1EDUA

Crystal structure of the enth domain of rat epsin 1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
149
structure length
149
Chain Sequence
b'NIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain binding protein EPSIN
publication title Epsin 1 undergoes nucleocytosolic shuttling and its eps15 interactor NH(2)-terminal homology (ENTH) domain, structurally similar to Armadillo and HEAT repeats, interacts with the transcription factor promyelocytic leukemia Zn(2)+ finger protein (PLZF).
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 51
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2000-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1eduA00
4Q96A 1VDYA 3LDZA 1PY1A 5LP0A 3D9KA 1ELKA 3D9PA 3G2WA 2QY7A 3D9IA 5J08A 1EDUA 3D9OA 4FLBA 4JXTA 2MOWA 2BF0X 2L0IA 3CLJA 3D9LA 1EYHA 2LO6A 1JUQA 3D9JA 3D9MA 4FU3A 4GZCA 1HFAA 3D9NA 1JWGA 4GZDA 3ZYMA 3ONKA 2V8SE 1X5BA 4HFGA 3G2SA 4NACA 3RRUA 1LF8A 2DCPA 2KM4A 3ZYQA 1SZ9A 1JPLA 3ZYLA 3ZYKA 1H0AA 3ONLA 3G2UA 1HX8A 1UJKA 1HF8A 2L0TB 1DVPA 4AVXA 1INZA 5CMWA 1JWFA 5LOZA 1UJJA 1HG2A 1MHQA 1XGWA 3G2VA 2DIWA 4Q94A 1HG5A 5CMYA 3G2TA 1SZAA
chains in the Genus database with same CATH superfamily
1N4SA 4MLPA 3OXGA 3FU5A 4ANXA 3PNTB 1MX6A 1H19A 3RRNB 3ZEFA 3SGHA 2GRLA 3NOGD 2BKKB 2H6GA 3FUHA 3EHQA 4H7XA 5IY5E 4LNGA 3RKVA 4G24A 1EPUA 4DK5A 2J09A 5FWQA 4KVMA 4LG6A 3LJNA 5M72A 2Y1LE 4GPKA 4RSYA 4LCTA 4HNAD 1HX8A 3DBSA 3PDNA 2XEVA 4HRNA 1ELKA 4N3BA 5ENQD 3UT7A 4GU5A 1U3DA 3T8MA 3ZW3A 3E33A 1OWPA 4JXTA 4D10C 4LRZA 1D8DA 3CVPA 1WY6A 3BQOA 3CVVA 5AARA 3JUIA 1LD8A 2X38A 2R17C 1BI7B 2IFUA 1N95A 4ZFHA 5HS0A 4HS2A 2J8SD 1K1AA 5FTPA 1TN8A 1OCZE 1MYOA 1IHBA 3CHRA 3ZYKA 3ONLA 1MX4A 4U0ZA 3QOUA 3B95A 1YYHA 2DIWA 4IYPA 3FU0A 5H7PA 4HI9A 5KJMA 2L0IA 3CGHA 3S7DA 2VGXB 2L6BA 2PQRA 3FTYA 3SNXA 2XQ0A 2I1JA 1PY1A 4C0MA 3UXGA 1EDUA 4U95D 4L2LA 3FUDA 1E7UA 4DUIA 2F8YA 4JC8A 2A5UA 3MKQB 4GYOA 1DVPA 3CHSA 2V4LA 2ZGGA 3W9GA 5FINA 2J07A 3J5PA 3J5QB 4I17A 3QB2A 1S70B 3X2QE 2WXPA 4AV7A 5JJTA 3CQCB 4F1SA 1S63A 4L9PA 1E96B 1N11A 4GMRA 5FZSA 1FT1A 2L0TB 4L7TA 2JLBA 4XKCA 1K1BA 5CECB 4AM9A 2WQ7A 4CGVA 3Q4AB 4LNBA 4FLHA 4JEUA 4V3IA 1FPPA 3D3MA 4DX7D 3FTZA 4BETA 2IOSA 4I1MA 5EKQD 3RRMB 2PL2A 5AQ9A 4PS7A 3Q49B 3PE3A 4DX5D 2I6HA 2PZIA 3S7FA 3QC1A 2GRPB 4Y6CA 2XGOA 3ZYQA 1NA3A 3JQ0A 4WNEA 1SZAA 4KZ0A 2XS1A 4F3VA 3BG0B 3DSVA 2WXMA 4HQDA 2VGYA 4H7YA 1UN9A 2CG3A 1KT0A 3UM0A 2UY1B 2XRZA 4HFGA 2ZIRA 4K03A 3DRAA 3Q9NC 3TWSA 2MRIA 3G2VA 3PUKA 2CFUA 3ZNGA 3PZ2A 1H6OA 3LXUX 4U8YD 4LUNU 2F37A 1EF1C 5T4YA 2PM6A 3FUJA 1D8EA 2ZISA 4UQXA 4BWRA 3JXJA 4TV3A 1HG2A 3SFYA 2OOEA 3Q7FA 1OCOE 3JQ1A 2IF4A 5AENA 3L9TA 3RO3A 4G23A 2DCPA 2C0MA 3B13A 4GTRA 1BLXB 3VLFA 3SZ7A 1HE8A 4WNGA 1WAO1 2RFMA 2LNIA 4RLYA 3D9PA 1YA0A 4HXIA 5CCLA 3ABLE 4U0SA 4OVUA 5CCMA 1FVHA 2VSNA 2R2LA 2WXGA 2NC9A 5FIOA 3U9WA 3MCXA 3OXFA 3CVNA 4FLBA 4JHKA 2BTDA 4BERA 3FTVA 1E7VA 2YINA 3OAWA 1SW6A 4LEUA 2X6FA 2EIME 3QWWA 4O6FA 3FFLA 2J9QA 3ESLA 4UWKA 2PNNA 3LEWA 4GAAA 1GW6A 1N4PA 4CDRA 3R9AB 3ZUVB 5A6CA 2V5FA 5KNHD 5HI7A 4OVVA 1N9AA 3U3WA 5T8IA 3NB2A 1E8WA 3CVWA 4BTBA 3CKBA 5JHAA 2JABA 3CVLA 3CIAA 3D9MA 3V30A 1IXVA 4BESA 3TG5A 5T3RA 4U0UA 4YVOA 4FC8A 1TJCA 4CDNA 3ZU7B 5A7DB 2CHWA 2H6HA 5D0OD 4FA6A 3DPDA 4HRMB 4K5CA 3B7UX 3ASFA 3LY7A 1YCSB 4YDOA 3B7BA 3TGOA 2ZU6B 3LY9A 5KWDA 4OAVB 3DPYA 3AG2E 4JVSA 4CCAA 4IN3B 3HVEA 2WM9A 3MEKA 3WG7E 4O1PA 3FP3A 4P29A 1Q2ZA 4CGWA 4YNDA 4G26A 1PAQA 2VGXA 2IY0C 3HXDA 3ASNE 5DIZA 4UI9K 5AYWD 1QBQA 1Y8MA 4RG9A 3RK6A 3SFXA 2EILE 4OAUC 2XPIA 4J8DA 4TUUA 3MKQA 2J49A 3R9MA 1MZCA 1WDYA 3MKRA 3UI2A 4NQ0A 5KCMA 2ETAA 4XI9A 4JZYA 3S7JA 4GTVA 3CK9A 4G11A 1P5QA 4WWOA 2PQNA 3FH7A 1N52A 3QARA 1MJ0A 4XEIG 3AU5A 2VQ2A 4F6RD 4I6GA 5G04C 2R05A 3Q9UC 3CK7A 4N5QA 3D9LA 3ZIMA 3P1UA 3LJ3A 3RJVA 3HXCA 4B94A 2X6HA 3ZYLA 2XPZA 3R7RA 2LXLA 3UQ3A 3FTXA 4QFVA 4M7CA 5B3SE 1TNOA 1IKND 5AAOA 1N94A 2VTBB 2HYZA 4JL0A 4EZJA 1OWNA 4UWGA 5HRYA 2RD0A 5FQ4A 4ACKA 5KJKA 1HZ4A 5CEAA 2F8XK 1JCSA 2GW1A 2EQXA 3E32A 4XI0A 1H2TC 1X81A 4C0EA 2WXJA 3MX3A 2BKGA 4HOSA 2V0PA 3L16A 4N39A 2HO1A 5HQ8A 3CV0A 2L6JA 2VSYA 3TXMA 3ULQA 5JJ6A 3LYAA 2LUHA 3I4GA 4R7LA 3TJPA 4KT6B 4FJYA 3CHMA 5FQ6A 3HHMA 4G8LA 5ARGA 1JWFA 3FUIA 1BU9A 3E34A 3CSTA 1TNZA 1WM5A 2C2LA 3E30A 5CBNA 3IBEA 3MV3B 3I5PA 4APFA 3R7QA 3I3NA 2YNQA 2E2EA 4NACA 3LCAA 2QFCA 4KMOA 1SZ9A 1H0AA 3ASOE 2XPYA 2KCVA 4ATGA 3CHQA 3UINC 1N4QA 4EQFA 3QK0A 5CEDB 4K0RA 2V5QC 5FJYA 3DXMG 2XGSA 1ELWA 4ABNA 3QJZA 2NXPA 2CG2A 5EX3A 3UT4A 2RG8A 3FH8A 1HXIA 4IULA 3ML8A 1DCQA 4M3OA 4J8YA 4L2YA 4YDYA 5JMND 4E6HA 4URKA 5CHEE 3ONKA 1Z3YA 3RU0A 2I9CA 3AS8A 4GTQA 1JCRA 3FU6A 4HOTA 5AQAA 3L22A 3ML9A 3VLEA 4L1BA 2OCCE 2XHEA 4GTSA 3G2SA 3DEPA 3FEYA 4J0UA 1TNUA 2KC7A 4GZ6A 4UQYA 5ENPD 1OY3D 1H6KA 4UWFA 4U8VD 2IOLA 4HLEA 3RRUA 2DBAA 5D2MC 5JJ7A 2OEWA 3L08A 3AS4A 1MHQA 2AVPA 2EIKE 3FUNA 4Q69A 3EHMA 3LVQE 3SO8A 2NYJA 5CMWA 3PZDA 4X8QA 1JWGA 4J8SA 2FBNA 4LSZE 4FJZA 4DI4A 5CRUA 4UI9C 2IJGX 2C0LA 4MBGA 3SBTB 5ARFA 4A3VA 3D9IA 2WXLA 2I2OA 2XZTG 3SQVA 4RQIA 4JEHA 1U3CA 5ITZF 1O5MA 2ETCA 2HM8A 2X3MA 5ENRD 2A4ZA 2KM4A 3OTNA 4F1PA 2Y4TA 5KJNA 3KSQA 3IKOB 2Y3AA 4BY6A 4JPSA 3C3OA 3PZ4A 2M63A 1Z6TA 3AG1E 3PE4A 4G8KA 3KSLA 2P9PG 4AP2A 3EJNA 3EUVA 4ATZD 3AJIA 5G2NA 3UIPC 4WWPA 2VYIA 4B8CB 3MZLB 3L6AA 4FP7A 3L17A 4EPZA 2FI7A 1VDYA 2QYJA 1UOHA 4F53A 3CLJA 1HH8A 2V8SE 3ASDA 3MV2B 3SHFA 4U07A 3S2AA 2QY7A 4GZ5A 2JEKA 3TAXA 2MOWA 1KZPA 1L5JA 4GYWA 5D66A 2WXNA 2XEHA 3IXEA 1E8XA 1V55E 4ANUA 3DXKG 4EZLA 5BNWA 2CHZA 3FUEA 5LCWC 4TXQA 3TG4A 3Q73A 3OXLA 4BT9A 3ZHEB 4JD2G 3GYZA 4NIKA 2VTBA 2R5SA 2AWIA 4B89A 3G2UA 4GTPA 1LD7A 1OUVA 1TEZA 5CMYA 1NL4A 5EIDA 1RW2A 4I2WA 3SBSA 4KVOA 1BI8B 1UW4B 3O48A 4AJWA 2OVBA 1TNBA 3ASHA 2ILRA 3MYVA 1KZOA 4A55A 4HRLA 4AXHA 4APOA 3TWRA 5C1DA 1O1SA 2WXQA 4GB9A 4EBAG 4GA1A 5BPPA 4HVBA 1FCHA 2XZDG 3EHNA 3Q47B 3FUFA 4JHJA 4J8EA 3JUEA 4IRUA 4GCNA 1O1TA 3ASGA 4WAFA 4U8HA 3FEXA 4AEZC 2J08A 2XENA 4U7EB 3T5XA 2LSVA 4C48B 3FHEA 1U2VG 4B8AA 5E75A 4KZCA 3EIJA 4LERA 3BEEA 5HKPA 2IO2C 5ENOD 3Q79A 5FZRA 3AS5A 5LX8A 4B0ZA 3VTYA 5ENTD 5KNGA 3E4BA 2WPVA 3UKRG 4YDEA 4EECA 2FEZA 4FHJA 3NZUA 3HXFA 2LAIA 3L13A 4MKTA 5DBKA 5EYPF 2BUGA 2P2CP 3CVUA 2B0OE 2E0IA 2LXMA 3IEGA 5J08A 4LNUD 4UUCA 3APFA 1KLXA 3UUXA 3RO2A 3ZRHA 3VTXA 5CERB 3U4TA 3UM3A 2VSXE 3APDA 3MGBA 3HXEA 3ZN3A 2DYRE 5C2YA 2AJAA 2GRQB 4TXPA 1LTXA 5AQ7A 1AP7A 3D9NA 5G04J 3ENEA 5LFAA 2XEEA 2WB2A 3TWQA 1BPOA 3ISMC 4FADA 1OWOA 4ILHB 5EIBE 3TWTA 5KJLA 4E85A 4CYMD 3MJWA 2GRNB 1KPSB 3O4ZA 3RSEG 3UM2A 3D9JA 4GZDA 2WMNA 3GZSA 2FF4A 1TNYA 4W9RA 3B7TA 5AJDA 2FULA 1ZB1A 2LSUA 4TXRA 3Q15A 2WXOA 2UWJG 2XS8A 2H6FA 4BFRA 1DCEA 2LAHA 3PVLA 2LO6A 5ENNA 4HOQA 3NF1A 4YVQC 3IHVA 1TYQG 4A3TA 3ESKA 1NA0A 2Y0BG 4GYYA 3V2OA 2OEVA 3ZKJA 2P9LG 3CHPA 2EIJE 5BXOA 5BXUA 4KYOB 4C9BB 2IEJA 2DZOA 5E76A 2X6KA 4XX5A 4HOUA 2P9SG 3T9KA 4I9EA 3B7RL 5FQ7A 1IHGA 3ZFWA 5CRVA 3PH0C 2AXUA 2R02A 3UPVA 4RVBA 1HS6A 5KBAA 4KXKB 5EYLA 3LPZA 2ONDA 3F6QA 3V79K 4MS6A 2VJ8A 5JHBA 2UY1A 4Q94A 4AY6A 5G05C 1DNPA 2P9UG 5AJLA 4N3CA 4BX9A 1SA5A 5BW8C 3TXNA 4CRWA 1S0PA 4DI3A 3FWVA 3JYSA 4I6EA 2R59A 2XGMA 1TN6A 4GA2A 2QZAA 2KZTB 2PM7A 3I4RB 3FTWA 2XCCA 1IQRA 4ZHBA 2WVIA 2B6CA 3C72A 4TUMA 3LY8A 3HYMB 4PUCA 2FO7A 3ZHEA 2AXVA 3SD5A 1N54A 1SA4A 3BUAA 5FZQA 4CDMA 4CT4A 5AQBA 2QYUA 3UMVA 3ZPJA 1XNFA 4CZ2D 3AAAC 1H2VC 3NBNB 4JA7A 1WG0A 2WXIA 4NURA 3HIZA 4N2SA 2XCBA 3EHRA 2Y69E 3FDHA 3FH5A 5AN8A 4GA0A 2RFAA 3C5RA 4EZKA 2RKKA 3LDZA 3PZ1A 2Q7FA 4WUYA 4B93B 4OYSA 4RG6A 4K5AB 4G2VA 1DC2A 1OXJA 2KBXA 4HB5A 4U96D 3SY2A 2A5EA 1BD8A 5BV1A 4DRXE 3K9IA 4UI9J 1B89A 3HVEB 1SQMA 2GROB 2P58C 4WNFA 4ME2A 4O1OA 5D0QD 2HE0A 5J90A 4KBQA 2WQHA 3DSSA 4XKBA 1LF8A 3ZXPA 4AIFA 4ILGA 2P9IG 4O60A 1OWMA 2J4DA 3PEVB 5G55A 2YHCA 4AY5A 3C3QA 4Q96A 4BEPA 3G2WA 1Z3XA 5BT1A 3FULA 5BUZA 4FU3A 4JB8P 2GGFA 3TWXA 3NAWA 3E37A 3Q75A 4DLOA 2IU1A 3FUKA 3CHOA 3SF4A 4J7WA 1OWLA 4GTTA 3U64A 4DLQA 4N5CA 2VGEA 2IONA 3PNLB 4BTAA 3NOCD 4DPRA 3FTSA 1D9SA 4I6JA 3TL5A 3VLDA 3EIQC 2DWZA 3KEAA 4UQZA 3C98A 2MYOA 3P2BA 3TWWA 1OCRE 1K3ZD 4L23A 3UT8A 2WXKA 3JCKC 1N0QA 3PRZA 4FHKA 2DZNA 4BSXA 3EU5A 1NP7A 2X6IA 2DVWA 2XRYA 4CT0A 1MQSA 3SI5A 1HF8A 4I2ZA 3C3RA 4AOFA 4WWNA 4GCOA 3QNKA 3KEZA 3CR3A 4GMLA 1HO8A 1SVXA 3KAEA 4I1AA 2IO3C 3IV0A 2I1KA 1K8KG 4A1GA 5LCWJ 4U04A 2EINE 5EN5D 1A17A 3UIOC 4G25A 3GZ1A 3QWPA 3D9OA 3NQPA 1NFIE 1JUQA 2WXFA 1TN7A 3DSXA 2L9BA 2WXRA 3ABME 3PEUB 1UJJA 3L82A 2AXZA 2MHKA 1HG5A 2WMOA 3G2TA 3DSTA 3D9KA 4ANVA 1NI1A 3FTUA 3T8KA 4ANWA 4K5BA 5EX0A 3RAUA 2WXHA 2CHXA 2CFZA 4UWHA 1W3BA 4A1SA 2KXPC 4BT8A 1Z5SC 5BV0A 2YHEA 3CSFA 3UKUG 4Z68A 3AG4E 3EU9A 1IQUA 5LP0A 3HXBA 1OT8A 4MRUA 3PZ3A 2ETBA 2P9KG 4F7AA 2ZXWE 5EILA 1JCQA 1H2UA 4I9CA 2HR2A 1UJKA 3CQGB 4AVXA 3APCA 4G1TA 1FVFA 3UTMA 5EDSA 3RIBA 4J6IA 3BU8A 3FUMA 4NRHB 3PS6A 2BF0X 3PREA 1EYHA 1TR4A 3HDXA 1UN8A 3QAQA 4JHRA 4J8FA 4GMJA 4EHMA 2X6JA 4FULA 2KZTA 3CVYA 3TWUA 1N0RA 1V54E 3FU3A 3IHYA 2DYSE 4GPMA 3QDNA 3ULYA 3W9FA 4BSZB 1ZBPA 4ILIA 5FT9A 3S7BA 1QYMA 3BG1B 3T5VA 4BX8A 1INZA 3ZGQA 3QWVA 3URZA 4XZ4A 5B1BE 5JA4D 4CEMA 1ZU2A 4HLLA 2FO1E 5B1AE 4N3AA 4I1OB 3B7SA 3GW4A 5AIJA 3ZYMA 1HFAA 4PDXA 4TRQA 3LKUA 2WQ6A 3FY4A 4JW1A 4PH4B 3KD7A 1Y6IA 4EBAA 3KS2A 1HU3A 2P9NG 1XGWA 3ABKE 3HG0D 3CKCA 3LVRE 3DEOA 2GRRB 4N2QA 3Q78A 1RZ4A 3Q7AA 4XE0A 1A5EA 1NZNA 4DJAA 1AWCB 2OV8A 2QC9A 5ENSD 2YQ8A 3MA5A 1IYGA 3QKYA 1E8YA 1ELRA 4GZ3A 3L54A 1X5BA 3WXXA 1JPLA 3CVQA 1QZ2A 2AW6A 4DX1A 4HBDA 5A23A 2VSOE 1E8ZA 1N4RA 5CBOA 1QNFA 5ANLA 4DX2A 4JA9A 1E90A 3UX4A 2V4HC 1TJFA 4GTMA 4YDWA 2KCKA 1YMPA 1G3NB 3JXIA 3Q5MA 3N71A 4Y6WA 2IQCA 1H6PA 4PS3A 3EDTB 2H6IA 3DSUA 2KCLA 3CVXA 1S64A 3DSWA 3AU4A 3V2XA 3LS8A 1KT1A 3NZSA 4A63B 3SFZA 2KATA 3DWLG 3HRAA 3D9HA 5G05J 4HORA 1O1RA 3CEQA 2GRMA 4GTOA 4GZCA 3ULEG 3CK8A 3TWVA 3PUJA 3UM1A 4ACLA 2ZGDA 5LOZA 4WNDA 5FQ8A 3U66A 4DX6D 1PC2A 4I43A 2OVFA 5ANRA 4QQIA 4UWLA 3V31A 4PS8A 3ZVVA 2R03A 4HI8A 4U63A 2Y4UA 3AG3E 1MX2A 1UG3A 2NSZA 2BEDA 2F0YA 4XIFA 1OCCE 1QQEA 1FT2A 2J4BA 3GZ2A 3ZXSA
chains in the Genus database with same CATH topology
4Q96A 4MLPA 3OXGA 3FU5A 4ANXA 3G2WA 3FUEA 3PNTB 5LCWC 1Z3XA 3B7UX 1H19A 3RRNB 5BT1A 3ASFA 3ZEFA 3FULA 3LY7A 5BUZA 3TG4A 3TGOA 2ZU6B 3LY9A 3OXLA 3ZHEB 4BT9A 4JVSA 4CCAA 4FU3A 3GYZA 3SGHA 4IN3B 2GRLA 2GGFA 3HVEA 2WM9A 2VTBA 3MEKA 2R5SA 2AWIA 4DLOA 4B89A 3G2UA 3FUHA 3FP3A 4H7XA 4P29A 1OUVA 2IU1A 4CGWA 4YNDA 3FUKA 4G26A 1TEZA 1PAQA 3CHOA 5CMYA 4G24A 2VGXA 3RKVA 3SF4A 4I2WA 1EPUA 5DIZA 4UI9K 5AYWD 1OWLA 3U64A 4DLQA 3SBSA 4KVOA 4N5CA 1UW4B 1Y8MA 4DK5A 2IONA 4RG9A 3RK6A 2J09A 3O48A 3PNLB 4BTAA 4AJWA 2OVBA 5FWQA 3ASHA 2ILRA 4KVMA 3MYVA 5M72A 4GPKA 4RSYA 3FTSA 4DPRA 4LCTA 4A55A 1HX8A 3DBSA 4AXHA 4APOA 2XPIA 4I6JA 4J8DA 3TL5A 3VLDA 4TUUA 3MKQA 2J49A 5C1DA 3EIQC 3U4TA 3PDNA 2WXQA 4UQZA 2XEVA 3C98A 3MKRA 3P2BA 4NQ0A 1ELKA 4N3BA 4GB9A 3UT7A 4GU5A 1U3DA 3T8MA 4L23A 3UT8A 4GA1A 3ZW3A 2WXKA 3JCKC 5KCMA 4EBAG 4XI9A 1OWPA 4JXTA 5BPPA 4JZYA 3PRZA 4FHKA 4BSXA 3S7JA 4HVBA 1FCHA 1NP7A 2X6IA 3CK9A 4D10C 3EHNA 2XRYA 4LRZA 4G11A 3Q47B 4CT0A 1P5QA 1MQSA 3CVPA 3FUFA 2PQNA 4JHJA 1WY6A 3FH7A 4J8EA 4WWOA 3SI5A 1HF8A 3CVVA 4IRUA 3JUIA 4GCNA 1N52A 3QARA 4I2ZA 4AOFA 4WWNA 4GCOA 3AU5A 2VQ2A 2X38A 3QNKA 2R17C 3ASGA 4WAFA 3KEZA 4U8HA 2IFUA 3CR3A 4I6GA 5G04C 3FEXA 4GMLA 4AEZC 1HO8A 2J08A 3CK7A 3T5XA 4HS2A 2LSVA 3FHEA 3D9LA 4B8AA 3ZIMA 3KAEA 5E75A 3P1UA 5FTPA 4I1AA 3LJ3A 3IV0A 2I1KA 4A1GA 5LCWJ 4KZCA 3EIJA 3RJVA 4B94A 4LERA 3BEEA 2X6HA 3CHRA 3ZYLA 3ZYKA 2XPZA 3ONLA 4U0ZA 3R7RA 4U04A 3UQ3A 3QOUA 5FZRA 3FTXA 4QFVA 2DIWA 3AS5A 1A17A 5LX8A 4G25A 4B0ZA 4IYPA 3VTYA 3FU0A 3GZ1A 3E4BA 3QWPA 2VTBB 2HYZA 3D9OA 3NQPA 4JL0A 5KJMA 2L0IA 2WPVA 4EZJA 1JUQA 2WXFA 1OWNA 3CGHA 4UWGA 2RD0A 5FQ4A 2FEZA 4ACKA 4EECA 1HZ4A 5KJKA 2L9BA 4FHJA 3NZUA 3S7DA 2VGXB 2GW1A 2LAIA 2EQXA 3L13A 4MKTA 4XI0A 2PQRA 2WXRA 1H2TC 2CHZA 3FTYA 5DBKA 3PEUB 2BUGA 1UJJA 3SNXA 3CVUA 2AXZA 2MHKA 1HG5A 2WMOA 2XQ0A 3G2TA 4C0EA 2I1JA 1PY1A 2WXJA 2E0IA 3D9KA 3MX3A 4C0MA 4ANVA 3IEGA 2V0PA 3FTUA 3L16A 5J08A 4HOSA 4N39A 1EDUA 2HO1A 4L2LA 4ANWA 4AY5A 5HQ8A 3CV0A 5EX0A 3APFA 3FUDA 2L6JA 2VSYA 2WXHA 2CHXA 1E7UA 1KLXA 3TXMA 3UUXA 2CFZA 3RO2A 3ULQA 5JJ6A 3LYAA 4UWHA 1W3BA 4JC8A 3ZRHA 3I4GA 2A5UA 4R7LA 4A1SA 3MKQB 4BT8A 3TJPA 3VTXA 4KT6B 4FJYA 5BV0A 3CHMA 5FQ6A 4GYOA 1DVPA 2YHEA 3HHMA 3CSFA 2VSXE 1JWFA 3APDA 3CHSA 2V4LA 3FUIA 3MGBA 5ARGA 2J07A 3CSTA 3ZN3A 1IQUA 1WM5A 4I17A 5LP0A 5C2YA 2C2LA 3QB2A 2WXPA 4MRUA 4AV7A 3IBEA 5JJTA 4F7AA 3CQCB 3MV3B 3I5PA 4APFA 4F1SA 3R7QA 3D9NA 5G04J 3ENEA 3I3NA 2YNQA 5LFAA 2E2EA 4NACA 3LCAA 1E96B 1H2UA 2QFCA 5FZSA 2WB2A 4KMOA 1SZ9A 1H0AA 2HR2A 4I9CA 1UJKA 2L0TB 3CQGB 1BPOA 2XPYA 4AVXA 4L7TA 2KCVA 3APCA 2JLBA 4G1TA 4FADA 1OWOA 1FVFA 4ILHB 4ATGA 3CHQA 4XKCA 5KJLA 4AM9A 4E85A 2WQ7A 4CGVA 5EDSA 3RIBA 4J6IA 3FUMA 3Q4AB 4NRHB 4EQFA 3MJWA 3QK0A 4FLHA 3PS6A 4JEUA 4V3IA 3O4ZA 4K0RA 3D3MA 5FJYA 2BF0X 3PREA 2XGSA 1EYHA 1ELWA 3D9JA 3QJZA 4ABNA 3HDXA 2WMNA 3GZSA 4GZDA 2FF4A 2NXPA 2CG2A 1UN8A 3QAQA 4JHRA 5EX3A 3UT4A 4W9RA 2RG8A 3B7TA 1HXIA 3FH8A 3FTZA 2IOSA 5AJDA 4I1MA 2FULA 4J8FA 4GMJA 2LSUA 2X6JA 4FULA 4IULA 5EKQD 2KZTA 3RRMB 2PL2A 3CVYA 3Q15A 4PS7A 2WXOA 3ML8A 3Q49B 2UWJG 4M3OA 3FU3A 4L2YA 3IHYA 4BFRA 3PE3A 2LAHA 2I6HA 4E6HA 3QDNA 4URKA 3PVLA 5CHEE 2LO6A 5ENNA 2PZIA 1ZBPA 3S7FA 3QC1A 3ONKA 4HOQA 4ILIA 5FT9A 4Y6CA 3S7BA 2XGOA 3NF1A 4YVQC 3ZYQA 3BG1B 3IHVA 4A3TA 1Z3YA 3T5VA 3ESKA 3RU0A 4BX8A 1NA0A 1INZA 1NA3A 2I9CA 3AS8A 3ZGQA 3QWVA 3JQ0A 3URZA 4XZ4A 3FU6A 4WNEA 4CEMA 1SZAA 4GYYA 4HOTA 4KZ0A 4F3VA 3L22A 1ZU2A 3BG0B 2WXMA 3ML9A 4N3AA 2VGYA 3CHPA 4I1OB 3VLEA 4H7YA 4L1BA 3B7SA 3GW4A 1UN9A 2XHEA 2CG3A 4KYOB 1KT0A 1HFAA 3ZYMA 4C9BB 5AIJA 2UY1B 4PDXA 5E76A 4HFGA 3G2SA 4TRQA 3LKUA 2WQ6A 2XRZA 3FY4A 4JW1A 2X6KA 4K03A 4XX5A 4PH4B 3KD7A 1Y6IA 4HOUA 3FEYA 4EBAA 2MRIA 3KS2A 4J0UA 1HU3A 1XGWA 2KC7A 3G2VA 3B7RL 1IHGA 3PUKA 4GZ6A 4I9EA 5FQ7A 2CFUA 4UQYA 3CKCA 3ZFWA 1H6KA 4UWFA 3PH0C 3LXUX 3LVRE 4LUNU 2AXUA 4N2QA 3UPVA 1EF1C 2IOLA 4RVBA 1HS6A 4HLEA 5T4YA 2PM6A 4XE0A 4KXKB 3LPZA 2ONDA 3FUJA 3RRUA 2DBAA 4UQXA 1NZNA 4BWRA 4DJAA 4MS6A 2OV8A 2VJ8A 5JJ7A 3L08A 3AS4A 4TV3A 5JHBA 2UY1A 1HG2A 1MHQA 4Q94A 2OOEA 4AY6A 5G05C 1DNPA 2AVPA 3FUNA 5AJLA 4N3CA 2YQ8A 4BX9A 4Q69A 3EHMA 3JQ1A 3MA5A 5BW8C 3TXNA 1IYGA 4CRWA 1S0PA 4DI3A 3LVQE 3QKYA 2IF4A 3FWVA 5AENA 3JYSA 4I6EA 3RO3A 5CMWA 1E8YA 4G23A 1ELRA 3PZDA 4GZ3A 2R59A 1JWGA 4J8SA 2XGMA 3L54A 1X5BA 4GA2A 2FBNA 3WXXA 3I4RB 2DCPA 2KZTB 2PM7A 3FTWA 1JPLA 1IQRA 2XCCA 4FJZA 2C0MA 4DI4A 2WVIA 3CVQA 2IJGX 3B13A 4UI9C 1QZ2A 3VLFA 2AW6A 3SZ7A 2C0LA 1HE8A 3SBTB 5ARFA 4A3VA 4WNGA 1WAO1 2LNIA 3LY8A 3D9PA 1YA0A 5A23A 3D9IA 2WXLA 2I2OA 4HXIA 5CCLA 3HYMB 2VSOE 4U0SA 1E8ZA 4OVUA 4JEHA 1U3CA 1QNFA 5CCMA 4PUCA 2HM8A 5ANLA 2FO7A 1FVHA 4JA9A 1E90A 2X3MA 2VSNA 2A4ZA 3UX4A 3ZHEA 2AXVA 2KM4A 3SD5A 1TJFA 1N54A 3OTNA 2WXGA 2KCKA 2NC9A 2Y4TA 5KJNA 5FZQA 4CDMA 4CT4A 3IKOB 2Y3AA 3U9WA 3Q5MA 3UMVA 3MCXA 4BY6A 3N71A 4JPSA 4Y6WA 3ZPJA 3OXFA 3CVNA 1XNFA 4FLBA 4JHKA 2BTDA 2IQCA 4PS3A 2M63A 1Z6TA 3EDTB 3FTVA 1E7VA 1H2VC 2YINA 3PE4A 3OAWA 4LEUA 2X6FA 4JA7A 2KCLA 3QWWA 4AP2A 3EJNA 3CVXA 4O6FA 3FFLA 5G2NA 2J9QA 3ESLA 2WXIA 4UWKA 4NURA 4WWPA 3AU4A 3HIZA 4N2SA 3LEWA 2VYIA 4B8CB 2XCBA 3LS8A 1KT1A 3MZLB 4GAAA 3FDHA 3FH5A 3L6AA 1GW6A 4GA0A 4CDRA 4FP7A 3NZSA 3R9AB 3L17A 4EPZA 4EZKA 2FI7A 5A6CA 1VDYA 3LDZA 2V5FA 3SFZA 2KATA 4WUYA 2Q7FA 5HI7A 4OVVA 4OYSA 4RG6A 5G05J 4HORA 3CEQA 4F53A 3CLJA 3U3WA 1HH8A 2GRMA 4GZCA 5T8IA 4G2VA 2V8SE 3CK8A 1E8WA 3ASDA 3MV2B 5BNWA 3PUJA 3CVWA 4BTBA 3SHFA 3CKBA 4ACLA 5JHAA 5LOZA 4U07A 4WNDA 5FQ8A 3U66A 5BV1A 3CVLA 3CIAA 3D9MA 1PC2A 4I43A 3S2AA 3K9IA 2QY7A 2OVFA 4UI9J 4GZ5A 4UWLA 5ANRA 1B89A 4PS8A 3TG5A 2JEKA 3HVEB 5T3RA 1SQMA 4U0UA 3ZVVA 4YVOA 2YHCA 3TAXA 2MOWA 4FC8A 1L5JA 1TJCA 2P58C 4U63A 4WNFA 4CDNA 4ME2A 4GYWA 5D0QD 5J90A 2Y4UA 4KBQA 2WXNA 2WQHA 1UG3A 4XKBA 1LF8A 2NSZA 1E8XA 4AIFA 4ANUA 4EZLA 5A7DB 4ILGA 1OWMA 2CHWA 2J4DA 3PEVB 5G55A 4XIFA 5D0OD 1QQEA 4FA6A 2J4BA 3GZ2A 3ZXSA 3DPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q96 A;  1VDY A;  3LDZ A;  1PY1 A;  5LP0 A;  3D9K A;  1ELK A;  3D9P A;  3G2W A;  2QY7 A;  3D9I A;  5J08 A;  1EDU A;  3D9O A;  4FLB A;  4JXT A;  2MOW A;  2BF0 X;  2L0I A;  3CLJ A;  3D9L A;  1EYH A;  2LO6 A;  1JUQ A;  3D9J A;  3D9M A;  4FU3 A;  4GZC A;  1HFA A;  3D9N A;  1JWG A;  4GZD A;  3ZYM A;  3ONK A;  2V8S E;  1X5B A;  4HFG A;  3G2S A;  4NAC A;  3RRU A;  1LF8 A;  2DCP A;  2KM4 A;  3ZYQ A;  1SZ9 A;  1JPL A;  3ZYL A;  3ZYK A;  1H0A A;  3ONL A;  3G2U A;  1HX8 A;  1UJK A;  1HF8 A;  2L0T B;  1DVP A;  4AVX A;  1INZ A;  5CMW A;  1JWF A;  5LOZ A;  1UJJ A;  1HG2 A;  1MHQ A;  1XGW A;  3G2V A;  2DIW A;  4Q94 A;  1HG5 A;  5CMY A;  3G2T A;  1SZA A; 
#chains in the Genus database with same CATH topology
 1N4S A;  4MLP A;  3OXG A;  3FU5 A;  4ANX A;  3PNT B;  1MX6 A;  1H19 A;  3RRN B;  3ZEF A;  3SGH A;  2GRL A;  3NOG D;  2BKK B;  2H6G A;  3FUH A;  3EHQ A;  4H7X A;  5IY5 E;  4LNG A;  3RKV A;  4G24 A;  1EPU A;  4DK5 A;  2J09 A;  5FWQ A;  4KVM A;  4LG6 A;  3LJN A;  5M72 A;  2Y1L E;  4GPK A;  4RSY A;  4LCT A;  4HNA D;  1HX8 A;  3DBS A;  3PDN A;  2XEV A;  4HRN A;  1ELK A;  4N3B A;  5ENQ D;  3UT7 A;  4GU5 A;  1U3D A;  3T8M A;  3ZW3 A;  3E33 A;  1OWP A;  4JXT A;  4D10 C;  4LRZ A;  1D8D A;  3CVP A;  1WY6 A;  3BQO A;  3CVV A;  5AAR A;  3JUI A;  1LD8 A;  2X38 A;  2R17 C;  1BI7 B;  2IFU A;  1N95 A;  4ZFH A;  5HS0 A;  4HS2 A;  2J8S D;  1K1A A;  5FTP A;  1TN8 A;  1OCZ E;  1MYO A;  1IHB A;  3CHR A;  3ZYK A;  3ONL A;  1MX4 A;  4U0Z A;  3QOU A;  3B95 A;  1YYH A;  2DIW A;  4IYP A;  3FU0 A;  5H7P A;  4HI9 A;  5KJM A;  2L0I A;  3CGH A;  3S7D A;  2VGX B;  2L6B A;  2PQR A;  3FTY A;  3SNX A;  2XQ0 A;  2I1J A;  1PY1 A;  4C0M A;  3UXG A;  1EDU A;  4U95 D;  4L2L A;  3FUD A;  1E7U A;  4DUI A;  2F8Y A;  4JC8 A;  2A5U A;  3MKQ B;  4GYO A;  1DVP A;  3CHS A;  2V4L A;  2ZGG A;  3W9G A;  5FIN A;  2J07 A;  3J5P A;  3J5Q B;  4I17 A;  3QB2 A;  1S70 B;  3X2Q E;  2WXP A;  4AV7 A;  5JJT A;  3CQC B;  4F1S A;  1S63 A;  4L9P A;  1E96 B;  1N11 A;  4GMR A;  5FZS A;  1FT1 A;  2L0T B;  4L7T A;  2JLB A;  4XKC A;  1K1B A;  5CEC B;  4AM9 A;  2WQ7 A;  4CGV A;  3Q4A B;  4LNB A;  4FLH A;  4JEU A;  4V3I A;  1FPP A;  3D3M A;  4DX7 D;  3FTZ A;  4BET A;  2IOS A;  4I1M A;  5EKQ D;  3RRM B;  2PL2 A;  5AQ9 A;  4PS7 A;  3Q49 B;  3PE3 A;  4DX5 D;  2I6H A;  2PZI A;  3S7F A;  3QC1 A;  2GRP B;  4Y6C A;  2XGO A;  3ZYQ A;  1NA3 A;  3JQ0 A;  4WNE A;  1SZA A;  4KZ0 A;  2XS1 A;  4F3V A;  3BG0 B;  3DSV A;  2WXM A;  4HQD A;  2VGY A;  4H7Y A;  1UN9 A;  2CG3 A;  1KT0 A;  3UM0 A;  2UY1 B;  2XRZ A;  4HFG A;  2ZIR A;  4K03 A;  3DRA A;  3Q9N C;  3TWS A;  2MRI A;  3G2V A;  3PUK A;  2CFU A;  3ZNG A;  3PZ2 A;  1H6O A;  3LXU X;  4U8Y D;  4LUN U;  2F37 A;  1EF1 C;  5T4Y A;  2PM6 A;  3FUJ A;  1D8E A;  2ZIS A;  4UQX A;  4BWR A;  3JXJ A;  4TV3 A;  1HG2 A;  3SFY A;  2OOE A;  3Q7F A;  1OCO E;  3JQ1 A;  2IF4 A;  5AEN A;  3L9T A;  3RO3 A;  4G23 A;  2DCP A;  2C0M A;  3B13 A;  4GTR A;  1BLX B;  3VLF A;  3SZ7 A;  1HE8 A;  4WNG A;  1WAO 1;  2RFM A;  2LNI A;  4RLY A;  3D9P A;  1YA0 A;  4HXI A;  5CCL A;  3ABL E;  4U0S A;  4OVU A;  5CCM A;  1FVH A;  2VSN A;  2R2L A;  2WXG A;  2NC9 A;  5FIO A;  3U9W A;  3MCX A;  3OXF A;  3CVN A;  4FLB A;  4JHK A;  2BTD A;  4BER A;  3FTV A;  1E7V A;  2YIN A;  3OAW A;  1SW6 A;  4LEU A;  2X6F A;  2EIM E;  3QWW A;  4O6F A;  3FFL A;  2J9Q A;  3ESL A;  4UWK A;  2PNN A;  3LEW A;  4GAA A;  1GW6 A;  1N4P A;  4CDR A;  3R9A B;  3ZUV B;  5A6C A;  2V5F A;  5KNH D;  5HI7 A;  4OVV A;  1N9A A;  3U3W A;  5T8I A;  3NB2 A;  1E8W A;  3CVW A;  4BTB A;  3CKB A;  5JHA A;  2JAB A;  3CVL A;  3CIA A;  3D9M A;  3V30 A;  1IXV A;  4BES A;  3TG5 A;  5T3R A;  4U0U A;  4YVO A;  4FC8 A;  1TJC A;  4CDN A;  3ZU7 B;  5A7D B;  2CHW A;  2H6H A;  5D0O D;  4FA6 A;  3DPD A;  4HRM B;  4K5C A;  3B7U X;  3ASF A;  3LY7 A;  1YCS B;  4YDO A;  3B7B A;  3TGO A;  2ZU6 B;  3LY9 A;  5KWD A;  4OAV B;  3DPY A;  3AG2 E;  4JVS A;  4CCA A;  4IN3 B;  3HVE A;  2WM9 A;  3MEK A;  3WG7 E;  4O1P A;  3FP3 A;  4P29 A;  1Q2Z A;  4CGW A;  4YND A;  4G26 A;  1PAQ A;  2VGX A;  2IY0 C;  3HXD A;  3ASN E;  5DIZ A;  4UI9 K;  5AYW D;  1QBQ A;  1Y8M A;  4RG9 A;  3RK6 A;  3SFX A;  2EIL E;  4OAU C;  2XPI A;  4J8D A;  4TUU A;  3MKQ A;  2J49 A;  3R9M A;  1MZC A;  1WDY A;  3MKR A;  3UI2 A;  4NQ0 A;  5KCM A;  2ETA A;  4XI9 A;  4JZY A;  3S7J A;  4GTV A;  3CK9 A;  4G11 A;  1P5Q A;  4WWO A;  2PQN A;  3FH7 A;  1N52 A;  3QAR A;  1MJ0 A;  4XEI G;  3AU5 A;  2VQ2 A;  4F6R D;  4I6G A;  5G04 C;  2R05 A;  3Q9U C;  3CK7 A;  4N5Q A;  3D9L A;  3ZIM A;  3P1U A;  3LJ3 A;  3RJV A;  3HXC A;  4B94 A;  2X6H A;  3ZYL A;  2XPZ A;  3R7R A;  2LXL A;  3UQ3 A;  3FTX A;  4QFV A;  4M7C A;  5B3S E;  1TNO A;  1IKN D;  5AAO A;  1N94 A;  2VTB B;  2HYZ A;  4JL0 A;  4EZJ A;  1OWN A;  4UWG A;  5HRY A;  2RD0 A;  5FQ4 A;  4ACK A;  5KJK A;  1HZ4 A;  5CEA A;  2F8X K;  1JCS A;  2GW1 A;  2EQX A;  3E32 A;  4XI0 A;  1H2T C;  1X81 A;  4C0E A;  2WXJ A;  3MX3 A;  2BKG A;  4HOS A;  2V0P A;  3L16 A;  4N39 A;  2HO1 A;  5HQ8 A;  3CV0 A;  2L6J A;  2VSY A;  3TXM A;  3ULQ A;  5JJ6 A;  3LYA A;  2LUH A;  3I4G A;  4R7L A;  3TJP A;  4KT6 B;  4FJY A;  3CHM A;  5FQ6 A;  3HHM A;  4G8L A;  5ARG A;  1JWF A;  3FUI A;  1BU9 A;  3E34 A;  3CST A;  1TNZ A;  1WM5 A;  2C2L A;  3E30 A;  5CBN A;  3IBE A;  3MV3 B;  3I5P A;  4APF A;  3R7Q A;  3I3N A;  2YNQ A;  2E2E A;  4NAC A;  3LCA A;  2QFC A;  4KMO A;  1SZ9 A;  1H0A A;  3ASO E;  2XPY A;  2KCV A;  4ATG A;  3CHQ A;  3UIN C;  1N4Q A;  4EQF A;  3QK0 A;  5CED B;  4K0R A;  2V5Q C;  5FJY A;  3DXM G;  2XGS A;  1ELW A;  4ABN A;  3QJZ A;  2NXP A;  2CG2 A;  5EX3 A;  3UT4 A;  2RG8 A;  3FH8 A;  1HXI A;  4IUL A;  3ML8 A;  1DCQ A;  4M3O A;  4J8Y A;  4L2Y A;  4YDY A;  5JMN D;  4E6H A;  4URK A;  5CHE E;  3ONK A;  1Z3Y A;  3RU0 A;  2I9C A;  3AS8 A;  4GTQ A;  1JCR A;  3FU6 A;  4HOT A;  5AQA A;  3L22 A;  3ML9 A;  3VLE A;  4L1B A;  2OCC E;  2XHE A;  4GTS A;  3G2S A;  3DEP A;  3FEY A;  4J0U A;  1TNU A;  2KC7 A;  4GZ6 A;  4UQY A;  5ENP D;  1OY3 D;  1H6K A;  4UWF A;  4U8V D;  2IOL A;  4HLE A;  3RRU A;  2DBA A;  5D2M C;  5JJ7 A;  2OEW A;  3L08 A;  3AS4 A;  1MHQ A;  2AVP A;  2EIK E;  3FUN A;  4Q69 A;  3EHM A;  3LVQ E;  3SO8 A;  2NYJ A;  5CMW A;  3PZD A;  4X8Q A;  1JWG A;  4J8S A;  2FBN A;  4LSZ E;  4FJZ A;  4DI4 A;  5CRU A;  4UI9 C;  2IJG X;  2C0L A;  4MBG A;  3SBT B;  5ARF A;  4A3V A;  3D9I A;  2WXL A;  2I2O A;  2XZT G;  3SQV A;  4RQI A;  4JEH A;  1U3C A;  5ITZ F;  1O5M A;  2ETC A;  2HM8 A;  2X3M A;  5ENR D;  2A4Z A;  2KM4 A;  3OTN A;  4F1P A;  2Y4T A;  5KJN A;  3KSQ A;  3IKO B;  2Y3A A;  4BY6 A;  4JPS A;  3C3O A;  3PZ4 A;  2M63 A;  1Z6T A;  3AG1 E;  3PE4 A;  4G8K A;  3KSL A;  2P9P G;  4AP2 A;  3EJN A;  3EUV A;  4ATZ D;  3AJI A;  5G2N A;  3UIP C;  4WWP A;  2VYI A;  4B8C B;  3MZL B;  3L6A A;  4FP7 A;  3L17 A;  4EPZ A;  2FI7 A;  1VDY A;  2QYJ A;  1UOH A;  4F53 A;  3CLJ A;  1HH8 A;  2V8S E;  3ASD A;  3MV2 B;  3SHF A;  4U07 A;  3S2A A;  2QY7 A;  4GZ5 A;  2JEK A;  3TAX A;  2MOW A;  1KZP A;  1L5J A;  4GYW A;  5D66 A;  2WXN A;  2XEH A;  3IXE A;  1E8X A;  1V55 E;  4ANU A;  3DXK G;  4EZL A;  5BNW A;  2CHZ A;  3FUE A;  5LCW C;  4TXQ A;  3TG4 A;  3Q73 A;  3OXL A;  4BT9 A;  3ZHE B;  4JD2 G;  3GYZ A;  4NIK A;  2VTB A;  2R5S A;  2AWI A;  4B89 A;  3G2U A;  4GTP A;  1LD7 A;  1OUV A;  1TEZ A;  5CMY A;  1NL4 A;  5EID A;  1RW2 A;  4I2W A;  3SBS A;  4KVO A;  1BI8 B;  1UW4 B;  3O48 A;  4AJW A;  2OVB A;  1TNB A;  3ASH A;  2ILR A;  3MYV A;  1KZO A;  4A55 A;  4HRL A;  4AXH A;  4APO A;  3TWR A;  5C1D A;  1O1S A;  2WXQ A;  4GB9 A;  4EBA G;  4GA1 A;  5BPP A;  4HVB A;  1FCH A;  2XZD G;  3EHN A;  3Q47 B;  3FUF A;  4JHJ A;  4J8E A;  3JUE A;  4IRU A;  4GCN A;  1O1T A;  3ASG A;  4WAF A;  4U8H A;  3FEX A;  4AEZ C;  2J08 A;  2XEN A;  4U7E B;  3T5X A;  2LSV A;  4C48 B;  3FHE A;  1U2V G;  4B8A A;  5E75 A;  4KZC A;  3EIJ A;  4LER A;  3BEE A;  5HKP A;  2IO2 C;  5ENO D;  3Q79 A;  5FZR A;  3AS5 A;  5LX8 A;  4B0Z A;  3VTY A;  5ENT D;  5KNG A;  3E4B A;  2WPV A;  3UKR G;  4YDE A;  4EEC A;  2FEZ A;  4FHJ A;  3NZU A;  3HXF A;  2LAI A;  3L13 A;  4MKT A;  5DBK A;  5EYP F;  2BUG A;  2P2C P;  3CVU A;  2B0O E;  2E0I A;  2LXM A;  3IEG A;  5J08 A;  4LNU D;  4UUC A;  3APF A;  1KLX A;  3UUX A;  3RO2 A;  3ZRH A;  3VTX A;  5CER B;  3U4T A;  3UM3 A;  2VSX E;  3APD A;  3MGB A;  3HXE A;  3ZN3 A;  2DYR E;  5C2Y A;  2AJA A;  2GRQ B;  4TXP A;  1LTX A;  5AQ7 A;  1AP7 A;  3D9N A;  5G04 J;  3ENE A;  5LFA A;  2XEE A;  2WB2 A;  3TWQ A;  1BPO A;  3ISM C;  4FAD A;  1OWO A;  4ILH B;  5EIB E;  3TWT A;  5KJL A;  4E85 A;  4CYM D;  3MJW A;  2GRN B;  1KPS B;  3O4Z A;  3RSE G;  3UM2 A;  3D9J A;  4GZD A;  2WMN A;  3GZS A;  2FF4 A;  1TNY A;  4W9R A;  3B7T A;  5AJD A;  2FUL A;  1ZB1 A;  2LSU A;  4TXR A;  3Q15 A;  2WXO A;  2UWJ G;  2XS8 A;  2H6F A;  4BFR A;  1DCE A;  2LAH A;  3PVL A;  2LO6 A;  5ENN A;  4HOQ A;  3NF1 A;  4YVQ C;  3IHV A;  1TYQ G;  4A3T A;  3ESK A;  1NA0 A;  2Y0B G;  4GYY A;  3V2O A;  2OEV A;  3ZKJ A;  2P9L G;  3CHP A;  2EIJ E;  5BXO A;  5BXU A;  4KYO B;  4C9B B;  2IEJ A;  2DZO A;  5E76 A;  2X6K A;  4XX5 A;  4HOU A;  2P9S G;  3T9K A;  4I9E A;  3B7R L;  5FQ7 A;  1IHG A;  3ZFW A;  5CRV A;  3PH0 C;  2AXU A;  2R02 A;  3UPV A;  4RVB A;  1HS6 A;  5KBA A;  4KXK B;  5EYL A;  3LPZ A;  2OND A;  3F6Q A;  3V79 K;  4MS6 A;  2VJ8 A;  5JHB A;  2UY1 A;  4Q94 A;  4AY6 A;  5G05 C;  1DNP A;  2P9U G;  5AJL A;  4N3C A;  4BX9 A;  1SA5 A;  5BW8 C;  3TXN A;  4CRW A;  1S0P A;  4DI3 A;  3FWV A;  3JYS A;  4I6E A;  2R59 A;  2XGM A;  1TN6 A;  4GA2 A;  2QZA A;  2KZT B;  2PM7 A;  3I4R B;  3FTW A;  2XCC A;  1IQR A;  4ZHB A;  2WVI A;  2B6C A;  3C72 A;  4TUM A;  3LY8 A;  3HYM B;  4PUC A;  2FO7 A;  3ZHE A;  2AXV A;  3SD5 A;  1N54 A;  1SA4 A;  3BUA A;  5FZQ A;  4CDM A;  4CT4 A;  5AQB A;  2QYU A;  3UMV A;  3ZPJ A;  1XNF A;  4CZ2 D;  3AAA C;  1H2V C;  3NBN B;  4JA7 A;  1WG0 A;  2WXI A;  4NUR A;  3HIZ A;  4N2S A;  2XCB A;  3EHR A;  2Y69 E;  3FDH A;  3FH5 A;  5AN8 A;  4GA0 A;  2RFA A;  3C5R A;  4EZK A;  2RKK A;  3LDZ A;  3PZ1 A;  2Q7F A;  4WUY A;  4B93 B;  4OYS A;  4RG6 A;  4K5A B;  4G2V A;  1DC2 A;  1OXJ A;  2KBX A;  4HB5 A;  4U96 D;  3SY2 A;  2A5E A;  1BD8 A;  5BV1 A;  4DRX E;  3K9I A;  4UI9 J;  1B89 A;  3HVE B;  1SQM A;  2GRO B;  2P58 C;  4WNF A;  4ME2 A;  4O1O A;  5D0Q D;  2HE0 A;  5J90 A;  4KBQ A;  2WQH A;  3DSS A;  4XKB A;  1LF8 A;  3ZXP A;  4AIF A;  4ILG A;  2P9I G;  4O60 A;  1OWM A;  2J4D A;  3PEV B;  5G55 A;  2YHC A;  4AY5 A;  3C3Q A;  4Q96 A;  4BEP A;  3G2W A;  1Z3X A;  5BT1 A;  3FUL A;  5BUZ A;  4FU3 A;  4JB8 P;  2GGF A;  3TWX A;  3NAW A;  3E37 A;  3Q75 A;  4DLO A;  2IU1 A;  3FUK A;  3CHO A;  3SF4 A;  4J7W A;  1OWL A;  4GTT A;  3U64 A;  4DLQ A;  4N5C A;  2VGE A;  2ION A;  3PNL B;  4BTA A;  3NOC D;  4DPR A;  3FTS A;  1D9S A;  4I6J A;  3TL5 A;  3VLD A;  3EIQ C;  2DWZ A;  3KEA A;  4UQZ A;  3C98 A;  2MYO A;  3P2B A;  3TWW A;  1OCR E;  1K3Z D;  4L23 A;  3UT8 A;  2WXK A;  3JCK C;  1N0Q A;  3PRZ A;  4FHK A;  2DZN A;  4BSX A;  3EU5 A;  1NP7 A;  2X6I A;  2DVW A;  2XRY A;  4CT0 A;  1MQS A;  3SI5 A;  1HF8 A;  4I2Z A;  3C3R A;  4AOF A;  4WWN A;  4GCO A;  3QNK A;  3KEZ A;  3CR3 A;  4GML A;  1HO8 A;  1SVX A;  3KAE A;  4I1A A;  2IO3 C;  3IV0 A;  2I1K A;  1K8K G;  4A1G A;  5LCW J;  4U04 A;  2EIN E;  5EN5 D;  1A17 A;  3UIO C;  4G25 A;  3GZ1 A;  3QWP A;  3D9O A;  3NQP A;  1NFI E;  1JUQ A;  2WXF A;  1TN7 A;  3DSX A;  2L9B A;  2WXR A;  3ABM E;  3PEU B;  1UJJ A;  3L82 A;  2AXZ A;  2MHK A;  1HG5 A;  2WMO A;  3G2T A;  3DST A;  3D9K A;  4ANV A;  1NI1 A;  3FTU A;  3T8K A;  4ANW A;  4K5B A;  5EX0 A;  3RAU A;  2WXH A;  2CHX A;  2CFZ A;  4UWH A;  1W3B A;  4A1S A;  2KXP C;  4BT8 A;  1Z5S C;  5BV0 A;  2YHE A;  3CSF A;  3UKU G;  4Z68 A;  3AG4 E;  3EU9 A;  1IQU A;  5LP0 A;  3HXB A;  1OT8 A;  4MRU A;  3PZ3 A;  2ETB A;  2P9K G;  4F7A A;  2ZXW E;  5EIL A;  1JCQ A;  1H2U A;  4I9C A;  2HR2 A;  1UJK A;  3CQG B;  4AVX A;  3APC A;  4G1T A;  1FVF A;  3UTM A;  5EDS A;  3RIB A;  4J6I A;  3BU8 A;  3FUM A;  4NRH B;  3PS6 A;  2BF0 X;  3PRE A;  1EYH A;  1TR4 A;  3HDX A;  1UN8 A;  3QAQ A;  4JHR A;  4J8F A;  4GMJ A;  4EHM A;  2X6J A;  4FUL A;  2KZT A;  3CVY A;  3TWU A;  1N0R A;  1V54 E;  3FU3 A;  3IHY A;  2DYS E;  4GPM A;  3QDN A;  3ULY A;  3W9F A;  4BSZ B;  1ZBP A;  4ILI A;  5FT9 A;  3S7B A;  1QYM A;  3BG1 B;  3T5V A;  4BX8 A;  1INZ A;  3ZGQ A;  3QWV A;  3URZ A;  4XZ4 A;  5B1B E;  5JA4 D;  4CEM A;  1ZU2 A;  4HLL A;  2FO1 E;  5B1A E;  4N3A A;  4I1O B;  3B7S A;  3GW4 A;  5AIJ A;  3ZYM A;  1HFA A;  4PDX A;  4TRQ A;  3LKU A;  2WQ6 A;  3FY4 A;  4JW1 A;  4PH4 B;  3KD7 A;  1Y6I A;  4EBA A;  3KS2 A;  1HU3 A;  2P9N G;  1XGW A;  3ABK E;  3HG0 D;  3CKC A;  3LVR E;  3DEO A;  2GRR B;  4N2Q A;  3Q78 A;  1RZ4 A;  3Q7A A;  4XE0 A;  1A5E A;  1NZN A;  4DJA A;  1AWC B;  2OV8 A;  2QC9 A;  5ENS D;  2YQ8 A;  3MA5 A;  1IYG A;  3QKY A;  1E8Y A;  1ELR A;  4GZ3 A;  3L54 A;  1X5B A;  3WXX A;  1JPL A;  3CVQ A;  1QZ2 A;  2AW6 A;  4DX1 A;  4HBD A;  5A23 A;  2VSO E;  1E8Z A;  1N4R A;  5CBO A;  1QNF A;  5ANL A;  4DX2 A;  4JA9 A;  1E90 A;  3UX4 A;  2V4H C;  1TJF A;  4GTM A;  4YDW A;  2KCK A;  1YMP A;  1G3N B;  3JXI A;  3Q5M A;  3N71 A;  4Y6W A;  2IQC A;  1H6P A;  4PS3 A;  3EDT B;  2H6I A;  3DSU A;  2KCL A;  3CVX A;  1S64 A;  3DSW A;  3AU4 A;  3V2X A;  3LS8 A;  1KT1 A;  3NZS A;  4A63 B;  3SFZ A;  2KAT A;  3DWL G;  3HRA A;  3D9H A;  5G05 J;  4HOR A;  1O1R A;  3CEQ A;  2GRM A;  4GTO A;  4GZC A;  3ULE G;  3CK8 A;  3TWV A;  3PUJ A;  3UM1 A;  4ACL A;  2ZGD A;  5LOZ A;  4WND A;  5FQ8 A;  3U66 A;  4DX6 D;  1PC2 A;  4I43 A;  2OVF A;  5ANR A;  4QQI A;  4UWL A;  3V31 A;  4PS8 A;  3ZVV A;  2R03 A;  4HI8 A;  4U63 A;  2Y4U A;  3AG3 E;  1MX2 A;  1UG3 A;  2NSZ A;  2BED A;  2F0Y A;  4XIF A;  1OCC E;  1QQE A;  1FT2 A;  2J4B A;  3GZ2 A;  3ZXS A; 
#chains in the Genus database with same CATH homology
 4Q96 A;  4MLP A;  3OXG A;  3FU5 A;  4ANX A;  3G2W A;  3FUE A;  3PNT B;  5LCW C;  1Z3X A;  3B7U X;  1H19 A;  3RRN B;  5BT1 A;  3ASF A;  3ZEF A;  3FUL A;  3LY7 A;  5BUZ A;  3TG4 A;  3TGO A;  2ZU6 B;  3LY9 A;  3OXL A;  3ZHE B;  4BT9 A;  4JVS A;  4CCA A;  4FU3 A;  3GYZ A;  3SGH A;  4IN3 B;  2GRL A;  2GGF A;  3HVE A;  2WM9 A;  2VTB A;  3MEK A;  2R5S A;  2AWI A;  4DLO A;  4B89 A;  3G2U A;  3FUH A;  3FP3 A;  4H7X A;  4P29 A;  1OUV A;  2IU1 A;  4CGW A;  4YND A;  3FUK A;  4G26 A;  1TEZ A;  1PAQ A;  3CHO A;  5CMY A;  4G24 A;  2VGX A;  3RKV A;  3SF4 A;  4I2W A;  1EPU A;  5DIZ A;  4UI9 K;  5AYW D;  1OWL A;  3U64 A;  4DLQ A;  3SBS A;  4KVO A;  4N5C A;  1UW4 B;  1Y8M A;  4DK5 A;  2ION A;  4RG9 A;  3RK6 A;  2J09 A;  3O48 A;  3PNL B;  4BTA A;  4AJW A;  2OVB A;  5FWQ A;  3ASH A;  2ILR A;  4KVM A;  3MYV A;  5M72 A;  4GPK A;  4RSY A;  3FTS A;  4DPR A;  4LCT A;  4A55 A;  1HX8 A;  3DBS A;  4AXH A;  4APO A;  2XPI A;  4I6J A;  4J8D A;  3TL5 A;  3VLD A;  4TUU A;  3MKQ A;  2J49 A;  5C1D A;  3EIQ C;  3U4T A;  3PDN A;  2WXQ A;  4UQZ A;  2XEV A;  3C98 A;  3MKR A;  3P2B A;  4NQ0 A;  1ELK A;  4N3B A;  4GB9 A;  3UT7 A;  4GU5 A;  1U3D A;  3T8M A;  4L23 A;  3UT8 A;  4GA1 A;  3ZW3 A;  2WXK A;  3JCK C;  5KCM A;  4EBA G;  4XI9 A;  1OWP A;  4JXT A;  5BPP A;  4JZY A;  3PRZ A;  4FHK A;  4BSX A;  3S7J A;  4HVB A;  1FCH A;  1NP7 A;  2X6I A;  3CK9 A;  4D10 C;  3EHN A;  2XRY A;  4LRZ A;  4G11 A;  3Q47 B;  4CT0 A;  1P5Q A;  1MQS A;  3CVP A;  3FUF A;  2PQN A;  4JHJ A;  1WY6 A;  3FH7 A;  4J8E A;  4WWO A;  3SI5 A;  1HF8 A;  3CVV A;  4IRU A;  3JUI A;  4GCN A;  1N52 A;  3QAR A;  4I2Z A;  4AOF A;  4WWN A;  4GCO A;  3AU5 A;  2VQ2 A;  2X38 A;  3QNK A;  2R17 C;  3ASG A;  4WAF A;  3KEZ A;  4U8H A;  2IFU A;  3CR3 A;  4I6G A;  5G04 C;  3FEX A;  4GML A;  4AEZ C;  1HO8 A;  2J08 A;  3CK7 A;  3T5X A;  4HS2 A;  2LSV A;  3FHE A;  3D9L A;  4B8A A;  3ZIM A;  3KAE A;  5E75 A;  3P1U A;  5FTP A;  4I1A A;  3LJ3 A;  3IV0 A;  2I1K A;  4A1G A;  5LCW J;  4KZC A;  3EIJ A;  3RJV A;  4B94 A;  4LER A;  3BEE A;  2X6H A;  3CHR A;  3ZYL A;  3ZYK A;  2XPZ A;  3ONL A;  4U0Z A;  3R7R A;  4U04 A;  3UQ3 A;  3QOU A;  5FZR A;  3FTX A;  4QFV A;  2DIW A;  3AS5 A;  1A17 A;  5LX8 A;  4G25 A;  4B0Z A;  4IYP A;  3VTY A;  3FU0 A;  3GZ1 A;  3E4B A;  3QWP A;  2VTB B;  2HYZ A;  3D9O A;  3NQP A;  4JL0 A;  5KJM A;  2L0I A;  2WPV A;  4EZJ A;  1JUQ A;  2WXF A;  1OWN A;  3CGH A;  4UWG A;  2RD0 A;  5FQ4 A;  2FEZ A;  4ACK A;  4EEC A;  1HZ4 A;  5KJK A;  2L9B A;  4FHJ A;  3NZU A;  3S7D A;  2VGX B;  2GW1 A;  2LAI A;  2EQX A;  3L13 A;  4MKT A;  4XI0 A;  2PQR A;  2WXR A;  1H2T C;  2CHZ A;  3FTY A;  5DBK A;  3PEU B;  2BUG A;  1UJJ A;  3SNX A;  3CVU A;  2AXZ A;  2MHK A;  1HG5 A;  2WMO A;  2XQ0 A;  3G2T A;  4C0E A;  2I1J A;  1PY1 A;  2WXJ A;  2E0I A;  3D9K A;  3MX3 A;  4C0M A;  4ANV A;  3IEG A;  2V0P A;  3FTU A;  3L16 A;  5J08 A;  4HOS A;  4N39 A;  1EDU A;  2HO1 A;  4L2L A;  4ANW A;  4AY5 A;  5HQ8 A;  3CV0 A;  5EX0 A;  3APF A;  3FUD A;  2L6J A;  2VSY A;  2WXH A;  2CHX A;  1E7U A;  1KLX A;  3TXM A;  3UUX A;  2CFZ A;  3RO2 A;  3ULQ A;  5JJ6 A;  3LYA A;  4UWH A;  1W3B A;  4JC8 A;  3ZRH A;  3I4G A;  2A5U A;  4R7L A;  4A1S A;  3MKQ B;  4BT8 A;  3TJP A;  3VTX A;  4KT6 B;  4FJY A;  5BV0 A;  3CHM A;  5FQ6 A;  4GYO A;  1DVP A;  2YHE A;  3HHM A;  3CSF A;  2VSX E;  1JWF A;  3APD A;  3CHS A;  2V4L A;  3FUI A;  3MGB A;  5ARG A;  2J07 A;  3CST A;  3ZN3 A;  1IQU A;  1WM5 A;  4I17 A;  5LP0 A;  5C2Y A;  2C2L A;  3QB2 A;  2WXP A;  4MRU A;  4AV7 A;  3IBE A;  5JJT A;  4F7A A;  3CQC B;  3MV3 B;  3I5P A;  4APF A;  4F1S A;  3R7Q A;  3D9N A;  5G04 J;  3ENE A;  3I3N A;  2YNQ A;  5LFA A;  2E2E A;  4NAC A;  3LCA A;  1E96 B;  1H2U A;  2QFC A;  5FZS A;  2WB2 A;  4KMO A;  1SZ9 A;  1H0A A;  2HR2 A;  4I9C A;  1UJK A;  2L0T B;  3CQG B;  1BPO A;  2XPY A;  4AVX A;  4L7T A;  2KCV A;  3APC A;  2JLB A;  4G1T A;  4FAD A;  1OWO A;  1FVF A;  4ILH B;  4ATG A;  3CHQ A;  4XKC A;  5KJL A;  4AM9 A;  4E85 A;  2WQ7 A;  4CGV A;  5EDS A;  3RIB A;  4J6I A;  3FUM A;  3Q4A B;  4NRH B;  4EQF A;  3MJW A;  3QK0 A;  4FLH A;  3PS6 A;  4JEU A;  4V3I A;  3O4Z A;  4K0R A;  3D3M A;  5FJY A;  2BF0 X;  3PRE A;  2XGS A;  1EYH A;  1ELW A;  3D9J A;  3QJZ A;  4ABN A;  3HDX A;  2WMN A;  3GZS A;  4GZD A;  2FF4 A;  2NXP A;  2CG2 A;  1UN8 A;  3QAQ A;  4JHR A;  5EX3 A;  3UT4 A;  4W9R A;  2RG8 A;  3B7T A;  1HXI A;  3FH8 A;  3FTZ A;  2IOS A;  5AJD A;  4I1M A;  2FUL A;  4J8F A;  4GMJ A;  2LSU A;  2X6J A;  4FUL A;  4IUL A;  5EKQ D;  2KZT A;  3RRM B;  2PL2 A;  3CVY A;  3Q15 A;  4PS7 A;  2WXO A;  3ML8 A;  3Q49 B;  2UWJ G;  4M3O A;  3FU3 A;  4L2Y A;  3IHY A;  4BFR A;  3PE3 A;  2LAH A;  2I6H A;  4E6H A;  3QDN A;  4URK A;  3PVL A;  5CHE E;  2LO6 A;  5ENN A;  2PZI A;  1ZBP A;  3S7F A;  3QC1 A;  3ONK A;  4HOQ A;  4ILI A;  5FT9 A;  4Y6C A;  3S7B A;  2XGO A;  3NF1 A;  4YVQ C;  3ZYQ A;  3BG1 B;  3IHV A;  4A3T A;  1Z3Y A;  3T5V A;  3ESK A;  3RU0 A;  4BX8 A;  1NA0 A;  1INZ A;  1NA3 A;  2I9C A;  3AS8 A;  3ZGQ A;  3QWV A;  3JQ0 A;  3URZ A;  4XZ4 A;  3FU6 A;  4WNE A;  4CEM A;  1SZA A;  4GYY A;  4HOT A;  4KZ0 A;  4F3V A;  3L22 A;  1ZU2 A;  3BG0 B;  2WXM A;  3ML9 A;  4N3A A;  2VGY A;  3CHP A;  4I1O B;  3VLE A;  4H7Y A;  4L1B A;  3B7S A;  3GW4 A;  1UN9 A;  2XHE A;  2CG3 A;  4KYO B;  1KT0 A;  1HFA A;  3ZYM A;  4C9B B;  5AIJ A;  2UY1 B;  4PDX A;  5E76 A;  4HFG A;  3G2S A;  4TRQ A;  3LKU A;  2WQ6 A;  2XRZ A;  3FY4 A;  4JW1 A;  2X6K A;  4K03 A;  4XX5 A;  4PH4 B;  3KD7 A;  1Y6I A;  4HOU A;  3FEY A;  4EBA A;  2MRI A;  3KS2 A;  4J0U A;  1HU3 A;  1XGW A;  2KC7 A;  3G2V A;  3B7R L;  1IHG A;  3PUK A;  4GZ6 A;  4I9E A;  5FQ7 A;  2CFU A;  4UQY A;  3CKC A;  3ZFW A;  1H6K A;  4UWF A;  3PH0 C;  3LXU X;  3LVR E;  4LUN U;  2AXU A;  4N2Q A;  3UPV A;  1EF1 C;  2IOL A;  4RVB A;  1HS6 A;  4HLE A;  5T4Y A;  2PM6 A;  4XE0 A;  4KXK B;  3LPZ A;  2OND A;  3FUJ A;  3RRU A;  2DBA A;  4UQX A;  1NZN A;  4BWR A;  4DJA A;  4MS6 A;  2OV8 A;  2VJ8 A;  5JJ7 A;  3L08 A;  3AS4 A;  4TV3 A;  5JHB A;  2UY1 A;  1HG2 A;  1MHQ A;  4Q94 A;  2OOE A;  4AY6 A;  5G05 C;  1DNP A;  2AVP A;  3FUN A;  5AJL A;  4N3C A;  2YQ8 A;  4BX9 A;  4Q69 A;  3EHM A;  3JQ1 A;  3MA5 A;  5BW8 C;  3TXN A;  1IYG A;  4CRW A;  1S0P A;  4DI3 A;  3LVQ E;  3QKY A;  2IF4 A;  3FWV A;  5AEN A;  3JYS A;  4I6E A;  3RO3 A;  5CMW A;  1E8Y A;  4G23 A;  1ELR A;  3PZD A;  4GZ3 A;  2R59 A;  1JWG A;  4J8S A;  2XGM A;  3L54 A;  1X5B A;  4GA2 A;  2FBN A;  3WXX A;  3I4R B;  2DCP A;  2KZT B;  2PM7 A;  3FTW A;  1JPL A;  1IQR A;  2XCC A;  4FJZ A;  2C0M A;  4DI4 A;  2WVI A;  3CVQ A;  2IJG X;  3B13 A;  4UI9 C;  1QZ2 A;  3VLF A;  2AW6 A;  3SZ7 A;  2C0L A;  1HE8 A;  3SBT B;  5ARF A;  4A3V A;  4WNG A;  1WAO 1;  2LNI A;  3LY8 A;  3D9P A;  1YA0 A;  5A23 A;  3D9I A;  2WXL A;  2I2O A;  4HXI A;  5CCL A;  3HYM B;  2VSO E;  4U0S A;  1E8Z A;  4OVU A;  4JEH A;  1U3C A;  1QNF A;  5CCM A;  4PUC A;  2HM8 A;  5ANL A;  2FO7 A;  1FVH A;  4JA9 A;  1E90 A;  2X3M A;  2VSN A;  2A4Z A;  3UX4 A;  3ZHE A;  2AXV A;  2KM4 A;  3SD5 A;  1TJF A;  1N54 A;  3OTN A;  2WXG A;  2KCK A;  2NC9 A;  2Y4T A;  5KJN A;  5FZQ A;  4CDM A;  4CT4 A;  3IKO B;  2Y3A A;  3U9W A;  3Q5M A;  3UMV A;  3MCX A;  4BY6 A;  3N71 A;  4JPS A;  4Y6W A;  3ZPJ A;  3OXF A;  3CVN A;  1XNF A;  4FLB A;  4JHK A;  2BTD A;  2IQC A;  4PS3 A;  2M63 A;  1Z6T A;  3EDT B;  3FTV A;  1E7V A;  1H2V C;  2YIN A;  3PE4 A;  3OAW A;  4LEU A;  2X6F A;  4JA7 A;  2KCL A;  3QWW A;  4AP2 A;  3EJN A;  3CVX A;  4O6F A;  3FFL A;  5G2N A;  2J9Q A;  3ESL A;  2WXI A;  4UWK A;  4NUR A;  4WWP A;  3AU4 A;  3HIZ A;  4N2S A;  3LEW A;  2VYI A;  4B8C B;  2XCB A;  3LS8 A;  1KT1 A;  3MZL B;  4GAA A;  3FDH A;  3FH5 A;  3L6A A;  1GW6 A;  4GA0 A;  4CDR A;  4FP7 A;  3NZS A;  3R9A B;  3L17 A;  4EPZ A;  4EZK A;  2FI7 A;  5A6C A;  1VDY A;  3LDZ A;  2V5F A;  3SFZ A;  2KAT A;  4WUY A;  2Q7F A;  5HI7 A;  4OVV A;  4OYS A;  4RG6 A;  5G05 J;  4HOR A;  3CEQ A;  4F53 A;  3CLJ A;  3U3W A;  1HH8 A;  2GRM A;  4GZC A;  5T8I A;  4G2V A;  2V8S E;  3CK8 A;  1E8W A;  3ASD A;  3MV2 B;  5BNW A;  3PUJ A;  3CVW A;  4BTB A;  3SHF A;  3CKB A;  4ACL A;  5JHA A;  5LOZ A;  4U07 A;  4WND A;  5FQ8 A;  3U66 A;  5BV1 A;  3CVL A;  3CIA A;  3D9M A;  1PC2 A;  4I43 A;  3S2A A;  3K9I A;  2QY7 A;  2OVF A;  4UI9 J;  4GZ5 A;  4UWL A;  5ANR A;  1B89 A;  4PS8 A;  3TG5 A;  2JEK A;  3HVE B;  5T3R A;  1SQM A;  4U0U A;  3ZVV A;  4YVO A;  2YHC A;  3TAX A;  2MOW A;  4FC8 A;  1L5J A;  1TJC A;  2P58 C;  4U63 A;  4WNF A;  4CDN A;  4ME2 A;  4GYW A;  5D0Q D;  5J90 A;  2Y4U A;  4KBQ A;  2WXN A;  2WQH A;  1UG3 A;  4XKB A;  1LF8 A;  2NSZ A;  1E8X A;  4AIF A;  4ANU A;  4EZL A;  5A7D B;  4ILG A;  1OWM A;  2CHW A;  2J4D A;  3PEV B;  5G55 A;  4XIF A;  5D0O D;  1QQE A;  4FA6 A;  2J4B A;  3GZ2 A;  3ZXS A;  3DPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...