJAA 2KCVA 3PNLB 5DBKA 2V4LA 2AXZA 2VYIA 4GA0A 3DEPA 4F53A 3ONKA 1MHQA 3OXGA 5EYLA 2R03A 5BUZA 3OXFA 2P9SG 3FU3A 2J08A 2KBXA 4JHJA 2F8YA 2H6GA 1JWFA 3UKRG 4PH4B 4JVSA 4O6FA 1ZBPA 3PUKA 3B13A 5JJ7A 5FQ6A 4I1OB 4RG6A 4JB8P 4F1PA 4UWFA 3MKQA 3KSLA 4YDYA 5M72A 4FU3A 3R9AB 1PY1A 2VQ2A 3V30A 4AM9A 1HG2A 1TN6A 3HXEA 1SZ9A 1SA4A 3HXBA 2JEKA 4FJYA 2I1KA 1TN7A 3UI2A 4UI9K 3ML8A 5FTPA 4M7CA 3FUMA 3MV3B 3PVLA 2YINA 4HORA 3HVEA 4G24A 2VSOE 3RU0A 4C0MA 5FZQA 3RRNB 4I1MA 3ZW3A 3ZHEB 3P2BA 2OEWA 1KT1A 4GMJA 1BLXB 2VSYA 2PNNA 4ACKA 4JHKA 3EIQC 4CYMD
chains in the Genus database with same CATH topology
1TNZA 2IEJA 1FPPA 4GTSA 3E37A 1JCQA 3DSSA 1JCSA 4GTRA 1D8EA 1N4RA 3EUVA 1X81A 3SFXA 4EHMA 1FT2A 1QBQA 2H6GA 2ZISA 2ZIRA 1FT1A 1LD8A 1NL4A 4GTOA 4YDEA 1S63A 3Q78A 3C72A 3DRAA 3KSQA 2F0YA 3DSXA 1KZPA 3DPYA 3Q7FA 4GTQA 1N94A 1NI1A 3PZ4A 3KSLA 1D8DA 4LNBA 3DSVA 1DCEA 3PZ3A 1N95A 1LD7A 1SA4A 1TN6A 3HXEA 3HXBA 1TN7A 3DSWA 4YDOA 3PZ2A 1KZOA 1O1RA 4LNGA 3Q73A 3E33A 1N4SA 2H6FA 4GTTA 1TNBA 4GTPA 3EU5A 4GTVA 1N9AA 3HXDA 1MZCA 1S64A 4GTMA 3E34A 3Q7AA 1TN8A 3HXFA 1LTXA 3SFYA 3DSUA 4MBGA 1TNUA 3E32A 1TNYA 3E30A 3Q79A 1O1SA 3HXCA 4L9PA 1N4PA 3PZ1A 1O5MA 1O1TA 1N4QA 3Q75A 2R2LA 3DSTA 1JCRA 2BEDA 1SA5A 1TNOA 2H6HA 2H6IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNZ A;  2IEJ A;  1FPP A;  4GTS A;  3E37 A;  1JCQ A;  3DSS A;  1JCS A;  4GTR A;  1D8E A;  1N4R A;  3EUV A;  1X81 A;  3SFX A;  4EHM A;  1FT2 A;  1QBQ A;  2H6G A;  2ZIS A;  2ZIR A;  1FT1 A;  1LD8 A;  1NL4 A;  4GTO A;  4YDE A;  1S63 A;  3Q78 A;  3C72 A;  3DRA A;  3KSQ A;  2F0Y A;  3DSX A;  1KZP A;  3DPY A;  3Q7F A;  4GTQ A;  1N94 A;  1NI1 A;  3PZ4 A;  3KSL A;  1D8D A;  4LNB A;  3DSV A;  1DCE A;  3PZ3 A;  1N95 A;  1LD7 A;  1SA4 A;  1TN6 A;  3HXE A;  3HXB A;  1TN7 A;  3DSW A;  4YDO A;  3PZ2 A;  1KZO A;  1O1R A;  4LNG A;  3Q73 A;  3E33 A;  1N4S A;  2H6F A;  4GTT A;  1TNB A;  4GTP A;  3EU5 A;  4GTV A;  1N9A A;  3HXD A;  1MZC A;  1S64 A;  4GTM A;  3E34 A;  3Q7A A;  1TN8 A;  3HXF A;  1LTX A;  3SFY A;  3DSU A;  4MBG A;  1TNU A;  3E32 A;  1TNY A;  3E30 A;  3Q79 A;  1O1S A;  3HXC A;  4L9P A;  1N4P A;  3PZ1 A;  1O5M A;  1O1T A;  1N4Q A;  3Q75 A;  2R2L A;  3DST A;  1JCR A;  2BED A;  1SA5 A;  1TNO A;  2H6H A;  2H6I A; 
#chains in the Genus database with same CATH topology
 1FPP A;  2EIM E;  4KMO A;  2KC7 A;  2A5E A;  4E85 A;  4LNU D;  2L9B A;  4F3V A;  5CCM A;  3OTN A;  3JXJ A;  4JL0 A;  2R59 A;  5BV0 A;  4GA1 A;  3U3W A;  4J8F A;  3CQG B;  4PS7 A;  2VJ8 A;  4HOT A;  3FEX A;  3TAX A;  4C9B B;  3CGH A;  1HH8 A;  2R02 A;  3MEK A;  5A7D B;  5B3S E;  2CHZ A;  2VSN A;  4LNB A;  3DSV A;  4B8A A;  3AG3 E;  1U3D A;  5AAR A;  3FUE A;  1AP7 A;  5FQ4 A;  1WDY A;  3NAW A;  4B93 B;  3X2Q E;  3T9K A;  3KD7 A;  4KVO A;  3C98 A;  4GTP A;  3ASF A;  4J8S A;  1E96 B;  4EQF A;  2LNI A;  4IN3 B;  3TWW A;  2ION A;  3UT4 A;  3RKV A;  2C2L A;  3PH0 C;  4APF A;  4DX5 D;  2OEV A;  3APD A;  3CVQ A;  4LER A;  1OWM A;  2P9N G;  5ARG A;  5JHA A;  5ENT D;  2WXH A;  4HRM B;  3E30 A;  3Q79 A;  5LOZ A;  4HI9 A;  1ZU2 A;  3CK9 A;  3D9J A;  2AXV A;  5BXU A;  3LXU X;  4F1S A;  4GYY A;  3HRA A;  4EZK A;  2XGM A;  5HRY A;  5G05 C;  1TNZ A;  4XX5 A;  3V31 A;  3NBN B;  4HOU A;  4WNG A;  4FJZ A;  3MX3 A;  3ESL A;  4UWH A;  3B7B A;  1P5Q A;  4HOQ A;  5CRV A;  2J4B A;  3HHM A;  1NA0 A;  5EYP F;  2WQ7 A;  3CK8 A;  2J4D A;  2AVP A;  2GRQ B;  3ZHE A;  3FU5 A;  3Q7F A;  4WWN A;  2XZD G;  2ETB A;  3JYS A;  3PZ4 A;  3MGB A;  3FTX A;  1IHB A;  1DCE A;  4A1S A;  3D9O A;  3CV0 A;  2BF0 X;  1HF8 A;  3TG5 A;  3IHY A;  2UY1 B;  3SF4 A;  1K1A A;  3MZL B;  3ASN E;  3EU5 A;  2XRZ A;  1YCS B;  4GZ3 A;  4F7A A;  3MYV A;  1HFA A;  4DX2 A;  2WQ6 A;  5ENO D;  3TG4 A;  4X8Q A;  4H7X A;  4RG9 A;  2GGF A;  4I6J A;  3FWV A;  3T8M A;  5CED B;  1Z3Y A;  2Y4T A;  1HX8 A;  3DST A;  3LVR E;  3QKY A;  3U64 A;  2FBN A;  4GML A;  1E8Z A;  1NFI E;  2EIJ E;  4L7T A;  1PC2 A;  4HBD A;  3TXM A;  3UKU G;  4L2L A;  1D8E A;  2XQ0 A;  3ZN3 A;  2WXI A;  4U0S A;  3VLE A;  3ESK A;  4BT8 A;  4BER A;  1D9S A;  2QFC A;  3ISM C;  1SQM A;  4TXQ A;  3ZIM A;  1ZB1 A;  4XZ4 A;  3L9T A;  3PUJ A;  3PEU B;  1ELW A;  4GA2 A;  2P58 C;  1H6P A;  4KZC A;  1OWO A;  4I43 A;  4U8H A;  3TWR A;  1NA3 A;  2DIW A;  2NYJ A;  5G2N A;  4ILG A;  2XRY A;  4G26 A;  2LO6 A;  4JEU A;  5ANL A;  2DZN A;  3CVY A;  4EZJ A;  2P9K G;  1ELR A;  2WXP A;  5FZR A;  1IXV A;  3ZXS A;  1AWC B;  2UWJ G;  2KXP C;  1E8Y A;  3EJN A;  3IEG A;  4GZ5 A;  3FUH A;  4WAF A;  2R5S A;  4K5C A;  1N52 A;  1RW2 A;  1E7V A;  3RRM B;  1O1S A;  2IOL A;  4PUC A;  5AJD A;  2Q7F A;  3D9H A;  2R2L A;  2Y69 E;  2LXL A;  2P2C P;  4F6R D;  3CKB A;  1Z3X A;  1GW6 A;  1DVP A;  1TNO A;  4O1P A;  5ENN A;  3BQO A;  3O4Z A;  5KNH D;  5A23 A;  2IO2 C;  1H6O A;  1JCQ A;  2PQR A;  4XIF A;  3CVP A;  3SFX A;  3JXI A;  4CT0 A;  2I6H A;  4ANX A;  3SD5 A;  5AEN A;  5HI7 A;  4L1B A;  3PZD A;  2PM7 A;  4C0E A;  3BU8 A;  4AY6 A;  4U04 A;  5HQ8 A;  4G11 A;  4GMR A;  4U8Y D;  3DPY A;  2VTB B;  3ULE G;  3CQC B;  2MOW A;  2XEE A;  4JXT A;  3CST A;  4JD2 G;  2WB2 A;  5LP0 A;  5CEA A;  3V79 K;  4QFV A;  5KJK A;  1H2V C;  3SI5 A;  2HM8 A;  3R9M A;  1Y6I A;  1TYQ G;  5D0Q D;  4U0U A;  4D10 C;  1EYH A;  4CT4 A;  1TR4 A;  3FU0 A;  1TNB A;  3PRE A;  4G25 A;  5AQB A;  5CBN A;  5FZS A;  1Y8M A;  3HXD A;  4GCO A;  3TWV A;  3FTY A;  5ENS D;  3LPZ A;  2QYJ A;  3Q15 A;  1L5J A;  1N0R A;  1JWG A;  3C5R A;  3SBS A;  3JQ1 A;  2XGS A;  3U9W A;  2XPY A;  5BNW A;  2IF4 A;  3AG4 E;  4IRU A;  1OWP A;  3DBS A;  3ML9 A;  5LFA A;  3ZUV B;  3T5X A;  4J0U A;  3SGH A;  4YVO A;  3NZU A;  3LEW A;  3FH5 A;  3CHQ A;  4HRN A;  1E90 A;  4P29 A;  2QZA A;  4DI3 A;  4B89 A;  4AVX A;  3FY4 A;  4HB5 A;  4XKB A;  3DSX A;  4XI0 A;  3UM0 A;  3MV2 B;  3ENE A;  5ENR D;  4HQD A;  4IYP A;  3MA5 A;  1SZA A;  3WXX A;  3LCA A;  3C3R A;  3CHP A;  4DPR A;  2HR2 A;  4JA9 A;  3PZ2 A;  2B6C A;  4U8V D;  1N4S A;  4BWR A;  4NRH B;  5ARF A;  2PL2 A;  2X6I A;  2KM4 A;  2GRO B;  3ZGQ A;  1MZC A;  2X6H A;  5A6C A;  4GTM A;  3SBT B;  3J5P A;  4AXH A;  2WM9 A;  4GAA A;  1H6K A;  5CER B;  3B7T A;  3APF A;  1IQR A;  4BY6 A;  4DX1 A;  2GRP B;  4BTB A;  4I2Z A;  1N4P A;  4HS2 A;  1E8X A;  2VTB A;  3LJ3 A;  1V55 E;  3U4T A;  3FTZ A;  5FWQ A;  3TGO A;  1OT8 A;  4AY5 A;  1SA5 A;  2H6H A;  2J07 A;  2ZGD A;  4AOF A;  2EIL E;  1KLX A;  4MLP A;  4GZC A;  3Q9U C;  4ZHB A;  2F37 A;  3Q9N C;  3IBE A;  3CLJ A;  1NZN A;  4UQY A;  1U3C A;  3DRA A;  4JC8 A;  2LAI A;  2DWZ A;  4GB9 A;  4DK5 A;  5KJL A;  2RKK A;  3R7Q A;  4N3C A;  3UT8 A;  1RZ4 A;  1N94 A;  1NI1 A;  4DLQ A;  1HE8 A;  2XPI A;  4Q96 A;  3OXL A;  5E76 A;  2X38 A;  3I3N A;  3LKU A;  2GRM A;  4HNA D;  1HS6 A;  1UW4 B;  4O1O A;  2WXM A;  3TWT A;  2XCC A;  3D9N A;  2IJG X;  1O1R A;  4LNG A;  4FHJ A;  2A4Z A;  4ATG A;  4GTT A;  4Q69 A;  4EPZ A;  3K9I A;  5EX0 A;  3ZU7 B;  3W9G A;  3S2A A;  4AJW A;  1DCQ A;  2XZT G;  5BV1 A;  4A55 A;  3B7R L;  3CVL A;  3NB2 A;  5BXO A;  4GZ6 A;  2XS1 A;  1EPU A;  4CZ2 D;  4J6I A;  3DEO A;  3AG2 E;  2RFM A;  3ZRH A;  2WMO A;  3CSF A;  5G04 C;  4E6H A;  4NQ0 A;  4U07 A;  2XPZ A;  3C3O A;  3S7B A;  4I9C A;  2L6J A;  4XE0 A;  1N4Q A;  3KEZ A;  3JCK C;  4CDN A;  2ETC A;  2XEH A;  4U63 A;  5CHE E;  5AQ9 A;  3UUX A;  2WXR A;  3WG7 E;  1JCS A;  2HO1 A;  4ME2 A;  3VLD A;  4K0R A;  1OWN A;  1H2U A;  3B7U X;  2Y3A A;  3QK0 A;  4CGW A;  2OV8 A;  1HU3 A;  2JLB A;  1MX6 A;  4HVB A;  2YHC A;  2BUG A;  4AV7 A;  3C72 A;  4DX7 D;  3RRU A;  2C0M A;  4TRQ A;  4PS3 A;  4BX8 A;  3QNK A;  2WXL A;  4EEC A;  2CHX A;  2VGX A;  4URK A;  2AW6 A;  4PDX A;  4WND A;  2NC9 A;  1S70 B;  2KCK A;  5FQ8 A;  1MJ0 A;  3KS2 A;  2PQN A;  4OYS A;  2FO7 A;  4I1A A;  3FHE A;  2ZU6 B;  3R7R A;  2WXQ A;  2MHK A;  3DXK G;  2IY0 C;  3FUK A;  3AU4 A;  4CDM A;  4BFR A;  3I5P A;  3LVQ E;  1OCR E;  1TN8 A;  3UTM A;  1UN8 A;  4HRL A;  1K1B A;  5AQ7 A;  1QNF A;  4GYW A;  2GRR B;  2LUH A;  3G2V A;  1BI8 B;  4MRU A;  1Z5S C;  3RAU A;  1O1T A;  3IKO B;  4XI9 A;  4KT6 B;  2LXM A;  5BPP A;  4R7L A;  4TXR A;  2YNQ A;  3TJP A;  2BED A;  5HS0 A;  5EIB E;  3PNT B;  4A63 B;  5G55 A;  3FFL A;  1QQE A;  4CDR A;  2IO3 C;  2QC9 A;  3AS8 A;  3UM2 A;  3URZ A;  5FQ7 A;  1HZ4 A;  3G2S A;  1NL4 A;  3BG1 B;  2J8S D;  3O48 A;  2F0Y A;  4GYO A;  3UM3 A;  2YQ8 A;  2AXU A;  3GZ1 A;  3ZPJ A;  2J09 A;  3FUN A;  2CG2 A;  5G04 J;  4BET A;  3QWW A;  3ZVV A;  4I2W A;  4CEM A;  5KJN A;  1WM5 A;  4J8Y A;  3AJI A;  3ABM E;  3MCX A;  3ZYM A;  4G8K A;  5EX3 A;  2QYU A;  4DLO A;  1MYO A;  4DRX E;  2RFA A;  4XEI G;  1EDU A;  3CVX A;  4N5Q A;  5J90 A;  2IOS A;  3DPD A;  1BD8 A;  2BKG A;  3E34 A;  2WXF A;  1OCC E;  2RG8 A;  3B7S A;  2WVI A;  2LSV A;  5DIZ A;  2XEV A;  5CBO A;  3S7F A;  2V0P A;  2NXP A;  3PEV B;  2MYO A;  2R17 C;  3NOG D;  2LSU A;  2H6I A;  4UUC A;  3L22 A;  2KCL A;  5KNG A;  2M63 A;  1X5B A;  3DSS A;  3UIP C;  4ACL A;  5IY5 E;  1B89 A;  4YVQ C;  4ILI A;  4BEP A;  4M3O A;  1X81 A;  4JHR A;  4A1G A;  4N39 A;  2BKK B;  1WY6 A;  1LD8 A;  3Q78 A;  4I17 A;  4A3V A;  3AS5 A;  1WAO 1;  1K8K G;  3FUJ A;  3L08 A;  4WWO A;  3ULQ A;  3BEE A;  2J9Q A;  2EIK E;  2C0L A;  2LAH A;  1D8D A;  3LY8 A;  3AU5 A;  2V4H C;  3ABK E;  2EQX A;  5H7P A;  2RD0 A;  5CMY A;  5ITZ F;  3GZ2 A;  3UM1 A;  5CCL A;  3E4B A;  2V5F A;  4QQI A;  4CGV A;  1N9A A;  2ZXW E;  1UG3 A;  1HXI A;  4PS8 A;  3I4R B;  3IHV A;  1Z6T A;  3HIZ A;  1BU9 A;  3OAW A;  5LX8 A;  4AIF A;  3APC A;  4JZY A;  3E32 A;  3GZS A;  3ZYK A;  5B1A E;  5LCW C;  1V54 E;  4RSY A;  1JUQ A;  4YND A;  1QZ2 A;  2PZI A;  4BSX A;  4WWP A;  3CVV A;  5JJT A;  3ASG A;  3D9P A;  4LRZ A;  4K03 A;  4AEZ C;  4RLY A;  4Z68 A;  3EDT B;  5KCM A;  3PRZ A;  3U66 A;  3V2O A;  3D9I A;  4UQX A;  1TJF A;  4GPM A;  2X6F A;  2B0O E;  4EHM A;  1QBQ A;  5BW8 C;  3AS4 A;  3UIN C;  3QWP A;  1BPO A;  1FT1 A;  3B95 A;  3FTW A;  3JUE A;  4FLH A;  4GTO A;  4YDE A;  3UQ3 A;  3RO2 A;  1S63 A;  3ZKJ A;  1KZP A;  2VGE A;  5D0O D;  3QDN A;  4BT9 A;  1OCO E;  4JEH A;  5T4Y A;  5C1D A;  1QYM A;  2I9C A;  3AG1 E;  5FT9 A;  3QAQ A;  3MJW A;  4NUR A;  1OY3 D;  1DC2 A;  1KZO A;  4WNF A;  2V8S E;  3JUI A;  5JHB A;  2PM6 A;  3PS6 A;  2DZO A;  5T8I A;  3QAR A;  2X3M A;  1VDY A;  3D9M A;  4H7Y A;  4GPK A;  4V3I A;  1HO8 A;  4ANV A;  4FA6 A;  3L6A A;  3PE3 A;  3HXF A;  4HXI A;  3ZNG A;  3I4G A;  4EZL A;  4UWK A;  3SNX A;  2R05 A;  3Q75 A;  4JPS A;  2WQH A;  4OAU C;  3SY2 A;  2WPV A;  5T3R A;  3TWS A;  3RO3 A;  4FP7 A;  3ZYL A;  3IV0 A;  3KAE A;  3ZEF A;  3T5V A;  3ASH A;  2L6B A;  4U0Z A;  4I9E A;  3FEY A;  4DUI A;  4N5C A;  4GZD A;  4U96 D;  2OOE A;  4LCT A;  4ANU A;  1LF8 A;  2VGX B;  2ZIR A;  3QWV A;  4MS6 A;  1A17 A;  3Q4A B;  5BT1 A;  3CKC A;  1W3B A;  3L13 A;  5EKQ D;  3CVN A;  3J5Q B;  3P1U A;  3FH8 A;  3HYM B;  2L0I A;  2WMN A;  3NOC D;  5LCW J;  4OVV A;  3AAA C;  4KVM A;  4TV3 A;  1KT0 A;  4UWL A;  3LYA A;  1A5E A;  2XGO A;  5EDS A;  2I1J A;  5KBA A;  4KXK B;  1SW6 A;  4BES A;  2E2E A;  3UMV A;  2OND A;  4G2V A;  3NQP A;  2NSZ A;  3RSE G;  3CVU A;  3Q49 B;  3ZFW A;  2VGY A;  1KPS B;  4CCA A;  2GW1 A;  3CK7 A;  1ELK A;  1LTX A;  3DSU A;  4B0Z A;  4C48 B;  3D9K A;  3T8K A;  1NP7 A;  4UWG A;  3SO8 A;  1E8W A;  2BTD A;  2OCC E;  4N3A A;  3C3Q A;  2P9L G;  3GYZ A;  2VSX E;  4GCN A;  4AP2 A;  2IU1 A;  3PE4 A;  3F6Q A;  5CMW A;  4LEU A;  4Q94 A;  3SHF A;  3PDN A;  2FUL A;  1DNP A;  1FT2 A;  3TWU A;  2WXJ A;  3TL5 A;  1FCH A;  4U95 D;  3EHR A;  2CFZ A;  2XCB A;  3L17 A;  3IXE A;  4G23 A;  4HOS A;  5JJ6 A;  2IQC A;  4WNE A;  2DYS E;  2WXN A;  1N95 A;  2X6K A;  3PZ3 A;  3CHO A;  2XEN A;  4TUM A;  3FDH A;  2F8X K;  3FTU A;  4WUY A;  3Q73 A;  2GRL A;  1N54 A;  5JA4 D;  2ILR A;  1N11 A;  5AAO A;  3L54 A;  1OCZ E;  3UX4 A;  3EHQ A;  3LDZ A;  1S64 A;  2OVB A;  4CRW A;  3QOU A;  2P9U G;  2KAT A;  3SFZ A;  4ZFH A;  4KBQ A;  3FUF A;  3FUD A;  2WXO A;  2P9I G;  4NAC A;  1TNY A;  1H0A A;  2WXG A;  4TXP A;  5ENP D;  3PZ1 A;  4APO A;  1Q2Z A;  2CHW A;  4DI4 A;  4FUL A;  2EIN E;  5FIN A;  2MRI A;  5ANR A;  3CVW A;  4ILH B;  3UT7 A;  3UPV A;  3FUI A;  2IEJ A;  4Y6W A;  3W9F A;  4GTR A;  2KZT B;  3VTX A;  1N4R A;  3EUV A;  2FO1 E;  1XGW A;  3Q47 B;  4RVB A;  1N0Q A;  2ETA A;  1H2T C;  3SZ7 A;  3CHR A;  4U7E B;  2AJA A;  4ABN A;  3VTY A;  4BX9 A;  1TEZ A;  2WXK A;  1IQU A;  4KYO B;  3FTV A;  1U2V G;  3ZXP A;  3TWX A;  2CFU A;  4J8E A;  5AJL A;  3LY7 A;  4G1T A;  2YHE A;  3E33 A;  2L0T B;  4K5A B;  3HDX A;  4O60 A;  3BG0 B;  1XNF A;  1BI7 B;  2Y1L E;  3CR3 A;  4GTV A;  4I6G A;  5EN5 D;  5FJY A;  3S7D A;  1MQS A;  1MX4 A;  2DCP A;  3DXM G;  3S7J A;  1YMP A;  4B8C B;  1JPL A;  2IFU A;  1G3N B;  5AYW D;  4OVU A;  5C2Y A;  5D66 A;  3DWL G;  2AWI A;  2XHE A;  2X6J A;  4I6E A;  5CRU A;  5KWD A;  3G2U A;  4W9R A;  1JCR A;  1K3Z D;  4MKT A;  3D3M A;  4GTS A;  3D9L A;  1TJC A;  3HG0 D;  3G2T A;  4LG6 A;  4GU5 A;  4TUU A;  2XS8 A;  1IHG A;  4FHK A;  4UI9 C;  5EIL A;  2E0I A;  2FEZ A;  3ABL E;  3GW4 A;  3TXN A;  5G05 J;  2FF4 A;  3CEQ A;  3EHM A;  2J49 A;  3CHS A;  1YYH A;  2GRN B;  4B94 A;  3EIJ A;  1OXJ A;  3RIB A;  3QB2 A;  4IUL A;  5FIO A;  4N3B A;  3KEA A;  1FVH A;  4J7W A;  4DX6 D;  1PAQ A;  3MKR A;  5AN8 A;  4N2S A;  1FVF A;  5EID A;  4Y6C A;  3Q5M A;  1IKN D;  4G8L A;  4K5B A;  5D2M C;  3LS8 A;  3L82 A;  2KZT A;  4ANW A;  4HLE A;  1WG0 A;  2A5U A;  5CEC B;  4FLB A;  3EHN A;  3Q7A A;  3LY9 A;  4UQZ A;  4ATZ D;  3SFY A;  3G2W A;  2CG3 A;  4MBG A;  1TNU A;  3MKQ B;  3QC1 A;  3FU6 A;  3UIO C;  1UN9 A;  3L16 A;  2UY1 A;  3SQV A;  3NZS A;  3RJV A;  1O5M A;  4JW1 A;  3ULY A;  3CIA A;  4HI8 A;  2HYZ A;  2DBA A;  4EBA G;  1OUV A;  3FUL A;  4FAD A;  3FTS A;  2HE0 A;  3EU9 A;  3E37 A;  3QJZ A;  3NF1 A;  4BTA A;  3FH7 A;  3HVE B;  3TWQ A;  4HFG A;  3VLF A;  5AQA A;  5ENQ D;  2Y4U A;  1MX2 A;  2JAB A;  2ZIS A;  3ZYQ A;  1OWL A;  1UOH A;  3UXG A;  3RK6 A;  1YA0 A;  4J8D A;  3ASO E;  3ASD A;  3CHM A;  3KSQ A;  4HLL A;  3JQ0 A;  2P9P G;  1S0P A;  5E75 A;  4GTQ A;  4N2Q A;  4RQI A;  5KJM A;  4JA7 A;  3BUA A;  2Y0B G;  1E7U A;  4KZ0 A;  5AIJ A;  5B1B E;  1LD7 A;  3FP3 A;  1INZ A;  2V5Q C;  3ONL A;  1H19 A;  1SVX A;  3DSW A;  4YDO A;  3N71 A;  4LSZ E;  4A3T A;  4LUN U;  2H6F A;  4XKC A;  4L2Y A;  1UJK A;  4YDW A;  5JMN D;  2FI7 A;  2QY7 A;  4BSZ B;  2DVW A;  2I2O A;  4UI9 J;  1IYG A;  4NIK A;  4EBA A;  2OVF A;  1EF1 C;  3V2X A;  3LJN A;  2DYR E;  1UJJ A;  2ZGG A;  3HXC A;  4L9P A;  5HKP A;  4OAV B;  5J08 A;  4FC8 A;  1HG5 A;  4L23 A;  4DJA A;  2KCV A;  3PNL B;  5DBK A;  2V4L A;  2AXZ A;  2VYI A;  4GA0 A;  3DEP A;  4F53 A;  3ONK A;  1MHQ A;  3OXG A;  5EYL A;  2R03 A;  5BUZ A;  3OXF A;  2P9S G;  3FU3 A;  2J08 A;  2KBX A;  4JHJ A;  2F8Y A;  2H6G A;  1JWF A;  3UKR G;  4PH4 B;  4JVS A;  4O6F A;  1ZBP A;  3PUK A;  3B13 A;  5JJ7 A;  5FQ6 A;  4I1O B;  4RG6 A;  4JB8 P;  4F1P A;  4UWF A;  3MKQ A;  3KSL A;  4YDY A;  5M72 A;  4FU3 A;  3R9A B;  1PY1 A;  2VQ2 A;  3V30 A;  4AM9 A;  1HG2 A;  1TN6 A;  3HXE A;  1SZ9 A;  1SA4 A;  3HXB A;  2JEK A;  4FJY A;  2I1K A;  1TN7 A;  3UI2 A;  4UI9 K;  3ML8 A;  5FTP A;  4M7C A;  3FUM A;  3MV3 B;  3PVL A;  2YIN A;  4HOR A;  3HVE A;  4G24 A;  2VSO E;  3RU0 A;  4C0M A;  5FZQ A;  3RRN B;  4I1M A;  3ZW3 A;  3ZHE B;  3P2B A;  2OEW A;  1KT1 A;  4GMJ A;  1BLX B;  2VSY A;  2PNN A;  4ACK A;  4JHK A;  3EIQ C;  4CYM D; 
#chains in the Genus database with same CATH homology
 1TNZ A;  2IEJ A;  1FPP A;  4GTS A;  3E37 A;  1JCQ A;  3DSS A;  1JCS A;  4GTR A;  1D8E A;  1N4R A;  3EUV A;  1X81 A;  3SFX A;  4EHM A;  1FT2 A;  1QBQ A;  2H6G A;  2ZIS A;  2ZIR A;  1FT1 A;  1LD8 A;  1NL4 A;  4GTO A;  4YDE A;  1S63 A;  3Q78 A;  3C72 A;  3DRA A;  3KSQ A;  2F0Y A;  3DSX A;  1KZP A;  3DPY A;  3Q7F A;  4GTQ A;  1N94 A;  1NI1 A;  3PZ4 A;  3KSL A;  1D8D A;  4LNB A;  3DSV A;  1DCE A;  3PZ3 A;  1N95 A;  1LD7 A;  1SA4 A;  1TN6 A;  3HXE A;  3HXB A;  1TN7 A;  3DSW A;  4YDO A;  3PZ2 A;  1KZO A;  1O1R A;  4LNG A;  3Q73 A;  3E33 A;  1N4S A;  2H6F A;  4GTT A;  1TNB A;  4GTP A;  3EU5 A;  4GTV A;  1N9A A;  3HXD A;  1MZC A;  1S64 A;  4GTM A;  3E34 A;  3Q7A A;  1TN8 A;  3HXF A;  1LTX A;  3SFY A;  3DSU A;  4MBG A;  1TNU A;  3E32 A;  1TNY A;  3E30 A;  3Q79 A;  1O1S A;  3HXC A;  4L9P A;  1N4P A;  3PZ1 A;  1O5M A;  1O1T A;  1N4Q A;  3Q75 A;  2R2L A;  3DST A;  1JCR A;  2BED A;  1SA5 A;  1TNO A;  2H6H A;  2H6I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...