1EDUA

Crystal structure of the enth domain of rat epsin 1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
149
structure length
149
Chain Sequence
NIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords EH domain binding protein EPSIN
publication title Epsin 1 undergoes nucleocytosolic shuttling and its eps15 interactor NH(2)-terminal homology (ENTH) domain, structurally similar to Armadillo and HEAT repeats, interacts with the transcription factor promyelocytic leukemia Zn(2)+ finger protein (PLZF).
pubmed doi rcsb
source organism Rattus norvegicus
total genus 51
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2000-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1eduA00
1HF8A 4GZDA 3RRUA 1SZAA 3D9JA 4HFGA 3ZYKA 3D9KA 3D9LA 3G2SA 1UJJA 1X5BA 2LO6A 1HX8A 3CLJA 4Q94A 2V8SE 4JXTA 3LDZA 5CMWA 3ZYLA 1JUQA 1JWFA 2BF0X 1DVPA 4AVXA 2MOWA 5LOZA 1HFAA 1LF8A 1PY1A 3D9NA 3ZYMA 1HG2A 2L0IA 3ONKA 2DIWA 2DCPA 5J08A 3D9IA 3D9PA 3ONLA 1HG5A 1JPLA 2L0TB 1EYHA 1VDYA 1UJKA 3G2UA 3G2TA 4GZCA 4Q96A 5CMYA 1JWGA 1H0AA 1SZ9A 1XGWA 4FU3A 3D9MA 4NACA 4FLBA 5LP0A 1EDUA 1INZA 3D9OA 1MHQA 3G2WA 3ZYQA 1ELKA 2QY7A 3G2VA 2KM4A
chains in the Genus database with same CATH superfamily
3JUEA 3APCA 4F6RD 3KSLA 5AENA 4APOA 4HS2A 1GW6A 3AS5A 3UX4A 4K03A 3FDHA 1XGWA 1MHQA 4GTMA 3EDTB 2XS8A 1OWLA 3E33A 3UKRG 3OXGA 1FVFA 3CK8A 3PNLB 4L7TA 4N2SA 3RO3A 2VSOE 4N2QA 2WMOA 1SZ9A 4GPKA 1D9SA 4AV7A 5KNGA 2Q7FA 3D9JA 1O1RA 3ZXPA 3T5XA 3ABME 4ACKA 3EIJA 2R03A 3IKOB 5CERB 2FF4A 4OYSA 3P2BA 5BXUA 3MGBA 4FLHA 3KSQA 2J07A 3CQCB 1X5BA 3CLJA 2GRMA 2AXZA 3E37A 4P29A 5FJYA 4W9RA 3J5PA 2IU1A 4U07A 1N4PA 4JA7A 2XRZA 4J8YA 5KCMA 2CHWA 3FTSA 4ANVA 2WQ6A 4I43A 4UWLA 3L13A 2NXPA 2E0IA 3DSXA 1V54E 5LP0A 3SQVA 2AXVA 3QWWA 5FIOA 1ELKA 1H2VC 3ZYQA 4MBGA 4F7AA 4CYMD 5J90A 1S0PA 3QWPA 3JCKC 3PZ1A 4EQFA 2A4ZA 1FT1A 1FPPA 2GW1A 5KJKA 3LYAA 4KZ0A 4FULA 2X6HA 4BSZB 3UM2A 1XNFA 2KZTB 3ZYKA 3CVPA 3C3QA 3CVLA 3ZYLA 4CEMA 4XI9A 3SFXA 3JXIA 3BQOA 3SF4A 3C98A 4UQZA 3IBEA 5JA4D 3DSTA 4OVUA 3RRNB 2QYJA 5KNHD 3HXEA 4CDRA 4GTSA 3AG1E 1YMPA 3CHOA 2X6FA 2XRYA 4GZ3A 2PL2A 2AXUA 4JB8P 2VSYA 3TXNA 2PNNA 4FU3A 1OT8A 4DX7D 4BEPA 4I1OB 4PUCA 3D9NA 3UMVA 4EHMA 1HG2A 2GRQB 4WNFA 2KBXA 2GGFA 3GZ1A 2OEVA 3I5PA 1E7UA 3AS4A 1TJFA 1L5JA 2RKKA 4JEHA 2ETCA 3CVVA 3EHRA 1Z5SC 5FQ7A 3GW4A 4GA2A 4Y6WA 2C2LA 4FHJA 4U8HA 5CCLA 2WMNA 1QQEA 3ASOE 2WXQA 4YDYA 3F6QA 4HB5A 1A17A 5G04J 2JEKA 5CMYA 4MLPA 2C0LA 3DRAA 2L9BA 5A6CA 5JHAA 5LCWJ 1HX8A 4FP7A 3PZDA 5EDSA 3CHMA 4L9PA 4WWPA 4BERA 2Y69E 3SZ7A 2NSZA 3FUJA 4FHKA 3D9MA 5D0QD 3B7SA 1OCRE 3KS2A 1E8ZA 1SZAA 3PNTB 1QYMA 5FQ4A 3AS8A 3ZUVB 2BF0X 4RVBA 2MYOA 2IEJA 3FHEA 2WXPA 3FTVA 3NZUA 2IQCA 5BXOA 5CECB 2VSXE 4XEIG 4J8SA 3FTWA 3S2AA 4ZHBA 3CHPA 4ILIA 3PVLA 3TG4A 2A5EA 4B8AA 3KAEA 3CVUA 4EPZA 4KMOA 1OWMA 1N0QA 5CEDB 3ONLA 3QKYA 4G8LA 2FBNA 1KZOA 2KZTA 3OXFA 5KJLA 3MJWA 2V4LA 4HORA 3ASHA 3B7TA 2HR2A 4JHRA 3ML8A 3TWWA 3U66A 4URKA 1JWGA 2YQ8A 3T8MA 3QB2A 1DCEA 4F53A 3TWXA 3DBSA 1WG0A 3RK6A 4KVOA 4BETA 3RO2A 4PH4B 3D3MA 3J5QB 2XPYA 1KPSB 3FUMA 2LXMA 2IF4A 4RLYA 4B89A 2I6HA 2PZIA 4N5CA 5FQ6A 3GYZA 3ZNGA 5AJLA 3PREA 3APFA 5AIJA 1HFAA 2DIWA 2QFCA 1HG5A 3IHYA 4KT6B 2JABA 4UWFA 2YNQA 1OXJA 3UM0A 2XEHA 3PZ4A 4EZJA 2P9LG 1UW4B 3FUNA 2CFZA 3MKQB 2MHKA 1DVPA 3Q5MA 5EX0A 2J4DA 2P58C 4I1AA 2BEDA 1JPLA 3L22A 2M63A 3V2XA 5FQ8A 3CVWA 1UG3A 2XZDG 3PE4A 2XPIA 4G8KA 2BKGA 4G23A 1LTXA 4I1MA 5AAOA 4JXTA 4CCAA 3HIZA 3LJ3A 2WXKA 3S7FA 1MJ0A 2ZISA 3B13A 3UIPC 2GROB 3HRAA 4FA6A 3V30A 3Q49B 4FJZA 2NYJA 2AJAA 4LNGA 2LNIA 4JPSA 3PZ2A 1G3NB 2AVPA 4K5AB 4GB9A 2LAIA 5D0OD 3IHVA 3FP3A 4UWHA 1N54A 2F8YA 2I9CA 5G05J 3UIOC 3LY8A 4XZ4A 2XPZA 1H19A 3AG4E 3CVQA 1K1BA 3UPVA 5BPPA 3QJZA 2CG3A 1MQSA 3EUVA 3OXLA 3ASNE 4O1OA 4Z68A 2VJ8A 4XI0A 1YA0A 2WXIA 2H6GA 2UY1B 5ENPD 3JQ1A 3VLDA 4LCTA 3LY9A 4UQXA 1H6PA 2PQRA 4UI9K 2IJGX 4GTVA 1K8KG 5EN5D 2OCCE 3ASFA 2DYSE 3W9GA 2WXJA 1O1TA 2XGSA 5HRYA 1N94A 2ZXWE 4UWKA 1X81A 2V0PA 4GMLA 3CHRA 4F3VA 3D9PA 1OCOE 4KBQA 4U8YD 5E75A 3TWQA 2DYRE 1HF8A 1ZU2A 4DJAA 1OCZE 3ZN3A 2DZOA 3PDNA 2RG8A 3S7DA 1Z3XA 1D8EA 3SI5A 4UI9J 4G11A 3CKCA 3AG3E 3MKQA 2R02A 4G25A 4O60A 4E85A 3S7JA 2L0TB 3NB2A 4GYOA 4N3BA 3EU5A 3NF1A 2P9NG 2Y0BG 3FULA 4L2YA 1HH8A 3D9OA 3HXDA 1ZBPA 2C0MA 3PS6A 4U96D 1BLXB 4EBAG 4C0EA 5EIBE 5A23A 4NQ0A 1Q2ZA 4TV3A 5ENTD 4DX6D 3C3OA 4HLEA 4DX1A 3S7BA 1EDUA 3PEVB 5D2MC 3ML9A 5ENNA 3UT7A 4GTPA 3FEYA 2QYUA 2H6HA 3ISMC 4H7XA 4M3OA 3CIAA 4JVSA 1KT1A 3SY2A 3EHMA 2XZTG 2EIME 3FTYA 4I6JA 3FUFA 3MA5A 3ZW3A 2Y4TA 3UTMA 4YDOA 4HRLA 1BI7B 2IOSA 1N4RA 1Y6IA 3L54A 1V55E 4N3AA 5BW8C 1K3ZD 3PUJA 2OVFA 3CQGB 3G2WA 3QK0A 2UY1A 4NIKA 4HRNA 4JD2G 3O48A 3LVRE 4LERA 5M72A 2P9KG 3ASGA 3ZIMA 3KEAA 5LX8A 5CHEE 3ZXSA 4EZLA 4PS7A 3D9IA 2WXHA 1TN6A 3HXCA 3JUIA 4YVQC 1E8WA 2OOEA 4WNEA 1EPUA 4BTAA 4PS3A 2KC7A 4GYWA 1NI1A 3FUHA 4JHKA 3WG7E 3C3RA 3PRZA 2IO2C 1INZA 4L23A 3CVXA 4WAFA 5C1DA 1TNBA 4DK5A 1JUQA 1PAQA 4TXRA 1PY1A 5ANRA 4K0RA 1E7VA 1SQMA 4N5QA 5ENSD 2B6CA 2OV8A 4GTQA 2F37A 4FJYA 2XCCA 3FU0A 4DX5D 4WNGA 2IONA 3B95A 4I2WA 3ENEA 1TNZA 3D9KA 4NRHB 3DSWA 3NBNB 4GMJA 4BX8A 5FINA 4JZYA 2P9IG 2X38A 2WXNA 2IFUA 2J08A 4HRMB 4XKCA 1PC2A 4GZCA 5BV1A 2H6IA 1WM5A 5C2YA 1HO8A 4A1SA 3ABLE 4AXHA 4WNDA 5ENQD 1KZPA 4O6FA 3HG0D 5LFAA 4BWRA 5CBNA 3SGHA 3HDXA 4ATZD 5DIZA 1HS6A 1UJKA 5G55A 4F1PA 4AOFA 3R9AB 1TR4A 5AYWD 1O5MA 1WDYA 4KXKB 4GPMA 2FI7A 2LSUA 2FO1E 1WY6A 4KYOB 3FFLA 1ELWA 3L17A 3NQPA 3BUAA 3TJPA 4K5CA 3URZA 4AP2A 3PUKA 1U3CA 2X3MA 2VYIA 3DPYA 2L0IA 5H7PA 3R7RA 4AY5A 1IHBA 3Q75A 3RRMB 3U9WA 3FH5A 2CHXA 2R17C 4DI4A 2Y3AA 4CDNA 1A5EA 5FWQA 2J9QA 1IQRA 3DSUA 3U4TA 4LSZE 4J7WA 3E32A 3UM1A 3D9HA 4CRWA 2VSNA 2OEWA 1Z6TA 1H2UA 4ANXA 4FADA 3TAXA 1MZCA 3E4BA 1QNFA 1E8YA 1IYGA 3I3NA 2WPVA 2VGEA 4TRQA 5HKPA 2WB2A 1LD7A 4DI3A 2GRRB 5BUZA 2LAHA 5EYPF 2XHEA 3SD5A 3P1UA 3B7RL 1JCQA 2WXRA 2DVWA 1JCRA 3D9LA 5JJ7A 4HOTA 2LO6A 3LXUX 4CGVA 4DLOA 1MX2A 4A63B 1IQUA 4J8FA 4J6IA 4ZFHA 3TL5A 1NFIE 2RFAA 4Y6CA 3ZVVA 2KXPC 2J4BA 3L08A 4ABNA 3L6AA 4G1TA 5BNWA 1N4SA 3HVEB 1AP7A 5B3SE 3T8KA 5G04C 2A5UA 3AU5A 3CV0A 4HLLA 2V4HC 4IULA 2KCVA 1HU3A 4NURA 5LCWC 1DCQA 3RSEG 2PM7A 2LUHA 5CMWA 1QBQA 4D10C 5LOZA 4DLQA 5AQBA 2LSVA 4U0UA 3N71A 1FCHA 5AARA 4C9BB 2FULA 3HXFA 5E76A 3IEGA 2F8XK 3DEPA 3CR3A 2ETBA 1BPOA 2KCLA 2J09A 4I6GA 4B0ZA 4IRUA 2WXGA 1U3DA 4A3VA 3Q9UC 3U64A 3C5RA 3PH0C 4TXPA 3SHFA 3ONKA 5ENOD 3JYSA 1MX4A 3OAWA 2P2CP 2YHEA 5AN8A 4GMRA 3ULYA 4RSYA 2MRIA 4A1GA 3MV3B 3ABKE 4IYPA 3UXGA 4GAAA 2HYZA 1QZ2A 2WXFA 3Q7FA 3DPDA 2NC9A 2R59A 3KEZA 4RG9A 2ETAA 2P9SG 2IOLA 3W9FA 4DPRA 1IXVA 3MZLB 4UQYA 1N4QA 2LXLA 2UWJG 3DEOA 2FO7A 4A3TA 1FVHA 3LDZA 4HVBA 2X6JA 4CDMA 1NA3A 3Q73A 2GRLA 4M7CA 5BT1A 4KZCA 3ULQA 4BY6A 3Q15A 3RIBA 2R05A 4U95D 2WM9A 1JCSA 4LRZA 5B1AE 3ULEG 1EF1C 4APFA 4BTBA 2ILRA 2WVIA 4Q94A 3GZSA 3L9TA 5HS0A 3HYMB 3TGOA 3FUKA 2QC9A 1HE8A 1N95A 4ANUA 5T3RA 4YVOA 2AWIA 4EZKA 4JHJA 3QOUA 4G26A 3ZKJA 4KVMA 4YDEA 1KT0A 4WUYA 4F1SA 3FY4A 3TWVA 4J8DA 5ARFA 2H6FA 3T5VA 1EYHA 3Q78A 1OCCE 3MCXA 3UUXA 3TWTA 3AU4A 3CHSA 5EILA 1LD8A 3HVEA 3QAQA 4G24A 4AIFA 1NZNA 2V5QC 4LNBA 1TEZA 3UQ3A 2WXOA 1E96B 4L2LA 3CK7A 3E34A 1SA5A 3VTYA 2GRNB 4X8QA 4XE0A 2CFUA 2R5SA 3ASDA 3NOCD 3SO8A 3TWRA 1FT2A 2KCKA 2XEEA 5ITZF 3B7UX 4JL0A 4U0SA 4U8VD 2GRPB 3O4ZA 1H6OA 1SW6A 2FEZA 5G2NA 4BX9A 1MX6A 5HI7A 1SA4A 1DC2A 3FU5A 3DXMG 4GCOA 3OTNA 2F0YA 3TXMA 3QC1A 1P5QA 4I6EA 1UOHA 3CK9A 1N11A 2EQXA 4L1BA 1O1SA 2WXMA 5FT9A 2V8SE 1S63A 3EHQA 3APDA 4AM9A 4I17A 4Q69A 5G05C 4H7YA 3QWVA 1H0AA 3FTUA 4WWNA 3KD7A 3SNXA 3AJIA 3R7QA 4GYYA 3TWSA 3DSVA 3LPZA 3TWUA 2YINA 3EIQC 2X6IA 4HNAD 5D66A 3L16A 4GA1A 4ME2A 5JHBA 2KATA 4YNDA 3ZGQA 1HZ4A 3FH7A 5AQ7A 4U04A 3I4GA 2XS1A 3IXEA 3AAAC 4EECA 2DBAA 3Q9NC 2E2EA 3ESKA 3V31A 5ANLA 4GTOA 3LS8A 4AY6A 5BV0A 2XENA 4AJWA 3UM3A 4FLBA 1Z3YA 1IHGA 2KM4A 3ZEFA 3E30A 4XIFA 2PM6A 1TN7A 2J49A 5KJMA 3FUIA 3K9IA 3T9KA 4B94A 4J8EA 4GZ6A 3Q4AB 4MRUA 4YDWA 1BI8B 3FU6A 4I9EA 1D8DA 3JQ0A 4AEZC 2PQNA 3LCAA 2ONDA 3NZSA 5CCMA 4ILHB 4BT9A 3SFZA 3IV0A 1OWOA 4ANWA 5J08A 2XEVA 3MX3A 1YCSB 2QZAA 3G2TA 3C72A 3PEUB 3LEWA 3MYVA 4UI9C 5T4YA 3JXJA 1UN9A 5EX3A 4AVXA 2DZNA 4XX5A 5CRUA 5IY5E 4K5BA 4GTRA 4JW1A 3FH8A 1LF8A 2BUGA 1S70B 2DCPA 2XQ0A 2VGYA 5JMND 2Y1LE 4NACA 1U2VG 3FU3A 4N3CA 2QY7A 5ENRD 5FZRA 3CVYA 4IN3B 2VQ2A 1N9AA 2J8SD 4RG6A 3X2QE 4UUCA 4CT4A 3V2OA 1BD8A 5A7DB 4MKTA 4I2ZA 5ARGA 1AWCB 4TXQA 3G2VA 2L6BA 4A55A 3UI2A 4PS8A 3ZHEB 4GTTA 2VGXB 3ZPJA 3FWVA 1N52A 4DRXE 4CZ2D 4C48B 1K1AA 2EIKE 3RKVA 4GZ5A 1TNOA 2JLBA 2EINE 1DNPA 1TYQG 4HFGA 3Q79A 3CVNA 4DUIA 4PDXA 1JWFA 4G2VA 3EJNA 1OWPA 4JEUA 2X6KA 3DXKG 4N39A 3DWLG 3VLEA 1ELRA 5CBOA 2XGOA 2IO3C 2I1KA 4HBDA 3ZRHA 4FC8A 5EIDA 2AW6A 2XGMA 2I1JA 2CHZA 4J0UA 1HXIA 1TNYA 3ESLA 3HHMA 3ZYMA 3QNKA 2L6JA 4ILGA 4R7LA 4OVVA 2VTBB 4ACLA 2B0OE 3SBSA 2OVBA 3ZU7B 2IY0C 1UN8A 2V5FA 4CT0A 4LG6A 1MYOA 3SFYA 1E8XA 5DBKA 1RW2A 1S64A 3UINC 2MOWA 5KBAA 1N0RA 2WQHA 2ZU6B 3UT8A 4C0MA 2EIJE 3CKBA 3UKUG 5KWDA 1YYHA 4ATGA 1UJJA 1E90A 4LNUD 4WWOA 3BEEA 5FTPA 3LY7A 4LUNU 3PZ3A 5FZQA 2HO1A 4OAUC 2R2LA 2Y4UA 3G2UA 4JC8A 4BSXA 3LJNA 4RQIA 4HQDA 1H2TC 3EHNA 4O1PA 3LVQE 2P9UG 1OUVA 4UWGA 3VTXA 3GZ2A 3SBTB 4Q96A 3QDNA 4GA0A 3AG2E 3L82A 2ZGDA 3RAUA 4XKBA 4U0ZA 4GU5A 1IKND 3RRUA 3EU9A 3MEKA 3QARA 3G2SA 5CEAA 3FTXA 2XCBA 4E6HA 2HE0A 4B8CB 4BT8A 1H6KA 1NP7A 4EBAA 1OWNA 3I4RB 4HXIA 1VDYA 2YHCA 5T8IA 3RU0A 3VLFA 5AQ9A 2WQ7A 4HI9A 3LKUA 5EKQD 3DSSA 4TUUA 3ZHEA 3CHQA 1W3BA 2VGXA 1Y8MA 3B7BA 4I9CA 3UT4A 5JJ6A 4HOQA 2BKKB 5HQ8A 3NOGD 3R9MA 2EILE 3WXXA 3CEQA 3BG0B 3MV2B 3CSTA 5AJDA 4HOSA 2BTDA 2RFMA 5CRVA 4OAVB 5AQAA 1WAO1 1B89A 3ZFWA 4BESA 4HI8A 1RZ4A 2I2OA 4U63A 3FUDA 1OY3D 4CGWA 1KLXA 3Q47B 3BG1B 3FUEA 1TNUA 4QQIA 3V79K 1BU9A 4V3IA 2HM8A 2RD0A 4HOUA 4GCNA 3NAWA 3CGHA 3FEXA 5FZSA 3MKRA 3Q7AA 3RJVA 3U3WA 1ZB1A 1NA0A 2P9PG 2VTBA 4JA9A 1TJCA 4MS6A 3CSFA 4BFRA 3HXBA 2ZGGA 4U7EB 1TN8A 4GZDA 2CG2A 3TG5A 3FTZA 5KJNA 2DWZA 2ZIRA 2WXLA 4LEUA 4QFVA 1SVXA 5B1BE 4TUMA 5JJTA 4DX2A 4B93B 5EYLA 3BU8A 1NL4A 3PE3A
chains in the Genus database with same CATH topology
4EECA 4KXKB 2DBAA 1UW4B 3FUNA 3APCA 2E2EA 2CFZA 2FI7A 3MKQB 2LSUA 5AENA 3ESKA 5ANLA 4APOA 1WY6A 2MHKA 1DVPA 4HS2A 3Q5MA 4KYOB 5EX0A 2J4DA 1GW6A 2P58C 3AS5A 3FFLA 3UX4A 3LS8A 4I1AA 4K03A 5BV1A 5BV0A 4AY6A 1ELWA 4AJWA 1JPLA 3L22A 3L17A 3FDHA 3NQPA 1XGWA 4FLBA 2M63A 1Z3YA 1IHGA 5FQ8A 3TJPA 3CVWA 1MHQA 1UG3A 3URZA 2KM4A 3EDTB 3PE4A 3ZEFA 2XPIA 4AP2A 1OWLA 3PUKA 4XIFA 4G23A 4I1MA 3OXGA 4JXTA 1U3CA 2X3MA 2VYIA 1FVFA 3CK8A 3PNLB 4CCAA 4L7TA 2PM6A 3HIZA 2J49A 4N2SA 5KJMA 3LJ3A 3FUIA 3RO3A 2L0IA 3R7RA 4AY5A 3K9IA 2WXKA 3RRMB 3S7FA 3U9WA 2VSOE 3B13A 3FH5A 4B94A 4N2QA 2CHXA 4J8EA 4GZ6A 2R17C 2WMOA 3Q4AB 4DI4A 1SZ9A 4GPKA 2Y3AA 4AV7A 4FA6A 4CDNA 4MRUA 3Q49B 4FJZA 2Q7FA 3FU6A 4I9EA 5FWQA 2J9QA 3D9JA 1IQRA 3JQ0A 4AEZC 3U4TA 2LNIA 2PQNA 3LCAA 4JPSA 3T5XA 2ONDA 3NZSA 5CCMA 2AVPA 4ILHB 4BT9A 3SFZA 3IV0A 4ACKA 4CRWA 1OWOA 2VSNA 3EIJA 4ANWA 5J08A 2XEVA 4GB9A 1Z6TA 3MX3A 2LAIA 3PEUB 5D0OD 3G2TA 3IHVA 1H2UA 3FP3A 3IKOB 4UWHA 1N54A 2FF4A 3LEWA 4OYSA 3MYVA 2I9CA 4ANXA 4UI9C 5G05J 5T4YA 3LY8A 4FADA 3P2BA 3TAXA 4XZ4A 1UN9A 3MGBA 5EX3A 4AVXA 4FLHA 2XPZA 1H19A 3E4BA 3CVQA 1QNFA 2J07A 4XX5A 3CQCB 1E8YA 1X5BA 3CLJA 1IYGA 3I3NA 2WPVA 3UPVA 4JW1A 4TRQA 2GRMA 2AXZA 3FH8A 5BPPA 1LF8A 3QJZA 4P29A 2BUGA 2WB2A 2CG3A 1MQSA 2DCPA 2XQ0A 3OXLA 5FJYA 4W9RA 4DI3A 5BUZA 2LAHA 2VGYA 2XHEA 2IU1A 4U07A 3SD5A 4NACA 3P1UA 4JA7A 3B7RL 2VJ8A 3FU3A 4N3CA 2XRZA 4XI0A 2QY7A 2WXRA 2WXIA 1YA0A 2UY1B 5KCMA 2CHWA 3FTSA 4ANVA 3D9LA 5JJ7A 4HOTA 3JQ1A 3VLDA 5FZRA 2LO6A 3LXUX 3CVYA 4CGVA 4LCTA 4DLOA 3LY9A 4UQXA 2WQ6A 4I43A 2PQRA 4IN3B 2VQ2A 4UI9K 4UWLA 3L13A 1IQUA 2IJGX 4RG6A 2NXPA 2E0IA 4J8FA 4J6IA 3TL5A 4CT4A 4Y6CA 5A7DB 3ZVVA 3ASFA 2J4BA 4I2ZA 4MKTA 3L08A 5ARGA 5LP0A 2AXVA 2WXJA 3QWWA 4ABNA 3L6AA 4G1TA 1ELKA 5BNWA 1H2VC 3G2VA 3ZYQA 4F7AA 2XGSA 3ZHEB 3HVEB 4PS8A 4A55A 5J90A 1S0PA 3QWPA 2VGXB 3ZPJA 3JCKC 4UWKA 3FWVA 1N52A 4EQFA 2V0PA 2A4ZA 4GMLA 5G04C 3CHRA 4F3VA 2A5UA 3AU5A 3CV0A 3D9PA 2GW1A 5KJKA 4KBQA 3LYAA 4IULA 3RKVA 4KZ0A 4FULA 2KCVA 4GZ5A 1HU3A 2JLBA 4NURA 5E75A 2X6HA 5LCWC 1XNFA 1DNPA 2KZTB 1HF8A 1ZU2A 4HFGA 2PM7A 3CVPA 3ZYKA 3CVNA 4DJAA 3ZN3A 3CVLA 4PDXA 5CMWA 3ZYLA 1JWFA 4G2VA 3EJNA 3PDNA 4CEMA 1OWPA 4XI9A 4D10C 5LOZA 2RG8A 4DLQA 4JEUA 3SF4A 2X6KA 3C98A 3S7DA 2LSVA 4U0UA 3N71A 4UQZA 3IBEA 1FCHA 1Z3XA 4C9BB 4N39A 2FULA 3VLEA 1ELRA 2XGOA 5E76A 3IEGA 3SI5A 4OVUA 2I1KA 3RRNB 3CR3A 3ZRHA 4CDRA 4UI9J 1BPOA 2KCLA 4FC8A 4G11A 3CKCA 2AW6A 2J09A 2XGMA 4I6GA 3MKQA 2I1JA 4B0ZA 4IRUA 2WXGA 1U3DA 2CHZA 1HXIA 3CHOA 3ESLA 4J0UA 4A3VA 2X6FA 2XRYA 3HHMA 4G25A 3U64A 3ZYMA 3QNKA 3PH0C 2L6JA 4ILGA 4E85A 3SHFA 3ONKA 4GZ3A 4R7LA 3S7JA 4OVVA 2PL2A 3JYSA 2AXUA 2L0TB 4ACLA 2VTBB 3SBSA 2VSYA 3TXNA 4GYOA 4N3BA 2OVBA 3OAWA 4FU3A 3NF1A 1UN8A 2V5FA 2YHEA 4CT0A 3FULA 4L2YA 1HH8A 3D9OA 1ZBPA 2C0MA 4RSYA 4I1OB 3PS6A 4PUCA 1E8XA 5DBKA 2MRIA 4A1GA 3MV3B 4IYPA 4EBAG 4C0EA 4GAAA 2HYZA 1QZ2A 5A23A 2WXFA 4NQ0A 2MOWA 3D9NA 3UMVA 4TV3A 1HG2A 3DPDA 2WQHA 4WNFA 2ZU6B 2NC9A 3UT8A 2R59A 2GGFA 4C0MA 3KEZA 4RG9A 3GZ1A 3CKBA 4HLEA 2IOLA 3I5PA 3S7BA 1E7UA 3AS4A 4DPRA 1EDUA 1TJFA 1L5JA 3PEVB 3MZLB 3ML9A 4JEHA 5ENNA 3CVVA 5FQ7A 3GW4A 4ATGA 4UQYA 4GA2A 1UJJA 4Y6WA 1E90A 2UWJG 4WWOA 2C2LA 2FO7A 1FVHA 4FHJA 4U8HA 4A3TA 3BEEA 3LDZA 5CCLA 3UT7A 5FTPA 4HVBA 2WMNA 2X6JA 1QQEA 1NA3A 4CDMA 3LY7A 4LUNU 2GRLA 2WXQA 5FZQA 3FEYA 5BT1A 2HO1A 4KZCA 3ULQA 4BY6A 1A17A 5G04J 2Y4UA 3G2UA 3Q15A 4H7XA 2JEKA 3CIAA 4JVSA 4M3OA 1KT1A 4MLPA 5CMYA 3RIBA 4JC8A 2C0LA 3EHMA 4BSXA 2WM9A 4LRZA 2L9BA 1H2TC 5A6CA 5JHAA 3EHNA 1EF1C 5LCWJ 4APFA 4BTBA 2ILRA 2WVIA 1HX8A 3FTYA 3LVQE 3FUFA 4I6JA 4FP7A 4Q94A 3MA5A 3PZDA 3ZW3A 2Y4TA 3GZSA 1OUVA 3HYMB 4UWGA 5EDSA 3CHMA 4WWPA 3VTXA 3TGOA 2IOSA 3FUKA 1HE8A 3GZ2A 1Y6IA 3L54A 3SBTB 3SZ7A 4N3AA 4ANUA 2NSZA 5BW8C 3PUJA 3QDNA 2OVFA 4GA0A 3FUJA 4Q96A 3CQGB 4FHKA 3D9MA 5T3RA 5D0QD 3B7SA 4YVOA 3KS2A 4XKBA 4U0ZA 1E8ZA 2AWIA 3G2WA 4EZKA 3QK0A 2UY1A 4GU5A 3RRUA 1SZAA 4JHJA 3MEKA 3O48A 3PNTB 3QARA 3G2SA 3LVRE 5FQ4A 4LERA 3AS8A 3QOUA 4G26A 5M72A 4KVMA 3ASGA 3ZIMA 1KT0A 2XCBA 3FTXA 4WUYA 4E6HA 4F1SA 3FY4A 4B8CB 2BF0X 4RVBA 5CHEE 4BT8A 5LX8A 4J8DA 3ZXSA 1H6KA 4EZLA 1NP7A 4PS7A 4EBAA 5ARFA 1OWNA 3D9IA 2WXHA 3I4RB 3FHEA 2WXPA 4HXIA 3T5VA 1EYHA 1VDYA 2YHCA 3FTVA 5T8IA 3RU0A 3VLFA 3MCXA 3NZUA 3UUXA 3JUIA 2IQCA 3AU4A 3CHSA 2WQ7A 2VSXE 4YVQC 3LKUA 1E8WA 5EKQD 4TUUA 3HVEA 4J8SA 3ZHEA 3FTWA 3S2AA 2OOEA 3CHQA 1W3BA 4WNEA 1EPUA 2VGXA 3QAQA 4G24A 4BTAA 3CHPA 1Y8MA 4I9CA 4AIFA 4ILIA 4PS3A 1NZNA 3PVLA 3UT4A 3TG4A 3UQ3A 4B8AA 1TEZA 2WXOA 3KAEA 1E96B 2KC7A 4L2LA 4GYWA 4HOQA 5JJ6A 3CK7A 5HQ8A 3CVUA 3VTYA 4EPZA 4XE0A 4KMOA 1OWMA 3FUHA 3ONLA 2CFUA 2R5SA 3QKYA 3WXXA 3CEQA 3ASDA 3BG0B 3MV2B 4JHKA 2FBNA 2KCKA 3CSTA 3PRZA 3B7UX 4JL0A 4U0SA 5AJDA 4HOSA 1INZA 2KZTA 3O4ZA 2BTDA 4L23A 2FEZA 5G2NA 3CVXA 4WAFA 4BX9A 5C1DA 3OXFA 5KJLA 1WAO1 1B89A 3MJWA 3ZFWA 4DK5A 1JUQA 2V4LA 3ASHA 3B7TA 5HI7A 4HORA 1PAQA 3FU5A 2HR2A 2I2OA 4U63A 1PY1A 4GCOA 4JHRA 4K0RA 3ML8A 5ANRA 1E7VA 3FUDA 3OTNA 1SQMA 4CGWA 3TXMA 2OV8A 3U66A 1KLXA 3Q47B 3QC1A 4FJYA 4URKA 2XCCA 3FU0A 1JWGA 3BG1B 3FUEA 2YQ8A 1P5QA 4WNGA 4I6EA 2IONA 3T8MA 3CK9A 4V3IA 3QB2A 4F53A 2HM8A 2RD0A 4HOUA 4I2WA 3DBSA 3ENEA 3D9KA 4GCNA 4NRHB 3CGHA 2EQXA 4L1BA 3FEXA 5FZSA 2WXMA 4GMJA 5FT9A 3MKRA 3RK6A 4BX8A 2V8SE 4KVOA 3RJVA 4JZYA 3U3WA 2X38A 3RO2A 3APDA 2WXNA 4AM9A 1NA0A 2IFUA 4PH4B 2J08A 2VTBA 4I17A 4Q69A 5G05C 4XKCA 1PC2A 3D3MA 4GZCA 3QWVA 4H7YA 4JA9A 1H0AA 1TJCA 1HO8A 1WM5A 4MS6A 5C2YA 4A1SA 2XPYA 4AXHA 4WNDA 3CSFA 3FTUA 4BFRA 4WWNA 3KD7A 3SNXA 3FUMA 2IF4A 4GZDA 4O6FA 4B89A 5LFAA 2CG2A 3R7QA 2I6HA 2PZIA 3TG5A 4N5CA 4BWRA 3FTZA 3SGHA 5FQ6A 4GYYA 3HDXA 3GYZA 3LPZA 5KJNA 2WXLA 5AJLA 4LEUA 3PREA 2YINA 3APFA 3EIQC 4QFVA 5AIJA 1HFAA 2X6IA 3L16A 5DIZA 2DIWA 4GA1A 2QFCA 4ME2A 1HS6A 5JJTA 1HG5A 2KATA 3IHYA 4YNDA 3ZGQA 4KT6B 5JHBA 1HZ4A 3FH7A 1UJKA 5G55A 4UWFA 2YNQA 4U04A 4AOFA 3PE3A 3R9AB 3I4GA 5AYWD 4EZJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HF8 A;  4GZD A;  3RRU A;  1SZA A;  3D9J A;  4HFG A;  3ZYK A;  3D9K A;  3D9L A;  3G2S A;  1UJJ A;  1X5B A;  2LO6 A;  1HX8 A;  3CLJ A;  4Q94 A;  2V8S E;  4JXT A;  3LDZ A;  5CMW A;  3ZYL A;  1JUQ A;  1JWF A;  2BF0 X;  1DVP A;  4AVX A;  2MOW A;  5LOZ A;  1HFA A;  1LF8 A;  1PY1 A;  3D9N A;  3ZYM A;  1HG2 A;  2L0I A;  3ONK A;  2DIW A;  2DCP A;  5J08 A;  3D9I A;  3D9P A;  3ONL A;  1HG5 A;  1JPL A;  2L0T B;  1EYH A;  1VDY A;  1UJK A;  3G2U A;  3G2T A;  4GZC A;  4Q96 A;  5CMY A;  1JWG A;  1H0A A;  1SZ9 A;  1XGW A;  4FU3 A;  3D9M A;  4NAC A;  4FLB A;  5LP0 A;  1EDU A;  1INZ A;  3D9O A;  1MHQ A;  3G2W A;  3ZYQ A;  1ELK A;  2QY7 A;  3G2V A;  2KM4 A; 
#chains in the Genus database with same CATH topology
 3JUE A;  3APC A;  4F6R D;  3KSL A;  5AEN A;  4APO A;  4HS2 A;  1GW6 A;  3AS5 A;  3UX4 A;  4K03 A;  3FDH A;  1XGW A;  1MHQ A;  4GTM A;  3EDT B;  2XS8 A;  1OWL A;  3E33 A;  3UKR G;  3OXG A;  1FVF A;  3CK8 A;  3PNL B;  4L7T A;  4N2S A;  3RO3 A;  2VSO E;  4N2Q A;  2WMO A;  1SZ9 A;  4GPK A;  1D9S A;  4AV7 A;  5KNG A;  2Q7F A;  3D9J A;  1O1R A;  3ZXP A;  3T5X A;  3ABM E;  4ACK A;  3EIJ A;  2R03 A;  3IKO B;  5CER B;  2FF4 A;  4OYS A;  3P2B A;  5BXU A;  3MGB A;  4FLH A;  3KSQ A;  2J07 A;  3CQC B;  1X5B A;  3CLJ A;  2GRM A;  2AXZ A;  3E37 A;  4P29 A;  5FJY A;  4W9R A;  3J5P A;  2IU1 A;  4U07 A;  1N4P A;  4JA7 A;  2XRZ A;  4J8Y A;  5KCM A;  2CHW A;  3FTS A;  4ANV A;  2WQ6 A;  4I43 A;  4UWL A;  3L13 A;  2NXP A;  2E0I A;  3DSX A;  1V54 E;  5LP0 A;  3SQV A;  2AXV A;  3QWW A;  5FIO A;  1ELK A;  1H2V C;  3ZYQ A;  4MBG A;  4F7A A;  4CYM D;  5J90 A;  1S0P A;  3QWP A;  3JCK C;  3PZ1 A;  4EQF A;  2A4Z A;  1FT1 A;  1FPP A;  2GW1 A;  5KJK A;  3LYA A;  4KZ0 A;  4FUL A;  2X6H A;  4BSZ B;  3UM2 A;  1XNF A;  2KZT B;  3ZYK A;  3CVP A;  3C3Q A;  3CVL A;  3ZYL A;  4CEM A;  4XI9 A;  3SFX A;  3JXI A;  3BQO A;  3SF4 A;  3C98 A;  4UQZ A;  3IBE A;  5JA4 D;  3DST A;  4OVU A;  3RRN B;  2QYJ A;  5KNH D;  3HXE A;  4CDR A;  4GTS A;  3AG1 E;  1YMP A;  3CHO A;  2X6F A;  2XRY A;  4GZ3 A;  2PL2 A;  2AXU A;  4JB8 P;  2VSY A;  3TXN A;  2PNN A;  4FU3 A;  1OT8 A;  4DX7 D;  4BEP A;  4I1O B;  4PUC A;  3D9N A;  3UMV A;  4EHM A;  1HG2 A;  2GRQ B;  4WNF A;  2KBX A;  2GGF A;  3GZ1 A;  2OEV A;  3I5P A;  1E7U A;  3AS4 A;  1TJF A;  1L5J A;  2RKK A;  4JEH A;  2ETC A;  3CVV A;  3EHR A;  1Z5S C;  5FQ7 A;  3GW4 A;  4GA2 A;  4Y6W A;  2C2L A;  4FHJ A;  4U8H A;  5CCL A;  2WMN A;  1QQE A;  3ASO E;  2WXQ A;  4YDY A;  3F6Q A;  4HB5 A;  1A17 A;  5G04 J;  2JEK A;  5CMY A;  4MLP A;  2C0L A;  3DRA A;  2L9B A;  5A6C A;  5JHA A;  5LCW J;  1HX8 A;  4FP7 A;  3PZD A;  5EDS A;  3CHM A;  4L9P A;  4WWP A;  4BER A;  2Y69 E;  3SZ7 A;  2NSZ A;  3FUJ A;  4FHK A;  3D9M A;  5D0Q D;  3B7S A;  1OCR E;  3KS2 A;  1E8Z A;  1SZA A;  3PNT B;  1QYM A;  5FQ4 A;  3AS8 A;  3ZUV B;  2BF0 X;  4RVB A;  2MYO A;  2IEJ A;  3FHE A;  2WXP A;  3FTV A;  3NZU A;  2IQC A;  5BXO A;  5CEC B;  2VSX E;  4XEI G;  4J8S A;  3FTW A;  3S2A A;  4ZHB A;  3CHP A;  4ILI A;  3PVL A;  3TG4 A;  2A5E A;  4B8A A;  3KAE A;  3CVU A;  4EPZ A;  4KMO A;  1OWM A;  1N0Q A;  5CED B;  3ONL A;  3QKY A;  4G8L A;  2FBN A;  1KZO A;  2KZT A;  3OXF A;  5KJL A;  3MJW A;  2V4L A;  4HOR A;  3ASH A;  3B7T A;  2HR2 A;  4JHR A;  3ML8 A;  3TWW A;  3U66 A;  4URK A;  1JWG A;  2YQ8 A;  3T8M A;  3QB2 A;  1DCE A;  4F53 A;  3TWX A;  3DBS A;  1WG0 A;  3RK6 A;  4KVO A;  4BET A;  3RO2 A;  4PH4 B;  3D3M A;  3J5Q B;  2XPY A;  1KPS B;  3FUM A;  2LXM A;  2IF4 A;  4RLY A;  4B89 A;  2I6H A;  2PZI A;  4N5C A;  5FQ6 A;  3GYZ A;  3ZNG A;  5AJL A;  3PRE A;  3APF A;  5AIJ A;  1HFA A;  2DIW A;  2QFC A;  1HG5 A;  3IHY A;  4KT6 B;  2JAB A;  4UWF A;  2YNQ A;  1OXJ A;  3UM0 A;  2XEH A;  3PZ4 A;  4EZJ A;  2P9L G;  1UW4 B;  3FUN A;  2CFZ A;  3MKQ B;  2MHK A;  1DVP A;  3Q5M A;  5EX0 A;  2J4D A;  2P58 C;  4I1A A;  2BED A;  1JPL A;  3L22 A;  2M63 A;  3V2X A;  5FQ8 A;  3CVW A;  1UG3 A;  2XZD G;  3PE4 A;  2XPI A;  4G8K A;  2BKG A;  4G23 A;  1LTX A;  4I1M A;  5AAO A;  4JXT A;  4CCA A;  3HIZ A;  3LJ3 A;  2WXK A;  3S7F A;  1MJ0 A;  2ZIS A;  3B13 A;  3UIP C;  2GRO B;  3HRA A;  4FA6 A;  3V30 A;  3Q49 B;  4FJZ A;  2NYJ A;  2AJA A;  4LNG A;  2LNI A;  4JPS A;  3PZ2 A;  1G3N B;  2AVP A;  4K5A B;  4GB9 A;  2LAI A;  5D0O D;  3IHV A;  3FP3 A;  4UWH A;  1N54 A;  2F8Y A;  2I9C A;  5G05 J;  3UIO C;  3LY8 A;  4XZ4 A;  2XPZ A;  1H19 A;  3AG4 E;  3CVQ A;  1K1B A;  3UPV A;  5BPP A;  3QJZ A;  2CG3 A;  1MQS A;  3EUV A;  3OXL A;  3ASN E;  4O1O A;  4Z68 A;  2VJ8 A;  4XI0 A;  1YA0 A;  2WXI A;  2H6G A;  2UY1 B;  5ENP D;  3JQ1 A;  3VLD A;  4LCT A;  3LY9 A;  4UQX A;  1H6P A;  2PQR A;  4UI9 K;  2IJG X;  4GTV A;  1K8K G;  5EN5 D;  2OCC E;  3ASF A;  2DYS E;  3W9G A;  2WXJ A;  1O1T A;  2XGS A;  5HRY A;  1N94 A;  2ZXW E;  4UWK A;  1X81 A;  2V0P A;  4GML A;  3CHR A;  4F3V A;  3D9P A;  1OCO E;  4KBQ A;  4U8Y D;  5E75 A;  3TWQ A;  2DYR E;  1HF8 A;  1ZU2 A;  4DJA A;  1OCZ E;  3ZN3 A;  2DZO A;  3PDN A;  2RG8 A;  3S7D A;  1Z3X A;  1D8E A;  3SI5 A;  4UI9 J;  4G11 A;  3CKC A;  3AG3 E;  3MKQ A;  2R02 A;  4G25 A;  4O60 A;  4E85 A;  3S7J A;  2L0T B;  3NB2 A;  4GYO A;  4N3B A;  3EU5 A;  3NF1 A;  2P9N G;  2Y0B G;  3FUL A;  4L2Y A;  1HH8 A;  3D9O A;  3HXD A;  1ZBP A;  2C0M A;  3PS6 A;  4U96 D;  1BLX B;  4EBA G;  4C0E A;  5EIB E;  5A23 A;  4NQ0 A;  1Q2Z A;  4TV3 A;  5ENT D;  4DX6 D;  3C3O A;  4HLE A;  4DX1 A;  3S7B A;  1EDU A;  3PEV B;  5D2M C;  3ML9 A;  5ENN A;  3UT7 A;  4GTP A;  3FEY A;  2QYU A;  2H6H A;  3ISM C;  4H7X A;  4M3O A;  3CIA A;  4JVS A;  1KT1 A;  3SY2 A;  3EHM A;  2XZT G;  2EIM E;  3FTY A;  4I6J A;  3FUF A;  3MA5 A;  3ZW3 A;  2Y4T A;  3UTM A;  4YDO A;  4HRL A;  1BI7 B;  2IOS A;  1N4R A;  1Y6I A;  3L54 A;  1V55 E;  4N3A A;  5BW8 C;  1K3Z D;  3PUJ A;  2OVF A;  3CQG B;  3G2W A;  3QK0 A;  2UY1 A;  4NIK A;  4HRN A;  4JD2 G;  3O48 A;  3LVR E;  4LER A;  5M72 A;  2P9K G;  3ASG A;  3ZIM A;  3KEA A;  5LX8 A;  5CHE E;  3ZXS A;  4EZL A;  4PS7 A;  3D9I A;  2WXH A;  1TN6 A;  3HXC A;  3JUI A;  4YVQ C;  1E8W A;  2OOE A;  4WNE A;  1EPU A;  4BTA A;  4PS3 A;  2KC7 A;  4GYW A;  1NI1 A;  3FUH A;  4JHK A;  3WG7 E;  3C3R A;  3PRZ A;  2IO2 C;  1INZ A;  4L23 A;  3CVX A;  4WAF A;  5C1D A;  1TNB A;  4DK5 A;  1JUQ A;  1PAQ A;  4TXR A;  1PY1 A;  5ANR A;  4K0R A;  1E7V A;  1SQM A;  4N5Q A;  5ENS D;  2B6C A;  2OV8 A;  4GTQ A;  2F37 A;  4FJY A;  2XCC A;  3FU0 A;  4DX5 D;  4WNG A;  2ION A;  3B95 A;  4I2W A;  3ENE A;  1TNZ A;  3D9K A;  4NRH B;  3DSW A;  3NBN B;  4GMJ A;  4BX8 A;  5FIN A;  4JZY A;  2P9I G;  2X38 A;  2WXN A;  2IFU A;  2J08 A;  4HRM B;  4XKC A;  1PC2 A;  4GZC A;  5BV1 A;  2H6I A;  1WM5 A;  5C2Y A;  1HO8 A;  4A1S A;  3ABL E;  4AXH A;  4WND A;  5ENQ D;  1KZP A;  4O6F A;  3HG0 D;  5LFA A;  4BWR A;  5CBN A;  3SGH A;  3HDX A;  4ATZ D;  5DIZ A;  1HS6 A;  1UJK A;  5G55 A;  4F1P A;  4AOF A;  3R9A B;  1TR4 A;  5AYW D;  1O5M A;  1WDY A;  4KXK B;  4GPM A;  2FI7 A;  2LSU A;  2FO1 E;  1WY6 A;  4KYO B;  3FFL A;  1ELW A;  3L17 A;  3NQP A;  3BUA A;  3TJP A;  4K5C A;  3URZ A;  4AP2 A;  3PUK A;  1U3C A;  2X3M A;  2VYI A;  3DPY A;  2L0I A;  5H7P A;  3R7R A;  4AY5 A;  1IHB A;  3Q75 A;  3RRM B;  3U9W A;  3FH5 A;  2CHX A;  2R17 C;  4DI4 A;  2Y3A A;  4CDN A;  1A5E A;  5FWQ A;  2J9Q A;  1IQR A;  3DSU A;  3U4T A;  4LSZ E;  4J7W A;  3E32 A;  3UM1 A;  3D9H A;  4CRW A;  2VSN A;  2OEW A;  1Z6T A;  1H2U A;  4ANX A;  4FAD A;  3TAX A;  1MZC A;  3E4B A;  1QNF A;  1E8Y A;  1IYG A;  3I3N A;  2WPV A;  2VGE A;  4TRQ A;  5HKP A;  2WB2 A;  1LD7 A;  4DI3 A;  2GRR B;  5BUZ A;  2LAH A;  5EYP F;  2XHE A;  3SD5 A;  3P1U A;  3B7R L;  1JCQ A;  2WXR A;  2DVW A;  1JCR A;  3D9L A;  5JJ7 A;  4HOT A;  2LO6 A;  3LXU X;  4CGV A;  4DLO A;  1MX2 A;  4A63 B;  1IQU A;  4J8F A;  4J6I A;  4ZFH A;  3TL5 A;  1NFI E;  2RFA A;  4Y6C A;  3ZVV A;  2KXP C;  2J4B A;  3L08 A;  4ABN A;  3L6A A;  4G1T A;  5BNW A;  1N4S A;  3HVE B;  1AP7 A;  5B3S E;  3T8K A;  5G04 C;  2A5U A;  3AU5 A;  3CV0 A;  4HLL A;  2V4H C;  4IUL A;  2KCV A;  1HU3 A;  4NUR A;  5LCW C;  1DCQ A;  3RSE G;  2PM7 A;  2LUH A;  5CMW A;  1QBQ A;  4D10 C;  5LOZ A;  4DLQ A;  5AQB A;  2LSV A;  4U0U A;  3N71 A;  1FCH A;  5AAR A;  4C9B B;  2FUL A;  3HXF A;  5E76 A;  3IEG A;  2F8X K;  3DEP A;  3CR3 A;  2ETB A;  1BPO A;  2KCL A;  2J09 A;  4I6G A;  4B0Z A;  4IRU A;  2WXG A;  1U3D A;  4A3V A;  3Q9U C;  3U64 A;  3C5R A;  3PH0 C;  4TXP A;  3SHF A;  3ONK A;  5ENO D;  3JYS A;  1MX4 A;  3OAW A;  2P2C P;  2YHE A;  5AN8 A;  4GMR A;  3ULY A;  4RSY A;  2MRI A;  4A1G A;  3MV3 B;  3ABK E;  4IYP A;  3UXG A;  4GAA A;  2HYZ A;  1QZ2 A;  2WXF A;  3Q7F A;  3DPD A;  2NC9 A;  2R59 A;  3KEZ A;  4RG9 A;  2ETA A;  2P9S G;  2IOL A;  3W9F A;  4DPR A;  1IXV A;  3MZL B;  4UQY A;  1N4Q A;  2LXL A;  2UWJ G;  3DEO A;  2FO7 A;  4A3T A;  1FVH A;  3LDZ A;  4HVB A;  2X6J A;  4CDM A;  1NA3 A;  3Q73 A;  2GRL A;  4M7C A;  5BT1 A;  4KZC A;  3ULQ A;  4BY6 A;  3Q15 A;  3RIB A;  2R05 A;  4U95 D;  2WM9 A;  1JCS A;  4LRZ A;  5B1A E;  3ULE G;  1EF1 C;  4APF A;  4BTB A;  2ILR A;  2WVI A;  4Q94 A;  3GZS A;  3L9T A;  5HS0 A;  3HYM B;  3TGO A;  3FUK A;  2QC9 A;  1HE8 A;  1N95 A;  4ANU A;  5T3R A;  4YVO A;  2AWI A;  4EZK A;  4JHJ A;  3QOU A;  4G26 A;  3ZKJ A;  4KVM A;  4YDE A;  1KT0 A;  4WUY A;  4F1S A;  3FY4 A;  3TWV A;  4J8D A;  5ARF A;  2H6F A;  3T5V A;  1EYH A;  3Q78 A;  1OCC E;  3MCX A;  3UUX A;  3TWT A;  3AU4 A;  3CHS A;  5EIL A;  1LD8 A;  3HVE A;  3QAQ A;  4G24 A;  4AIF A;  1NZN A;  2V5Q C;  4LNB A;  1TEZ A;  3UQ3 A;  2WXO A;  1E96 B;  4L2L A;  3CK7 A;  3E34 A;  1SA5 A;  3VTY A;  2GRN B;  4X8Q A;  4XE0 A;  2CFU A;  2R5S A;  3ASD A;  3NOC D;  3SO8 A;  3TWR A;  1FT2 A;  2KCK A;  2XEE A;  5ITZ F;  3B7U X;  4JL0 A;  4U0S A;  4U8V D;  2GRP B;  3O4Z A;  1H6O A;  1SW6 A;  2FEZ A;  5G2N A;  4BX9 A;  1MX6 A;  5HI7 A;  1SA4 A;  1DC2 A;  3FU5 A;  3DXM G;  4GCO A;  3OTN A;  2F0Y A;  3TXM A;  3QC1 A;  1P5Q A;  4I6E A;  1UOH A;  3CK9 A;  1N11 A;  2EQX A;  4L1B A;  1O1S A;  2WXM A;  5FT9 A;  2V8S E;  1S63 A;  3EHQ A;  3APD A;  4AM9 A;  4I17 A;  4Q69 A;  5G05 C;  4H7Y A;  3QWV A;  1H0A A;  3FTU A;  4WWN A;  3KD7 A;  3SNX A;  3AJI A;  3R7Q A;  4GYY A;  3TWS A;  3DSV A;  3LPZ A;  3TWU A;  2YIN A;  3EIQ C;  2X6I A;  4HNA D;  5D66 A;  3L16 A;  4GA1 A;  4ME2 A;  5JHB A;  2KAT A;  4YND A;  3ZGQ A;  1HZ4 A;  3FH7 A;  5AQ7 A;  4U04 A;  3I4G A;  2XS1 A;  3IXE A;  3AAA C;  4EEC A;  2DBA A;  3Q9N C;  2E2E A;  3ESK A;  3V31 A;  5ANL A;  4GTO A;  3LS8 A;  4AY6 A;  5BV0 A;  2XEN A;  4AJW A;  3UM3 A;  4FLB A;  1Z3Y A;  1IHG A;  2KM4 A;  3ZEF A;  3E30 A;  4XIF A;  2PM6 A;  1TN7 A;  2J49 A;  5KJM A;  3FUI A;  3K9I A;  3T9K A;  4B94 A;  4J8E A;  4GZ6 A;  3Q4A B;  4MRU A;  4YDW A;  1BI8 B;  3FU6 A;  4I9E A;  1D8D A;  3JQ0 A;  4AEZ C;  2PQN A;  3LCA A;  2OND A;  3NZS A;  5CCM A;  4ILH B;  4BT9 A;  3SFZ A;  3IV0 A;  1OWO A;  4ANW A;  5J08 A;  2XEV A;  3MX3 A;  1YCS B;  2QZA A;  3G2T A;  3C72 A;  3PEU B;  3LEW A;  3MYV A;  4UI9 C;  5T4Y A;  3JXJ A;  1UN9 A;  5EX3 A;  4AVX A;  2DZN A;  4XX5 A;  5CRU A;  5IY5 E;  4K5B A;  4GTR A;  4JW1 A;  3FH8 A;  1LF8 A;  2BUG A;  1S70 B;  2DCP A;  2XQ0 A;  2VGY A;  5JMN D;  2Y1L E;  4NAC A;  1U2V G;  3FU3 A;  4N3C A;  2QY7 A;  5ENR D;  5FZR A;  3CVY A;  4IN3 B;  2VQ2 A;  1N9A A;  2J8S D;  4RG6 A;  3X2Q E;  4UUC A;  4CT4 A;  3V2O A;  1BD8 A;  5A7D B;  4MKT A;  4I2Z A;  5ARG A;  1AWC B;  4TXQ A;  3G2V A;  2L6B A;  4A55 A;  3UI2 A;  4PS8 A;  3ZHE B;  4GTT A;  2VGX B;  3ZPJ A;  3FWV A;  1N52 A;  4DRX E;  4CZ2 D;  4C48 B;  1K1A A;  2EIK E;  3RKV A;  4GZ5 A;  1TNO A;  2JLB A;  2EIN E;  1DNP A;  1TYQ G;  4HFG A;  3Q79 A;  3CVN A;  4DUI A;  4PDX A;  1JWF A;  4G2V A;  3EJN A;  1OWP A;  4JEU A;  2X6K A;  3DXK G;  4N39 A;  3DWL G;  3VLE A;  1ELR A;  5CBO A;  2XGO A;  2IO3 C;  2I1K A;  4HBD A;  3ZRH A;  4FC8 A;  5EID A;  2AW6 A;  2XGM A;  2I1J A;  2CHZ A;  4J0U A;  1HXI A;  1TNY A;  3ESL A;  3HHM A;  3ZYM A;  3QNK A;  2L6J A;  4ILG A;  4R7L A;  4OVV A;  2VTB B;  4ACL A;  2B0O E;  3SBS A;  2OVB A;  3ZU7 B;  2IY0 C;  1UN8 A;  2V5F A;  4CT0 A;  4LG6 A;  1MYO A;  3SFY A;  1E8X A;  5DBK A;  1RW2 A;  1S64 A;  3UIN C;  2MOW A;  5KBA A;  1N0R A;  2WQH A;  2ZU6 B;  3UT8 A;  4C0M A;  2EIJ E;  3CKB A;  3UKU G;  5KWD A;  1YYH A;  4ATG A;  1UJJ A;  1E90 A;  4LNU D;  4WWO A;  3BEE A;  5FTP A;  3LY7 A;  4LUN U;  3PZ3 A;  5FZQ A;  2HO1 A;  4OAU C;  2R2L A;  2Y4U A;  3G2U A;  4JC8 A;  4BSX A;  3LJN A;  4RQI A;  4HQD A;  1H2T C;  3EHN A;  4O1P A;  3LVQ E;  2P9U G;  1OUV A;  4UWG A;  3VTX A;  3GZ2 A;  3SBT B;  4Q96 A;  3QDN A;  4GA0 A;  3AG2 E;  3L82 A;  2ZGD A;  3RAU A;  4XKB A;  4U0Z A;  4GU5 A;  1IKN D;  3RRU A;  3EU9 A;  3MEK A;  3QAR A;  3G2S A;  5CEA A;  3FTX A;  2XCB A;  4E6H A;  2HE0 A;  4B8C B;  4BT8 A;  1H6K A;  1NP7 A;  4EBA A;  1OWN A;  3I4R B;  4HXI A;  1VDY A;  2YHC A;  5T8I A;  3RU0 A;  3VLF A;  5AQ9 A;  2WQ7 A;  4HI9 A;  3LKU A;  5EKQ D;  3DSS A;  4TUU A;  3ZHE A;  3CHQ A;  1W3B A;  2VGX A;  1Y8M A;  3B7B A;  4I9C A;  3UT4 A;  5JJ6 A;  4HOQ A;  2BKK B;  5HQ8 A;  3NOG D;  3R9M A;  2EIL E;  3WXX A;  3CEQ A;  3BG0 B;  3MV2 B;  3CST A;  5AJD A;  4HOS A;  2BTD A;  2RFM A;  5CRV A;  4OAV B;  5AQA A;  1WAO 1;  1B89 A;  3ZFW A;  4BES A;  4HI8 A;  1RZ4 A;  2I2O A;  4U63 A;  3FUD A;  1OY3 D;  4CGW A;  1KLX A;  3Q47 B;  3BG1 B;  3FUE A;  1TNU A;  4QQI A;  3V79 K;  1BU9 A;  4V3I A;  2HM8 A;  2RD0 A;  4HOU A;  4GCN A;  3NAW A;  3CGH A;  3FEX A;  5FZS A;  3MKR A;  3Q7A A;  3RJV A;  3U3W A;  1ZB1 A;  1NA0 A;  2P9P G;  2VTB A;  4JA9 A;  1TJC A;  4MS6 A;  3CSF A;  4BFR A;  3HXB A;  2ZGG A;  4U7E B;  1TN8 A;  4GZD A;  2CG2 A;  3TG5 A;  3FTZ A;  5KJN A;  2DWZ A;  2ZIR A;  2WXL A;  4LEU A;  4QFV A;  1SVX A;  5B1B E;  4TUM A;  5JJT A;  4DX2 A;  4B93 B;  5EYL A;  3BU8 A;  1NL4 A;  3PE3 A; 
#chains in the Genus database with same CATH homology
 4EEC A;  4KXK B;  2DBA A;  1UW4 B;  3FUN A;  3APC A;  2E2E A;  2CFZ A;  2FI7 A;  3MKQ B;  2LSU A;  5AEN A;  3ESK A;  5ANL A;  4APO A;  1WY6 A;  2MHK A;  1DVP A;  4HS2 A;  3Q5M A;  4KYO B;  5EX0 A;  2J4D A;  1GW6 A;  2P58 C;  3AS5 A;  3FFL A;  3UX4 A;  3LS8 A;  4I1A A;  4K03 A;  5BV1 A;  5BV0 A;  4AY6 A;  1ELW A;  4AJW A;  1JPL A;  3L22 A;  3L17 A;  3FDH A;  3NQP A;  1XGW A;  4FLB A;  2M63 A;  1Z3Y A;  1IHG A;  5FQ8 A;  3TJP A;  3CVW A;  1MHQ A;  1UG3 A;  3URZ A;  2KM4 A;  3EDT B;  3PE4 A;  3ZEF A;  2XPI A;  4AP2 A;  1OWL A;  3PUK A;  4XIF A;  4G23 A;  4I1M A;  3OXG A;  4JXT A;  1U3C A;  2X3M A;  2VYI A;  1FVF A;  3CK8 A;  3PNL B;  4CCA A;  4L7T A;  2PM6 A;  3HIZ A;  2J49 A;  4N2S A;  5KJM A;  3LJ3 A;  3FUI A;  3RO3 A;  2L0I A;  3R7R A;  4AY5 A;  3K9I A;  2WXK A;  3RRM B;  3S7F A;  3U9W A;  2VSO E;  3B13 A;  3FH5 A;  4B94 A;  4N2Q A;  2CHX A;  4J8E A;  4GZ6 A;  2R17 C;  2WMO A;  3Q4A B;  4DI4 A;  1SZ9 A;  4GPK A;  2Y3A A;  4AV7 A;  4FA6 A;  4CDN A;  4MRU A;  3Q49 B;  4FJZ A;  2Q7F A;  3FU6 A;  4I9E A;  5FWQ A;  2J9Q A;  3D9J A;  1IQR A;  3JQ0 A;  4AEZ C;  3U4T A;  2LNI A;  2PQN A;  3LCA A;  4JPS A;  3T5X A;  2OND A;  3NZS A;  5CCM A;  2AVP A;  4ILH B;  4BT9 A;  3SFZ A;  3IV0 A;  4ACK A;  4CRW A;  1OWO A;  2VSN A;  3EIJ A;  4ANW A;  5J08 A;  2XEV A;  4GB9 A;  1Z6T A;  3MX3 A;  2LAI A;  3PEU B;  5D0O D;  3G2T A;  3IHV A;  1H2U A;  3FP3 A;  3IKO B;  4UWH A;  1N54 A;  2FF4 A;  3LEW A;  4OYS A;  3MYV A;  2I9C A;  4ANX A;  4UI9 C;  5G05 J;  5T4Y A;  3LY8 A;  4FAD A;  3P2B A;  3TAX A;  4XZ4 A;  1UN9 A;  3MGB A;  5EX3 A;  4AVX A;  4FLH A;  2XPZ A;  1H19 A;  3E4B A;  3CVQ A;  1QNF A;  2J07 A;  4XX5 A;  3CQC B;  1E8Y A;  1X5B A;  3CLJ A;  1IYG A;  3I3N A;  2WPV A;  3UPV A;  4JW1 A;  4TRQ A;  2GRM A;  2AXZ A;  3FH8 A;  5BPP A;  1LF8 A;  3QJZ A;  4P29 A;  2BUG A;  2WB2 A;  2CG3 A;  1MQS A;  2DCP A;  2XQ0 A;  3OXL A;  5FJY A;  4W9R A;  4DI3 A;  5BUZ A;  2LAH A;  2VGY A;  2XHE A;  2IU1 A;  4U07 A;  3SD5 A;  4NAC A;  3P1U A;  4JA7 A;  3B7R L;  2VJ8 A;  3FU3 A;  4N3C A;  2XRZ A;  4XI0 A;  2QY7 A;  2WXR A;  2WXI A;  1YA0 A;  2UY1 B;  5KCM A;  2CHW A;  3FTS A;  4ANV A;  3D9L A;  5JJ7 A;  4HOT A;  3JQ1 A;  3VLD A;  5FZR A;  2LO6 A;  3LXU X;  3CVY A;  4CGV A;  4LCT A;  4DLO A;  3LY9 A;  4UQX A;  2WQ6 A;  4I43 A;  2PQR A;  4IN3 B;  2VQ2 A;  4UI9 K;  4UWL A;  3L13 A;  1IQU A;  2IJG X;  4RG6 A;  2NXP A;  2E0I A;  4J8F A;  4J6I A;  3TL5 A;  4CT4 A;  4Y6C A;  5A7D B;  3ZVV A;  3ASF A;  2J4B A;  4I2Z A;  4MKT A;  3L08 A;  5ARG A;  5LP0 A;  2AXV A;  2WXJ A;  3QWW A;  4ABN A;  3L6A A;  4G1T A;  1ELK A;  5BNW A;  1H2V C;  3G2V A;  3ZYQ A;  4F7A A;  2XGS A;  3ZHE B;  3HVE B;  4PS8 A;  4A55 A;  5J90 A;  1S0P A;  3QWP A;  2VGX B;  3ZPJ A;  3JCK C;  4UWK A;  3FWV A;  1N52 A;  4EQF A;  2V0P A;  2A4Z A;  4GML A;  5G04 C;  3CHR A;  4F3V A;  2A5U A;  3AU5 A;  3CV0 A;  3D9P A;  2GW1 A;  5KJK A;  4KBQ A;  3LYA A;  4IUL A;  3RKV A;  4KZ0 A;  4FUL A;  2KCV A;  4GZ5 A;  1HU3 A;  2JLB A;  4NUR A;  5E75 A;  2X6H A;  5LCW C;  1XNF A;  1DNP A;  2KZT B;  1HF8 A;  1ZU2 A;  4HFG A;  2PM7 A;  3CVP A;  3ZYK A;  3CVN A;  4DJA A;  3ZN3 A;  3CVL A;  4PDX A;  5CMW A;  3ZYL A;  1JWF A;  4G2V A;  3EJN A;  3PDN A;  4CEM A;  1OWP A;  4XI9 A;  4D10 C;  5LOZ A;  2RG8 A;  4DLQ A;  4JEU A;  3SF4 A;  2X6K A;  3C98 A;  3S7D A;  2LSV A;  4U0U A;  3N71 A;  4UQZ A;  3IBE A;  1FCH A;  1Z3X A;  4C9B B;  4N39 A;  2FUL A;  3VLE A;  1ELR A;  2XGO A;  5E76 A;  3IEG A;  3SI5 A;  4OVU A;  2I1K A;  3RRN B;  3CR3 A;  3ZRH A;  4CDR A;  4UI9 J;  1BPO A;  2KCL A;  4FC8 A;  4G11 A;  3CKC A;  2AW6 A;  2J09 A;  2XGM A;  4I6G A;  3MKQ A;  2I1J A;  4B0Z A;  4IRU A;  2WXG A;  1U3D A;  2CHZ A;  1HXI A;  3CHO A;  3ESL A;  4J0U A;  4A3V A;  2X6F A;  2XRY A;  3HHM A;  4G25 A;  3U64 A;  3ZYM A;  3QNK A;  3PH0 C;  2L6J A;  4ILG A;  4E85 A;  3SHF A;  3ONK A;  4GZ3 A;  4R7L A;  3S7J A;  4OVV A;  2PL2 A;  3JYS A;  2AXU A;  2L0T B;  4ACL A;  2VTB B;  3SBS A;  2VSY A;  3TXN A;  4GYO A;  4N3B A;  2OVB A;  3OAW A;  4FU3 A;  3NF1 A;  1UN8 A;  2V5F A;  2YHE A;  4CT0 A;  3FUL A;  4L2Y A;  1HH8 A;  3D9O A;  1ZBP A;  2C0M A;  4RSY A;  4I1O B;  3PS6 A;  4PUC A;  1E8X A;  5DBK A;  2MRI A;  4A1G A;  3MV3 B;  4IYP A;  4EBA G;  4C0E A;  4GAA A;  2HYZ A;  1QZ2 A;  5A23 A;  2WXF A;  4NQ0 A;  2MOW A;  3D9N A;  3UMV A;  4TV3 A;  1HG2 A;  3DPD A;  2WQH A;  4WNF A;  2ZU6 B;  2NC9 A;  3UT8 A;  2R59 A;  2GGF A;  4C0M A;  3KEZ A;  4RG9 A;  3GZ1 A;  3CKB A;  4HLE A;  2IOL A;  3I5P A;  3S7B A;  1E7U A;  3AS4 A;  4DPR A;  1EDU A;  1TJF A;  1L5J A;  3PEV B;  3MZL B;  3ML9 A;  4JEH A;  5ENN A;  3CVV A;  5FQ7 A;  3GW4 A;  4ATG A;  4UQY A;  4GA2 A;  1UJJ A;  4Y6W A;  1E90 A;  2UWJ G;  4WWO A;  2C2L A;  2FO7 A;  1FVH A;  4FHJ A;  4U8H A;  4A3T A;  3BEE A;  3LDZ A;  5CCL A;  3UT7 A;  5FTP A;  4HVB A;  2WMN A;  2X6J A;  1QQE A;  1NA3 A;  4CDM A;  3LY7 A;  4LUN U;  2GRL A;  2WXQ A;  5FZQ A;  3FEY A;  5BT1 A;  2HO1 A;  4KZC A;  3ULQ A;  4BY6 A;  1A17 A;  5G04 J;  2Y4U A;  3G2U A;  3Q15 A;  4H7X A;  2JEK A;  3CIA A;  4JVS A;  4M3O A;  1KT1 A;  4MLP A;  5CMY A;  3RIB A;  4JC8 A;  2C0L A;  3EHM A;  4BSX A;  2WM9 A;  4LRZ A;  2L9B A;  1H2T C;  5A6C A;  5JHA A;  3EHN A;  1EF1 C;  5LCW J;  4APF A;  4BTB A;  2ILR A;  2WVI A;  1HX8 A;  3FTY A;  3LVQ E;  3FUF A;  4I6J A;  4FP7 A;  4Q94 A;  3MA5 A;  3PZD A;  3ZW3 A;  2Y4T A;  3GZS A;  1OUV A;  3HYM B;  4UWG A;  5EDS A;  3CHM A;  4WWP A;  3VTX A;  3TGO A;  2IOS A;  3FUK A;  1HE8 A;  3GZ2 A;  1Y6I A;  3L54 A;  3SBT B;  3SZ7 A;  4N3A A;  4ANU A;  2NSZ A;  5BW8 C;  3PUJ A;  3QDN A;  2OVF A;  4GA0 A;  3FUJ A;  4Q96 A;  3CQG B;  4FHK A;  3D9M A;  5T3R A;  5D0Q D;  3B7S A;  4YVO A;  3KS2 A;  4XKB A;  4U0Z A;  1E8Z A;  2AWI A;  3G2W A;  4EZK A;  3QK0 A;  2UY1 A;  4GU5 A;  3RRU A;  1SZA A;  4JHJ A;  3MEK A;  3O48 A;  3PNT B;  3QAR A;  3G2S A;  3LVR E;  5FQ4 A;  4LER A;  3AS8 A;  3QOU A;  4G26 A;  5M72 A;  4KVM A;  3ASG A;  3ZIM A;  1KT0 A;  2XCB A;  3FTX A;  4WUY A;  4E6H A;  4F1S A;  3FY4 A;  4B8C B;  2BF0 X;  4RVB A;  5CHE E;  4BT8 A;  5LX8 A;  4J8D A;  3ZXS A;  1H6K A;  4EZL A;  1NP7 A;  4PS7 A;  4EBA A;  5ARF A;  1OWN A;  3D9I A;  2WXH A;  3I4R B;  3FHE A;  2WXP A;  4HXI A;  3T5V A;  1EYH A;  1VDY A;  2YHC A;  3FTV A;  5T8I A;  3RU0 A;  3VLF A;  3MCX A;  3NZU A;  3UUX A;  3JUI A;  2IQC A;  3AU4 A;  3CHS A;  2WQ7 A;  2VSX E;  4YVQ C;  3LKU A;  1E8W A;  5EKQ D;  4TUU A;  3HVE A;  4J8S A;  3ZHE A;  3FTW A;  3S2A A;  2OOE A;  3CHQ A;  1W3B A;  4WNE A;  1EPU A;  2VGX A;  3QAQ A;  4G24 A;  4BTA A;  3CHP A;  1Y8M A;  4I9C A;  4AIF A;  4ILI A;  4PS3 A;  1NZN A;  3PVL A;  3UT4 A;  3TG4 A;  3UQ3 A;  4B8A A;  1TEZ A;  2WXO A;  3KAE A;  1E96 B;  2KC7 A;  4L2L A;  4GYW A;  4HOQ A;  5JJ6 A;  3CK7 A;  5HQ8 A;  3CVU A;  3VTY A;  4EPZ A;  4XE0 A;  4KMO A;  1OWM A;  3FUH A;  3ONL A;  2CFU A;  2R5S A;  3QKY A;  3WXX A;  3CEQ A;  3ASD A;  3BG0 B;  3MV2 B;  4JHK A;  2FBN A;  2KCK A;  3CST A;  3PRZ A;  3B7U X;  4JL0 A;  4U0S A;  5AJD A;  4HOS A;  1INZ A;  2KZT A;  3O4Z A;  2BTD A;  4L23 A;  2FEZ A;  5G2N A;  3CVX A;  4WAF A;  4BX9 A;  5C1D A;  3OXF A;  5KJL A;  1WAO 1;  1B89 A;  3MJW A;  3ZFW A;  4DK5 A;  1JUQ A;  2V4L A;  3ASH A;  3B7T A;  5HI7 A;  4HOR A;  1PAQ A;  3FU5 A;  2HR2 A;  2I2O A;  4U63 A;  1PY1 A;  4GCO A;  4JHR A;  4K0R A;  3ML8 A;  5ANR A;  1E7V A;  3FUD A;  3OTN A;  1SQM A;  4CGW A;  3TXM A;  2OV8 A;  3U66 A;  1KLX A;  3Q47 B;  3QC1 A;  4FJY A;  4URK A;  2XCC A;  3FU0 A;  1JWG A;  3BG1 B;  3FUE A;  2YQ8 A;  1P5Q A;  4WNG A;  4I6E A;  2ION A;  3T8M A;  3CK9 A;  4V3I A;  3QB2 A;  4F53 A;  2HM8 A;  2RD0 A;  4HOU A;  4I2W A;  3DBS A;  3ENE A;  3D9K A;  4GCN A;  4NRH B;  3CGH A;  2EQX A;  4L1B A;  3FEX A;  5FZS A;  2WXM A;  4GMJ A;  5FT9 A;  3MKR A;  3RK6 A;  4BX8 A;  2V8S E;  4KVO A;  3RJV A;  4JZY A;  3U3W A;  2X38 A;  3RO2 A;  3APD A;  2WXN A;  4AM9 A;  1NA0 A;  2IFU A;  4PH4 B;  2J08 A;  2VTB A;  4I17 A;  4Q69 A;  5G05 C;  4XKC A;  1PC2 A;  3D3M A;  4GZC A;  3QWV A;  4H7Y A;  4JA9 A;  1H0A A;  1TJC A;  1HO8 A;  1WM5 A;  4MS6 A;  5C2Y A;  4A1S A;  2XPY A;  4AXH A;  4WND A;  3CSF A;  3FTU A;  4BFR A;  4WWN A;  3KD7 A;  3SNX A;  3FUM A;  2IF4 A;  4GZD A;  4O6F A;  4B89 A;  5LFA A;  2CG2 A;  3R7Q A;  2I6H A;  2PZI A;  3TG5 A;  4N5C A;  4BWR A;  3FTZ A;  3SGH A;  5FQ6 A;  4GYY A;  3HDX A;  3GYZ A;  3LPZ A;  5KJN A;  2WXL A;  5AJL A;  4LEU A;  3PRE A;  2YIN A;  3APF A;  3EIQ C;  4QFV A;  5AIJ A;  1HFA A;  2X6I A;  3L16 A;  5DIZ A;  2DIW A;  4GA1 A;  2QFC A;  4ME2 A;  1HS6 A;  5JJT A;  1HG5 A;  2KAT A;  3IHY A;  4YND A;  3ZGQ A;  4KT6 B;  5JHB A;  1HZ4 A;  3FH7 A;  1UJK A;  5G55 A;  4UWF A;  2YNQ A;  4U04 A;  4AOF A;  3PE3 A;  3R9A B;  3I4G A;  5AYW D;  4EZJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...