1EDUA

Crystal structure of the enth domain of rat epsin 1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
149
structure length
149
Chain Sequence
NIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMIWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQGVNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EH domain binding protein EPSIN
publication title Epsin 1 undergoes nucleocytosolic shuttling and its eps15 interactor NH(2)-terminal homology (ENTH) domain, structurally similar to Armadillo and HEAT repeats, interacts with the transcription factor promyelocytic leukemia Zn(2)+ finger protein (PLZF).
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 51
structure length 149
sequence length 149
ec nomenclature
pdb deposition date 2000-01-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01417 ENTH ENTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1eduA00
5CMYA 4GZCA 1EYHA 4HFGA 2MOWA 5LOZA 1JPLA 2QY7A 3G2UA 1EDUA 2V8SE 4AVXA 3ZYLA 1HG5A 1HFAA 3G2VA 3ONLA 3D9KA 4GZDA 1LF8A 2DIWA 3G2WA 1PY1A 1INZA 1XGWA 3LDZA 1SZ9A 2LO6A 3ZYQA 2BF0X 3ZYKA 3D9NA 1HX8A 4FLBA 4Q96A 3D9OA 2L0TB 1HG2A 1HF8A 3D9PA 1UJJA 3ONKA 3RRUA 3CLJA 3D9IA 1JWFA 2L0IA 1H0AA 2DCPA 5J08A 3D9LA 1DVPA 1VDYA 4JXTA 3D9MA 3G2TA 5CMWA 4Q94A 1MHQA 4FU3A 3G2SA 4NACA 5LP0A 1ELKA 1UJKA 1SZAA 1X5BA 3ZYMA 3D9JA 2KM4A 1JUQA 1JWGA
chains in the Genus database with same CATH superfamily
2OEVA 3U66A 5FINA 3FWVA 5B1BE 2VGYA 1SA5A 2KZTA 3LS8A 2XGOA 4CZ2D 3T5XA 2V4LA 4BT9A 5B1AE 1N94A 2V5FA 4G26A 5CERB 3UM1A 2IO3C 4B8AA 2YNQA 3PZ2A 5KNHD 1TNZA 4GAAA 4OAVB 2YHCA 3SI5A 3FUIA 5AENA 5FZSA 3SBTB 4CGVA 2JABA 1JCQA 3Q4AB 4URKA 3FU3A 4GZDA 3CHMA 3F6QA 2VQ2A 3ABME 2AXUA 1S70B 3ZU7B 3G2TA 4L23A 4JC8A 2GGFA 4BX9A 4CDMA 4HNAD 1N95A 2R5SA 4IRUA 2XZTG 4YDEA 2FO1E 3AG2E 4IN3B 4DPRA 3PZ3A 1WAO1 4D10C 2WXKA 4UQXA 2WQHA 2KC7A 2UWJG 4F53A 4DK5A 2XPYA 4W9RA 3RKVA 2MOWA 4U8YD 4F6RD 1EF1C 4WWNA 3LKUA 4N2QA 4GTQA 3L82A 4JHRA 3MKRA 2GRLA 3D9PA 3HHMA 3CK7A 1N4RA 3DSXA 4GZ5A 3OXGA 1QBQA 4JEHA 1X5BA 3UXGA 5EILA 4DJAA 4BESA 2YINA 4ME2A 4GZ6A 1KPSB 4GYOA 1N54A 4I6GA 2OVBA 4WNGA 3ISMC 5BXOA 3FU0A 4U8HA 3HVEA 5AJLA 4YVOA 4YDWA 5E75A 4HOSA 2AJAA 2RFAA 3DPYA 3UKUG 2P9IG 3HXCA 5ENTD 3T9KA 4E85A 3Q78A 1YA0A 2IFUA 5ENSD 4BSXA 5EDSA 1E8XA 4N3CA 1IHBA 1E8ZA 4APFA 1N9AA 4GTSA 3FTSA 1E7UA 1TN7A 2XS1A 2WXRA 1S0PA 3DXKG 3D9KA 3MGBA 3SD5A 2PNNA 4AOFA 1ZB1A 2GRPB 2LXLA 5CECB 1V55E 3DEOA 1YMPA 5FJYA 1L5JA 2I2OA 3FEYA 3X2QE 1KZPA 3SY2A 3CVXA 2Y3AA 4BT8A 3CGHA 3QKYA 3MA5A 3Q9NC 4AXHA 5G2NA 3EU9A 5CEDB 1XNFA 1UW4B 1SA4A 4XI9A 2YQ8A 1NP7A 2P9NG 1TJCA 4BETA 5T4YA 1SW6A 2UY1B 4KMOA 1V54E 5JA4D 5LOZA 4WNDA 2ONDA 3ONLA 1FPPA 5LX8A 2KCLA 2XCBA 4FC8A 2QYJA 1S63A 2DVWA 4RLYA 5CHEE 4BY6A 3V2OA 4I2WA 4DI4A 1TNUA 2I1KA 3B7TA 4U7EB 3CHRA 3CVWA 3E37A 2X6KA 3TWVA 3FUKA 3ASDA 2ETCA 3DWLG 1OCZE 2B6CA 3SZ7A 2VTBB 3RK6A 1PAQA 1HF8A 2CHXA 2YHEA 4CT4A 3AS4A 2XEEA 2IF4A 2V5QC 4AEZC 5AJDA 1OUVA 3UUXA 4U95D 3UIOC 3EIJA 1OWMA 1Z5SC 5G05J 1IYGA 5CMWA 4I2ZA 4GCNA 2BTDA 1WM5A 3I3NA 2F0YA 2QZAA 3ML8A 3RRUA 1AP7A 4G23A 1OWPA 4CYMD 4CT0A 4C0MA 4FA6A 3PEUB 3IXEA 3L16A 1N0RA 1X81A 3ZIMA 4A1SA 4L9PA 3LJ3A 4ACKA 5AQ9A 2DIWA 2WXIA 1OT8A 3EJNA 2BF0X 3C5RA 2ILRA 3TWSA 3KSLA 3FHEA 4GA1A 2P9KG 1MYOA 2DYRE 1K1BA 4TUUA 3BUAA 4BSZB 2EILE 5ARGA 3Q7FA 4ATGA 2IONA 3JXIA 1OXJA 2FI7A 1IQRA 5LCWJ 4XI0A 1PC2A 3RO2A 3TWQA 4HI9A 3WG7E 3UT8A 4GMJA 3D9JA 1JWGA 2WXFA 3I4GA 3U9WA 3QDNA 1ZU2A 3FULA 3W9GA 4F3VA 2QYUA 3ABKE 5ENNA 3L6AA 3HXDA 3DBSA 5CEAA 4DUIA 4GA2A 3ZYMA 3Q15A 3I4RB 4B8CB 3G2VA 1SQMA 3CIAA 4K5AB 4O6FA 4HRMB 3CVVA 1QYMA 3CHSA 2IU1A 3VLFA 1ELWA 2P9SG 3EUVA 4RG6A 4EQFA 4YNDA 1INZA 2VSXE 5A7DB 1YYHA 3NB2A 3RSEG 1OCOE 3EDTB 3PNLB 4HQDA 4UI9K 3JXJA 2FBNA 3B7SA 3QC1A 3PRZA 3TG5A 1W3BA 3LXUX 4K5BA 3CSTA 3CQCB 3TG4A 3MV2B 3FP3A 3QK0A 2ZGGA 5A23A 4JVSA 1UN9A 3S7DA 3R7QA 3UT4A 2ETAA 2XRYA 2DZNA 1Z3XA 4AJWA 2J8SD 2WPVA 4DRXE 3QWPA 4MKTA 4DX2A 2XRZA 5EX0A 2CG3A 4O1OA 4FULA 3OAWA 5AIJA 3RIBA 4ATZD 3HYMB 2GRQB 3PDNA 4HXIA 1E8YA 4Y6CA 4N39A 4JL0A 3URZA 4OVUA 1HO8A 4QQIA 2MHKA 4XKCA 4BWRA 1O1SA 3AG3E 3Q75A 4K03A 3SHFA 4U8VD 3SO8A 5JHBA 3LY8A 3CV0A 5BT1A 1ELKA 5C2YA 1SZAA 2XPIA 3RAUA 3SBSA 5AQBA 1OWNA 3NOCD 3UMVA 5CBOA 1LD7A 3QARA 4DX5D 3I5PA 1H6OA 1LD8A 3QOUA 5C1DA 4FLBA 4DLOA 1JWFA 1JCSA 2GRRB 3FUNA 2R02A 4U96D 4IYPA 4A1GA 2PL2A 4DI3A 2XENA 3EHNA 5AYWD 4LSZE 2V4HC 2Y69E 1A17A 1DCQA 4MRUA 3U4TA 4I1AA 1NA3A 3KS2A 3U3WA 4GZCA 4AY6A 3B95A 2H6GA 2WM9A 5KJLA 4TXQA 3TXNA 5A6CA 2WXMA 3D3MA 3S7FA 3JYSA 1UJKA 2LSUA 1K3ZD 3AJIA 3FU5A 5HS0A 3V79K 4BERA 4LEUA 4LCTA 1O5MA 4L2LA 2MYOA 2Y0BG 3FUMA 3SQVA 2WXOA 1NL4A 2AW6A 4HBDA 2A4ZA 5EX3A 3ZXPA 4EZLA 3CHQA 3CKCA 4HORA 1KT0A 4I6EA 2J4BA 3DEPA 3MV3B 2J08A 4WWOA 3DSVA 1U3CA 4J6IA 4CEMA 3CR3A 3NBNB 1U2VG 3J5PA 4G11A 4B93B 2FF4A 2RD0A 2Y4TA 3EU5A 4J8DA 2L0TB 3T8KA 3LVRE 2F37A 2EINE 1TNBA 2Q7FA 3ASNE 5BUZA 4C48B 3ZRHA 4I6JA 2V8SE 2EQXA 3MKQB 4HLEA 2DBAA 2KXPC 3ML9A 5ENOD 5FQ4A 3ZN3A 2A5EA 3HRAA 4G2VA 4P29A 3FTZA 5ENRD 3O48A 4XEIG 5FZQA 1D8EA 4DLQA 2P58C 3N71A 4H7XA 2C0MA 5HQ8A 4PS3A 2UY1A 5CRUA 4FJZA 2LXMA 1TR4A 2MRIA 4G25A 4XX5A 4L2YA 3AU4A 3ZW3A 2ZU6B 2I6HA 3SGHA 3ZHEB 3ULQA 4LG6A 3RO3A 3FUEA 1O1TA 5H7PA 5J90A 2VSYA 2XGMA 3FUHA 2AVPA 4I9EA 3T8MA 1HZ4A 1BU9A 4EBAG 3ONKA 2IJGX 4Q69A 3CVQA 4E6HA 2VTBA 4JA9A 4U04A 1BI7B 4LRZA 4K5CA 2XHEA 2WQ7A 1TYQG 5FQ6A 5KJKA 2QY7A 3L9TA 4A63B 3UPVA 1HX8A 2V0PA 1Z3YA 4HOUA 2M63A 3LYAA 3O4ZA 4N5CA 3DSWA 2J49A 3TL5A 3CVNA 4DX1A 2LAIA 2LAHA 5FZRA 3L13A 4LERA 3FTWA 3ZYKA 2I1JA 3PUJA 1TNOA 5FQ7A 5JMND 3NZUA 3J5QB 4I43A 4Q94A 3TAXA 2VGXB 3PE4A 4R7LA 5HRYA 3UINC 5JJ7A 2GRNB 3C3QA 3FTVA 1Q2ZA 4J8SA 4BTBA 4Z68A 4NACA 1AWCB 2KBXA 5G05C 3IHYA 3TWWA 3TWUA 2AXVA 2X3MA 4A3VA 2FO7A 5LFAA 2A5UA 3UM0A 2R05A 3V31A 1N0QA 3ZPJA 2FEZA 4RG9A 3BEEA 1HU3A 1OWLA 2JLBA 3ZUVB 3QWWA 3L17A 4UWKA 4CRWA 4N3AA 4UQZA 2XEVA 2ZISA 2P9PG 3EHMA 4OYSA 2R2LA 4JB8P 1G3NB 2VYIA 4F1PA 3UTMA 3KD7A 1ELRA 5CCMA 2J4DA 4C9BB 3B13A 3V30A 4GTVA 3AU5A 1IQUA 2WQ6A 3C72A 3EHQA 3UQ3A 5LCWC 4HRLA 4YVQC 3KSQA 5CCLA 4OAUC 3ENEA 3PREA 5J08A 4UUCA 1VDYA 4X8QA 4FU3A 2CFUA 3NF1A 4I1MA 4HFGA 2CG2A 3PUKA 4G1TA 2HYZA 2X6FA 2LUHA 3IKOB 2PQRA 4FP7A 3FTYA 5ANLA 4LNGA 2XCCA 3D9HA 3E32A 2CHWA 4G24A 2VSOE 4RQIA 3UIPC 4B0ZA 1E8WA 5EYLA 4AP2A 3WXXA 2DWZA 3W9FA 2WXNA 4J8YA 1IKND 5AQAA 1UJJA 3IBEA 3ZEFA 4ILIA 1MHQA 4GTMA 5AQ7A 5DIZA 1N11A 3C3OA 4IULA 1FCHA 3G2UA 4AY5A 1KLXA 3CHPA 3LY9A 3G2WA 1PY1A 4NQ0A 4UI9J 4J7WA 2BUGA 1QNFA 2NSZA 3D9OA 2XQ0A 4ANWA 1TJFA 3CSFA 4MS6A 3GW4A 3JQ0A 3HXFA 3PH0C 1NZNA 1WG0A 3CKBA 4AIFA 4XIFA 5FTPA 2PZIA 2ZXWE 2J09A 3QAQA 3MCXA 4EPZA 5JHAA 3P2BA 3DSUA 3HXEA 1H6PA 3CEQA 5BNWA 2IOSA 2ETBA 3AG4E 4FJYA 3LPZA 3IEGA 3JCKC 4BX8A 5ANRA 3UKRG 2WXQA 2H6HA 2WXLA 4JHKA 2QC9A 1NI1A 3K9IA 4F7AA 4I17A 1D9SA 4I9CA 1EPUA 5CMYA 2X6IA 4WNFA 3SFZA 3FY4A 5JJTA 3LVQE 1XGWA 5G04J 2ZGDA 4JPSA 4WWPA 1TEZA 3PNTB 4HLLA 2DYSE 2X6JA 4XE0A 4M7CA 4U63A 2JEKA 2IO2C 5EN5D 5G55A 5KBAA 2F8YA 1BLXB 5CRVA 4ANUA 2L0IA 4HOTA 4O60A 3RJVA 3FU6A 3FDHA 4GPMA 1HH8A 2L6BA 1BPOA 2J07A 4NURA 3TXMA 4UQYA 1N4SA 1K8KG 4RSYA 1HFAA 1OCRE 4K0RA 1H2UA 1WDYA 2EIME 2PM6A 3AG1E 3FUJA 1SZ9A 2LO6A 3ZYQA 1N52A 1FT2A 3ZKJA 2PM7A 2IY0C 1E90A 3RRNB 3RRMB 4HS2A 3T5VA 4AM9A 5D66A 2C2LA 1ZBPA 5KNGA 2R03A 3E33A 3TGOA 1GW6A 2GW1A 1NFIE 1NA0A 3BU8A 3MYVA 4PH4B 4A3TA 3QNKA 3TWRA 1FVFA 2HO1A 2L6JA 3ASOE 2E2EA 4G8LA 2NC9A 4PUCA 4UWLA 3CHOA 5BV0A 4NRHB 5FQ8A 4F1SA 3HDXA 3R7RA 1H0AA 4H7YA 3JUEA 2KZTB 1OCCE 3D9MA 4WUYA 1OY3D 4FLHA 1S64A 4TXRA 2C0LA 3HIZA 1MQSA 1OWOA 3SFXA 3NAWA 2I9CA 5FWQA 2X6HA 3ASGA 3GZ2A 3MKQA 3FH8A 3IV0A 3Q73A 3S7JA 4EBAA 2HR2A 3Q9UC 1EDUA 2H6IA 1MX2A 1QZ2A 5BW8C 4KBQA 3CVLA 3LJNA 4AV7A 3EIQC 3FEXA 3GYZA 5AN8A 3G2SA 1WY6A 4HVBA 3FH5A 4GU5A 3AS8A 2KM4A 2DZOA 1QQEA 2OOEA 5ARFA 1JPLA 3S7BA 4ANXA 3B7BA 3ZXSA 4WAFA 3ZHEA 3ESKA 3ULEG 4GTRA 4Q96A 1K1AA 4KYOB 4ILGA 4JEUA 5KJMA 3QJZA 1UOHA 4GTOA 4B89A 5AARA 4XZ4A 1B89A 3JQ1A 3UT7A 4ABNA 1TN6A 4NIKA 4GTPA 5EYPF 3ULYA 4XKBA 3ASHA 3LDZA 1Z6TA 4MBGA 4GTTA 3MX3A 3CVUA 1RW2A 2WVIA 5AAOA 1MJ0A 4B94A 4LUNU 1IHGA 4BTAA 2BKGA 1EYHA 4JZYA 2OCCE 3HVEB 4AVXA 3VLEA 4U0SA 4N3BA 1JCRA 3B7RL 1P5QA 3ZVVA 1O1RA 2VJ8A 4JD2G 2WXHA 5D0QD 2R59A 3E4BA 4U0ZA 2X38A 2L9BA 1E96B 4GB9A 2VGXA 4GA0A 2BEDA 4KVOA 4QFVA 3PVLA 3UM3A 4KT6B 2DCPA 3CK9A 5EKQD 5EIDA 2H6FA 4BFRA 3APFA 4PS7A 1RZ4A 4HRNA 3BG0B 2P9UG 4UWFA 3OXLA 1UN8A 4ZFHA 3NOGD 3OTNA 3BG1B 2EIJE 2WB2A 1N4PA 5FIOA 3B7UX 3FUFA 3DPDA 2IQCA 3Q49B 3LY7A 2LNIA 5JJ6A 1KZOA 4TRQA 4GZ3A 3BQOA 2XPZA 2AWIA 1N4QA 4JA7A 3GZSA 2XZDG 4M3OA 2WXJA 4TXPA 5D2MC 5KWDA 2WMNA 4I1OB 3ASFA 5CBNA 3FTXA 1MX6A 1HXIA 4HOQA 2HM8A 1YCSB 3PZ4A 3OXFA 3R9MA 4HI8A 3GZ1A 3ZYLA 3ZNGA 1MZCA 2LSVA 3LEWA 4DX6D 5B3SE 3NQPA 1IXVA 3SF4A 4J8EA 3L08A 3ABLE 4JW1A 5HKPA 2BKKB 3U64A 2XGSA 4TUMA 3Q79A 2NXPA 1KT1A 2VSNA 3LCAA 2WXPA 1HG2A 3CLJA 3D9IA 1TNYA 3AS5A 2B0OE 3L22A 2OVFA 1H2VC 4GYYA 4G8KA 2RFMA 2KATA 3AAAC 4Y6WA 4J8FA 3UI2A 5DBKA 2AXZA 2RG8A 4GCOA 1LF8A 4ZHBA 3ZFWA 4LNUD 3HXBA 1TN8A 5KJNA 4JXTA 4PDXA 3EHRA 4OVVA 5EIBE 1HE8A 4LNBA 3VTXA 4EZKA 4BEPA 2VGEA 4KZ0A 2XEHA 3DRAA 4J0UA 5BXUA 1DCEA 3RU0A 5ENPD 1UG3A 4O1PA 3PE3A 2P2CP 3VLDA 5D0OD 4GYWA 4CDRA 4WNEA 2CFZA 3MZLB 2NYJA 2OEWA 3KEAA 3TWTA 3SNXA 3VTYA 4ILHB 5M72A 4L7TA 4HB5A 4GMRA 2F8XK 3APCA 5T3RA 4FHKA 3DXMG 4APOA 3KAEA 4FHJA 4YDOA 4KZCA 3L54A 4PS8A 4CGWA 1H2TC 3V2XA 4UI9C 2KCKA 2Y4UA 4FADA 3MEKA 4L1BA 1HS6A 3JUIA 1Y8MA 4EECA 5ITZF 3UM2A 5IY5E 3NZSA 3FTUA 3UX4A 3R9AB 4GMLA 3IHVA 2IOLA 4TV3A 5BV1A 1FT1A 3PZDA 4ANVA 1LTXA 4U0UA 3S2AA 3P1UA 5E76A 3PEVB 4EZJA 1A5EA 3CVYA 2GRMA 1BD8A 3PS6A 4CCAA 2J9QA 2P9LG 1HG5A 4U07A 4UWHA 2Y1LE 5HI7A 3PZ1A 1DNPA 4N5QA 3E34A 4DX7D 4YDYA 2E0IA 3HG0D 3Q7AA 3MJWA 2WMOA 5BPPA 2GROB 4A55A 3QB2A 3C98A 5FT9A 2R17C 1BI8B 2PQNA 2KCVA 3APDA 1Y6IA 3Q5MA 4RVBA 3TWXA 3FFLA 2EIKE 3DSSA 5T8IA 4CDNA 3CVPA 3CQGB 4MLPA 3TJPA 3DSTA 2RKKA 5G04C 2OV8A 2WXGA 1H6KA 3ESLA 1E7VA 5ENQD 5LP0A 3QWVA 3FH7A 1JUQA 2HE0A 2CHZA 2ZIRA 2XS8A 3C3RA 3KEZA 2IEJA 4KXKB 4V3IA 1D8DA 1U3DA 1DC2A 3D9NA 5KCMA 2FULA 4UWGA 3CK8A 3ZGQA 2QFCA 1DVPA 4C0EA 1H19A 1FVHA 1MX4A 3E30A 3Q47B 4EHMA 4N2SA 4ACLA 3SFYA 1SVXA 4GPKA 4JHJA 3D9LA 3FUDA 4KVMA
chains in the Genus database with same CATH topology
3JQ1A 3UT7A 3IHYA 3U66A 4ABNA 1ELWA 2AXVA 3FWVA 2X3MA 2VGYA 2KZTA 4A3VA 2FO7A 5LFAA 2A5UA 3LS8A 4RG6A 4XKBA 3ASHA 4EQFA 4YNDA 2XGOA 1INZA 3T5XA 2VSXE 2V4LA 3LDZA 5A7DB 1Z6TA 4BT9A 3EDTB 2V5FA 3ZPJA 2FEZA 4G26A 3MX3A 4RG9A 3PNLB 4B8AA 2YNQA 4UI9K 3CVUA 3BEEA 2WVIA 2FBNA 3B7SA 3QC1A 3PRZA 1HU3A 3TG5A 1OWLA 1W3BA 2JLBA 4GAAA 4B94A 2YHCA 3LXUX 3QWWA 1IHGA 4LUNU 3SI5A 4BTAA 3L17A 3FUIA 1EYHA 4UWKA 4JZYA 4CRWA 5FZSA 5AENA 3CSTA 3SBTB 3CQCB 3TG4A 4CGVA 3HVEB 3MV2B 3Q4AB 4N3AA 4AVXA 4URKA 3FP3A 3FU3A 4UQZA 3QK0A 4GZDA 3VLEA 4U0SA 5A23A 2XEVA 4N3BA 3CHMA 4JVSA 3EHMA 2VQ2A 4OYSA 2VYIA 1UN9A 2AXUA 3B7RL 3R7QA 3S7DA 1P5QA 3UT4A 3ZVVA 2XRYA 3G2TA 3KD7A 1ELRA 1Z3XA 4L23A 4AJWA 2VJ8A 4JC8A 2WXHA 2J4DA 4C9BB 5CCMA 2GGFA 3B13A 5D0QD 4BX9A 2R59A 4CDMA 2WPVA 3AU5A 1IQUA 3E4BA 2R5SA 4IRUA 2WQ6A 3QWPA 4U0ZA 4MKTA 4IN3B 2X38A 4DPRA 3UQ3A 1WAO1 1E96B 2L9BA 4GB9A 5EX0A 2CG3A 4D10C 2XRZA 2VGXA 4GA0A 4KVOA 4FULA 2WXKA 3OAWA 5LCWC 5AIJA 3RIBA 4YVQC 3HYMB 5CCLA 3ENEA 4QFVA 3PREA 3PVLA 3PDNA 4KT6B 4UQXA 2DCPA 4HXIA 5J08A 1E8YA 1VDYA 2WQHA 2KC7A 3CK9A 2UWJG 5EKQD 4F53A 4Y6CA 4FU3A 2CFUA 4N39A 3NF1A 4JL0A 4BFRA 4I1MA 4DK5A 2XPYA 3URZA 3APFA 4PS7A 4W9RA 4HFGA 1HO8A 2MOWA 4OVUA 3RKVA 3BG0B 2CG2A 3OXLA 4UWFA 1UN8A 2MHKA 1EF1C 3PUKA 4WWNA 4G1TA 4XKCA 3OTNA 4BWRA 3LKUA 4N2QA 2HYZA 3BG1B 4K03A 2X6FA 2WB2A 3IKOB 3SHFA 4JHRA 3MKRA 2PQRA 4FP7A 2GRLA 3B7UX 3D9PA 3FTYA 3HHMA 3CK7A 3FUFA 5ANLA 4GZ5A 3DPDA 3OXGA 2IQCA 5JHBA 3Q49B 2XCCA 3LY8A 3CV0A 3LY7A 2LNIA 5BT1A 2CHWA 1ELKA 4JEHA 5C2YA 1SZAA 1X5BA 2XPIA 3SBSA 1OWNA 5JJ6A 3UMVA 4G24A 2VSOE 3QARA 4DJAA 3I5PA 4TRQA 4GZ3A 2XPZA 2YINA 2AWIA 4ME2A 4GZ6A 4B0ZA 1E8WA 4JA7A 4AP2A 3GZSA 4M3OA 3WXXA 4GYOA 1N54A 2WXNA 2WXJA 4I6GA 2OVBA 3QOUA 5C1DA 4WNGA 4FLBA 3FU0A 1UJJA 3IBEA 4DLOA 4U8HA 1JWFA 3HVEA 4YVOA 2WMNA 4I1OB 5AJLA 5E75A 3ZEFA 3ASFA 3FUNA 4HOSA 4ILIA 3FTXA 1MHQA 1HXIA 5DIZA 4IYPA 4HOQA 2HM8A 2PL2A 4A1GA 4IULA 1FCHA 4DI3A 3OXFA 3G2UA 4AY5A 1KLXA 3EHNA 3GZ1A 5AYWD 3ZYLA 3CHPA 3LY9A 2LSVA 3LEWA 3G2WA 1PY1A 4NQ0A 4E85A 1YA0A 2IFUA 4UI9J 4BSXA 1A17A 2BUGA 1QNFA 2NSZA 3D9OA 5EDSA 1E8XA 2XQ0A 4ANWA 1TJFA 3CSFA 4N3CA 3NQPA 4MS6A 3GW4A 3JQ0A 3SF4A 4MRUA 1E8ZA 4J8EA 3L08A 4JW1A 3U4TA 4I1AA 3PH0C 3U64A 4APFA 2XGSA 1NA3A 3KS2A 3U3WA 1NZNA 3FTSA 4GZCA 1E7UA 3CKBA 4AY6A 4AIFA 4XIFA 2NXPA 2WXRA 1KT1A 2VSNA 2WM9A 1S0PA 2PZIA 3LCAA 5FTPA 5KJLA 3D9KA 3MGBA 3SD5A 3TXNA 2WXPA 4AOFA 2J09A 1HG2A 5A6CA 3QAQA 3CLJA 2WXMA 3D9IA 3AS5A 3D3MA 3MCXA 3L22A 2OVFA 4EPZA 5FJYA 1L5JA 5JHAA 3S7FA 3JYSA 2I2OA 1H2VC 1UJKA 2LSUA 4GYYA 3FEYA 3P2BA 2KATA 4Y6WA 3FU5A 4J8FA 5DBKA 3CEQA 3CVXA 5BNWA 2AXZA 2IOSA 2Y3AA 4BT8A 2RG8A 3CGHA 3QKYA 3MA5A 4GCOA 1LF8A 4AXHA 4LEUA 4FJYA 5G2NA 4LCTA 1XNFA 3LPZA 3ZFWA 4L2LA 3IEGA 1UW4B 3JCKC 4BX8A 5ANRA 4XI9A 2WXQA 2YQ8A 1NP7A 3FUMA 2WXLA 4JHKA 5KJNA 4JXTA 1TJCA 3K9IA 5T4YA 2WXOA 4PDXA 4F7AA 4I17A 2UY1B 4KMOA 4OVVA 4I9CA 1HE8A 1EPUA 2AW6A 5CMYA 2X6IA 2A4ZA 3VTXA 5LOZA 4WNDA 5EX3A 4WNFA 2ONDA 3SFZA 3FY4A 3ONLA 4EZLA 5LX8A 4EZKA 2KCLA 5JJTA 2XCBA 4FC8A 3LVQE 1XGWA 3CHQA 3CKCA 4HORA 1KT0A 5G04J 5CHEE 4BY6A 4KZ0A 4I6EA 2J4BA 4J0UA 4JPSA 4I2WA 4DI4A 4WWPA 3MV3B 1TEZA 2J08A 2I1KA 4WWOA 3RU0A 3B7TA 3CVWA 3CHRA 3PNTB 1U3CA 4J6IA 2X6JA 1UG3A 3CR3A 4CEMA 2X6KA 4XE0A 3FUKA 4U63A 2JEKA 4G11A 3PE3A 3VLDA 3ASDA 5D0OD 4GYWA 4CDRA 4WNEA 3SZ7A 2CFZA 2VTBB 5G55A 3RK6A 3MZLB 1PAQA 2FF4A 2RD0A 2Y4TA 4J8DA 2L0TB 1HF8A 4ANUA 2L0IA 3LVRE 2CHXA 2YHEA 3SNXA 3VTYA 4HOTA 4ILHB 5M72A 3RJVA 4CT4A 4L7TA 2Q7FA 3FU6A 3APCA 3AS4A 3FDHA 1HH8A 5T3RA 5BUZA 4FHKA 1BPOA 3ZRHA 2IF4A 2J07A 4NURA 4I6JA 3TXMA 4AEZC 4UQYA 5AJDA 2V8SE 2EQXA 3MKQB 4APOA 4RSYA 1HFAA 4HLEA 4K0RA 1H2UA 1OUVA 2DBAA 3KAEA 4FHJA 2PM6A 3FUJA 3ML9A 1SZ9A 4KZCA 2LO6A 1N52A 3L54A 3UUXA 3ZYQA 4PS8A 5FQ4A 3ZN3A 4CGWA 1H2TC 2PM7A 3EIJA 4G2VA 1E90A 4P29A 4UI9C 1OWMA 5G05J 2KCKA 1IYGA 3FTZA 3RRNB 5CMWA 3RRMB 4I2ZA 4HS2A 3T5VA 2Y4UA 4FADA 3MEKA 3O48A 4L1BA 1HS6A 5FZQA 3JUIA 4AM9A 1Y8MA 4EECA 2C2LA 1ZBPA 4GCNA 2P58C 4DLQA 3N71A 2BTDA 1WM5A 4H7XA 3TGOA 1GW6A 2C0MA 5HQ8A 3I3NA 3FTUA 3NZSA 3UX4A 2GW1A 3R9AB 4GMLA 4PS3A 3IHVA 2UY1A 2IOLA 4FJZA 4TV3A 5BV1A 2MRIA 4G25A 3PZDA 4ANVA 1NA0A 4PH4B 3MYVA 4XX5A 3ML8A 4A3TA 3QNKA 4L2YA 3RRUA 4G23A 1FVFA 1OWPA 2HO1A 2L6JA 3AU4A 4U0UA 3S2AA 3P1UA 3ZW3A 2ZU6B 4CT0A 2E2EA 2I6HA 3SGHA 3ZHEB 4C0MA 4FA6A 2NC9A 5E76A 3PEUB 3L16A 3PEVB 3ULQA 4EZJA 3CVYA 2GRMA 4PUCA 3FUEA 3PS6A 3CHOA 4UWLA 3RO3A 2J9QA 2VSYA 4CCAA 5J90A 2XGMA 3ZIMA 3FUHA 2AVPA 4I9EA 1HG5A 4A1SA 4U07A 4UWHA 5BV0A 3LJ3A 4NRHB 4ACKA 2DIWA 2WXIA 5FQ8A 3T8MA 5HI7A 1HZ4A 3EJNA 1DNPA 4F1SA 2BF0X 2ILRA 4EBAG 2E0IA 3ONKA 3HDXA 3R7RA 2IJGX 3FHEA 1H0AA 3MJWA 4H7YA 4GA1A 4Q69A 2WMOA 2KZTB 3CVQA 4E6HA 2VTBA 5BPPA 3D9MA 4WUYA 4JA9A 4A55A 4U04A 3QB2A 4LRZA 4TUUA 4FLHA 2XHEA 3C98A 5FT9A 2R17C 5ARGA 2WQ7A 4ATGA 2IONA 2PQNA 5FQ6A 2KCVA 2FI7A 3APDA 1IQRA 1Y6IA 5KJKA 3Q5MA 4RVBA 2C0LA 2QY7A 3HIZA 1MQSA 1OWOA 3FFLA 5LCWJ 3UPVA 4XI0A 5T8IA 4CDNA 2I9CA 3CVPA 5FWQA 1PC2A 1HX8A 3CQGB 2X6HA 2V0PA 3ASGA 4MLPA 1Z3YA 3GZ2A 3TJPA 3RO2A 4HOUA 3MKQA 5G04C 2OV8A 2M63A 2WXGA 3LYAA 1H6KA 3FH8A 3O4ZA 3ESLA 4N5CA 1E7VA 3IV0A 2J49A 5LP0A 3S7JA 3UT8A 3QWVA 4GMJA 3D9JA 3FH7A 1JUQA 1JWGA 2WXFA 4EBAA 3TL5A 3CVNA 2HR2A 3I4GA 2CHZA 2LAIA 1EDUA 2LAHA 5FZRA 3U9WA 3L13A 4LERA 3QDNA 1QZ2A 1ZU2A 5BW8C 3FULA 4KBQA 3CVLA 3KEZA 3FTWA 4KXKB 4V3IA 1U3DA 3ZYKA 3D9NA 4F3VA 2I1JA 3PUJA 5KCMA 2FULA 4UWGA 3CK8A 5ENNA 3ZGQA 3L6AA 5FQ7A 2QFCA 4AV7A 3NZUA 1DVPA 4C0EA 3DBSA 3EIQC 3FEXA 3GYZA 4I43A 4Q94A 1H19A 3G2SA 3TAXA 2VGXB 1WY6A 3PE4A 4GA2A 4HVBA 4R7LA 3ZYMA 3FH5A 4GU5A 3AS8A 1FVHA 2KM4A 1QQEA 2OOEA 5ARFA 1JPLA 3Q15A 3S7BA 3I4RB 4ANXA 5JJ7A 3Q47B 4B8CB 3G2VA 4N2SA 3ZXSA 4WAFA 3ZHEA 3ESKA 4ACLA 1SQMA 3CIAA 3FTVA 4GPKA 4Q96A 4JHJA 4J8SA 4O6FA 4BTBA 4KYOB 3D9LA 3FUDA 4ILGA 3CVVA 4JEUA 5KJMA 3CHSA 4NACA 3QJZA 2IU1A 5G05C 3VLFA 4KVMA 4B89A 4XZ4A 1B89A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMY A;  4GZC A;  1EYH A;  4HFG A;  2MOW A;  5LOZ A;  1JPL A;  2QY7 A;  3G2U A;  1EDU A;  2V8S E;  4AVX A;  3ZYL A;  1HG5 A;  1HFA A;  3G2V A;  3ONL A;  3D9K A;  4GZD A;  1LF8 A;  2DIW A;  3G2W A;  1PY1 A;  1INZ A;  1XGW A;  3LDZ A;  1SZ9 A;  2LO6 A;  3ZYQ A;  2BF0 X;  3ZYK A;  3D9N A;  1HX8 A;  4FLB A;  4Q96 A;  3D9O A;  2L0T B;  1HG2 A;  1HF8 A;  3D9P A;  1UJJ A;  3ONK A;  3RRU A;  3CLJ A;  3D9I A;  1JWF A;  2L0I A;  1H0A A;  2DCP A;  5J08 A;  3D9L A;  1DVP A;  1VDY A;  4JXT A;  3D9M A;  3G2T A;  5CMW A;  4Q94 A;  1MHQ A;  4FU3 A;  3G2S A;  4NAC A;  5LP0 A;  1ELK A;  1UJK A;  1SZA A;  1X5B A;  3ZYM A;  3D9J A;  2KM4 A;  1JUQ A;  1JWG A; 
#chains in the Genus database with same CATH topology
 2OEV A;  3U66 A;  5FIN A;  3FWV A;  5B1B E;  2VGY A;  1SA5 A;  2KZT A;  3LS8 A;  2XGO A;  4CZ2 D;  3T5X A;  2V4L A;  4BT9 A;  5B1A E;  1N94 A;  2V5F A;  4G26 A;  5CER B;  3UM1 A;  2IO3 C;  4B8A A;  2YNQ A;  3PZ2 A;  5KNH D;  1TNZ A;  4GAA A;  4OAV B;  2YHC A;  3SI5 A;  3FUI A;  5AEN A;  5FZS A;  3SBT B;  4CGV A;  2JAB A;  1JCQ A;  3Q4A B;  4URK A;  3FU3 A;  4GZD A;  3CHM A;  3F6Q A;  2VQ2 A;  3ABM E;  2AXU A;  1S70 B;  3ZU7 B;  3G2T A;  4L23 A;  4JC8 A;  2GGF A;  4BX9 A;  4CDM A;  4HNA D;  1N95 A;  2R5S A;  4IRU A;  2XZT G;  4YDE A;  2FO1 E;  3AG2 E;  4IN3 B;  4DPR A;  3PZ3 A;  1WAO 1;  4D10 C;  2WXK A;  4UQX A;  2WQH A;  2KC7 A;  2UWJ G;  4F53 A;  4DK5 A;  2XPY A;  4W9R A;  3RKV A;  2MOW A;  4U8Y D;  4F6R D;  1EF1 C;  4WWN A;  3LKU A;  4N2Q A;  4GTQ A;  3L82 A;  4JHR A;  3MKR A;  2GRL A;  3D9P A;  3HHM A;  3CK7 A;  1N4R A;  3DSX A;  4GZ5 A;  3OXG A;  1QBQ A;  4JEH A;  1X5B A;  3UXG A;  5EIL A;  4DJA A;  4BES A;  2YIN A;  4ME2 A;  4GZ6 A;  1KPS B;  4GYO A;  1N54 A;  4I6G A;  2OVB A;  4WNG A;  3ISM C;  5BXO A;  3FU0 A;  4U8H A;  3HVE A;  5AJL A;  4YVO A;  4YDW A;  5E75 A;  4HOS A;  2AJA A;  2RFA A;  3DPY A;  3UKU G;  2P9I G;  3HXC A;  5ENT D;  3T9K A;  4E85 A;  3Q78 A;  1YA0 A;  2IFU A;  5ENS D;  4BSX A;  5EDS A;  1E8X A;  4N3C A;  1IHB A;  1E8Z A;  4APF A;  1N9A A;  4GTS A;  3FTS A;  1E7U A;  1TN7 A;  2XS1 A;  2WXR A;  1S0P A;  3DXK G;  3D9K A;  3MGB A;  3SD5 A;  2PNN A;  4AOF A;  1ZB1 A;  2GRP B;  2LXL A;  5CEC B;  1V55 E;  3DEO A;  1YMP A;  5FJY A;  1L5J A;  2I2O A;  3FEY A;  3X2Q E;  1KZP A;  3SY2 A;  3CVX A;  2Y3A A;  4BT8 A;  3CGH A;  3QKY A;  3MA5 A;  3Q9N C;  4AXH A;  5G2N A;  3EU9 A;  5CED B;  1XNF A;  1UW4 B;  1SA4 A;  4XI9 A;  2YQ8 A;  1NP7 A;  2P9N G;  1TJC A;  4BET A;  5T4Y A;  1SW6 A;  2UY1 B;  4KMO A;  1V54 E;  5JA4 D;  5LOZ A;  4WND A;  2OND A;  3ONL A;  1FPP A;  5LX8 A;  2KCL A;  2XCB A;  4FC8 A;  2QYJ A;  1S63 A;  2DVW A;  4RLY A;  5CHE E;  4BY6 A;  3V2O A;  4I2W A;  4DI4 A;  1TNU A;  2I1K A;  3B7T A;  4U7E B;  3CHR A;  3CVW A;  3E37 A;  2X6K A;  3TWV A;  3FUK A;  3ASD A;  2ETC A;  3DWL G;  1OCZ E;  2B6C A;  3SZ7 A;  2VTB B;  3RK6 A;  1PAQ A;  1HF8 A;  2CHX A;  2YHE A;  4CT4 A;  3AS4 A;  2XEE A;  2IF4 A;  2V5Q C;  4AEZ C;  5AJD A;  1OUV A;  3UUX A;  4U95 D;  3UIO C;  3EIJ A;  1OWM A;  1Z5S C;  5G05 J;  1IYG A;  5CMW A;  4I2Z A;  4GCN A;  2BTD A;  1WM5 A;  3I3N A;  2F0Y A;  2QZA A;  3ML8 A;  3RRU A;  1AP7 A;  4G23 A;  1OWP A;  4CYM D;  4CT0 A;  4C0M A;  4FA6 A;  3PEU B;  3IXE A;  3L16 A;  1N0R A;  1X81 A;  3ZIM A;  4A1S A;  4L9P A;  3LJ3 A;  4ACK A;  5AQ9 A;  2DIW A;  2WXI A;  1OT8 A;  3EJN A;  2BF0 X;  3C5R A;  2ILR A;  3TWS A;  3KSL A;  3FHE A;  4GA1 A;  2P9K G;  1MYO A;  2DYR E;  1K1B A;  4TUU A;  3BUA A;  4BSZ B;  2EIL E;  5ARG A;  3Q7F A;  4ATG A;  2ION A;  3JXI A;  1OXJ A;  2FI7 A;  1IQR A;  5LCW J;  4XI0 A;  1PC2 A;  3RO2 A;  3TWQ A;  4HI9 A;  3WG7 E;  3UT8 A;  4GMJ A;  3D9J A;  1JWG A;  2WXF A;  3I4G A;  3U9W A;  3QDN A;  1ZU2 A;  3FUL A;  3W9G A;  4F3V A;  2QYU A;  3ABK E;  5ENN A;  3L6A A;  3HXD A;  3DBS A;  5CEA A;  4DUI A;  4GA2 A;  3ZYM A;  3Q15 A;  3I4R B;  4B8C B;  3G2V A;  1SQM A;  3CIA A;  4K5A B;  4O6F A;  4HRM B;  3CVV A;  1QYM A;  3CHS A;  2IU1 A;  3VLF A;  1ELW A;  2P9S G;  3EUV A;  4RG6 A;  4EQF A;  4YND A;  1INZ A;  2VSX E;  5A7D B;  1YYH A;  3NB2 A;  3RSE G;  1OCO E;  3EDT B;  3PNL B;  4HQD A;  4UI9 K;  3JXJ A;  2FBN A;  3B7S A;  3QC1 A;  3PRZ A;  3TG5 A;  1W3B A;  3LXU X;  4K5B A;  3CST A;  3CQC B;  3TG4 A;  3MV2 B;  3FP3 A;  3QK0 A;  2ZGG A;  5A23 A;  4JVS A;  1UN9 A;  3S7D A;  3R7Q A;  3UT4 A;  2ETA A;  2XRY A;  2DZN A;  1Z3X A;  4AJW A;  2J8S D;  2WPV A;  4DRX E;  3QWP A;  4MKT A;  4DX2 A;  2XRZ A;  5EX0 A;  2CG3 A;  4O1O A;  4FUL A;  3OAW A;  5AIJ A;  3RIB A;  4ATZ D;  3HYM B;  2GRQ B;  3PDN A;  4HXI A;  1E8Y A;  4Y6C A;  4N39 A;  4JL0 A;  3URZ A;  4OVU A;  1HO8 A;  4QQI A;  2MHK A;  4XKC A;  4BWR A;  1O1S A;  3AG3 E;  3Q75 A;  4K03 A;  3SHF A;  4U8V D;  3SO8 A;  5JHB A;  3LY8 A;  3CV0 A;  5BT1 A;  1ELK A;  5C2Y A;  1SZA A;  2XPI A;  3RAU A;  3SBS A;  5AQB A;  1OWN A;  3NOC D;  3UMV A;  5CBO A;  1LD7 A;  3QAR A;  4DX5 D;  3I5P A;  1H6O A;  1LD8 A;  3QOU A;  5C1D A;  4FLB A;  4DLO A;  1JWF A;  1JCS A;  2GRR B;  3FUN A;  2R02 A;  4U96 D;  4IYP A;  4A1G A;  2PL2 A;  4DI3 A;  2XEN A;  3EHN A;  5AYW D;  4LSZ E;  2V4H C;  2Y69 E;  1A17 A;  1DCQ A;  4MRU A;  3U4T A;  4I1A A;  1NA3 A;  3KS2 A;  3U3W A;  4GZC A;  4AY6 A;  3B95 A;  2H6G A;  2WM9 A;  5KJL A;  4TXQ A;  3TXN A;  5A6C A;  2WXM A;  3D3M A;  3S7F A;  3JYS A;  1UJK A;  2LSU A;  1K3Z D;  3AJI A;  3FU5 A;  5HS0 A;  3V79 K;  4BER A;  4LEU A;  4LCT A;  1O5M A;  4L2L A;  2MYO A;  2Y0B G;  3FUM A;  3SQV A;  2WXO A;  1NL4 A;  2AW6 A;  4HBD A;  2A4Z A;  5EX3 A;  3ZXP A;  4EZL A;  3CHQ A;  3CKC A;  4HOR A;  1KT0 A;  4I6E A;  2J4B A;  3DEP A;  3MV3 B;  2J08 A;  4WWO A;  3DSV A;  1U3C A;  4J6I A;  4CEM A;  3CR3 A;  3NBN B;  1U2V G;  3J5P A;  4G11 A;  4B93 B;  2FF4 A;  2RD0 A;  2Y4T A;  3EU5 A;  4J8D A;  2L0T B;  3T8K A;  3LVR E;  2F37 A;  2EIN E;  1TNB A;  2Q7F A;  3ASN E;  5BUZ A;  4C48 B;  3ZRH A;  4I6J A;  2V8S E;  2EQX A;  3MKQ B;  4HLE A;  2DBA A;  2KXP C;  3ML9 A;  5ENO D;  5FQ4 A;  3ZN3 A;  2A5E A;  3HRA A;  4G2V A;  4P29 A;  3FTZ A;  5ENR D;  3O48 A;  4XEI G;  5FZQ A;  1D8E A;  4DLQ A;  2P58 C;  3N71 A;  4H7X A;  2C0M A;  5HQ8 A;  4PS3 A;  2UY1 A;  5CRU A;  4FJZ A;  2LXM A;  1TR4 A;  2MRI A;  4G25 A;  4XX5 A;  4L2Y A;  3AU4 A;  3ZW3 A;  2ZU6 B;  2I6H A;  3SGH A;  3ZHE B;  3ULQ A;  4LG6 A;  3RO3 A;  3FUE A;  1O1T A;  5H7P A;  5J90 A;  2VSY A;  2XGM A;  3FUH A;  2AVP A;  4I9E A;  3T8M A;  1HZ4 A;  1BU9 A;  4EBA G;  3ONK A;  2IJG X;  4Q69 A;  3CVQ A;  4E6H A;  2VTB A;  4JA9 A;  4U04 A;  1BI7 B;  4LRZ A;  4K5C A;  2XHE A;  2WQ7 A;  1TYQ G;  5FQ6 A;  5KJK A;  2QY7 A;  3L9T A;  4A63 B;  3UPV A;  1HX8 A;  2V0P A;  1Z3Y A;  4HOU A;  2M63 A;  3LYA A;  3O4Z A;  4N5C A;  3DSW A;  2J49 A;  3TL5 A;  3CVN A;  4DX1 A;  2LAI A;  2LAH A;  5FZR A;  3L13 A;  4LER A;  3FTW A;  3ZYK A;  2I1J A;  3PUJ A;  1TNO A;  5FQ7 A;  5JMN D;  3NZU A;  3J5Q B;  4I43 A;  4Q94 A;  3TAX A;  2VGX B;  3PE4 A;  4R7L A;  5HRY A;  3UIN C;  5JJ7 A;  2GRN B;  3C3Q A;  3FTV A;  1Q2Z A;  4J8S A;  4BTB A;  4Z68 A;  4NAC A;  1AWC B;  2KBX A;  5G05 C;  3IHY A;  3TWW A;  3TWU A;  2AXV A;  2X3M A;  4A3V A;  2FO7 A;  5LFA A;  2A5U A;  3UM0 A;  2R05 A;  3V31 A;  1N0Q A;  3ZPJ A;  2FEZ A;  4RG9 A;  3BEE A;  1HU3 A;  1OWL A;  2JLB A;  3ZUV B;  3QWW A;  3L17 A;  4UWK A;  4CRW A;  4N3A A;  4UQZ A;  2XEV A;  2ZIS A;  2P9P G;  3EHM A;  4OYS A;  2R2L A;  4JB8 P;  1G3N B;  2VYI A;  4F1P A;  3UTM A;  3KD7 A;  1ELR A;  5CCM A;  2J4D A;  4C9B B;  3B13 A;  3V30 A;  4GTV A;  3AU5 A;  1IQU A;  2WQ6 A;  3C72 A;  3EHQ A;  3UQ3 A;  5LCW C;  4HRL A;  4YVQ C;  3KSQ A;  5CCL A;  4OAU C;  3ENE A;  3PRE A;  5J08 A;  4UUC A;  1VDY A;  4X8Q A;  4FU3 A;  2CFU A;  3NF1 A;  4I1M A;  4HFG A;  2CG2 A;  3PUK A;  4G1T A;  2HYZ A;  2X6F A;  2LUH A;  3IKO B;  2PQR A;  4FP7 A;  3FTY A;  5ANL A;  4LNG A;  2XCC A;  3D9H A;  3E32 A;  2CHW A;  4G24 A;  2VSO E;  4RQI A;  3UIP C;  4B0Z A;  1E8W A;  5EYL A;  4AP2 A;  3WXX A;  2DWZ A;  3W9F A;  2WXN A;  4J8Y A;  1IKN D;  5AQA A;  1UJJ A;  3IBE A;  3ZEF A;  4ILI A;  1MHQ A;  4GTM A;  5AQ7 A;  5DIZ A;  1N11 A;  3C3O A;  4IUL A;  1FCH A;  3G2U A;  4AY5 A;  1KLX A;  3CHP A;  3LY9 A;  3G2W A;  1PY1 A;  4NQ0 A;  4UI9 J;  4J7W A;  2BUG A;  1QNF A;  2NSZ A;  3D9O A;  2XQ0 A;  4ANW A;  1TJF A;  3CSF A;  4MS6 A;  3GW4 A;  3JQ0 A;  3HXF A;  3PH0 C;  1NZN A;  1WG0 A;  3CKB A;  4AIF A;  4XIF A;  5FTP A;  2PZI A;  2ZXW E;  2J09 A;  3QAQ A;  3MCX A;  4EPZ A;  5JHA A;  3P2B A;  3DSU A;  3HXE A;  1H6P A;  3CEQ A;  5BNW A;  2IOS A;  2ETB A;  3AG4 E;  4FJY A;  3LPZ A;  3IEG A;  3JCK C;  4BX8 A;  5ANR A;  3UKR G;  2WXQ A;  2H6H A;  2WXL A;  4JHK A;  2QC9 A;  1NI1 A;  3K9I A;  4F7A A;  4I17 A;  1D9S A;  4I9C A;  1EPU A;  5CMY A;  2X6I A;  4WNF A;  3SFZ A;  3FY4 A;  5JJT A;  3LVQ E;  1XGW A;  5G04 J;  2ZGD A;  4JPS A;  4WWP A;  1TEZ A;  3PNT B;  4HLL A;  2DYS E;  2X6J A;  4XE0 A;  4M7C A;  4U63 A;  2JEK A;  2IO2 C;  5EN5 D;  5G55 A;  5KBA A;  2F8Y A;  1BLX B;  5CRV A;  4ANU A;  2L0I A;  4HOT A;  4O60 A;  3RJV A;  3FU6 A;  3FDH A;  4GPM A;  1HH8 A;  2L6B A;  1BPO A;  2J07 A;  4NUR A;  3TXM A;  4UQY A;  1N4S A;  1K8K G;  4RSY A;  1HFA A;  1OCR E;  4K0R A;  1H2U A;  1WDY A;  2EIM E;  2PM6 A;  3AG1 E;  3FUJ A;  1SZ9 A;  2LO6 A;  3ZYQ A;  1N52 A;  1FT2 A;  3ZKJ A;  2PM7 A;  2IY0 C;  1E90 A;  3RRN B;  3RRM B;  4HS2 A;  3T5V A;  4AM9 A;  5D66 A;  2C2L A;  1ZBP A;  5KNG A;  2R03 A;  3E33 A;  3TGO A;  1GW6 A;  2GW1 A;  1NFI E;  1NA0 A;  3BU8 A;  3MYV A;  4PH4 B;  4A3T A;  3QNK A;  3TWR A;  1FVF A;  2HO1 A;  2L6J A;  3ASO E;  2E2E A;  4G8L A;  2NC9 A;  4PUC A;  4UWL A;  3CHO A;  5BV0 A;  4NRH B;  5FQ8 A;  4F1S A;  3HDX A;  3R7R A;  1H0A A;  4H7Y A;  3JUE A;  2KZT B;  1OCC E;  3D9M A;  4WUY A;  1OY3 D;  4FLH A;  1S64 A;  4TXR A;  2C0L A;  3HIZ A;  1MQS A;  1OWO A;  3SFX A;  3NAW A;  2I9C A;  5FWQ A;  2X6H A;  3ASG A;  3GZ2 A;  3MKQ A;  3FH8 A;  3IV0 A;  3Q73 A;  3S7J A;  4EBA A;  2HR2 A;  3Q9U C;  1EDU A;  2H6I A;  1MX2 A;  1QZ2 A;  5BW8 C;  4KBQ A;  3CVL A;  3LJN A;  4AV7 A;  3EIQ C;  3FEX A;  3GYZ A;  5AN8 A;  3G2S A;  1WY6 A;  4HVB A;  3FH5 A;  4GU5 A;  3AS8 A;  2KM4 A;  2DZO A;  1QQE A;  2OOE A;  5ARF A;  1JPL A;  3S7B A;  4ANX A;  3B7B A;  3ZXS A;  4WAF A;  3ZHE A;  3ESK A;  3ULE G;  4GTR A;  4Q96 A;  1K1A A;  4KYO B;  4ILG A;  4JEU A;  5KJM A;  3QJZ A;  1UOH A;  4GTO A;  4B89 A;  5AAR A;  4XZ4 A;  1B89 A;  3JQ1 A;  3UT7 A;  4ABN A;  1TN6 A;  4NIK A;  4GTP A;  5EYP F;  3ULY A;  4XKB A;  3ASH A;  3LDZ A;  1Z6T A;  4MBG A;  4GTT A;  3MX3 A;  3CVU A;  1RW2 A;  2WVI A;  5AAO A;  1MJ0 A;  4B94 A;  4LUN U;  1IHG A;  4BTA A;  2BKG A;  1EYH A;  4JZY A;  2OCC E;  3HVE B;  4AVX A;  3VLE A;  4U0S A;  4N3B A;  1JCR A;  3B7R L;  1P5Q A;  3ZVV A;  1O1R A;  2VJ8 A;  4JD2 G;  2WXH A;  5D0Q D;  2R59 A;  3E4B A;  4U0Z A;  2X38 A;  2L9B A;  1E96 B;  4GB9 A;  2VGX A;  4GA0 A;  2BED A;  4KVO A;  4QFV A;  3PVL A;  3UM3 A;  4KT6 B;  2DCP A;  3CK9 A;  5EKQ D;  5EID A;  2H6F A;  4BFR A;  3APF A;  4PS7 A;  1RZ4 A;  4HRN A;  3BG0 B;  2P9U G;  4UWF A;  3OXL A;  1UN8 A;  4ZFH A;  3NOG D;  3OTN A;  3BG1 B;  2EIJ E;  2WB2 A;  1N4P A;  5FIO A;  3B7U X;  3FUF A;  3DPD A;  2IQC A;  3Q49 B;  3LY7 A;  2LNI A;  5JJ6 A;  1KZO A;  4TRQ A;  4GZ3 A;  3BQO A;  2XPZ A;  2AWI A;  1N4Q A;  4JA7 A;  3GZS A;  2XZD G;  4M3O A;  2WXJ A;  4TXP A;  5D2M C;  5KWD A;  2WMN A;  4I1O B;  3ASF A;  5CBN A;  3FTX A;  1MX6 A;  1HXI A;  4HOQ A;  2HM8 A;  1YCS B;  3PZ4 A;  3OXF A;  3R9M A;  4HI8 A;  3GZ1 A;  3ZYL A;  3ZNG A;  1MZC A;  2LSV A;  3LEW A;  4DX6 D;  5B3S E;  3NQP A;  1IXV A;  3SF4 A;  4J8E A;  3L08 A;  3ABL E;  4JW1 A;  5HKP A;  2BKK B;  3U64 A;  2XGS A;  4TUM A;  3Q79 A;  2NXP A;  1KT1 A;  2VSN A;  3LCA A;  2WXP A;  1HG2 A;  3CLJ A;  3D9I A;  1TNY A;  3AS5 A;  2B0O E;  3L22 A;  2OVF A;  1H2V C;  4GYY A;  4G8K A;  2RFM A;  2KAT A;  3AAA C;  4Y6W A;  4J8F A;  3UI2 A;  5DBK A;  2AXZ A;  2RG8 A;  4GCO A;  1LF8 A;  4ZHB A;  3ZFW A;  4LNU D;  3HXB A;  1TN8 A;  5KJN A;  4JXT A;  4PDX A;  3EHR A;  4OVV A;  5EIB E;  1HE8 A;  4LNB A;  3VTX A;  4EZK A;  4BEP A;  2VGE A;  4KZ0 A;  2XEH A;  3DRA A;  4J0U A;  5BXU A;  1DCE A;  3RU0 A;  5ENP D;  1UG3 A;  4O1P A;  3PE3 A;  2P2C P;  3VLD A;  5D0O D;  4GYW A;  4CDR A;  4WNE A;  2CFZ A;  3MZL B;  2NYJ A;  2OEW A;  3KEA A;  3TWT A;  3SNX A;  3VTY A;  4ILH B;  5M72 A;  4L7T A;  4HB5 A;  4GMR A;  2F8X K;  3APC A;  5T3R A;  4FHK A;  3DXM G;  4APO A;  3KAE A;  4FHJ A;  4YDO A;  4KZC A;  3L54 A;  4PS8 A;  4CGW A;  1H2T C;  3V2X A;  4UI9 C;  2KCK A;  2Y4U A;  4FAD A;  3MEK A;  4L1B A;  1HS6 A;  3JUI A;  1Y8M A;  4EEC A;  5ITZ F;  3UM2 A;  5IY5 E;  3NZS A;  3FTU A;  3UX4 A;  3R9A B;  4GML A;  3IHV A;  2IOL A;  4TV3 A;  5BV1 A;  1FT1 A;  3PZD A;  4ANV A;  1LTX A;  4U0U A;  3S2A A;  3P1U A;  5E76 A;  3PEV B;  4EZJ A;  1A5E A;  3CVY A;  2GRM A;  1BD8 A;  3PS6 A;  4CCA A;  2J9Q A;  2P9L G;  1HG5 A;  4U07 A;  4UWH A;  2Y1L E;  5HI7 A;  3PZ1 A;  1DNP A;  4N5Q A;  3E34 A;  4DX7 D;  4YDY A;  2E0I A;  3HG0 D;  3Q7A A;  3MJW A;  2WMO A;  5BPP A;  2GRO B;  4A55 A;  3QB2 A;  3C98 A;  5FT9 A;  2R17 C;  1BI8 B;  2PQN A;  2KCV A;  3APD A;  1Y6I A;  3Q5M A;  4RVB A;  3TWX A;  3FFL A;  2EIK E;  3DSS A;  5T8I A;  4CDN A;  3CVP A;  3CQG B;  4MLP A;  3TJP A;  3DST A;  2RKK A;  5G04 C;  2OV8 A;  2WXG A;  1H6K A;  3ESL A;  1E7V A;  5ENQ D;  5LP0 A;  3QWV A;  3FH7 A;  1JUQ A;  2HE0 A;  2CHZ A;  2ZIR A;  2XS8 A;  3C3R A;  3KEZ A;  2IEJ A;  4KXK B;  4V3I A;  1D8D A;  1U3D A;  1DC2 A;  3D9N A;  5KCM A;  2FUL A;  4UWG A;  3CK8 A;  3ZGQ A;  2QFC A;  1DVP A;  4C0E A;  1H19 A;  1FVH A;  1MX4 A;  3E30 A;  3Q47 B;  4EHM A;  4N2S A;  4ACL A;  3SFY A;  1SVX A;  4GPK A;  4JHJ A;  3D9L A;  3FUD A;  4KVM A; 
#chains in the Genus database with same CATH homology
 3JQ1 A;  3UT7 A;  3IHY A;  3U66 A;  4ABN A;  1ELW A;  2AXV A;  3FWV A;  2X3M A;  2VGY A;  2KZT A;  4A3V A;  2FO7 A;  5LFA A;  2A5U A;  3LS8 A;  4RG6 A;  4XKB A;  3ASH A;  4EQF A;  4YND A;  2XGO A;  1INZ A;  3T5X A;  2VSX E;  2V4L A;  3LDZ A;  5A7D B;  1Z6T A;  4BT9 A;  3EDT B;  2V5F A;  3ZPJ A;  2FEZ A;  4G26 A;  3MX3 A;  4RG9 A;  3PNL B;  4B8A A;  2YNQ A;  4UI9 K;  3CVU A;  3BEE A;  2WVI A;  2FBN A;  3B7S A;  3QC1 A;  3PRZ A;  1HU3 A;  3TG5 A;  1OWL A;  1W3B A;  2JLB A;  4GAA A;  4B94 A;  2YHC A;  3LXU X;  3QWW A;  1IHG A;  4LUN U;  3SI5 A;  4BTA A;  3L17 A;  3FUI A;  1EYH A;  4UWK A;  4JZY A;  4CRW A;  5FZS A;  5AEN A;  3CST A;  3SBT B;  3CQC B;  3TG4 A;  4CGV A;  3HVE B;  3MV2 B;  3Q4A B;  4N3A A;  4AVX A;  4URK A;  3FP3 A;  3FU3 A;  4UQZ A;  3QK0 A;  4GZD A;  3VLE A;  4U0S A;  5A23 A;  2XEV A;  4N3B A;  3CHM A;  4JVS A;  3EHM A;  2VQ2 A;  4OYS A;  2VYI A;  1UN9 A;  2AXU A;  3B7R L;  3R7Q A;  3S7D A;  1P5Q A;  3UT4 A;  3ZVV A;  2XRY A;  3G2T A;  3KD7 A;  1ELR A;  1Z3X A;  4L23 A;  4AJW A;  2VJ8 A;  4JC8 A;  2WXH A;  2J4D A;  4C9B B;  5CCM A;  2GGF A;  3B13 A;  5D0Q D;  4BX9 A;  2R59 A;  4CDM A;  2WPV A;  3AU5 A;  1IQU A;  3E4B A;  2R5S A;  4IRU A;  2WQ6 A;  3QWP A;  4U0Z A;  4MKT A;  4IN3 B;  2X38 A;  4DPR A;  3UQ3 A;  1WAO 1;  1E96 B;  2L9B A;  4GB9 A;  5EX0 A;  2CG3 A;  4D10 C;  2XRZ A;  2VGX A;  4GA0 A;  4KVO A;  4FUL A;  2WXK A;  3OAW A;  5LCW C;  5AIJ A;  3RIB A;  4YVQ C;  3HYM B;  5CCL A;  3ENE A;  4QFV A;  3PRE A;  3PVL A;  3PDN A;  4KT6 B;  4UQX A;  2DCP A;  4HXI A;  5J08 A;  1E8Y A;  1VDY A;  2WQH A;  2KC7 A;  3CK9 A;  2UWJ G;  5EKQ D;  4F53 A;  4Y6C A;  4FU3 A;  2CFU A;  4N39 A;  3NF1 A;  4JL0 A;  4BFR A;  4I1M A;  4DK5 A;  2XPY A;  3URZ A;  3APF A;  4PS7 A;  4W9R A;  4HFG A;  1HO8 A;  2MOW A;  4OVU A;  3RKV A;  3BG0 B;  2CG2 A;  3OXL A;  4UWF A;  1UN8 A;  2MHK A;  1EF1 C;  3PUK A;  4WWN A;  4G1T A;  4XKC A;  3OTN A;  4BWR A;  3LKU A;  4N2Q A;  2HYZ A;  3BG1 B;  4K03 A;  2X6F A;  2WB2 A;  3IKO B;  3SHF A;  4JHR A;  3MKR A;  2PQR A;  4FP7 A;  2GRL A;  3B7U X;  3D9P A;  3FTY A;  3HHM A;  3CK7 A;  3FUF A;  5ANL A;  4GZ5 A;  3DPD A;  3OXG A;  2IQC A;  5JHB A;  3Q49 B;  2XCC A;  3LY8 A;  3CV0 A;  3LY7 A;  2LNI A;  5BT1 A;  2CHW A;  1ELK A;  4JEH A;  5C2Y A;  1SZA A;  1X5B A;  2XPI A;  3SBS A;  1OWN A;  5JJ6 A;  3UMV A;  4G24 A;  2VSO E;  3QAR A;  4DJA A;  3I5P A;  4TRQ A;  4GZ3 A;  2XPZ A;  2YIN A;  2AWI A;  4ME2 A;  4GZ6 A;  4B0Z A;  1E8W A;  4JA7 A;  4AP2 A;  3GZS A;  4M3O A;  3WXX A;  4GYO A;  1N54 A;  2WXN A;  2WXJ A;  4I6G A;  2OVB A;  3QOU A;  5C1D A;  4WNG A;  4FLB A;  3FU0 A;  1UJJ A;  3IBE A;  4DLO A;  4U8H A;  1JWF A;  3HVE A;  4YVO A;  2WMN A;  4I1O B;  5AJL A;  5E75 A;  3ZEF A;  3ASF A;  3FUN A;  4HOS A;  4ILI A;  3FTX A;  1MHQ A;  1HXI A;  5DIZ A;  4IYP A;  4HOQ A;  2HM8 A;  2PL2 A;  4A1G A;  4IUL A;  1FCH A;  4DI3 A;  3OXF A;  3G2U A;  4AY5 A;  1KLX A;  3EHN A;  3GZ1 A;  5AYW D;  3ZYL A;  3CHP A;  3LY9 A;  2LSV A;  3LEW A;  3G2W A;  1PY1 A;  4NQ0 A;  4E85 A;  1YA0 A;  2IFU A;  4UI9 J;  4BSX A;  1A17 A;  2BUG A;  1QNF A;  2NSZ A;  3D9O A;  5EDS A;  1E8X A;  2XQ0 A;  4ANW A;  1TJF A;  3CSF A;  4N3C A;  3NQP A;  4MS6 A;  3GW4 A;  3JQ0 A;  3SF4 A;  4MRU A;  1E8Z A;  4J8E A;  3L08 A;  4JW1 A;  3U4T A;  4I1A A;  3PH0 C;  3U64 A;  4APF A;  2XGS A;  1NA3 A;  3KS2 A;  3U3W A;  1NZN A;  3FTS A;  4GZC A;  1E7U A;  3CKB A;  4AY6 A;  4AIF A;  4XIF A;  2NXP A;  2WXR A;  1KT1 A;  2VSN A;  2WM9 A;  1S0P A;  2PZI A;  3LCA A;  5FTP A;  5KJL A;  3D9K A;  3MGB A;  3SD5 A;  3TXN A;  2WXP A;  4AOF A;  2J09 A;  1HG2 A;  5A6C A;  3QAQ A;  3CLJ A;  2WXM A;  3D9I A;  3AS5 A;  3D3M A;  3MCX A;  3L22 A;  2OVF A;  4EPZ A;  5FJY A;  1L5J A;  5JHA A;  3S7F A;  3JYS A;  2I2O A;  1H2V C;  1UJK A;  2LSU A;  4GYY A;  3FEY A;  3P2B A;  2KAT A;  4Y6W A;  3FU5 A;  4J8F A;  5DBK A;  3CEQ A;  3CVX A;  5BNW A;  2AXZ A;  2IOS A;  2Y3A A;  4BT8 A;  2RG8 A;  3CGH A;  3QKY A;  3MA5 A;  4GCO A;  1LF8 A;  4AXH A;  4LEU A;  4FJY A;  5G2N A;  4LCT A;  1XNF A;  3LPZ A;  3ZFW A;  4L2L A;  3IEG A;  1UW4 B;  3JCK C;  4BX8 A;  5ANR A;  4XI9 A;  2WXQ A;  2YQ8 A;  1NP7 A;  3FUM A;  2WXL A;  4JHK A;  5KJN A;  4JXT A;  1TJC A;  3K9I A;  5T4Y A;  2WXO A;  4PDX A;  4F7A A;  4I17 A;  2UY1 B;  4KMO A;  4OVV A;  4I9C A;  1HE8 A;  1EPU A;  2AW6 A;  5CMY A;  2X6I A;  2A4Z A;  3VTX A;  5LOZ A;  4WND A;  5EX3 A;  4WNF A;  2OND A;  3SFZ A;  3FY4 A;  3ONL A;  4EZL A;  5LX8 A;  4EZK A;  2KCL A;  5JJT A;  2XCB A;  4FC8 A;  3LVQ E;  1XGW A;  3CHQ A;  3CKC A;  4HOR A;  1KT0 A;  5G04 J;  5CHE E;  4BY6 A;  4KZ0 A;  4I6E A;  2J4B A;  4J0U A;  4JPS A;  4I2W A;  4DI4 A;  4WWP A;  3MV3 B;  1TEZ A;  2J08 A;  2I1K A;  4WWO A;  3RU0 A;  3B7T A;  3CVW A;  3CHR A;  3PNT B;  1U3C A;  4J6I A;  2X6J A;  1UG3 A;  3CR3 A;  4CEM A;  2X6K A;  4XE0 A;  3FUK A;  4U63 A;  2JEK A;  4G11 A;  3PE3 A;  3VLD A;  3ASD A;  5D0O D;  4GYW A;  4CDR A;  4WNE A;  3SZ7 A;  2CFZ A;  2VTB B;  5G55 A;  3RK6 A;  3MZL B;  1PAQ A;  2FF4 A;  2RD0 A;  2Y4T A;  4J8D A;  2L0T B;  1HF8 A;  4ANU A;  2L0I A;  3LVR E;  2CHX A;  2YHE A;  3SNX A;  3VTY A;  4HOT A;  4ILH B;  5M72 A;  3RJV A;  4CT4 A;  4L7T A;  2Q7F A;  3FU6 A;  3APC A;  3AS4 A;  3FDH A;  1HH8 A;  5T3R A;  5BUZ A;  4FHK A;  1BPO A;  3ZRH A;  2IF4 A;  2J07 A;  4NUR A;  4I6J A;  3TXM A;  4AEZ C;  4UQY A;  5AJD A;  2V8S E;  2EQX A;  3MKQ B;  4APO A;  4RSY A;  1HFA A;  4HLE A;  4K0R A;  1H2U A;  1OUV A;  2DBA A;  3KAE A;  4FHJ A;  2PM6 A;  3FUJ A;  3ML9 A;  1SZ9 A;  4KZC A;  2LO6 A;  1N52 A;  3L54 A;  3UUX A;  3ZYQ A;  4PS8 A;  5FQ4 A;  3ZN3 A;  4CGW A;  1H2T C;  2PM7 A;  3EIJ A;  4G2V A;  1E90 A;  4P29 A;  4UI9 C;  1OWM A;  5G05 J;  2KCK A;  1IYG A;  3FTZ A;  3RRN B;  5CMW A;  3RRM B;  4I2Z A;  4HS2 A;  3T5V A;  2Y4U A;  4FAD A;  3MEK A;  3O48 A;  4L1B A;  1HS6 A;  5FZQ A;  3JUI A;  4AM9 A;  1Y8M A;  4EEC A;  2C2L A;  1ZBP A;  4GCN A;  2P58 C;  4DLQ A;  3N71 A;  2BTD A;  1WM5 A;  4H7X A;  3TGO A;  1GW6 A;  2C0M A;  5HQ8 A;  3I3N A;  3FTU A;  3NZS A;  3UX4 A;  2GW1 A;  3R9A B;  4GML A;  4PS3 A;  3IHV A;  2UY1 A;  2IOL A;  4FJZ A;  4TV3 A;  5BV1 A;  2MRI A;  4G25 A;  3PZD A;  4ANV A;  1NA0 A;  4PH4 B;  3MYV A;  4XX5 A;  3ML8 A;  4A3T A;  3QNK A;  4L2Y A;  3RRU A;  4G23 A;  1FVF A;  1OWP A;  2HO1 A;  2L6J A;  3AU4 A;  4U0U A;  3S2A A;  3P1U A;  3ZW3 A;  2ZU6 B;  4CT0 A;  2E2E A;  2I6H A;  3SGH A;  3ZHE B;  4C0M A;  4FA6 A;  2NC9 A;  5E76 A;  3PEU B;  3L16 A;  3PEV B;  3ULQ A;  4EZJ A;  3CVY A;  2GRM A;  4PUC A;  3FUE A;  3PS6 A;  3CHO A;  4UWL A;  3RO3 A;  2J9Q A;  2VSY A;  4CCA A;  5J90 A;  2XGM A;  3ZIM A;  3FUH A;  2AVP A;  4I9E A;  1HG5 A;  4A1S A;  4U07 A;  4UWH A;  5BV0 A;  3LJ3 A;  4NRH B;  4ACK A;  2DIW A;  2WXI A;  5FQ8 A;  3T8M A;  5HI7 A;  1HZ4 A;  3EJN A;  1DNP A;  4F1S A;  2BF0 X;  2ILR A;  4EBA G;  2E0I A;  3ONK A;  3HDX A;  3R7R A;  2IJG X;  3FHE A;  1H0A A;  3MJW A;  4H7Y A;  4GA1 A;  4Q69 A;  2WMO A;  2KZT B;  3CVQ A;  4E6H A;  2VTB A;  5BPP A;  3D9M A;  4WUY A;  4JA9 A;  4A55 A;  4U04 A;  3QB2 A;  4LRZ A;  4TUU A;  4FLH A;  2XHE A;  3C98 A;  5FT9 A;  2R17 C;  5ARG A;  2WQ7 A;  4ATG A;  2ION A;  2PQN A;  5FQ6 A;  2KCV A;  2FI7 A;  3APD A;  1IQR A;  1Y6I A;  5KJK A;  3Q5M A;  4RVB A;  2C0L A;  2QY7 A;  3HIZ A;  1MQS A;  1OWO A;  3FFL A;  5LCW J;  3UPV A;  4XI0 A;  5T8I A;  4CDN A;  2I9C A;  3CVP A;  5FWQ A;  1PC2 A;  1HX8 A;  3CQG B;  2X6H A;  2V0P A;  3ASG A;  4MLP A;  1Z3Y A;  3GZ2 A;  3TJP A;  3RO2 A;  4HOU A;  3MKQ A;  5G04 C;  2OV8 A;  2M63 A;  2WXG A;  3LYA A;  1H6K A;  3FH8 A;  3O4Z A;  3ESL A;  4N5C A;  1E7V A;  3IV0 A;  2J49 A;  5LP0 A;  3S7J A;  3UT8 A;  3QWV A;  4GMJ A;  3D9J A;  3FH7 A;  1JUQ A;  1JWG A;  2WXF A;  4EBA A;  3TL5 A;  3CVN A;  2HR2 A;  3I4G A;  2CHZ A;  2LAI A;  1EDU A;  2LAH A;  5FZR A;  3U9W A;  3L13 A;  4LER A;  3QDN A;  1QZ2 A;  1ZU2 A;  5BW8 C;  3FUL A;  4KBQ A;  3CVL A;  3KEZ A;  3FTW A;  4KXK B;  4V3I A;  1U3D A;  3ZYK A;  3D9N A;  4F3V A;  2I1J A;  3PUJ A;  5KCM A;  2FUL A;  4UWG A;  3CK8 A;  5ENN A;  3ZGQ A;  3L6A A;  5FQ7 A;  2QFC A;  4AV7 A;  3NZU A;  1DVP A;  4C0E A;  3DBS A;  3EIQ C;  3FEX A;  3GYZ A;  4I43 A;  4Q94 A;  1H19 A;  3G2S A;  3TAX A;  2VGX B;  1WY6 A;  3PE4 A;  4GA2 A;  4HVB A;  4R7L A;  3ZYM A;  3FH5 A;  4GU5 A;  3AS8 A;  1FVH A;  2KM4 A;  1QQE A;  2OOE A;  5ARF A;  1JPL A;  3Q15 A;  3S7B A;  3I4R B;  4ANX A;  5JJ7 A;  3Q47 B;  4B8C B;  3G2V A;  4N2S A;  3ZXS A;  4WAF A;  3ZHE A;  3ESK A;  4ACL A;  1SQM A;  3CIA A;  3FTV A;  4GPK A;  4Q96 A;  4JHJ A;  4J8S A;  4O6F A;  4BTB A;  4KYO B;  3D9L A;  3FUD A;  4ILG A;  3CVV A;  4JEU A;  5KJM A;  3CHS A;  4NAC A;  3QJZ A;  2IU1 A;  5G05 C;  3VLF A;  4KVM A;  4B89 A;  4XZ4 A;  1B89 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...