2RFAA

Crystal structure of the mouse trpv6 ankyrin repeat domain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
222
structure length
222
Chain Sequence
IWESPLLLAAKENDVQALSKLLKFEGCEVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATGSVFHYRPHNLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title Structural analyses of the ankyrin repeat domain of TRPV6 and related TRPV ion channels.
pubmed doi rcsb
source organism Mus musculus
total genus 78
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2rfaA00
3DEOA 4HRNA 5EILA 3W9FA 5ENRD 4O60A 1YYHA 3V2XA 4DUIA 2ZGGA 3IXEA 5EYLA 4O1PA 4HNAD 4QFVA 4J8YA 4TUMA 4F6RD 5D66A 3HRAA 4N5QA 3TWUA 1A5EA 4CZ2D 1S70B 3J5PA 2KBXA 3Q9UC 2V5QC 4BEPA 2AJAA 2B0OE 2ETAA 3J5QB 4U8VD 5ITZF 4CYMD 3V31A 5HKPA 4JB8P 4F1PA 5CBNA 3DEPA 5EYPF 2Y1LE 1MX2A 2RFMA 4RLYA 5AQ9A 3TWXA 1MX4A 2DWZA 2ETCA 2HE0A 3NOCD 3T8KA 3ZNGA 3TWSA 5HRYA 4YDWA 5FIOA 3F6QA 5AQAA 1AWCB 5AQ7A 1OY3D 1IXVA 1YMPA 4LNUD 4ATZD 1QYMA 2A5EA 2XENA 1DC2A 3JXIA 3C5RA 1DCQA 4U96D 3AJIA 4HBDA 1YCSB 3W9GA 1K3ZD 3KEAA 4DX2A 4U8YD 3JUEA 2F8XK 1K1BA 1BLXB 2KXPC 4DRXE 5AQBA 2JABA 3LJNA 1UOHA 4HI9A 3V30A 4LG6A 5ENOD 5CERB 2BKKB 3B7BA 3B95A 5EIDA 4HQDA 5EN5D 2F37A 3UTMA 4OAUC 2P2CP 3D9HA 1OT8A 3TWRA 5AN8A 2F8YA 1AP7A 1SVXA 1D9SA 5CEDB 5CBOA 4Z68A 5KNHD 5BXUA 2DZOA 4NIKA 5AARA 1WDYA 4ZHBA 5BXOA 3Q9NC 1NFIE 4GMRA 3V79K 2DVWA 1N0QA 1N11A 4OAVB 4LSZE 4QQIA 1TR4A 5JMND 2J8SD 3TWWA 4BSZB 3JXJA 3EHRA 3T9KA 1SW6A 2ETBA 2BKGA 4DX1A 2NYJA 4UUCA 2DZNA 2XZDG 4J7WA 4GPMA 3ZUVB 4DX5D 1MYOA 4DX7D 4O1OA 5ENQD 3SO8A 1K1AA 2V4HC 5ENSD 2FO1E 1MX6A 2XZTG 4HRLA 2QC9A 4K5AB 3ZU7B 3NBNB 3EU9A 5HS0A 5FINA 4HLLA 4B93B 5KWDA 4C48B 5ENPD 1G3NB 4K5CA 1MJ0A 4G8KA 2RFAA 3V2OA 3AAAC 2QYJA 5CEAA 3HG0D 1IHBA 4DX6D 3TWQA 2ZGDA 1N0RA 2XEHA 4K5BA 2VGEA 3TWVA 4ZFHA 1WG0A 1BU9A 4YDYA 4BETA 5CECB 5ENTD 5EIBE 2MYOA 4HB5A 4HRMB 2PNNA 5JA4D 4G8LA 4BERA 4A63B 3UXGA 3ZKJA 3UI2A 4HI8A 4U95D 4BESA 3TWTA 1BI8B 1BD8A 3EHQA 2Y0BG 2L6BA 5KNGA 2XEEA 5KBAA 3NOGD 1BI7B 1IKND 5AAOA
chains in the Genus database with same CATH superfamily
4H7YA 4DUIA 4ANWA 2V8SE 3ESKA 1PY1A 2ZISA 3PEVB 1TN6A 1ZB1A 4L2YA 2AJAA 4I6EA 3UT8A 2I1JA 2CHZA 3FUDA 5HRYA 4J8SA 2IEJA 1YMPA 1IXVA 1JUQA 3S7BA 3PEUB 2XCBA 3DSSA 1SQMA 3MKQA 1NL4A 4YNDA 4DLOA 1BLXB 1JPLA 1E8XA 3O48A 5EIDA 5G2NA 3JYSA 4TUUA 4JEHA 4JA9A 2I2OA 3TWRA 4HVBA 1N4RA 3AU4A 1Y6IA 3CSFA 1N0QA 3PH0C 3CV0A 2CG2A 2H6IA 1TJCA 1H2UA 3FTSA 3UM2A 3GW4A 2XZTG 4HRLA 2QY7A 3ONKA 4GAAA 5FINA 2J08A 4U0SA 3TG4A 5A6CA 4CT0A 2RFAA 3V2OA 1OWPA 5CCMA 4RVBA 2FO7A 3GZ2A 1WG0A 4FJZA 3ZXPA 4CGWA 4C0MA 3ENEA 5ARGA 3UIPC 5FQ7A 4KBQA 3UI2A 3ULYA 4HXIA 3EUVA 3MX3A 4BY6A 2WXPA 4K03A 3DEOA 2GRNB 2Y3AA 3AS4A 1FVHA 5EYLA 4A55A 4QFVA 1E90A 4J8YA 4N5QA 4YDOA 3FH5A 2C0LA 2J9QA 4AY6A 2R5SA 2B0OE 4G11A 5FWQA 1X5BA 2WXQA 4JB8P 4CGVA 4GB9A 1H6PA 1JCSA 1TNBA 5FIOA 4UI9K 3LS8A 4KZCA 1O5MA 3S7JA 5C2YA 2Y4UA 1TNZA 3HVEB 2P9IG 2IY0C 5CHEE 1NZNA 3LYAA 2L0TB 4ABNA 4CRWA 3D9HA 3Q49B 3X2QE 1RZ4A 4KYOB 5CBOA 5AARA 5BXOA 2BTDA 5LFAA 2LSVA 4XEIG 3CKCA 3EIQC 3APCA 4GTRA 3SO8A 1LTXA 2ZXWE 3QAQA 2WXHA 3E34A 4C48B 3LVRE 4K5CA 5G04C 1EPUA 3CGHA 3C3QA 4HOQA 1OCOE 3D9LA 2FULA 5LOZA 4BETA 4HRMB 5JJ6A 3FY4A 4KVMA 3FFLA 2X6HA 3HXEA 4N3CA 3FEXA 4DI3A 3MA5A 1YYHA 4BX8A 2VGXB 1ELRA 5BV0A 2WXIA 3KD7A 4BEPA 3Q47B 3VTYA 4N3BA 3NAWA 4XKBA 2PQRA 4GA2A 1OY3D 2VQ2A 2LAIA 3E30A 1O1SA 2WVIA 3HDXA 2JABA 2QFCA 4HI9A 3V30A 4IYPA 2RD0A 4FP7A 4HOUA 2XS8A 2J4BA 4JC8A 1WDYA 4OAVB 2A5UA 3ML9A 2XZDG 4J7WA 4M7CA 3Q78A 2CG3A 3JUIA 4ACKA 2GRRB 1MX6A 3Q79A 3NBNB 3QARA 2V5FA 3RU0A 2HYZA 3CQCB 3ZYMA 1HH8A 2ZGDA 5AYWD 2LAHA 4B8CB 2VGEA 4JPSA 3RAUA 5ENTD 4UQYA 2KZTB 2XHEA 5AAOA 3T5VA 5ENRD 4IN3B 2P9SG 4ACLA 2C2LA 3S2AA 2VYIA 2XGSA 4CDMA 4ME2A 3L54A 1Z3XA 5EYPF 4FHJA 3CHQA 2M63A 5HI7A 4UI9C 1HG2A 1L5JA 3C3OA 4ANUA 1K1BA 1UOHA 2H6FA 4HLEA 4WWNA 4GZCA 3UPVA 5BXUA 1UJKA 1N94A 4CEMA 3FUNA 5KJKA 2EIJE 2DVWA 3G2SA 5B1BE 4UUCA 4DX7D 5EX3A 4AV7A 5JJTA 1N9AA 4P29A 1TNYA 2R59A 4J8FA 5BUZA 1NP7A 3ESLA 1SZAA 5E75A 4JZYA 3G2VA 2GRQB 3L6AA 4EECA 2XRZA 2WPVA 1Z6TA 4GZ5A 2GRPB 5CMWA 2I9CA 3EJNA 1E8ZA 5A7DB 2R02A 1A17A 3MJWA 2OOEA 2XEVA 3IXEA 5LCWJ 2V4LA 5FJYA 3HRAA 5T4YA 3KSQA 1LF8A 2WXLA 4PS8A 3SGHA 4CYMD 3DEPA 4I9EA 1WAO1 2J07A 4F1SA 2AXVA 4RSYA 1IQUA 3FUKA 3FH7A 1XGWA 4IRUA 4U8YD 4KZ0A 1JWFA 3CVLA 1H19A 4U04A 2DIWA 4B89A 1LD8A 2WXOA 2YQ8A 3FU3A 2LNIA 3CVXA 2LO6A 3IBEA 5G55A 4LEUA 3UM3A 2YNQA 1D9SA 1N4PA 2PQNA 4NRHB 4ZHBA 3D9PA 4I6GA 2IO3C 3V79K 5JMND 4AXHA 3OXFA 4NQ0A 1TNUA 1N52A 5ENPD 3HG0D 1IHBA 2R05A 5FQ6A 3UM1A 1BU9A 2WQHA 3ASFA 3PZ4A 4DPRA 4A3TA 4CDRA 2KCLA 3Q4AB 3BUAA 2PL2A 4PUCA 4CT4A 4JD2G 4JHKA 2P58C 4DLQA 2WXRA 4O60A 2XQ0A 3V2XA 1KPSB 1FPPA 5FQ4A 3PZDA 1A5EA 1S70B 3J5PA 1SA5A 3NZSA 3AG1E 1JCRA 4Q96A 1D8DA 4F1PA 1RW2A 2ETCA 3SBTB 5AQAA 4D10C 3OXLA 3MV2B 5KJMA 4GU5A 3FUIA 2F8XK 2EIKE 4PS7A 2NXPA 4TXRA 3L16A 4XZ4A 2WMNA 3U9WA 1SVXA 5AENA 4WNDA 2KM4A 3L22A 4GZ3A 3PE3A 4N5CA 3E4BA 3TL5A 1EF1C 4GPMA 3ZUVB 2JEKA 2AWIA 3MCXA 4HLLA 2L0IA 3BG1B 2X6IA 5BV1A 4J8EA 4EZLA 3IHYA 1N0RA 5EKQD 3D9NA 5EIBE 1DVPA 1ELWA 4U95D 1QZ2A 3RKVA 2AXUA 2CHWA 1Z5SC 4TXPA 4YDEA 5ENQD 1HE8A 1O1RA 3RO2A 3CVUA 3JQ1A 4JXTA 4CCAA 4O1PA 2IO2C 4HNAD 1S64A 2KBXA 4GYOA 4HFGA 4GTOA 3R9MA 3HVEA 4WNGA 4WNEA 5CBNA 1MX2A 3SZ7A 3MGBA 3VTXA 4UWLA 4GTTA 3JCKC 2LXMA 4ILGA 1QQEA 1IQRA 3QKYA 4KXKB 4MKTA 3SHFA 4RG6A 4B94A 2OVBA 3GZSA 1QNFA 1OT8A 3B7SA 5ARFA 5H7PA 2DZOA 2Y69E 2EIME 5D0OD 2EINE 1TR4A 3LJ3A 4A1GA 1MYOA 3RRMB 3SFYA 3EU5A 4Y6CA 1HXIA 1KLXA 3ZYQA 3AS8A 4UWHA 1FT1A 4C9BB 2I6HA 4OVUA 1JWGA 3TWQA 4LUNU 5T8IA 3CVVA 4R7LA 2KCVA 2VGXA 3JQ0A 3ULQA 1FCHA 3CKBA 4G8LA 1EYHA 4EBAG 4YVOA 3LXUX 5KBAA 3FP3A 3S7DA 3U3WA 1N4QA 4O6FA 2VSNA 4LNGA 4G24A 1HG5A 4GA0A 5J90A 1N4SA 4DI4A 3FTXA 5D66A 5FT9A 4I43A 1OXJA 2J09A 1VDYA 3ZRHA 3D9JA 2RFMA 4EZJA 3I4RB 3TAXA 3QWVA 2V0PA 3KSLA 4TXQA 3G2WA 1QYMA 3ZW3A 2XENA 5FTPA 3CHPA 4HOTA 3L82A 2J4DA 2VSOE 2A4ZA 2R2LA 1OWNA 3PZ1A 1INZA 2AW6A 3RRNB 3QWWA 4FLHA 1B89A 2KCKA 3DXKG 5CRVA 4FHKA 3UM0A 3RO3A 3NB2A 1KZOA 3UMVA 4H7XA 2EILE 3T9KA 3UINC 1SW6A 4MLPA 3ZVVA 1NA0A 3CHSA 2X38A 5B3SE 3I4GA 1N95A 2E0IA 1K1AA 4WAFA 2FO1E 4B8AA 3UUXA 3E37A 2NC9A 3PUJA 2KZTA 4BT9A 3ABLE 4X8QA 2BUGA 1OWLA 3OAWA 1UN9A 3EDTB 3DSXA 3NZUA 3UT4A 4DX6D 3CHOA 1TN7A 1JCQA 3MZLB 1OCZE 3Q73A 4JW1A 4N39A 5ANRA 3T5XA 3ASGA 2GGFA 3CHRA 4BESA 2PM7A 1BI8B 3DSTA 1W3BA 3E33A 4AY5A 5HKPA 3ML8A 3R7RA 3SD5A 3HXCA 4AP2A 4TUMA 4JA7A 4W9RA 3RK6A 3FUJA 5AJDA 4EPZA 2IONA 2DBAA 4U8VD 3V31A 4E6HA 3FUMA 4YDWA 3Q7AA 4ATZD 2HR2A 2MOWA 3IHVA 4GYYA 3FH8A 1WM5A 1K3ZD 1HX8A 2FF4A 3FDHA 1N54A 5CERB 2FBNA 3LKUA 4MBGA 3EHMA 2AXZA 4KMOA 4AM9A 2J49A 4GCOA 3Q5MA 5CEDB 1Z3YA 1IHGA 1UW4B 4JHJA 1O1TA 3APDA 3DSUA 5AIJA 4FA6A 2BKGA 4I2ZA 4DX5D 2R03A 4JVSA 1DNPA 3CVQA 3D9MA 3FTZA 4FADA 3MKRA 1XNFA 2YINA 2QZAA 3ZGQA 3D9KA 1YA0A 1E8YA 3SBSA 3ZPJA 2CHXA 2PNNA 4Y6WA 3CK9A 4LCTA 4HI8A 2P9NG 4N3AA 2XRYA 5KJLA 3DXMG 1H2TC 1OWOA 1BI7B 3ONLA 4HRNA 3QOUA 4A1SA 4BFRA 3HHMA 3TJPA 1H0AA 3SY2A 1EDUA 3B7RL 2B6CA 2XCCA 4XX5A 5KCMA 1SA4A 3AS5A 4HBDA 3PZ3A 2ZIRA 4U7EB 4DX2A 3JUEA 2KXPC 4K0RA 3CEQA 4OAUC 2R17C 4MS6A 3PNLB 5LP0A 1AP7A 2YHCA 2ILRA 4Z68A 3S7FA 5DIZA 1LD7A 3DWLG 3GZ1A 3WG7E 4ILIA 4AJWA 2VGYA 3KAEA 1H6KA 3VLEA 4K5AB 3ASDA 2IU1A 5HS0A 4WNFA 3D9OA 1MQSA 2IOSA 2UWJG 2CFZA 3L17A 2LSUA 5LCWC 5LX8A 1GW6A 5ENNA 4XKCA 2Y4TA 3ZKJA 1ZU2A 3ABKE 1BD8A 2Q7FA 3EHQA 4MRUA 2XGOA 4F3VA 3ZN3A 3URZA 4U07A 1Q2ZA 3R9AB 2X3MA 2UY1B 3TWUA 4DJAA 2ETAA 2QYUA 2RG8A 2YHEA 4ANVA 2IQCA 3TWXA 3DRAA 2DWZA 3FU6A 4I1OB 1H2VC 3C5RA 3I3NA 1E96B 2BEDA 3Q75A 1X81A 4DRXE 3CHMA 1KT1A 3SFXA 4EZKA 4GCNA 4LG6A 2DCPA 5D2MC 2F37A 3GYZA 4L2LA 1PAQA 4G25A 2VTBB 2EQXA 3DSVA 4N2SA 3LCAA 2XGMA 2GW1A 3N71A 5JJ7A 1ZBPA 3LVQE 2OEWA 3K9IA 3O4ZA 1MHQA 3CVYA 3B7TA 3ZYLA 3PVLA 4AEZC 2WXFA 5JHAA 4RG9A 4CDNA 2XPYA 3FEYA 3SQVA 5KWDA 1G3NB 4G8KA 2IFUA 2JLBA 1S0PA 3BG0B 4ANXA 4BSXA 1HF8A 3TGOA 2WXGA 3UT7A 3ZIMA 3L08A 3B13A 2Y0BG 3Q15A 3FUHA 3MV3B 5EILA 3OXGA 4HS2A 3CK7A 3PZ2A 3Q9UC 2IOLA 3D9IA 2VSYA 5CMYA 1OUVA 3CQGB 2WXJA 5EDSA 3FHEA 5AQ7A 2P9KG 4FU3A 1DC2A 3ASNE 4G23A 3JXIA 3SNXA 1DCQA 1HS6A 2X6KA 5HQ8A 3DSWA 5AQBA 3I5PA 4LNBA 3L13A 2FI7A 3B95A 4BTAA 4KT6B 3PDNA 3FTUA 3UKRG 2WMOA 3ZEFA 4GTSA 2XPIA 4G2VA 4I1MA 4GMRA 1V54E 3MKQB 2J8SD 1OWMA 2ETBA 4HORA 3TXNA 3HXDA 2H6GA 2NSZA 2GRLA 4O1OA 2P9LG 4GZDA 3G2TA 4V3IA 3FUEA 1OCCE 5B1AE 4G1TA 1PC2A 1D8EA 3LY9A 2QYJA 3PE4A 4L7TA 3FUFA 3HYMB 3TWVA 4F53A 2MYOA 4PH4B 5BPPA 3C98A 3LEWA 2HM8A 4GTQA 2HO1A 3TWTA 3D3MA 3QC1A 3NOGD 4NURA 5G04J 3CR3A 2KC7A 4EQFA 2VSXE 2E2EA 2OV8A 5EX0A 3LPZA 3VLFA 4XI0A 2WM9A 1BPOA 1NA3A 4EHMA 3AU5A 4RLYA 1P5QA 5CCLA 4BT8A 3TWSA 4LERA 3APFA 4J6IA 2MHKA 3DBSA 1UN8A 2I1KA 4L9PA 3LJNA 5ENOD 2LUHA 3B7BA 3ABME 4HQDA 2IJGX 4GMJA 3IV0A 1KZPA 2F8YA 3QWPA 1TJFA 4WWOA 3ZYKA 4UWKA 5KNHD 5DBKA 2FEZA 3P1UA 5E76A 2DYRE 2CFUA 3R7QA 5JHBA 4PDXA 4GTMA 4BSZB 3JXJA 1UJJA 4U0UA 5CRUA 2NYJA 1E8WA 4RQIA 2AVPA 2H6HA 5ENSD 4EBAA 3ZU7B 1TYQG 2WB2A 1DCEA 3FTYA 4BTBA 4JHRA 2OEVA 4GTPA 3ASOE 3VLDA 5CECB 4GYWA 2X6JA 3BEEA 1U2VG 4AVXA 1WY6A 2PZIA 3ZFWA 2RKKA 2VJ8A 3QJZA 2ZGGA 3MYVA 3KS2A 2PM6A 3TXMA 3OTNA 4F6RD 4CZ2D 1HU3A 4U8HA 3EHNA 2OCCE 3L9TA 1Y8MA 3HXBA 5ITZF 3UKUG 4FC8A 3RSEG 2A5EA 4TRQA 4I1AA 4U96D 3SF4A 3W9GA 3BU8A 3ZXSA 4WWPA 4JL0A 4M3OA 4FJYA 4TV3A 3AG2E 3UTMA 5D0QD 2KATA 4ILHB 4BWRA 4Q69A 5IY5E 1UG3A 4OYSA 4UI9J 3HIZA 3NF1A 1E7VA 4QQIA 2DZNA 4GA1A 1FVFA 2V4HC 2QC9A 1MJ0A 3UIOC 3AG3E 4PS3A 3TG5A 4XI9A 5CEAA 3SFZA 3IEGA 4N2QA 1TNOA 2P9PG 2MRIA 2GROB 4HB5A 1TEZA 3PRZA 5FZQA 3FWVA 4F7AA 5JA4D 2BF0X 4BERA 2WQ6A 4KVOA 2XPZA 3CIAA 3ULEG 3CK8A 4XE0A 1IKND 3QB2A 3W9FA 4G26A 2WXKA 1KT0A 2P9UG 4UWGA 2V5QC 1IYGA 3J5QB 4E85A 3U4TA 1HO8A 1TN8A 3T8KA 3ZNGA 3MEKA 1FT2A 3F6QA 2OVFA 3Q7FA 3RIBA 1AWCB 4I2WA 5KJNA 4AIFA 3CVWA 4JEUA 3CSTA 3G2UA 5FZRA 3LDZA 2WXNA 2BKKB 1HFAA 4U0ZA 3PUKA 2LXLA 4GMLA 4U63A 3C72A 5AN8A 4NIKA 5BNWA 4GTVA 3Q9NC 1NFIE 1N11A 1S63A 3EHRA 4WUYA 3FULA 1QBQA 3U66A 3CLJA 3BQOA 5C1DA 4L23A 4I9CA 3EU9A 3CVPA 3AG4E 2XS1A 5FZSA 4DK5A 4IULA 2L9BA 4GPKA 4HOSA 2XEHA 3B7UX 3U64A 4K5BA 4ZFHA 1U3DA 4I6JA 4BX9A 4YDYA 2UY1A 3FU5A 5T3RA 4FLBA 3IKOB 3SI5A 3PS6A 1SZ9A 4C0EA 2L6BA 4A3VA 3PNTB 5KNGA 1NI1A 5M72A 1MZCA 1V55E 5FQ8A 4LRZA 4YVQC 4ATGA 4AOFA 3WXXA 3UQ3A 3ISMC 5BT1A 1H6OA 3QDNA 3QNKA 5AJLA 3QK0A 2Y1LE 5AQ9A 1MX4A 2HE0A 3E32A 2VTBA 3NOCD 3LY7A 4L1BA 4LNUD 2GRMA 3DPYA 5A23A 5G05J 4APOA 3AJIA 1YCSB 4UWFA 3KEAA 2ONDA 5ANLA 2L6JA 3ZHEA 4UQXA 3DPDA 2P2CP 3ASHA 3KEZA 3C3RA 3HXFA 3T8MA 2ZU6B 3EIJA 4LSZE 3TWWA 3FTWA 4DX1A 4Q94A 4URKA 4J8DA 2F0YA 4I17A 4J0UA 3RRUA 2WXMA 1OCRE 4B93B 3RJVA 4FULA 3AAAC 5G05C 1K8KG 5BW8C 4NACA 2WQ7A 2DYSE 1HZ4A 3P2BA 2IF4A 2C0MA 3NQPA 4GZ6A 4UQZA 4APFA 4B0ZA 3UX4A 3FU0A 3LY8A 3ZHEB 1U3CA 3PREA 4A63B 3UXGA 1E7UA 4OVVA 5J08A 4XIFA 3CVNA 2X6FA 3FTVA 2XEEA 5EN5D 1ELKA
chains in the Genus database with same CATH topology
3DEOA 4HRNA 5EILA 3W9FA 5ENRD 4O60A 1YYHA 3V2XA 4DUIA 2ZGGA 3IXEA 5EYLA 4O1PA 4HNAD 4QFVA 4J8YA 4TUMA 4F6RD 5D66A 3HRAA 4N5QA 3TWUA 1A5EA 4CZ2D 1S70B 3J5PA 2KBXA 3Q9UC 2V5QC 4BEPA 2AJAA 2B0OE 2ETAA 3J5QB 4U8VD 5ITZF 4CYMD 3V31A 5HKPA 4JB8P 4F1PA 5CBNA 3DEPA 5EYPF 2Y1LE 1MX2A 2RFMA 4RLYA 5AQ9A 3TWXA 1MX4A 2DWZA 2ETCA 2HE0A 3NOCD 3T8KA 3ZNGA 3TWSA 5HRYA 4YDWA 5FIOA 3F6QA 5AQAA 1AWCB 5AQ7A 1OY3D 1IXVA 1YMPA 4LNUD 4ATZD 1QYMA 2A5EA 2XENA 1DC2A 3JXIA 3C5RA 1DCQA 4U96D 3AJIA 4HBDA 1YCSB 3W9GA 1K3ZD 3KEAA 4DX2A 4U8YD 3JUEA 2F8XK 1K1BA 1BLXB 2KXPC 4DRXE 5AQBA 2JABA 3LJNA 1UOHA 4HI9A 3V30A 4LG6A 5ENOD 5CERB 2BKKB 3B7BA 3B95A 5EIDA 4HQDA 5EN5D 2F37A 3UTMA 4OAUC 2P2CP 3D9HA 1OT8A 3TWRA 5AN8A 2F8YA 1AP7A 1SVXA 1D9SA 5CEDB 5CBOA 4Z68A 5KNHD 5BXUA 2DZOA 4NIKA 5AARA 1WDYA 4ZHBA 5BXOA 3Q9NC 1NFIE 4GMRA 3V79K 2DVWA 1N0QA 1N11A 4OAVB 4LSZE 4QQIA 1TR4A 5JMND 2J8SD 3TWWA 4BSZB 3JXJA 3EHRA 3T9KA 1SW6A 2ETBA 2BKGA 4DX1A 2NYJA 4UUCA 2DZNA 2XZDG 4J7WA 4GPMA 3ZUVB 4DX5D 1MYOA 4DX7D 4O1OA 5ENQD 3SO8A 1K1AA 2V4HC 5ENSD 2FO1E 1MX6A 2XZTG 4HRLA 2QC9A 4K5AB 3ZU7B 3NBNB 3EU9A 5HS0A 5FINA 4HLLA 4B93B 5KWDA 4C48B 5ENPD 1G3NB 4K5CA 1MJ0A 4G8KA 2RFAA 3V2OA 3AAAC 2QYJA 5CEAA 3HG0D 1IHBA 4DX6D 3TWQA 2ZGDA 1N0RA 2XEHA 4K5BA 2VGEA 3TWVA 4ZFHA 1WG0A 1BU9A 4YDYA 4BETA 5CECB 5ENTD 5EIBE 2MYOA 4HB5A 4HRMB 2PNNA 5JA4D 4G8LA 4BERA 4A63B 3UXGA 3ZKJA 3UI2A 4HI8A 4U95D 4BESA 3TWTA 1BI8B 1BD8A 3EHQA 2Y0BG 2L6BA 5KNGA 2XEEA 5KBAA 3NOGD 1BI7B 1IKND 5AAOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DEO A;  4HRN A;  5EIL A;  3W9F A;  5ENR D;  4O60 A;  1YYH A;  3V2X A;  4DUI A;  2ZGG A;  3IXE A;  5EYL A;  4O1P A;  4HNA D;  4QFV A;  4J8Y A;  4TUM A;  4F6R D;  5D66 A;  3HRA A;  4N5Q A;  3TWU A;  1A5E A;  4CZ2 D;  1S70 B;  3J5P A;  2KBX A;  3Q9U C;  2V5Q C;  4BEP A;  2AJA A;  2B0O E;  2ETA A;  3J5Q B;  4U8V D;  5ITZ F;  4CYM D;  3V31 A;  5HKP A;  4JB8 P;  4F1P A;  5CBN A;  3DEP A;  5EYP F;  2Y1L E;  1MX2 A;  2RFM A;  4RLY A;  5AQ9 A;  3TWX A;  1MX4 A;  2DWZ A;  2ETC A;  2HE0 A;  3NOC D;  3T8K A;  3ZNG A;  3TWS A;  5HRY A;  4YDW A;  5FIO A;  3F6Q A;  5AQA A;  1AWC B;  5AQ7 A;  1OY3 D;  1IXV A;  1YMP A;  4LNU D;  4ATZ D;  1QYM A;  2A5E A;  2XEN A;  1DC2 A;  3JXI A;  3C5R A;  1DCQ A;  4U96 D;  3AJI A;  4HBD A;  1YCS B;  3W9G A;  1K3Z D;  3KEA A;  4DX2 A;  4U8Y D;  3JUE A;  2F8X K;  1K1B A;  1BLX B;  2KXP C;  4DRX E;  5AQB A;  2JAB A;  3LJN A;  1UOH A;  4HI9 A;  3V30 A;  4LG6 A;  5ENO D;  5CER B;  2BKK B;  3B7B A;  3B95 A;  5EID A;  4HQD A;  5EN5 D;  2F37 A;  3UTM A;  4OAU C;  2P2C P;  3D9H A;  1OT8 A;  3TWR A;  5AN8 A;  2F8Y A;  1AP7 A;  1SVX A;  1D9S A;  5CED B;  5CBO A;  4Z68 A;  5KNH D;  5BXU A;  2DZO A;  4NIK A;  5AAR A;  1WDY A;  4ZHB A;  5BXO A;  3Q9N C;  1NFI E;  4GMR A;  3V79 K;  2DVW A;  1N0Q A;  1N11 A;  4OAV B;  4LSZ E;  4QQI A;  1TR4 A;  5JMN D;  2J8S D;  3TWW A;  4BSZ B;  3JXJ A;  3EHR A;  3T9K A;  1SW6 A;  2ETB A;  2BKG A;  4DX1 A;  2NYJ A;  4UUC A;  2DZN A;  2XZD G;  4J7W A;  4GPM A;  3ZUV B;  4DX5 D;  1MYO A;  4DX7 D;  4O1O A;  5ENQ D;  3SO8 A;  1K1A A;  2V4H C;  5ENS D;  2FO1 E;  1MX6 A;  2XZT G;  4HRL A;  2QC9 A;  4K5A B;  3ZU7 B;  3NBN B;  3EU9 A;  5HS0 A;  5FIN A;  4HLL A;  4B93 B;  5KWD A;  4C48 B;  5ENP D;  1G3N B;  4K5C A;  1MJ0 A;  4G8K A;  2RFA A;  3V2O A;  3AAA C;  2QYJ A;  5CEA A;  3HG0 D;  1IHB A;  4DX6 D;  3TWQ A;  2ZGD A;  1N0R A;  2XEH A;  4K5B A;  2VGE A;  3TWV A;  4ZFH A;  1WG0 A;  1BU9 A;  4YDY A;  4BET A;  5CEC B;  5ENT D;  5EIB E;  2MYO A;  4HB5 A;  4HRM B;  2PNN A;  5JA4 D;  4G8L A;  4BER A;  4A63 B;  3UXG A;  3ZKJ A;  3UI2 A;  4HI8 A;  4U95 D;  4BES A;  3TWT A;  1BI8 B;  1BD8 A;  3EHQ A;  2Y0B G;  2L6B A;  5KNG A;  2XEE A;  5KBA A;  3NOG D;  1BI7 B;  1IKN D;  5AAO A; 
#chains in the Genus database with same CATH topology
 4H7Y A;  4DUI A;  4ANW A;  2V8S E;  3ESK A;  1PY1 A;  2ZIS A;  3PEV B;  1TN6 A;  1ZB1 A;  4L2Y A;  2AJA A;  4I6E A;  3UT8 A;  2I1J A;  2CHZ A;  3FUD A;  5HRY A;  4J8S A;  2IEJ A;  1YMP A;  1IXV A;  1JUQ A;  3S7B A;  3PEU B;  2XCB A;  3DSS A;  1SQM A;  3MKQ A;  1NL4 A;  4YND A;  4DLO A;  1BLX B;  1JPL A;  1E8X A;  3O48 A;  5EID A;  5G2N A;  3JYS A;  4TUU A;  4JEH A;  4JA9 A;  2I2O A;  3TWR A;  4HVB A;  1N4R A;  3AU4 A;  1Y6I A;  3CSF A;  1N0Q A;  3PH0 C;  3CV0 A;  2CG2 A;  2H6I A;  1TJC A;  1H2U A;  3FTS A;  3UM2 A;  3GW4 A;  2XZT G;  4HRL A;  2QY7 A;  3ONK A;  4GAA A;  5FIN A;  2J08 A;  4U0S A;  3TG4 A;  5A6C A;  4CT0 A;  2RFA A;  3V2O A;  1OWP A;  5CCM A;  4RVB A;  2FO7 A;  3GZ2 A;  1WG0 A;  4FJZ A;  3ZXP A;  4CGW A;  4C0M A;  3ENE A;  5ARG A;  3UIP C;  5FQ7 A;  4KBQ A;  3UI2 A;  3ULY A;  4HXI A;  3EUV A;  3MX3 A;  4BY6 A;  2WXP A;  4K03 A;  3DEO A;  2GRN B;  2Y3A A;  3AS4 A;  1FVH A;  5EYL A;  4A55 A;  4QFV A;  1E90 A;  4J8Y A;  4N5Q A;  4YDO A;  3FH5 A;  2C0L A;  2J9Q A;  4AY6 A;  2R5S A;  2B0O E;  4G11 A;  5FWQ A;  1X5B A;  2WXQ A;  4JB8 P;  4CGV A;  4GB9 A;  1H6P A;  1JCS A;  1TNB A;  5FIO A;  4UI9 K;  3LS8 A;  4KZC A;  1O5M A;  3S7J A;  5C2Y A;  2Y4U A;  1TNZ A;  3HVE B;  2P9I G;  2IY0 C;  5CHE E;  1NZN A;  3LYA A;  2L0T B;  4ABN A;  4CRW A;  3D9H A;  3Q49 B;  3X2Q E;  1RZ4 A;  4KYO B;  5CBO A;  5AAR A;  5BXO A;  2BTD A;  5LFA A;  2LSV A;  4XEI G;  3CKC A;  3EIQ C;  3APC A;  4GTR A;  3SO8 A;  1LTX A;  2ZXW E;  3QAQ A;  2WXH A;  3E34 A;  4C48 B;  3LVR E;  4K5C A;  5G04 C;  1EPU A;  3CGH A;  3C3Q A;  4HOQ A;  1OCO E;  3D9L A;  2FUL A;  5LOZ A;  4BET A;  4HRM B;  5JJ6 A;  3FY4 A;  4KVM A;  3FFL A;  2X6H A;  3HXE A;  4N3C A;  3FEX A;  4DI3 A;  3MA5 A;  1YYH A;  4BX8 A;  2VGX B;  1ELR A;  5BV0 A;  2WXI A;  3KD7 A;  4BEP A;  3Q47 B;  3VTY A;  4N3B A;  3NAW A;  4XKB A;  2PQR A;  4GA2 A;  1OY3 D;  2VQ2 A;  2LAI A;  3E30 A;  1O1S A;  2WVI A;  3HDX A;  2JAB A;  2QFC A;  4HI9 A;  3V30 A;  4IYP A;  2RD0 A;  4FP7 A;  4HOU A;  2XS8 A;  2J4B A;  4JC8 A;  1WDY A;  4OAV B;  2A5U A;  3ML9 A;  2XZD G;  4J7W A;  4M7C A;  3Q78 A;  2CG3 A;  3JUI A;  4ACK A;  2GRR B;  1MX6 A;  3Q79 A;  3NBN B;  3QAR A;  2V5F A;  3RU0 A;  2HYZ A;  3CQC B;  3ZYM A;  1HH8 A;  2ZGD A;  5AYW D;  2LAH A;  4B8C B;  2VGE A;  4JPS A;  3RAU A;  5ENT D;  4UQY A;  2KZT B;  2XHE A;  5AAO A;  3T5V A;  5ENR D;  4IN3 B;  2P9S G;  4ACL A;  2C2L A;  3S2A A;  2VYI A;  2XGS A;  4CDM A;  4ME2 A;  3L54 A;  1Z3X A;  5EYP F;  4FHJ A;  3CHQ A;  2M63 A;  5HI7 A;  4UI9 C;  1HG2 A;  1L5J A;  3C3O A;  4ANU A;  1K1B A;  1UOH A;  2H6F A;  4HLE A;  4WWN A;  4GZC A;  3UPV A;  5BXU A;  1UJK A;  1N94 A;  4CEM A;  3FUN A;  5KJK A;  2EIJ E;  2DVW A;  3G2S A;  5B1B E;  4UUC A;  4DX7 D;  5EX3 A;  4AV7 A;  5JJT A;  1N9A A;  4P29 A;  1TNY A;  2R59 A;  4J8F A;  5BUZ A;  1NP7 A;  3ESL A;  1SZA A;  5E75 A;  4JZY A;  3G2V A;  2GRQ B;  3L6A A;  4EEC A;  2XRZ A;  2WPV A;  1Z6T A;  4GZ5 A;  2GRP B;  5CMW A;  2I9C A;  3EJN A;  1E8Z A;  5A7D B;  2R02 A;  1A17 A;  3MJW A;  2OOE A;  2XEV A;  3IXE A;  5LCW J;  2V4L A;  5FJY A;  3HRA A;  5T4Y A;  3KSQ A;  1LF8 A;  2WXL A;  4PS8 A;  3SGH A;  4CYM D;  3DEP A;  4I9E A;  1WAO 1;  2J07 A;  4F1S A;  2AXV A;  4RSY A;  1IQU A;  3FUK A;  3FH7 A;  1XGW A;  4IRU A;  4U8Y D;  4KZ0 A;  1JWF A;  3CVL A;  1H19 A;  4U04 A;  2DIW A;  4B89 A;  1LD8 A;  2WXO A;  2YQ8 A;  3FU3 A;  2LNI A;  3CVX A;  2LO6 A;  3IBE A;  5G55 A;  4LEU A;  3UM3 A;  2YNQ A;  1D9S A;  1N4P A;  2PQN A;  4NRH B;  4ZHB A;  3D9P A;  4I6G A;  2IO3 C;  3V79 K;  5JMN D;  4AXH A;  3OXF A;  4NQ0 A;  1TNU A;  1N52 A;  5ENP D;  3HG0 D;  1IHB A;  2R05 A;  5FQ6 A;  3UM1 A;  1BU9 A;  2WQH A;  3ASF A;  3PZ4 A;  4DPR A;  4A3T A;  4CDR A;  2KCL A;  3Q4A B;  3BUA A;  2PL2 A;  4PUC A;  4CT4 A;  4JD2 G;  4JHK A;  2P58 C;  4DLQ A;  2WXR A;  4O60 A;  2XQ0 A;  3V2X A;  1KPS B;  1FPP A;  5FQ4 A;  3PZD A;  1A5E A;  1S70 B;  3J5P A;  1SA5 A;  3NZS A;  3AG1 E;  1JCR A;  4Q96 A;  1D8D A;  4F1P A;  1RW2 A;  2ETC A;  3SBT B;  5AQA A;  4D10 C;  3OXL A;  3MV2 B;  5KJM A;  4GU5 A;  3FUI A;  2F8X K;  2EIK E;  4PS7 A;  2NXP A;  4TXR A;  3L16 A;  4XZ4 A;  2WMN A;  3U9W A;  1SVX A;  5AEN A;  4WND A;  2KM4 A;  3L22 A;  4GZ3 A;  3PE3 A;  4N5C A;  3E4B A;  3TL5 A;  1EF1 C;  4GPM A;  3ZUV B;  2JEK A;  2AWI A;  3MCX A;  4HLL A;  2L0I A;  3BG1 B;  2X6I A;  5BV1 A;  4J8E A;  4EZL A;  3IHY A;  1N0R A;  5EKQ D;  3D9N A;  5EIB E;  1DVP A;  1ELW A;  4U95 D;  1QZ2 A;  3RKV A;  2AXU A;  2CHW A;  1Z5S C;  4TXP A;  4YDE A;  5ENQ D;  1HE8 A;  1O1R A;  3RO2 A;  3CVU A;  3JQ1 A;  4JXT A;  4CCA A;  4O1P A;  2IO2 C;  4HNA D;  1S64 A;  2KBX A;  4GYO A;  4HFG A;  4GTO A;  3R9M A;  3HVE A;  4WNG A;  4WNE A;  5CBN A;  1MX2 A;  3SZ7 A;  3MGB A;  3VTX A;  4UWL A;  4GTT A;  3JCK C;  2LXM A;  4ILG A;  1QQE A;  1IQR A;  3QKY A;  4KXK B;  4MKT A;  3SHF A;  4RG6 A;  4B94 A;  2OVB A;  3GZS A;  1QNF A;  1OT8 A;  3B7S A;  5ARF A;  5H7P A;  2DZO A;  2Y69 E;  2EIM E;  5D0O D;  2EIN E;  1TR4 A;  3LJ3 A;  4A1G A;  1MYO A;  3RRM B;  3SFY A;  3EU5 A;  4Y6C A;  1HXI A;  1KLX A;  3ZYQ A;  3AS8 A;  4UWH A;  1FT1 A;  4C9B B;  2I6H A;  4OVU A;  1JWG A;  3TWQ A;  4LUN U;  5T8I A;  3CVV A;  4R7L A;  2KCV A;  2VGX A;  3JQ0 A;  3ULQ A;  1FCH A;  3CKB A;  4G8L A;  1EYH A;  4EBA G;  4YVO A;  3LXU X;  5KBA A;  3FP3 A;  3S7D A;  3U3W A;  1N4Q A;  4O6F A;  2VSN A;  4LNG A;  4G24 A;  1HG5 A;  4GA0 A;  5J90 A;  1N4S A;  4DI4 A;  3FTX A;  5D66 A;  5FT9 A;  4I43 A;  1OXJ A;  2J09 A;  1VDY A;  3ZRH A;  3D9J A;  2RFM A;  4EZJ A;  3I4R B;  3TAX A;  3QWV A;  2V0P A;  3KSL A;  4TXQ A;  3G2W A;  1QYM A;  3ZW3 A;  2XEN A;  5FTP A;  3CHP A;  4HOT A;  3L82 A;  2J4D A;  2VSO E;  2A4Z A;  2R2L A;  1OWN A;  3PZ1 A;  1INZ A;  2AW6 A;  3RRN B;  3QWW A;  4FLH A;  1B89 A;  2KCK A;  3DXK G;  5CRV A;  4FHK A;  3UM0 A;  3RO3 A;  3NB2 A;  1KZO A;  3UMV A;  4H7X A;  2EIL E;  3T9K A;  3UIN C;  1SW6 A;  4MLP A;  3ZVV A;  1NA0 A;  3CHS A;  2X38 A;  5B3S E;  3I4G A;  1N95 A;  2E0I A;  1K1A A;  4WAF A;  2FO1 E;  4B8A A;  3UUX A;  3E37 A;  2NC9 A;  3PUJ A;  2KZT A;  4BT9 A;  3ABL E;  4X8Q A;  2BUG A;  1OWL A;  3OAW A;  1UN9 A;  3EDT B;  3DSX A;  3NZU A;  3UT4 A;  4DX6 D;  3CHO A;  1TN7 A;  1JCQ A;  3MZL B;  1OCZ E;  3Q73 A;  4JW1 A;  4N39 A;  5ANR A;  3T5X A;  3ASG A;  2GGF A;  3CHR A;  4BES A;  2PM7 A;  1BI8 B;  3DST A;  1W3B A;  3E33 A;  4AY5 A;  5HKP A;  3ML8 A;  3R7R A;  3SD5 A;  3HXC A;  4AP2 A;  4TUM A;  4JA7 A;  4W9R A;  3RK6 A;  3FUJ A;  5AJD A;  4EPZ A;  2ION A;  2DBA A;  4U8V D;  3V31 A;  4E6H A;  3FUM A;  4YDW A;  3Q7A A;  4ATZ D;  2HR2 A;  2MOW A;  3IHV A;  4GYY A;  3FH8 A;  1WM5 A;  1K3Z D;  1HX8 A;  2FF4 A;  3FDH A;  1N54 A;  5CER B;  2FBN A;  3LKU A;  4MBG A;  3EHM A;  2AXZ A;  4KMO A;  4AM9 A;  2J49 A;  4GCO A;  3Q5M A;  5CED B;  1Z3Y A;  1IHG A;  1UW4 B;  4JHJ A;  1O1T A;  3APD A;  3DSU A;  5AIJ A;  4FA6 A;  2BKG A;  4I2Z A;  4DX5 D;  2R03 A;  4JVS A;  1DNP A;  3CVQ A;  3D9M A;  3FTZ A;  4FAD A;  3MKR A;  1XNF A;  2YIN A;  2QZA A;  3ZGQ A;  3D9K A;  1YA0 A;  1E8Y A;  3SBS A;  3ZPJ A;  2CHX A;  2PNN A;  4Y6W A;  3CK9 A;  4LCT A;  4HI8 A;  2P9N G;  4N3A A;  2XRY A;  5KJL A;  3DXM G;  1H2T C;  1OWO A;  1BI7 B;  3ONL A;  4HRN A;  3QOU A;  4A1S A;  4BFR A;  3HHM A;  3TJP A;  1H0A A;  3SY2 A;  1EDU A;  3B7R L;  2B6C A;  2XCC A;  4XX5 A;  5KCM A;  1SA4 A;  3AS5 A;  4HBD A;  3PZ3 A;  2ZIR A;  4U7E B;  4DX2 A;  3JUE A;  2KXP C;  4K0R A;  3CEQ A;  4OAU C;  2R17 C;  4MS6 A;  3PNL B;  5LP0 A;  1AP7 A;  2YHC A;  2ILR A;  4Z68 A;  3S7F A;  5DIZ A;  1LD7 A;  3DWL G;  3GZ1 A;  3WG7 E;  4ILI A;  4AJW A;  2VGY A;  3KAE A;  1H6K A;  3VLE A;  4K5A B;  3ASD A;  2IU1 A;  5HS0 A;  4WNF A;  3D9O A;  1MQS A;  2IOS A;  2UWJ G;  2CFZ A;  3L17 A;  2LSU A;  5LCW C;  5LX8 A;  1GW6 A;  5ENN A;  4XKC A;  2Y4T A;  3ZKJ A;  1ZU2 A;  3ABK E;  1BD8 A;  2Q7F A;  3EHQ A;  4MRU A;  2XGO A;  4F3V A;  3ZN3 A;  3URZ A;  4U07 A;  1Q2Z A;  3R9A B;  2X3M A;  2UY1 B;  3TWU A;  4DJA A;  2ETA A;  2QYU A;  2RG8 A;  2YHE A;  4ANV A;  2IQC A;  3TWX A;  3DRA A;  2DWZ A;  3FU6 A;  4I1O B;  1H2V C;  3C5R A;  3I3N A;  1E96 B;  2BED A;  3Q75 A;  1X81 A;  4DRX E;  3CHM A;  1KT1 A;  3SFX A;  4EZK A;  4GCN A;  4LG6 A;  2DCP A;  5D2M C;  2F37 A;  3GYZ A;  4L2L A;  1PAQ A;  4G25 A;  2VTB B;  2EQX A;  3DSV A;  4N2S A;  3LCA A;  2XGM A;  2GW1 A;  3N71 A;  5JJ7 A;  1ZBP A;  3LVQ E;  2OEW A;  3K9I A;  3O4Z A;  1MHQ A;  3CVY A;  3B7T A;  3ZYL A;  3PVL A;  4AEZ C;  2WXF A;  5JHA A;  4RG9 A;  4CDN A;  2XPY A;  3FEY A;  3SQV A;  5KWD A;  1G3N B;  4G8K A;  2IFU A;  2JLB A;  1S0P A;  3BG0 B;  4ANX A;  4BSX A;  1HF8 A;  3TGO A;  2WXG A;  3UT7 A;  3ZIM A;  3L08 A;  3B13 A;  2Y0B G;  3Q15 A;  3FUH A;  3MV3 B;  5EIL A;  3OXG A;  4HS2 A;  3CK7 A;  3PZ2 A;  3Q9U C;  2IOL A;  3D9I A;  2VSY A;  5CMY A;  1OUV A;  3CQG B;  2WXJ A;  5EDS A;  3FHE A;  5AQ7 A;  2P9K G;  4FU3 A;  1DC2 A;  3ASN E;  4G23 A;  3JXI A;  3SNX A;  1DCQ A;  1HS6 A;  2X6K A;  5HQ8 A;  3DSW A;  5AQB A;  3I5P A;  4LNB A;  3L13 A;  2FI7 A;  3B95 A;  4BTA A;  4KT6 B;  3PDN A;  3FTU A;  3UKR G;  2WMO A;  3ZEF A;  4GTS A;  2XPI A;  4G2V A;  4I1M A;  4GMR A;  1V54 E;  3MKQ B;  2J8S D;  1OWM A;  2ETB A;  4HOR A;  3TXN A;  3HXD A;  2H6G A;  2NSZ A;  2GRL A;  4O1O A;  2P9L G;  4GZD A;  3G2T A;  4V3I A;  3FUE A;  1OCC E;  5B1A E;  4G1T A;  1PC2 A;  1D8E A;  3LY9 A;  2QYJ A;  3PE4 A;  4L7T A;  3FUF A;  3HYM B;  3TWV A;  4F53 A;  2MYO A;  4PH4 B;  5BPP A;  3C98 A;  3LEW A;  2HM8 A;  4GTQ A;  2HO1 A;  3TWT A;  3D3M A;  3QC1 A;  3NOG D;  4NUR A;  5G04 J;  3CR3 A;  2KC7 A;  4EQF A;  2VSX E;  2E2E A;  2OV8 A;  5EX0 A;  3LPZ A;  3VLF A;  4XI0 A;  2WM9 A;  1BPO A;  1NA3 A;  4EHM A;  3AU5 A;  4RLY A;  1P5Q A;  5CCL A;  4BT8 A;  3TWS A;  4LER A;  3APF A;  4J6I A;  2MHK A;  3DBS A;  1UN8 A;  2I1K A;  4L9P A;  3LJN A;  5ENO D;  2LUH A;  3B7B A;  3ABM E;  4HQD A;  2IJG X;  4GMJ A;  3IV0 A;  1KZP A;  2F8Y A;  3QWP A;  1TJF A;  4WWO A;  3ZYK A;  4UWK A;  5KNH D;  5DBK A;  2FEZ A;  3P1U A;  5E76 A;  2DYR E;  2CFU A;  3R7Q A;  5JHB A;  4PDX A;  4GTM A;  4BSZ B;  3JXJ A;  1UJJ A;  4U0U A;  5CRU A;  2NYJ A;  1E8W A;  4RQI A;  2AVP A;  2H6H A;  5ENS D;  4EBA A;  3ZU7 B;  1TYQ G;  2WB2 A;  1DCE A;  3FTY A;  4BTB A;  4JHR A;  2OEV A;  4GTP A;  3ASO E;  3VLD A;  5CEC B;  4GYW A;  2X6J A;  3BEE A;  1U2V G;  4AVX A;  1WY6 A;  2PZI A;  3ZFW A;  2RKK A;  2VJ8 A;  3QJZ A;  2ZGG A;  3MYV A;  3KS2 A;  2PM6 A;  3TXM A;  3OTN A;  4F6R D;  4CZ2 D;  1HU3 A;  4U8H A;  3EHN A;  2OCC E;  3L9T A;  1Y8M A;  3HXB A;  5ITZ F;  3UKU G;  4FC8 A;  3RSE G;  2A5E A;  4TRQ A;  4I1A A;  4U96 D;  3SF4 A;  3W9G A;  3BU8 A;  3ZXS A;  4WWP A;  4JL0 A;  4M3O A;  4FJY A;  4TV3 A;  3AG2 E;  3UTM A;  5D0Q D;  2KAT A;  4ILH B;  4BWR A;  4Q69 A;  5IY5 E;  1UG3 A;  4OYS A;  4UI9 J;  3HIZ A;  3NF1 A;  1E7V A;  4QQI A;  2DZN A;  4GA1 A;  1FVF A;  2V4H C;  2QC9 A;  1MJ0 A;  3UIO C;  3AG3 E;  4PS3 A;  3TG5 A;  4XI9 A;  5CEA A;  3SFZ A;  3IEG A;  4N2Q A;  1TNO A;  2P9P G;  2MRI A;  2GRO B;  4HB5 A;  1TEZ A;  3PRZ A;  5FZQ A;  3FWV A;  4F7A A;  5JA4 D;  2BF0 X;  4BER A;  2WQ6 A;  4KVO A;  2XPZ A;  3CIA A;  3ULE G;  3CK8 A;  4XE0 A;  1IKN D;  3QB2 A;  3W9F A;  4G26 A;  2WXK A;  1KT0 A;  2P9U G;  4UWG A;  2V5Q C;  1IYG A;  3J5Q B;  4E85 A;  3U4T A;  1HO8 A;  1TN8 A;  3T8K A;  3ZNG A;  3MEK A;  1FT2 A;  3F6Q A;  2OVF A;  3Q7F A;  3RIB A;  1AWC B;  4I2W A;  5KJN A;  4AIF A;  3CVW A;  4JEU A;  3CST A;  3G2U A;  5FZR A;  3LDZ A;  2WXN A;  2BKK B;  1HFA A;  4U0Z A;  3PUK A;  2LXL A;  4GML A;  4U63 A;  3C72 A;  5AN8 A;  4NIK A;  5BNW A;  4GTV A;  3Q9N C;  1NFI E;  1N11 A;  1S63 A;  3EHR A;  4WUY A;  3FUL A;  1QBQ A;  3U66 A;  3CLJ A;  3BQO A;  5C1D A;  4L23 A;  4I9C A;  3EU9 A;  3CVP A;  3AG4 E;  2XS1 A;  5FZS A;  4DK5 A;  4IUL A;  2L9B A;  4GPK A;  4HOS A;  2XEH A;  3B7U X;  3U64 A;  4K5B A;  4ZFH A;  1U3D A;  4I6J A;  4BX9 A;  4YDY A;  2UY1 A;  3FU5 A;  5T3R A;  4FLB A;  3IKO B;  3SI5 A;  3PS6 A;  1SZ9 A;  4C0E A;  2L6B A;  4A3V A;  3PNT B;  5KNG A;  1NI1 A;  5M72 A;  1MZC A;  1V55 E;  5FQ8 A;  4LRZ A;  4YVQ C;  4ATG A;  4AOF A;  3WXX A;  3UQ3 A;  3ISM C;  5BT1 A;  1H6O A;  3QDN A;  3QNK A;  5AJL A;  3QK0 A;  2Y1L E;  5AQ9 A;  1MX4 A;  2HE0 A;  3E32 A;  2VTB A;  3NOC D;  3LY7 A;  4L1B A;  4LNU D;  2GRM A;  3DPY A;  5A23 A;  5G05 J;  4APO A;  3AJI A;  1YCS B;  4UWF A;  3KEA A;  2OND A;  5ANL A;  2L6J A;  3ZHE A;  4UQX A;  3DPD A;  2P2C P;  3ASH A;  3KEZ A;  3C3R A;  3HXF A;  3T8M A;  2ZU6 B;  3EIJ A;  4LSZ E;  3TWW A;  3FTW A;  4DX1 A;  4Q94 A;  4URK A;  4J8D A;  2F0Y A;  4I17 A;  4J0U A;  3RRU A;  2WXM A;  1OCR E;  4B93 B;  3RJV A;  4FUL A;  3AAA C;  5G05 C;  1K8K G;  5BW8 C;  4NAC A;  2WQ7 A;  2DYS E;  1HZ4 A;  3P2B A;  2IF4 A;  2C0M A;  3NQP A;  4GZ6 A;  4UQZ A;  4APF A;  4B0Z A;  3UX4 A;  3FU0 A;  3LY8 A;  3ZHE B;  1U3C A;  3PRE A;  4A63 B;  3UXG A;  1E7U A;  4OVV A;  5J08 A;  4XIF A;  3CVN A;  2X6F A;  3FTV A;  2XEE A;  5EN5 D;  1ELK A; 
#chains in the Genus database with same CATH homology
 3DEO A;  4HRN A;  5EIL A;  3W9F A;  5ENR D;  4O60 A;  1YYH A;  3V2X A;  4DUI A;  2ZGG A;  3IXE A;  5EYL A;  4O1P A;  4HNA D;  4QFV A;  4J8Y A;  4TUM A;  4F6R D;  5D66 A;  3HRA A;  4N5Q A;  3TWU A;  1A5E A;  4CZ2 D;  1S70 B;  3J5P A;  2KBX A;  3Q9U C;  2V5Q C;  4BEP A;  2AJA A;  2B0O E;  2ETA A;  3J5Q B;  4U8V D;  5ITZ F;  4CYM D;  3V31 A;  5HKP A;  4JB8 P;  4F1P A;  5CBN A;  3DEP A;  5EYP F;  2Y1L E;  1MX2 A;  2RFM A;  4RLY A;  5AQ9 A;  3TWX A;  1MX4 A;  2DWZ A;  2ETC A;  2HE0 A;  3NOC D;  3T8K A;  3ZNG A;  3TWS A;  5HRY A;  4YDW A;  5FIO A;  3F6Q A;  5AQA A;  1AWC B;  5AQ7 A;  1OY3 D;  1IXV A;  1YMP A;  4LNU D;  4ATZ D;  1QYM A;  2A5E A;  2XEN A;  1DC2 A;  3JXI A;  3C5R A;  1DCQ A;  4U96 D;  3AJI A;  4HBD A;  1YCS B;  3W9G A;  1K3Z D;  3KEA A;  4DX2 A;  4U8Y D;  3JUE A;  2F8X K;  1K1B A;  1BLX B;  2KXP C;  4DRX E;  5AQB A;  2JAB A;  3LJN A;  1UOH A;  4HI9 A;  3V30 A;  4LG6 A;  5ENO D;  5CER B;  2BKK B;  3B7B A;  3B95 A;  5EID A;  4HQD A;  5EN5 D;  2F37 A;  3UTM A;  4OAU C;  2P2C P;  3D9H A;  1OT8 A;  3TWR A;  5AN8 A;  2F8Y A;  1AP7 A;  1SVX A;  1D9S A;  5CED B;  5CBO A;  4Z68 A;  5KNH D;  5BXU A;  2DZO A;  4NIK A;  5AAR A;  1WDY A;  4ZHB A;  5BXO A;  3Q9N C;  1NFI E;  4GMR A;  3V79 K;  2DVW A;  1N0Q A;  1N11 A;  4OAV B;  4LSZ E;  4QQI A;  1TR4 A;  5JMN D;  2J8S D;  3TWW A;  4BSZ B;  3JXJ A;  3EHR A;  3T9K A;  1SW6 A;  2ETB A;  2BKG A;  4DX1 A;  2NYJ A;  4UUC A;  2DZN A;  2XZD G;  4J7W A;  4GPM A;  3ZUV B;  4DX5 D;  1MYO A;  4DX7 D;  4O1O A;  5ENQ D;  3SO8 A;  1K1A A;  2V4H C;  5ENS D;  2FO1 E;  1MX6 A;  2XZT G;  4HRL A;  2QC9 A;  4K5A B;  3ZU7 B;  3NBN B;  3EU9 A;  5HS0 A;  5FIN A;  4HLL A;  4B93 B;  5KWD A;  4C48 B;  5ENP D;  1G3N B;  4K5C A;  1MJ0 A;  4G8K A;  2RFA A;  3V2O A;  3AAA C;  2QYJ A;  5CEA A;  3HG0 D;  1IHB A;  4DX6 D;  3TWQ A;  2ZGD A;  1N0R A;  2XEH A;  4K5B A;  2VGE A;  3TWV A;  4ZFH A;  1WG0 A;  1BU9 A;  4YDY A;  4BET A;  5CEC B;  5ENT D;  5EIB E;  2MYO A;  4HB5 A;  4HRM B;  2PNN A;  5JA4 D;  4G8L A;  4BER A;  4A63 B;  3UXG A;  3ZKJ A;  3UI2 A;  4HI8 A;  4U95 D;  4BES A;  3TWT A;  1BI8 B;  1BD8 A;  3EHQ A;  2Y0B G;  2L6B A;  5KNG A;  2XEE A;  5KBA A;  3NOG D;  1BI7 B;  1IKN D;  5AAO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...