2RFAA

Crystal structure of the mouse trpv6 ankyrin repeat domain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
222
structure length
222
Chain Sequence
IWESPLLLAAKENDVQALSKLLKFEGCEVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATGSVFHYRPHNLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analyses of the ankyrin repeat domain of TRPV6 and related TRPV ion channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
molecule keywords Transient receptor potential cation channel subfamily V memb
total genus 78
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2rfaA00
3NOGD 4RLYA 1IKND 2V5QC 1BI8B 2XENA 4HRNA 4U96D 5HS0A 3DEPA 4O1OA 4HB5A 4HI8A 3TWRA 4GMRA 2DZOA 2KBXA 5ITZF 5FIOA 3LJNA 4DX6D 5D66A 1NFIE 5ENQD 3IXEA 2JABA 3B95A 3EHRA 4O60A 4TUMA 3V30A 2DZNA 2XZTG 3T8KA 4DX1A 4K5BA 5CECB 5ENRD 5BXUA 5AN8A 4C48B 3HG0D 3SO8A 5AARA 1UOHA 2XEHA 3NOCD 5JA4D 3TWVA 5AQ9A 4U95D 3V79K 2QYJA 4K5CA 3EU9A 3W9FA 2DVWA 5KNGA 1BD8A 1QYMA 4J8YA 4YDWA 5ENTD 4DUIA 4N5QA 1K1BA 4HLLA 4K5AB 5FINA 2NYJA 2RFAA 4BSZB 4CZ2D 4BERA 4HQDA 2ETCA 2F8YA 3EHQA 2Y0BG 4F1PA 4YDYA 1YYHA 1MX6A 5JMND 1MYOA 2HE0A 3TWWA 2PNNA 1A5EA 3V31A 4ATZD 4HNAD 4LNUD 1N11A 5KNHD 4G8LA 4DX5D 2ETBA 2ZGDA 5CEDB 5EN5D 5AQAA 2QC9A 1IHBA 1SW6A 4B93B 5EYPF 4OAVB 4LSZE 3UI2A 5EILA 4HRLA 5HRYA 5ENSD 5KWDA 2F37A 4NIKA 4DRXE 2A5EA 4DX7D 3D9HA 1N0QA 3AJIA 3JXIA 3HRAA 2B0OE 2V4HC 3V2XA 5AQBA 5CBOA 2Y1LE 2AJAA 1DC2A 2J8SD 2KXPC 4LG6A 4UUCA 1BU9A 3T9KA 3DEOA 3JXJA 1BI7B 3TWUA 2BKKB 3C5RA 5EIBE 5KBAA 4Z68A 1G3NB 1MX2A 4CYMD 4OAUC 3AAAC 1MJ0A 3ZUVB 2RFMA 5AQ7A 5HKPA 3UTMA 1K1AA 5EIDA 3ZKJA 4GPMA 3NBNB 1S70B 3ZNGA 1YMPA 2XEEA 1DCQA 2P2CP 3V2OA 2XZDG 3TWXA 3F6QA 3TWSA 1OT8A 3J5QB 4F6RD 5CBNA 5CEAA 3B7BA 2F8XK 1AP7A 1WG0A 2ZGGA 3KEAA 4J7WA 2DWZA 2BKGA 4BETA 4QFVA 4BESA 3UXGA 4JB8P 2VGEA 3Q9UC 3JUEA 5CERB 1K3ZD 1BLXB 1TR4A 4HRMB 2MYOA 5ENPD 1D9SA 4O1PA 5AAOA 4ZFHA 2L6BA 3Q9NC 1AWCB 1SVXA 4BEPA 1IXVA 4QQIA 1OY3D 3TWQA 4U8VD 4A63B 1WDYA 4G8KA 2FO1E 5BXOA 4U8YD 4DX2A 4HI9A 1N0RA 5EYLA 1MX4A 3J5PA 3W9GA 4HBDA 5ENOD 3TWTA 3ZU7B 4ZHBA 1YCSB 2ETAA
chains in the Genus database with same CATH superfamily
4G1TA 4HRNA 5E76A 4I1AA 3LY7A 3SFXA 2XGOA 2CG3A 4JHRA 4DX6D 5HQ8A 4DPRA 3ZPJA 2AVPA 4TUMA 5A6CA 3P2BA 3NF1A 2MOWA 2IFUA 4GB9A 2XEHA 4FHJA 5JA4D 3L08A 3V79K 5A23A 3CVLA 4HLLA 1DVPA 4XEIG 4CGVA 3CK9A 4URKA 4DLOA 3MV2B 2KZTB 2HM8A 3Q15A 3QC1A 4UQYA 1TJFA 3TG5A 4DX5D 4H7YA 4DLQA 4HRLA 2R03A 2KZTA 1OWMA 1LD8A 2AJAA 3OXFA 5G05C 1Y6IA 4WUYA 2P9UG 3NB2A 2RFMA 3NBNB 4ACLA 3P1UA 3B7SA 4UWLA 1OWNA 1OWLA 4J7WA 4GCOA 4BETA 5JHAA 5C1DA 1U3DA 5CERB 1TR4A 3U3WA 1FPPA 2IOSA 3Q5MA 4GTOA 2Q7FA 2FO1E 3FUIA 3DPDA 2XPYA 1Z3YA 1HG5A 2XENA 3AG4E 3HXBA 1EDUA 4G2VA 4JPSA 5FQ7A 3ASDA 5D0OD 1H2UA 3FTXA 5B1AE 3QJZA 2JABA 3G2TA 3ULYA 3Q4AB 1H6PA 4H7XA 3SFYA 5CRVA 3D9IA 4XE0A 1HXIA 1JCQA 2XRZA 2P9PG 3W9FA 4I17A 4GTRA 4N5QA 3DWLG 4AJWA 2OEVA 4FJZA 1HF8A 4GYYA 1N54A 3FH5A 2QYUA 3GZ2A 3C72A 4FJYA 3AG3E 4LSZE 3ZYMA 3CGHA 3ESLA 2M63A 4CGWA 3TXMA 4MLPA 4CDMA 4HOUA 4DI4A 3JXJA 3PEVB 3TWUA 3ZIMA 2WXOA 1V54E 4EBAA 2XEVA 4IULA 5AQ7A 1K1AA 1WY6A 3ZKJA 3T8MA 3GZSA 1Z6TA 3C3QA 3V2OA 1D8DA 4KBQA 4MRUA 3ZHEB 4QFVA 1OCOE 4KZ0A 4J8SA 1BLXB 4I9EA 4O6FA 3X2QE 2F0YA 2OVFA 5EKQD 2R2LA 4ZFHA 3L17A 3FUNA 4RSYA 1JUQA 1K8KG 3HVEB 2J4DA 1KZOA 2J49A 3RO2A 3FWVA 3KS2A 2DBAA 4XZ4A 4EBAG 2CHWA 3FFLA 4GMRA 1LF8A 5ENQD 2YQ8A 3SY2A 3NQPA 5ENRD 3CKCA 4HOSA 2YHCA 4ACKA 2KM4A 5ENNA 3FUJA 2BTDA 2I1JA 5HI7A 1FT2A 4N3CA 4CT0A 3UT7A 4ILIA 4JD2G 4YDYA 2XQ0A 1N4RA 2XGMA 5AJLA 1N11A 5D2MC 3ASHA 3SI5A 2AXUA 4DX7D 3DXKG 4WNEA 2BUGA 2V4LA 4I43A 2JLBA 2KXPC 5BV1A 1BU9A 3NZUA 3N71A 3AU4A 4CDRA 2P9KG 5EIDA 3D9KA 2HR2A 3DSTA 2XEEA 3IBEA 2LXLA 3RAUA 5BV0A 3F6QA 4LRZA 4F53A 4GTTA 4DK5A 3FEYA 2DWZA 4ILHB 2VGEA 4B94A 1E7UA 2XCCA 4XI0A 1HU3A 4U0UA 2L6BA 3MKQA 2HO1A 2ZU6B 4U8VD 4G8KA 5BXOA 1U2VG 3TAXA 3JQ1A 1YCSB 3NOGD 3ZYLA 4U63A 1BI8B 4U8HA 3BG0B 4YVQC 5BW8C 1QZ2A 2YHEA 4HVBA 2H6GA 5KCMA 3EHRA 3S7JA 1OWOA 5BXUA 4UQZA 3C3OA 4CDNA 4GA0A 1E8YA 2VTBA 3DXMG 4RQIA 2GRPB 4U07A 2QYJA 2X3MA 4KMOA 2QZAA 2XPZA 3CK7A 2ETCA 5BNWA 1NI1A 3CQGB 4ATZD 1TNUA 1NA0A 2DCPA 3FY4A 4ANUA 1H2TC 4B93B 4OAVB 4ILGA 4EQFA 4NIKA 1E7VA 4PS3A 3HRAA 3C3RA 4GAAA 3I5PA 5LP0A 1VDYA 4U0SA 2WXLA 4WNFA 1KZPA 3RJVA 3LEWA 4GPMA 4XIFA 3UX4A 3I4GA 1GW6A 3UMVA 2WQHA 3HIZA 3CSTA 1HX8A 2RD0A 4JEHA 5FTPA 4K0RA 5FQ6A 1EF1C 5ANLA 3CVNA 5BT1A 3ZFWA 2L6JA 1EPUA 2ZXWE 2IO3C 4U8YD 2DYRE 3QWWA 4AXHA 2WQ7A 2IO2C 3DRAA 4EZLA 4HI8A 5AIJA 4G26A 2P58C 3ASOE 2GW1A 5BUZA 2NC9A 1NFIE 4G24A 1RW2A 2IY0C 3ASNE 4C0MA 1UN8A 4HFGA 4FU3A 1N94A 4HORA 3UINC 2VGXA 2V0PA 4UQXA 1H19A 1QQEA 3D9MA 3L54A 1MYOA 3RRNB 2PNNA 5J90A 2GRRB 3APFA 5KNHD 4FHKA 3PDNA 1B89A 5LCWC 3LVQE 5CBOA 2VYIA 4YNDA 4BTAA 3VLDA 3DSVA 5KBAA 4TXRA 1QNFA 3CHPA 3ONKA 2WXPA 1YMPA 2Y4UA 2XZDG 5CBNA 3KEAA 3C98A 3UXGA 4XKCA 3MZLB 4A55A 4ABNA 3UUXA 3R9AB 3U64A 1HZ4A 3MEKA 4L1BA 1IXVA 4KYOB 1IQUA 1JPLA 3QNKA 3FP3A 4U96D 4WNDA 3QK0A 2EIKE 4CT4A 3LJNA 4HOQA 1SZAA 1H6OA 4U0ZA 3T8KA 4DX1A 5B3SE 3FUMA 3MCXA 4C48B 3HG0D 4BT8A 4FP7A 3PZ4A 1PY1A 2XS8A 1ZU2A 5FWQA 2LSUA 5B1BE 4BSZB 4F7AA 2F8YA 3TWWA 3UT4A 4G8LA 2CHZA 2FULA 5EN5D 5AQAA 2ONDA 3D9NA 3ML8A 2J09A 4GZ6A 2V4HC 4XX5A 2Y69E 2ZIRA 1BI7B 4Y6WA 1ZBPA 3KAEA 1TEZA 2A4ZA 3Q7AA 3GYZA 4N2SA 3RO3A 1HO8A 1DCQA 1KLXA 2J08A 3J5QB 2GRMA 3Q9UC 2FBNA 4JHKA 5LOZA 1W3BA 4HRMB 2MYOA 4I2WA 1OCRE 3PUJA 3KEZA 3ONLA 1SVXA 1QBQA 1OY3D 4A63B 1E90A 5ENOD 3I3NA 4RLYA 4YDEA 3PREA 3ZYQA 4MBGA 2I6HA 1LTXA 2KBXA 1JCSA 5ARGA 4AY6A 1E8WA 3AS4A 2QY7A 3FUFA 4P29A 3FEXA 4AVXA 4TUUA 1OXJA 3NOCD 5T3RA 4EZKA 5LX8A 3B13A 4MS6A 4G23A 2DVWA 1BD8A 5FJYA 2WXNA 3EHQA 2Y0BG 3SHFA 2C0LA 1X5BA 3EHMA 4B8AA 3U4TA 2CHXA 2WMOA 2P9LG 4F1SA 2QC9A 4BSXA 3PZDA 2OVBA 2A5EA 3D9HA 1N0QA 4GMJA 3AJIA 2J4BA 2B0OE 4M7CA 4TXQA 2J8SD 3RSEG 3IHVA 4AP2A 4UWKA 5EIBE 3HXEA 1G3NB 3Q47B 4OAUC 1HG2A 2EIJE 3KSQA 3CVPA 3HXCA 2L9BA 5ARFA 4L7TA 4JEUA 2BKGA 3RRUA 3CIAA 3O48A 3OXGA 5FQ4A 3Q73A 2EQXA 1A17A 3CVVA 2EIME 2FO7A 1D9SA 2VSYA 3D3MA 3ASGA 3E30A 5CMWA 2WVIA 4FULA 2A5UA 3WXXA 4BFRA 1KT1A 4ATGA 4W9RA 3QAQA 4AOFA 3FTUA 4KVOA 1TN7A 3TG4A 4A3VA 3DBSA 3EDTB 3D9JA 2LAIA 3ZYKA 3CVXA 1O1SA 3FU6A 3QB2A 3L16A 3NAWA 5KJMA 3E4BA 2RG8A 4IN3B 1FCHA 3ZW3A 4B0ZA 1MX6A 2HE0A 1A5EA 3VTXA 4AY5A 3MV3B 5AJDA 2VGYA 2YNQA 5FZQA 3ZXPA 2WXQA 2R05A 1OCCE 3FU5A 2E0IA 1H2VC 1DC2A 3G2UA 3S7FA 4EZJA 1Q2ZA 4E6HA 3E32A 2WXIA 3Q78A 4U04A 5A7DB 1UN9A 5KJNA 3PVLA 1H6KA 2DIWA 3B7RL 4LCTA 2ZGGA 3RK6A 2PQRA 3E33A 1MZCA 3TXNA 2YINA 1TN8A 4L9PA 4APOA 4EECA 4KT6B 5CHEE 2OEWA 2KATA 1E8ZA 3JQ0A 5AAOA 3PE3A 3TGOA 2LO6A 3CK8A 3ABLE 4RVBA 1N0RA 1MX4A 5M72A 2V5QC 3PNLB 2X38A 3L13A 2DZOA 2XRYA 2PM6A 4N3AA 2X6HA 3HYMB 4O60A 3FUHA 2WXGA 3FUDA 3AG2E 3CHRA 3PUKA 3CQCB 2IQCA 4GTSA 4K03A 3ABME 2OV8A 4B8CB 4OVVA 1FT1A 1FVHA 4KVMA 2GGFA 3G2VA 3EU5A 3PNTB 2QFCA 5FT9A 3ZN3A 2GROB 3LY9A 3JXIA 2V8SE 2AXZA 1INZA 3DSSA 3FH7A 3ZUVB 3UTMA 3ULEG 4J8DA 3O4ZA 4UI9K 4PH4B 2UY1B 3CV0A 4L2YA 1OT8A 3SF4A 4GCNA 4JB8P 4RG9A 4AEZC 1PC2A 4GTQA 3EIJA 4GTVA 4JA9A 2KC7A 4KZCA 4QQIA 3R9MA 2WXMA 4HI9A 4ZHBA 1HS6A 1RZ4A 4EPZA 3UM0A 1TNBA 4AIFA 3QWPA 3L82A 3DEPA 3UM3A 2NSZA 2P9IG 3IXEA 2XCBA 1MHQA 1PAQA 5CCMA 4UWFA 3SFZA 1Y8MA 1NA3A 2WXKA 3CLJA 1UOHA 1UW4B 3RKVA 3S7BA 2XS1A 5JJ6A 2VSNA 3Q79A 5CMYA 3AU5A 3LJ3A 3FTZA 4BX8A 4HNAD 4BWRA 3GZ1A 5CEDB 2LUHA 3L22A 5JJ7A 5KWDA 3UI2A 5T8IA 3V2XA 5AQBA 3OAWA 4NACA 4X8QA 2WMNA 2XPIA 3BUAA 3DEOA 2IJGX 4JA7A 1U3CA 1MX2A 4LNGA 1JCRA 3CHOA 4C0EA 2GRLA 3TWSA 1HFAA 4WWPA 3HVEA 3CKBA 3NZSA 1IQRA 1K3ZD 3DSXA 3S2AA 4A1GA 4TRQA 5DIZA 1NP7A 2VTBB 2R59A 3ESKA 4G25A 4CCAA 5AENA 4PUCA 3B7TA 1TYQG 3SD5A 3ZU7B 3TWTA 4UI9J 2H6IA 4LEUA 5HS0A 4GPKA 2EILE 4HB5A 4FLHA 3APDA 3TWRA 4HS2A 5CRUA 4AM9A 4GZDA 4HOTA 4PS8A 5KJLA 3E37A 4I2ZA 2WXJA 3B95A 3RU0A 3V30A 5CECB 2WXHA 5AARA 3FH8A 4Q94A 5AQ9A 4HXIA 4YDWA 3CHMA 1K1BA 4CZ2D 3ZVVA 5G04C 5FZSA 4F1PA 3UM1A 1SA4A 4A3TA 3CHQA 4GZ5A 4BTBA 3QOUA 2RKKA 3B7UX 1IHBA 5EYPF 5HRYA 1N4PA 3FUEA 2P9NG 4N5CA 4OYSA 2Y1LE 4ANWA 2R5SA 3MJWA 3T9KA 3PZ3A 2VQ2A 5H7PA 2WM9A 4GU5A 3U66A 5FQ8A 1DCEA 1S70B 4J6IA 4WWNA 2P2CP 3VLFA 4IYPA 2XHEA 3AS8A 3B7BA 1WG0A 3S7DA 3LPZA 1S63A 4KXKB 2R17C 4FLBA 4J0UA 4TXPA 4GZCA 4O1PA 1XNFA 1WAO1 3ML9A 3RRMB 2CFUA 1WDYA 1DNPA 5J08A 3J5PA 4RG6A 3W9GA 2L0TB 2ZISA 2ETAA 1IKND 3SNXA 5EX3A 4GYOA 3LYAA 3UM2A 5ITZF 1V55E 4LERA 3K9IA 1X81A 3FTSA 5G04J 5G05J 5AN8A 2AWIA 3SO8A 2H6HA 3QARA 3Q7FA 4DUIA 1WM5A 3ZEFA 3AG1E 2VJ8A 2NYJA 4YDOA 2PL2A 2ILRA 2R02A 4LNUD 3KD7A 2FEZA 5LFAA 3SZ7A 3FULA 3URZA 2X6FA 3TJPA 4DRXE 4EHMA 1N4QA 2AXVA 4GTMA 5EDSA 1TJCA 3OTNA 4UUCA 1L5JA 3FUKA 4LNBA 3C5RA 2BEDA 2WPVA 4N3BA 3AAAC 3L9TA 3E34A 4V3IA 5HKPA 4AV7A 3CSFA 1Z3XA 4F3VA 4UI9C 4BT9A 4F6RD 1H0AA 1NL4A 2B6CA 2MRIA 2OOEA 5JHBA 3G2SA 4GMLA 2CFZA 4BEPA 3ENEA 3TWQA 4DX2A 2I9CA 4M3OA 3JUIA 4HBDA 3FHEA 1MQSA 3BQOA 4GA1A 4ANXA 2J9QA 3QDNA 4O1OA 1TNYA 2MHKA 3CVWA 4J8FA 5D66A 3Q75A 5BPPA 2VSXE 1OUVA 1EYHA 3QKYA 2UWJG 3TWVA 3IV0A 2KCKA 4U95D 4GYWA 3APCA 5KNGA 3TL5A 3UPVA 2E2EA 2LSVA 5JJTA 3SQVA 2V5FA 1E96B 4TV3A 1D8EA 1SW6A 5T4YA 5ENSD 2IEJA 3SBSA 4XKBA 1BPOA 2BKKB 3PRZA 4CYMD 4WWOA 4NQ0A 1MJ0A 1N95A 4J8EA 2XGSA 1JWGA 3R7RA 3EJNA 5D0QD 3PH0C 1YA0A 3CVQA 2IF4A 4WNGA 4BESA 4JXTA 3JUEA 4I9CA 4I6GA 1FVFA 2EINE 2P9SG 1ZB1A 2VGXB 3UT8A 4GA2A 4N2QA 1TNOA 3ZHEA 4I1OB 3ZGQA 3EHNA 3DPYA 1IYGA 3UIPC 1ELRA 1SA5A 2Y3AA 1OWPA 3UIOC 3I4RB 5FIOA 3FTWA 3D9PA 2PZIA 4JHJA 2X6JA 2DZNA 1S64A 3ABKE 4NRHB 4K5CA 2DYSE 4J8YA 4K5AB 4BERA 1N4SA 4HQDA 1TNZA 2LAHA 5E75A 3IHYA 2KCLA 4UWHA 3JCKC 4C9BB 3FTYA 3LVRE 2ETBA 2ZGDA 3CHSA 2X6IA 5EILA 3ISMC 1KPSB 4Q96A 2AW6A 1N52A 5IY5E 2I2OA 3MKRA 4L23A 4Z68A 5G55A 3ZRHA 1LD7A 2GRQB 5G2NA 5CCLA 3HDXA 3LCAA 4HLEA 3VTYA 3RIBA 2F8XK 1AP7A 3EUVA 4FC8A 1XGWA 5DBKA 3SGHA 1ELKA 3MYVA 2WXRA 2LXMA 4DJAA 2IONA 1UG3A 3JYSA 5LCWJ 4WAFA 2J07A 1AWCB 3OXLA 2KCVA 3U9WA 4CEMA 3DSWA 3FDHA 3LKUA 3AS5A 1NZNA 3UKRG 2LNIA 3MA5A 2WQ6A 3D9LA 5ANRA 4XI9A 1E8XA 2C0MA 2H6FA 3D9OA 1SZ9A 4NURA 4K5BA 2CG2A 4GZ3A 3FTVA 4OVUA 4I6JA 3T5VA 2IOLA 1O1TA 4PDXA 5FINA 2RFAA 4R7LA 4B89A 1YYHA 4Y6CA 4A1SA 3DSUA 3LS8A 3V31A 1N9AA 3SBTB 2WB2A 3KSLA 3CR3A 2F37A 4IRUA 4N39A 4Q69A 4U7EB 4JZYA 2FF4A 4UWGA 5FZRA 1O5MA 4L2LA 4LG6A 2WXFA 3BEEA 1KT0A 2OCCE 4YVOA 1O1RA 4I6EA 3ULQA 4D10C 1P5QA 2I1KA 4BY6A 4BX9A 4JC8A 1TN6A 3TWXA 5KJKA 2Y4TA 3UKUG 3CVUA 1S0PA 4FADA 3IKOB 3HHMA 3Q49B 5ENPD 4G11A 3FU3A 3Q9NC 2FI7A 4E85A 3FU0A 1HE8A 3CVYA 1ELWA 1Z5SC 3PEUB 5EYLA 3R7QA 2JEKA 3EIQC 1IHGA 1HH8A 1UJKA 3CEQA 2XZTG 3MGBA 4MKTA 4ANVA 5EX0A 4ME2A 1SQMA 2VSOE 2BF0X 3EU9A 4JL0A 3MX3A 3ZXSA 3G2WA 1QYMA 3LY8A 3T5XA 5ENTD 4JW1A 2C2LA 3QWVA 3BG1B 3WG7E 5JMND 4PS7A 2UY1A 3HXFA 2X6KA 2PM7A 4CRWA 5C2YA 4DI3A 2NXPA 4I1MA 2IU1A 2HYZA 3BU8A 3UQ3A 3LXUX 2PQNA 2GRNB 3LDZA 4JVSA 2L0IA 3IEGA 3PZ1A 3ZNGA 1OCZE 5CEAA 3VLEA 3PE4A 4FA6A 4LUNU 3MKQB 1UJJA 3ASFA 3HXDA 5AYWD 3L6AA 3GW4A 4APFA 3PS6A 1JWFA 3PZ2A 4GTPA
chains in the Genus database with same CATH topology
3NOGD 4RLYA 1IKND 2V5QC 1BI8B 2XENA 4HRNA 4U96D 5HS0A 3DEPA 4O1OA 4HB5A 4HI8A 3TWRA 4GMRA 2DZOA 2KBXA 5ITZF 5FIOA 3LJNA 4DX6D 5D66A 1NFIE 5ENQD 3IXEA 2JABA 3B95A 3EHRA 4O60A 4TUMA 3V30A 2DZNA 2XZTG 3T8KA 4DX1A 4K5BA 5CECB 5ENRD 5BXUA 5AN8A 4C48B 3HG0D 3SO8A 5AARA 1UOHA 2XEHA 3NOCD 5JA4D 3TWVA 5AQ9A 4U95D 3V79K 2QYJA 4K5CA 3EU9A 3W9FA 2DVWA 5KNGA 1BD8A 1QYMA 4J8YA 4YDWA 5ENTD 4DUIA 4N5QA 1K1BA 4HLLA 4K5AB 5FINA 2NYJA 2RFAA 4BSZB 4CZ2D 4BERA 4HQDA 2ETCA 2F8YA 3EHQA 2Y0BG 4F1PA 4YDYA 1YYHA 1MX6A 5JMND 1MYOA 2HE0A 3TWWA 2PNNA 1A5EA 3V31A 4ATZD 4HNAD 4LNUD 1N11A 5KNHD 4G8LA 4DX5D 2ETBA 2ZGDA 5CEDB 5EN5D 5AQAA 2QC9A 1IHBA 1SW6A 4B93B 5EYPF 4OAVB 4LSZE 3UI2A 5EILA 4HRLA 5HRYA 5ENSD 5KWDA 2F37A 4NIKA 4DRXE 2A5EA 4DX7D 3D9HA 1N0QA 3AJIA 3JXIA 3HRAA 2B0OE 2V4HC 3V2XA 5AQBA 5CBOA 2Y1LE 2AJAA 1DC2A 2J8SD 2KXPC 4LG6A 4UUCA 1BU9A 3T9KA 3DEOA 3JXJA 1BI7B 3TWUA 2BKKB 3C5RA 5EIBE 5KBAA 4Z68A 1G3NB 1MX2A 4CYMD 4OAUC 3AAAC 1MJ0A 3ZUVB 2RFMA 5AQ7A 5HKPA 3UTMA 1K1AA 5EIDA 3ZKJA 4GPMA 3NBNB 1S70B 3ZNGA 1YMPA 2XEEA 1DCQA 2P2CP 3V2OA 2XZDG 3TWXA 3F6QA 3TWSA 1OT8A 3J5QB 4F6RD 5CBNA 5CEAA 3B7BA 2F8XK 1AP7A 1WG0A 2ZGGA 3KEAA 4J7WA 2DWZA 2BKGA 4BETA 4QFVA 4BESA 3UXGA 4JB8P 2VGEA 3Q9UC 3JUEA 5CERB 1K3ZD 1BLXB 1TR4A 4HRMB 2MYOA 5ENPD 1D9SA 4O1PA 5AAOA 4ZFHA 2L6BA 3Q9NC 1AWCB 1SVXA 4BEPA 1IXVA 4QQIA 1OY3D 3TWQA 4U8VD 4A63B 1WDYA 4G8KA 2FO1E 5BXOA 4U8YD 4DX2A 4HI9A 1N0RA 5EYLA 1MX4A 3J5PA 3W9GA 4HBDA 5ENOD 3TWTA 3ZU7B 4ZHBA 1YCSB 2ETAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NOG D;  4RLY A;  1IKN D;  2V5Q C;  1BI8 B;  2XEN A;  4HRN A;  4U96 D;  5HS0 A;  3DEP A;  4O1O A;  4HB5 A;  4HI8 A;  3TWR A;  4GMR A;  2DZO A;  2KBX A;  5ITZ F;  5FIO A;  3LJN A;  4DX6 D;  5D66 A;  1NFI E;  5ENQ D;  3IXE A;  2JAB A;  3B95 A;  3EHR A;  4O60 A;  4TUM A;  3V30 A;  2DZN A;  2XZT G;  3T8K A;  4DX1 A;  4K5B A;  5CEC B;  5ENR D;  5BXU A;  5AN8 A;  4C48 B;  3HG0 D;  3SO8 A;  5AAR A;  1UOH A;  2XEH A;  3NOC D;  5JA4 D;  3TWV A;  5AQ9 A;  4U95 D;  3V79 K;  2QYJ A;  4K5C A;  3EU9 A;  3W9F A;  2DVW A;  5KNG A;  1BD8 A;  1QYM A;  4J8Y A;  4YDW A;  5ENT D;  4DUI A;  4N5Q A;  1K1B A;  4HLL A;  4K5A B;  5FIN A;  2NYJ A;  2RFA A;  4BSZ B;  4CZ2 D;  4BER A;  4HQD A;  2ETC A;  2F8Y A;  3EHQ A;  2Y0B G;  4F1P A;  4YDY A;  1YYH A;  1MX6 A;  5JMN D;  1MYO A;  2HE0 A;  3TWW A;  2PNN A;  1A5E A;  3V31 A;  4ATZ D;  4HNA D;  4LNU D;  1N11 A;  5KNH D;  4G8L A;  4DX5 D;  2ETB A;  2ZGD A;  5CED B;  5EN5 D;  5AQA A;  2QC9 A;  1IHB A;  1SW6 A;  4B93 B;  5EYP F;  4OAV B;  4LSZ E;  3UI2 A;  5EIL A;  4HRL A;  5HRY A;  5ENS D;  5KWD A;  2F37 A;  4NIK A;  4DRX E;  2A5E A;  4DX7 D;  3D9H A;  1N0Q A;  3AJI A;  3JXI A;  3HRA A;  2B0O E;  2V4H C;  3V2X A;  5AQB A;  5CBO A;  2Y1L E;  2AJA A;  1DC2 A;  2J8S D;  2KXP C;  4LG6 A;  4UUC A;  1BU9 A;  3T9K A;  3DEO A;  3JXJ A;  1BI7 B;  3TWU A;  2BKK B;  3C5R A;  5EIB E;  5KBA A;  4Z68 A;  1G3N B;  1MX2 A;  4CYM D;  4OAU C;  3AAA C;  1MJ0 A;  3ZUV B;  2RFM A;  5AQ7 A;  5HKP A;  3UTM A;  1K1A A;  5EID A;  3ZKJ A;  4GPM A;  3NBN B;  1S70 B;  3ZNG A;  1YMP A;  2XEE A;  1DCQ A;  2P2C P;  3V2O A;  2XZD G;  3TWX A;  3F6Q A;  3TWS A;  1OT8 A;  3J5Q B;  4F6R D;  5CBN A;  5CEA A;  3B7B A;  2F8X K;  1AP7 A;  1WG0 A;  2ZGG A;  3KEA A;  4J7W A;  2DWZ A;  2BKG A;  4BET A;  4QFV A;  4BES A;  3UXG A;  4JB8 P;  2VGE A;  3Q9U C;  3JUE A;  5CER B;  1K3Z D;  1BLX B;  1TR4 A;  4HRM B;  2MYO A;  5ENP D;  1D9S A;  4O1P A;  5AAO A;  4ZFH A;  2L6B A;  3Q9N C;  1AWC B;  1SVX A;  4BEP A;  1IXV A;  4QQI A;  1OY3 D;  3TWQ A;  4U8V D;  4A63 B;  1WDY A;  4G8K A;  2FO1 E;  5BXO A;  4U8Y D;  4DX2 A;  4HI9 A;  1N0R A;  5EYL A;  1MX4 A;  3J5P A;  3W9G A;  4HBD A;  5ENO D;  3TWT A;  3ZU7 B;  4ZHB A;  1YCS B;  2ETA A; 
#chains in the Genus database with same CATH topology
 4G1T A;  4HRN A;  5E76 A;  4I1A A;  3LY7 A;  3SFX A;  2XGO A;  2CG3 A;  4JHR A;  4DX6 D;  5HQ8 A;  4DPR A;  3ZPJ A;  2AVP A;  4TUM A;  5A6C A;  3P2B A;  3NF1 A;  2MOW A;  2IFU A;  4GB9 A;  2XEH A;  4FHJ A;  5JA4 D;  3L08 A;  3V79 K;  5A23 A;  3CVL A;  4HLL A;  1DVP A;  4XEI G;  4CGV A;  3CK9 A;  4URK A;  4DLO A;  3MV2 B;  2KZT B;  2HM8 A;  3Q15 A;  3QC1 A;  4UQY A;  1TJF A;  3TG5 A;  4DX5 D;  4H7Y A;  4DLQ A;  4HRL A;  2R03 A;  2KZT A;  1OWM A;  1LD8 A;  2AJA A;  3OXF A;  5G05 C;  1Y6I A;  4WUY A;  2P9U G;  3NB2 A;  2RFM A;  3NBN B;  4ACL A;  3P1U A;  3B7S A;  4UWL A;  1OWN A;  1OWL A;  4J7W A;  4GCO A;  4BET A;  5JHA A;  5C1D A;  1U3D A;  5CER B;  1TR4 A;  3U3W A;  1FPP A;  2IOS A;  3Q5M A;  4GTO A;  2Q7F A;  2FO1 E;  3FUI A;  3DPD A;  2XPY A;  1Z3Y A;  1HG5 A;  2XEN A;  3AG4 E;  3HXB A;  1EDU A;  4G2V A;  4JPS A;  5FQ7 A;  3ASD A;  5D0O D;  1H2U A;  3FTX A;  5B1A E;  3QJZ A;  2JAB A;  3G2T A;  3ULY A;  3Q4A B;  1H6P A;  4H7X A;  3SFY A;  5CRV A;  3D9I A;  4XE0 A;  1HXI A;  1JCQ A;  2XRZ A;  2P9P G;  3W9F A;  4I17 A;  4GTR A;  4N5Q A;  3DWL G;  4AJW A;  2OEV A;  4FJZ A;  1HF8 A;  4GYY A;  1N54 A;  3FH5 A;  2QYU A;  3GZ2 A;  3C72 A;  4FJY A;  3AG3 E;  4LSZ E;  3ZYM A;  3CGH A;  3ESL A;  2M63 A;  4CGW A;  3TXM A;  4MLP A;  4CDM A;  4HOU A;  4DI4 A;  3JXJ A;  3PEV B;  3TWU A;  3ZIM A;  2WXO A;  1V54 E;  4EBA A;  2XEV A;  4IUL A;  5AQ7 A;  1K1A A;  1WY6 A;  3ZKJ A;  3T8M A;  3GZS A;  1Z6T A;  3C3Q A;  3V2O A;  1D8D A;  4KBQ A;  4MRU A;  3ZHE B;  4QFV A;  1OCO E;  4KZ0 A;  4J8S A;  1BLX B;  4I9E A;  4O6F A;  3X2Q E;  2F0Y A;  2OVF A;  5EKQ D;  2R2L A;  4ZFH A;  3L17 A;  3FUN A;  4RSY A;  1JUQ A;  1K8K G;  3HVE B;  2J4D A;  1KZO A;  2J49 A;  3RO2 A;  3FWV A;  3KS2 A;  2DBA A;  4XZ4 A;  4EBA G;  2CHW A;  3FFL A;  4GMR A;  1LF8 A;  5ENQ D;  2YQ8 A;  3SY2 A;  3NQP A;  5ENR D;  3CKC A;  4HOS A;  2YHC A;  4ACK A;  2KM4 A;  5ENN A;  3FUJ A;  2BTD A;  2I1J A;  5HI7 A;  1FT2 A;  4N3C A;  4CT0 A;  3UT7 A;  4ILI A;  4JD2 G;  4YDY A;  2XQ0 A;  1N4R A;  2XGM A;  5AJL A;  1N11 A;  5D2M C;  3ASH A;  3SI5 A;  2AXU A;  4DX7 D;  3DXK G;  4WNE A;  2BUG A;  2V4L A;  4I43 A;  2JLB A;  2KXP C;  5BV1 A;  1BU9 A;  3NZU A;  3N71 A;  3AU4 A;  4CDR A;  2P9K G;  5EID A;  3D9K A;  2HR2 A;  3DST A;  2XEE A;  3IBE A;  2LXL A;  3RAU A;  5BV0 A;  3F6Q A;  4LRZ A;  4F53 A;  4GTT A;  4DK5 A;  3FEY A;  2DWZ A;  4ILH B;  2VGE A;  4B94 A;  1E7U A;  2XCC A;  4XI0 A;  1HU3 A;  4U0U A;  2L6B A;  3MKQ A;  2HO1 A;  2ZU6 B;  4U8V D;  4G8K A;  5BXO A;  1U2V G;  3TAX A;  3JQ1 A;  1YCS B;  3NOG D;  3ZYL A;  4U63 A;  1BI8 B;  4U8H A;  3BG0 B;  4YVQ C;  5BW8 C;  1QZ2 A;  2YHE A;  4HVB A;  2H6G A;  5KCM A;  3EHR A;  3S7J A;  1OWO A;  5BXU A;  4UQZ A;  3C3O A;  4CDN A;  4GA0 A;  1E8Y A;  2VTB A;  3DXM G;  4RQI A;  2GRP B;  4U07 A;  2QYJ A;  2X3M A;  4KMO A;  2QZA A;  2XPZ A;  3CK7 A;  2ETC A;  5BNW A;  1NI1 A;  3CQG B;  4ATZ D;  1TNU A;  1NA0 A;  2DCP A;  3FY4 A;  4ANU A;  1H2T C;  4B93 B;  4OAV B;  4ILG A;  4EQF A;  4NIK A;  1E7V A;  4PS3 A;  3HRA A;  3C3R A;  4GAA A;  3I5P A;  5LP0 A;  1VDY A;  4U0S A;  2WXL A;  4WNF A;  1KZP A;  3RJV A;  3LEW A;  4GPM A;  4XIF A;  3UX4 A;  3I4G A;  1GW6 A;  3UMV A;  2WQH A;  3HIZ A;  3CST A;  1HX8 A;  2RD0 A;  4JEH A;  5FTP A;  4K0R A;  5FQ6 A;  1EF1 C;  5ANL A;  3CVN A;  5BT1 A;  3ZFW A;  2L6J A;  1EPU A;  2ZXW E;  2IO3 C;  4U8Y D;  2DYR E;  3QWW A;  4AXH A;  2WQ7 A;  2IO2 C;  3DRA A;  4EZL A;  4HI8 A;  5AIJ A;  4G26 A;  2P58 C;  3ASO E;  2GW1 A;  5BUZ A;  2NC9 A;  1NFI E;  4G24 A;  1RW2 A;  2IY0 C;  3ASN E;  4C0M A;  1UN8 A;  4HFG A;  4FU3 A;  1N94 A;  4HOR A;  3UIN C;  2VGX A;  2V0P A;  4UQX A;  1H19 A;  1QQE A;  3D9M A;  3L54 A;  1MYO A;  3RRN B;  2PNN A;  5J90 A;  2GRR B;  3APF A;  5KNH D;  4FHK A;  3PDN A;  1B89 A;  5LCW C;  3LVQ E;  5CBO A;  2VYI A;  4YND A;  4BTA A;  3VLD A;  3DSV A;  5KBA A;  4TXR A;  1QNF A;  3CHP A;  3ONK A;  2WXP A;  1YMP A;  2Y4U A;  2XZD G;  5CBN A;  3KEA A;  3C98 A;  3UXG A;  4XKC A;  3MZL B;  4A55 A;  4ABN A;  3UUX A;  3R9A B;  3U64 A;  1HZ4 A;  3MEK A;  4L1B A;  1IXV A;  4KYO B;  1IQU A;  1JPL A;  3QNK A;  3FP3 A;  4U96 D;  4WND A;  3QK0 A;  2EIK E;  4CT4 A;  3LJN A;  4HOQ A;  1SZA A;  1H6O A;  4U0Z A;  3T8K A;  4DX1 A;  5B3S E;  3FUM A;  3MCX A;  4C48 B;  3HG0 D;  4BT8 A;  4FP7 A;  3PZ4 A;  1PY1 A;  2XS8 A;  1ZU2 A;  5FWQ A;  2LSU A;  5B1B E;  4BSZ B;  4F7A A;  2F8Y A;  3TWW A;  3UT4 A;  4G8L A;  2CHZ A;  2FUL A;  5EN5 D;  5AQA A;  2OND A;  3D9N A;  3ML8 A;  2J09 A;  4GZ6 A;  2V4H C;  4XX5 A;  2Y69 E;  2ZIR A;  1BI7 B;  4Y6W A;  1ZBP A;  3KAE A;  1TEZ A;  2A4Z A;  3Q7A A;  3GYZ A;  4N2S A;  3RO3 A;  1HO8 A;  1DCQ A;  1KLX A;  2J08 A;  3J5Q B;  2GRM A;  3Q9U C;  2FBN A;  4JHK A;  5LOZ A;  1W3B A;  4HRM B;  2MYO A;  4I2W A;  1OCR E;  3PUJ A;  3KEZ A;  3ONL A;  1SVX A;  1QBQ A;  1OY3 D;  4A63 B;  1E90 A;  5ENO D;  3I3N A;  4RLY A;  4YDE A;  3PRE A;  3ZYQ A;  4MBG A;  2I6H A;  1LTX A;  2KBX A;  1JCS A;  5ARG A;  4AY6 A;  1E8W A;  3AS4 A;  2QY7 A;  3FUF A;  4P29 A;  3FEX A;  4AVX A;  4TUU A;  1OXJ A;  3NOC D;  5T3R A;  4EZK A;  5LX8 A;  3B13 A;  4MS6 A;  4G23 A;  2DVW A;  1BD8 A;  5FJY A;  2WXN A;  3EHQ A;  2Y0B G;  3SHF A;  2C0L A;  1X5B A;  3EHM A;  4B8A A;  3U4T A;  2CHX A;  2WMO A;  2P9L G;  4F1S A;  2QC9 A;  4BSX A;  3PZD A;  2OVB A;  2A5E A;  3D9H A;  1N0Q A;  4GMJ A;  3AJI A;  2J4B A;  2B0O E;  4M7C A;  4TXQ A;  2J8S D;  3RSE G;  3IHV A;  4AP2 A;  4UWK A;  5EIB E;  3HXE A;  1G3N B;  3Q47 B;  4OAU C;  1HG2 A;  2EIJ E;  3KSQ A;  3CVP A;  3HXC A;  2L9B A;  5ARF A;  4L7T A;  4JEU A;  2BKG A;  3RRU A;  3CIA A;  3O48 A;  3OXG A;  5FQ4 A;  3Q73 A;  2EQX A;  1A17 A;  3CVV A;  2EIM E;  2FO7 A;  1D9S A;  2VSY A;  3D3M A;  3ASG A;  3E30 A;  5CMW A;  2WVI A;  4FUL A;  2A5U A;  3WXX A;  4BFR A;  1KT1 A;  4ATG A;  4W9R A;  3QAQ A;  4AOF A;  3FTU A;  4KVO A;  1TN7 A;  3TG4 A;  4A3V A;  3DBS A;  3EDT B;  3D9J A;  2LAI A;  3ZYK A;  3CVX A;  1O1S A;  3FU6 A;  3QB2 A;  3L16 A;  3NAW A;  5KJM A;  3E4B A;  2RG8 A;  4IN3 B;  1FCH A;  3ZW3 A;  4B0Z A;  1MX6 A;  2HE0 A;  1A5E A;  3VTX A;  4AY5 A;  3MV3 B;  5AJD A;  2VGY A;  2YNQ A;  5FZQ A;  3ZXP A;  2WXQ A;  2R05 A;  1OCC E;  3FU5 A;  2E0I A;  1H2V C;  1DC2 A;  3G2U A;  3S7F A;  4EZJ A;  1Q2Z A;  4E6H A;  3E32 A;  2WXI A;  3Q78 A;  4U04 A;  5A7D B;  1UN9 A;  5KJN A;  3PVL A;  1H6K A;  2DIW A;  3B7R L;  4LCT A;  2ZGG A;  3RK6 A;  2PQR A;  3E33 A;  1MZC A;  3TXN A;  2YIN A;  1TN8 A;  4L9P A;  4APO A;  4EEC A;  4KT6 B;  5CHE E;  2OEW A;  2KAT A;  1E8Z A;  3JQ0 A;  5AAO A;  3PE3 A;  3TGO A;  2LO6 A;  3CK8 A;  3ABL E;  4RVB A;  1N0R A;  1MX4 A;  5M72 A;  2V5Q C;  3PNL B;  2X38 A;  3L13 A;  2DZO A;  2XRY A;  2PM6 A;  4N3A A;  2X6H A;  3HYM B;  4O60 A;  3FUH A;  2WXG A;  3FUD A;  3AG2 E;  3CHR A;  3PUK A;  3CQC B;  2IQC A;  4GTS A;  4K03 A;  3ABM E;  2OV8 A;  4B8C B;  4OVV A;  1FT1 A;  1FVH A;  4KVM A;  2GGF A;  3G2V A;  3EU5 A;  3PNT B;  2QFC A;  5FT9 A;  3ZN3 A;  2GRO B;  3LY9 A;  3JXI A;  2V8S E;  2AXZ A;  1INZ A;  3DSS A;  3FH7 A;  3ZUV B;  3UTM A;  3ULE G;  4J8D A;  3O4Z A;  4UI9 K;  4PH4 B;  2UY1 B;  3CV0 A;  4L2Y A;  1OT8 A;  3SF4 A;  4GCN A;  4JB8 P;  4RG9 A;  4AEZ C;  1PC2 A;  4GTQ A;  3EIJ A;  4GTV A;  4JA9 A;  2KC7 A;  4KZC A;  4QQI A;  3R9M A;  2WXM A;  4HI9 A;  4ZHB A;  1HS6 A;  1RZ4 A;  4EPZ A;  3UM0 A;  1TNB A;  4AIF A;  3QWP A;  3L82 A;  3DEP A;  3UM3 A;  2NSZ A;  2P9I G;  3IXE A;  2XCB A;  1MHQ A;  1PAQ A;  5CCM A;  4UWF A;  3SFZ A;  1Y8M A;  1NA3 A;  2WXK A;  3CLJ A;  1UOH A;  1UW4 B;  3RKV A;  3S7B A;  2XS1 A;  5JJ6 A;  2VSN A;  3Q79 A;  5CMY A;  3AU5 A;  3LJ3 A;  3FTZ A;  4BX8 A;  4HNA D;  4BWR A;  3GZ1 A;  5CED B;  2LUH A;  3L22 A;  5JJ7 A;  5KWD A;  3UI2 A;  5T8I A;  3V2X A;  5AQB A;  3OAW A;  4NAC A;  4X8Q A;  2WMN A;  2XPI A;  3BUA A;  3DEO A;  2IJG X;  4JA7 A;  1U3C A;  1MX2 A;  4LNG A;  1JCR A;  3CHO A;  4C0E A;  2GRL A;  3TWS A;  1HFA A;  4WWP A;  3HVE A;  3CKB A;  3NZS A;  1IQR A;  1K3Z D;  3DSX A;  3S2A A;  4A1G A;  4TRQ A;  5DIZ A;  1NP7 A;  2VTB B;  2R59 A;  3ESK A;  4G25 A;  4CCA A;  5AEN A;  4PUC A;  3B7T A;  1TYQ G;  3SD5 A;  3ZU7 B;  3TWT A;  4UI9 J;  2H6I A;  4LEU A;  5HS0 A;  4GPK A;  2EIL E;  4HB5 A;  4FLH A;  3APD A;  3TWR A;  4HS2 A;  5CRU A;  4AM9 A;  4GZD A;  4HOT A;  4PS8 A;  5KJL A;  3E37 A;  4I2Z A;  2WXJ A;  3B95 A;  3RU0 A;  3V30 A;  5CEC B;  2WXH A;  5AAR A;  3FH8 A;  4Q94 A;  5AQ9 A;  4HXI A;  4YDW A;  3CHM A;  1K1B A;  4CZ2 D;  3ZVV A;  5G04 C;  5FZS A;  4F1P A;  3UM1 A;  1SA4 A;  4A3T A;  3CHQ A;  4GZ5 A;  4BTB A;  3QOU A;  2RKK A;  3B7U X;  1IHB A;  5EYP F;  5HRY A;  1N4P A;  3FUE A;  2P9N G;  4N5C A;  4OYS A;  2Y1L E;  4ANW A;  2R5S A;  3MJW A;  3T9K A;  3PZ3 A;  2VQ2 A;  5H7P A;  2WM9 A;  4GU5 A;  3U66 A;  5FQ8 A;  1DCE A;  1S70 B;  4J6I A;  4WWN A;  2P2C P;  3VLF A;  4IYP A;  2XHE A;  3AS8 A;  3B7B A;  1WG0 A;  3S7D A;  3LPZ A;  1S63 A;  4KXK B;  2R17 C;  4FLB A;  4J0U A;  4TXP A;  4GZC A;  4O1P A;  1XNF A;  1WAO 1;  3ML9 A;  3RRM B;  2CFU A;  1WDY A;  1DNP A;  5J08 A;  3J5P A;  4RG6 A;  3W9G A;  2L0T B;  2ZIS A;  2ETA A;  1IKN D;  3SNX A;  5EX3 A;  4GYO A;  3LYA A;  3UM2 A;  5ITZ F;  1V55 E;  4LER A;  3K9I A;  1X81 A;  3FTS A;  5G04 J;  5G05 J;  5AN8 A;  2AWI A;  3SO8 A;  2H6H A;  3QAR A;  3Q7F A;  4DUI A;  1WM5 A;  3ZEF A;  3AG1 E;  2VJ8 A;  2NYJ A;  4YDO A;  2PL2 A;  2ILR A;  2R02 A;  4LNU D;  3KD7 A;  2FEZ A;  5LFA A;  3SZ7 A;  3FUL A;  3URZ A;  2X6F A;  3TJP A;  4DRX E;  4EHM A;  1N4Q A;  2AXV A;  4GTM A;  5EDS A;  1TJC A;  3OTN A;  4UUC A;  1L5J A;  3FUK A;  4LNB A;  3C5R A;  2BED A;  2WPV A;  4N3B A;  3AAA C;  3L9T A;  3E34 A;  4V3I A;  5HKP A;  4AV7 A;  3CSF A;  1Z3X A;  4F3V A;  4UI9 C;  4BT9 A;  4F6R D;  1H0A A;  1NL4 A;  2B6C A;  2MRI A;  2OOE A;  5JHB A;  3G2S A;  4GML A;  2CFZ A;  4BEP A;  3ENE A;  3TWQ A;  4DX2 A;  2I9C A;  4M3O A;  3JUI A;  4HBD A;  3FHE A;  1MQS A;  3BQO A;  4GA1 A;  4ANX A;  2J9Q A;  3QDN A;  4O1O A;  1TNY A;  2MHK A;  3CVW A;  4J8F A;  5D66 A;  3Q75 A;  5BPP A;  2VSX E;  1OUV A;  1EYH A;  3QKY A;  2UWJ G;  3TWV A;  3IV0 A;  2KCK A;  4U95 D;  4GYW A;  3APC A;  5KNG A;  3TL5 A;  3UPV A;  2E2E A;  2LSV A;  5JJT A;  3SQV A;  2V5F A;  1E96 B;  4TV3 A;  1D8E A;  1SW6 A;  5T4Y A;  5ENS D;  2IEJ A;  3SBS A;  4XKB A;  1BPO A;  2BKK B;  3PRZ A;  4CYM D;  4WWO A;  4NQ0 A;  1MJ0 A;  1N95 A;  4J8E A;  2XGS A;  1JWG A;  3R7R A;  3EJN A;  5D0Q D;  3PH0 C;  1YA0 A;  3CVQ A;  2IF4 A;  4WNG A;  4BES A;  4JXT A;  3JUE A;  4I9C A;  4I6G A;  1FVF A;  2EIN E;  2P9S G;  1ZB1 A;  2VGX B;  3UT8 A;  4GA2 A;  4N2Q A;  1TNO A;  3ZHE A;  4I1O B;  3ZGQ A;  3EHN A;  3DPY A;  1IYG A;  3UIP C;  1ELR A;  1SA5 A;  2Y3A A;  1OWP A;  3UIO C;  3I4R B;  5FIO A;  3FTW A;  3D9P A;  2PZI A;  4JHJ A;  2X6J A;  2DZN A;  1S64 A;  3ABK E;  4NRH B;  4K5C A;  2DYS E;  4J8Y A;  4K5A B;  4BER A;  1N4S A;  4HQD A;  1TNZ A;  2LAH A;  5E75 A;  3IHY A;  2KCL A;  4UWH A;  3JCK C;  4C9B B;  3FTY A;  3LVR E;  2ETB A;  2ZGD A;  3CHS A;  2X6I A;  5EIL A;  3ISM C;  1KPS B;  4Q96 A;  2AW6 A;  1N52 A;  5IY5 E;  2I2O A;  3MKR A;  4L23 A;  4Z68 A;  5G55 A;  3ZRH A;  1LD7 A;  2GRQ B;  5G2N A;  5CCL A;  3HDX A;  3LCA A;  4HLE A;  3VTY A;  3RIB A;  2F8X K;  1AP7 A;  3EUV A;  4FC8 A;  1XGW A;  5DBK A;  3SGH A;  1ELK A;  3MYV A;  2WXR A;  2LXM A;  4DJA A;  2ION A;  1UG3 A;  3JYS A;  5LCW J;  4WAF A;  2J07 A;  1AWC B;  3OXL A;  2KCV A;  3U9W A;  4CEM A;  3DSW A;  3FDH A;  3LKU A;  3AS5 A;  1NZN A;  3UKR G;  2LNI A;  3MA5 A;  2WQ6 A;  3D9L A;  5ANR A;  4XI9 A;  1E8X A;  2C0M A;  2H6F A;  3D9O A;  1SZ9 A;  4NUR A;  4K5B A;  2CG2 A;  4GZ3 A;  3FTV A;  4OVU A;  4I6J A;  3T5V A;  2IOL A;  1O1T A;  4PDX A;  5FIN A;  2RFA A;  4R7L A;  4B89 A;  1YYH A;  4Y6C A;  4A1S A;  3DSU A;  3LS8 A;  3V31 A;  1N9A A;  3SBT B;  2WB2 A;  3KSL A;  3CR3 A;  2F37 A;  4IRU A;  4N39 A;  4Q69 A;  4U7E B;  4JZY A;  2FF4 A;  4UWG A;  5FZR A;  1O5M A;  4L2L A;  4LG6 A;  2WXF A;  3BEE A;  1KT0 A;  2OCC E;  4YVO A;  1O1R A;  4I6E A;  3ULQ A;  4D10 C;  1P5Q A;  2I1K A;  4BY6 A;  4BX9 A;  4JC8 A;  1TN6 A;  3TWX A;  5KJK A;  2Y4T A;  3UKU G;  3CVU A;  1S0P A;  4FAD A;  3IKO B;  3HHM A;  3Q49 B;  5ENP D;  4G11 A;  3FU3 A;  3Q9N C;  2FI7 A;  4E85 A;  3FU0 A;  1HE8 A;  3CVY A;  1ELW A;  1Z5S C;  3PEU B;  5EYL A;  3R7Q A;  2JEK A;  3EIQ C;  1IHG A;  1HH8 A;  1UJK A;  3CEQ A;  2XZT G;  3MGB A;  4MKT A;  4ANV A;  5EX0 A;  4ME2 A;  1SQM A;  2VSO E;  2BF0 X;  3EU9 A;  4JL0 A;  3MX3 A;  3ZXS A;  3G2W A;  1QYM A;  3LY8 A;  3T5X A;  5ENT D;  4JW1 A;  2C2L A;  3QWV A;  3BG1 B;  3WG7 E;  5JMN D;  4PS7 A;  2UY1 A;  3HXF A;  2X6K A;  2PM7 A;  4CRW A;  5C2Y A;  4DI3 A;  2NXP A;  4I1M A;  2IU1 A;  2HYZ A;  3BU8 A;  3UQ3 A;  3LXU X;  2PQN A;  2GRN B;  3LDZ A;  4JVS A;  2L0I A;  3IEG A;  3PZ1 A;  3ZNG A;  1OCZ E;  5CEA A;  3VLE A;  3PE4 A;  4FA6 A;  4LUN U;  3MKQ B;  1UJJ A;  3ASF A;  3HXD A;  5AYW D;  3L6A A;  3GW4 A;  4APF A;  3PS6 A;  1JWF A;  3PZ2 A;  4GTP A; 
#chains in the Genus database with same CATH homology
 3NOG D;  4RLY A;  1IKN D;  2V5Q C;  1BI8 B;  2XEN A;  4HRN A;  4U96 D;  5HS0 A;  3DEP A;  4O1O A;  4HB5 A;  4HI8 A;  3TWR A;  4GMR A;  2DZO A;  2KBX A;  5ITZ F;  5FIO A;  3LJN A;  4DX6 D;  5D66 A;  1NFI E;  5ENQ D;  3IXE A;  2JAB A;  3B95 A;  3EHR A;  4O60 A;  4TUM A;  3V30 A;  2DZN A;  2XZT G;  3T8K A;  4DX1 A;  4K5B A;  5CEC B;  5ENR D;  5BXU A;  5AN8 A;  4C48 B;  3HG0 D;  3SO8 A;  5AAR A;  1UOH A;  2XEH A;  3NOC D;  5JA4 D;  3TWV A;  5AQ9 A;  4U95 D;  3V79 K;  2QYJ A;  4K5C A;  3EU9 A;  3W9F A;  2DVW A;  5KNG A;  1BD8 A;  1QYM A;  4J8Y A;  4YDW A;  5ENT D;  4DUI A;  4N5Q A;  1K1B A;  4HLL A;  4K5A B;  5FIN A;  2NYJ A;  2RFA A;  4BSZ B;  4CZ2 D;  4BER A;  4HQD A;  2ETC A;  2F8Y A;  3EHQ A;  2Y0B G;  4F1P A;  4YDY A;  1YYH A;  1MX6 A;  5JMN D;  1MYO A;  2HE0 A;  3TWW A;  2PNN A;  1A5E A;  3V31 A;  4ATZ D;  4HNA D;  4LNU D;  1N11 A;  5KNH D;  4G8L A;  4DX5 D;  2ETB A;  2ZGD A;  5CED B;  5EN5 D;  5AQA A;  2QC9 A;  1IHB A;  1SW6 A;  4B93 B;  5EYP F;  4OAV B;  4LSZ E;  3UI2 A;  5EIL A;  4HRL A;  5HRY A;  5ENS D;  5KWD A;  2F37 A;  4NIK A;  4DRX E;  2A5E A;  4DX7 D;  3D9H A;  1N0Q A;  3AJI A;  3JXI A;  3HRA A;  2B0O E;  2V4H C;  3V2X A;  5AQB A;  5CBO A;  2Y1L E;  2AJA A;  1DC2 A;  2J8S D;  2KXP C;  4LG6 A;  4UUC A;  1BU9 A;  3T9K A;  3DEO A;  3JXJ A;  1BI7 B;  3TWU A;  2BKK B;  3C5R A;  5EIB E;  5KBA A;  4Z68 A;  1G3N B;  1MX2 A;  4CYM D;  4OAU C;  3AAA C;  1MJ0 A;  3ZUV B;  2RFM A;  5AQ7 A;  5HKP A;  3UTM A;  1K1A A;  5EID A;  3ZKJ A;  4GPM A;  3NBN B;  1S70 B;  3ZNG A;  1YMP A;  2XEE A;  1DCQ A;  2P2C P;  3V2O A;  2XZD G;  3TWX A;  3F6Q A;  3TWS A;  1OT8 A;  3J5Q B;  4F6R D;  5CBN A;  5CEA A;  3B7B A;  2F8X K;  1AP7 A;  1WG0 A;  2ZGG A;  3KEA A;  4J7W A;  2DWZ A;  2BKG A;  4BET A;  4QFV A;  4BES A;  3UXG A;  4JB8 P;  2VGE A;  3Q9U C;  3JUE A;  5CER B;  1K3Z D;  1BLX B;  1TR4 A;  4HRM B;  2MYO A;  5ENP D;  1D9S A;  4O1P A;  5AAO A;  4ZFH A;  2L6B A;  3Q9N C;  1AWC B;  1SVX A;  4BEP A;  1IXV A;  4QQI A;  1OY3 D;  3TWQ A;  4U8V D;  4A63 B;  1WDY A;  4G8K A;  2FO1 E;  5BXO A;  4U8Y D;  4DX2 A;  4HI9 A;  1N0R A;  5EYL A;  1MX4 A;  3J5P A;  3W9G A;  4HBD A;  5ENO D;  3TWT A;  3ZU7 B;  4ZHB A;  1YCS B;  2ETA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...