2P9NG

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
134
Chain Sequence
ARFRKVDVDEYDENKFVDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
total genus 42
structure length 134
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9nG00
4XEIG 3DXKG 3UKUG 3RSEG 2P9SG 2P9KG 1U2VG 3ULEG 1TYQG 4JD2G 2P9PG 1K8KG 2P9LG 3UKRG 3DWLG 2P9UG 2P9NG 2P9IG 3DXMG
chains in the Genus database with same CATH superfamily
4WWOA 2XPIA 3S7DA 1HS6A 3D9PA 1O1TA 2ETBA 3CK7A 2J4BA 2P9SG 4LUNU 2V8SE 4GPKA 2GRRB 2WXKA 4I2ZA 4HOUA 4UI9C 1BD8A 3KAEA 2FBNA 3VTXA 2WXMA 3ASDA 2F8YA 1HF8A 3TWRA 2CHZA 4JHKA 3SD5A 5JJTA 5ENPD 2QZAA 4LERA 3T9KA 1UJKA 2L6BA 1SQMA 3LJNA 4DI4A 3WXXA 4HOSA 2EIKE 4JXTA 1IQUA 4CDNA 3PE3A 4O60A 4RQIA 2YNQA 3C5RA 1QBQA 3I4RB 2LXMA 3EHMA 3FEXA 2H6IA 2MRIA 1PAQA 1EYHA 3B7BA 1WM5A 2ZGGA 2EIME 2NXPA 3NOGD 1U3CA 4IULA 4GMJA 4UWFA 4G23A 4U63A 4IYPA 1Z5SC 5AQBA 4A63B 1FVHA 3ONLA 3NQPA 4YDOA 2VTBA 2XCCA 1E8YA 1NA0A 3UIPC 1KZOA 1QQEA 4YDYA 1IHGA 1TEZA 2J9QA 4BSXA 4TRQA 4HRNA 5EN5D 3JUIA 4K5CA 1H2UA 1DNPA 3L54A 3VLFA 1S0PA 2A4ZA 4QFVA 1JCQA 3Q5MA 5G05C 4GTVA 5AN8A 2C2LA 2Y0BG 4O6FA 1TR4A 5BT1A 3CKCA 2V4HC 4KMOA 3CKBA 3JQ1A 2P9UG 1RW2A 3C98A 3HVEA 5LX8A 3T8KA 3RSEG 2XS8A 3FH7A 3PNLB 3CVVA 4HLEA 3SFYA 4DK5A 2H6HA 3L16A 3RIBA 1E8ZA 3KD7A 3HHMA 5FQ6A 2RD0A 1BU9A 2XZTG 5BV0A 4KVMA 1X81A 2AXVA 2MHKA 1V55E 4J8EA 2X3MA 2VQ2A 2J07A 3AU4A 5FQ8A 3PNTB 5G04J 2ZU6B 2LO6A 4OAUC 4AVXA 1BLXB 3D9KA 4YVOA 3UT8A 3CV0A 4GMRA 2OVFA 3ASNE 1EDUA 2V5FA 2Y69E 4R7LA 4UWKA 3RKVA 2NC9A 3TXNA 1S63A 3AG1E 3CSFA 3TWSA 1KT0A 4JW1A 4EECA 5CECB 4C0MA 4ANUA 4N3BA 3DWLG 3SNXA 2LUHA 2XEEA 2JEKA 1H6KA 3RAUA 5EIBE 2GRMA 3D9HA 2FI7A 3FUHA 2VGEA 2H6GA 4IRUA 5CCLA 5T8IA 4I9CA 3UTMA 5KJNA 1FT2A 4GTPA 4EHMA 3EU9A 4GA0A 3PZ1A 4XI9A 3JUEA 1JCSA 4URKA 3EIJA 2Y1LE 4PS8A 3ZEFA 2WXJA 1N9AA 3TWUA 1TN7A 2I1KA 2CG3A 2WQHA 5EILA 4A3TA 1P5QA 4G11A 3CR3A 2J8SD 4JL0A 4ZFHA 2E0IA 4U8HA 3I4GA 2XPZA 2H6FA 1BI7B 5J08A 4I1OB 2WB2A 3CK9A 3U4TA 2M63A 4F53A 2PM6A 4UQYA 3JQ0A 4KYOB 5BNWA 4GZCA 3D9NA 2V5QC 4XE0A 5BXOA 3CVPA 3AJIA 3DSXA 3S7FA 3MEKA 3PZ4A 3EHRA 4CGVA 2EINE 4G25A 5FTPA 3SFXA 2IEJA 1TJCA 4I1MA 3PREA 3UQ3A 4YDEA 1E8WA 1V54E 5JHBA 2WMOA 3O48A 4ANWA 5CEAA 2KZTB 1WAO1 1WDYA 3SBSA 3QWWA 5IY5E 3CVLA 5CMYA 5AJDA 4CEMA 3QNKA 3LY8A 4HBDA 2R5SA 2IF4A 4CDRA 2ETCA 1U2VG 3EDTB 5AARA 5T4YA 3PS6A 2XZDG 3LPZA 2BEDA 4PUCA 1OCRE 2VYIA 1YCSB 4HVBA 4HOTA 4HORA 1LD7A 1QYMA 5BPPA 4Q69A 2MOWA 5FT9A 2X6IA 3FHEA 3QK0A 1Q2ZA 1FCHA 5ENQD 4CDMA 2PL2A 3ASGA 3E4BA 3OXGA 4AIFA 1OCZE 2KXPC 3W9FA 1Y8MA 3L6AA 4H7XA 2R2LA 3E33A 4JD2G 4BETA 3CEQA 2WXHA 3DRAA 1LF8A 1KLXA 3D9IA 4YNDA 4O1OA 3J5PA 2R17C 4BX9A 4F7AA 4TXRA 2Y4UA 4N5QA 3AG2E 2QYUA 1JCRA 4EBAG 2P2CP 1HH8A 4DLOA 1QNFA 2GW1A 3SHFA 3G2SA 4B8CB 4XEIG 2P58C 2DCPA 1TNBA 2VTBB 4NURA 4TV3A 5A7DB 2ZIRA 3C3QA 2XCBA 3RK6A 1KPSB 5KNGA 3GZ1A 4GZDA 4NRHB 3SFZA 1JWFA 3TWWA 5J90A 2BKKB 3AS4A 2GRLA 2LSVA 1WG0A 2FO1E 4AY5A 3B7RL 3WG7E 3LEWA 3QWVA 1LTXA 3U9WA 3JXIA 4AV7A 3SI5A 4A3VA 4PS7A 3FH8A 3HVEB 3HXBA 2I1JA 3FU0A 2KCLA 1OUVA 4KT6B 4GTMA 4E6HA 4XI0A 2CFZA 4Y6CA 1SA5A 4FC8A 5JMND 4N39A 5D0OD 1EPUA 1NFIE 4RG9A 3EIQC 4K03A 1SZAA 3HG0D 3BU8A 4WAFA 4CT0A 5JJ6A 2WXGA 4GYWA 5FJYA 4GTSA 4TUMA 2QFCA 1W3BA 3PEUB 4U0ZA 4AP2A 3E37A 3PZ2A 3TL5A 3RO3A 2DVWA 4XX5A 4HOQA 3FTUA 4CCAA 5KJLA 3TAXA 5ENNA 3ZRHA 4Y6WA 3ZGQA 3CVWA 3SGHA 2F37A 3FY4A 3MKQB 3CGHA 3S7BA 2FULA 3CHOA 4UWLA 3ASOE 4LG6A 4ANVA 3PZ3A 3BG0B 1H0AA 3ZPJA 3OXFA 3CVXA 2CHXA 1D8EA 3OTNA 1E8XA 3Q79A 1NZNA 4WNEA 3HRAA 4EZLA 3UM2A 5HS0A 3RRMB 1DVPA 1OWLA 3Q7AA 3FTXA 3CSTA 5AQAA 3BEEA 3UI2A 3FFLA 4OYSA 5A23A 3APDA 2I2OA 5ITZF 3KS2A 3NZSA 4JB8P 5A6CA 3FEYA 1UJJA 2IOSA 3B7UX 2WXLA 1OWOA 2XGMA 1INZA 4FU3A 2BKGA 4UI9J 1PY1A 2E2EA 3KEAA 4B89A 1BI8B 4G8KA 2P9PG 3ML9A 2RKKA 4CYMD 1H6OA 2HO1A 1Z3XA 1E7VA 2R02A 4WUYA 1OCOE 4I9EA 3HDXA 2WQ7A 4ACKA 1TYQG 3TJPA 5G04C 1IKND 3ZYKA 3NOCD 2PQRA 4DLQA 2XENA 5ARFA 5HQ8A 3G2TA 1MX2A 1N0QA 2GRQB 4C0EA 2A5EA 5FIOA 4GCNA 3TGOA 4DPRA 4MRUA 3TWXA 2OEVA 3RJVA 3ZYMA 1D8DA 2L0TB 1UG3A 1ELKA 1HG2A 3V79K 2X6HA 1DCEA 1ZU2A 3DEPA 2XQ0A 4JA7A 5AYWD 4OAVB 5D0QD 4B8AA 3LXUX 1TNUA 3DPYA 4I6EA 3JYSA 2DYRE 3ZYLA 2VJ8A 3PEVB 4DX5D 1UN9A 3T5XA 1OT8A 3Q49B 5E76A 4C9BB 4LRZA 2YHCA 5EKQD 4I17A 4FA6A 5LCWC 2UWJG 1HX8A 3I5PA 1SW6A 4JHRA 1JUQA 4EZKA 5G05J 2LAIA 4I6GA 5ARGA 3QWPA 4G1TA 5JHAA 4BFRA 2OVBA 4HRMB 3CHQA 5BXUA 3ZUVB 3MKQA 2DZNA 3AU5A 3RU0A 1JWGA 5ENSD 3K9IA 3ISMC 2LAHA 4CZ2D 5CHEE 3L08A 1BPOA 5CBNA 1B89A 3LVRE 2C0LA 3F6QA 1IHBA 2RG8A 4FULA 4J8DA 1TN6A 4OVUA 3D3MA 1IXVA 2V0PA 1HG5A 2WPVA 2VSYA 1E7UA 3LS8A 5AAOA 4JZYA 4A1SA 1MYOA 4L9PA 3UM0A 4GPMA 5M72A 4FADA 3ZXPA 3VLDA 4X8QA 3D9JA 3BG1B 3LKUA 4U8VD 1HFAA 1NA3A 2X6JA 3QDNA 3ZU7B 3TWVA 1N4SA 4JPSA 1N94A 1VDYA 5DIZA 5CMWA 4U8YD 3TWQA 3SY2A 2P9NG 2X6KA 4UWGA 2R05A 3PUJA 4YVQC 3L13A 3ENEA 2F0YA 3UMVA 3NAWA 5FQ4A 5KBAA 2VSNA 3MV2B 2X6FA 1HXIA 3TG5A 2DWZA 4ZHBA 3VLEA 4J8YA 4RLYA 3TG4A 3ABME 3L22A 3ESLA 3IEGA 4L7TA 2PQNA 2IQCA 3SBTB 3PVLA 4G26A 4FLBA 1K8KG 1SZ9A 3E34A 3LYAA 4UQXA 2WXIA 3CLJA 3LVQE 4LEUA 4RG6A 3CQGB 4GB9A 4J0UA 4AJWA 1ZB1A 4GA1A 3E32A 3HXDA 5FWQA 2KM4A 4JVSA 3ESKA 3IBEA 2KATA 3IV0A 3CVNA 3NF1A 2ZXWE 3GYZA 4UQZA 3UM3A 4CRWA 5B3SE 2V4LA 3B7TA 2GROB 5AQ7A 1IYGA 3CVUA 3T8MA 3IHVA 2GRNB 2WMNA 3X2QE 4DJAA 3MJWA 3IHYA 2XEVA 1A17A 4DRXE 2HR2A 2WM9A 1MJ0A 3EUVA 5EIDA 2OV8A 4DX2A 4B93B 3BQOA 2OEWA 3PZDA 3PDNA 3NZUA 4FHKA 1O1RA 4N3CA 2AWIA 4G8LA 3SF4A 2YHEA 3MX3A 4ATGA 2F8XK 5D2MC 2QYJA 4GTQA 2J49A 4N2SA 3CVYA 4HI9A 3ABLE 3LDZA 2UY1A 3DSTA 4N5CA 5CEDB 5EX3A 4KZ0A 3FUFA 1HZ4A 2EQXA 4I6JA 5FZQA 4PH4B 3VTYA 4HS2A 3R7QA 4A55A 4U95D 4APOA 3AAAC 1ZBPA 3IXEA 4BT8A 4JHJA 3D9MA 3Q75A 1QZ2A 5ANLA 3FU3A 2CFUA 3U66A 2XS1A 3APFA 4J8FA 2EILE 4NIKA 2LSUA 4AXHA 2P9KG 2ZISA 1ELWA 4XKCA 3CHSA 4F3VA 2ZGDA 4I43A 1DCQA 1TNZA 4J7WA 4HLLA 2IU1A 5KCMA 1HU3A 4GTTA 4U7EB 5AIJA 3UPVA 4JA9A 4FJZA 4LNUD 4XZ4A 2KC7A 2VSXE 5CRVA 2OOEA 3KSLA 2LNIA 3DSVA 4JC8A 4MKTA 3APCA 3JXJA 5BV1A 3ASFA 5JJ7A 2P9IG 3ZVVA 4UWHA 4Q96A 5H7PA 1YA0A 4ME2A 1H2TC 3UT4A 4BESA 1S70B 5CRUA 3FUDA 1YYHA 2WXNA 5B1AE 5LOZA 3V30A 4RVBA 2Y3AA 1G3NB 3ZYQA 3NBNB 4GMLA 4HRLA 3HYMB 5LP0A 2B0OE 1SVXA 2Y4TA 4Z68A 4FP7A 3EHNA 2XPYA 4ILIA 3QC1A 1X5BA 4TXPA 1K3ZD 2YINA 2WXQA 3OXLA 4GYYA 4APFA 5HRYA 1H6PA 1KZPA 3CHRA 5CERB 5ENRD 4BEPA 1K1AA 3G2UA 2R03A 4XIFA 3FUIA 3Q78A 3ZHEB 3JCKC 3UIOC 3B7SA 4L2YA 1MX4A 2R59A 4N3AA 2IY0C 3V2OA 4YDWA 5B1BE 3V2XA 1Y6IA 4BERA 3LCAA 2DYSE 5BW8C 2XRZA 2ONDA 1WY6A 3LY7A 2ETAA 4B0ZA 3OAWA 2WXPA 3ULQA 2FEZA 2HYZA 3QJZA 1UOHA 4NQ0A 3QARA 4ATZD 5AENA 3L9TA 4H7YA 4E85A 2IOLA 3R9AB 1H19A 2ILRA 1HO8A 1OY3D 2J08A 1H2VC 1OWPA 3Q7FA 3Q73A 5CCMA 5CBOA 5ANRA 4G2VA 3UX4A 4EQFA 4N2QA 4BY6A 2AXUA 4LNBA 1AWCB 4L1BA 2NSZA 1JPLA 4HNAD 3O4ZA 3EU5A 2FF4A 3DEOA 3FUNA 5HKPA 2IJGX 1RZ4A 3TWTA 5JA4D 4L23A 4F1PA 4V3IA 2XRYA 2VGXB 4GTOA 3UT7A 3CVQA 4MS6A 3URZA 3V31A 1MZCA 3B95A 2MYOA 3L82A 2HE0A 1TNYA 5C1DA 3CIAA 4DUIA 4WNDA 5AJLA 3Q9NC 3RRNB 1N54A 3UKUG 1N4PA 4KZCA 2JABA 4G24A 5HI7A 2A5UA 5EDSA 4DI3A 3MKRA 4HFGA 2QY7A 1GW6A 3Q4AB 4LNGA 4XKBA 2CG2A 2J09A 4LCTA 3ZNGA 3FUJA 4GA2A 4GZ3A 4WWPA 5G55A 3N71A 2DZOA 1NI1A 2XGSA 4ILGA 3FTWA 3I3NA 5AQ9A 3CHMA 2I6HA 1E96B 3QAQA 4L2LA 5EX0A 3GZSA 2AW6A 3MZLB 2BUGA 1YMPA 2CHWA 2P9LG 3ZFWA 4PS3A 4PDXA 4U0SA 3DSWA 1HE8A 5G2NA 2Q7FA 4ILHB 4HQDA 2KBXA 4AM9A 4FHJA 2IO2C 1N0RA 2IONA 2OCCE 1E90A 1TJFA 1N11A 4AOFA 5EYLA 2L6JA 1TNOA 2EIJE 3Q47B 3J5QB 1N4QA 5FZSA 1FPPA 3UUXA 3S2AA 3FTVA 2VGYA 3FTYA 3ZHEA 1MQSA 3RRUA 3Q9UC 5ENOD 4F1SA 4D10C 3ZKJA 4IN3B 2J4DA 3FUKA 3MGBA 2DIWA 3C72A 3AS5A 4DX1A 4UUCA 4W9RA 3GZ2A 4KBQA 3FP3A 3DSSA 3FU5A 4BSZB 3SQVA 5LCWJ 5FINA 2X38A 1NL4A 3SO8A 2DBAA 3FH5A 4ABNA 2LXLA 5EYPF 3UKRG 2UY1B 4EBAA 2KCKA 1XNFA 1FVFA 3KEZA 4DX7D 3ONKA 3L17A 1OXJA 3FULA 3PH0C 3HXCA 4KVOA 2BTDA 4U07A 4HI8A 3AG3E 4HB5A 4TUUA 2WXOA 3UINC 1OCCE 1UW4B 3KSQA 2BF0X 4WNFA 2PNNA 4BT9A 3SZ7A 4GTRA 2VGXA 4TXQA 2YQ8A 1O5MA 2WXFA 4BTBA 1K1BA 1OWMA 1FT1A 1O1SA 3GW4A 4MBGA 3UXGA 4K5BA 3C3RA 3TXMA 4JEHA 4HXIA 3EJNA 2L0IA 1KT1A 4GAAA 2XGOA 2I9CA 3HXFA 4GYOA 4GZ6A 4F6RD 3EHQA 1U3DA 1PC2A 3AG4E 1Z6TA 3PE4A 4WNGA 3DXMG 2JLBA 4NACA 2HM8A 4K0RA 4U96D 2IFUA 1L5JA 3C3OA 3D9OA 1DC2A 4RSYA 3D9LA 2KCVA 3ABKE 1MX6A 2RFMA 3T5VA 3G2VA 2AXZA 3LY9A 1NP7A 4I1AA 5T3RA 3HIZA 3FTSA 3BUAA 4AY6A 2L9BA 3ULEG 3FUEA 1N52A 2WVIA 4AEZC 3R9MA 3RO2A 2AJAA 3DPDA 1A5EA 4GU5A 3AS8A 3DSUA 3MA5A 3HXEA 4U0UA 1OWNA 4GZ5A 4EZJA 5LFAA 4KXKB 2QC9A 4J8SA 3FUMA 1N4RA 3PRZA 2VSOE 4LSZE 4O1PA 1XGWA 5C2YA 2AVPA 3FTZA 3FU6A 3DBSA 4ACLA 4MLPA 3QOUA 2GGFA 1AP7A 4M7CA 4BTAA 3ZIMA 3CQCB 4B94A 3LJ3A 3PUKA 5E75A 1S64A 2GRPB 4M3OA 3MV3B 4FLHA 1D9SA 4CT4A 1SA4A 1Z3YA 4GCOA 4DX6D 2IO3C 4QQIA 3U3WA 4C48B 4K5AB 3FDHA 4P29A 3UM1A 5KNHD 3ASHA 5FZRA 3ML8A 3Q15A 1TN8A 3W9GA 2C0MA 3G2WA 3P1UA 3QKYA 1LD8A 3ZW3A 3CHPA 4JEUA 2WXRA 4I2WA 1UN8A 2B6CA 4BWRA 4ANXA 3MCXA 4U04A 5KJMA 3ZXSA 1EF1C 4BX8A 2RFAA 3P2BA 4CGWA 5D66A 4FJYA 3NB2A 3ZN3A 3B13A 4OVVA 2PZIA 1IQRA 3DXKG 2PM7A 4WWNA 1ELRA 3CK8A 2WQ6A 3ULYA 4EPZA 5KJKA 3U64A 5DBKA 3QB2A 2KZTA 3MYVA 4UI9K 3S7JA 5ENTD 5BUZA 4A1GA 4J6IA 2NYJA 1MHQA 3R7RA 5FQ7A 2XHEA 2FO7A 3IKOB 2XEHA 3FWVA 3E30A 5KWDA 1N95A 4Q94A
chains in the Genus database with same CATH topology
4XEIG 3DXKG 3UKUG 3RSEG 2P9SG 2P9KG 1U2VG 3ULEG 1TYQG 4JD2G 2P9PG 1K8KG 2P9LG 3UKRG 3DWLG 2P9UG 2P9NG 2P9IG 3DXMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XEI G;  3DXK G;  3UKU G;  3RSE G;  2P9S G;  2P9K G;  1U2V G;  3ULE G;  1TYQ G;  4JD2 G;  2P9P G;  1K8K G;  2P9L G;  3UKR G;  3DWL G;  2P9U G;  2P9N G;  2P9I G;  3DXM G; 
#chains in the Genus database with same CATH topology
 4WWO A;  2XPI A;  3S7D A;  1HS6 A;  3D9P A;  1O1T A;  2ETB A;  3CK7 A;  2J4B A;  2P9S G;  4LUN U;  2V8S E;  4GPK A;  2GRR B;  2WXK A;  4I2Z A;  4HOU A;  4UI9 C;  1BD8 A;  3KAE A;  2FBN A;  3VTX A;  2WXM A;  3ASD A;  2F8Y A;  1HF8 A;  3TWR A;  2CHZ A;  4JHK A;  3SD5 A;  5JJT A;  5ENP D;  2QZA A;  4LER A;  3T9K A;  1UJK A;  2L6B A;  1SQM A;  3LJN A;  4DI4 A;  3WXX A;  4HOS A;  2EIK E;  4JXT A;  1IQU A;  4CDN A;  3PE3 A;  4O60 A;  4RQI A;  2YNQ A;  3C5R A;  1QBQ A;  3I4R B;  2LXM A;  3EHM A;  3FEX A;  2H6I A;  2MRI A;  1PAQ A;  1EYH A;  3B7B A;  1WM5 A;  2ZGG A;  2EIM E;  2NXP A;  3NOG D;  1U3C A;  4IUL A;  4GMJ A;  4UWF A;  4G23 A;  4U63 A;  4IYP A;  1Z5S C;  5AQB A;  4A63 B;  1FVH A;  3ONL A;  3NQP A;  4YDO A;  2VTB A;  2XCC A;  1E8Y A;  1NA0 A;  3UIP C;  1KZO A;  1QQE A;  4YDY A;  1IHG A;  1TEZ A;  2J9Q A;  4BSX A;  4TRQ A;  4HRN A;  5EN5 D;  3JUI A;  4K5C A;  1H2U A;  1DNP A;  3L54 A;  3VLF A;  1S0P A;  2A4Z A;  4QFV A;  1JCQ A;  3Q5M A;  5G05 C;  4GTV A;  5AN8 A;  2C2L A;  2Y0B G;  4O6F A;  1TR4 A;  5BT1 A;  3CKC A;  2V4H C;  4KMO A;  3CKB A;  3JQ1 A;  2P9U G;  1RW2 A;  3C98 A;  3HVE A;  5LX8 A;  3T8K A;  3RSE G;  2XS8 A;  3FH7 A;  3PNL B;  3CVV A;  4HLE A;  3SFY A;  4DK5 A;  2H6H A;  3L16 A;  3RIB A;  1E8Z A;  3KD7 A;  3HHM A;  5FQ6 A;  2RD0 A;  1BU9 A;  2XZT G;  5BV0 A;  4KVM A;  1X81 A;  2AXV A;  2MHK A;  1V55 E;  4J8E A;  2X3M A;  2VQ2 A;  2J07 A;  3AU4 A;  5FQ8 A;  3PNT B;  5G04 J;  2ZU6 B;  2LO6 A;  4OAU C;  4AVX A;  1BLX B;  3D9K A;  4YVO A;  3UT8 A;  3CV0 A;  4GMR A;  2OVF A;  3ASN E;  1EDU A;  2V5F A;  2Y69 E;  4R7L A;  4UWK A;  3RKV A;  2NC9 A;  3TXN A;  1S63 A;  3AG1 E;  3CSF A;  3TWS A;  1KT0 A;  4JW1 A;  4EEC A;  5CEC B;  4C0M A;  4ANU A;  4N3B A;  3DWL G;  3SNX A;  2LUH A;  2XEE A;  2JEK A;  1H6K A;  3RAU A;  5EIB E;  2GRM A;  3D9H A;  2FI7 A;  3FUH A;  2VGE A;  2H6G A;  4IRU A;  5CCL A;  5T8I A;  4I9C A;  3UTM A;  5KJN A;  1FT2 A;  4GTP A;  4EHM A;  3EU9 A;  4GA0 A;  3PZ1 A;  4XI9 A;  3JUE A;  1JCS A;  4URK A;  3EIJ A;  2Y1L E;  4PS8 A;  3ZEF A;  2WXJ A;  1N9A A;  3TWU A;  1TN7 A;  2I1K A;  2CG3 A;  2WQH A;  5EIL A;  4A3T A;  1P5Q A;  4G11 A;  3CR3 A;  2J8S D;  4JL0 A;  4ZFH A;  2E0I A;  4U8H A;  3I4G A;  2XPZ A;  2H6F A;  1BI7 B;  5J08 A;  4I1O B;  2WB2 A;  3CK9 A;  3U4T A;  2M63 A;  4F53 A;  2PM6 A;  4UQY A;  3JQ0 A;  4KYO B;  5BNW A;  4GZC A;  3D9N A;  2V5Q C;  4XE0 A;  5BXO A;  3CVP A;  3AJI A;  3DSX A;  3S7F A;  3MEK A;  3PZ4 A;  3EHR A;  4CGV A;  2EIN E;  4G25 A;  5FTP A;  3SFX A;  2IEJ A;  1TJC A;  4I1M A;  3PRE A;  3UQ3 A;  4YDE A;  1E8W A;  1V54 E;  5JHB A;  2WMO A;  3O48 A;  4ANW A;  5CEA A;  2KZT B;  1WAO 1;  1WDY A;  3SBS A;  3QWW A;  5IY5 E;  3CVL A;  5CMY A;  5AJD A;  4CEM A;  3QNK A;  3LY8 A;  4HBD A;  2R5S A;  2IF4 A;  4CDR A;  2ETC A;  1U2V G;  3EDT B;  5AAR A;  5T4Y A;  3PS6 A;  2XZD G;  3LPZ A;  2BED A;  4PUC A;  1OCR E;  2VYI A;  1YCS B;  4HVB A;  4HOT A;  4HOR A;  1LD7 A;  1QYM A;  5BPP A;  4Q69 A;  2MOW A;  5FT9 A;  2X6I A;  3FHE A;  3QK0 A;  1Q2Z A;  1FCH A;  5ENQ D;  4CDM A;  2PL2 A;  3ASG A;  3E4B A;  3OXG A;  4AIF A;  1OCZ E;  2KXP C;  3W9F A;  1Y8M A;  3L6A A;  4H7X A;  2R2L A;  3E33 A;  4JD2 G;  4BET A;  3CEQ A;  2WXH A;  3DRA A;  1LF8 A;  1KLX A;  3D9I A;  4YND A;  4O1O A;  3J5P A;  2R17 C;  4BX9 A;  4F7A A;  4TXR A;  2Y4U A;  4N5Q A;  3AG2 E;  2QYU A;  1JCR A;  4EBA G;  2P2C P;  1HH8 A;  4DLO A;  1QNF A;  2GW1 A;  3SHF A;  3G2S A;  4B8C B;  4XEI G;  2P58 C;  2DCP A;  1TNB A;  2VTB B;  4NUR A;  4TV3 A;  5A7D B;  2ZIR A;  3C3Q A;  2XCB A;  3RK6 A;  1KPS B;  5KNG A;  3GZ1 A;  4GZD A;  4NRH B;  3SFZ A;  1JWF A;  3TWW A;  5J90 A;  2BKK B;  3AS4 A;  2GRL A;  2LSV A;  1WG0 A;  2FO1 E;  4AY5 A;  3B7R L;  3WG7 E;  3LEW A;  3QWV A;  1LTX A;  3U9W A;  3JXI A;  4AV7 A;  3SI5 A;  4A3V A;  4PS7 A;  3FH8 A;  3HVE B;  3HXB A;  2I1J A;  3FU0 A;  2KCL A;  1OUV A;  4KT6 B;  4GTM A;  4E6H A;  4XI0 A;  2CFZ A;  4Y6C A;  1SA5 A;  4FC8 A;  5JMN D;  4N39 A;  5D0O D;  1EPU A;  1NFI E;  4RG9 A;  3EIQ C;  4K03 A;  1SZA A;  3HG0 D;  3BU8 A;  4WAF A;  4CT0 A;  5JJ6 A;  2WXG A;  4GYW A;  5FJY A;  4GTS A;  4TUM A;  2QFC A;  1W3B A;  3PEU B;  4U0Z A;  4AP2 A;  3E37 A;  3PZ2 A;  3TL5 A;  3RO3 A;  2DVW A;  4XX5 A;  4HOQ A;  3FTU A;  4CCA A;  5KJL A;  3TAX A;  5ENN A;  3ZRH A;  4Y6W A;  3ZGQ A;  3CVW A;  3SGH A;  2F37 A;  3FY4 A;  3MKQ B;  3CGH A;  3S7B A;  2FUL A;  3CHO A;  4UWL A;  3ASO E;  4LG6 A;  4ANV A;  3PZ3 A;  3BG0 B;  1H0A A;  3ZPJ A;  3OXF A;  3CVX A;  2CHX A;  1D8E A;  3OTN A;  1E8X A;  3Q79 A;  1NZN A;  4WNE A;  3HRA A;  4EZL A;  3UM2 A;  5HS0 A;  3RRM B;  1DVP A;  1OWL A;  3Q7A A;  3FTX A;  3CST A;  5AQA A;  3BEE A;  3UI2 A;  3FFL A;  4OYS A;  5A23 A;  3APD A;  2I2O A;  5ITZ F;  3KS2 A;  3NZS A;  4JB8 P;  5A6C A;  3FEY A;  1UJJ A;  2IOS A;  3B7U X;  2WXL A;  1OWO A;  2XGM A;  1INZ A;  4FU3 A;  2BKG A;  4UI9 J;  1PY1 A;  2E2E A;  3KEA A;  4B89 A;  1BI8 B;  4G8K A;  2P9P G;  3ML9 A;  2RKK A;  4CYM D;  1H6O A;  2HO1 A;  1Z3X A;  1E7V A;  2R02 A;  4WUY A;  1OCO E;  4I9E A;  3HDX A;  2WQ7 A;  4ACK A;  1TYQ G;  3TJP A;  5G04 C;  1IKN D;  3ZYK A;  3NOC D;  2PQR A;  4DLQ A;  2XEN A;  5ARF A;  5HQ8 A;  3G2T A;  1MX2 A;  1N0Q A;  2GRQ B;  4C0E A;  2A5E A;  5FIO A;  4GCN A;  3TGO A;  4DPR A;  4MRU A;  3TWX A;  2OEV A;  3RJV A;  3ZYM A;  1D8D A;  2L0T B;  1UG3 A;  1ELK A;  1HG2 A;  3V79 K;  2X6H A;  1DCE A;  1ZU2 A;  3DEP A;  2XQ0 A;  4JA7 A;  5AYW D;  4OAV B;  5D0Q D;  4B8A A;  3LXU X;  1TNU A;  3DPY A;  4I6E A;  3JYS A;  2DYR E;  3ZYL A;  2VJ8 A;  3PEV B;  4DX5 D;  1UN9 A;  3T5X A;  1OT8 A;  3Q49 B;  5E76 A;  4C9B B;  4LRZ A;  2YHC A;  5EKQ D;  4I17 A;  4FA6 A;  5LCW C;  2UWJ G;  1HX8 A;  3I5P A;  1SW6 A;  4JHR A;  1JUQ A;  4EZK A;  5G05 J;  2LAI A;  4I6G A;  5ARG A;  3QWP A;  4G1T A;  5JHA A;  4BFR A;  2OVB A;  4HRM B;  3CHQ A;  5BXU A;  3ZUV B;  3MKQ A;  2DZN A;  3AU5 A;  3RU0 A;  1JWG A;  5ENS D;  3K9I A;  3ISM C;  2LAH A;  4CZ2 D;  5CHE E;  3L08 A;  1BPO A;  5CBN A;  1B89 A;  3LVR E;  2C0L A;  3F6Q A;  1IHB A;  2RG8 A;  4FUL A;  4J8D A;  1TN6 A;  4OVU A;  3D3M A;  1IXV A;  2V0P A;  1HG5 A;  2WPV A;  2VSY A;  1E7U A;  3LS8 A;  5AAO A;  4JZY A;  4A1S A;  1MYO A;  4L9P A;  3UM0 A;  4GPM A;  5M72 A;  4FAD A;  3ZXP A;  3VLD A;  4X8Q A;  3D9J A;  3BG1 B;  3LKU A;  4U8V D;  1HFA A;  1NA3 A;  2X6J A;  3QDN A;  3ZU7 B;  3TWV A;  1N4S A;  4JPS A;  1N94 A;  1VDY A;  5DIZ A;  5CMW A;  4U8Y D;  3TWQ A;  3SY2 A;  2P9N G;  2X6K A;  4UWG A;  2R05 A;  3PUJ A;  4YVQ C;  3L13 A;  3ENE A;  2F0Y A;  3UMV A;  3NAW A;  5FQ4 A;  5KBA A;  2VSN A;  3MV2 B;  2X6F A;  1HXI A;  3TG5 A;  2DWZ A;  4ZHB A;  3VLE A;  4J8Y A;  4RLY A;  3TG4 A;  3ABM E;  3L22 A;  3ESL A;  3IEG A;  4L7T A;  2PQN A;  2IQC A;  3SBT B;  3PVL A;  4G26 A;  4FLB A;  1K8K G;  1SZ9 A;  3E34 A;  3LYA A;  4UQX A;  2WXI A;  3CLJ A;  3LVQ E;  4LEU A;  4RG6 A;  3CQG B;  4GB9 A;  4J0U A;  4AJW A;  1ZB1 A;  4GA1 A;  3E32 A;  3HXD A;  5FWQ A;  2KM4 A;  4JVS A;  3ESK A;  3IBE A;  2KAT A;  3IV0 A;  3CVN A;  3NF1 A;  2ZXW E;  3GYZ A;  4UQZ A;  3UM3 A;  4CRW A;  5B3S E;  2V4L A;  3B7T A;  2GRO B;  5AQ7 A;  1IYG A;  3CVU A;  3T8M A;  3IHV A;  2GRN B;  2WMN A;  3X2Q E;  4DJA A;  3MJW A;  3IHY A;  2XEV A;  1A17 A;  4DRX E;  2HR2 A;  2WM9 A;  1MJ0 A;  3EUV A;  5EID A;  2OV8 A;  4DX2 A;  4B93 B;  3BQO A;  2OEW A;  3PZD A;  3PDN A;  3NZU A;  4FHK A;  1O1R A;  4N3C A;  2AWI A;  4G8L A;  3SF4 A;  2YHE A;  3MX3 A;  4ATG A;  2F8X K;  5D2M C;  2QYJ A;  4GTQ A;  2J49 A;  4N2S A;  3CVY A;  4HI9 A;  3ABL E;  3LDZ A;  2UY1 A;  3DST A;  4N5C A;  5CED B;  5EX3 A;  4KZ0 A;  3FUF A;  1HZ4 A;  2EQX A;  4I6J A;  5FZQ A;  4PH4 B;  3VTY A;  4HS2 A;  3R7Q A;  4A55 A;  4U95 D;  4APO A;  3AAA C;  1ZBP A;  3IXE A;  4BT8 A;  4JHJ A;  3D9M A;  3Q75 A;  1QZ2 A;  5ANL A;  3FU3 A;  2CFU A;  3U66 A;  2XS1 A;  3APF A;  4J8F A;  2EIL E;  4NIK A;  2LSU A;  4AXH A;  2P9K G;  2ZIS A;  1ELW A;  4XKC A;  3CHS A;  4F3V A;  2ZGD A;  4I43 A;  1DCQ A;  1TNZ A;  4J7W A;  4HLL A;  2IU1 A;  5KCM A;  1HU3 A;  4GTT A;  4U7E B;  5AIJ A;  3UPV A;  4JA9 A;  4FJZ A;  4LNU D;  4XZ4 A;  2KC7 A;  2VSX E;  5CRV A;  2OOE A;  3KSL A;  2LNI A;  3DSV A;  4JC8 A;  4MKT A;  3APC A;  3JXJ A;  5BV1 A;  3ASF A;  5JJ7 A;  2P9I G;  3ZVV A;  4UWH A;  4Q96 A;  5H7P A;  1YA0 A;  4ME2 A;  1H2T C;  3UT4 A;  4BES A;  1S70 B;  5CRU A;  3FUD A;  1YYH A;  2WXN A;  5B1A E;  5LOZ A;  3V30 A;  4RVB A;  2Y3A A;  1G3N B;  3ZYQ A;  3NBN B;  4GML A;  4HRL A;  3HYM B;  5LP0 A;  2B0O E;  1SVX A;  2Y4T A;  4Z68 A;  4FP7 A;  3EHN A;  2XPY A;  4ILI A;  3QC1 A;  1X5B A;  4TXP A;  1K3Z D;  2YIN A;  2WXQ A;  3OXL A;  4GYY A;  4APF A;  5HRY A;  1H6P A;  1KZP A;  3CHR A;  5CER B;  5ENR D;  4BEP A;  1K1A A;  3G2U A;  2R03 A;  4XIF A;  3FUI A;  3Q78 A;  3ZHE B;  3JCK C;  3UIO C;  3B7S A;  4L2Y A;  1MX4 A;  2R59 A;  4N3A A;  2IY0 C;  3V2O A;  4YDW A;  5B1B E;  3V2X A;  1Y6I A;  4BER A;  3LCA A;  2DYS E;  5BW8 C;  2XRZ A;  2OND A;  1WY6 A;  3LY7 A;  2ETA A;  4B0Z A;  3OAW A;  2WXP A;  3ULQ A;  2FEZ A;  2HYZ A;  3QJZ A;  1UOH A;  4NQ0 A;  3QAR A;  4ATZ D;  5AEN A;  3L9T A;  4H7Y A;  4E85 A;  2IOL A;  3R9A B;  1H19 A;  2ILR A;  1HO8 A;  1OY3 D;  2J08 A;  1H2V C;  1OWP A;  3Q7F A;  3Q73 A;  5CCM A;  5CBO A;  5ANR A;  4G2V A;  3UX4 A;  4EQF A;  4N2Q A;  4BY6 A;  2AXU A;  4LNB A;  1AWC B;  4L1B A;  2NSZ A;  1JPL A;  4HNA D;  3O4Z A;  3EU5 A;  2FF4 A;  3DEO A;  3FUN A;  5HKP A;  2IJG X;  1RZ4 A;  3TWT A;  5JA4 D;  4L23 A;  4F1P A;  4V3I A;  2XRY A;  2VGX B;  4GTO A;  3UT7 A;  3CVQ A;  4MS6 A;  3URZ A;  3V31 A;  1MZC A;  3B95 A;  2MYO A;  3L82 A;  2HE0 A;  1TNY A;  5C1D A;  3CIA A;  4DUI A;  4WND A;  5AJL A;  3Q9N C;  3RRN B;  1N54 A;  3UKU G;  1N4P A;  4KZC A;  2JAB A;  4G24 A;  5HI7 A;  2A5U A;  5EDS A;  4DI3 A;  3MKR A;  4HFG A;  2QY7 A;  1GW6 A;  3Q4A B;  4LNG A;  4XKB A;  2CG2 A;  2J09 A;  4LCT A;  3ZNG A;  3FUJ A;  4GA2 A;  4GZ3 A;  4WWP A;  5G55 A;  3N71 A;  2DZO A;  1NI1 A;  2XGS A;  4ILG A;  3FTW A;  3I3N A;  5AQ9 A;  3CHM A;  2I6H A;  1E96 B;  3QAQ A;  4L2L A;  5EX0 A;  3GZS A;  2AW6 A;  3MZL B;  2BUG A;  1YMP A;  2CHW A;  2P9L G;  3ZFW A;  4PS3 A;  4PDX A;  4U0S A;  3DSW A;  1HE8 A;  5G2N A;  2Q7F A;  4ILH B;  4HQD A;  2KBX A;  4AM9 A;  4FHJ A;  2IO2 C;  1N0R A;  2ION A;  2OCC E;  1E90 A;  1TJF A;  1N11 A;  4AOF A;  5EYL A;  2L6J A;  1TNO A;  2EIJ E;  3Q47 B;  3J5Q B;  1N4Q A;  5FZS A;  1FPP A;  3UUX A;  3S2A A;  3FTV A;  2VGY A;  3FTY A;  3ZHE A;  1MQS A;  3RRU A;  3Q9U C;  5ENO D;  4F1S A;  4D10 C;  3ZKJ A;  4IN3 B;  2J4D A;  3FUK A;  3MGB A;  2DIW A;  3C72 A;  3AS5 A;  4DX1 A;  4UUC A;  4W9R A;  3GZ2 A;  4KBQ A;  3FP3 A;  3DSS A;  3FU5 A;  4BSZ B;  3SQV A;  5LCW J;  5FIN A;  2X38 A;  1NL4 A;  3SO8 A;  2DBA A;  3FH5 A;  4ABN A;  2LXL A;  5EYP F;  3UKR G;  2UY1 B;  4EBA A;  2KCK A;  1XNF A;  1FVF A;  3KEZ A;  4DX7 D;  3ONK A;  3L17 A;  1OXJ A;  3FUL A;  3PH0 C;  3HXC A;  4KVO A;  2BTD A;  4U07 A;  4HI8 A;  3AG3 E;  4HB5 A;  4TUU A;  2WXO A;  3UIN C;  1OCC E;  1UW4 B;  3KSQ A;  2BF0 X;  4WNF A;  2PNN A;  4BT9 A;  3SZ7 A;  4GTR A;  2VGX A;  4TXQ A;  2YQ8 A;  1O5M A;  2WXF A;  4BTB A;  1K1B A;  1OWM A;  1FT1 A;  1O1S A;  3GW4 A;  4MBG A;  3UXG A;  4K5B A;  3C3R A;  3TXM A;  4JEH A;  4HXI A;  3EJN A;  2L0I A;  1KT1 A;  4GAA A;  2XGO A;  2I9C A;  3HXF A;  4GYO A;  4GZ6 A;  4F6R D;  3EHQ A;  1U3D A;  1PC2 A;  3AG4 E;  1Z6T A;  3PE4 A;  4WNG A;  3DXM G;  2JLB A;  4NAC A;  2HM8 A;  4K0R A;  4U96 D;  2IFU A;  1L5J A;  3C3O A;  3D9O A;  1DC2 A;  4RSY A;  3D9L A;  2KCV A;  3ABK E;  1MX6 A;  2RFM A;  3T5V A;  3G2V A;  2AXZ A;  3LY9 A;  1NP7 A;  4I1A A;  5T3R A;  3HIZ A;  3FTS A;  3BUA A;  4AY6 A;  2L9B A;  3ULE G;  3FUE A;  1N52 A;  2WVI A;  4AEZ C;  3R9M A;  3RO2 A;  2AJA A;  3DPD A;  1A5E A;  4GU5 A;  3AS8 A;  3DSU A;  3MA5 A;  3HXE A;  4U0U A;  1OWN A;  4GZ5 A;  4EZJ A;  5LFA A;  4KXK B;  2QC9 A;  4J8S A;  3FUM A;  1N4R A;  3PRZ A;  2VSO E;  4LSZ E;  4O1P A;  1XGW A;  5C2Y A;  2AVP A;  3FTZ A;  3FU6 A;  3DBS A;  4ACL A;  4MLP A;  3QOU A;  2GGF A;  1AP7 A;  4M7C A;  4BTA A;  3ZIM A;  3CQC B;  4B94 A;  3LJ3 A;  3PUK A;  5E75 A;  1S64 A;  2GRP B;  4M3O A;  3MV3 B;  4FLH A;  1D9S A;  4CT4 A;  1SA4 A;  1Z3Y A;  4GCO A;  4DX6 D;  2IO3 C;  4QQI A;  3U3W A;  4C48 B;  4K5A B;  3FDH A;  4P29 A;  3UM1 A;  5KNH D;  3ASH A;  5FZR A;  3ML8 A;  3Q15 A;  1TN8 A;  3W9G A;  2C0M A;  3G2W A;  3P1U A;  3QKY A;  1LD8 A;  3ZW3 A;  3CHP A;  4JEU A;  2WXR A;  4I2W A;  1UN8 A;  2B6C A;  4BWR A;  4ANX A;  3MCX A;  4U04 A;  5KJM A;  3ZXS A;  1EF1 C;  4BX8 A;  2RFA A;  3P2B A;  4CGW A;  5D66 A;  4FJY A;  3NB2 A;  3ZN3 A;  3B13 A;  4OVV A;  2PZI A;  1IQR A;  3DXK G;  2PM7 A;  4WWN A;  1ELR A;  3CK8 A;  2WQ6 A;  3ULY A;  4EPZ A;  5KJK A;  3U64 A;  5DBK A;  3QB2 A;  2KZT A;  3MYV A;  4UI9 K;  3S7J A;  5ENT D;  5BUZ A;  4A1G A;  4J6I A;  2NYJ A;  1MHQ A;  3R7R A;  5FQ7 A;  2XHE A;  2FO7 A;  3IKO B;  2XEH A;  3FWV A;  3E30 A;  5KWD A;  1N95 A;  4Q94 A; 
#chains in the Genus database with same CATH homology
 4XEI G;  3DXK G;  3UKU G;  3RSE G;  2P9S G;  2P9K G;  1U2V G;  3ULE G;  1TYQ G;  4JD2 G;  2P9P G;  1K8K G;  2P9L G;  3UKR G;  3DWL G;  2P9U G;  2P9N G;  2P9I G;  3DXM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...