2P9NG

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
134
Chain Sequence
ARFRKVDVDEYDENKFVDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Actin-like protein 3
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
total genus 42
structure length 134
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9nG00
2P9PG 3UKUG 2P9LG 2P9UG 3UKRG 1K8KG 2P9SG 4XEIG 2P9KG 3RSEG 2P9NG 3DXMG 3DWLG 3ULEG 4JD2G 2P9IG 1TYQG 1U2VG 3DXKG
chains in the Genus database with same CATH superfamily
4I9CA 4XEIG 3HXFA 3CLJA 1UOHA 2H6FA 1DNPA 4M7CA 3MJWA 5BXUA 4FULA 3BG1B 4UI9J 3IEGA 2XCCA 2IJGX 4CRWA 1Q2ZA 2Y4UA 4PUCA 1MYOA 3HIZA 2IY0C 3VLEA 3R9MA 2HR2A 4F6RD 3L22A 4CYMD 3FP3A 3B95A 2BUGA 3LYAA 4NQ0A 4ATZD 1FVHA 3CVUA 3E37A 2X6FA 3JUIA 3KS2A 4C0EA 4F53A 2KCLA 1HG5A 4KYOB 3ZXPA 3MGBA 5BW8C 4A1SA 4AY6A 3UXGA 4URKA 3KEZA 2L9BA 2XRZA 3CVYA 3T8MA 3BU8A 2GRPB 5AQAA 4DX5D 3CK9A 3D9KA 4KZCA 5FZRA 1QBQA 1QNFA 3ZYQA 3VTXA 2CHXA 1JCSA 5A7DB 3NQPA 1B89A 3E34A 1TNOA 2WQHA 3FUEA 4O6FA 1H2UA 4J8YA 4K0RA 3CQGB 2WXPA 4TRQA 3QWWA 4YDWA 4IN3B 3EHQA 4AP2A 2XCBA 1WY6A 2MYOA 3V30A 1KZPA 3TJPA 4K5CA 2EIME 3FH7A 5G2NA 2VJ8A 5J08A 3RAUA 2OEWA 1IKND 1NL4A 1OWLA 1BI7B 4HXIA 5G05C 4DUIA 4HOUA 3CVLA 1W3BA 3JUEA 3C72A 4F3VA 2NSZA 4NIKA 3ZUVB 2R05A 1U3DA 4I17A 4GTTA 3FEYA 5CBNA 3FTYA 3D9OA 1N95A 5ENNA 1K1AA 3G2TA 3R9AB 2R2LA 4C48B 2IO2C 3RK6A 5ENSD 2LXMA 4G24A 3CEQA 2EINE 3ZYMA 3B7TA 3HG0D 2V5FA 3ENEA 3OTNA 2Y1LE 5C2YA 2WXGA 3CVVA 4HS2A 3UKRG 5KCMA 3PREA 1H6KA 1N54A 4IRUA 2OCCE 3ZRHA 2XS8A 1INZA 4AY5A 3AS8A 3QWPA 3SQVA 4NACA 2C2LA 4FP7A 1OCOE 1TEZA 1K3ZD 1SA4A 2QC9A 4N2SA 3AG2E 3TAXA 4CEMA 4JA9A 4BSXA 3SI5A 3ABLE 4RSYA 3V31A 2P9PG 1OWPA 3AG3E 4UI9C 4A63B 3JQ0A 2UY1A 2M63A 2WXOA 2XZTG 4XI9A 1BI8B 1OCRE 1KLXA 2F0YA 3Q5MA 2UY1B 4U8VD 3DSSA 3IV0A 5EDSA 4AM9A 3FUIA 1YMPA 3LDZA 5AENA 1Z3YA 2R17C 3D9IA 5G04C 5EYLA 2VGEA 4A1GA 1BLXB 3PZDA 1TNBA 2A5UA 3CR3A 4RQIA 5AQ9A 1X81A 3ZN3A 4UQZA 2QFCA 3G2VA 4DLOA 3ZHEB 3HYMB 2PZIA 1Z3XA 5KWDA 4N5QA 1BD8A 1U3CA 1SZAA 3HXEA 1O5MA 4UWKA 4EPZA 5ARFA 1E96B 3HXBA 1ZU2A 3ASDA 2KM4A 4U8YD 2NC9A 3VLFA 1OWNA 3MYVA 3RU0A 3FTUA 3L9TA 2XRYA 4JPSA 4GA0A 4DX1A 5B1BE 3PRZA 3PEUB 4M3OA 2DIWA 3LPZA 5CBOA 3D9NA 5HQ8A 4Y6CA 4U95D 2VQ2A 4GTQA 3C3QA 4D10C 3HVEB 4NURA 4GMRA 3APFA 1OY3D 4I1MA 1JWGA 2IO3C 5CERB 2PL2A 2RG8A 1HU3A 1KPSB 2FO1E 1UN9A 5BXOA 2H6IA 3ASGA 4KVMA 4UWLA 3DRAA 4HRNA 2ETAA 4P29A 2WXIA 3Q79A 4ZFHA 5BV0A 4Q94A 4BT8A 2GRMA 1WAO1 2R59A 3ULEG 3BG0B 2IEJA 3AU5A 2WXFA 2WQ6A 3AJIA 3FTWA 4BX9A 4LSZE 2VSOE 4G26A 2CFZA 4TXPA 2E0IA 2DVWA 3D3MA 3HDXA 2XHEA 2JLBA 3DXMG 5LCWJ 2J4DA 4EBAA 2WXNA 3LVQE 4YDEA 5AAOA 1BU9A 3T8KA 3C5RA 2RFAA 4GTRA 3SFXA 2QZAA 3ZYLA 4H7YA 4BX8A 2WB2A 3CVWA 1E8WA 2OVFA 4GZDA 3LJNA 5HKPA 2C0LA 3WG7E 3HXDA 4HVBA 3FTSA 2XS1A 4BTBA 2HYZA 4JC8A 3S7DA 1KT1A 2I1JA 3CV0A 2LXLA 3PS6A 1MQSA 1OCCE 4BETA 2GGFA 5A6CA 5EX3A 1N4PA 3PUJA 3MKRA 4WWPA 2XPYA 1H6PA 1SA5A 4JHKA 3JCKC 4C0MA 5KJNA 3S7FA 4AIFA 2VGXA 4GB9A 4CT4A 2WVIA 1N4SA 3RO2A 1TNYA 3CSTA 3DBSA 3NF1A 4YVQC 2H6GA 2KCKA 4MRUA 3QAQA 4G2VA 4L9PA 3IXEA 2V4LA 2DYSE 4IULA 5C1DA 4WAFA 3TL5A 3EHNA 4HQDA 1UN8A 3OAWA 2QY7A 3MA5A 2CG3A 4PS8A 5E75A 2L6BA 4Z68A 4LG6A 3AG4E 3TXNA 3GZ1A 3U66A 2XEEA 3TWVA 3D9PA 2I9CA 2NXPA 4R7LA 3B7UX 4CGVA 3APCA 3DSUA 4JVSA 1WM5A 1RZ4A 3V2OA 4HOQA 5AYWD 2RD0A 4CT0A 4EZJA 2F8XK 5KNGA 1H6OA 3QNKA 5DBKA 4LEUA 5FZSA 3UMVA 4DRXE 2MRIA 3C98A 4ILHB 2PQNA 4GYWA 1QYMA 3SNXA 2V4HC 3FULA 2A4ZA 4XIFA 3V2XA 3FTVA 5FJYA 4GTOA 2J4BA 5AN8A 5B3SE 4GYYA 1FPPA 2EIKE 1MHQA 4FLHA 3SFZA 4DX7D 2Q7FA 2FBNA 5KJKA 3QARA 5CHEE 1X5BA 2IFUA 2IQCA 2XGMA 4BEPA 3L82A 1S70B 3UKUG 1GW6A 1E8YA 3EHMA 4H7XA 3AG1E 4RG9A 4WNEA 1DCEA 4J8FA 4FHKA 4V3IA 5T4YA 3FH5A 3ZKJA 2PNNA 1TNZA 3TXMA 4E85A 4XKCA 4ME2A 4AVXA 3HXCA 2DZOA 3UQ3A 3ISMC 2KZTB 1PY1A 3MV2B 4W9RA 2KBXA 4MS6A 3L17A 2XGOA 2I6HA 5BUZA 3VTYA 4YDOA 3QDNA 2BF0X 2LUHA 4HOTA 4JB8P 3SBTB 3CVQA 2VSYA 4YVOA 2FF4A 3ULQA 3SGHA 2LSUA 1ELRA 4DX6D 2GRQB 3UM1A 1A5EA 4GZCA 5LOZA 2WXKA 2EIJE 2RKKA 2YHCA 4O60A 3P2BA 2WPVA 3T5XA 5HI7A 4B94A 1P5QA 1DVPA 3MEKA 2XGSA 3DWLG 5FQ4A 4AEZC 1HS6A 2GRNB 1UW4B 2YNQA 3QB2A 2LAHA 3ABKE 1IHBA 3ASFA 4EQFA 4G11A 3CK8A 3W9FA 3RIBA 3OXGA 5J90A 2XEVA 3FTXA 4KZ0A 1NFIE 3E4BA 1HF8A 4HI9A 3E32A 4HLEA 4AOFA 3ML8A 2P9KG 2WM9A 3L16A 3BUAA 3UM0A 5M72A 5FZQA 5AJLA 3NAWA 1ELWA 3PZ2A 4TUUA 1TJFA 3Q49B 3QC1A 2HM8A 5CECB 1LD8A 1N4RA 2XQ0A 4GZ5A 4MKTA 3LS8A 4L2YA 2WXHA 1S0PA 4U0ZA 3URZA 1WG0A 3AS4A 1E8XA 3ZU7B 3B7RL 1MX2A 3TG4A 1OWOA 2WXQA 3HHMA 2OEVA 3JXIA 5BNWA 3DSVA 5ANLA 4GCOA 4OVUA 3J5PA 3QWVA 4YNDA 3FUKA 3FTZA 3OXFA 2ONDA 2GRLA 2XEHA 3SBSA 2Y4TA 1OXJA 4DPRA 3PZ3A 1D9SA 2MHKA 4WWNA 3LY8A 3FUHA 2XPZA 2X6KA 2XPIA 4N39A 1N11A 3D9HA 1FT1A 1A17A 3CK7A 5CEAA 2Y0BG 1DCQA 2J8SD 4ATGA 4FADA 3Q7FA 5AQ7A 3X2QE 4LNBA 1FVFA 4FJYA 3Q9NC 3T5VA 2VTBB 3CQCB 3OXLA 1E7UA 3CHSA 2AXVA 3SZ7A 1V54E 3L08A 5ARGA 3D9LA 3ZHEA 3PEVB 3FUFA 3O4ZA 4GMJA 3W9GA 2LNIA 5BV1A 1D8DA 4KMOA 1E7VA 4ANVA 5BPPA 3IBEA 4G25A 4CDNA 3DEPA 3KEAA 4GA2A 4Q96A 3UINC 3KD7A 4CDMA 3FWVA 2WXLA 4J6IA 5FWQA 3FU3A 3SY2A 1YYHA 2P9IG 4GCNA 3PE3A 1O1RA 4U07A 3HVEA 4G1TA 4CCAA 2XZDG 4UI9K 4WWOA 5CCMA 4GA1A 4LNGA 2P9NG 5EYPF 3CSFA 3I4RB 2I1KA 3LJ3A 3ZGQA 2DYRE 2VSNA 4LCTA 1HH8A 3FFLA 2P9SG 2AVPA 3UI2A 2JEKA 5BT1A 1N9AA 4YDYA 2DWZA 5CRUA 5EN5D 2V8SE 1RW2A 5FQ7A 4HB5A 3U3WA 1NA3A 5KJMA 1E90A 3NOCD 3LCAA 4FLBA 4I2WA 4U7EB 3PDNA 4TXQA 4PS3A 3Q7AA 5LFAA 1IQRA 2UWJG 1TNUA 3FU5A 4MLPA 3ZPJA 2R02A 2X6HA 5EIDA 1OT8A 2FO7A 5EIBE 4GPKA 3ULYA 3ASOE 2KXPC 4BFRA 2DZNA 4LERA 3DXKG 2WXRA 3FUNA 3D9MA 5T8IA 1E8ZA 3SFYA 1OCZE 2YHEA 3PE4A 5JA4D 3DSXA 2FULA 1NP7A 4OAVB 1U2VG 3NOGD 3RRNB 4F1SA 3FDHA 4BY6A 4AJWA 2C0MA 2YQ8A 3Q47B 4HRLA 2J49A 3V79K 3L13A 5FQ8A 1BPOA 2L0TB 3ZVVA 2Y3AA 1IQUA 3EU5A 4G8KA 4WNGA 4QQIA 5EX0A 4B89A 2VYIA 3TG5A 5B1AE 2AXUA 2QYJA 4BWRA 4HNAD 5G05J 5JHBA 4HBDA 3MKQB 4J8DA 5T3RA 2WQ7A 2KCVA 3HRAA 3RKVA 1KZOA 2AJAA 4N3BA 3DPYA 4PS7A 3DPDA 3I4GA 1UJKA 2BKGA 3RSEG 2J09A 4I2ZA 5CMWA 5FINA 3SHFA 4APOA 3PH0C 4E6HA 1XNFA 4JHJA 5FQ6A 3ESLA 3TWXA 1H19A 3TWUA 5FIOA 2KATA 1OUVA 4HRMB 5EKQD 1Z5SC 2PQRA 3MZLB 2ETCA 1K8KG 2ZIRA 3TGOA 3CKBA 4HLLA 3T9KA 3FY4A 4GTMA 2ILRA 4ANWA 2EQXA 3DEOA 3UIOC 4J8EA 3LY7A 2IONA 2OV8A 1MX4A 2GROB 1TN7A 4FJZA 2YINA 1N0RA 1IXVA 2ZXWE 4JXTA 3G2SA 3Q9UC 3ONLA 4PDXA 3AU4A 3CHMA 3Q4AB 1MZCA 2J08A 4J0UA 1HXIA 4BT9A 4GTVA 5ANRA 1TN8A 1NZNA 1XGWA 2GW1A 1JUQA 3EJNA 2F8YA 2CHWA 2QYUA 1EF1C 3QOUA 2X38A 2LO6A 3K9IA 1Y6IA 1VDYA 2V0PA 5AQBA 3KSQA 4CZ2D 2ZGDA 3FU0A 3PZ4A 1JCRA 1S64A 2IF4A 4LUNU 5G04J 2KZTA 3B7BA 4U04A 3UT8A 4UQYA 5LCWC 3UT4A 2JABA 4XZ4A 3GZ2A 3IHYA 1UJJA 3PVLA 3RJVA 4EBAG 4O1OA 4B0ZA 3IKOB 4GMLA 3CKCA 1EPUA 3PZ1A 1HO8A 4U63A 4JEUA 4WNDA 1SZ9A 4B93B 3Q15A 3VLDA 2ZGGA 5HS0A 2J07A 4GTSA 4DI4A 5KNHD 1IHGA 3ASHA 4N2QA 3CHPA 2NYJA 3MV3B 4TXRA 3G2WA 1AWCB 4LRZA 4WNFA 1MX6A 4ANUA 4XE0A 3EU9A 1N4QA 1Z6TA 4DX2A 3EIJA 4KBQA 2Y69E 4FU3A 5E76A 1ZBPA 4Y6WA 3R7QA 4JW1A 1TR4A 2EILE 4F7AA 3LXUX 5D0QD 3MCXA 2IOSA 3CIAA 4I1OB 3UUXA 3PUKA 4RVBA 1SW6A 4N3CA 4GAAA 3FHEA 3CVNA 3JXJA 4GTPA 4F1PA 4HFGA 1O1TA 3NZUA 1NA0A 3RRUA 3FUMA 4TV3A 3EHRA 3S2AA 3RRMB 5ENRD 3KAEA 4TUMA 5DIZA 3QJZA 1TJCA 2H6HA 3ASNE 1TYQG 2CFUA 1SQMA 3ZNGA 3AAAC 2X6IA 3UX4A 4L7TA 3C3RA 1IYGA 3Q73A 4B8CB 3L54A 4OAUC 5JJTA 4HORA 4B8AA 1HG2A 1UG3A 4BTAA 4JL0A 3LVRE 3I5PA 3IHVA 4MBGA 4ABNA 4G23A 3EDTB 2GRRB 4ACLA 3CHRA 3Q78A 2PM6A 3P1UA 4I6EA 2HO1A 3LKUA 3LY9A 4FA6A 1NI1A 3UIPC 1V55E 3O48A 5ENTD 4U0UA 1FCHA 5ITZF 3J5QB 3ML9A 4OVVA 1OWMA 3C3OA 5ENOD 5AJDA 3GW4A 3APDA 3UM3A 2VSXE 1H0AA 4J8SA 3TWSA 4G8LA 3CHQA 3I3NA 4RLYA 1PC2A 1MJ0A 2VTBA 3GYZA 1SVXA 1QQEA 4I9EA 2MOWA 4O1PA 3S7JA 1N0QA 1AP7A 1HX8A 4DK5A 3F6QA 3NB2A 3UM2A 2B6CA 3CVXA 2X6JA 4CGWA 2E2EA 4AV7A 2CHZA 4CDRA 3L6AA 5KBAA 2P2CP 4U96D 4HOSA 3PNTB 4ILGA 1N94A 3ZEFA 5FT9A 1HE8A 3R7RA 3FH8A 4IYPA 2AW6A 3GZSA 3PNLB 2LSVA 5JJ6A 3LEWA 1H2VC 4Q69A 3ZYKA 1PAQA 4ANXA 1G3NB 3NZSA 4DJAA 4JD2G 2HE0A 4KVOA 3KSLA 2BTDA 2OOEA 3FUJA 5EILA 2ZISA 4AXHA 4EZLA 2L6JA 4EHMA 2ZU6B 1N52A 2VGYA 4XKBA 3EUVA 2IOLA 1D8EA 4WUYA 3SD5A 3NBNB 4XI0A 4L23A 3EIQC 4ACKA 1HZ4A 2KC7A 2V5QC 4U8HA 4J7WA 1L5JA 4X8QA 3BQOA 3FEXA 2LAIA 3ABME 4K03A 2X3MA 3ZIMA 3FUDA 3ESKA 1ELKA 1Y8MA 3S7BA 3UT7A 5G55A 2AXZA 5CRVA 2DCPA 2WXMA 3TWTA 3UTMA 2RFMA 4JZYA 2IU1A 5AARA 3DSWA 4I6GA 4GZ3A 4FHJA 3RO3A 2P9LG 4N3AA 4EECA 5A23A 3U4TA 3B13A 4JHRA 5D66A 2B0OE 3QK0A 4ILIA 4FC8A 4XX5A 4APFA 1EYHA 5D0OD 4DI3A 3TWQA 4OYSA 5JMND 3AS5A 2R5SA 3U9WA 4DLQA 1O1SA 1LF8A 4JEHA 1FT2A 5HRYA 3CHOA 4JA7A 4I6JA 3U64A 2BEDA 5ENPD 4EZKA 5D2MC 3ZFWA 2R03A 1YCSB 3UPVA 4PH4B 4GYOA 4BERA 5KJLA 4NRHB 4N5CA 1DC2A 4QFVA 2BKKB 4UWGA 3JQ1A 3MKQA 4ZHBA 3MX3A 3Q75A 2P58C 3D9JA 4UUCA 2WMNA 4UWHA 4KT6B 4LNUD 3JYSA 3DSTA 5CEDB 4L2LA 1H2TC 1JPLA 2ETBA 1QZ2A 1EDUA 1JWFA 2WMOA 4HI8A 3N71A 1TN6A 2F37A 1LTXA 1KT0A 2A5EA 4BESA 1K1BA 4KXKB 4U0SA 5FTPA 3G2UA 2CG2A 2VGXB 4A3VA 5AIJA 4GU5A 3SF4A 4GPMA 5CMYA 3ZXSA 5JHAA 3B7SA 5LX8A 1HFAA 4K5AB 5JJ7A 4UWFA 4BSZB 1ZB1A 3ONKA 1YA0A 4GZ6A 3FU6A 5ENQD 2WXJA 5IY5E 3ZW3A 4K5BA 2XENA 2FEZA 3TWRA 3E30A 4L1BA 2AWIA 3BEEA 4UQXA 4C9BB 3CGHA 2FI7A 1WDYA 2P9UG 1JCQA 5H7PA 2DBAA 2OVBA 4A55A 4RG6A 3TWWA 3E33A 3WXXA 2J9QA 2I2OA 5LP0A 5CCLA 2L0IA 3QKYA 1S63A 4A3TA 1LD7A 4I43A 3SO8A 2PM7A 4I1AA 3CVPA
chains in the Genus database with same CATH topology
2P9PG 3UKUG 2P9LG 2P9UG 3UKRG 1K8KG 2P9SG 4XEIG 2P9KG 3RSEG 2P9NG 3DXMG 3DWLG 3ULEG 4JD2G 2P9IG 1TYQG 1U2VG 3DXKG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9P G;  3UKU G;  2P9L G;  2P9U G;  3UKR G;  1K8K G;  2P9S G;  4XEI G;  2P9K G;  3RSE G;  2P9N G;  3DXM G;  3DWL G;  3ULE G;  4JD2 G;  2P9I G;  1TYQ G;  1U2V G;  3DXK G; 
#chains in the Genus database with same CATH topology
 4I9C A;  4XEI G;  3HXF A;  3CLJ A;  1UOH A;  2H6F A;  1DNP A;  4M7C A;  3MJW A;  5BXU A;  4FUL A;  3BG1 B;  4UI9 J;  3IEG A;  2XCC A;  2IJG X;  4CRW A;  1Q2Z A;  2Y4U A;  4PUC A;  1MYO A;  3HIZ A;  2IY0 C;  3VLE A;  3R9M A;  2HR2 A;  4F6R D;  3L22 A;  4CYM D;  3FP3 A;  3B95 A;  2BUG A;  3LYA A;  4NQ0 A;  4ATZ D;  1FVH A;  3CVU A;  3E37 A;  2X6F A;  3JUI A;  3KS2 A;  4C0E A;  4F53 A;  2KCL A;  1HG5 A;  4KYO B;  3ZXP A;  3MGB A;  5BW8 C;  4A1S A;  4AY6 A;  3UXG A;  4URK A;  3KEZ A;  2L9B A;  2XRZ A;  3CVY A;  3T8M A;  3BU8 A;  2GRP B;  5AQA A;  4DX5 D;  3CK9 A;  3D9K A;  4KZC A;  5FZR A;  1QBQ A;  1QNF A;  3ZYQ A;  3VTX A;  2CHX A;  1JCS A;  5A7D B;  3NQP A;  1B89 A;  3E34 A;  1TNO A;  2WQH A;  3FUE A;  4O6F A;  1H2U A;  4J8Y A;  4K0R A;  3CQG B;  2WXP A;  4TRQ A;  3QWW A;  4YDW A;  4IN3 B;  3EHQ A;  4AP2 A;  2XCB A;  1WY6 A;  2MYO A;  3V30 A;  1KZP A;  3TJP A;  4K5C A;  2EIM E;  3FH7 A;  5G2N A;  2VJ8 A;  5J08 A;  3RAU A;  2OEW A;  1IKN D;  1NL4 A;  1OWL A;  1BI7 B;  4HXI A;  5G05 C;  4DUI A;  4HOU A;  3CVL A;  1W3B A;  3JUE A;  3C72 A;  4F3V A;  2NSZ A;  4NIK A;  3ZUV B;  2R05 A;  1U3D A;  4I17 A;  4GTT A;  3FEY A;  5CBN A;  3FTY A;  3D9O A;  1N95 A;  5ENN A;  1K1A A;  3G2T A;  3R9A B;  2R2L A;  4C48 B;  2IO2 C;  3RK6 A;  5ENS D;  2LXM A;  4G24 A;  3CEQ A;  2EIN E;  3ZYM A;  3B7T A;  3HG0 D;  2V5F A;  3ENE A;  3OTN A;  2Y1L E;  5C2Y A;  2WXG A;  3CVV A;  4HS2 A;  3UKR G;  5KCM A;  3PRE A;  1H6K A;  1N54 A;  4IRU A;  2OCC E;  3ZRH A;  2XS8 A;  1INZ A;  4AY5 A;  3AS8 A;  3QWP A;  3SQV A;  4NAC A;  2C2L A;  4FP7 A;  1OCO E;  1TEZ A;  1K3Z D;  1SA4 A;  2QC9 A;  4N2S A;  3AG2 E;  3TAX A;  4CEM A;  4JA9 A;  4BSX A;  3SI5 A;  3ABL E;  4RSY A;  3V31 A;  2P9P G;  1OWP A;  3AG3 E;  4UI9 C;  4A63 B;  3JQ0 A;  2UY1 A;  2M63 A;  2WXO A;  2XZT G;  4XI9 A;  1BI8 B;  1OCR E;  1KLX A;  2F0Y A;  3Q5M A;  2UY1 B;  4U8V D;  3DSS A;  3IV0 A;  5EDS A;  4AM9 A;  3FUI A;  1YMP A;  3LDZ A;  5AEN A;  1Z3Y A;  2R17 C;  3D9I A;  5G04 C;  5EYL A;  2VGE A;  4A1G A;  1BLX B;  3PZD A;  1TNB A;  2A5U A;  3CR3 A;  4RQI A;  5AQ9 A;  1X81 A;  3ZN3 A;  4UQZ A;  2QFC A;  3G2V A;  4DLO A;  3ZHE B;  3HYM B;  2PZI A;  1Z3X A;  5KWD A;  4N5Q A;  1BD8 A;  1U3C A;  1SZA A;  3HXE A;  1O5M A;  4UWK A;  4EPZ A;  5ARF A;  1E96 B;  3HXB A;  1ZU2 A;  3ASD A;  2KM4 A;  4U8Y D;  2NC9 A;  3VLF A;  1OWN A;  3MYV A;  3RU0 A;  3FTU A;  3L9T A;  2XRY A;  4JPS A;  4GA0 A;  4DX1 A;  5B1B E;  3PRZ A;  3PEU B;  4M3O A;  2DIW A;  3LPZ A;  5CBO A;  3D9N A;  5HQ8 A;  4Y6C A;  4U95 D;  2VQ2 A;  4GTQ A;  3C3Q A;  4D10 C;  3HVE B;  4NUR A;  4GMR A;  3APF A;  1OY3 D;  4I1M A;  1JWG A;  2IO3 C;  5CER B;  2PL2 A;  2RG8 A;  1HU3 A;  1KPS B;  2FO1 E;  1UN9 A;  5BXO A;  2H6I A;  3ASG A;  4KVM A;  4UWL A;  3DRA A;  4HRN A;  2ETA A;  4P29 A;  2WXI A;  3Q79 A;  4ZFH A;  5BV0 A;  4Q94 A;  4BT8 A;  2GRM A;  1WAO 1;  2R59 A;  3ULE G;  3BG0 B;  2IEJ A;  3AU5 A;  2WXF A;  2WQ6 A;  3AJI A;  3FTW A;  4BX9 A;  4LSZ E;  2VSO E;  4G26 A;  2CFZ A;  4TXP A;  2E0I A;  2DVW A;  3D3M A;  3HDX A;  2XHE A;  2JLB A;  3DXM G;  5LCW J;  2J4D A;  4EBA A;  2WXN A;  3LVQ E;  4YDE A;  5AAO A;  1BU9 A;  3T8K A;  3C5R A;  2RFA A;  4GTR A;  3SFX A;  2QZA A;  3ZYL A;  4H7Y A;  4BX8 A;  2WB2 A;  3CVW A;  1E8W A;  2OVF A;  4GZD A;  3LJN A;  5HKP A;  2C0L A;  3WG7 E;  3HXD A;  4HVB A;  3FTS A;  2XS1 A;  4BTB A;  2HYZ A;  4JC8 A;  3S7D A;  1KT1 A;  2I1J A;  3CV0 A;  2LXL A;  3PS6 A;  1MQS A;  1OCC E;  4BET A;  2GGF A;  5A6C A;  5EX3 A;  1N4P A;  3PUJ A;  3MKR A;  4WWP A;  2XPY A;  1H6P A;  1SA5 A;  4JHK A;  3JCK C;  4C0M A;  5KJN A;  3S7F A;  4AIF A;  2VGX A;  4GB9 A;  4CT4 A;  2WVI A;  1N4S A;  3RO2 A;  1TNY A;  3CST A;  3DBS A;  3NF1 A;  4YVQ C;  2H6G A;  2KCK A;  4MRU A;  3QAQ A;  4G2V A;  4L9P A;  3IXE A;  2V4L A;  2DYS E;  4IUL A;  5C1D A;  4WAF A;  3TL5 A;  3EHN A;  4HQD A;  1UN8 A;  3OAW A;  2QY7 A;  3MA5 A;  2CG3 A;  4PS8 A;  5E75 A;  2L6B A;  4Z68 A;  4LG6 A;  3AG4 E;  3TXN A;  3GZ1 A;  3U66 A;  2XEE A;  3TWV A;  3D9P A;  2I9C A;  2NXP A;  4R7L A;  3B7U X;  4CGV A;  3APC A;  3DSU A;  4JVS A;  1WM5 A;  1RZ4 A;  3V2O A;  4HOQ A;  5AYW D;  2RD0 A;  4CT0 A;  4EZJ A;  2F8X K;  5KNG A;  1H6O A;  3QNK A;  5DBK A;  4LEU A;  5FZS A;  3UMV A;  4DRX E;  2MRI A;  3C98 A;  4ILH B;  2PQN A;  4GYW A;  1QYM A;  3SNX A;  2V4H C;  3FUL A;  2A4Z A;  4XIF A;  3V2X A;  3FTV A;  5FJY A;  4GTO A;  2J4B A;  5AN8 A;  5B3S E;  4GYY A;  1FPP A;  2EIK E;  1MHQ A;  4FLH A;  3SFZ A;  4DX7 D;  2Q7F A;  2FBN A;  5KJK A;  3QAR A;  5CHE E;  1X5B A;  2IFU A;  2IQC A;  2XGM A;  4BEP A;  3L82 A;  1S70 B;  3UKU G;  1GW6 A;  1E8Y A;  3EHM A;  4H7X A;  3AG1 E;  4RG9 A;  4WNE A;  1DCE A;  4J8F A;  4FHK A;  4V3I A;  5T4Y A;  3FH5 A;  3ZKJ A;  2PNN A;  1TNZ A;  3TXM A;  4E85 A;  4XKC A;  4ME2 A;  4AVX A;  3HXC A;  2DZO A;  3UQ3 A;  3ISM C;  2KZT B;  1PY1 A;  3MV2 B;  4W9R A;  2KBX A;  4MS6 A;  3L17 A;  2XGO A;  2I6H A;  5BUZ A;  3VTY A;  4YDO A;  3QDN A;  2BF0 X;  2LUH A;  4HOT A;  4JB8 P;  3SBT B;  3CVQ A;  2VSY A;  4YVO A;  2FF4 A;  3ULQ A;  3SGH A;  2LSU A;  1ELR A;  4DX6 D;  2GRQ B;  3UM1 A;  1A5E A;  4GZC A;  5LOZ A;  2WXK A;  2EIJ E;  2RKK A;  2YHC A;  4O60 A;  3P2B A;  2WPV A;  3T5X A;  5HI7 A;  4B94 A;  1P5Q A;  1DVP A;  3MEK A;  2XGS A;  3DWL G;  5FQ4 A;  4AEZ C;  1HS6 A;  2GRN B;  1UW4 B;  2YNQ A;  3QB2 A;  2LAH A;  3ABK E;  1IHB A;  3ASF A;  4EQF A;  4G11 A;  3CK8 A;  3W9F A;  3RIB A;  3OXG A;  5J90 A;  2XEV A;  3FTX A;  4KZ0 A;  1NFI E;  3E4B A;  1HF8 A;  4HI9 A;  3E32 A;  4HLE A;  4AOF A;  3ML8 A;  2P9K G;  2WM9 A;  3L16 A;  3BUA A;  3UM0 A;  5M72 A;  5FZQ A;  5AJL A;  3NAW A;  1ELW A;  3PZ2 A;  4TUU A;  1TJF A;  3Q49 B;  3QC1 A;  2HM8 A;  5CEC B;  1LD8 A;  1N4R A;  2XQ0 A;  4GZ5 A;  4MKT A;  3LS8 A;  4L2Y A;  2WXH A;  1S0P A;  4U0Z A;  3URZ A;  1WG0 A;  3AS4 A;  1E8X A;  3ZU7 B;  3B7R L;  1MX2 A;  3TG4 A;  1OWO A;  2WXQ A;  3HHM A;  2OEV A;  3JXI A;  5BNW A;  3DSV A;  5ANL A;  4GCO A;  4OVU A;  3J5P A;  3QWV A;  4YND A;  3FUK A;  3FTZ A;  3OXF A;  2OND A;  2GRL A;  2XEH A;  3SBS A;  2Y4T A;  1OXJ A;  4DPR A;  3PZ3 A;  1D9S A;  2MHK A;  4WWN A;  3LY8 A;  3FUH A;  2XPZ A;  2X6K A;  2XPI A;  4N39 A;  1N11 A;  3D9H A;  1FT1 A;  1A17 A;  3CK7 A;  5CEA A;  2Y0B G;  1DCQ A;  2J8S D;  4ATG A;  4FAD A;  3Q7F A;  5AQ7 A;  3X2Q E;  4LNB A;  1FVF A;  4FJY A;  3Q9N C;  3T5V A;  2VTB B;  3CQC B;  3OXL A;  1E7U A;  3CHS A;  2AXV A;  3SZ7 A;  1V54 E;  3L08 A;  5ARG A;  3D9L A;  3ZHE A;  3PEV B;  3FUF A;  3O4Z A;  4GMJ A;  3W9G A;  2LNI A;  5BV1 A;  1D8D A;  4KMO A;  1E7V A;  4ANV A;  5BPP A;  3IBE A;  4G25 A;  4CDN A;  3DEP A;  3KEA A;  4GA2 A;  4Q96 A;  3UIN C;  3KD7 A;  4CDM A;  3FWV A;  2WXL A;  4J6I A;  5FWQ A;  3FU3 A;  3SY2 A;  1YYH A;  2P9I G;  4GCN A;  3PE3 A;  1O1R A;  4U07 A;  3HVE A;  4G1T A;  4CCA A;  2XZD G;  4UI9 K;  4WWO A;  5CCM A;  4GA1 A;  4LNG A;  2P9N G;  5EYP F;  3CSF A;  3I4R B;  2I1K A;  3LJ3 A;  3ZGQ A;  2DYR E;  2VSN A;  4LCT A;  1HH8 A;  3FFL A;  2P9S G;  2AVP A;  3UI2 A;  2JEK A;  5BT1 A;  1N9A A;  4YDY A;  2DWZ A;  5CRU A;  5EN5 D;  2V8S E;  1RW2 A;  5FQ7 A;  4HB5 A;  3U3W A;  1NA3 A;  5KJM A;  1E90 A;  3NOC D;  3LCA A;  4FLB A;  4I2W A;  4U7E B;  3PDN A;  4TXQ A;  4PS3 A;  3Q7A A;  5LFA A;  1IQR A;  2UWJ G;  1TNU A;  3FU5 A;  4MLP A;  3ZPJ A;  2R02 A;  2X6H A;  5EID A;  1OT8 A;  2FO7 A;  5EIB E;  4GPK A;  3ULY A;  3ASO E;  2KXP C;  4BFR A;  2DZN A;  4LER A;  3DXK G;  2WXR A;  3FUN A;  3D9M A;  5T8I A;  1E8Z A;  3SFY A;  1OCZ E;  2YHE A;  3PE4 A;  5JA4 D;  3DSX A;  2FUL A;  1NP7 A;  4OAV B;  1U2V G;  3NOG D;  3RRN B;  4F1S A;  3FDH A;  4BY6 A;  4AJW A;  2C0M A;  2YQ8 A;  3Q47 B;  4HRL A;  2J49 A;  3V79 K;  3L13 A;  5FQ8 A;  1BPO A;  2L0T B;  3ZVV A;  2Y3A A;  1IQU A;  3EU5 A;  4G8K A;  4WNG A;  4QQI A;  5EX0 A;  4B89 A;  2VYI A;  3TG5 A;  5B1A E;  2AXU A;  2QYJ A;  4BWR A;  4HNA D;  5G05 J;  5JHB A;  4HBD A;  3MKQ B;  4J8D A;  5T3R A;  2WQ7 A;  2KCV A;  3HRA A;  3RKV A;  1KZO A;  2AJA A;  4N3B A;  3DPY A;  4PS7 A;  3DPD A;  3I4G A;  1UJK A;  2BKG A;  3RSE G;  2J09 A;  4I2Z A;  5CMW A;  5FIN A;  3SHF A;  4APO A;  3PH0 C;  4E6H A;  1XNF A;  4JHJ A;  5FQ6 A;  3ESL A;  3TWX A;  1H19 A;  3TWU A;  5FIO A;  2KAT A;  1OUV A;  4HRM B;  5EKQ D;  1Z5S C;  2PQR A;  3MZL B;  2ETC A;  1K8K G;  2ZIR A;  3TGO A;  3CKB A;  4HLL A;  3T9K A;  3FY4 A;  4GTM A;  2ILR A;  4ANW A;  2EQX A;  3DEO A;  3UIO C;  4J8E A;  3LY7 A;  2ION A;  2OV8 A;  1MX4 A;  2GRO B;  1TN7 A;  4FJZ A;  2YIN A;  1N0R A;  1IXV A;  2ZXW E;  4JXT A;  3G2S A;  3Q9U C;  3ONL A;  4PDX A;  3AU4 A;  3CHM A;  3Q4A B;  1MZC A;  2J08 A;  4J0U A;  1HXI A;  4BT9 A;  4GTV A;  5ANR A;  1TN8 A;  1NZN A;  1XGW A;  2GW1 A;  1JUQ A;  3EJN A;  2F8Y A;  2CHW A;  2QYU A;  1EF1 C;  3QOU A;  2X38 A;  2LO6 A;  3K9I A;  1Y6I A;  1VDY A;  2V0P A;  5AQB A;  3KSQ A;  4CZ2 D;  2ZGD A;  3FU0 A;  3PZ4 A;  1JCR A;  1S64 A;  2IF4 A;  4LUN U;  5G04 J;  2KZT A;  3B7B A;  4U04 A;  3UT8 A;  4UQY A;  5LCW C;  3UT4 A;  2JAB A;  4XZ4 A;  3GZ2 A;  3IHY A;  1UJJ A;  3PVL A;  3RJV A;  4EBA G;  4O1O A;  4B0Z A;  3IKO B;  4GML A;  3CKC A;  1EPU A;  3PZ1 A;  1HO8 A;  4U63 A;  4JEU A;  4WND A;  1SZ9 A;  4B93 B;  3Q15 A;  3VLD A;  2ZGG A;  5HS0 A;  2J07 A;  4GTS A;  4DI4 A;  5KNH D;  1IHG A;  3ASH A;  4N2Q A;  3CHP A;  2NYJ A;  3MV3 B;  4TXR A;  3G2W A;  1AWC B;  4LRZ A;  4WNF A;  1MX6 A;  4ANU A;  4XE0 A;  3EU9 A;  1N4Q A;  1Z6T A;  4DX2 A;  3EIJ A;  4KBQ A;  2Y69 E;  4FU3 A;  5E76 A;  1ZBP A;  4Y6W A;  3R7Q A;  4JW1 A;  1TR4 A;  2EIL E;  4F7A A;  3LXU X;  5D0Q D;  3MCX A;  2IOS A;  3CIA A;  4I1O B;  3UUX A;  3PUK A;  4RVB A;  1SW6 A;  4N3C A;  4GAA A;  3FHE A;  3CVN A;  3JXJ A;  4GTP A;  4F1P A;  4HFG A;  1O1T A;  3NZU A;  1NA0 A;  3RRU A;  3FUM A;  4TV3 A;  3EHR A;  3S2A A;  3RRM B;  5ENR D;  3KAE A;  4TUM A;  5DIZ A;  3QJZ A;  1TJC A;  2H6H A;  3ASN E;  1TYQ G;  2CFU A;  1SQM A;  3ZNG A;  3AAA C;  2X6I A;  3UX4 A;  4L7T A;  3C3R A;  1IYG A;  3Q73 A;  4B8C B;  3L54 A;  4OAU C;  5JJT A;  4HOR A;  4B8A A;  1HG2 A;  1UG3 A;  4BTA A;  4JL0 A;  3LVR E;  3I5P A;  3IHV A;  4MBG A;  4ABN A;  4G23 A;  3EDT B;  2GRR B;  4ACL A;  3CHR A;  3Q78 A;  2PM6 A;  3P1U A;  4I6E A;  2HO1 A;  3LKU A;  3LY9 A;  4FA6 A;  1NI1 A;  3UIP C;  1V55 E;  3O48 A;  5ENT D;  4U0U A;  1FCH A;  5ITZ F;  3J5Q B;  3ML9 A;  4OVV A;  1OWM A;  3C3O A;  5ENO D;  5AJD A;  3GW4 A;  3APD A;  3UM3 A;  2VSX E;  1H0A A;  4J8S A;  3TWS A;  4G8L A;  3CHQ A;  3I3N A;  4RLY A;  1PC2 A;  1MJ0 A;  2VTB A;  3GYZ A;  1SVX A;  1QQE A;  4I9E A;  2MOW A;  4O1P A;  3S7J A;  1N0Q A;  1AP7 A;  1HX8 A;  4DK5 A;  3F6Q A;  3NB2 A;  3UM2 A;  2B6C A;  3CVX A;  2X6J A;  4CGW A;  2E2E A;  4AV7 A;  2CHZ A;  4CDR A;  3L6A A;  5KBA A;  2P2C P;  4U96 D;  4HOS A;  3PNT B;  4ILG A;  1N94 A;  3ZEF A;  5FT9 A;  1HE8 A;  3R7R A;  3FH8 A;  4IYP A;  2AW6 A;  3GZS A;  3PNL B;  2LSV A;  5JJ6 A;  3LEW A;  1H2V C;  4Q69 A;  3ZYK A;  1PAQ A;  4ANX A;  1G3N B;  3NZS A;  4DJA A;  4JD2 G;  2HE0 A;  4KVO A;  3KSL A;  2BTD A;  2OOE A;  3FUJ A;  5EIL A;  2ZIS A;  4AXH A;  4EZL A;  2L6J A;  4EHM A;  2ZU6 B;  1N52 A;  2VGY A;  4XKB A;  3EUV A;  2IOL A;  1D8E A;  4WUY A;  3SD5 A;  3NBN B;  4XI0 A;  4L23 A;  3EIQ C;  4ACK A;  1HZ4 A;  2KC7 A;  2V5Q C;  4U8H A;  4J7W A;  1L5J A;  4X8Q A;  3BQO A;  3FEX A;  2LAI A;  3ABM E;  4K03 A;  2X3M A;  3ZIM A;  3FUD A;  3ESK A;  1ELK A;  1Y8M A;  3S7B A;  3UT7 A;  5G55 A;  2AXZ A;  5CRV A;  2DCP A;  2WXM A;  3TWT A;  3UTM A;  2RFM A;  4JZY A;  2IU1 A;  5AAR A;  3DSW A;  4I6G A;  4GZ3 A;  4FHJ A;  3RO3 A;  2P9L G;  4N3A A;  4EEC A;  5A23 A;  3U4T A;  3B13 A;  4JHR A;  5D66 A;  2B0O E;  3QK0 A;  4ILI A;  4FC8 A;  4XX5 A;  4APF A;  1EYH A;  5D0O D;  4DI3 A;  3TWQ A;  4OYS A;  5JMN D;  3AS5 A;  2R5S A;  3U9W A;  4DLQ A;  1O1S A;  1LF8 A;  4JEH A;  1FT2 A;  5HRY A;  3CHO A;  4JA7 A;  4I6J A;  3U64 A;  2BED A;  5ENP D;  4EZK A;  5D2M C;  3ZFW A;  2R03 A;  1YCS B;  3UPV A;  4PH4 B;  4GYO A;  4BER A;  5KJL A;  4NRH B;  4N5C A;  1DC2 A;  4QFV A;  2BKK B;  4UWG A;  3JQ1 A;  3MKQ A;  4ZHB A;  3MX3 A;  3Q75 A;  2P58 C;  3D9J A;  4UUC A;  2WMN A;  4UWH A;  4KT6 B;  4LNU D;  3JYS A;  3DST A;  5CED B;  4L2L A;  1H2T C;  1JPL A;  2ETB A;  1QZ2 A;  1EDU A;  1JWF A;  2WMO A;  4HI8 A;  3N71 A;  1TN6 A;  2F37 A;  1LTX A;  1KT0 A;  2A5E A;  4BES A;  1K1B A;  4KXK B;  4U0S A;  5FTP A;  3G2U A;  2CG2 A;  2VGX B;  4A3V A;  5AIJ A;  4GU5 A;  3SF4 A;  4GPM A;  5CMY A;  3ZXS A;  5JHA A;  3B7S A;  5LX8 A;  1HFA A;  4K5A B;  5JJ7 A;  4UWF A;  4BSZ B;  1ZB1 A;  3ONK A;  1YA0 A;  4GZ6 A;  3FU6 A;  5ENQ D;  2WXJ A;  5IY5 E;  3ZW3 A;  4K5B A;  2XEN A;  2FEZ A;  3TWR A;  3E30 A;  4L1B A;  2AWI A;  3BEE A;  4UQX A;  4C9B B;  3CGH A;  2FI7 A;  1WDY A;  2P9U G;  1JCQ A;  5H7P A;  2DBA A;  2OVB A;  4A55 A;  4RG6 A;  3TWW A;  3E33 A;  3WXX A;  2J9Q A;  2I2O A;  5LP0 A;  5CCL A;  2L0I A;  3QKY A;  1S63 A;  4A3T A;  1LD7 A;  4I43 A;  3SO8 A;  2PM7 A;  4I1A A;  3CVP A; 
#chains in the Genus database with same CATH homology
 2P9P G;  3UKU G;  2P9L G;  2P9U G;  3UKR G;  1K8K G;  2P9S G;  4XEI G;  2P9K G;  3RSE G;  2P9N G;  3DXM G;  3DWL G;  3ULE G;  4JD2 G;  2P9I G;  1TYQ G;  1U2V G;  3DXK G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...