2RFAA

Crystal structure of the mouse trpv6 ankyrin repeat domain
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
222
structure length
222
Chain Sequence
IWESPLLLAAKENDVQALSKLLKFEGCEVHQRGAMGETALHIAALYDNLEAAMVLMEAAPELVFEPMTSELYEGQTALHIAVINQNVNLVRALLARGASVSARATGSVFHYRPHNLIYYGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVLHILILQPNKTFACQMYNLLLSYDGGDHLKSLELVPNNQGLTPFKLAGVEGNIVMFQHLMQKRKHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transient receptor potential cation channel subfamily V memb
publication title Structural analyses of the ankyrin repeat domain of TRPV6 and related TRPV ion channels.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 78
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12796 Ank_2 Ankyrin repeats (3 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2rfaA00
5CECB 4OAVB 4DX1A 4U8VD 1MJ0A 5CBNA 3NOGD 5D66A 4GPMA 4F6RD 5KWDA 5EILA 1MYOA 2QC9A 5AARA 3AAAC 3LJNA 1IHBA 2JABA 2ETAA 4N5QA 3ZNGA 5AQ7A 1DCQA 5HRYA 2F8YA 4O1PA 4DX6D 2F8XK 3EU9A 1K1BA 5EYPF 3JUEA 3DEOA 3UI2A 4BESA 2RFAA 4YDYA 4G8KA 3V31A 2NYJA 2V4HC 4HNAD 3C5RA 3W9FA 3EHQA 4OAUC 1IKND 1N0RA 3ZU7B 4BSZB 4QQIA 5AN8A 2AJAA 3B95A 4LNUD 1K3ZD 2DZNA 1SVXA 1WDYA 3SO8A 4U8YD 1SW6A 3V30A 1AWCB 4Z68A 4RLYA 1YYHA 4B93B 4DRXE 4HB5A 4DUIA 5CEAA 5CERB 3T9KA 3TWSA 3TWXA 5AQ9A 1BU9A 4HQDA 4BERA 4LG6A 3ZUVB 1N11A 4G8LA 2ZGGA 3TWTA 2J8SD 2MYOA 4ZFHA 1MX6A 5EYLA 4CYMD 2BKGA 4NIKA 2KBXA 1YMPA 3IXEA 3D9HA 3Q9UC 5AQAA 1NFIE 5FIOA 5CEDB 2DVWA 2ETBA 4GMRA 4YDWA 5BXOA 1MX4A 5ENQD 1BD8A 2V5QC 3TWWA 2HE0A 3TWRA 2XZDG 4BETA 5JMND 2Y0BG 3W9GA 1N0QA 3HG0D 5CBOA 5FINA 4F1PA 2BKKB 2QYJA 4U95D 4K5CA 4CZ2D 4ZHBA 1IXVA 2VGEA 2XENA 2A5EA 2DZOA 4O60A 2PNNA 1A5EA 1K1AA 4K5BA 3KEAA 4QFVA 3HRAA 2P2CP 5AQBA 3V2XA 5EN5D 2F37A 3J5PA 3TWVA 5JA4D 4BEPA 3V2OA 2KXPC 3NOCD 1YCSB 2ZGDA 3JXIA 4TUMA 2XEHA 5HS0A 5ENTD 5ITZF 5BXUA 2FO1E 2Y1LE 4J8YA 1G3NB 2XZTG 1OY3D 3B7BA 4DX5D 4HI9A 3TWUA 4DX7D 1TR4A 4JB8P 4HI8A 5KNGA 5AAOA 3UXGA 3JXJA 5ENRD 4HRNA 5KBAA 1D9SA 4O1OA 1WG0A 4UUCA 1MX2A 4DX2A 2ETCA 4HBDA 5KNHD 4HLLA 3EHRA 5ENSD 4J7WA 1DC2A 1BI8B 3T8KA 5EIDA 1UOHA 2RFMA 3V79K 3NBNB 1S70B 1OT8A 5EIBE 1AP7A 1QYMA 3UTMA 5ENOD 1BLXB 5ENPD 2DWZA 3J5QB 4U96D 5HKPA 2XEEA 3DEPA 4HRLA 4HRMB 4A63B 3Q9NC 2B0OE 4ATZD 3F6QA 2L6BA 4K5AB 4LSZE 3ZKJA 3AJIA 1BI7B 4C48B 3TWQA
chains in the Genus database with same CATH superfamily
3TG4A 3AAAC 3APCA 5D0QD 1ELWA 4UWGA 4FA6A 3T5XA 2I1KA 3FY4A 4LEUA 2LSUA 3JUEA 4BT8A 2FULA 5BV0A 3EHQA 5AN8A 2CHWA 3OXFA 1FPPA 5LOZA 3TWSA 5DIZA 4HVBA 3FULA 4NRHB 4KMOA 2J07A 2FI7A 3ZVVA 2WQ6A 1YMPA 2R05A 2VTBB 3SD5A 4O6FA 3PNLB 3JQ1A 2V8SE 1GW6A 4A1SA 2IY0C 1TN8A 4U8HA 5KJMA 3L16A 3OXLA 5ARFA 3S7BA 2F37A 2V0PA 2V5FA 4I9EA 3D9MA 2A5UA 4PS7A 3UT8A 4TUMA 5CMYA 4ILGA 3C3QA 2OVFA 3CHPA 3IHYA 3B7BA 4D10C 2WXLA 4HRNA 4Q69A 1DCEA 1E8YA 2VGXB 2R17C 2VGYA 3NQPA 4L23A 3NBNB 1NI1A 3HVEA 3TWQA 3Q49B 4GZ5A 4WNFA 2IEJA 4G23A 2RKKA 2NSZA 2VJ8A 5M72A 2QY7A 3FTYA 5JHAA 4APOA 3V31A 4GA0A 4BESA 3CVWA 1LTXA 2IOSA 2VSNA 5T3RA 3RRMB 5FZQA 5G55A 2WXOA 1AWCB 4Z68A 3ASFA 1IHGA 3S7JA 4BERA 2J8SD 3PZ1A 2KBXA 3TXNA 2CHZA 5EX0A 3DWLG 4GMRA 4CCAA 2UY1B 4UWLA 3MKRA 2QYJA 5BPPA 1A5EA 2VQ2A 2RD0A 4F53A 2R03A 4ILHB 2WXGA 4CGVA 5HS0A 5ENTD 2FF4A 3FUHA 5LCWJ 1MZCA 3SI5A 3JXJA 4E6HA 1E90A 2GRQB 3AS5A 3CVQA 5FTPA 4I17A 1Z3YA 1E8ZA 1KZOA 2XPIA 3BUAA 3PH0C 2C2LA 3FHEA 2DYSE 4JXTA 3D9JA 3U4TA 3Q5MA 3PDNA 4EBAG 4HRMB 4A63B 3CVUA 2VSXE 4ANUA 3CKCA 2E2EA 4K5AB 4LSZE 4GTMA 4AVXA 4APFA 1OXJA 4XX5A 5ANLA 4J8SA 3UIOC 1QBQA 3U3WA 1SQMA 3MX3A 4RG9A 3ABKE 1DCQA 4DX6D 2V4LA 3MKQA 3Q7AA 3E33A 5KCMA 3UM1A 3U64A 5AENA 3IKOB 4KZCA 3DPYA 4J0UA 4ANXA 5HQ8A 1N0RA 4PH4B 2XEVA 2DZNA 2DYRE 5BW8C 1WDYA 4WWNA 4RLYA 1UJKA 1NA0A 4B93B 4I9CA 2M63A 4HB5A 2LO6A 3T9KA 1N54A 1HG2A 1WAO1 3D9NA 4BFRA 2WXFA 5BT1A 3E30A 4FULA 5ANRA 3D9HA 4EQFA 1KT1A 3FU6A 2P9UG 4RG6A 1MX4A 5ENQD 3S7FA 3TWRA 4PS8A 3HXDA 5JMND 2C0LA 4DI4A 1FT2A 4GA2A 3EJNA 4N39A 4I6EA 1IXVA 3AU5A 3UX4A 3PUKA 3PE3A 1JWGA 2E0IA 3PZ3A 5KJLA 3C3OA 4YNDA 4TXRA 4K0RA 4HI8A 3P1UA 5ENRD 1H2TC 1E7VA 3LEWA 4I43A 2ETCA 4GYYA 2AXZA 2RFMA 2XGSA 2XPZA 2WXQA 3HHMA 2MOWA 5EIBE 1QYMA 2H6HA 4G24A 5ENPD 4I1AA 2XHEA 2X3MA 3BU8A 3FUNA 4IULA 4HORA 1MYOA 2XCBA 4GAAA 1WM5A 4URKA 4I1MA 3UI2A 4GTSA 3QARA 2DBAA 5FWQA 3ZFWA 2KZTB 1JWFA 3JYSA 4F7AA 4FLBA 3L13A 3S7DA 3TL5A 4I6JA 4LNUD 1H6PA 3UUXA 1X5BA 4ACLA 1HO8A 4AIFA 5CERB 3DXMG 4PS3A 3ZYKA 4OVVA 5AQAA 2DVWA 3CVNA 3TXMA 4N2SA 5AYWD 1EPUA 3CVYA 3PZDA 3G2UA 2OV8A 5FINA 4F1PA 4WAFA 4LNGA 1S63A 3D3MA 4QFVA 3HXCA 5C1DA 1LD8A 4AP2A 5JA4D 1U2VG 3OXGA 2PZIA 2J08A 4A1GA 3PREA 4GYWA 4N2QA 3ZIMA 2GRRB 5B1AE 2J9QA 3G2WA 2OEVA 4P29A 2PL2A 3IV0A 2ILRA 4EPZA 3DSXA 3FTUA 1AP7A 4YDEA 1BLXB 3PS6A 3J5QB 2P9SG 4ABNA 4ANWA 1S64A 1K8KG 3NB2A 5CBNA 4GMJA 4JEUA 3VLFA 2QC9A 1IYGA 2DIWA 2UY1A 3QB2A 5EDSA 2F8XK 3DEOA 2UWJG 4UQZA 3SFXA 4XE0A 3G2VA 2I2OA 4OAUC 1QQEA 3FEYA 2H6GA 1K3ZD 5LP0A 2H6IA 1SW6A 4CT0A 2ONDA 2WXKA 1JCRA 1WY6A 4DUIA 4U07A 1UJJA 3ASHA 2YHCA 4GTRA 5EYLA 2BKGA 3Q9UC 2A4ZA 1BD8A 1H6OA 4PUCA 4FJZA 3B7SA 5D2MC 3RU0A 2IU1A 2P58C 2R02A 4K5BA 5H7PA 2CFZA 2L0TB 4KYOB 3V2XA 3CSFA 3E34A 4HOTA 4BX8A 3V2OA 2KXPC 3HXEA 3RSEG 3B7UX 1UW4B 4UWFA 2Y1LE 4L2LA 3CVLA 3RO3A 2IQCA 2KATA 1WG0A 4DX2A 2Y3AA 3T8KA 3UKUG 1HS6A 3EDTB 3FH7A 4JW1A 4HXIA 5HKPA 4CT4A 4N3CA 3ZKJA 5G05C 3GZ1A 5JJ6A 3EU5A 3ZYQA 2KCVA 5EILA 1E96B 4GZDA 4KVMA 2ETAA 1YA0A 4G11A 2OVBA 4HOSA 3O48A 2IJGX 3MCXA 3D9OA 3UM3A 4Q96A 2AVPA 5G05J 3PEVB 3B7TA 4DRXE 3LXUX 5CEAA 1BU9A 1TJCA 4HQDA 3MGBA 2KCKA 1N95A 3VLDA 3VTXA 2AWIA 3SBSA 3LVRE 1NFIE 3AG3E 2ETBA 4G25A 5BXOA 2GROB 3TWWA 1O1RA 4ANVA 1QNFA 3HG0D 2LSVA 4U95D 2EIJE 1ZB1A 2OEWA 3IEGA 1JPLA 4BTAA 3ENEA 2L9BA 4JHJA 1IQRA 2BF0X 2BEDA 5FT9A 4OVUA 3QK0A 2I1JA 2KZTA 3UIPC 3PNTB 5E76A 2LAIA 4GTTA 4EZJA 3K9IA 1UOHA 3FUFA 1QZ2A 3LY9A 3SNXA 3QWVA 3CV0A 4WUYA 3QAQA 4ATZD 2L6BA 3PUJA 3WG7E 1P5QA 4YVQC 4FLHA 2NC9A 4GZ3A 3LJNA 4B8CB 1HU3A 2F8YA 5CRUA 2KM4A 2RFAA 2VYIA 3APFA 1BPOA 1SA4A 5G2NA 2X6KA 4BX9A 3ZHEA 4AEZC 3ASDA 4U7EB 3SFYA 3KSQA 2WQHA 1V54E 2HE0A 2XZDG 3FUEA 1N0QA 1EF1C 3LY8A 3Q75A 2AW6A 2WXMA 2BKKB 4ZHBA 2XENA 4U04A 2ZIRA 4UQXA 3TG5A 1D8DA 3D9IA 1S0PA 3OTNA 3NOCD 4XZ4A 3ONLA 4DJAA 4TV3A 5G04C 2IONA 5JJTA 3FUDA 2FEZA 3G2TA 4LNBA 2PQRA 3SQVA 2H6FA 4UUCA 4FADA 2XQ0A 3RKVA 1S70B 4YVOA 4BT9A 4J8EA 1O5MA 3AJIA 2EILE 5CECB 5G04J 2ZXWE 5KJKA 3RRUA 1W3BA 5D66A 3UQ3A 4FHKA 5A7DB 2OCCE 2WXRA 2ZU6B 5AJDA 3TJPA 4L9PA 4EZKA 3SFZA 3FEXA 3E37A 3EU9A 3DXKG 4N3BA 1E8WA 2PM7A 2V4HC 4LUNU 1IKND 3DSSA 4U0SA 4MBGA 4HLEA 1VDYA 1JUQA 4MS6A 3WXXA 4I2ZA 4LG6A 1N11A 2ZGGA 5EKQD 1H2UA 4AY5A 5DBKA 4YDWA 3Q79A 2V5QC 3DSUA 3S2AA 4L7TA 1PY1A 2P9IG 3FUIA 3R7RA 2VGEA 2DZOA 1OWOA 5LX8A 3CKBA 2LXMA 2YHEA 3DPDA 2EQXA 3ZYMA 2I9CA 4HI9A 4DX7D 2YNQA 4CDMA 3ZN3A 5KBAA 1D9SA 4HS2A 3URZA 4J7WA 3V79K 3DSWA 2J4BA 2VSYA 1HF8A 3BG0B 4CDNA 3D9KA 3R9AB 4TUUA 1TNZA 4XKBA 3CIAA 1IHBA 2JABA 3LDZA 2WB2A 4C0EA 5BV1A 3KD7A 3L6AA 1KLXA 1N94A 4I2WA 2EINE 4BY6A 5IY5E 4G26A 3UT7A 1EDUA 3LJ3A 3I5PA 4NURA 4U8YD 4DI3A 4IN3B 2VTBA 3ONKA 3RJVA 3ZUVB 3FU5A 5AIJA 4KT6B 3CQGB 3QWWA 1LD7A 1LF8A 1FVFA 2J4DA 4GTOA 4R7LA 2R59A 2Y4TA 2XRYA 4BETA 3AS4A 4JA7A 3D9PA 2AXUA 3CSTA 3PZ2A 2PNNA 4A3TA 1ELKA 3TWVA 3FTVA 1OCOE 3FU0A 4F3VA 4GZ6A 2P9KG 2VGXA 2HM8A 4L1BA 3Q73A 4MRUA 4JB8P 4A3VA 2WQ7A 2PM6A 3ZPJA 5KNHD 2MRIA 4J8FA 1TEZA 2LAHA 4JEHA 1HXIA 5FZSA 3FH5A 2XEEA 2WXPA 2AXVA 4G1TA 4AY6A 3EIJA 3HXFA 2X6FA 2XPYA 3JUIA 5KWDA 4FJYA 4CRWA 4JL0A 4C0MA 3HVEB 5CCLA 3ZGQA 5EYPF 4YDYA 4GB9A 1DNPA 1OCCE 4Y6CA 2FBNA 3FWVA 4JC8A 2AJAA 3P2BA 1ZU2A 1N4PA 1FT1A 1N4RA 3C3RA 3E32A 1SA5A 3QWPA 5CHEE 3TWTA 2MYOA 3LPZA 2R2LA 4GCOA 1NA3A 5CEDB 1HG5A 4PDXA 3UMVA 3EHMA 4CGWA 3UM2A 3ASOE 1NZNA 4TRQA 3CVXA 3MV3B 1HFAA 3HRAA 3FUMA 1O1TA 2B6CA 5A23A 4RSYA 3JXIA 3FP3A 2PQNA 3DSVA 3SGHA 3E4BA 4DX5D 4H7YA 2RG8A 1UN9A 5AAOA 3UXGA 2XS8A 1INZA 1MX2A 2XGOA 2C0MA 3SHFA 3BQOA 4HBDA 3EHRA 2J09A 3GZ2A 2I6HA 4B94A 4JD2G 2HYZA 4JHRA 2CG2A 1TYQG 3F6QA 1JCSA 1X81A 4DX1A 2IFUA 5JJ7A 4F6RD 3FH8A 1TNOA 2GRPB 2JEKA 5AARA 4IYPA 4JHKA 2NXPA 3PVLA 4H7XA 2WXJA 2GRLA 3APDA 1FCHA 2QYUA 4WNEA 1XGWA 4GA1A 3C5RA 4BWRA 2FO7A 3CHOA 4WNGA 1N4SA 2GRNB 3MKQB 4L2YA 3T5VA 4M7CA 3OAWA 4X8QA 3SO8A 3V30A 5J08A 4A55A 5FQ4A 3JQ0A 4OYSA 3ASGA 3PRZA 3FUKA 5E75A 4AJWA 1Z5SC 3G2SA 2HR2A 1B89A 2Y0BG 1E8XA 3MV2B 2WXNA 3GYZA 1ELRA 2A5EA 3HYMB 1K1AA 3PEUB 4RVBA 5EN5D 4LERA 2YINA 3CQCB 2ZGDA 5ITZF 4J8YA 3CVPA 4WWOA 1TN6A 1UN8A 3TWUA 1PAQA 5KNGA 3ASNE 3RIBA 3BEEA 4FU3A 1EYHA 1SZ9A 5AJLA 5EIDA 2L0IA 5KJNA 3MA5A 3UTMA 1N52A 4TXPA 4U96D 3DEPA 4NQ0A 1XNFA 1TNUA 4E85A 1BI7B 3FDHA 3ULYA 4CDRA 4J8DA 2XRZA 1MJ0A 2XGMA 3CHSA 4N5QA 4GPKA 4U63A 1OWLA 3CR3A 1TN7A 2CFUA 2IO2C 3U9WA 1OWMA 1D8EA 3DSTA 1Z3XA 5FJYA 3KEZA 1H2VC 3SF4A 1KZPA 1DVPA 3LY7A 4XEIG 1YYHA 3LCAA 5ENNA 4Y6WA 4HOQA 3CK8A 5AQ9A 3LKUA 4N5CA 3KSLA 4ZFHA 3R7QA 1HH8A 4CYMD 5JHBA 4N3AA 4LRZA 3L22A 3QJZA 5FQ8A 3HXBA 4HFGA 3Q78A 3W9GA 4GTQA 2LXLA 1RW2A 2IF4A 4JVSA 4CZ2D 2LUHA 3CLJA 1NL4A 4NACA 5BUZA 4BEPA 4YDOA 4B89A 2QFCA 3MYVA 1SZAA 2Y69E 4MKTA 5D0OD 1TR4A 3FTWA 4GU5A 5FQ6A 2WPVA 2WMOA 2BUGA 4UI9C 4XI0A 1U3CA 2P9LG 5ARGA 5CMWA 3N71A 3QDNA 3ULQA 5T8IA 3PZ4A 3L82A 2LNIA 4HRLA 4KXKB 3ABME 4ACKA 3SZ7A 4C48B 2VSOE 2QZAA 3NOGD 4FP7A 3MJWA 4I6GA 3CEQA 2GW1A 3CHRA 3ZEFA 3NAWA 3CK7A 4U0ZA 4O1PA 2KCLA 1K1BA 3C72A 4UI9J 5LCWC 3AG1E 1ZBPA 3ZU7B 2KC7A 4K03A 1HE8A 2GRMA 3MZLB 2X38A 3TWXA 3HDXA 2X6JA 4WNDA 3JCKC 1HZ4A 4C9BB 1Z6TA 3IXEA 5FIOA 3FFLA 4MLPA 4KBQA 3DBSA 3SBTB 3ML9A 2DCPA 5CBOA 3Q7FA 1KT0A 5LFAA 3NZUA 3KEAA 5A6CA 3FTSA 2OOEA 1L5JA 3UINC 1MQSA 1OY3D 1TNYA 4JPSA 3CHQA 2X6IA 3QOUA 3R9MA 2WXIA 4KVOA 1BI8B 3RK6A 1OWPA 4EECA 3IBEA 3CGHA 3ESKA 3RAUA 4KZ0A 2WM9A 3U66A 4OAVB 3IHVA 2F0YA 3FUJA 4XIFA 4I1OB 4ME2A 3HIZA 5AQ7A 5HRYA 2WXHA 1V55E 2EIME 1O1SA 3LVQE 2NYJA 2MHKA 4JA9A 3LYAA 4BSZB 1E7UA 4QQIA 3ULEG 2CHXA 2P9NG 4ILIA 4BSXA 4G8LA 4XKCA 4NIKA 5BNWA 1FVHA 1KPSB 5B3SE 4W9RA 2CG3A 2R5SA 3ZXSA 4O60A 3B13A 4EZLA 4UQYA 3ESLA 4GYOA 4Q94A 3KS2A 3D9LA 3EIQC 4GTPA 3AG4E 4IRUA 2XEHA 2Y4UA 1RZ4A 3BG1B 4RQIA 2BTDA 4DPRA 2WVIA 1TJFA 4G2VA 1DC2A 3KAEA 3NF1A 3Q4AB 1N9AA 4XI9A 2EIKE 3LS8A 4UWHA 2L6JA 3ISMC 3RRNB 3AU4A 2XS1A 3I3NA 3ZXPA 3EUVA 4GPMA 3QC1A 3RO2A 3AS8A 1Y6IA 4ATGA 2P9PG 5C2YA 3DRAA 4G8KA 4HNAD 2WMNA 3UPVA 3VTYA 4DLQA 1IQUA 2HO1A 2IO3C 1MHQA 4AXHA 3Q47B 3FTXA 4GCNA 3UT4A 3L17A 3ZHEB 4EBAA 2YQ8A 4AM9A 4TXQA 3O4ZA 4K5CA 4B8AA 1OCZE 5HI7A 3TAXA 2Q7FA 3TGOA 1TNBA 3J5PA 2XCCA 5BXUA 2FO1E 4V3IA 4UI9K 2GGFA 3L08A 5CRVA 4UWKA 4HLLA 5ENSD 1H6KA 3QKYA 3Q15A 1OWNA 4M3OA 5CCMA 1OT8A 4WWPA 5FQ7A 2ZISA 4GZCA 2B0OE 3X2QE 4B0ZA 3ZRHA 3FU3A 4LCTA 2IOLA 2JLBA 4U8VD 2J49A 3GW4A 3NZSA 5FZRA 1UG3A 4HOUA 4AOFA 3ZNGA 3VLEA 4AV7A 1A17A 3I4GA 3UM0A 3CHMA 3W9FA 4FC8A 3CK9A 4DK5A 3MEKA 1N4QA 3T8MA 5J90A 3B95A 4CEMA 1SVXA 3PE4A 3C98A 1OCRE 1OUVA 5EX3A 3AG2E 1MX6A 3L9TA 1U3DA 3CVVA 4J6IA 1H19A 4JZYA 1HX8A 3FTZA 3SY2A 4DLOA 4BTBA 3UKRG 2X6HA 1PC2A 3L54A 1H0AA 2P2CP 5AQBA 4F1SA 4EHMA 1YCSB 4GMLA 5B1BE 3ZYLA 1JCQA 1G3NB 2XZTG 3B7RL 4U0UA 3I4RB 3QNKA 3ML8A 5T4YA 3GZSA 3ZW3A 4O1OA 1Q2ZA 1NP7A 4FHJA 4GTVA 3EHNA 3ABLE 5ENOD 1Y8MA 2DWZA 3Q9NC
chains in the Genus database with same CATH topology
5CECB 4OAVB 4DX1A 4U8VD 1MJ0A 5CBNA 3NOGD 5D66A 4GPMA 4F6RD 5KWDA 5EILA 1MYOA 2QC9A 5AARA 3AAAC 3LJNA 1IHBA 2JABA 2ETAA 4N5QA 3ZNGA 5AQ7A 1DCQA 5HRYA 2F8YA 4O1PA 4DX6D 2F8XK 3EU9A 1K1BA 5EYPF 3JUEA 3DEOA 3UI2A 4BESA 2RFAA 4YDYA 4G8KA 3V31A 2NYJA 2V4HC 4HNAD 3C5RA 3W9FA 3EHQA 4OAUC 1IKND 1N0RA 3ZU7B 4BSZB 4QQIA 5AN8A 2AJAA 3B95A 4LNUD 1K3ZD 2DZNA 1SVXA 1WDYA 3SO8A 4U8YD 1SW6A 3V30A 1AWCB 4Z68A 4RLYA 1YYHA 4B93B 4DRXE 4HB5A 4DUIA 5CEAA 5CERB 3T9KA 3TWSA 3TWXA 5AQ9A 1BU9A 4HQDA 4BERA 4LG6A 3ZUVB 1N11A 4G8LA 2ZGGA 3TWTA 2J8SD 2MYOA 4ZFHA 1MX6A 5EYLA 4CYMD 2BKGA 4NIKA 2KBXA 1YMPA 3IXEA 3D9HA 3Q9UC 5AQAA 1NFIE 5FIOA 5CEDB 2DVWA 2ETBA 4GMRA 4YDWA 5BXOA 1MX4A 5ENQD 1BD8A 2V5QC 3TWWA 2HE0A 3TWRA 2XZDG 4BETA 5JMND 2Y0BG 3W9GA 1N0QA 3HG0D 5CBOA 5FINA 4F1PA 2BKKB 2QYJA 4U95D 4K5CA 4CZ2D 4ZHBA 1IXVA 2VGEA 2XENA 2A5EA 2DZOA 4O60A 2PNNA 1A5EA 1K1AA 4K5BA 3KEAA 4QFVA 3HRAA 2P2CP 5AQBA 3V2XA 5EN5D 2F37A 3J5PA 3TWVA 5JA4D 4BEPA 3V2OA 2KXPC 3NOCD 1YCSB 2ZGDA 3JXIA 4TUMA 2XEHA 5HS0A 5ENTD 5ITZF 5BXUA 2FO1E 2Y1LE 4J8YA 1G3NB 2XZTG 1OY3D 3B7BA 4DX5D 4HI9A 3TWUA 4DX7D 1TR4A 4JB8P 4HI8A 5KNGA 5AAOA 3UXGA 3JXJA 5ENRD 4HRNA 5KBAA 1D9SA 4O1OA 1WG0A 4UUCA 1MX2A 4DX2A 2ETCA 4HBDA 5KNHD 4HLLA 3EHRA 5ENSD 4J7WA 1DC2A 1BI8B 3T8KA 5EIDA 1UOHA 2RFMA 3V79K 3NBNB 1S70B 1OT8A 5EIBE 1AP7A 1QYMA 3UTMA 5ENOD 1BLXB 5ENPD 2DWZA 3J5QB 4U96D 5HKPA 2XEEA 3DEPA 4HRLA 4HRMB 4A63B 3Q9NC 2B0OE 4ATZD 3F6QA 2L6BA 4K5AB 4LSZE 3ZKJA 3AJIA 1BI7B 4C48B 3TWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CEC B;  4OAV B;  4DX1 A;  4U8V D;  1MJ0 A;  5CBN A;  3NOG D;  5D66 A;  4GPM A;  4F6R D;  5KWD A;  5EIL A;  1MYO A;  2QC9 A;  5AAR A;  3AAA C;  3LJN A;  1IHB A;  2JAB A;  2ETA A;  4N5Q A;  3ZNG A;  5AQ7 A;  1DCQ A;  5HRY A;  2F8Y A;  4O1P A;  4DX6 D;  2F8X K;  3EU9 A;  1K1B A;  5EYP F;  3JUE A;  3DEO A;  3UI2 A;  4BES A;  2RFA A;  4YDY A;  4G8K A;  3V31 A;  2NYJ A;  2V4H C;  4HNA D;  3C5R A;  3W9F A;  3EHQ A;  4OAU C;  1IKN D;  1N0R A;  3ZU7 B;  4BSZ B;  4QQI A;  5AN8 A;  2AJA A;  3B95 A;  4LNU D;  1K3Z D;  2DZN A;  1SVX A;  1WDY A;  3SO8 A;  4U8Y D;  1SW6 A;  3V30 A;  1AWC B;  4Z68 A;  4RLY A;  1YYH A;  4B93 B;  4DRX E;  4HB5 A;  4DUI A;  5CEA A;  5CER B;  3T9K A;  3TWS A;  3TWX A;  5AQ9 A;  1BU9 A;  4HQD A;  4BER A;  4LG6 A;  3ZUV B;  1N11 A;  4G8L A;  2ZGG A;  3TWT A;  2J8S D;  2MYO A;  4ZFH A;  1MX6 A;  5EYL A;  4CYM D;  2BKG A;  4NIK A;  2KBX A;  1YMP A;  3IXE A;  3D9H A;  3Q9U C;  5AQA A;  1NFI E;  5FIO A;  5CED B;  2DVW A;  2ETB A;  4GMR A;  4YDW A;  5BXO A;  1MX4 A;  5ENQ D;  1BD8 A;  2V5Q C;  3TWW A;  2HE0 A;  3TWR A;  2XZD G;  4BET A;  5JMN D;  2Y0B G;  3W9G A;  1N0Q A;  3HG0 D;  5CBO A;  5FIN A;  4F1P A;  2BKK B;  2QYJ A;  4U95 D;  4K5C A;  4CZ2 D;  4ZHB A;  1IXV A;  2VGE A;  2XEN A;  2A5E A;  2DZO A;  4O60 A;  2PNN A;  1A5E A;  1K1A A;  4K5B A;  3KEA A;  4QFV A;  3HRA A;  2P2C P;  5AQB A;  3V2X A;  5EN5 D;  2F37 A;  3J5P A;  3TWV A;  5JA4 D;  4BEP A;  3V2O A;  2KXP C;  3NOC D;  1YCS B;  2ZGD A;  3JXI A;  4TUM A;  2XEH A;  5HS0 A;  5ENT D;  5ITZ F;  5BXU A;  2FO1 E;  2Y1L E;  4J8Y A;  1G3N B;  2XZT G;  1OY3 D;  3B7B A;  4DX5 D;  4HI9 A;  3TWU A;  4DX7 D;  1TR4 A;  4JB8 P;  4HI8 A;  5KNG A;  5AAO A;  3UXG A;  3JXJ A;  5ENR D;  4HRN A;  5KBA A;  1D9S A;  4O1O A;  1WG0 A;  4UUC A;  1MX2 A;  4DX2 A;  2ETC A;  4HBD A;  5KNH D;  4HLL A;  3EHR A;  5ENS D;  4J7W A;  1DC2 A;  1BI8 B;  3T8K A;  5EID A;  1UOH A;  2RFM A;  3V79 K;  3NBN B;  1S70 B;  1OT8 A;  5EIB E;  1AP7 A;  1QYM A;  3UTM A;  5ENO D;  1BLX B;  5ENP D;  2DWZ A;  3J5Q B;  4U96 D;  5HKP A;  2XEE A;  3DEP A;  4HRL A;  4HRM B;  4A63 B;  3Q9N C;  2B0O E;  4ATZ D;  3F6Q A;  2L6B A;  4K5A B;  4LSZ E;  3ZKJ A;  3AJI A;  1BI7 B;  4C48 B;  3TWQ A; 
#chains in the Genus database with same CATH topology
 3TG4 A;  3AAA C;  3APC A;  5D0Q D;  1ELW A;  4UWG A;  4FA6 A;  3T5X A;  2I1K A;  3FY4 A;  4LEU A;  2LSU A;  3JUE A;  4BT8 A;  2FUL A;  5BV0 A;  3EHQ A;  5AN8 A;  2CHW A;  3OXF A;  1FPP A;  5LOZ A;  3TWS A;  5DIZ A;  4HVB A;  3FUL A;  4NRH B;  4KMO A;  2J07 A;  2FI7 A;  3ZVV A;  2WQ6 A;  1YMP A;  2R05 A;  2VTB B;  3SD5 A;  4O6F A;  3PNL B;  3JQ1 A;  2V8S E;  1GW6 A;  4A1S A;  2IY0 C;  1TN8 A;  4U8H A;  5KJM A;  3L16 A;  3OXL A;  5ARF A;  3S7B A;  2F37 A;  2V0P A;  2V5F A;  4I9E A;  3D9M A;  2A5U A;  4PS7 A;  3UT8 A;  4TUM A;  5CMY A;  4ILG A;  3C3Q A;  2OVF A;  3CHP A;  3IHY A;  3B7B A;  4D10 C;  2WXL A;  4HRN A;  4Q69 A;  1DCE A;  1E8Y A;  2VGX B;  2R17 C;  2VGY A;  3NQP A;  4L23 A;  3NBN B;  1NI1 A;  3HVE A;  3TWQ A;  3Q49 B;  4GZ5 A;  4WNF A;  2IEJ A;  4G23 A;  2RKK A;  2NSZ A;  2VJ8 A;  5M72 A;  2QY7 A;  3FTY A;  5JHA A;  4APO A;  3V31 A;  4GA0 A;  4BES A;  3CVW A;  1LTX A;  2IOS A;  2VSN A;  5T3R A;  3RRM B;  5FZQ A;  5G55 A;  2WXO A;  1AWC B;  4Z68 A;  3ASF A;  1IHG A;  3S7J A;  4BER A;  2J8S D;  3PZ1 A;  2KBX A;  3TXN A;  2CHZ A;  5EX0 A;  3DWL G;  4GMR A;  4CCA A;  2UY1 B;  4UWL A;  3MKR A;  2QYJ A;  5BPP A;  1A5E A;  2VQ2 A;  2RD0 A;  4F53 A;  2R03 A;  4ILH B;  2WXG A;  4CGV A;  5HS0 A;  5ENT D;  2FF4 A;  3FUH A;  5LCW J;  1MZC A;  3SI5 A;  3JXJ A;  4E6H A;  1E90 A;  2GRQ B;  3AS5 A;  3CVQ A;  5FTP A;  4I17 A;  1Z3Y A;  1E8Z A;  1KZO A;  2XPI A;  3BUA A;  3PH0 C;  2C2L A;  3FHE A;  2DYS E;  4JXT A;  3D9J A;  3U4T A;  3Q5M A;  3PDN A;  4EBA G;  4HRM B;  4A63 B;  3CVU A;  2VSX E;  4ANU A;  3CKC A;  2E2E A;  4K5A B;  4LSZ E;  4GTM A;  4AVX A;  4APF A;  1OXJ A;  4XX5 A;  5ANL A;  4J8S A;  3UIO C;  1QBQ A;  3U3W A;  1SQM A;  3MX3 A;  4RG9 A;  3ABK E;  1DCQ A;  4DX6 D;  2V4L A;  3MKQ A;  3Q7A A;  3E33 A;  5KCM A;  3UM1 A;  3U64 A;  5AEN A;  3IKO B;  4KZC A;  3DPY A;  4J0U A;  4ANX A;  5HQ8 A;  1N0R A;  4PH4 B;  2XEV A;  2DZN A;  2DYR E;  5BW8 C;  1WDY A;  4WWN A;  4RLY A;  1UJK A;  1NA0 A;  4B93 B;  4I9C A;  2M63 A;  4HB5 A;  2LO6 A;  3T9K A;  1N54 A;  1HG2 A;  1WAO 1;  3D9N A;  4BFR A;  2WXF A;  5BT1 A;  3E30 A;  4FUL A;  5ANR A;  3D9H A;  4EQF A;  1KT1 A;  3FU6 A;  2P9U G;  4RG6 A;  1MX4 A;  5ENQ D;  3S7F A;  3TWR A;  4PS8 A;  3HXD A;  5JMN D;  2C0L A;  4DI4 A;  1FT2 A;  4GA2 A;  3EJN A;  4N39 A;  4I6E A;  1IXV A;  3AU5 A;  3UX4 A;  3PUK A;  3PE3 A;  1JWG A;  2E0I A;  3PZ3 A;  5KJL A;  3C3O A;  4YND A;  4TXR A;  4K0R A;  4HI8 A;  3P1U A;  5ENR D;  1H2T C;  1E7V A;  3LEW A;  4I43 A;  2ETC A;  4GYY A;  2AXZ A;  2RFM A;  2XGS A;  2XPZ A;  2WXQ A;  3HHM A;  2MOW A;  5EIB E;  1QYM A;  2H6H A;  4G24 A;  5ENP D;  4I1A A;  2XHE A;  2X3M A;  3BU8 A;  3FUN A;  4IUL A;  4HOR A;  1MYO A;  2XCB A;  4GAA A;  1WM5 A;  4URK A;  4I1M A;  3UI2 A;  4GTS A;  3QAR A;  2DBA A;  5FWQ A;  3ZFW A;  2KZT B;  1JWF A;  3JYS A;  4F7A A;  4FLB A;  3L13 A;  3S7D A;  3TL5 A;  4I6J A;  4LNU D;  1H6P A;  3UUX A;  1X5B A;  4ACL A;  1HO8 A;  4AIF A;  5CER B;  3DXM G;  4PS3 A;  3ZYK A;  4OVV A;  5AQA A;  2DVW A;  3CVN A;  3TXM A;  4N2S A;  5AYW D;  1EPU A;  3CVY A;  3PZD A;  3G2U A;  2OV8 A;  5FIN A;  4F1P A;  4WAF A;  4LNG A;  1S63 A;  3D3M A;  4QFV A;  3HXC A;  5C1D A;  1LD8 A;  4AP2 A;  5JA4 D;  1U2V G;  3OXG A;  2PZI A;  2J08 A;  4A1G A;  3PRE A;  4GYW A;  4N2Q A;  3ZIM A;  2GRR B;  5B1A E;  2J9Q A;  3G2W A;  2OEV A;  4P29 A;  2PL2 A;  3IV0 A;  2ILR A;  4EPZ A;  3DSX A;  3FTU A;  1AP7 A;  4YDE A;  1BLX B;  3PS6 A;  3J5Q B;  2P9S G;  4ABN A;  4ANW A;  1S64 A;  1K8K G;  3NB2 A;  5CBN A;  4GMJ A;  4JEU A;  3VLF A;  2QC9 A;  1IYG A;  2DIW A;  2UY1 A;  3QB2 A;  5EDS A;  2F8X K;  3DEO A;  2UWJ G;  4UQZ A;  3SFX A;  4XE0 A;  3G2V A;  2I2O A;  4OAU C;  1QQE A;  3FEY A;  2H6G A;  1K3Z D;  5LP0 A;  2H6I A;  1SW6 A;  4CT0 A;  2OND A;  2WXK A;  1JCR A;  1WY6 A;  4DUI A;  4U07 A;  1UJJ A;  3ASH A;  2YHC A;  4GTR A;  5EYL A;  2BKG A;  3Q9U C;  2A4Z A;  1BD8 A;  1H6O A;  4PUC A;  4FJZ A;  3B7S A;  5D2M C;  3RU0 A;  2IU1 A;  2P58 C;  2R02 A;  4K5B A;  5H7P A;  2CFZ A;  2L0T B;  4KYO B;  3V2X A;  3CSF A;  3E34 A;  4HOT A;  4BX8 A;  3V2O A;  2KXP C;  3HXE A;  3RSE G;  3B7U X;  1UW4 B;  4UWF A;  2Y1L E;  4L2L A;  3CVL A;  3RO3 A;  2IQC A;  2KAT A;  1WG0 A;  4DX2 A;  2Y3A A;  3T8K A;  3UKU G;  1HS6 A;  3EDT B;  3FH7 A;  4JW1 A;  4HXI A;  5HKP A;  4CT4 A;  4N3C A;  3ZKJ A;  5G05 C;  3GZ1 A;  5JJ6 A;  3EU5 A;  3ZYQ A;  2KCV A;  5EIL A;  1E96 B;  4GZD A;  4KVM A;  2ETA A;  1YA0 A;  4G11 A;  2OVB A;  4HOS A;  3O48 A;  2IJG X;  3MCX A;  3D9O A;  3UM3 A;  4Q96 A;  2AVP A;  5G05 J;  3PEV B;  3B7T A;  4DRX E;  3LXU X;  5CEA A;  1BU9 A;  1TJC A;  4HQD A;  3MGB A;  2KCK A;  1N95 A;  3VLD A;  3VTX A;  2AWI A;  3SBS A;  3LVR E;  1NFI E;  3AG3 E;  2ETB A;  4G25 A;  5BXO A;  2GRO B;  3TWW A;  1O1R A;  4ANV A;  1QNF A;  3HG0 D;  2LSV A;  4U95 D;  2EIJ E;  1ZB1 A;  2OEW A;  3IEG A;  1JPL A;  4BTA A;  3ENE A;  2L9B A;  4JHJ A;  1IQR A;  2BF0 X;  2BED A;  5FT9 A;  4OVU A;  3QK0 A;  2I1J A;  2KZT A;  3UIP C;  3PNT B;  5E76 A;  2LAI A;  4GTT A;  4EZJ A;  3K9I A;  1UOH A;  3FUF A;  1QZ2 A;  3LY9 A;  3SNX A;  3QWV A;  3CV0 A;  4WUY A;  3QAQ A;  4ATZ D;  2L6B A;  3PUJ A;  3WG7 E;  1P5Q A;  4YVQ C;  4FLH A;  2NC9 A;  4GZ3 A;  3LJN A;  4B8C B;  1HU3 A;  2F8Y A;  5CRU A;  2KM4 A;  2RFA A;  2VYI A;  3APF A;  1BPO A;  1SA4 A;  5G2N A;  2X6K A;  4BX9 A;  3ZHE A;  4AEZ C;  3ASD A;  4U7E B;  3SFY A;  3KSQ A;  2WQH A;  1V54 E;  2HE0 A;  2XZD G;  3FUE A;  1N0Q A;  1EF1 C;  3LY8 A;  3Q75 A;  2AW6 A;  2WXM A;  2BKK B;  4ZHB A;  2XEN A;  4U04 A;  2ZIR A;  4UQX A;  3TG5 A;  1D8D A;  3D9I A;  1S0P A;  3OTN A;  3NOC D;  4XZ4 A;  3ONL A;  4DJA A;  4TV3 A;  5G04 C;  2ION A;  5JJT A;  3FUD A;  2FEZ A;  3G2T A;  4LNB A;  2PQR A;  3SQV A;  2H6F A;  4UUC A;  4FAD A;  2XQ0 A;  3RKV A;  1S70 B;  4YVO A;  4BT9 A;  4J8E A;  1O5M A;  3AJI A;  2EIL E;  5CEC B;  5G04 J;  2ZXW E;  5KJK A;  3RRU A;  1W3B A;  5D66 A;  3UQ3 A;  4FHK A;  5A7D B;  2OCC E;  2WXR A;  2ZU6 B;  5AJD A;  3TJP A;  4L9P A;  4EZK A;  3SFZ A;  3FEX A;  3E37 A;  3EU9 A;  3DXK G;  4N3B A;  1E8W A;  2PM7 A;  2V4H C;  4LUN U;  1IKN D;  3DSS A;  4U0S A;  4MBG A;  4HLE A;  1VDY A;  1JUQ A;  4MS6 A;  3WXX A;  4I2Z A;  4LG6 A;  1N11 A;  2ZGG A;  5EKQ D;  1H2U A;  4AY5 A;  5DBK A;  4YDW A;  3Q79 A;  2V5Q C;  3DSU A;  3S2A A;  4L7T A;  1PY1 A;  2P9I G;  3FUI A;  3R7R A;  2VGE A;  2DZO A;  1OWO A;  5LX8 A;  3CKB A;  2LXM A;  2YHE A;  3DPD A;  2EQX A;  3ZYM A;  2I9C A;  4HI9 A;  4DX7 D;  2YNQ A;  4CDM A;  3ZN3 A;  5KBA A;  1D9S A;  4HS2 A;  3URZ A;  4J7W A;  3V79 K;  3DSW A;  2J4B A;  2VSY A;  1HF8 A;  3BG0 B;  4CDN A;  3D9K A;  3R9A B;  4TUU A;  1TNZ A;  4XKB A;  3CIA A;  1IHB A;  2JAB A;  3LDZ A;  2WB2 A;  4C0E A;  5BV1 A;  3KD7 A;  3L6A A;  1KLX A;  1N94 A;  4I2W A;  2EIN E;  4BY6 A;  5IY5 E;  4G26 A;  3UT7 A;  1EDU A;  3LJ3 A;  3I5P A;  4NUR A;  4U8Y D;  4DI3 A;  4IN3 B;  2VTB A;  3ONK A;  3RJV A;  3ZUV B;  3FU5 A;  5AIJ A;  4KT6 B;  3CQG B;  3QWW A;  1LD7 A;  1LF8 A;  1FVF A;  2J4D A;  4GTO A;  4R7L A;  2R59 A;  2Y4T A;  2XRY A;  4BET A;  3AS4 A;  4JA7 A;  3D9P A;  2AXU A;  3CST A;  3PZ2 A;  2PNN A;  4A3T A;  1ELK A;  3TWV A;  3FTV A;  1OCO E;  3FU0 A;  4F3V A;  4GZ6 A;  2P9K G;  2VGX A;  2HM8 A;  4L1B A;  3Q73 A;  4MRU A;  4JB8 P;  4A3V A;  2WQ7 A;  2PM6 A;  3ZPJ A;  5KNH D;  2MRI A;  4J8F A;  1TEZ A;  2LAH A;  4JEH A;  1HXI A;  5FZS A;  3FH5 A;  2XEE A;  2WXP A;  2AXV A;  4G1T A;  4AY6 A;  3EIJ A;  3HXF A;  2X6F A;  2XPY A;  3JUI A;  5KWD A;  4FJY A;  4CRW A;  4JL0 A;  4C0M A;  3HVE B;  5CCL A;  3ZGQ A;  5EYP F;  4YDY A;  4GB9 A;  1DNP A;  1OCC E;  4Y6C A;  2FBN A;  3FWV A;  4JC8 A;  2AJA A;  3P2B A;  1ZU2 A;  1N4P A;  1FT1 A;  1N4R A;  3C3R A;  3E32 A;  1SA5 A;  3QWP A;  5CHE E;  3TWT A;  2MYO A;  3LPZ A;  2R2L A;  4GCO A;  1NA3 A;  5CED B;  1HG5 A;  4PDX A;  3UMV A;  3EHM A;  4CGW A;  3UM2 A;  3ASO E;  1NZN A;  4TRQ A;  3CVX A;  3MV3 B;  1HFA A;  3HRA A;  3FUM A;  1O1T A;  2B6C A;  5A23 A;  4RSY A;  3JXI A;  3FP3 A;  2PQN A;  3DSV A;  3SGH A;  3E4B A;  4DX5 D;  4H7Y A;  2RG8 A;  1UN9 A;  5AAO A;  3UXG A;  2XS8 A;  1INZ A;  1MX2 A;  2XGO A;  2C0M A;  3SHF A;  3BQO A;  4HBD A;  3EHR A;  2J09 A;  3GZ2 A;  2I6H A;  4B94 A;  4JD2 G;  2HYZ A;  4JHR A;  2CG2 A;  1TYQ G;  3F6Q A;  1JCS A;  1X81 A;  4DX1 A;  2IFU A;  5JJ7 A;  4F6R D;  3FH8 A;  1TNO A;  2GRP B;  2JEK A;  5AAR A;  4IYP A;  4JHK A;  2NXP A;  3PVL A;  4H7X A;  2WXJ A;  2GRL A;  3APD A;  1FCH A;  2QYU A;  4WNE A;  1XGW A;  4GA1 A;  3C5R A;  4BWR A;  2FO7 A;  3CHO A;  4WNG A;  1N4S A;  2GRN B;  3MKQ B;  4L2Y A;  3T5V A;  4M7C A;  3OAW A;  4X8Q A;  3SO8 A;  3V30 A;  5J08 A;  4A55 A;  5FQ4 A;  3JQ0 A;  4OYS A;  3ASG A;  3PRZ A;  3FUK A;  5E75 A;  4AJW A;  1Z5S C;  3G2S A;  2HR2 A;  1B89 A;  2Y0B G;  1E8X A;  3MV2 B;  2WXN A;  3GYZ A;  1ELR A;  2A5E A;  3HYM B;  1K1A A;  3PEU B;  4RVB A;  5EN5 D;  4LER A;  2YIN A;  3CQC B;  2ZGD A;  5ITZ F;  4J8Y A;  3CVP A;  4WWO A;  1TN6 A;  1UN8 A;  3TWU A;  1PAQ A;  5KNG A;  3ASN E;  3RIB A;  3BEE A;  4FU3 A;  1EYH A;  1SZ9 A;  5AJL A;  5EID A;  2L0I A;  5KJN A;  3MA5 A;  3UTM A;  1N52 A;  4TXP A;  4U96 D;  3DEP A;  4NQ0 A;  1XNF A;  1TNU A;  4E85 A;  1BI7 B;  3FDH A;  3ULY A;  4CDR A;  4J8D A;  2XRZ A;  1MJ0 A;  2XGM A;  3CHS A;  4N5Q A;  4GPK A;  4U63 A;  1OWL A;  3CR3 A;  1TN7 A;  2CFU A;  2IO2 C;  3U9W A;  1OWM A;  1D8E A;  3DST A;  1Z3X A;  5FJY A;  3KEZ A;  1H2V C;  3SF4 A;  1KZP A;  1DVP A;  3LY7 A;  4XEI G;  1YYH A;  3LCA A;  5ENN A;  4Y6W A;  4HOQ A;  3CK8 A;  5AQ9 A;  3LKU A;  4N5C A;  3KSL A;  4ZFH A;  3R7Q A;  1HH8 A;  4CYM D;  5JHB A;  4N3A A;  4LRZ A;  3L22 A;  3QJZ A;  5FQ8 A;  3HXB A;  4HFG A;  3Q78 A;  3W9G A;  4GTQ A;  2LXL A;  1RW2 A;  2IF4 A;  4JVS A;  4CZ2 D;  2LUH A;  3CLJ A;  1NL4 A;  4NAC A;  5BUZ A;  4BEP A;  4YDO A;  4B89 A;  2QFC A;  3MYV A;  1SZA A;  2Y69 E;  4MKT A;  5D0O D;  1TR4 A;  3FTW A;  4GU5 A;  5FQ6 A;  2WPV A;  2WMO A;  2BUG A;  4UI9 C;  4XI0 A;  1U3C A;  2P9L G;  5ARG A;  5CMW A;  3N71 A;  3QDN A;  3ULQ A;  5T8I A;  3PZ4 A;  3L82 A;  2LNI A;  4HRL A;  4KXK B;  3ABM E;  4ACK A;  3SZ7 A;  4C48 B;  2VSO E;  2QZA A;  3NOG D;  4FP7 A;  3MJW A;  4I6G A;  3CEQ A;  2GW1 A;  3CHR A;  3ZEF A;  3NAW A;  3CK7 A;  4U0Z A;  4O1P A;  2KCL A;  1K1B A;  3C72 A;  4UI9 J;  5LCW C;  3AG1 E;  1ZBP A;  3ZU7 B;  2KC7 A;  4K03 A;  1HE8 A;  2GRM A;  3MZL B;  2X38 A;  3TWX A;  3HDX A;  2X6J A;  4WND A;  3JCK C;  1HZ4 A;  4C9B B;  1Z6T A;  3IXE A;  5FIO A;  3FFL A;  4MLP A;  4KBQ A;  3DBS A;  3SBT B;  3ML9 A;  2DCP A;  5CBO A;  3Q7F A;  1KT0 A;  5LFA A;  3NZU A;  3KEA A;  5A6C A;  3FTS A;  2OOE A;  1L5J A;  3UIN C;  1MQS A;  1OY3 D;  1TNY A;  4JPS A;  3CHQ A;  2X6I A;  3QOU A;  3R9M A;  2WXI A;  4KVO A;  1BI8 B;  3RK6 A;  1OWP A;  4EEC A;  3IBE A;  3CGH A;  3ESK A;  3RAU A;  4KZ0 A;  2WM9 A;  3U66 A;  4OAV B;  3IHV A;  2F0Y A;  3FUJ A;  4XIF A;  4I1O B;  4ME2 A;  3HIZ A;  5AQ7 A;  5HRY A;  2WXH A;  1V55 E;  2EIM E;  1O1S A;  3LVQ E;  2NYJ A;  2MHK A;  4JA9 A;  3LYA A;  4BSZ B;  1E7U A;  4QQI A;  3ULE G;  2CHX A;  2P9N G;  4ILI A;  4BSX A;  4G8L A;  4XKC A;  4NIK A;  5BNW A;  1FVH A;  1KPS B;  5B3S E;  4W9R A;  2CG3 A;  2R5S A;  3ZXS A;  4O60 A;  3B13 A;  4EZL A;  4UQY A;  3ESL A;  4GYO A;  4Q94 A;  3KS2 A;  3D9L A;  3EIQ C;  4GTP A;  3AG4 E;  4IRU A;  2XEH A;  2Y4U A;  1RZ4 A;  3BG1 B;  4RQI A;  2BTD A;  4DPR A;  2WVI A;  1TJF A;  4G2V A;  1DC2 A;  3KAE A;  3NF1 A;  3Q4A B;  1N9A A;  4XI9 A;  2EIK E;  3LS8 A;  4UWH A;  2L6J A;  3ISM C;  3RRN B;  3AU4 A;  2XS1 A;  3I3N A;  3ZXP A;  3EUV A;  4GPM A;  3QC1 A;  3RO2 A;  3AS8 A;  1Y6I A;  4ATG A;  2P9P G;  5C2Y A;  3DRA A;  4G8K A;  4HNA D;  2WMN A;  3UPV A;  3VTY A;  4DLQ A;  1IQU A;  2HO1 A;  2IO3 C;  1MHQ A;  4AXH A;  3Q47 B;  3FTX A;  4GCN A;  3UT4 A;  3L17 A;  3ZHE B;  4EBA A;  2YQ8 A;  4AM9 A;  4TXQ A;  3O4Z A;  4K5C A;  4B8A A;  1OCZ E;  5HI7 A;  3TAX A;  2Q7F A;  3TGO A;  1TNB A;  3J5P A;  2XCC A;  5BXU A;  2FO1 E;  4V3I A;  4UI9 K;  2GGF A;  3L08 A;  5CRV A;  4UWK A;  4HLL A;  5ENS D;  1H6K A;  3QKY A;  3Q15 A;  1OWN A;  4M3O A;  5CCM A;  1OT8 A;  4WWP A;  5FQ7 A;  2ZIS A;  4GZC A;  2B0O E;  3X2Q E;  4B0Z A;  3ZRH A;  3FU3 A;  4LCT A;  2IOL A;  2JLB A;  4U8V D;  2J49 A;  3GW4 A;  3NZS A;  5FZR A;  1UG3 A;  4HOU A;  4AOF A;  3ZNG A;  3VLE A;  4AV7 A;  1A17 A;  3I4G A;  3UM0 A;  3CHM A;  3W9F A;  4FC8 A;  3CK9 A;  4DK5 A;  3MEK A;  1N4Q A;  3T8M A;  5J90 A;  3B95 A;  4CEM A;  1SVX A;  3PE4 A;  3C98 A;  1OCR E;  1OUV A;  5EX3 A;  3AG2 E;  1MX6 A;  3L9T A;  1U3D A;  3CVV A;  4J6I A;  1H19 A;  4JZY A;  1HX8 A;  3FTZ A;  3SY2 A;  4DLO A;  4BTB A;  3UKR G;  2X6H A;  1PC2 A;  3L54 A;  1H0A A;  2P2C P;  5AQB A;  4F1S A;  4EHM A;  1YCS B;  4GML A;  5B1B E;  3ZYL A;  1JCQ A;  1G3N B;  2XZT G;  3B7R L;  4U0U A;  3I4R B;  3QNK A;  3ML8 A;  5T4Y A;  3GZS A;  3ZW3 A;  4O1O A;  1Q2Z A;  1NP7 A;  4FHJ A;  4GTV A;  3EHN A;  3ABL E;  5ENO D;  1Y8M A;  2DWZ A;  3Q9N C; 
#chains in the Genus database with same CATH homology
 5CEC B;  4OAV B;  4DX1 A;  4U8V D;  1MJ0 A;  5CBN A;  3NOG D;  5D66 A;  4GPM A;  4F6R D;  5KWD A;  5EIL A;  1MYO A;  2QC9 A;  5AAR A;  3AAA C;  3LJN A;  1IHB A;  2JAB A;  2ETA A;  4N5Q A;  3ZNG A;  5AQ7 A;  1DCQ A;  5HRY A;  2F8Y A;  4O1P A;  4DX6 D;  2F8X K;  3EU9 A;  1K1B A;  5EYP F;  3JUE A;  3DEO A;  3UI2 A;  4BES A;  2RFA A;  4YDY A;  4G8K A;  3V31 A;  2NYJ A;  2V4H C;  4HNA D;  3C5R A;  3W9F A;  3EHQ A;  4OAU C;  1IKN D;  1N0R A;  3ZU7 B;  4BSZ B;  4QQI A;  5AN8 A;  2AJA A;  3B95 A;  4LNU D;  1K3Z D;  2DZN A;  1SVX A;  1WDY A;  3SO8 A;  4U8Y D;  1SW6 A;  3V30 A;  1AWC B;  4Z68 A;  4RLY A;  1YYH A;  4B93 B;  4DRX E;  4HB5 A;  4DUI A;  5CEA A;  5CER B;  3T9K A;  3TWS A;  3TWX A;  5AQ9 A;  1BU9 A;  4HQD A;  4BER A;  4LG6 A;  3ZUV B;  1N11 A;  4G8L A;  2ZGG A;  3TWT A;  2J8S D;  2MYO A;  4ZFH A;  1MX6 A;  5EYL A;  4CYM D;  2BKG A;  4NIK A;  2KBX A;  1YMP A;  3IXE A;  3D9H A;  3Q9U C;  5AQA A;  1NFI E;  5FIO A;  5CED B;  2DVW A;  2ETB A;  4GMR A;  4YDW A;  5BXO A;  1MX4 A;  5ENQ D;  1BD8 A;  2V5Q C;  3TWW A;  2HE0 A;  3TWR A;  2XZD G;  4BET A;  5JMN D;  2Y0B G;  3W9G A;  1N0Q A;  3HG0 D;  5CBO A;  5FIN A;  4F1P A;  2BKK B;  2QYJ A;  4U95 D;  4K5C A;  4CZ2 D;  4ZHB A;  1IXV A;  2VGE A;  2XEN A;  2A5E A;  2DZO A;  4O60 A;  2PNN A;  1A5E A;  1K1A A;  4K5B A;  3KEA A;  4QFV A;  3HRA A;  2P2C P;  5AQB A;  3V2X A;  5EN5 D;  2F37 A;  3J5P A;  3TWV A;  5JA4 D;  4BEP A;  3V2O A;  2KXP C;  3NOC D;  1YCS B;  2ZGD A;  3JXI A;  4TUM A;  2XEH A;  5HS0 A;  5ENT D;  5ITZ F;  5BXU A;  2FO1 E;  2Y1L E;  4J8Y A;  1G3N B;  2XZT G;  1OY3 D;  3B7B A;  4DX5 D;  4HI9 A;  3TWU A;  4DX7 D;  1TR4 A;  4JB8 P;  4HI8 A;  5KNG A;  5AAO A;  3UXG A;  3JXJ A;  5ENR D;  4HRN A;  5KBA A;  1D9S A;  4O1O A;  1WG0 A;  4UUC A;  1MX2 A;  4DX2 A;  2ETC A;  4HBD A;  5KNH D;  4HLL A;  3EHR A;  5ENS D;  4J7W A;  1DC2 A;  1BI8 B;  3T8K A;  5EID A;  1UOH A;  2RFM A;  3V79 K;  3NBN B;  1S70 B;  1OT8 A;  5EIB E;  1AP7 A;  1QYM A;  3UTM A;  5ENO D;  1BLX B;  5ENP D;  2DWZ A;  3J5Q B;  4U96 D;  5HKP A;  2XEE A;  3DEP A;  4HRL A;  4HRM B;  4A63 B;  3Q9N C;  2B0O E;  4ATZ D;  3F6Q A;  2L6B A;  4K5A B;  4LSZ E;  3ZKJ A;  3AJI A;  1BI7 B;  4C48 B;  3TWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...