2RFAA

Crystal structure of the mouse trpv6 ankyrin repeat domain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
222
structure length
222
Chain Sequence
b'IWESPLLLAAKENDVQALSKLLKFEGCEVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATGSVFHYRPHNLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title Structural analyses of the ankyrin repeat domain of TRPV6 and related TRPV ion channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 78
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2rfaA00
2A5EA 2HE0A 4JB8P 5AQ7A 4F6RD 2ZGGA 4A63B 1AWCB 4QQIA 4O1OA 2JABA 1BLXB 5FINA 3IXEA 4B93B 4DRXE 2XZTG 4DUIA 2F37A 4GMRA 1S70B 2QYJA 2ETCA 1YYHA 3ZNGA 2V5QC 5AQAA 2P2CP 1MYOA 3T8KA 2QC9A 2B0OE 2VGEA 5ENQD 3TWRA 4C48B 3AJIA 4LSZE 5EN5D 4N5QA 4HNAD 3Q9NC 4Z68A 4BETA 3TWSA 4ZHBA 3DEPA 4HBDA 5AN8A 3V31A 3UXGA 2ZGDA 4U8YD 4HQDA 5CEDB 3LJNA 4YDYA 3J5PA 1N0RA 5AAOA 4O60A 1G3NB 4G8KA 5CBNA 5JMND 3TWUA 1OT8A 3NOCD 4J7WA 4U95D 5EILA 1IKND 3T9KA 3TWTA 2F8YA 2XEHA 2Y0BG 5ENTD 5CECB 1BU9A 4NIKA 5ENRD 1D9SA 3ZKJA 3B7BA 3EU9A 2L6BA 4HRNA 2AJAA 5EYLA 4BERA 2V4HC 5ENPD 5KNGA 5BXUA 2XEEA 4TUMA 3V2XA 1WDYA 4BESA 5EYPF 4OAUC 3C5RA 2Y1LE 3EHQA 3JXIA 5AQ9A 2FO1E 4CZ2D 5ENOD 1A5EA 2RFMA 2KBXA 3NOGD 2DZOA 2ETBA 4HI8A 2DWZA 5FIOA 1BD8A 4ZFHA 5KBAA 2NYJA 1BI7B 5BXOA 2RFAA 4LG6A 2ETAA 5EIBE 3V30A 5AQBA 1IHBA 4CYMD 3ZU7B 5CBOA 2MYOA 4LNUD 3TWVA 3UTMA 3W9FA 5HS0A 1OY3D 3SO8A 4DX7D 1UOHA 3JXJA 4HLLA 4J8YA 3UI2A 3NBNB 3ZUVB 1YCSB 3D9HA 4G8LA 4F1PA 4HI9A 2DVWA 3V79K 5KNHD 4HB5A 1WG0A 4QFVA 5CERB 1N11A 4U8VD 2J8SD 2DZNA 3B95A 3AAAC 3HRAA 5D66A 5HRYA 1YMPA 4DX5D 1SVXA 3DEOA 3F6QA 4ATZD 5KWDA 2XZDG 1AP7A 1MX2A 4HRMB 4DX2A 2BKGA 4YDWA 2PNNA 3V2OA 5CEAA 2XENA 3EHRA 1NFIE 4HRLA 1QYMA 4GPMA 3J5QB 4OAVB 1MJ0A 2KXPC 1MX6A 2BKKB 4O1PA 4BSZB 3TWXA 4RLYA 1TR4A 5ENSD 1SW6A 4U96D 4BEPA 1DC2A 4K5BA 5EIDA 4K5AB 3TWWA 1N0QA 5HKPA 3TWQA 4K5CA 4DX1A 4UUCA 1K3ZD 3KEAA 5ITZF 1DCQA 1MX4A 5AARA 1K1AA 3Q9UC 3HG0D 2F8XK 1IXVA 5JA4D 3JUEA 1BI8B 4DX6D 1K1BA 3W9GA
chains in the Genus database with same CATH superfamily
3MV3B 4N3AA 3FTSA 4GZ5A 5G05J 2FI7A 5AQAA 2P9IG 2XHEA 4I17A 3SQVA 2LUHA 3RSEG 3VLEA 2WXRA 1S64A 3ZYQA 5AN8A 5FQ7A 3B7UX 3FUDA 1E90A 1U2VG 4U95D 2Y3AA 2FBNA 3EIJA 2IQCA 4EECA 4MLPA 1WDYA 5LCWC 4OAUC 5AENA 3EHQA 1Z6TA 3JXIA 4U0SA 4Y6CA 2X38A 4N5CA 2RFMA 4B8AA 3CQCB 1HE8A 2M63A 4L7TA 2WQHA 1E96B 5FZSA 4MBGA 3SFZA 4L9PA 3ABKE 2OOEA 2UWJG 1YMPA 1UJKA 4L23A 1MX2A 3E34A 1HZ4A 1NFIE 1O5MA 3J5QB 1MJ0A 1ELRA 5EIDA 4FLHA 3K9IA 4LEUA 4GMLA 4UUCA 3D3MA 1MX4A 4GTQA 1BI8B 2A5EA 4P29A 1AWCB 3NB2A 1BLXB 1NI1A 3ZYLA 3APCA 4GMRA 1IYGA 4AY6A 2V5QC 3NZUA 5ENQD 2AWIA 2VGXA 2RG8A 1DNPA 2ZU6B 3AG2E 4KZ0A 1H6OA 2WM9A 5ANRA 4F1SA 4HBDA 5EKQD 2OV8A 2FO7A 3SZ7A 1N54A 3FUJA 4YDYA 4GA2A 2YNQA 3FY4A 4Q69A 2XGSA 2KCLA 2XEHA 4GU5A 3LEWA 3LY8A 5J08A 2Y1LE 3NQPA 3RRMB 2NC9A 1N4RA 4U8HA 3ZEFA 3TAXA 2RFAA 4JL0A 4I1OB 4DJAA 2KCKA 4GZDA 1IHGA 3RAUA 2NSZA 4N2QA 4G8LA 4LRZA 4HI9A 3BG1B 2LAHA 4U7EB 3D9KA 3CLJA 3FTZA 3HRAA 2OEWA 4XZ4A 1SVXA 2HR2A 4J8EA 3FU0A 3B7RL 1U3CA 4YDWA 3DSTA 1TNUA 3QC1A 2KXPC 5ENSD 4PS3A 1Z3XA 1W3BA 4AJWA 2WXMA 2GRLA 3G2TA 1LD8A 4N2SA 3L13A 3ESLA 3TG4A 2H6IA 3KAEA 4HLEA 3PEUB 1S70B 4L2LA 4I9CA 3N71A 1HH8A 3Q9NC 3FUNA 4A3TA 3MV2B 4GTVA 4TV3A 4I6JA 5CEDB 4N3BA 4NURA 3ZFWA 1N0RA 3TG5A 2P9PG 2IF4A 3B7SA 2IONA 2WXGA 3NF1A 2Y0BG 1QBQA 2J07A 3ASHA 1D9SA 4TUMA 3QWPA 3NZSA 3SBTB 2GW1A 3PZ1A 3AG4E 3E4BA 1N4PA 2WXQA 4EZJA 3UMVA 3FFLA 3VLFA 4LNUD 3IHVA 3AS4A 3WXXA 2PL2A 3QOUA 4U8VD 3B95A 3Q79A 2WPVA 4HXIA 2I2OA 4HORA 5ANLA 4G25A 4HRLA 2UY1A 1OWMA 3VLDA 3FP3A 3FTVA 1DC2A 1HS6A 3FDHA 5D2MC 3TWQA 3DRAA 1Q2ZA 3JCKC 4A1GA 1NP7A 3PDNA 4N3CA 4Y6WA 1K1BA 3W9GA 4WNGA 3CHOA 3KSQA 3JUIA 3IXEA 4DUIA 4XI9A 4ANVA 3ZW3A 1XGWA 3FUEA 2WXPA 2VSOE 3D9LA 2VGEA 4GYOA 5FTPA 4C48B 4WWPA 3CVPA 2ILRA 4JD2G 2VQ2A 4OVUA 1WY6A 3APFA 5FQ4A 5JMND 3DSSA 3PNLB 3BEEA 4LNBA 1JPLA 2DYRE 4WWNA 4HRNA 3HHMA 3L9TA 3G2SA 5BXUA 2Y4UA 4F53A 1LF8A 2KM4A 2V4LA 3OXFA 2VJ8A 5AQ9A 1TEZA 3GYZA 1BI7B 3WG7E 2GROB 2B6CA 3CR3A 3ZU7B 5CBOA 3LVRE 2IY0C 3CIAA 4GZ3A 3LVQE 5AYWD 3PZ3A 2LSUA 3ZUVB 1L5JA 1SZAA 5FT9A 3DPYA 3OTNA 3FH7A 2CFUA 1JCRA 1DCEA 3V2OA 2PNNA 1H6KA 1MZCA 1SA4A 4BFRA 2YHCA 3FEYA 4KBQA 2HM8A 3CVWA 4K5AB 2R17C 1WM5A 4DX1A 2OVFA 4BT8A 4C0EA 3KEAA 4ACLA 5EX0A 1RW2A 2V5FA 5FQ8A 1TN6A 4JB8P 4F6RD 4YNDA 3FTUA 3BQOA 4OVVA 4ANUA 4B89A 4FULA 2VGXB 2P2CP 3ULYA 3RIBA 3CQGB 5KJNA 4RSYA 4I1MA 4N5QA 4ZHBA 3V31A 3ONLA 4GTOA 2ZGDA 1H0AA 2L6JA 5CCMA 1TNOA 4GAAA 3MJWA 3S2AA 1HF8A 3T9KA 2IFUA 2WXOA 4XKBA 2YQ8A 2BUGA 3RK6A 4NIKA 2XPIA 3OXGA 4GTMA 4XI0A 4CGWA 2FO1E 5B1BE 3ESKA 3Q7AA 5FIOA 3MEKA 5KBAA 2A5UA 4UI9C 3TWVA 4JHJA 3RJVA 3CGHA 3I4GA 2DIWA 3ZXSA 4I6GA 2RD0A 3D9JA 1FVHA 3Q73A 4RVBA 2C0LA 2VSNA 3LPZA 2AW6A 3I3NA 4I9EA 5AIJA 4I6EA 4HOQA 4GZ6A 3C72A 3E30A 2GRMA 2IO2C 1EF1C 4EZLA 5CRUA 4K5CA 4UQZA 3I5PA 3CK8A 3ZN3A 1N4QA 5FQ6A 2H6GA 5CMYA 4BX8A 2CFZA 4A63B 3ZHEB 3DXMG 3CVYA 5BV1A 5JHAA 4R7LA 5KCMA 3L16A 2IEJA 4Z68A 1TNYA 2VYIA 2X6JA 1Z5SC 4UWFA 3FUKA 2C0MA 3PEVB 4FHKA 5FJYA 4EBAA 2J4DA 4EPZA 4ILIA 3U64A 3Q4AB 4BX9A 1H6PA 2L6BA 4FA6A 4B0ZA 4TRQA 3CVXA 3CHSA 2XGOA 4CZ2D 5D0QD 1OUVA 4HI8A 1TJFA 4ZFHA 3DSXA 2R2LA 3AG1E 5BXOA 3TGOA 5LX8A 4JW1A 5EDSA 2GGFA 3SO8A 1QZ2A 2HO1A 3U3WA 3LY7A 3D9HA 3L17A 2KZTA 2KATA 3FH8A 4PS8A 2XZDG 3EUVA 2BKGA 2UY1B 3ASNE 1X81A 2CHXA 1HG2A 3CVNA 1QYMA 1N94A 1EDUA 2WXIA 3FTXA 1TR4A 4TXQA 3TWWA 4G23A 3KEZA 2PQRA 3UT7A 3CVLA 3QDNA 1Z3YA 2R59A 1V55E 1H2VC 4Q94A 3QWVA 2LXLA 2LO6A 2CHWA 4UWHA 1OCCE 4XX5A 3FWVA 3HVEA 4HFGA 3ZNGA 3CVUA 2IOSA 4APFA 2J9QA 4DLQA 4IULA 1E8YA 2X6FA 4ME2A 3R9MA 3TL5A 4ATGA 3ZIMA 4CDMA 2AXZA 5BV0A 3QNKA 1MHQA 2XCCA 3X2QE 1FVFA 2WXJA 3B7BA 4M7CA 1SA5A 1KZPA 3ISMC 3ASOE 3ZVVA 2BEDA 3G2WA 2J08A 3LJ3A 5ENOD 3U4TA 3S7JA 1O1SA 1OCOE 2AVPA 3JQ0A 4LG6A 3V30A 3B7TA 5G2NA 3ASDA 3ONKA 3UIOC 4DX7D 3D9MA 5BNWA 5CMWA 4C9BB 4HOUA 5D66A 5HRYA 4FLBA 4DX5D 2ZIRA 4UI9J 3T8MA 4KVOA 4DPRA 4YVOA 4GTRA 1E8XA 3O4ZA 4L2YA 5LOZA 4A3VA 2DCPA 3NAWA 4WUYA 5ITZF 4KZCA 1TN8A 2Y4TA 2RKKA 3ASFA 4J0UA 4CRWA 3GW4A 4U0UA 4GB9A 2WB2A 4F7AA 3E37A 2C2LA 1O1TA 4HNAD 3L6AA 4BETA 4CEMA 1KT1A 4K0RA 2XS1A 4U8YD 5LP0A 1TNZA 3TWUA 3CEQA 3NOCD 3S7FA 1OCRE 3UT4A 2QFCA 2V4HC 3ZHEA 3L22A 2XEVA 4XEIG 4AIFA 4W9RA 2WMNA 3NOGD 1N52A 1BD8A 2PM6A 1OWLA 4J8DA 2LAIA 3FULA 5AJDA 3W9FA 3HDXA 5HI7A 3KD7A 2E2EA 4F1PA 3TXMA 3QAQA 1E8WA 2J8SD 3FUHA 4Q96A 3F6QA 2P9SG 3SGHA 1NA3A 4WNFA 2FF4A 1MQSA 1SQMA 2XENA 2BTDA 4D10C 5J90A 3DXKG 2BF0X 5CHEE 2FEZA 3MA5A 3EDTB 3MCXA 1QQEA 3FHEA 2P9NG 1Y8MA 4APOA 1N4SA 1YYHA 4GCOA 3AU4A 3FUIA 1EYHA 1UN9A 3T8KA 4NACA 3HXFA 3MYVA 4I2ZA 3LJNA 1TYQG 2WXHA 3D9NA 2R03A 4EBAG 4ILGA 3EU9A 2WXKA 5EYLA 5T3RA 5KNGA 4YDOA 1S63A 3C5RA 3P1UA 5KJLA 3MGBA 1P5QA 2DWZA 4I1AA 1HG5A 4V3IA 3CKBA 2GRPB 3JQ1A 1JCSA 3UTMA 5FZRA 1E7VA 1UOHA 2KZTB 1O1RA 2ZXWE 1HU3A 1WG0A 3SF4A 4RG9A 1PC2A 3Q75A 2QYUA 2E0IA 3SY2A 1UJJA 3FU6A 4PH4B 2R05A 5D0OD 4URKA 3S7BA 2BKKB 1SW6A 5ENNA 2VGYA 2EINE 2I6HA 4G26A 2X6IA 1DCQA 3C3QA 4GA1A 1JCQA 2J4BA 2EQXA 1ELWA 5T4YA 3HVEB 4WAFA 3UM0A 1KPSB 3D9OA 2QYJA 4TUUA 1NZNA 3B13A 2ONDA 1H19A 1IQUA 3PZ2A 3DEPA 3MZLB 1SZ9A 2OVBA 2FULA 5AJLA 3J5PA 3QKYA 4O60A 4J7WA 4LCTA 1LD7A 5CECB 3HXDA 1A17A 5EYPF 4BWRA 1IQRA 1HXIA 4N39A 4YVQC 4CDNA 1A5EA 3GZ1A 2XPZA 3QWWA 4UI9K 5M72A 2X3MA 2VTBA 1TJCA 2NYJA 4LERA 5CRVA 2GRRB 4TXPA 5KNHD 3ZYMA 2L9BA 1AP7A 4HS2A 2OCCE 4DLOA 3LXUX 4JVSA 1E7UA 5B1AE 3QK0A 4U96D 5C2YA 3BU8A 2PZIA 3CSTA 3HXBA 1OWPA 3CHRA 4G1TA 4KYOB 1N9AA 2LSVA 4FHJA 4E6HA 1FT2A 4O1OA 3PS6A 1GW6A 2JLBA 3Q15A 1JWFA 4EZKA 1UW4B 2OEVA 2MHKA 3R7RA 5E76A 3UINC 2P58C 3TWSA 1OCZE 3D9IA 3UIPC 1G3NB 2DYSE 1OT8A 4CT4A 4GYWA 3DSVA 4PUCA 4JXTA 3L82A 4GTSA 3ABME 3HXEA 4I2WA 1E8ZA 2CG3A 3SNXA 5A23A 4U07A 5AQBA 2R5SA 3VTXA 1YCSB 2DVWA 3L54A 3UX4A 2R02A 2GRNB 3E32A 4FU3A 3PZDA 2Q7FA 3EU5A 4HRMB 4BSXA 5CEAA 3VTYA 2YHEA 4WNDA 5BW8C 4XE0A 1HFAA 4K5BA 1N0QA 5HKPA 2A4ZA 2XCBA 2Y69E 3ML8A 3ULQA 3TXNA 5AARA 3UQ3A 3Q9UC 3HG0D 3Q78A 4KMOA 3DSUA 4CDRA 2ZGGA 4AV7A 2WQ7A 1ZBPA 4H7YA 2AXUA 5FINA 2XZTG 4AM9A 4JHKA 4UQXA 4PDXA 3CVQA 2B0OE 5DBKA 5G04J 3ZPJA 3DSWA 2IJGX 1KT0A 2X6HA 1OWNA 4B8CB 4LUNU 4FJZA 1KLXA 4CT0A 3IBEA 2WQ6A 4IYPA 1PY1A 2I9CA 3TWTA 4BERA 2F0YA 3ASGA 2IU1A 3V2XA 4GYYA 5IY5E 2J09A 3QB2A 3PE4A 3IHYA 3CV0A 2ETAA 1X5BA 4JHRA 4HB5A 3CHMA 2DBAA 5CCLA 1D8EA 5KWDA 3ZGQA 3AS8A 2P9LG 3KSLA 4PS7A 3IEGA 3EHRA 3FH5A 4HOTA 5BUZA 4OAVB 3PUKA 4CGVA 3DBSA 4UWGA 4RLYA 4BEPA 4ABNA 3PE3A 4U63A 3APDA 5DIZA 4KXKB 4GPKA 3DPDA 4HOSA 3I4RB 1K1AA 2P9UG 1PAQA 5JA4D 3GZ2A 3Q47B 1EPUA 4DRXE 3L08A 5FZQA 2XQ0A 2YINA 4OYSA 3TWRA 3SHFA 3Q5MA 4LSZE 3LCAA 3UM1A 3ZRHA 4XKCA 4C0MA 3ENEA 4G8KA 3Q7FA 3IV0A 3CHQA 5EILA 1IKND 5H7PA 3UM3A 2JEKA 2H6HA 2L0TB 5JHBA 2MRIA 2VSYA 4A1SA 1OXJA 2EILE 2EIKE 5KJKA 2VTBB 3AU5A 1B89A 5EIBE 4ILHB 2MYOA 2XRYA 5A7DB 5ARGA 1H2TC 3HYMB 4A55A 3SFXA 3V79K 3CK7A 3QJZA 4WWOA 3RO2A 4UQYA 3OXLA 3FEXA 3FU3A 3EIQC 3UPVA 3C3OA 4UWLA 2QY7A 2H6FA 3RO3A 3BG0B 3ULEG 4AEZC 1NL4A 1UN8A 3JUEA 4YDEA 2HE0A 2GRQB 4GTTA 4HVBA 1JUQA 5A6CA 3AG3E 2ETCA 4FP7A 4GMJA 5C1DA 3EHMA 5G55A 2WXNA 2IO3C 5E75A 4ANXA 1INZA 1ZB1A 1ELKA 3UXGA 1K8KG 3LDZA 2WXFA 3G2UA 4DI3A 1N95A 3MKQB 3LY9A 2F8YA 3RU0A 4J8SA 5LCWJ 4MKTA 2CHZA 4NQ0A 3SBSA 3KS2A 1HO8A 3QARA 2EIME 3SD5A 3HXCA 2X6KA 2ZISA 1V54E 3UM2A 3GZSA 2V8SE 3C3RA 3E33A 1FPPA 4M3OA 4KVMA 2LXMA 1TNBA 1QNFA 1IHBA 2KCVA 4EHMA 3SFYA 3JXJA 1HX8A 3UI2A 3D9PA 3RRNB 3PUJA 3SI5A 5HQ8A 5CERB 3AAAC 3UUXA 1NA0A 2PM7A 3BUAA 3MKRA 4H7XA 3R9AB 3UKUG 4GPMA 3G2VA 3CVVA 4MRUA 1MX6A 4BT9A 2P9KG 1YA0A 5BPPA 1DVPA 3CKCA 4IRUA 5G05C 1K3ZD 1KZOA 4AOFA 4JA7A 3JYSA 2F8XK 1IXVA 2WXLA 4ANWA 4DX6D 4GA0A 5KJMA 5AQ7A 3P2BA 1LTXA 4QQIA 4FJYA 4IN3B 4B93B 4K03A 4BY6A 3FUMA 4KT6B 2QC9A 3R7QA 4EQFA 3ZYKA 4JC8A 4I43A 4CCAA 5G04C 5JJ7A 4HQDA 3OAWA 3Q49B 5CBNA 4BTAA 5B3SE 1XNFA 1BU9A 2J49A 3ZKJA 2AJAA 5ENPD 1H2UA 2XEEA 4JA9A 4WNEA 4G11A 5T8IA 2ETBA 3PRZA 4AXHA 2WMOA 4JEHA 3FTYA 3LS8A 4U0ZA 1WAO1 5HS0A 4JPSA 2EIJE 3UKRG 3C98A 1U3DA 3AS5A 4J6IA 4E85A 5BT1A 3CK9A 3RRUA 1N11A 1UG3A 4DK5A 1RZ4A 4AVXA 2QZAA 4DI4A 4ATZD 5JJTA 4LNGA 2L0IA 3CSFA 3PZ4A 3RKVA 1VDYA 4O6FA 3FUFA 2IOLA 3HIZA 4BTBA 3UT8A 4FADA 3TWXA 4RG6A 1JWGA 2V0PA 4GTPA 1TN7A 4B94A 4AP2A 4U04A 4GCNA 4AY5A 1D8DA 5ARFA 4MS6A 2VSXE 2JABA 3FU5A 3PREA 2F37A 3FTWA 3EJNA 1MYOA 3URZA 1S0PA 2XRZA 3T5XA 3AJIA 5EN5D 3DWLG 4L1BA 4RQIA 2I1KA 1BPOA 4NRHB 4XIFA 3T5VA 5AAOA 3U66A 3PNTB 2XGMA 1OWOA 4J8FA 4FC8A 3ABLE 5ENTD 2NXPA 2LNIA 5ENRD 2KC7A 1FT1A 4G2VA 2MOWA 4BESA 4UWKA 4JEUA 2CG2A 2KBXA 2DZOA 4JZYA 3IKOB 1FCHA 3ML9A 4CYMD 1OY3D 5LFAA 3MKQA 4HLLA 4J8YA 4TXRA 3NBNB 3PH0C 2WVIA 4GZCA 4QFVA 3S7DA 2DZNA 4ACKA 3DEOA 2XS8A 4DX2A 1Y6IA 3MX3A 4X8QA 2AXVA 3TJPA 5FWQA 2XPYA 3U9WA 3PVLA 1ZU2A 4O1PA 4BSZB 3LYAA 3CHPA 5JJ6A 2I1JA 4F3VA 5EX3A 2HYZA 3LKUA 4G24A 3EHNA 2PQNA 3ZXPA 3O48A
chains in the Genus database with same CATH topology
2A5EA 2HE0A 4JB8P 5AQ7A 4F6RD 2ZGGA 4A63B 1AWCB 4QQIA 4O1OA 2JABA 1BLXB 5FINA 3IXEA 4B93B 4DRXE 2XZTG 4DUIA 2F37A 4GMRA 1S70B 2QYJA 2ETCA 1YYHA 3ZNGA 2V5QC 5AQAA 2P2CP 1MYOA 3T8KA 2QC9A 2B0OE 2VGEA 5ENQD 3TWRA 4C48B 3AJIA 4LSZE 5EN5D 4N5QA 4HNAD 3Q9NC 4Z68A 4BETA 3TWSA 4ZHBA 3DEPA 4HBDA 5AN8A 3V31A 3UXGA 2ZGDA 4U8YD 4HQDA 5CEDB 3LJNA 4YDYA 3J5PA 1N0RA 5AAOA 4O60A 1G3NB 4G8KA 5CBNA 5JMND 3TWUA 1OT8A 3NOCD 4J7WA 4U95D 5EILA 1IKND 3T9KA 3TWTA 2F8YA 2XEHA 2Y0BG 5ENTD 5CECB 1BU9A 4NIKA 5ENRD 1D9SA 3ZKJA 3B7BA 3EU9A 2L6BA 4HRNA 2AJAA 5EYLA 4BERA 2V4HC 5ENPD 5KNGA 5BXUA 2XEEA 4TUMA 3V2XA 1WDYA 4BESA 5EYPF 4OAUC 3C5RA 2Y1LE 3EHQA 3JXIA 5AQ9A 2FO1E 4CZ2D 5ENOD 1A5EA 2RFMA 2KBXA 3NOGD 2DZOA 2ETBA 4HI8A 2DWZA 5FIOA 1BD8A 4ZFHA 5KBAA 2NYJA 1BI7B 5BXOA 2RFAA 4LG6A 2ETAA 5EIBE 3V30A 5AQBA 1IHBA 4CYMD 3ZU7B 5CBOA 2MYOA 4LNUD 3TWVA 3UTMA 3W9FA 5HS0A 1OY3D 3SO8A 4DX7D 1UOHA 3JXJA 4HLLA 4J8YA 3UI2A 3NBNB 3ZUVB 1YCSB 3D9HA 4G8LA 4F1PA 4HI9A 2DVWA 3V79K 5KNHD 4HB5A 1WG0A 4QFVA 5CERB 1N11A 4U8VD 2J8SD 2DZNA 3B95A 3AAAC 3HRAA 5D66A 5HRYA 1YMPA 4DX5D 1SVXA 3DEOA 3F6QA 4ATZD 5KWDA 2XZDG 1AP7A 1MX2A 4HRMB 4DX2A 2BKGA 4YDWA 2PNNA 3V2OA 5CEAA 2XENA 3EHRA 1NFIE 4HRLA 1QYMA 4GPMA 3J5QB 4OAVB 1MJ0A 2KXPC 1MX6A 2BKKB 4O1PA 4BSZB 3TWXA 4RLYA 1TR4A 5ENSD 1SW6A 4U96D 4BEPA 1DC2A 4K5BA 5EIDA 4K5AB 3TWWA 1N0QA 5HKPA 3TWQA 4K5CA 4DX1A 4UUCA 1K3ZD 3KEAA 5ITZF 1DCQA 1MX4A 5AARA 1K1AA 3Q9UC 3HG0D 2F8XK 1IXVA 5JA4D 3JUEA 1BI8B 4DX6D 1K1BA 3W9GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A5E A;  2HE0 A;  4JB8 P;  5AQ7 A;  4F6R D;  2ZGG A;  4A63 B;  1AWC B;  4QQI A;  4O1O A;  2JAB A;  1BLX B;  5FIN A;  3IXE A;  4B93 B;  4DRX E;  2XZT G;  4DUI A;  2F37 A;  4GMR A;  1S70 B;  2QYJ A;  2ETC A;  1YYH A;  3ZNG A;  2V5Q C;  5AQA A;  2P2C P;  1MYO A;  3T8K A;  2QC9 A;  2B0O E;  2VGE A;  5ENQ D;  3TWR A;  4C48 B;  3AJI A;  4LSZ E;  5EN5 D;  4N5Q A;  4HNA D;  3Q9N C;  4Z68 A;  4BET A;  3TWS A;  4ZHB A;  3DEP A;  4HBD A;  5AN8 A;  3V31 A;  3UXG A;  2ZGD A;  4U8Y D;  4HQD A;  5CED B;  3LJN A;  4YDY A;  3J5P A;  1N0R A;  5AAO A;  4O60 A;  1G3N B;  4G8K A;  5CBN A;  5JMN D;  3TWU A;  1OT8 A;  3NOC D;  4J7W A;  4U95 D;  5EIL A;  1IKN D;  3T9K A;  3TWT A;  2F8Y A;  2XEH A;  2Y0B G;  5ENT D;  5CEC B;  1BU9 A;  4NIK A;  5ENR D;  1D9S A;  3ZKJ A;  3B7B A;  3EU9 A;  2L6B A;  4HRN A;  2AJA A;  5EYL A;  4BER A;  2V4H C;  5ENP D;  5KNG A;  5BXU A;  2XEE A;  4TUM A;  3V2X A;  1WDY A;  4BES A;  5EYP F;  4OAU C;  3C5R A;  2Y1L E;  3EHQ A;  3JXI A;  5AQ9 A;  2FO1 E;  4CZ2 D;  5ENO D;  1A5E A;  2RFM A;  2KBX A;  3NOG D;  2DZO A;  2ETB A;  4HI8 A;  2DWZ A;  5FIO A;  1BD8 A;  4ZFH A;  5KBA A;  2NYJ A;  1BI7 B;  5BXO A;  2RFA A;  4LG6 A;  2ETA A;  5EIB E;  3V30 A;  5AQB A;  1IHB A;  4CYM D;  3ZU7 B;  5CBO A;  2MYO A;  4LNU D;  3TWV A;  3UTM A;  3W9F A;  5HS0 A;  1OY3 D;  3SO8 A;  4DX7 D;  1UOH A;  3JXJ A;  4HLL A;  4J8Y A;  3UI2 A;  3NBN B;  3ZUV B;  1YCS B;  3D9H A;  4G8L A;  4F1P A;  4HI9 A;  2DVW A;  3V79 K;  5KNH D;  4HB5 A;  1WG0 A;  4QFV A;  5CER B;  1N11 A;  4U8V D;  2J8S D;  2DZN A;  3B95 A;  3AAA C;  3HRA A;  5D66 A;  5HRY A;  1YMP A;  4DX5 D;  1SVX A;  3DEO A;  3F6Q A;  4ATZ D;  5KWD A;  2XZD G;  1AP7 A;  1MX2 A;  4HRM B;  4DX2 A;  2BKG A;  4YDW A;  2PNN A;  3V2O A;  5CEA A;  2XEN A;  3EHR A;  1NFI E;  4HRL A;  1QYM A;  4GPM A;  3J5Q B;  4OAV B;  1MJ0 A;  2KXP C;  1MX6 A;  2BKK B;  4O1P A;  4BSZ B;  3TWX A;  4RLY A;  1TR4 A;  5ENS D;  1SW6 A;  4U96 D;  4BEP A;  1DC2 A;  4K5B A;  5EID A;  4K5A B;  3TWW A;  1N0Q A;  5HKP A;  3TWQ A;  4K5C A;  4DX1 A;  4UUC A;  1K3Z D;  3KEA A;  5ITZ F;  1DCQ A;  1MX4 A;  5AAR A;  1K1A A;  3Q9U C;  3HG0 D;  2F8X K;  1IXV A;  5JA4 D;  3JUE A;  1BI8 B;  4DX6 D;  1K1B A;  3W9G A; 
#chains in the Genus database with same CATH topology
 3MV3 B;  4N3A A;  3FTS A;  4GZ5 A;  5G05 J;  2FI7 A;  5AQA A;  2P9I G;  2XHE A;  4I17 A;  3SQV A;  2LUH A;  3RSE G;  3VLE A;  2WXR A;  1S64 A;  3ZYQ A;  5AN8 A;  5FQ7 A;  3B7U X;  3FUD A;  1E90 A;  1U2V G;  4U95 D;  2Y3A A;  2FBN A;  3EIJ A;  2IQC A;  4EEC A;  4MLP A;  1WDY A;  5LCW C;  4OAU C;  5AEN A;  3EHQ A;  1Z6T A;  3JXI A;  4U0S A;  4Y6C A;  2X38 A;  4N5C A;  2RFM A;  4B8A A;  3CQC B;  1HE8 A;  2M63 A;  4L7T A;  2WQH A;  1E96 B;  5FZS A;  4MBG A;  3SFZ A;  4L9P A;  3ABK E;  2OOE A;  2UWJ G;  1YMP A;  1UJK A;  4L23 A;  1MX2 A;  3E34 A;  1HZ4 A;  1NFI E;  1O5M A;  3J5Q B;  1MJ0 A;  1ELR A;  5EID A;  4FLH A;  3K9I A;  4LEU A;  4GML A;  4UUC A;  3D3M A;  1MX4 A;  4GTQ A;  1BI8 B;  2A5E A;  4P29 A;  1AWC B;  3NB2 A;  1BLX B;  1NI1 A;  3ZYL A;  3APC A;  4GMR A;  1IYG A;  4AY6 A;  2V5Q C;  3NZU A;  5ENQ D;  2AWI A;  2VGX A;  2RG8 A;  1DNP A;  2ZU6 B;  3AG2 E;  4KZ0 A;  1H6O A;  2WM9 A;  5ANR A;  4F1S A;  4HBD A;  5EKQ D;  2OV8 A;  2FO7 A;  3SZ7 A;  1N54 A;  3FUJ A;  4YDY A;  4GA2 A;  2YNQ A;  3FY4 A;  4Q69 A;  2XGS A;  2KCL A;  2XEH A;  4GU5 A;  3LEW A;  3LY8 A;  5J08 A;  2Y1L E;  3NQP A;  3RRM B;  2NC9 A;  1N4R A;  4U8H A;  3ZEF A;  3TAX A;  2RFA A;  4JL0 A;  4I1O B;  4DJA A;  2KCK A;  4GZD A;  1IHG A;  3RAU A;  2NSZ A;  4N2Q A;  4G8L A;  4LRZ A;  4HI9 A;  3BG1 B;  2LAH A;  4U7E B;  3D9K A;  3CLJ A;  3FTZ A;  3HRA A;  2OEW A;  4XZ4 A;  1SVX A;  2HR2 A;  4J8E A;  3FU0 A;  3B7R L;  1U3C A;  4YDW A;  3DST A;  1TNU A;  3QC1 A;  2KXP C;  5ENS D;  4PS3 A;  1Z3X A;  1W3B A;  4AJW A;  2WXM A;  2GRL A;  3G2T A;  1LD8 A;  4N2S A;  3L13 A;  3ESL A;  3TG4 A;  2H6I A;  3KAE A;  4HLE A;  3PEU B;  1S70 B;  4L2L A;  4I9C A;  3N71 A;  1HH8 A;  3Q9N C;  3FUN A;  4A3T A;  3MV2 B;  4GTV A;  4TV3 A;  4I6J A;  5CED B;  4N3B A;  4NUR A;  3ZFW A;  1N0R A;  3TG5 A;  2P9P G;  2IF4 A;  3B7S A;  2ION A;  2WXG A;  3NF1 A;  2Y0B G;  1QBQ A;  2J07 A;  3ASH A;  1D9S A;  4TUM A;  3QWP A;  3NZS A;  3SBT B;  2GW1 A;  3PZ1 A;  3AG4 E;  3E4B A;  1N4P A;  2WXQ A;  4EZJ A;  3UMV A;  3FFL A;  3VLF A;  4LNU D;  3IHV A;  3AS4 A;  3WXX A;  2PL2 A;  3QOU A;  4U8V D;  3B95 A;  3Q79 A;  2WPV A;  4HXI A;  2I2O A;  4HOR A;  5ANL A;  4G25 A;  4HRL A;  2UY1 A;  1OWM A;  3VLD A;  3FP3 A;  3FTV A;  1DC2 A;  1HS6 A;  3FDH A;  5D2M C;  3TWQ A;  3DRA A;  1Q2Z A;  3JCK C;  4A1G A;  1NP7 A;  3PDN A;  4N3C A;  4Y6W A;  1K1B A;  3W9G A;  4WNG A;  3CHO A;  3KSQ A;  3JUI A;  3IXE A;  4DUI A;  4XI9 A;  4ANV A;  3ZW3 A;  1XGW A;  3FUE A;  2WXP A;  2VSO E;  3D9L A;  2VGE A;  4GYO A;  5FTP A;  4C48 B;  4WWP A;  3CVP A;  2ILR A;  4JD2 G;  2VQ2 A;  4OVU A;  1WY6 A;  3APF A;  5FQ4 A;  5JMN D;  3DSS A;  3PNL B;  3BEE A;  4LNB A;  1JPL A;  2DYR E;  4WWN A;  4HRN A;  3HHM A;  3L9T A;  3G2S A;  5BXU A;  2Y4U A;  4F53 A;  1LF8 A;  2KM4 A;  2V4L A;  3OXF A;  2VJ8 A;  5AQ9 A;  1TEZ A;  3GYZ A;  1BI7 B;  3WG7 E;  2GRO B;  2B6C A;  3CR3 A;  3ZU7 B;  5CBO A;  3LVR E;  2IY0 C;  3CIA A;  4GZ3 A;  3LVQ E;  5AYW D;  3PZ3 A;  2LSU A;  3ZUV B;  1L5J A;  1SZA A;  5FT9 A;  3DPY A;  3OTN A;  3FH7 A;  2CFU A;  1JCR A;  1DCE A;  3V2O A;  2PNN A;  1H6K A;  1MZC A;  1SA4 A;  4BFR A;  2YHC A;  3FEY A;  4KBQ A;  2HM8 A;  3CVW A;  4K5A B;  2R17 C;  1WM5 A;  4DX1 A;  2OVF A;  4BT8 A;  4C0E A;  3KEA A;  4ACL A;  5EX0 A;  1RW2 A;  2V5F A;  5FQ8 A;  1TN6 A;  4JB8 P;  4F6R D;  4YND A;  3FTU A;  3BQO A;  4OVV A;  4ANU A;  4B89 A;  4FUL A;  2VGX B;  2P2C P;  3ULY A;  3RIB A;  3CQG B;  5KJN A;  4RSY A;  4I1M A;  4N5Q A;  4ZHB A;  3V31 A;  3ONL A;  4GTO A;  2ZGD A;  1H0A A;  2L6J A;  5CCM A;  1TNO A;  4GAA A;  3MJW A;  3S2A A;  1HF8 A;  3T9K A;  2IFU A;  2WXO A;  4XKB A;  2YQ8 A;  2BUG A;  3RK6 A;  4NIK A;  2XPI A;  3OXG A;  4GTM A;  4XI0 A;  4CGW A;  2FO1 E;  5B1B E;  3ESK A;  3Q7A A;  5FIO A;  3MEK A;  5KBA A;  2A5U A;  4UI9 C;  3TWV A;  4JHJ A;  3RJV A;  3CGH A;  3I4G A;  2DIW A;  3ZXS A;  4I6G A;  2RD0 A;  3D9J A;  1FVH A;  3Q73 A;  4RVB A;  2C0L A;  2VSN A;  3LPZ A;  2AW6 A;  3I3N A;  4I9E A;  5AIJ A;  4I6E A;  4HOQ A;  4GZ6 A;  3C72 A;  3E30 A;  2GRM A;  2IO2 C;  1EF1 C;  4EZL A;  5CRU A;  4K5C A;  4UQZ A;  3I5P A;  3CK8 A;  3ZN3 A;  1N4Q A;  5FQ6 A;  2H6G A;  5CMY A;  4BX8 A;  2CFZ A;  4A63 B;  3ZHE B;  3DXM G;  3CVY A;  5BV1 A;  5JHA A;  4R7L A;  5KCM A;  3L16 A;  2IEJ A;  4Z68 A;  1TNY A;  2VYI A;  2X6J A;  1Z5S C;  4UWF A;  3FUK A;  2C0M A;  3PEV B;  4FHK A;  5FJY A;  4EBA A;  2J4D A;  4EPZ A;  4ILI A;  3U64 A;  3Q4A B;  4BX9 A;  1H6P A;  2L6B A;  4FA6 A;  4B0Z A;  4TRQ A;  3CVX A;  3CHS A;  2XGO A;  4CZ2 D;  5D0Q D;  1OUV A;  4HI8 A;  1TJF A;  4ZFH A;  3DSX A;  2R2L A;  3AG1 E;  5BXO A;  3TGO A;  5LX8 A;  4JW1 A;  5EDS A;  2GGF A;  3SO8 A;  1QZ2 A;  2HO1 A;  3U3W A;  3LY7 A;  3D9H A;  3L17 A;  2KZT A;  2KAT A;  3FH8 A;  4PS8 A;  2XZD G;  3EUV A;  2BKG A;  2UY1 B;  3ASN E;  1X81 A;  2CHX A;  1HG2 A;  3CVN A;  1QYM A;  1N94 A;  1EDU A;  2WXI A;  3FTX A;  1TR4 A;  4TXQ A;  3TWW A;  4G23 A;  3KEZ A;  2PQR A;  3UT7 A;  3CVL A;  3QDN A;  1Z3Y A;  2R59 A;  1V55 E;  1H2V C;  4Q94 A;  3QWV A;  2LXL A;  2LO6 A;  2CHW A;  4UWH A;  1OCC E;  4XX5 A;  3FWV A;  3HVE A;  4HFG A;  3ZNG A;  3CVU A;  2IOS A;  4APF A;  2J9Q A;  4DLQ A;  4IUL A;  1E8Y A;  2X6F A;  4ME2 A;  3R9M A;  3TL5 A;  4ATG A;  3ZIM A;  4CDM A;  2AXZ A;  5BV0 A;  3QNK A;  1MHQ A;  2XCC A;  3X2Q E;  1FVF A;  2WXJ A;  3B7B A;  4M7C A;  1SA5 A;  1KZP A;  3ISM C;  3ASO E;  3ZVV A;  2BED A;  3G2W A;  2J08 A;  3LJ3 A;  5ENO D;  3U4T A;  3S7J A;  1O1S A;  1OCO E;  2AVP A;  3JQ0 A;  4LG6 A;  3V30 A;  3B7T A;  5G2N A;  3ASD A;  3ONK A;  3UIO C;  4DX7 D;  3D9M A;  5BNW A;  5CMW A;  4C9B B;  4HOU A;  5D66 A;  5HRY A;  4FLB A;  4DX5 D;  2ZIR A;  4UI9 J;  3T8M A;  4KVO A;  4DPR A;  4YVO A;  4GTR A;  1E8X A;  3O4Z A;  4L2Y A;  5LOZ A;  4A3V A;  2DCP A;  3NAW A;  4WUY A;  5ITZ F;  4KZC A;  1TN8 A;  2Y4T A;  2RKK A;  3ASF A;  4J0U A;  4CRW A;  3GW4 A;  4U0U A;  4GB9 A;  2WB2 A;  4F7A A;  3E37 A;  2C2L A;  1O1T A;  4HNA D;  3L6A A;  4BET A;  4CEM A;  1KT1 A;  4K0R A;  2XS1 A;  4U8Y D;  5LP0 A;  1TNZ A;  3TWU A;  3CEQ A;  3NOC D;  3S7F A;  1OCR E;  3UT4 A;  2QFC A;  2V4H C;  3ZHE A;  3L22 A;  2XEV A;  4XEI G;  4AIF A;  4W9R A;  2WMN A;  3NOG D;  1N52 A;  1BD8 A;  2PM6 A;  1OWL A;  4J8D A;  2LAI A;  3FUL A;  5AJD A;  3W9F A;  3HDX A;  5HI7 A;  3KD7 A;  2E2E A;  4F1P A;  3TXM A;  3QAQ A;  1E8W A;  2J8S D;  3FUH A;  4Q96 A;  3F6Q A;  2P9S G;  3SGH A;  1NA3 A;  4WNF A;  2FF4 A;  1MQS A;  1SQM A;  2XEN A;  2BTD A;  4D10 C;  5J90 A;  3DXK G;  2BF0 X;  5CHE E;  2FEZ A;  3MA5 A;  3EDT B;  3MCX A;  1QQE A;  3FHE A;  2P9N G;  1Y8M A;  4APO A;  1N4S A;  1YYH A;  4GCO A;  3AU4 A;  3FUI A;  1EYH A;  1UN9 A;  3T8K A;  4NAC A;  3HXF A;  3MYV A;  4I2Z A;  3LJN A;  1TYQ G;  2WXH A;  3D9N A;  2R03 A;  4EBA G;  4ILG A;  3EU9 A;  2WXK A;  5EYL A;  5T3R A;  5KNG A;  4YDO A;  1S63 A;  3C5R A;  3P1U A;  5KJL A;  3MGB A;  1P5Q A;  2DWZ A;  4I1A A;  1HG5 A;  4V3I A;  3CKB A;  2GRP B;  3JQ1 A;  1JCS A;  3UTM A;  5FZR A;  1E7V A;  1UOH A;  2KZT B;  1O1R A;  2ZXW E;  1HU3 A;  1WG0 A;  3SF4 A;  4RG9 A;  1PC2 A;  3Q75 A;  2QYU A;  2E0I A;  3SY2 A;  1UJJ A;  3FU6 A;  4PH4 B;  2R05 A;  5D0O D;  4URK A;  3S7B A;  2BKK B;  1SW6 A;  5ENN A;  2VGY A;  2EIN E;  2I6H A;  4G26 A;  2X6I A;  1DCQ A;  3C3Q A;  4GA1 A;  1JCQ A;  2J4B A;  2EQX A;  1ELW A;  5T4Y A;  3HVE B;  4WAF A;  3UM0 A;  1KPS B;  3D9O A;  2QYJ A;  4TUU A;  1NZN A;  3B13 A;  2OND A;  1H19 A;  1IQU A;  3PZ2 A;  3DEP A;  3MZL B;  1SZ9 A;  2OVB A;  2FUL A;  5AJL A;  3J5P A;  3QKY A;  4O60 A;  4J7W A;  4LCT A;  1LD7 A;  5CEC B;  3HXD A;  1A17 A;  5EYP F;  4BWR A;  1IQR A;  1HXI A;  4N39 A;  4YVQ C;  4CDN A;  1A5E A;  3GZ1 A;  2XPZ A;  3QWW A;  4UI9 K;  5M72 A;  2X3M A;  2VTB A;  1TJC A;  2NYJ A;  4LER A;  5CRV A;  2GRR B;  4TXP A;  5KNH D;  3ZYM A;  2L9B A;  1AP7 A;  4HS2 A;  2OCC E;  4DLO A;  3LXU X;  4JVS A;  1E7U A;  5B1A E;  3QK0 A;  4U96 D;  5C2Y A;  3BU8 A;  2PZI A;  3CST A;  3HXB A;  1OWP A;  3CHR A;  4G1T A;  4KYO B;  1N9A A;  2LSV A;  4FHJ A;  4E6H A;  1FT2 A;  4O1O A;  3PS6 A;  1GW6 A;  2JLB A;  3Q15 A;  1JWF A;  4EZK A;  1UW4 B;  2OEV A;  2MHK A;  3R7R A;  5E76 A;  3UIN C;  2P58 C;  3TWS A;  1OCZ E;  3D9I A;  3UIP C;  1G3N B;  2DYS E;  1OT8 A;  4CT4 A;  4GYW A;  3DSV A;  4PUC A;  4JXT A;  3L82 A;  4GTS A;  3ABM E;  3HXE A;  4I2W A;  1E8Z A;  2CG3 A;  3SNX A;  5A23 A;  4U07 A;  5AQB A;  2R5S A;  3VTX A;  1YCS B;  2DVW A;  3L54 A;  3UX4 A;  2R02 A;  2GRN B;  3E32 A;  4FU3 A;  3PZD A;  2Q7F A;  3EU5 A;  4HRM B;  4BSX A;  5CEA A;  3VTY A;  2YHE A;  4WND A;  5BW8 C;  4XE0 A;  1HFA A;  4K5B A;  1N0Q A;  5HKP A;  2A4Z A;  2XCB A;  2Y69 E;  3ML8 A;  3ULQ A;  3TXN A;  5AAR A;  3UQ3 A;  3Q9U C;  3HG0 D;  3Q78 A;  4KMO A;  3DSU A;  4CDR A;  2ZGG A;  4AV7 A;  2WQ7 A;  1ZBP A;  4H7Y A;  2AXU A;  5FIN A;  2XZT G;  4AM9 A;  4JHK A;  4UQX A;  4PDX A;  3CVQ A;  2B0O E;  5DBK A;  5G04 J;  3ZPJ A;  3DSW A;  2IJG X;  1KT0 A;  2X6H A;  1OWN A;  4B8C B;  4LUN U;  4FJZ A;  1KLX A;  4CT0 A;  3IBE A;  2WQ6 A;  4IYP A;  1PY1 A;  2I9C A;  3TWT A;  4BER A;  2F0Y A;  3ASG A;  2IU1 A;  3V2X A;  4GYY A;  5IY5 E;  2J09 A;  3QB2 A;  3PE4 A;  3IHY A;  3CV0 A;  2ETA A;  1X5B A;  4JHR A;  4HB5 A;  3CHM A;  2DBA A;  5CCL A;  1D8E A;  5KWD A;  3ZGQ A;  3AS8 A;  2P9L G;  3KSL A;  4PS7 A;  3IEG A;  3EHR A;  3FH5 A;  4HOT A;  5BUZ A;  4OAV B;  3PUK A;  4CGV A;  3DBS A;  4UWG A;  4RLY A;  4BEP A;  4ABN A;  3PE3 A;  4U63 A;  3APD A;  5DIZ A;  4KXK B;  4GPK A;  3DPD A;  4HOS A;  3I4R B;  1K1A A;  2P9U G;  1PAQ A;  5JA4 D;  3GZ2 A;  3Q47 B;  1EPU A;  4DRX E;  3L08 A;  5FZQ A;  2XQ0 A;  2YIN A;  4OYS A;  3TWR A;  3SHF A;  3Q5M A;  4LSZ E;  3LCA A;  3UM1 A;  3ZRH A;  4XKC A;  4C0M A;  3ENE A;  4G8K A;  3Q7F A;  3IV0 A;  3CHQ A;  5EIL A;  1IKN D;  5H7P A;  3UM3 A;  2JEK A;  2H6H A;  2L0T B;  5JHB A;  2MRI A;  2VSY A;  4A1S A;  1OXJ A;  2EIL E;  2EIK E;  5KJK A;  2VTB B;  3AU5 A;  1B89 A;  5EIB E;  4ILH B;  2MYO A;  2XRY A;  5A7D B;  5ARG A;  1H2T C;  3HYM B;  4A55 A;  3SFX A;  3V79 K;  3CK7 A;  3QJZ A;  4WWO A;  3RO2 A;  4UQY A;  3OXL A;  3FEX A;  3FU3 A;  3EIQ C;  3UPV A;  3C3O A;  4UWL A;  2QY7 A;  2H6F A;  3RO3 A;  3BG0 B;  3ULE G;  4AEZ C;  1NL4 A;  1UN8 A;  3JUE A;  4YDE A;  2HE0 A;  2GRQ B;  4GTT A;  4HVB A;  1JUQ A;  5A6C A;  3AG3 E;  2ETC A;  4FP7 A;  4GMJ A;  5C1D A;  3EHM A;  5G55 A;  2WXN A;  2IO3 C;  5E75 A;  4ANX A;  1INZ A;  1ZB1 A;  1ELK A;  3UXG A;  1K8K G;  3LDZ A;  2WXF A;  3G2U A;  4DI3 A;  1N95 A;  3MKQ B;  3LY9 A;  2F8Y A;  3RU0 A;  4J8S A;  5LCW J;  4MKT A;  2CHZ A;  4NQ0 A;  3SBS A;  3KS2 A;  1HO8 A;  3QAR A;  2EIM E;  3SD5 A;  3HXC A;  2X6K A;  2ZIS A;  1V54 E;  3UM2 A;  3GZS A;  2V8S E;  3C3R A;  3E33 A;  1FPP A;  4M3O A;  4KVM A;  2LXM A;  1TNB A;  1QNF A;  1IHB A;  2KCV A;  4EHM A;  3SFY A;  3JXJ A;  1HX8 A;  3UI2 A;  3D9P A;  3RRN B;  3PUJ A;  3SI5 A;  5HQ8 A;  5CER B;  3AAA C;  3UUX A;  1NA0 A;  2PM7 A;  3BUA A;  3MKR A;  4H7X A;  3R9A B;  3UKU G;  4GPM A;  3G2V A;  3CVV A;  4MRU A;  1MX6 A;  4BT9 A;  2P9K G;  1YA0 A;  5BPP A;  1DVP A;  3CKC A;  4IRU A;  5G05 C;  1K3Z D;  1KZO A;  4AOF A;  4JA7 A;  3JYS A;  2F8X K;  1IXV A;  2WXL A;  4ANW A;  4DX6 D;  4GA0 A;  5KJM A;  5AQ7 A;  3P2B A;  1LTX A;  4QQI A;  4FJY A;  4IN3 B;  4B93 B;  4K03 A;  4BY6 A;  3FUM A;  4KT6 B;  2QC9 A;  3R7Q A;  4EQF A;  3ZYK A;  4JC8 A;  4I43 A;  4CCA A;  5G04 C;  5JJ7 A;  4HQD A;  3OAW A;  3Q49 B;  5CBN A;  4BTA A;  5B3S E;  1XNF A;  1BU9 A;  2J49 A;  3ZKJ A;  2AJA A;  5ENP D;  1H2U A;  2XEE A;  4JA9 A;  4WNE A;  4G11 A;  5T8I A;  2ETB A;  3PRZ A;  4AXH A;  2WMO A;  4JEH A;  3FTY A;  3LS8 A;  4U0Z A;  1WAO 1;  5HS0 A;  4JPS A;  2EIJ E;  3UKR G;  3C98 A;  1U3D A;  3AS5 A;  4J6I A;  4E85 A;  5BT1 A;  3CK9 A;  3RRU A;  1N11 A;  1UG3 A;  4DK5 A;  1RZ4 A;  4AVX A;  2QZA A;  4DI4 A;  4ATZ D;  5JJT A;  4LNG A;  2L0I A;  3CSF A;  3PZ4 A;  3RKV A;  1VDY A;  4O6F A;  3FUF A;  2IOL A;  3HIZ A;  4BTB A;  3UT8 A;  4FAD A;  3TWX A;  4RG6 A;  1JWG A;  2V0P A;  4GTP A;  1TN7 A;  4B94 A;  4AP2 A;  4U04 A;  4GCN A;  4AY5 A;  1D8D A;  5ARF A;  4MS6 A;  2VSX E;  2JAB A;  3FU5 A;  3PRE A;  2F37 A;  3FTW A;  3EJN A;  1MYO A;  3URZ A;  1S0P A;  2XRZ A;  3T5X A;  3AJI A;  5EN5 D;  3DWL G;  4L1B A;  4RQI A;  2I1K A;  1BPO A;  4NRH B;  4XIF A;  3T5V A;  5AAO A;  3U66 A;  3PNT B;  2XGM A;  1OWO A;  4J8F A;  4FC8 A;  3ABL E;  5ENT D;  2NXP A;  2LNI A;  5ENR D;  2KC7 A;  1FT1 A;  4G2V A;  2MOW A;  4BES A;  4UWK A;  4JEU A;  2CG2 A;  2KBX A;  2DZO A;  4JZY A;  3IKO B;  1FCH A;  3ML9 A;  4CYM D;  1OY3 D;  5LFA A;  3MKQ A;  4HLL A;  4J8Y A;  4TXR A;  3NBN B;  3PH0 C;  2WVI A;  4GZC A;  4QFV A;  3S7D A;  2DZN A;  4ACK A;  3DEO A;  2XS8 A;  4DX2 A;  1Y6I A;  3MX3 A;  4X8Q A;  2AXV A;  3TJP A;  5FWQ A;  2XPY A;  3U9W A;  3PVL A;  1ZU2 A;  4O1P A;  4BSZ B;  3LYA A;  3CHP A;  5JJ6 A;  2I1J A;  4F3V A;  5EX3 A;  2HYZ A;  3LKU A;  4G24 A;  3EHN A;  2PQN A;  3ZXP A;  3O48 A; 
#chains in the Genus database with same CATH homology
 2A5E A;  2HE0 A;  4JB8 P;  5AQ7 A;  4F6R D;  2ZGG A;  4A63 B;  1AWC B;  4QQI A;  4O1O A;  2JAB A;  1BLX B;  5FIN A;  3IXE A;  4B93 B;  4DRX E;  2XZT G;  4DUI A;  2F37 A;  4GMR A;  1S70 B;  2QYJ A;  2ETC A;  1YYH A;  3ZNG A;  2V5Q C;  5AQA A;  2P2C P;  1MYO A;  3T8K A;  2QC9 A;  2B0O E;  2VGE A;  5ENQ D;  3TWR A;  4C48 B;  3AJI A;  4LSZ E;  5EN5 D;  4N5Q A;  4HNA D;  3Q9N C;  4Z68 A;  4BET A;  3TWS A;  4ZHB A;  3DEP A;  4HBD A;  5AN8 A;  3V31 A;  3UXG A;  2ZGD A;  4U8Y D;  4HQD A;  5CED B;  3LJN A;  4YDY A;  3J5P A;  1N0R A;  5AAO A;  4O60 A;  1G3N B;  4G8K A;  5CBN A;  5JMN D;  3TWU A;  1OT8 A;  3NOC D;  4J7W A;  4U95 D;  5EIL A;  1IKN D;  3T9K A;  3TWT A;  2F8Y A;  2XEH A;  2Y0B G;  5ENT D;  5CEC B;  1BU9 A;  4NIK A;  5ENR D;  1D9S A;  3ZKJ A;  3B7B A;  3EU9 A;  2L6B A;  4HRN A;  2AJA A;  5EYL A;  4BER A;  2V4H C;  5ENP D;  5KNG A;  5BXU A;  2XEE A;  4TUM A;  3V2X A;  1WDY A;  4BES A;  5EYP F;  4OAU C;  3C5R A;  2Y1L E;  3EHQ A;  3JXI A;  5AQ9 A;  2FO1 E;  4CZ2 D;  5ENO D;  1A5E A;  2RFM A;  2KBX A;  3NOG D;  2DZO A;  2ETB A;  4HI8 A;  2DWZ A;  5FIO A;  1BD8 A;  4ZFH A;  5KBA A;  2NYJ A;  1BI7 B;  5BXO A;  2RFA A;  4LG6 A;  2ETA A;  5EIB E;  3V30 A;  5AQB A;  1IHB A;  4CYM D;  3ZU7 B;  5CBO A;  2MYO A;  4LNU D;  3TWV A;  3UTM A;  3W9F A;  5HS0 A;  1OY3 D;  3SO8 A;  4DX7 D;  1UOH A;  3JXJ A;  4HLL A;  4J8Y A;  3UI2 A;  3NBN B;  3ZUV B;  1YCS B;  3D9H A;  4G8L A;  4F1P A;  4HI9 A;  2DVW A;  3V79 K;  5KNH D;  4HB5 A;  1WG0 A;  4QFV A;  5CER B;  1N11 A;  4U8V D;  2J8S D;  2DZN A;  3B95 A;  3AAA C;  3HRA A;  5D66 A;  5HRY A;  1YMP A;  4DX5 D;  1SVX A;  3DEO A;  3F6Q A;  4ATZ D;  5KWD A;  2XZD G;  1AP7 A;  1MX2 A;  4HRM B;  4DX2 A;  2BKG A;  4YDW A;  2PNN A;  3V2O A;  5CEA A;  2XEN A;  3EHR A;  1NFI E;  4HRL A;  1QYM A;  4GPM A;  3J5Q B;  4OAV B;  1MJ0 A;  2KXP C;  1MX6 A;  2BKK B;  4O1P A;  4BSZ B;  3TWX A;  4RLY A;  1TR4 A;  5ENS D;  1SW6 A;  4U96 D;  4BEP A;  1DC2 A;  4K5B A;  5EID A;  4K5A B;  3TWW A;  1N0Q A;  5HKP A;  3TWQ A;  4K5C A;  4DX1 A;  4UUC A;  1K3Z D;  3KEA A;  5ITZ F;  1DCQ A;  1MX4 A;  5AAR A;  1K1A A;  3Q9U C;  3HG0 D;  2F8X K;  1IXV A;  5JA4 D;  3JUE A;  1BI8 B;  4DX6 D;  1K1B A;  3W9G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...