2P9NG

Crystal structure of bovine arp2/3 complex co-crystallized with adp
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
143
structure length
134
Chain Sequence
ARFRKVDVDEYDENKFVDAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDSSAVLLQWHEKALAAGGVGSIVRVLTARKTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the Influence of Nucleotides on Actin Family Proteins from Seven Structures of Arp2/3 Complex.
pubmed doi rcsb
source organism Bos taurus
molecule tags Structural protein
molecule keywords Actin-like protein 3
total genus 42
structure length 134
sequence length 143
ec nomenclature
pdb deposition date 2007-03-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF04699 P16-Arc ARP2/3 complex 16 kDa subunit (p16-Arc)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.190 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Actin-related protein 2/3 complex subunit 5 2p9nG00
1TYQG 3ULEG 2P9PG 3DWLG 1U2VG 3DXKG 2P9SG 2P9NG 3DXMG 1K8KG 4JD2G 3UKRG 3UKUG 3RSEG 2P9UG 2P9IG 2P9LG 4XEIG 2P9KG
chains in the Genus database with same CATH superfamily
3Q9NC 5AJLA 4AY6A 2WXLA 4FHJA 2PL2A 1NI1A 3OXFA 1E90A 5A6CA 3PEUB 1P5QA 3FP3A 4G11A 3AU5A 4CYMD 4AOFA 1INZA 1ZB1A 2XGSA 5HRYA 4DLQA 4I1OB 3Q7FA 2XS1A 1KPSB 2HR2A 3DSVA 3BU8A 1KZOA 4N2SA 3PRZA 3FHEA 3U9WA 2Y3AA 1ZU2A 3L9TA 4HI8A 1OWPA 3PUKA 2XEVA 1QZ2A 2L0TB 2OVFA 1NP7A 3CK8A 3LJ3A 4O60A 4HRNA 3CVLA 3SO8A 3CVUA 2VYIA 3ZHEA 3ZPJA 4FJYA 2F8YA 3I3NA 4GMRA 3MEKA 4E6HA 3UM2A 2LSUA 1S70B 3ZVVA 3EHQA 4QQIA 3EIJA 1D8DA 2PQNA 4GTVA 1A17A 4WUYA 1Z3XA 2BTDA 4B8CB 1E8YA 3KAEA 4UWLA 3FUKA 3UKUG 1MX6A 2BF0X 3ZEFA 2ETAA 4LNBA 2WXOA 3U4TA 5JA4D 1FT1A 4O6FA 3UM3A 3B7BA 1VDYA 4BSXA 3VTXA 5G2NA 4L9PA 3ZYQA 4JW1A 1FVHA 3KD7A 5EILA 3T5VA 5FQ6A 4C0EA 2P9SG 1FT2A 1N52A 3IKOB 1L5JA 3N71A 4I2WA 3BG1B 4WNGA 4HLEA 3HHMA 4GYWA 3Q9UC 2VTBB 2HE0A 2ONDA 4DI3A 4URKA 4C0MA 4BESA 2UY1B 3UIPC 3JXJA 3ZXPA 2QY7A 1KLXA 2VSYA 3PNTB 4LUNU 3MV3B 3QOUA 1LD8A 1N9AA 4YVQC 2XRZA 4LERA 2L9BA 5ENOD 1IQRA 2V8SE 4GZCA 3RU0A 2WQ7A 3R9MA 2F8XK 3UIOC 1HXIA 4EZJA 4FLHA 3CVVA 2JLBA 3UMVA 3PDNA 3ZYKA 5KBAA 3FUMA 3UM0A 4ACKA 3EDTB 2PNNA 3UINC 4Q96A 5BV1A 1TN7A 1N4QA 2XEHA 5EN5D 4DK5A 4XX5A 2J4BA 4K5CA 2WXJA 5KWDA 3UKRG 3OTNA 3PE3A 1IYGA 4J0UA 1SZAA 1SVXA 1TN6A 2RG8A 2P9LG 4ZFHA 4AV7A 5BV0A 4L23A 3NQPA 3JUIA 2LO6A 5ENPD 2CHXA 3D9NA 4B0ZA 4I9CA 3MKQB 5AARA 3B95A 4TRQA 2H6HA 5EX0A 4GYYA 2WPVA 5CMYA 4MRUA 4L7TA 4I1MA 3O4ZA 5D0QD 2DYRE 2MYOA 1E7UA 3ZUVB 4I17A 1WG0A 2GRRB 3L22A 1OCRE 3AG4E 1HZ4A 2L6JA 5CBNA 4K0RA 3ABKE 1OCZE 2V0PA 2WXGA 4NURA 3DBSA 3AAAC 4AY5A 4PS7A 2X6JA 4G25A 4I43A 1RW2A 2C2LA 4U95D 2KCVA 3CVYA 4XI0A 3ML8A 4I2ZA 2VSXE 3HXCA 3TWRA 2DWZA 1WY6A 5AQ7A 1N0QA 1SQMA 4FULA 5KNGA 4CRWA 2QFCA 3ONKA 4GA0A 2B0OE 3FH8A 5EIDA 4N3CA 1TNZA 4DJAA 4H7YA 4A3TA 1E96B 4UI9J 4GB9A 4MLPA 4UQZA 1HU3A 1K1BA 3CHMA 3E30A 1JUQA 4BSZB 3UTMA 2LAIA 3MA5A 3PE4A 5JHBA 2X38A 3CK9A 4BWRA 4Y6CA 5KJLA 1YCSB 4UQXA 4DX6D 2AXVA 5CEAA 5HKPA 2Q7FA 4FA6A 2BUGA 5BT1A 4UWKA 3RJVA 4DX1A 3FTYA 5LP0A 4F6RD 3UT4A 3JUEA 4J8DA 5ITZF 4OYSA 1W3BA 3I4GA 4WWOA 2XEEA 2X6IA 3CVXA 4AIFA 1JWGA 4BERA 2X3MA 3FTZA 5CCMA 1QYMA 3B7TA 4KXKB 3C3QA 4UI9C 3ZGQA 3LY7A 2IO2C 3FUIA 1FPPA 2R5SA 3K9IA 5CEDB 4RG9A 4LNUD 4J6IA 2R2LA 5LX8A 3KEAA 3QNKA 3CVQA 4APOA 1X5BA 3G2VA 1K1AA 2KBXA 3BUAA 5AYWD 4AM9A 1OCOE 3TWXA 3CHQA 4U8VD 4MKTA 2P9NG 4ANUA 3OXGA 3AG2E 5C2YA 3DRAA 3CHOA 2LUHA 4GYOA 4GTTA 4DLOA 4HOSA 4BTBA 3ESLA 4CGWA 2Y1LE 4ME2A 2GRPB 1JPLA 3IEGA 2IO3C 3FFLA 4UWHA 4TUMA 5CBOA 4A1SA 3S7FA 1Z5SC 3DEPA 3VLEA 3LJNA 5BXOA 5J08A 3SBTB 2FO1E 1OT8A 4GTRA 3TG4A 5BPPA 4GA2A 4KZ0A 1EYHA 3V2XA 4PUCA 2VTBA 1DNPA 4F53A 1NA0A 2WXNA 2BKGA 4GTQA 5M72A 4DX2A 2H6GA 4DPRA 4HOQA 2CFZA 3QARA 2XHEA 4HXIA 1O5MA 4RQIA 3FUFA 1H6KA 2WXKA 3GYZA 1UG3A 2X6FA 5ARFA 4EHMA 3TWWA 5CRVA 3FTXA 3OXLA 5IY5E 4UWGA 3V2OA 3MX3A 1UN8A 2ZGGA 2HM8A 3QWWA 4EZLA 3Q15A 3HYMB 3Q75A 3CKCA 4HBDA 2EIKE 3SQVA 3ZFWA 3ZKJA 4GZDA 5E76A 4ANXA 3CHRA 2DVWA 1XGWA 2OVBA 2LSVA 4M3OA 5CMWA 2IY0C 2YNQA 5LOZA 4U0ZA 3UXGA 2CHWA 2I1KA 2QC9A 3IXEA 3FTUA 4LCTA 5ENRD 3APFA 3CVPA 1HG5A 2AXUA 3L17A 2XPIA 2FO7A 4DX5D 4JB8P 4O1PA 3RO2A 3FUEA 2P9IG 2WXFA 3MKRA 3FU0A 1FVFA 4TV3A 1SW6A 4F3VA 1HE8A 1JCRA 3VTYA 3HXDA 1OWMA 3UPVA 4JEUA 3C98A 3UQ3A 2BEDA 3ML9A 1Y8MA 4DI4A 2WQ6A 3S7BA 3E37A 3UX4A 2IOLA 1HX8A 3JCKC 3V79K 5A23A 2OCCE 3D9IA 5AQAA 2CG3A 4CDMA 3IHYA 2LNIA 5EDSA 4I6EA 4WWNA 2KCKA 5G55A 1HF8A 3FEYA 1DCQA 1TNUA 4CGVA 3FDHA 3JQ1A 3TAXA 1H2VC 3PZDA 2RFAA 4CT0A 3MKQA 3HDXA 3P2BA 4CDRA 1PC2A 2XRYA 3MGBA 2YHCA 4BETA 4HB5A 4M7CA 3L13A 3CLJA 3PZ1A 4ACLA 3EHNA 4I1AA 1PY1A 1QBQA 3W9FA 3TGOA 2VSNA 3IBEA 3D9LA 1N4RA 4N2QA 4ANVA 2WMOA 4FADA 3B7SA 3NB2A 1MZCA 1UJJA 5FQ8A 3SBSA 2ZGDA 3F6QA 5A7DB 1UJKA 2WXPA 4HRMB 2NC9A 3ABLE 2VGYA 1BD8A 1WM5A 2PQRA 3W9GA 5T8IA 2Y4TA 2IEJA 4U7EB 4JXTA 1N95A 2XQ0A 2FF4A 4JPSA 1NL4A 3SZ7A 2R02A 3AG1E 1OUVA 2LXLA 4FHKA 5JJ7A 3RKVA 2XPZA 2EQXA 1E8XA 1HG2A 1ZBPA 4YNDA 4NIKA 2KCLA 4JHKA 2ZU6B 4XE0A 3CGHA 5JJTA 3ZYMA 2ZXWE 1H2UA 2WXHA 3QWPA 1MQSA 3URZA 1S0PA 4GPKA 3PH0C 2DIWA 1XNFA 3C5RA 3HVEB 4KMOA 3CSFA 2XS8A 4FLBA 2EINE 2NYJA 1MJ0A 4TXQA 1ELRA 2WXRA 3EHRA 4CCAA 1HH8A 3Q47B 4ZHBA 3Q79A 2VSOE 3RO3A 4L1BA 5DBKA 4LSZE 5JHAA 4LG6A 4V3IA 2WXMA 3LY8A 1YA0A 5D2MC 4TXRA 3G2SA 3ZYLA 4B89A 5LCWJ 2GGFA 1V55E 5B1AE 5KJNA 4I6JA 2KATA 4HFGA 4EBAG 3LY9A 4FJZA 3Q5MA 1JCSA 3I5PA 5G05J 2GW1A 5AQ9A 4PH4B 3DXMG 4NRHB 3SF4A 3EHMA 2E0IA 4KT6B 5ENNA 4JEHA 1IKND 3CHSA 1SA4A 2MHKA 1A5EA 3QWVA 1NZNA 2GRQB 3HXBA 3DSXA 1N94A 4OVVA 1GW6A 2P9PG 3PUJA 3ASGA 2V5FA 4A63B 3O48A 1HFAA 3TWSA 3QKYA 2P9KG 3FY4A 2EIME 3GZ1A 5CECB 4HORA 4JHJA 2V4LA 3ULQA 2FULA 5FQ7A 3RK6A 1H6OA 4IRUA 3R7RA 2DZNA 3SI5A 1K8KG 1H0AA 2B6CA 2UY1A 1UOHA 5ENTD 2I6HA 3PS6A 2XCCA 3I4RB 5FWQA 1BPOA 5FINA 4N3BA 5ENSD 4J8YA 2V4HC 1TNYA 2QZAA 2X6KA 4GTSA 4DUIA 2ETBA 2OOEA 4Z68A 3PZ4A 3D9MA 3RSEG 3P1UA 3HG0D 3R7QA 3UT7A 3CQCB 4R7LA 4WNDA 1UN9A 3FUJA 3HRAA 5FIOA 4G24A 1JCQA 1O1TA 4N3AA 3KSLA 3NOCD 3AG3E 3V31A 2J8SD 4HRLA 4JA7A 4JZYA 5FJYA 4UQYA 2CHZA 1KT1A 3J5QB 2R59A 3S2AA 3E4BA 1OWOA 4U0UA 3PEVB 4O1OA 4F7AA 3LXUX 4JC8A 5LFAA 4HQDA 3ENEA 4GCNA 4IYPA 2FI7A 4C48B 2WXIA 1OWLA 3DPDA 4L2YA 4WWPA 3BEEA 5J90A 5EYLA 3S7JA 1H2TC 4GZ6A 2L0IA 4LNGA 5CHEE 4FC8A 1O1RA 4J8SA 2IFUA 3PREA 1Z6TA 2OEWA 2LXMA 2AJAA 4QFVA 1BI7B 3TXNA 3NAWA 5FQ4A 3R9AB 1TN8A 5ANLA 3ULYA 4XKBA 2R05A 3ASNE 4UUCA 4OAVB 1K3ZD 1NA3A 3LKUA 4F1PA 3CIAA 4CT4A 2UWJG 3X2QE 4K03A 4GPMA 3T5XA 3FUDA 1IQUA 3FTVA 3PZ2A 1SZ9A 3FTSA 1PAQA 1DVPA 2H6IA 2NSZA 2MRIA 2WMNA 4L2LA 4YDOA 4G8KA 3L16A 2X6HA 5D66A 1AP7A 1N4PA 4KBQA 3FU5A 3QJZA 3E32A 4N5QA 4G26A 4WNEA 4RSYA 4XIFA 5ENQD 1IXVA 1LTXA 3B7RL 3AS8A 2RD0A 4IULA 3FUNA 4HS2A 2XENA 2P58C 1S63A 4U63A 3ASDA 4GTOA 1IHBA 4KVOA 4KYOB 4YVOA 2A4ZA 4OAUC 4I9EA 1E8WA 4ILGA 1D8EA 2BKKB 2AWIA 3SD5A 1U3CA 1O1SA 2JEKA 4CZ2D 3U3WA 3E34A 2VJ8A 4LEUA 1TNOA 3U66A 4BEPA 4G8LA 5BW8C 3MYVA 3IV0A 5JJ6A 2QYUA 3TWUA 3CEQA 3Q49B 3PZ3A 5FZSA 4AP2A 2J4DA 2XPYA 5G05C 3ISMC 4NQ0A 4APFA 4Y6WA 3TXMA 5BUZA 5FZRA 3FULA 3RAUA 2KXPC 5KJMA 1Z3YA 5KCMA 2J07A 5LCWC 1WDYA 1N11A 3NF1A 4K5AB 2VGXA 3MZLB 2R17C 4P29A 3NZSA 3AS4A 2I1JA 1JWFA 2WQHA 3EU9A 4BY6A 1FCHA 2ZIRA 3UM1A 5EKQD 4GZ3A 4B8AA 1OWNA 4KVMA 5AENA 3BQOA 3CR3A 4BX9A 4Q94A 4N5CA 1EPUA 2EILE 2IJGX 1QNFA 3DSUA 4GMLA 5KJKA 3UI2A 4OVUA 3RIBA 3DWLG 4ANWA 3ONLA 3DXKG 3GZ2A 3WXXA 4CDNA 4RLYA 2L6BA 3LEWA 5C1DA 3RRMB 2WVIA 2XCBA 5BXUA 2XZTG 1SA5A 1N54A 2YINA 3CSTA 2P2CP 3DSTA 3C3OA 3LCAA 3T9KA 4EZKA 2GROB 3JXIA 3RRNB 3FU6A 2YQ8A 3HXFA 3L82A 3EUVA 1WAO1 1MX4A 1TEZA 2I2OA 3T8MA 2EIJE 4GU5A 3QDNA 2J49A 1Y6IA 2RKKA 4HVBA 4GMJA 5EX3A 3G2UA 2VQ2A 3Q73A 5D0OD 4U8YD 2GRNB 5G04C 3BG0B 1V54E 4J8FA 3ZRHA 4MS6A 3Q78A 4BTAA 4GTPA 1MX2A 1EDUA 3GW4A 4DX7D 3LDZA 3LYAA 4J7WA 3ZNGA 1B89A 4PS3A 2J08A 2XGOA 3JQ0A 3SGHA 4EBAA 2Y4UA 2F0YA 3QAQA 1UW4B 4U07A 3CV0A 5B3SE 4BFRA 2DBAA 2OV8A 2J9QA 4ABNA 1DC2A 1HO8A 3ASOE 2FEZA 1YMPA 3DPYA 3GZSA 4XEIG 4BT9A 2CG2A 3WG7E 2GRMA 4YDYA 1IHGA 4WAFA 5HQ8A 4IN3B 4NACA 2CFUA 4AVXA 4W9RA 4RG6A 1D9SA 2KZTA 5FT9A 4MBGA 3TWQA 3ASHA 2KM4A 5ANRA 2I9CA 1KT0A 4GCOA 3VLDA 3C3RA 5G04J 2IOSA 3B7UX 3NOGD 1OY3D 2PZIA 4RVBA 4A55A 2KZTB 2J09A 2DZOA 4HLLA 4FU3A 1BU9A 1HS6A 1AWCB 1U2VG 4Q69A 3LPZA 5BNWA 3CVNA 3HVEA 3G2WA 3LVRE 2ETCA 3OAWA 5AQBA 3S7DA 4J8EA 3MCXA 2VGXB 2VGEA 2OEVA 3TWVA 1N0RA 2M63A 4A3VA 4XI9A 3SNXA 3SFXA 3SY2A 4JHRA 2Y69E 3SFZA 3APDA 3DSWA 3PNLB 5HS0A 3HIZA 3L6AA 4F1SA 4E85A 1TR4A 1MYOA 2IF4A 1ELWA 2NXPA 1Q2ZA 5AIJA 1E8ZA 3IHVA 3KS2A 4EECA 4FP7A 3D9HA 4GZ5A 2HO1A 3RRUA 2JABA 2A5UA 4ATZD 2P9UG 2PM6A 4I6GA 4X8QA 1MHQA 3AU4A 3CHPA 2IU1A 3ASFA 1X81A 3VLFA 4WNFA 3UT8A 3AS5A 3CQGB 2E2EA 4YDWA 3JYSA 3LS8A 4UI9K 3TG5A 2H6FA 3QK0A 3ZXSA 3C72A 2PM7A 3NZUA 2WXQA 2V5QC 3KSQA 4LRZA 5H7PA 3FH5A 4XZ4A 3CKBA 3U64A 5DIZA 3ABME 1LD7A 5AN8A 3FH7A 5EIBE 2WB2A 3FUHA 4PDXA 2DCPA 5AJDA 4KZCA 4TUUA 4AJWA 2AW6A 4N39A 1U3DA 4G23A 3TJPA 1BLXB 1BI8B 4HOTA 2MOWA 3FU3A 5E75A 4K5BA 1TJCA 2Y0BG 4TXPA 3HXEA 4HI9A 2HYZA 1LF8A 2A5EA 5CCLA 4XKCA 4AEZC 2KC7A 1OCCE 4GA1A 4H7XA 4UWFA 3SFYA 3DEOA 4CEMA 4ATGA 3FTWA 5FZQA 5HI7A 3TWTA 4B93B 3ZIMA 3NBNB 4ILHB 4G1TA 2FBNA 3ULEG 4DRXE 2AXZA 4JVSA 4C9BB 4BX8A 1KZPA 2WM9A 4JL0A 1YYHA 3L54A 4GAAA 3MV2B 3SHFA 3ZN3A 3ZHEB 4HOUA 3QC1A 4D10C 2YHEA 4PS8A 5JMND 1N4SA 4U0SA 1RZ4A 4BT8A 3DSSA 5T4YA 5CERB 3T8KA 2C0LA 2XGMA 4EQFA 3ESKA 2ILRA 3ZU7B 3FWVA 1H6PA 3EJNA 4GTMA 3APCA 2QYJA 1TNBA 3FEXA 1NFIE 4ILIA 4A1GA 3TL5A 5AAOA 3J5PA 3ZW3A 1ELKA 1G3NB 1TYQG 4U04A 3D9JA 3EIQC 3D3MA 5KNHD 3V30A 2F37A 3E33A 3MJWA 2GRLA 2C0MA 3AJIA 3EU5A 1OXJA 1E7VA 4HNAD 3G2TA 4U8HA 2XZDG 3CVWA 4U96D 3QB2A 3LVQE 3Q7AA 2DYSE 3Q4AB 5FTPA 4AXHA 2LAHA 3KEZA 4JD2G 1TJFA 1S64A 5T3RA 4JA9A 5ARGA 3CK7A 5B1BE 3D9PA 2IONA 1QQEA 3PVLA 4G2VA 2R03A 2RFMA 1H19A 4EPZA 3B13A 5EYPF 1DCEA 4B94A 5CRUA 2AVPA 3UUXA 2IQCA 3D9KA 3L08A 3D9OA 4YDEA 1EF1C 2ZISA
chains in the Genus database with same CATH topology
1TYQG 3ULEG 2P9PG 3DWLG 1U2VG 3DXKG 2P9SG 2P9NG 3DXMG 1K8KG 4JD2G 3UKRG 3UKUG 3RSEG 2P9UG 2P9IG 2P9LG 4XEIG 2P9KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYQ G;  3ULE G;  2P9P G;  3DWL G;  1U2V G;  3DXK G;  2P9S G;  2P9N G;  3DXM G;  1K8K G;  4JD2 G;  3UKR G;  3UKU G;  3RSE G;  2P9U G;  2P9I G;  2P9L G;  4XEI G;  2P9K G; 
#chains in the Genus database with same CATH topology
 3Q9N C;  5AJL A;  4AY6 A;  2WXL A;  4FHJ A;  2PL2 A;  1NI1 A;  3OXF A;  1E90 A;  5A6C A;  3PEU B;  1P5Q A;  3FP3 A;  4G11 A;  3AU5 A;  4CYM D;  4AOF A;  1INZ A;  1ZB1 A;  2XGS A;  5HRY A;  4DLQ A;  4I1O B;  3Q7F A;  2XS1 A;  1KPS B;  2HR2 A;  3DSV A;  3BU8 A;  1KZO A;  4N2S A;  3PRZ A;  3FHE A;  3U9W A;  2Y3A A;  1ZU2 A;  3L9T A;  4HI8 A;  1OWP A;  3PUK A;  2XEV A;  1QZ2 A;  2L0T B;  2OVF A;  1NP7 A;  3CK8 A;  3LJ3 A;  4O60 A;  4HRN A;  3CVL A;  3SO8 A;  3CVU A;  2VYI A;  3ZHE A;  3ZPJ A;  4FJY A;  2F8Y A;  3I3N A;  4GMR A;  3MEK A;  4E6H A;  3UM2 A;  2LSU A;  1S70 B;  3ZVV A;  3EHQ A;  4QQI A;  3EIJ A;  1D8D A;  2PQN A;  4GTV A;  1A17 A;  4WUY A;  1Z3X A;  2BTD A;  4B8C B;  1E8Y A;  3KAE A;  4UWL A;  3FUK A;  3UKU G;  1MX6 A;  2BF0 X;  3ZEF A;  2ETA A;  4LNB A;  2WXO A;  3U4T A;  5JA4 D;  1FT1 A;  4O6F A;  3UM3 A;  3B7B A;  1VDY A;  4BSX A;  3VTX A;  5G2N A;  4L9P A;  3ZYQ A;  4JW1 A;  1FVH A;  3KD7 A;  5EIL A;  3T5V A;  5FQ6 A;  4C0E A;  2P9S G;  1FT2 A;  1N52 A;  3IKO B;  1L5J A;  3N71 A;  4I2W A;  3BG1 B;  4WNG A;  4HLE A;  3HHM A;  4GYW A;  3Q9U C;  2VTB B;  2HE0 A;  2OND A;  4DI3 A;  4URK A;  4C0M A;  4BES A;  2UY1 B;  3UIP C;  3JXJ A;  3ZXP A;  2QY7 A;  1KLX A;  2VSY A;  3PNT B;  4LUN U;  3MV3 B;  3QOU A;  1LD8 A;  1N9A A;  4YVQ C;  2XRZ A;  4LER A;  2L9B A;  5ENO D;  1IQR A;  2V8S E;  4GZC A;  3RU0 A;  2WQ7 A;  3R9M A;  2F8X K;  3UIO C;  1HXI A;  4EZJ A;  4FLH A;  3CVV A;  2JLB A;  3UMV A;  3PDN A;  3ZYK A;  5KBA A;  3FUM A;  3UM0 A;  4ACK A;  3EDT B;  2PNN A;  3UIN C;  4Q96 A;  5BV1 A;  1TN7 A;  1N4Q A;  2XEH A;  5EN5 D;  4DK5 A;  4XX5 A;  2J4B A;  4K5C A;  2WXJ A;  5KWD A;  3UKR G;  3OTN A;  3PE3 A;  1IYG A;  4J0U A;  1SZA A;  1SVX A;  1TN6 A;  2RG8 A;  2P9L G;  4ZFH A;  4AV7 A;  5BV0 A;  4L23 A;  3NQP A;  3JUI A;  2LO6 A;  5ENP D;  2CHX A;  3D9N A;  4B0Z A;  4I9C A;  3MKQ B;  5AAR A;  3B95 A;  4TRQ A;  2H6H A;  5EX0 A;  4GYY A;  2WPV A;  5CMY A;  4MRU A;  4L7T A;  4I1M A;  3O4Z A;  5D0Q D;  2DYR E;  2MYO A;  1E7U A;  3ZUV B;  4I17 A;  1WG0 A;  2GRR B;  3L22 A;  1OCR E;  3AG4 E;  1HZ4 A;  2L6J A;  5CBN A;  4K0R A;  3ABK E;  1OCZ E;  2V0P A;  2WXG A;  4NUR A;  3DBS A;  3AAA C;  4AY5 A;  4PS7 A;  2X6J A;  4G25 A;  4I43 A;  1RW2 A;  2C2L A;  4U95 D;  2KCV A;  3CVY A;  4XI0 A;  3ML8 A;  4I2Z A;  2VSX E;  3HXC A;  3TWR A;  2DWZ A;  1WY6 A;  5AQ7 A;  1N0Q A;  1SQM A;  4FUL A;  5KNG A;  4CRW A;  2QFC A;  3ONK A;  4GA0 A;  2B0O E;  3FH8 A;  5EID A;  4N3C A;  1TNZ A;  4DJA A;  4H7Y A;  4A3T A;  1E96 B;  4UI9 J;  4GB9 A;  4MLP A;  4UQZ A;  1HU3 A;  1K1B A;  3CHM A;  3E30 A;  1JUQ A;  4BSZ B;  3UTM A;  2LAI A;  3MA5 A;  3PE4 A;  5JHB A;  2X38 A;  3CK9 A;  4BWR A;  4Y6C A;  5KJL A;  1YCS B;  4UQX A;  4DX6 D;  2AXV A;  5CEA A;  5HKP A;  2Q7F A;  4FA6 A;  2BUG A;  5BT1 A;  4UWK A;  3RJV A;  4DX1 A;  3FTY A;  5LP0 A;  4F6R D;  3UT4 A;  3JUE A;  4J8D A;  5ITZ F;  4OYS A;  1W3B A;  3I4G A;  4WWO A;  2XEE A;  2X6I A;  3CVX A;  4AIF A;  1JWG A;  4BER A;  2X3M A;  3FTZ A;  5CCM A;  1QYM A;  3B7T A;  4KXK B;  3C3Q A;  4UI9 C;  3ZGQ A;  3LY7 A;  2IO2 C;  3FUI A;  1FPP A;  2R5S A;  3K9I A;  5CED B;  4RG9 A;  4LNU D;  4J6I A;  2R2L A;  5LX8 A;  3KEA A;  3QNK A;  3CVQ A;  4APO A;  1X5B A;  3G2V A;  1K1A A;  2KBX A;  3BUA A;  5AYW D;  4AM9 A;  1OCO E;  3TWX A;  3CHQ A;  4U8V D;  4MKT A;  2P9N G;  4ANU A;  3OXG A;  3AG2 E;  5C2Y A;  3DRA A;  3CHO A;  2LUH A;  4GYO A;  4GTT A;  4DLO A;  4HOS A;  4BTB A;  3ESL A;  4CGW A;  2Y1L E;  4ME2 A;  2GRP B;  1JPL A;  3IEG A;  2IO3 C;  3FFL A;  4UWH A;  4TUM A;  5CBO A;  4A1S A;  3S7F A;  1Z5S C;  3DEP A;  3VLE A;  3LJN A;  5BXO A;  5J08 A;  3SBT B;  2FO1 E;  1OT8 A;  4GTR A;  3TG4 A;  5BPP A;  4GA2 A;  4KZ0 A;  1EYH A;  3V2X A;  4PUC A;  2VTB A;  1DNP A;  4F53 A;  1NA0 A;  2WXN A;  2BKG A;  4GTQ A;  5M72 A;  4DX2 A;  2H6G A;  4DPR A;  4HOQ A;  2CFZ A;  3QAR A;  2XHE A;  4HXI A;  1O5M A;  4RQI A;  3FUF A;  1H6K A;  2WXK A;  3GYZ A;  1UG3 A;  2X6F A;  5ARF A;  4EHM A;  3TWW A;  5CRV A;  3FTX A;  3OXL A;  5IY5 E;  4UWG A;  3V2O A;  3MX3 A;  1UN8 A;  2ZGG A;  2HM8 A;  3QWW A;  4EZL A;  3Q15 A;  3HYM B;  3Q75 A;  3CKC A;  4HBD A;  2EIK E;  3SQV A;  3ZFW A;  3ZKJ A;  4GZD A;  5E76 A;  4ANX A;  3CHR A;  2DVW A;  1XGW A;  2OVB A;  2LSV A;  4M3O A;  5CMW A;  2IY0 C;  2YNQ A;  5LOZ A;  4U0Z A;  3UXG A;  2CHW A;  2I1K A;  2QC9 A;  3IXE A;  3FTU A;  4LCT A;  5ENR D;  3APF A;  3CVP A;  1HG5 A;  2AXU A;  3L17 A;  2XPI A;  2FO7 A;  4DX5 D;  4JB8 P;  4O1P A;  3RO2 A;  3FUE A;  2P9I G;  2WXF A;  3MKR A;  3FU0 A;  1FVF A;  4TV3 A;  1SW6 A;  4F3V A;  1HE8 A;  1JCR A;  3VTY A;  3HXD A;  1OWM A;  3UPV A;  4JEU A;  3C98 A;  3UQ3 A;  2BED A;  3ML9 A;  1Y8M A;  4DI4 A;  2WQ6 A;  3S7B A;  3E37 A;  3UX4 A;  2IOL A;  1HX8 A;  3JCK C;  3V79 K;  5A23 A;  2OCC E;  3D9I A;  5AQA A;  2CG3 A;  4CDM A;  3IHY A;  2LNI A;  5EDS A;  4I6E A;  4WWN A;  2KCK A;  5G55 A;  1HF8 A;  3FEY A;  1DCQ A;  1TNU A;  4CGV A;  3FDH A;  3JQ1 A;  3TAX A;  1H2V C;  3PZD A;  2RFA A;  4CT0 A;  3MKQ A;  3HDX A;  3P2B A;  4CDR A;  1PC2 A;  2XRY A;  3MGB A;  2YHC A;  4BET A;  4HB5 A;  4M7C A;  3L13 A;  3CLJ A;  3PZ1 A;  4ACL A;  3EHN A;  4I1A A;  1PY1 A;  1QBQ A;  3W9F A;  3TGO A;  2VSN A;  3IBE A;  3D9L A;  1N4R A;  4N2Q A;  4ANV A;  2WMO A;  4FAD A;  3B7S A;  3NB2 A;  1MZC A;  1UJJ A;  5FQ8 A;  3SBS A;  2ZGD A;  3F6Q A;  5A7D B;  1UJK A;  2WXP A;  4HRM B;  2NC9 A;  3ABL E;  2VGY A;  1BD8 A;  1WM5 A;  2PQR A;  3W9G A;  5T8I A;  2Y4T A;  2IEJ A;  4U7E B;  4JXT A;  1N95 A;  2XQ0 A;  2FF4 A;  4JPS A;  1NL4 A;  3SZ7 A;  2R02 A;  3AG1 E;  1OUV A;  2LXL A;  4FHK A;  5JJ7 A;  3RKV A;  2XPZ A;  2EQX A;  1E8X A;  1HG2 A;  1ZBP A;  4YND A;  4NIK A;  2KCL A;  4JHK A;  2ZU6 B;  4XE0 A;  3CGH A;  5JJT A;  3ZYM A;  2ZXW E;  1H2U A;  2WXH A;  3QWP A;  1MQS A;  3URZ A;  1S0P A;  4GPK A;  3PH0 C;  2DIW A;  1XNF A;  3C5R A;  3HVE B;  4KMO A;  3CSF A;  2XS8 A;  4FLB A;  2EIN E;  2NYJ A;  1MJ0 A;  4TXQ A;  1ELR A;  2WXR A;  3EHR A;  4CCA A;  1HH8 A;  3Q47 B;  4ZHB A;  3Q79 A;  2VSO E;  3RO3 A;  4L1B A;  5DBK A;  4LSZ E;  5JHA A;  4LG6 A;  4V3I A;  2WXM A;  3LY8 A;  1YA0 A;  5D2M C;  4TXR A;  3G2S A;  3ZYL A;  4B89 A;  5LCW J;  2GGF A;  1V55 E;  5B1A E;  5KJN A;  4I6J A;  2KAT A;  4HFG A;  4EBA G;  3LY9 A;  4FJZ A;  3Q5M A;  1JCS A;  3I5P A;  5G05 J;  2GW1 A;  5AQ9 A;  4PH4 B;  3DXM G;  4NRH B;  3SF4 A;  3EHM A;  2E0I A;  4KT6 B;  5ENN A;  4JEH A;  1IKN D;  3CHS A;  1SA4 A;  2MHK A;  1A5E A;  3QWV A;  1NZN A;  2GRQ B;  3HXB A;  3DSX A;  1N94 A;  4OVV A;  1GW6 A;  2P9P G;  3PUJ A;  3ASG A;  2V5F A;  4A63 B;  3O48 A;  1HFA A;  3TWS A;  3QKY A;  2P9K G;  3FY4 A;  2EIM E;  3GZ1 A;  5CEC B;  4HOR A;  4JHJ A;  2V4L A;  3ULQ A;  2FUL A;  5FQ7 A;  3RK6 A;  1H6O A;  4IRU A;  3R7R A;  2DZN A;  3SI5 A;  1K8K G;  1H0A A;  2B6C A;  2UY1 A;  1UOH A;  5ENT D;  2I6H A;  3PS6 A;  2XCC A;  3I4R B;  5FWQ A;  1BPO A;  5FIN A;  4N3B A;  5ENS D;  4J8Y A;  2V4H C;  1TNY A;  2QZA A;  2X6K A;  4GTS A;  4DUI A;  2ETB A;  2OOE A;  4Z68 A;  3PZ4 A;  3D9M A;  3RSE G;  3P1U A;  3HG0 D;  3R7Q A;  3UT7 A;  3CQC B;  4R7L A;  4WND A;  1UN9 A;  3FUJ A;  3HRA A;  5FIO A;  4G24 A;  1JCQ A;  1O1T A;  4N3A A;  3KSL A;  3NOC D;  3AG3 E;  3V31 A;  2J8S D;  4HRL A;  4JA7 A;  4JZY A;  5FJY A;  4UQY A;  2CHZ A;  1KT1 A;  3J5Q B;  2R59 A;  3S2A A;  3E4B A;  1OWO A;  4U0U A;  3PEV B;  4O1O A;  4F7A A;  3LXU X;  4JC8 A;  5LFA A;  4HQD A;  3ENE A;  4GCN A;  4IYP A;  2FI7 A;  4C48 B;  2WXI A;  1OWL A;  3DPD A;  4L2Y A;  4WWP A;  3BEE A;  5J90 A;  5EYL A;  3S7J A;  1H2T C;  4GZ6 A;  2L0I A;  4LNG A;  5CHE E;  4FC8 A;  1O1R A;  4J8S A;  2IFU A;  3PRE A;  1Z6T A;  2OEW A;  2LXM A;  2AJA A;  4QFV A;  1BI7 B;  3TXN A;  3NAW A;  5FQ4 A;  3R9A B;  1TN8 A;  5ANL A;  3ULY A;  4XKB A;  2R05 A;  3ASN E;  4UUC A;  4OAV B;  1K3Z D;  1NA3 A;  3LKU A;  4F1P A;  3CIA A;  4CT4 A;  2UWJ G;  3X2Q E;  4K03 A;  4GPM A;  3T5X A;  3FUD A;  1IQU A;  3FTV A;  3PZ2 A;  1SZ9 A;  3FTS A;  1PAQ A;  1DVP A;  2H6I A;  2NSZ A;  2MRI A;  2WMN A;  4L2L A;  4YDO A;  4G8K A;  3L16 A;  2X6H A;  5D66 A;  1AP7 A;  1N4P A;  4KBQ A;  3FU5 A;  3QJZ A;  3E32 A;  4N5Q A;  4G26 A;  4WNE A;  4RSY A;  4XIF A;  5ENQ D;  1IXV A;  1LTX A;  3B7R L;  3AS8 A;  2RD0 A;  4IUL A;  3FUN A;  4HS2 A;  2XEN A;  2P58 C;  1S63 A;  4U63 A;  3ASD A;  4GTO A;  1IHB A;  4KVO A;  4KYO B;  4YVO A;  2A4Z A;  4OAU C;  4I9E A;  1E8W A;  4ILG A;  1D8E A;  2BKK B;  2AWI A;  3SD5 A;  1U3C A;  1O1S A;  2JEK A;  4CZ2 D;  3U3W A;  3E34 A;  2VJ8 A;  4LEU A;  1TNO A;  3U66 A;  4BEP A;  4G8L A;  5BW8 C;  3MYV A;  3IV0 A;  5JJ6 A;  2QYU A;  3TWU A;  3CEQ A;  3Q49 B;  3PZ3 A;  5FZS A;  4AP2 A;  2J4D A;  2XPY A;  5G05 C;  3ISM C;  4NQ0 A;  4APF A;  4Y6W A;  3TXM A;  5BUZ A;  5FZR A;  3FUL A;  3RAU A;  2KXP C;  5KJM A;  1Z3Y A;  5KCM A;  2J07 A;  5LCW C;  1WDY A;  1N11 A;  3NF1 A;  4K5A B;  2VGX A;  3MZL B;  2R17 C;  4P29 A;  3NZS A;  3AS4 A;  2I1J A;  1JWF A;  2WQH A;  3EU9 A;  4BY6 A;  1FCH A;  2ZIR A;  3UM1 A;  5EKQ D;  4GZ3 A;  4B8A A;  1OWN A;  4KVM A;  5AEN A;  3BQO A;  3CR3 A;  4BX9 A;  4Q94 A;  4N5C A;  1EPU A;  2EIL E;  2IJG X;  1QNF A;  3DSU A;  4GML A;  5KJK A;  3UI2 A;  4OVU A;  3RIB A;  3DWL G;  4ANW A;  3ONL A;  3DXK G;  3GZ2 A;  3WXX A;  4CDN A;  4RLY A;  2L6B A;  3LEW A;  5C1D A;  3RRM B;  2WVI A;  2XCB A;  5BXU A;  2XZT G;  1SA5 A;  1N54 A;  2YIN A;  3CST A;  2P2C P;  3DST A;  3C3O A;  3LCA A;  3T9K A;  4EZK A;  2GRO B;  3JXI A;  3RRN B;  3FU6 A;  2YQ8 A;  3HXF A;  3L82 A;  3EUV A;  1WAO 1;  1MX4 A;  1TEZ A;  2I2O A;  3T8M A;  2EIJ E;  4GU5 A;  3QDN A;  2J49 A;  1Y6I A;  2RKK A;  4HVB A;  4GMJ A;  5EX3 A;  3G2U A;  2VQ2 A;  3Q73 A;  5D0O D;  4U8Y D;  2GRN B;  5G04 C;  3BG0 B;  1V54 E;  4J8F A;  3ZRH A;  4MS6 A;  3Q78 A;  4BTA A;  4GTP A;  1MX2 A;  1EDU A;  3GW4 A;  4DX7 D;  3LDZ A;  3LYA A;  4J7W A;  3ZNG A;  1B89 A;  4PS3 A;  2J08 A;  2XGO A;  3JQ0 A;  3SGH A;  4EBA A;  2Y4U A;  2F0Y A;  3QAQ A;  1UW4 B;  4U07 A;  3CV0 A;  5B3S E;  4BFR A;  2DBA A;  2OV8 A;  2J9Q A;  4ABN A;  1DC2 A;  1HO8 A;  3ASO E;  2FEZ A;  1YMP A;  3DPY A;  3GZS A;  4XEI G;  4BT9 A;  2CG2 A;  3WG7 E;  2GRM A;  4YDY A;  1IHG A;  4WAF A;  5HQ8 A;  4IN3 B;  4NAC A;  2CFU A;  4AVX A;  4W9R A;  4RG6 A;  1D9S A;  2KZT A;  5FT9 A;  4MBG A;  3TWQ A;  3ASH A;  2KM4 A;  5ANR A;  2I9C A;  1KT0 A;  4GCO A;  3VLD A;  3C3R A;  5G04 J;  2IOS A;  3B7U X;  3NOG D;  1OY3 D;  2PZI A;  4RVB A;  4A55 A;  2KZT B;  2J09 A;  2DZO A;  4HLL A;  4FU3 A;  1BU9 A;  1HS6 A;  1AWC B;  1U2V G;  4Q69 A;  3LPZ A;  5BNW A;  3CVN A;  3HVE A;  3G2W A;  3LVR E;  2ETC A;  3OAW A;  5AQB A;  3S7D A;  4J8E A;  3MCX A;  2VGX B;  2VGE A;  2OEV A;  3TWV A;  1N0R A;  2M63 A;  4A3V A;  4XI9 A;  3SNX A;  3SFX A;  3SY2 A;  4JHR A;  2Y69 E;  3SFZ A;  3APD A;  3DSW A;  3PNL B;  5HS0 A;  3HIZ A;  3L6A A;  4F1S A;  4E85 A;  1TR4 A;  1MYO A;  2IF4 A;  1ELW A;  2NXP A;  1Q2Z A;  5AIJ A;  1E8Z A;  3IHV A;  3KS2 A;  4EEC A;  4FP7 A;  3D9H A;  4GZ5 A;  2HO1 A;  3RRU A;  2JAB A;  2A5U A;  4ATZ D;  2P9U G;  2PM6 A;  4I6G A;  4X8Q A;  1MHQ A;  3AU4 A;  3CHP A;  2IU1 A;  3ASF A;  1X81 A;  3VLF A;  4WNF A;  3UT8 A;  3AS5 A;  3CQG B;  2E2E A;  4YDW A;  3JYS A;  3LS8 A;  4UI9 K;  3TG5 A;  2H6F A;  3QK0 A;  3ZXS A;  3C72 A;  2PM7 A;  3NZU A;  2WXQ A;  2V5Q C;  3KSQ A;  4LRZ A;  5H7P A;  3FH5 A;  4XZ4 A;  3CKB A;  3U64 A;  5DIZ A;  3ABM E;  1LD7 A;  5AN8 A;  3FH7 A;  5EIB E;  2WB2 A;  3FUH A;  4PDX A;  2DCP A;  5AJD A;  4KZC A;  4TUU A;  4AJW A;  2AW6 A;  4N39 A;  1U3D A;  4G23 A;  3TJP A;  1BLX B;  1BI8 B;  4HOT A;  2MOW A;  3FU3 A;  5E75 A;  4K5B A;  1TJC A;  2Y0B G;  4TXP A;  3HXE A;  4HI9 A;  2HYZ A;  1LF8 A;  2A5E A;  5CCL A;  4XKC A;  4AEZ C;  2KC7 A;  1OCC E;  4GA1 A;  4H7X A;  4UWF A;  3SFY A;  3DEO A;  4CEM A;  4ATG A;  3FTW A;  5FZQ A;  5HI7 A;  3TWT A;  4B93 B;  3ZIM A;  3NBN B;  4ILH B;  4G1T A;  2FBN A;  3ULE G;  4DRX E;  2AXZ A;  4JVS A;  4C9B B;  4BX8 A;  1KZP A;  2WM9 A;  4JL0 A;  1YYH A;  3L54 A;  4GAA A;  3MV2 B;  3SHF A;  3ZN3 A;  3ZHE B;  4HOU A;  3QC1 A;  4D10 C;  2YHE A;  4PS8 A;  5JMN D;  1N4S A;  4U0S A;  1RZ4 A;  4BT8 A;  3DSS A;  5T4Y A;  5CER B;  3T8K A;  2C0L A;  2XGM A;  4EQF A;  3ESK A;  2ILR A;  3ZU7 B;  3FWV A;  1H6P A;  3EJN A;  4GTM A;  3APC A;  2QYJ A;  1TNB A;  3FEX A;  1NFI E;  4ILI A;  4A1G A;  3TL5 A;  5AAO A;  3J5P A;  3ZW3 A;  1ELK A;  1G3N B;  1TYQ G;  4U04 A;  3D9J A;  3EIQ C;  3D3M A;  5KNH D;  3V30 A;  2F37 A;  3E33 A;  3MJW A;  2GRL A;  2C0M A;  3AJI A;  3EU5 A;  1OXJ A;  1E7V A;  4HNA D;  3G2T A;  4U8H A;  2XZD G;  3CVW A;  4U96 D;  3QB2 A;  3LVQ E;  3Q7A A;  2DYS E;  3Q4A B;  5FTP A;  4AXH A;  2LAH A;  3KEZ A;  4JD2 G;  1TJF A;  1S64 A;  5T3R A;  4JA9 A;  5ARG A;  3CK7 A;  5B1B E;  3D9P A;  2ION A;  1QQE A;  3PVL A;  4G2V A;  2R03 A;  2RFM A;  1H19 A;  4EPZ A;  3B13 A;  5EYP F;  1DCE A;  4B94 A;  5CRU A;  2AVP A;  3UUX A;  2IQC A;  3D9K A;  3L08 A;  3D9O A;  4YDE A;  1EF1 C;  2ZIS A; 
#chains in the Genus database with same CATH homology
 1TYQ G;  3ULE G;  2P9P G;  3DWL G;  1U2V G;  3DXK G;  2P9S G;  2P9N G;  3DXM G;  1K8K G;  4JD2 G;  3UKR G;  3UKU G;  3RSE G;  2P9U G;  2P9I G;  2P9L G;  4XEI G;  2P9K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...