1SZ9A

The rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
143
structure length
143
Chain Sequence
b'DHDTEVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQKLYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGLPLFEGSALEKIEQFLIKASAAALE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PCF11 protein
publication title Recognition of RNA polymerase II carboxy-terminal domain by 3'-RNA-processing factors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 55
structure length 143
sequence length 143
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1sz9A00
3D9MA 1EYHA 1JUQA 3D9JA 1LF8A 3D9PA 2L0IA 1SZ9A 4GZCA 5CMYA 3LDZA 2BF0X 5LOZA 3ZYKA 1SZAA 3CLJA 2KM4A 3D9IA 3ZYMA 3G2TA 4NACA 4Q94A 1HX8A 2MOWA 3G2UA 1EDUA 1MHQA 2V8SE 3ONLA 3ONKA 1HG2A 4JXTA 1INZA 4FU3A 2DIWA 4FLBA 1UJKA 1JWGA 5CMWA 1DVPA 2LO6A 5LP0A 1HG5A 1JWFA 1UJJA 1XGWA 3ZYLA 1JPLA 1X5BA 3D9OA 3D9NA 4AVXA 4HFGA 1VDYA 1PY1A 2DCPA 3RRUA 2L0TB 4Q96A 3G2WA 3G2SA 4GZDA 1HF8A 1ELKA 3G2VA 1H0AA 2QY7A 3D9LA 3D9KA 1HFAA 3ZYQA 5J08A
chains in the Genus database with same CATH superfamily
5AQBA 2B6CA 1TNBA 3KSLA 3BQOA 2ZGGA 4PDXA 1IQUA 1WDYA 3ASDA 4DI4A 4E85A 5ARGA 3SFXA 4GTVA 3PE4A 2P9NG 5EN5D 2AW6A 3URZA 4UI9K 2JABA 2OCCE 3ZFWA 2WQHA 2OV8A 4GCNA 1O1TA 5FWQA 1DC2A 1AP7A 3N71A 3FU5A 4I1MA 5JHAA 4UQZA 4KT6B 2F0YA 1N4QA 4Z68A 1KT1A 3S7BA 3EHMA 5HKPA 1OWOA 1U3DA 1BU9A 5FIOA 4APOA 1JCQA 2QC9A 2IQCA 1TNOA 4U0SA 5KJLA 2WQ7A 2XGOA 1MX2A 5C2YA 5D0QD 3PNTB 2LNIA 3AG1E 3V2OA 3QARA 1SZ9A 5G05J 4TXRA 5JJ7A 4GTQA 1A17A 2QZAA 3U9WA 1BD8A 1NL4A 3FUNA 4ANVA 3UM1A 5JJ6A 1OWPA 2V5FA 4ILGA 2PZIA 1NP7A 3DPDA 4GZDA 5AENA 2I1JA 4XKCA 2X3MA 1O1SA 5ENOD 1YA0A 5A7DB 3D9IA 4GYYA 3TG5A 4BEPA 4J8SA 2LSUA 1S64A 4BFRA 1OWNA 1N0QA 2RFAA 2Q7FA 1YMPA 5HRYA 1TN8A 3KAEA 2BEDA 4JD2G 3ISMC 3LKUA 4G8KA 3G2SA 5HQ8A 5KBAA 3D9MA 3S7DA 4NQ0A 3D9JA 3FTVA 5ENRD 3UQ3A 3MGBA 5KJNA 3FUIA 3FDHA 1O5MA 1UJKA 4KYOB 3QAQA 4ACKA 3FUEA 3Q7FA 3JUIA 1EF1C 1HS6A 4YDOA 4ILIA 1N4SA 3HXDA 3ZYKA 3ABME 3RO3A 1UW4B 2IF4A 2FEZA 4O6FA 3DXKG 5KJKA 3KD7A 1SA4A 2PL2A 2WMOA 4B89A 2XEEA 3NZSA 4J8YA 3R9MA 3SGHA 5BV0A 3DWLG 3D9PA 5B1AE 3PZDA 4BSXA 1GW6A 3MYVA 2XGSA 4B8CB 2XPIA 3RKVA 4C0EA 3L13A 3QB2A 3CIAA 4N3CA 2F8YA 2VQ2A 2OEVA 2DWZA 2WPVA 1TEZA 3UM3A 1OCCE 1H6KA 3RRUA 2IJGX 3QK0A 1LTXA 4W9RA 2P2CP 3VTYA 3Q75A 3UIPC 2WXKA 4BERA 1JWGA 3D3MA 2X38A 1HG5A 3QNKA 5CECB 3RAUA 3OXGA 2OOEA 3FU6A 3TWWA 4YDYA 3LEWA 3FFLA 5CBOA 5LCWJ 2WXPA 3GZ2A 3EIJA 3Q15A 4HOUA 3RSEG 4DX1A 3CLJA 1Z5SC 5CCLA 2B0OE 5B1BE 2YNQA 3FUJA 3LJNA 1NFIE 4TXQA 1IXVA 2V4HC 1N11A 1Z3XA 4K5AB 1E7UA 2DZOA 2L9BA 2WXMA 4U07A 4FP7A 2GRNB 4Y6CA 4B93B 4A55A 4FLBA 4GZ6A 4XEIG 4MBGA 3QKYA 4FHKA 4LG6A 3UT7A 5CRUA 1Y6IA 4U0ZA 5LCWC 3Q79A 4L23A 3ZYMA 3OAWA 2ILRA 4URKA 3JQ0A 3VLEA 5BUZA 2WMNA 3Q9NC 4J6IA 4JL0A 5FINA 2RG8A 1QZ2A 2X6KA 2QYUA 4RVBA 3ZN3A 3TAXA 3JYSA 2FBNA 5LOZA 3J5QB 3ASGA 3C72A 3BEEA 4OAUC 3HVEA 5T8IA 1L5JA 4AIFA 3ZEFA 5LP0A 1XGWA 4WUYA 3RRNB 3O4ZA 3HG0D 5G55A 1ELRA 4DUIA 2J4BA 4K5CA 4A1SA 2PQNA 3QDNA 2WXFA 1H19A 3RU0A 3IEGA 2J4DA 2H6GA 5DBKA 5AQAA 3I5PA 2BKGA 3QC1A 5ARFA 3L22A 1N54A 3HVEB 3VLFA 4HOTA 1H6OA 4EZLA 2AXZA 3NAWA 4LUNU 3ULEG 3ULQA 3KSQA 1N4RA 5EX3A 1XNFA 3CHRA 3VLDA 2J07A 2GRPB 3LCAA 3LY8A 4A3VA 1V54E 3LJ3A 2I9CA 2WXOA 2C0LA 4TUUA 2IFUA 4BY6A 4G26A 3UXGA 3UM0A 3APDA 4PH4B 3UX4A 3SBTB 3BUAA 1LD7A 4N3AA 4HLLA 1Y8MA 2XCBA 2GGFA 2NC9A 2IU1A 3AS4A 1OWMA 4XX5A 2JLBA 4GPKA 5CMWA 3ASFA 2YQ8A 4HNAD 4B0ZA 4JA9A 1OUVA 5FQ4A 1SVXA 1W3BA 3ESKA 4LCTA 2CHWA 3LS8A 4NACA 1KLXA 1KZPA 4AEZC 2WXRA 3NOGD 5FTPA 5LX8A 4YVQC 4L7TA 1E8YA 3PS6A 3SQVA 4ATGA 3G2VA 3CV0A 3FH7A 4G8LA 4RLYA 1NA3A 4MLPA 3PDNA 2KZTA 2EILE 4OVVA 2V8SE 3K9IA 1BLXB 2ETCA 4G23A 5ENSD 2WXNA 3JQ1A 3FU3A 2I6HA 3FHEA 5CEDB 3CKCA 1H2TC 4TV3A 4HVBA 3BG0B 4UWLA 4ANXA 2Y4TA 3E32A 4DX5D 1HU3A 1TNZA 1OY3D 3FUMA 3HRAA 5AJDA 3GYZA 5BPPA 3TJPA 3ASHA 3SI5A 1PY1A 3WG7E 5AIJA 2XPZA 2R59A 2H6FA 5ANLA 2KZTB 2PNNA 2CG3A 2BKKB 2YHCA 3MV2B 4QFVA 3UI2A 5KCMA 4CGWA 1DCQA 1G3NB 2AXUA 3FY4A 1UJJA 4X8QA 4CEMA 3HXFA 2VSXE 4UWHA 1JUQA 2KCKA 2WVIA 4HORA 1S63A 2PM6A 1E8ZA 2ETAA 4CGVA 2PQRA 3AG3E 3L16A 3WXXA 5G04J 4AXHA 4IULA 2WM9A 5FZRA 3ZW3A 4JA7A 3R7QA 3ZIMA 1K1BA 5CERB 3Q4AB 3UIOC 4N3BA 2BF0X 3NOCD 5BT1A 3Q5MA 1TN7A 3AS5A 2V5QC 5EILA 3OXLA 3VTXA 3CVVA 4BX9A 2VSNA 2NXPA 3UKUG 1FPPA 2FO1E 2ETBA 5KWDA 1IQRA 4H7XA 4BT9A 1RZ4A 4AJWA 1D8DA 3HDXA 4M3OA 1TYQG 4I6GA 3W9GA 1HH8A 4U95D 5G04C 2XHEA 4XI0A 3EDTB 2IOLA 3PH0C 3L17A 3FTYA 3L6AA 1JCRA 1D9SA 4U8HA 3DSVA 3C5RA 4AVXA 5ANRA 4I6EA 3EJNA 4R7LA 4AP2A 1AWCB 4CT4A 2X6FA 5G05C 4U7EB 2VGEA 2NSZA 4EBAA 4HOQA 4NURA 4JVSA 4MKTA 3UM2A 4CDRA 4DLOA 2IONA 5BXUA 2A5EA 3ZKJA 5A23A 2R03A 3DSUA 3ZU7B 4AOFA 5DIZA 4ANUA 3APFA 2P9LG 4LSZE 1INZA 3GZ1A 3EHNA 3IV0A 2DYRE 4GZ3A 1NZNA 2ZGDA 1OCZE 5D66A 4I9CA 4F3VA 4JEHA 4FA6A 4J0UA 2XQ0A 3KS2A 3TWUA 3PNLB 3SHFA 5AARA 3ULYA 3RJVA 4EECA 4HI9A 3B7RL 4J8DA 4N2SA 2WB2A 2E0IA 3U66A 4D10C 3MKRA 1MQSA 3I3NA 3LYAA 1LF8A 1FCHA 5IY5E 1U3CA 4N2QA 3C3RA 4FU3A 4EZJA 2GRLA 1TR4A 4PS7A 4I9EA 1K3ZD 3BU8A 4MRUA 5M72A 2LXMA 4V3IA 4F1PA 2Y4UA 3Q49B 5CMYA 3Q9UC 3P2BA 4ILHB 2Y0BG 2DYSE 3JCKC 5EX0A 4CDNA 2WXQA 3SNXA 5JA4D 4CZ2D 3PUJA 4FJZA 1LD8A 4GB9A 3CHPA 4LERA 1N9AA 1RW2A 4U63A 4WNEA 3GZSA 4JXTA 3DXMG 3UUXA 4M7CA 4CT0A 4CCAA 3TL5A 3E33A 2IO2C 4I1OB 1MJ0A 1ELWA 3DSXA 3S7JA 2XZTG 5FZSA 4UWFA 1OCRE 4HXIA 1SA5A 4G1TA 1TJFA 3LPZA 1QBQA 5EYPF 4GAAA 3EU5A 4JZYA 1N4PA 2FF4A 5EDSA 2NYJA 3PZ2A 4EHMA 4ZHBA 2P9IG 3IHVA 4TXPA 2DZNA 5FJYA 4ME2A 5HI7A 1QYMA 4JW1A 1MHQA 3U3WA 3TWTA 4HRMB 4U8YD 5EIBE 1HXIA 2Y3AA 3PUKA 4U04A 3ZYLA 1P5QA 1X5BA 3FUHA 3TWVA 4UQXA 3V31A 2VSOE 2Y1LE 1FVHA 3L82A 1O1RA 3CVQA 4DJAA 2ZISA 1KZOA 3FULA 2FULA 4AY5A 4C9BB 5EYLA 2C2LA 5CBNA 4DK5A 2P9SG 3DEPA 4NIKA 4ANWA 4AY6A 2LAIA 4CYMD 4B8AA 4ACLA 3CSTA 5CRVA 3QOUA 4PUCA 3EHRA 2J09A 3ZUVB 5CEAA 4GMJA 1PC2A 1Z6TA 4KZCA 1BI7B 4EZKA 1H6PA 2UWJG 4J8EA 1FT1A 3LDZA 2HYZA 3FWVA 4JHJA 1BPOA 3OTNA 5KJMA 3ZNGA 5LFAA 2M63A 3PVLA 1D8EA 5C1DA 4KXKB 1WY6A 3C98A 4LNBA 4YVOA 4GTPA 4WWOA 2R17C 4YDWA 5ENNA 1WM5A 1MZCA 3C3OA 4MS6A 1BI8B 2AVPA 3T8KA 4FADA 3I4GA 1MX4A 4FLHA 3CVNA 4G24A 3OXFA 2KCVA 2KXPC 1E8WA 3MCXA 3DRAA 3IKOB 4JEUA 3Q73A 3MZLB 1FT2A 3ZPJA 4HOSA 2E2EA 3AG2E 3C3QA 3D9KA 3CQGB 1UG3A 1WG0A 2XENA 3JUEA 4O1PA 1S70B 2C0MA 3Q47B 3FUDA 3FP3A 3T8MA 4IRUA 1Q2ZA 3CVLA 3FUKA 3ESLA 3V79K 5BNWA 3SFYA 3TWXA 3D9NA 3CKBA 1JCSA 3RRMB 1HFAA 2CFZA 4LRZA 2H6IA 5ENPD 4BTBA 3FTSA 5EIDA 1Z3YA 3ZXSA 4WNFA 4N5QA 4BESA 4NRHB 3UT4A 2I1KA 2LAHA 3F6QA 3AAAC 3ZXPA 2RKKA 3FTUA 2Y69E 1DNPA 4GYOA 4GZ5A 3LVQE 2RD0A 4BETA 4K0RA 3PZ4A 4DX6D 3FUFA 4AM9A 2XRYA 1VDYA 3LXUX 5FT9A 3E4BA 1HF8A 5AN8A 5JMND 3ZVVA 2VJ8A 1QQEA 2KC7A 4GMLA 1UN8A 3DSWA 2I2OA 5AQ7A 2CG2A 3B13A 2V4LA 3LY9A 3E30A 1JWFA 3UTMA 5JJTA 2H6HA 3L08A 3PEVB 1H2UA 3UINC 1K8KG 3ZYQA 2XS1A 2QYJA 2GW1A 1E8XA 4A3TA 5EKQD 3G2TA 4DLQA 4AV7A 1SW6A 2VGXA 1KPSB 2XEVA 1PAQA 3UT8A 1TNYA 5T4YA 3CQCB 2AXVA 1IHBA 3TXMA 3FU0A 4I2ZA 2EINE 3CEQA 4GTSA 1UOHA 2L6JA 3SO8A 4KBQA 2F37A 4P29A 3SFZA 3W9FA 3SBSA 4G11A 3HHMA 1IKND 3SY2A 1NA0A 3I4RB 5BXOA 2WXGA 4UI9J 3CVUA 3TWSA 2VGXB 1OT8A 2WXIA 5J08A 3PREA 2AWIA 4B94A 4UWGA 2BTDA 1UN9A 3SF4A 5FQ6A 2X6HA 4IYPA 4F53A 3G2WA 3PZ3A 3FTXA 3BG1B 3B7TA 5ENQD 3AS8A 5KNHD 5D0OD 4PS8A 3IXEA 3X2QE 1HZ4A 4FULA 3E37A 5HS0A 1JPLA 1KT0A 4HFGA 2XGMA 3MV3B 1E90A 3CVXA 4I6JA 3ZHEA 4EQFA 4HRNA 4BTAA 3EIQC 4G2VA 5FQ7A 2FI7A 2WXJA 1OCOE 4BX8A 3MX3A 4UI9C 4KVMA 4UWKA 3ONLA 5T3RA 4F7AA 2DIWA 2ZIRA 2J08A 4ZFHA 4FJYA 4XIFA 4XI9A 2XPYA 1DCEA 4GYWA 2KATA 4GTTA 4I17A 5AYWD 3B7UX 3MJWA 4GCOA 1YCSB 3V2XA 4BWRA 2RFMA 4GZCA 1FVFA 3B7SA 1EDUA 3U4TA 3Q78A 3ZHEB 1HE8A 3L54A 2LO6A 4N5CA 4BT8A 4ABNA 2XCCA 4N39A 2L0IA 3DBSA 3CK9A 4DI3A 2PM7A 3ZRHA 2EQXA 5CHEE 2XZDG 3IBEA 2DVWA 5CCMA 3PE3A 4OVUA 2HM8A 3CVWA 2P9UG 3QWVA 2VTBA 3QWWA 2EIME 4L1BA 4HS2A 3CHQA 3ONKA 4EBAG 3DSTA 4Q69A 3FTZA 2ZXWE 4WNDA 1DVPA 4RSYA 3NBNB 3U64A 2JEKA 3NQPA 4O60A 2FO7A 4JC8A 4PS3A 3UPVA 1TN6A 1ZB1A 3EHQA 4KZ0A 2IY0C 1OXJA 3G2UA 1QNFA 2HE0A 1ZBPA 5KNGA 4XZ4A 3EU9A 3HYMB 4E6HA 3NZUA 1N95A 2VSYA 4U0UA 2HO1A 3CHOA 3FEXA 3CR3A 2MYOA 4LEUA 2VTBB 3D9LA 2X6JA 4JPSA 3P1UA 1N94A 4L9PA 4HLEA 1E96B 2KBXA 3R7RA 2MRIA 2IO3C 4L2LA 4APFA 3AU4A 1IHGA 5JHBA 2XS8A 4L2YA 3D9OA 2V0PA 2L0TB 4IN3B 1N0RA 1E7VA 4J7WA 1TJCA 4DX7D 3RO2A 3SZ7A 1S0PA 4RG6A 4F1SA 2BUGA 3NF1A 4DX2A 3TWQA 2F8XK 3UKRG 3TXNA 2J9QA 3ABLE 5BV1A 2LSVA 3AU5A 4K03A 4I1AA 3T5VA 3DPYA 3IHYA 2GRQB 4O1OA 3S7FA 5AAOA 3DEOA 1N52A 3T5XA 3UMVA 2R5SA 3FH5A 1H2VC 4HQDA 4A1GA 3D9HA 5AQ9A 4WAFA 2X6IA 3KEZA 3ABKE 2MHKA 3AG4E 4XE0A 4JHKA 2A5UA 4GTMA 1V55E 4EPZA 4J8FA 3QWPA 4UQYA 3E34A 3CHSA 4CDMA 2CFUA 3V30A 5E75A 2J49A 1ZU2A 3CVYA 2QFCA 4DPRA 4K5BA 4Q94A 2MOWA 2L6BA 4OAVB 2GROB 3AJIA 1B89A 3B95A 4QQIA 4JB8P 3PZ1A 4C48B 5J90A 3ZGQA 2R05A 4YNDA 3PRZA 3CSFA 2KCLA 4HRLA 2KM4A 3PEUB 1X81A 3EUVA 3B7BA 3L9TA 3MEKA 3FH8A 3O48A 1A5EA 3S2AA 1U2VG 4GTOA 4WWNA 2LUHA 1TNUA 2WXLA 1HG2A 5G2NA 1MX6A 3DSSA 4HB5A 2R02A 3FEYA 3QJZA 3ASNE 1OWLA 4GA2A 1EYHA 4DRXE 5ENTD 1K1AA 4CRWA 3CHMA 4I43A 4JHRA 4GTRA 2OVFA 3CK7A 5ITZF 2P58C 3ENEA 3LY7A 2P9KG 3J5PA 1ELKA 3T9KA 3MKQA 2OVBA 2IEJA 2A4ZA 5H7PA 3R9AB 1EPUA 3LVRE 3RK6A 4GA1A 2VGYA 4A63B 2GRRB 2XRZA 3MA5A 4KMOA 3GW4A 2GRMA 5FQ8A 3JXIA 2R2LA 2VYIA 4YDEA 5D2MC 4WWPA 4HI8A 4ATZD 2UY1A 3FTWA 1NI1A 2YINA 3TGOA 3MKQB 4RG9A 4Q96A 3JXJA 3KEAA 1HO8A 3CVPA 1MYOA 2ONDA 3CGHA 3CK8A 4UUCA 2EIKE 2OEWA 3NB2A 4TRQA 4XKBA 1SQMA 4WNGA 4GU5A 3ML9A 5AJLA 5A6CA 5E76A 2HR2A 4BSZB 2YHEA 4U8VD 4FHJA 2XEHA 2WQ6A 2ZU6B 4Y6WA 5FZQA 3TG4A 4FC8A 2UY1B 4GMRA 2P9PG 2J8SD 1WAO1 4OYSA 4TUMA 2CHXA 3HIZA 2WXHA 3Q7AA 2LXLA 4RQIA 3RIBA 3SD5A 4H7YA 3HXCA 4KVOA 5B3SE 2QY7A 2AJAA 4I2WA 4GPMA 2EIJE 3APCA 2CHZA 4GA0A 3TWRA 3ASOE 1SZAA 5BW8C 1IYGA 4U96D 3ML8A 1HX8A 4G25A 4LNUD 2DBAA 3HXEA 2IOSA 4HBDA 1YYHA 2DCPA 3HXBA 4LNGA 4C0MA 1H0AA 4F6RD
chains in the Genus database with same CATH topology
5FZSA 2L0IA 4UWFA 3DBSA 4HXIA 3CK9A 4TUUA 4DI3A 2IFUA 4G1TA 1TJFA 3LPZA 4BY6A 4G26A 2PM7A 4GAAA 3ZRHA 4PDXA 1IQUA 2EQXA 3APDA 5CHEE 4PH4B 3UX4A 3IBEA 3ASDA 4JZYA 2FF4A 4DI4A 4E85A 5ARGA 5EDSA 3SBTB 3PE4A 5CCMA 4N3AA 1Y8MA 3IHVA 3PE3A 2AW6A 4OVUA 2XCBA 3URZA 4UI9K 2HM8A 3ZFWA 2GGFA 2WQHA 2OV8A 5FJYA 3CVWA 2NC9A 2IU1A 3AS4A 3QWVA 4ME2A 4GCNA 5HI7A 2VTBA 3QWWA 4JW1A 1OWMA 4L1BA 5FWQA 4HS2A 1MHQA 3CHQA 3ONKA 4XX5A 4EBAG 3U3WA 4Q69A 3FTZA 3N71A 2JLBA 4GPKA 3FU5A 4I1MA 1HXIA 4WNDA 5CMWA 1DVPA 2Y3AA 3PUKA 4RSYA 4U04A 3ZYLA 1P5QA 1X5BA 3FUHA 5JHAA 4UQXA 4UQZA 2JEKA 2YQ8A 3ASFA 3NQPA 4KT6B 3U64A 2FO7A 2VSOE 1FVHA 1KT1A 4B0ZA 4JC8A 4PS3A 4JA9A 3S7BA 3CVQA 1OUVA 5FQ4A 4DJAA 3UPVA 1W3BA 3EHMA 3ESKA 2FULA 3FULA 4AY5A 4C9BB 4KZ0A 1OWOA 1U3DA 2C2LA 4LCTA 2CHWA 3LS8A 4DK5A 4APOA 4NACA 1KLXA 3G2UA 4AEZC 1QNFA 1ZBPA 4ANWA 4AY6A 2LAIA 4XZ4A 2WXRA 2IQCA 3HYMB 4ACLA 4B8AA 5FTPA 4E6HA 3CSTA 4U0SA 3NZUA 5LX8A 2VSYA 5KJLA 2WQ7A 2XGOA 4U0UA 3QOUA 4L7TA 1E8YA 3PS6A 4PUCA 4YVQC 2HO1A 3CHOA 3FEXA 2J09A 3CR3A 5D0QD 5C2YA 3PNTB 4LEUA 4GMJA 4ATGA 3G2VA 1PC2A 1Z6TA 4KZCA 4EZKA 2VTBB 3D9LA 2LNIA 2X6JA 4JPSA 3CV0A 3FH7A 2UWJG 3P1UA 4J8EA 3QARA 1SZ9A 5G05J 4HLEA 3LDZA 2HYZA 3FWVA 4JHJA 1E96B 1NA3A 4MLPA 3PDNA 3R7RA 2KZTA 2MRIA 1BPOA 5JJ7A 4APFA 4L2LA 1A17A 4OVVA 2V8SE 3U9WA 3OTNA 5KJMA 3K9IA 3AU4A 5LFAA 2M63A 3FUNA 4ANVA 5JJ6A 1IHGA 3PVLA 1OWPA 2V5FA 4G23A 4ILGA 5JHBA 2WXNA 4L2YA 3D9OA 3JQ1A 5C1DA 3FU3A 4KXKB 2PZIA 2V0PA 1NP7A 2L0TB 2I6HA 3DPDA 1WY6A 4GZDA 4IN3B 5AENA 3FHEA 2I1JA 4XKCA 1E7VA 1TJCA 2X3MA 3RO2A 3SZ7A 3C98A 3CKCA 1S0PA 1YA0A 4RG6A 5A7DB 4YVOA 1H2TC 2BUGA 3NF1A 4F1SA 4TV3A 3D9IA 4GYYA 4HVBA 3BG0B 3TG5A 4J8SA 2LSUA 4UWLA 4WWOA 2Y4TA 4ANXA 4BFRA 1OWNA 1HU3A 2R17C 3TXNA 3FUMA 2J9QA 2Q7FA 5AJDA 5ENNA 5BV1A 2LSVA 3GYZA 3AU5A 4K03A 1WM5A 4I1AA 3T5VA 3KAEA 5BPPA 3TJPA 3IHYA 3ASHA 3LKUA 1PY1A 3SI5A 5AIJA 3G2SA 2XPZA 2R59A 3S7FA 4MS6A 5ANLA 2KZTB 5HQ8A 2AVPA 3D9MA 3S7DA 4NQ0A 3D9JA 2CG3A 2YHCA 3FTVA 4FADA 1N52A 3MV2B 3I4GA 4FLHA 4QFVA 3T5XA 3CVNA 4G24A 3UQ3A 3OXFA 3MGBA 5KCMA 4CGWA 5KJNA 3UMVA 2KCVA 3FUIA 4N39A 2R5SA 3FDHA 3FH5A 1H2VC 4KYOB 1UJKA 2AXUA 3QAQA 3FY4A 4ACKA 3FUEA 1UJJA 3JUIA 4CEMA 1E8WA 2VSXE 3MCXA 1EF1C 1HS6A 3IKOB 4A1GA 4UWHA 4ILIA 4JEUA 3MZLB 3ZPJA 4HOSA 2E2EA 4WAFA 2X6IA 3D9KA 3CQGB 1UG3A 3KEZA 1JUQA 2KCKA 2WVIA 2MHKA 4HORA 2C0MA 3Q47B 3ZYKA 4XE0A 3FUDA 3FP3A 2PM6A 4JHKA 3RO3A 1E8ZA 1UW4B 2A5UA 3T8MA 4IRUA 4CGVA 2IF4A 2FEZA 2PQRA 4O6FA 3L16A 3WXXA 3CVLA 3FUKA 3ESLA 5KJKA 3KD7A 5BNWA 2PL2A 2WMOA 3D9NA 5G04J 4B89A 4AXHA 4IULA 2WM9A 4EPZA 4J8FA 3QWPA 4UQYA 5FZRA 3ZW3A 4JA7A 3CKBA 3CHSA 3R7QA 3NZSA 3ZIMA 3RRMB 3SGHA 4CDMA 2CFUA 1HFAA 5BV0A 5E75A 3D9PA 2CFZA 3Q4AB 4N3BA 3PZDA 2J49A 2BF0X 4BSXA 1ZU2A 4LRZA 5BT1A 3CVYA 3Q5MA 2QFCA 4DPRA 3AS5A 4BTBA 4Q94A 2MOWA 1GW6A 3MYVA 3FTSA 2XGSA 1Z3YA 3ZXSA 1B89A 3OXLA 4WNFA 3VTXA 3CVVA 4BX9A 4B8CB 4NRHB 3UT4A 2XPIA 2VSNA 2NXPA 2I1KA 2LAHA 3RKVA 4C0EA 5J90A 3L13A 3QB2A 3CIAA 3ZGQA 4YNDA 4N3CA 2VQ2A 3PRZA 3CSFA 2KCLA 1IQRA 4H7XA 4BT9A 2WPVA 3FTUA 1DNPA 2KM4A 4GYOA 4GZ5A 4AJWA 3LVQE 3PEUB 3HDXA 4M3OA 2RD0A 1TEZA 4I6GA 4K0RA 1H6KA 3FUFA 4AM9A 1HH8A 2XRYA 3MEKA 3FH8A 1VDYA 3O48A 3RRUA 5G04C 3LXUX 5FT9A 2IJGX 3E4BA 1HF8A 3ZVVA 2XHEA 3QK0A 3S2AA 2VJ8A 4WWNA 4XI0A 4W9RA 3EDTB 1QQEA 2IOLA 2KC7A 3PH0C 4GMLA 3VTYA 3L17A 3FTYA 1UN8A 2WXKA 2WXLA 1HG2A 2I2OA 5G2NA 3L6AA 2CG2A 1JWGA 3D3MA 3B13A 2V4LA 2X38A 3LY9A 1HG5A 1JWFA 3FEYA 3QNKA 4U8HA 4AVXA 5ANRA 5JJTA 3QJZA 4I6EA 1OWLA 3L08A 3EJNA 3OXGA 3PEVB 2OOEA 4R7LA 1H2UA 3FU6A 4AP2A 4GA2A 3LEWA 3FFLA 5LCWJ 3ZYQA 2WXPA 3GZ2A 1EYHA 2X6FA 4CT4A 3EIJA 3Q15A 2GW1A 4HOUA 3CLJA 1E8XA 4A3TA 5CCLA 5G05C 2YNQA 3FUJA 5EKQD 3G2TA 2NSZA 4DLQA 4EBAA 4AV7A 4HOQA 3CHMA 4CRWA 4I43A 4JHRA 2VGXA 4NURA 2OVFA 3CK7A 4JVSA 2XEVA 1Z3XA 2P58C 3ENEA 3LY7A 4MKTA 1PAQA 4CDRA 1E7UA 3UT8A 4DLOA 2IONA 2L9BA 2WXMA 4U07A 5T4YA 3CQCB 4FP7A 1ELKA 2AXVA 3TXMA 3FU0A 3MKQA 2OVBA 4I2ZA 5A23A 4AOFA 3CEQA 5DIZA 2A4ZA 3APFA 4ANUA 3R9AB 2L6JA 1EPUA 3LVRE 4Y6CA 4KBQA 3RK6A 1INZA 3SFZA 3GZ1A 4P29A 4GA1A 2VGYA 3EHNA 4A55A 3SBSA 4FLBA 4GZ6A 4G11A 3IV0A 2XRZA 3QKYA 4GZ3A 1NZNA 3MA5A 3HHMA 4FHKA 4KMOA 3GW4A 3UT7A 2GRMA 4I9CA 4F3VA 4JEHA 4FA6A 5FQ8A 1NA0A 1Y6IA 3I4RB 2VYIA 4J0UA 2XQ0A 2WXGA 3KS2A 4U0ZA 5LCWC 3PNLB 4UI9J 3CVUA 3SHFA 4EECA 3RJVA 3B7RL 2VGXB 4L23A 3ZYMA 4J8DA 4WWPA 4N2SA 2WXIA 3OAWA 2ILRA 2UY1A 3FTWA 4URKA 3PREA 3JQ0A 3VLEA 5J08A 2YINA 2WB2A 2AWIA 2E0IA 4B94A 4UWGA 2BTDA 3TGOA 1UN9A 5BUZA 3SF4A 4D10C 3U66A 3MKRA 5FQ6A 2WMNA 2X6HA 4J6IA 4IYPA 3MKQB 4JL0A 4RG9A 4F53A 1MQSA 4Q96A 3G2WA 3I3NA 2RG8A 1QZ2A 1HO8A 3LYAA 2X6KA 3CVPA 3FTXA 3BG1B 3B7TA 2ONDA 4RVBA 3ZN3A 1LF8A 3CGHA 3AS8A 3TAXA 3CK8A 3JYSA 2FBNA 5LOZA 5D0OD 1FCHA 4TRQA 3ASGA 4PS8A 1U3CA 3BEEA 4XKBA 4N2QA 3HVEA 1SQMA 4FU3A 5T8IA 4EZJA 1L5JA 4WNGA 1HZ4A 4GU5A 4AIFA 2GRLA 3ML9A 5AJLA 4FULA 3ZEFA 5A6CA 5LP0A 1XGWA 4PS7A 2HR2A 1JPLA 5E76A 4WUYA 1KT0A 2YHEA 4I9EA 3RRNB 4HFGA 2XGMA 4FHJA 3MV3B 1E90A 3O4ZA 4I6JA 4MRUA 3ZHEA 4EQFA 5M72A 3CVXA 5G55A 4BTAA 1ELRA 3EIQC 2ZU6B 4G2VA 4Y6WA 2WQ6A 5FQ7A 2FI7A 5FZQA 2WXJA 3TG4A 4FC8A 4V3IA 2J4BA 2UY1B 2Y4UA 3Q49B 4BX8A 3MX3A 5CMYA 4A1SA 3P2BA 2PQNA 4UI9C 3QDNA 4ILHB 1WAO1 4KVMA 2WXFA 4UWKA 4OYSA 3JCKC 1H19A 3ONLA 5T3RA 2CHXA 5EX0A 3RU0A 3HIZA 2WXHA 4F7AA 4CDNA 2DIWA 2WXQA 3IEGA 3SNXA 3RIBA 3SD5A 3PUJA 2J4DA 2J08A 4H7YA 4KVOA 5DBKA 4FJYA 4FJZA 4GB9A 4XIFA 3CHPA 4XI9A 2XPYA 4LERA 4GYWA 2KATA 3I5PA 4I17A 3QC1A 2QY7A 3B7UX 3L22A 1N54A 3MJWA 4I2WA 5ARFA 5AYWD 3APCA 4GCOA 4BWRA 3HVEB 4GZCA 2CHZA 1FVFA 4U63A 4GA0A 3B7SA 3VLFA 1IYGA 1SZAA 5BW8C 4HOTA 4EZLA 4WNEA 2AXZA 3ML8A 3GZSA 1HX8A 4LUNU 1EDUA 4JXTA 3U4TA 4G25A 3ULQA 3UUXA 5EX3A 3ZHEB 1HE8A 2DBAA 4CCAA 4CT0A 3L54A 2LO6A 3TL5A 1XNFA 2IOSA 3CHRA 4N5CA 4I1OB 3VLDA 2DCPA 4BT8A 2J07A 4ABNA 1ELWA 3LCAA 3LY8A 4C0MA 3S7JA 1H0AA 2XCCA 4A3VA 3LJ3A 2I9CA 2WXOA 2C0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9M A;  1EYH A;  1JUQ A;  3D9J A;  1LF8 A;  3D9P A;  2L0I A;  1SZ9 A;  4GZC A;  5CMY A;  3LDZ A;  2BF0 X;  5LOZ A;  3ZYK A;  1SZA A;  3CLJ A;  2KM4 A;  3D9I A;  3ZYM A;  3G2T A;  4NAC A;  4Q94 A;  1HX8 A;  2MOW A;  3G2U A;  1EDU A;  1MHQ A;  2V8S E;  3ONL A;  3ONK A;  1HG2 A;  4JXT A;  1INZ A;  4FU3 A;  2DIW A;  4FLB A;  1UJK A;  1JWG A;  5CMW A;  1DVP A;  2LO6 A;  5LP0 A;  1HG5 A;  1JWF A;  1UJJ A;  1XGW A;  3ZYL A;  1JPL A;  1X5B A;  3D9O A;  3D9N A;  4AVX A;  4HFG A;  1VDY A;  1PY1 A;  2DCP A;  3RRU A;  2L0T B;  4Q96 A;  3G2W A;  3G2S A;  4GZD A;  1HF8 A;  1ELK A;  3G2V A;  1H0A A;  2QY7 A;  3D9L A;  3D9K A;  1HFA A;  3ZYQ A;  5J08 A; 
#chains in the Genus database with same CATH topology
 5AQB A;  2B6C A;  1TNB A;  3KSL A;  3BQO A;  2ZGG A;  4PDX A;  1IQU A;  1WDY A;  3ASD A;  4DI4 A;  4E85 A;  5ARG A;  3SFX A;  4GTV A;  3PE4 A;  2P9N G;  5EN5 D;  2AW6 A;  3URZ A;  4UI9 K;  2JAB A;  2OCC E;  3ZFW A;  2WQH A;  2OV8 A;  4GCN A;  1O1T A;  5FWQ A;  1DC2 A;  1AP7 A;  3N71 A;  3FU5 A;  4I1M A;  5JHA A;  4UQZ A;  4KT6 B;  2F0Y A;  1N4Q A;  4Z68 A;  1KT1 A;  3S7B A;  3EHM A;  5HKP A;  1OWO A;  1U3D A;  1BU9 A;  5FIO A;  4APO A;  1JCQ A;  2QC9 A;  2IQC A;  1TNO A;  4U0S A;  5KJL A;  2WQ7 A;  2XGO A;  1MX2 A;  5C2Y A;  5D0Q D;  3PNT B;  2LNI A;  3AG1 E;  3V2O A;  3QAR A;  1SZ9 A;  5G05 J;  4TXR A;  5JJ7 A;  4GTQ A;  1A17 A;  2QZA A;  3U9W A;  1BD8 A;  1NL4 A;  3FUN A;  4ANV A;  3UM1 A;  5JJ6 A;  1OWP A;  2V5F A;  4ILG A;  2PZI A;  1NP7 A;  3DPD A;  4GZD A;  5AEN A;  2I1J A;  4XKC A;  2X3M A;  1O1S A;  5ENO D;  1YA0 A;  5A7D B;  3D9I A;  4GYY A;  3TG5 A;  4BEP A;  4J8S A;  2LSU A;  1S64 A;  4BFR A;  1OWN A;  1N0Q A;  2RFA A;  2Q7F A;  1YMP A;  5HRY A;  1TN8 A;  3KAE A;  2BED A;  4JD2 G;  3ISM C;  3LKU A;  4G8K A;  3G2S A;  5HQ8 A;  5KBA A;  3D9M A;  3S7D A;  4NQ0 A;  3D9J A;  3FTV A;  5ENR D;  3UQ3 A;  3MGB A;  5KJN A;  3FUI A;  3FDH A;  1O5M A;  1UJK A;  4KYO B;  3QAQ A;  4ACK A;  3FUE A;  3Q7F A;  3JUI A;  1EF1 C;  1HS6 A;  4YDO A;  4ILI A;  1N4S A;  3HXD A;  3ZYK A;  3ABM E;  3RO3 A;  1UW4 B;  2IF4 A;  2FEZ A;  4O6F A;  3DXK G;  5KJK A;  3KD7 A;  1SA4 A;  2PL2 A;  2WMO A;  4B89 A;  2XEE A;  3NZS A;  4J8Y A;  3R9M A;  3SGH A;  5BV0 A;  3DWL G;  3D9P A;  5B1A E;  3PZD A;  4BSX A;  1GW6 A;  3MYV A;  2XGS A;  4B8C B;  2XPI A;  3RKV A;  4C0E A;  3L13 A;  3QB2 A;  3CIA A;  4N3C A;  2F8Y A;  2VQ2 A;  2OEV A;  2DWZ A;  2WPV A;  1TEZ A;  3UM3 A;  1OCC E;  1H6K A;  3RRU A;  2IJG X;  3QK0 A;  1LTX A;  4W9R A;  2P2C P;  3VTY A;  3Q75 A;  3UIP C;  2WXK A;  4BER A;  1JWG A;  3D3M A;  2X38 A;  1HG5 A;  3QNK A;  5CEC B;  3RAU A;  3OXG A;  2OOE A;  3FU6 A;  3TWW A;  4YDY A;  3LEW A;  3FFL A;  5CBO A;  5LCW J;  2WXP A;  3GZ2 A;  3EIJ A;  3Q15 A;  4HOU A;  3RSE G;  4DX1 A;  3CLJ A;  1Z5S C;  5CCL A;  2B0O E;  5B1B E;  2YNQ A;  3FUJ A;  3LJN A;  1NFI E;  4TXQ A;  1IXV A;  2V4H C;  1N11 A;  1Z3X A;  4K5A B;  1E7U A;  2DZO A;  2L9B A;  2WXM A;  4U07 A;  4FP7 A;  2GRN B;  4Y6C A;  4B93 B;  4A55 A;  4FLB A;  4GZ6 A;  4XEI G;  4MBG A;  3QKY A;  4FHK A;  4LG6 A;  3UT7 A;  5CRU A;  1Y6I A;  4U0Z A;  5LCW C;  3Q79 A;  4L23 A;  3ZYM A;  3OAW A;  2ILR A;  4URK A;  3JQ0 A;  3VLE A;  5BUZ A;  2WMN A;  3Q9N C;  4J6I A;  4JL0 A;  5FIN A;  2RG8 A;  1QZ2 A;  2X6K A;  2QYU A;  4RVB A;  3ZN3 A;  3TAX A;  3JYS A;  2FBN A;  5LOZ A;  3J5Q B;  3ASG A;  3C72 A;  3BEE A;  4OAU C;  3HVE A;  5T8I A;  1L5J A;  4AIF A;  3ZEF A;  5LP0 A;  1XGW A;  4WUY A;  3RRN B;  3O4Z A;  3HG0 D;  5G55 A;  1ELR A;  4DUI A;  2J4B A;  4K5C A;  4A1S A;  2PQN A;  3QDN A;  2WXF A;  1H19 A;  3RU0 A;  3IEG A;  2J4D A;  2H6G A;  5DBK A;  5AQA A;  3I5P A;  2BKG A;  3QC1 A;  5ARF A;  3L22 A;  1N54 A;  3HVE B;  3VLF A;  4HOT A;  1H6O A;  4EZL A;  2AXZ A;  3NAW A;  4LUN U;  3ULE G;  3ULQ A;  3KSQ A;  1N4R A;  5EX3 A;  1XNF A;  3CHR A;  3VLD A;  2J07 A;  2GRP B;  3LCA A;  3LY8 A;  4A3V A;  1V54 E;  3LJ3 A;  2I9C A;  2WXO A;  2C0L A;  4TUU A;  2IFU A;  4BY6 A;  4G26 A;  3UXG A;  3UM0 A;  3APD A;  4PH4 B;  3UX4 A;  3SBT B;  3BUA A;  1LD7 A;  4N3A A;  4HLL A;  1Y8M A;  2XCB A;  2GGF A;  2NC9 A;  2IU1 A;  3AS4 A;  1OWM A;  4XX5 A;  2JLB A;  4GPK A;  5CMW A;  3ASF A;  2YQ8 A;  4HNA D;  4B0Z A;  4JA9 A;  1OUV A;  5FQ4 A;  1SVX A;  1W3B A;  3ESK A;  4LCT A;  2CHW A;  3LS8 A;  4NAC A;  1KLX A;  1KZP A;  4AEZ C;  2WXR A;  3NOG D;  5FTP A;  5LX8 A;  4YVQ C;  4L7T A;  1E8Y A;  3PS6 A;  3SQV A;  4ATG A;  3G2V A;  3CV0 A;  3FH7 A;  4G8L A;  4RLY A;  1NA3 A;  4MLP A;  3PDN A;  2KZT A;  2EIL E;  4OVV A;  2V8S E;  3K9I A;  1BLX B;  2ETC A;  4G23 A;  5ENS D;  2WXN A;  3JQ1 A;  3FU3 A;  2I6H A;  3FHE A;  5CED B;  3CKC A;  1H2T C;  4TV3 A;  4HVB A;  3BG0 B;  4UWL A;  4ANX A;  2Y4T A;  3E32 A;  4DX5 D;  1HU3 A;  1TNZ A;  1OY3 D;  3FUM A;  3HRA A;  5AJD A;  3GYZ A;  5BPP A;  3TJP A;  3ASH A;  3SI5 A;  1PY1 A;  3WG7 E;  5AIJ A;  2XPZ A;  2R59 A;  2H6F A;  5ANL A;  2KZT B;  2PNN A;  2CG3 A;  2BKK B;  2YHC A;  3MV2 B;  4QFV A;  3UI2 A;  5KCM A;  4CGW A;  1DCQ A;  1G3N B;  2AXU A;  3FY4 A;  1UJJ A;  4X8Q A;  4CEM A;  3HXF A;  2VSX E;  4UWH A;  1JUQ A;  2KCK A;  2WVI A;  4HOR A;  1S63 A;  2PM6 A;  1E8Z A;  2ETA A;  4CGV A;  2PQR A;  3AG3 E;  3L16 A;  3WXX A;  5G04 J;  4AXH A;  4IUL A;  2WM9 A;  5FZR A;  3ZW3 A;  4JA7 A;  3R7Q A;  3ZIM A;  1K1B A;  5CER B;  3Q4A B;  3UIO C;  4N3B A;  2BF0 X;  3NOC D;  5BT1 A;  3Q5M A;  1TN7 A;  3AS5 A;  2V5Q C;  5EIL A;  3OXL A;  3VTX A;  3CVV A;  4BX9 A;  2VSN A;  2NXP A;  3UKU G;  1FPP A;  2FO1 E;  2ETB A;  5KWD A;  1IQR A;  4H7X A;  4BT9 A;  1RZ4 A;  4AJW A;  1D8D A;  3HDX A;  4M3O A;  1TYQ G;  4I6G A;  3W9G A;  1HH8 A;  4U95 D;  5G04 C;  2XHE A;  4XI0 A;  3EDT B;  2IOL A;  3PH0 C;  3L17 A;  3FTY A;  3L6A A;  1JCR A;  1D9S A;  4U8H A;  3DSV A;  3C5R A;  4AVX A;  5ANR A;  4I6E A;  3EJN A;  4R7L A;  4AP2 A;  1AWC B;  4CT4 A;  2X6F A;  5G05 C;  4U7E B;  2VGE A;  2NSZ A;  4EBA A;  4HOQ A;  4NUR A;  4JVS A;  4MKT A;  3UM2 A;  4CDR A;  4DLO A;  2ION A;  5BXU A;  2A5E A;  3ZKJ A;  5A23 A;  2R03 A;  3DSU A;  3ZU7 B;  4AOF A;  5DIZ A;  4ANU A;  3APF A;  2P9L G;  4LSZ E;  1INZ A;  3GZ1 A;  3EHN A;  3IV0 A;  2DYR E;  4GZ3 A;  1NZN A;  2ZGD A;  1OCZ E;  5D66 A;  4I9C A;  4F3V A;  4JEH A;  4FA6 A;  4J0U A;  2XQ0 A;  3KS2 A;  3TWU A;  3PNL B;  3SHF A;  5AAR A;  3ULY A;  3RJV A;  4EEC A;  4HI9 A;  3B7R L;  4J8D A;  4N2S A;  2WB2 A;  2E0I A;  3U66 A;  4D10 C;  3MKR A;  1MQS A;  3I3N A;  3LYA A;  1LF8 A;  1FCH A;  5IY5 E;  1U3C A;  4N2Q A;  3C3R A;  4FU3 A;  4EZJ A;  2GRL A;  1TR4 A;  4PS7 A;  4I9E A;  1K3Z D;  3BU8 A;  4MRU A;  5M72 A;  2LXM A;  4V3I A;  4F1P A;  2Y4U A;  3Q49 B;  5CMY A;  3Q9U C;  3P2B A;  4ILH B;  2Y0B G;  2DYS E;  3JCK C;  5EX0 A;  4CDN A;  2WXQ A;  3SNX A;  5JA4 D;  4CZ2 D;  3PUJ A;  4FJZ A;  1LD8 A;  4GB9 A;  3CHP A;  4LER A;  1N9A A;  1RW2 A;  4U63 A;  4WNE A;  3GZS A;  4JXT A;  3DXM G;  3UUX A;  4M7C A;  4CT0 A;  4CCA A;  3TL5 A;  3E33 A;  2IO2 C;  4I1O B;  1MJ0 A;  1ELW A;  3DSX A;  3S7J A;  2XZT G;  5FZS A;  4UWF A;  1OCR E;  4HXI A;  1SA5 A;  4G1T A;  1TJF A;  3LPZ A;  1QBQ A;  5EYP F;  4GAA A;  3EU5 A;  4JZY A;  1N4P A;  2FF4 A;  5EDS A;  2NYJ A;  3PZ2 A;  4EHM A;  4ZHB A;  2P9I G;  3IHV A;  4TXP A;  2DZN A;  5FJY A;  4ME2 A;  5HI7 A;  1QYM A;  4JW1 A;  1MHQ A;  3U3W A;  3TWT A;  4HRM B;  4U8Y D;  5EIB E;  1HXI A;  2Y3A A;  3PUK A;  4U04 A;  3ZYL A;  1P5Q A;  1X5B A;  3FUH A;  3TWV A;  4UQX A;  3V31 A;  2VSO E;  2Y1L E;  1FVH A;  3L82 A;  1O1R A;  3CVQ A;  4DJA A;  2ZIS A;  1KZO A;  3FUL A;  2FUL A;  4AY5 A;  4C9B B;  5EYL A;  2C2L A;  5CBN A;  4DK5 A;  2P9S G;  3DEP A;  4NIK A;  4ANW A;  4AY6 A;  2LAI A;  4CYM D;  4B8A A;  4ACL A;  3CST A;  5CRV A;  3QOU A;  4PUC A;  3EHR A;  2J09 A;  3ZUV B;  5CEA A;  4GMJ A;  1PC2 A;  1Z6T A;  4KZC A;  1BI7 B;  4EZK A;  1H6P A;  2UWJ G;  4J8E A;  1FT1 A;  3LDZ A;  2HYZ A;  3FWV A;  4JHJ A;  1BPO A;  3OTN A;  5KJM A;  3ZNG A;  5LFA A;  2M63 A;  3PVL A;  1D8E A;  5C1D A;  4KXK B;  1WY6 A;  3C98 A;  4LNB A;  4YVO A;  4GTP A;  4WWO A;  2R17 C;  4YDW A;  5ENN A;  1WM5 A;  1MZC A;  3C3O A;  4MS6 A;  1BI8 B;  2AVP A;  3T8K A;  4FAD A;  3I4G A;  1MX4 A;  4FLH A;  3CVN A;  4G24 A;  3OXF A;  2KCV A;  2KXP C;  1E8W A;  3MCX A;  3DRA A;  3IKO B;  4JEU A;  3Q73 A;  3MZL B;  1FT2 A;  3ZPJ A;  4HOS A;  2E2E A;  3AG2 E;  3C3Q A;  3D9K A;  3CQG B;  1UG3 A;  1WG0 A;  2XEN A;  3JUE A;  4O1P A;  1S70 B;  2C0M A;  3Q47 B;  3FUD A;  3FP3 A;  3T8M A;  4IRU A;  1Q2Z A;  3CVL A;  3FUK A;  3ESL A;  3V79 K;  5BNW A;  3SFY A;  3TWX A;  3D9N A;  3CKB A;  1JCS A;  3RRM B;  1HFA A;  2CFZ A;  4LRZ A;  2H6I A;  5ENP D;  4BTB A;  3FTS A;  5EID A;  1Z3Y A;  3ZXS A;  4WNF A;  4N5Q A;  4BES A;  4NRH B;  3UT4 A;  2I1K A;  2LAH A;  3F6Q A;  3AAA C;  3ZXP A;  2RKK A;  3FTU A;  2Y69 E;  1DNP A;  4GYO A;  4GZ5 A;  3LVQ E;  2RD0 A;  4BET A;  4K0R A;  3PZ4 A;  4DX6 D;  3FUF A;  4AM9 A;  2XRY A;  1VDY A;  3LXU X;  5FT9 A;  3E4B A;  1HF8 A;  5AN8 A;  5JMN D;  3ZVV A;  2VJ8 A;  1QQE A;  2KC7 A;  4GML A;  1UN8 A;  3DSW A;  2I2O A;  5AQ7 A;  2CG2 A;  3B13 A;  2V4L A;  3LY9 A;  3E30 A;  1JWF A;  3UTM A;  5JJT A;  2H6H A;  3L08 A;  3PEV B;  1H2U A;  3UIN C;  1K8K G;  3ZYQ A;  2XS1 A;  2QYJ A;  2GW1 A;  1E8X A;  4A3T A;  5EKQ D;  3G2T A;  4DLQ A;  4AV7 A;  1SW6 A;  2VGX A;  1KPS B;  2XEV A;  1PAQ A;  3UT8 A;  1TNY A;  5T4Y A;  3CQC B;  2AXV A;  1IHB A;  3TXM A;  3FU0 A;  4I2Z A;  2EIN E;  3CEQ A;  4GTS A;  1UOH A;  2L6J A;  3SO8 A;  4KBQ A;  2F37 A;  4P29 A;  3SFZ A;  3W9F A;  3SBS A;  4G11 A;  3HHM A;  1IKN D;  3SY2 A;  1NA0 A;  3I4R B;  5BXO A;  2WXG A;  4UI9 J;  3CVU A;  3TWS A;  2VGX B;  1OT8 A;  2WXI A;  5J08 A;  3PRE A;  2AWI A;  4B94 A;  4UWG A;  2BTD A;  1UN9 A;  3SF4 A;  5FQ6 A;  2X6H A;  4IYP A;  4F53 A;  3G2W A;  3PZ3 A;  3FTX A;  3BG1 B;  3B7T A;  5ENQ D;  3AS8 A;  5KNH D;  5D0O D;  4PS8 A;  3IXE A;  3X2Q E;  1HZ4 A;  4FUL A;  3E37 A;  5HS0 A;  1JPL A;  1KT0 A;  4HFG A;  2XGM A;  3MV3 B;  1E90 A;  3CVX A;  4I6J A;  3ZHE A;  4EQF A;  4HRN A;  4BTA A;  3EIQ C;  4G2V A;  5FQ7 A;  2FI7 A;  2WXJ A;  1OCO E;  4BX8 A;  3MX3 A;  4UI9 C;  4KVM A;  4UWK A;  3ONL A;  5T3R A;  4F7A A;  2DIW A;  2ZIR A;  2J08 A;  4ZFH A;  4FJY A;  4XIF A;  4XI9 A;  2XPY A;  1DCE A;  4GYW A;  2KAT A;  4GTT A;  4I17 A;  5AYW D;  3B7U X;  3MJW A;  4GCO A;  1YCS B;  3V2X A;  4BWR A;  2RFM A;  4GZC A;  1FVF A;  3B7S A;  1EDU A;  3U4T A;  3Q78 A;  3ZHE B;  1HE8 A;  3L54 A;  2LO6 A;  4N5C A;  4BT8 A;  4ABN A;  2XCC A;  4N39 A;  2L0I A;  3DBS A;  3CK9 A;  4DI3 A;  2PM7 A;  3ZRH A;  2EQX A;  5CHE E;  2XZD G;  3IBE A;  2DVW A;  5CCM A;  3PE3 A;  4OVU A;  2HM8 A;  3CVW A;  2P9U G;  3QWV A;  2VTB A;  3QWW A;  2EIM E;  4L1B A;  4HS2 A;  3CHQ A;  3ONK A;  4EBA G;  3DST A;  4Q69 A;  3FTZ A;  2ZXW E;  4WND A;  1DVP A;  4RSY A;  3NBN B;  3U64 A;  2JEK A;  3NQP A;  4O60 A;  2FO7 A;  4JC8 A;  4PS3 A;  3UPV A;  1TN6 A;  1ZB1 A;  3EHQ A;  4KZ0 A;  2IY0 C;  1OXJ A;  3G2U A;  1QNF A;  2HE0 A;  1ZBP A;  5KNG A;  4XZ4 A;  3EU9 A;  3HYM B;  4E6H A;  3NZU A;  1N95 A;  2VSY A;  4U0U A;  2HO1 A;  3CHO A;  3FEX A;  3CR3 A;  2MYO A;  4LEU A;  2VTB B;  3D9L A;  2X6J A;  4JPS A;  3P1U A;  1N94 A;  4L9P A;  4HLE A;  1E96 B;  2KBX A;  3R7R A;  2MRI A;  2IO3 C;  4L2L A;  4APF A;  3AU4 A;  1IHG A;  5JHB A;  2XS8 A;  4L2Y A;  3D9O A;  2V0P A;  2L0T B;  4IN3 B;  1N0R A;  1E7V A;  4J7W A;  1TJC A;  4DX7 D;  3RO2 A;  3SZ7 A;  1S0P A;  4RG6 A;  4F1S A;  2BUG A;  3NF1 A;  4DX2 A;  3TWQ A;  2F8X K;  3UKR G;  3TXN A;  2J9Q A;  3ABL E;  5BV1 A;  2LSV A;  3AU5 A;  4K03 A;  4I1A A;  3T5V A;  3DPY A;  3IHY A;  2GRQ B;  4O1O A;  3S7F A;  5AAO A;  3DEO A;  1N52 A;  3T5X A;  3UMV A;  2R5S A;  3FH5 A;  1H2V C;  4HQD A;  4A1G A;  3D9H A;  5AQ9 A;  4WAF A;  2X6I A;  3KEZ A;  3ABK E;  2MHK A;  3AG4 E;  4XE0 A;  4JHK A;  2A5U A;  4GTM A;  1V55 E;  4EPZ A;  4J8F A;  3QWP A;  4UQY A;  3E34 A;  3CHS A;  4CDM A;  2CFU A;  3V30 A;  5E75 A;  2J49 A;  1ZU2 A;  3CVY A;  2QFC A;  4DPR A;  4K5B A;  4Q94 A;  2MOW A;  2L6B A;  4OAV B;  2GRO B;  3AJI A;  1B89 A;  3B95 A;  4QQI A;  4JB8 P;  3PZ1 A;  4C48 B;  5J90 A;  3ZGQ A;  2R05 A;  4YND A;  3PRZ A;  3CSF A;  2KCL A;  4HRL A;  2KM4 A;  3PEU B;  1X81 A;  3EUV A;  3B7B A;  3L9T A;  3MEK A;  3FH8 A;  3O48 A;  1A5E A;  3S2A A;  1U2V G;  4GTO A;  4WWN A;  2LUH A;  1TNU A;  2WXL A;  1HG2 A;  5G2N A;  1MX6 A;  3DSS A;  4HB5 A;  2R02 A;  3FEY A;  3QJZ A;  3ASN E;  1OWL A;  4GA2 A;  1EYH A;  4DRX E;  5ENT D;  1K1A A;  4CRW A;  3CHM A;  4I43 A;  4JHR A;  4GTR A;  2OVF A;  3CK7 A;  5ITZ F;  2P58 C;  3ENE A;  3LY7 A;  2P9K G;  3J5P A;  1ELK A;  3T9K A;  3MKQ A;  2OVB A;  2IEJ A;  2A4Z A;  5H7P A;  3R9A B;  1EPU A;  3LVR E;  3RK6 A;  4GA1 A;  2VGY A;  4A63 B;  2GRR B;  2XRZ A;  3MA5 A;  4KMO A;  3GW4 A;  2GRM A;  5FQ8 A;  3JXI A;  2R2L A;  2VYI A;  4YDE A;  5D2M C;  4WWP A;  4HI8 A;  4ATZ D;  2UY1 A;  3FTW A;  1NI1 A;  2YIN A;  3TGO A;  3MKQ B;  4RG9 A;  4Q96 A;  3JXJ A;  3KEA A;  1HO8 A;  3CVP A;  1MYO A;  2OND A;  3CGH A;  3CK8 A;  4UUC A;  2EIK E;  2OEW A;  3NB2 A;  4TRQ A;  4XKB A;  1SQM A;  4WNG A;  4GU5 A;  3ML9 A;  5AJL A;  5A6C A;  5E76 A;  2HR2 A;  4BSZ B;  2YHE A;  4U8V D;  4FHJ A;  2XEH A;  2WQ6 A;  2ZU6 B;  4Y6W A;  5FZQ A;  3TG4 A;  4FC8 A;  2UY1 B;  4GMR A;  2P9P G;  2J8S D;  1WAO 1;  4OYS A;  4TUM A;  2CHX A;  3HIZ A;  2WXH A;  3Q7A A;  2LXL A;  4RQI A;  3RIB A;  3SD5 A;  4H7Y A;  3HXC A;  4KVO A;  5B3S E;  2QY7 A;  2AJA A;  4I2W A;  4GPM A;  2EIJ E;  3APC A;  2CHZ A;  4GA0 A;  3TWR A;  3ASO E;  1SZA A;  5BW8 C;  1IYG A;  4U96 D;  3ML8 A;  1HX8 A;  4G25 A;  4LNU D;  2DBA A;  3HXE A;  2IOS A;  4HBD A;  1YYH A;  2DCP A;  3HXB A;  4LNG A;  4C0M A;  1H0A A;  4F6R D; 
#chains in the Genus database with same CATH homology
 5FZS A;  2L0I A;  4UWF A;  3DBS A;  4HXI A;  3CK9 A;  4TUU A;  4DI3 A;  2IFU A;  4G1T A;  1TJF A;  3LPZ A;  4BY6 A;  4G26 A;  2PM7 A;  4GAA A;  3ZRH A;  4PDX A;  1IQU A;  2EQX A;  3APD A;  5CHE E;  4PH4 B;  3UX4 A;  3IBE A;  3ASD A;  4JZY A;  2FF4 A;  4DI4 A;  4E85 A;  5ARG A;  5EDS A;  3SBT B;  3PE4 A;  5CCM A;  4N3A A;  1Y8M A;  3IHV A;  3PE3 A;  2AW6 A;  4OVU A;  2XCB A;  3URZ A;  4UI9 K;  2HM8 A;  3ZFW A;  2GGF A;  2WQH A;  2OV8 A;  5FJY A;  3CVW A;  2NC9 A;  2IU1 A;  3AS4 A;  3QWV A;  4ME2 A;  4GCN A;  5HI7 A;  2VTB A;  3QWW A;  4JW1 A;  1OWM A;  4L1B A;  5FWQ A;  4HS2 A;  1MHQ A;  3CHQ A;  3ONK A;  4XX5 A;  4EBA G;  3U3W A;  4Q69 A;  3FTZ A;  3N71 A;  2JLB A;  4GPK A;  3FU5 A;  4I1M A;  1HXI A;  4WND A;  5CMW A;  1DVP A;  2Y3A A;  3PUK A;  4RSY A;  4U04 A;  3ZYL A;  1P5Q A;  1X5B A;  3FUH A;  5JHA A;  4UQX A;  4UQZ A;  2JEK A;  2YQ8 A;  3ASF A;  3NQP A;  4KT6 B;  3U64 A;  2FO7 A;  2VSO E;  1FVH A;  1KT1 A;  4B0Z A;  4JC8 A;  4PS3 A;  4JA9 A;  3S7B A;  3CVQ A;  1OUV A;  5FQ4 A;  4DJA A;  3UPV A;  1W3B A;  3EHM A;  3ESK A;  2FUL A;  3FUL A;  4AY5 A;  4C9B B;  4KZ0 A;  1OWO A;  1U3D A;  2C2L A;  4LCT A;  2CHW A;  3LS8 A;  4DK5 A;  4APO A;  4NAC A;  1KLX A;  3G2U A;  4AEZ C;  1QNF A;  1ZBP A;  4ANW A;  4AY6 A;  2LAI A;  4XZ4 A;  2WXR A;  2IQC A;  3HYM B;  4ACL A;  4B8A A;  5FTP A;  4E6H A;  3CST A;  4U0S A;  3NZU A;  5LX8 A;  2VSY A;  5KJL A;  2WQ7 A;  2XGO A;  4U0U A;  3QOU A;  4L7T A;  1E8Y A;  3PS6 A;  4PUC A;  4YVQ C;  2HO1 A;  3CHO A;  3FEX A;  2J09 A;  3CR3 A;  5D0Q D;  5C2Y A;  3PNT B;  4LEU A;  4GMJ A;  4ATG A;  3G2V A;  1PC2 A;  1Z6T A;  4KZC A;  4EZK A;  2VTB B;  3D9L A;  2LNI A;  2X6J A;  4JPS A;  3CV0 A;  3FH7 A;  2UWJ G;  3P1U A;  4J8E A;  3QAR A;  1SZ9 A;  5G05 J;  4HLE A;  3LDZ A;  2HYZ A;  3FWV A;  4JHJ A;  1E96 B;  1NA3 A;  4MLP A;  3PDN A;  3R7R A;  2KZT A;  2MRI A;  1BPO A;  5JJ7 A;  4APF A;  4L2L A;  1A17 A;  4OVV A;  2V8S E;  3U9W A;  3OTN A;  5KJM A;  3K9I A;  3AU4 A;  5LFA A;  2M63 A;  3FUN A;  4ANV A;  5JJ6 A;  1IHG A;  3PVL A;  1OWP A;  2V5F A;  4G23 A;  4ILG A;  5JHB A;  2WXN A;  4L2Y A;  3D9O A;  3JQ1 A;  5C1D A;  3FU3 A;  4KXK B;  2PZI A;  2V0P A;  1NP7 A;  2L0T B;  2I6H A;  3DPD A;  1WY6 A;  4GZD A;  4IN3 B;  5AEN A;  3FHE A;  2I1J A;  4XKC A;  1E7V A;  1TJC A;  2X3M A;  3RO2 A;  3SZ7 A;  3C98 A;  3CKC A;  1S0P A;  1YA0 A;  4RG6 A;  5A7D B;  4YVO A;  1H2T C;  2BUG A;  3NF1 A;  4F1S A;  4TV3 A;  3D9I A;  4GYY A;  4HVB A;  3BG0 B;  3TG5 A;  4J8S A;  2LSU A;  4UWL A;  4WWO A;  2Y4T A;  4ANX A;  4BFR A;  1OWN A;  1HU3 A;  2R17 C;  3TXN A;  3FUM A;  2J9Q A;  2Q7F A;  5AJD A;  5ENN A;  5BV1 A;  2LSV A;  3GYZ A;  3AU5 A;  4K03 A;  1WM5 A;  4I1A A;  3T5V A;  3KAE A;  5BPP A;  3TJP A;  3IHY A;  3ASH A;  3LKU A;  1PY1 A;  3SI5 A;  5AIJ A;  3G2S A;  2XPZ A;  2R59 A;  3S7F A;  4MS6 A;  5ANL A;  2KZT B;  5HQ8 A;  2AVP A;  3D9M A;  3S7D A;  4NQ0 A;  3D9J A;  2CG3 A;  2YHC A;  3FTV A;  4FAD A;  1N52 A;  3MV2 B;  3I4G A;  4FLH A;  4QFV A;  3T5X A;  3CVN A;  4G24 A;  3UQ3 A;  3OXF A;  3MGB A;  5KCM A;  4CGW A;  5KJN A;  3UMV A;  2KCV A;  3FUI A;  4N39 A;  2R5S A;  3FDH A;  3FH5 A;  1H2V C;  4KYO B;  1UJK A;  2AXU A;  3QAQ A;  3FY4 A;  4ACK A;  3FUE A;  1UJJ A;  3JUI A;  4CEM A;  1E8W A;  2VSX E;  3MCX A;  1EF1 C;  1HS6 A;  3IKO B;  4A1G A;  4UWH A;  4ILI A;  4JEU A;  3MZL B;  3ZPJ A;  4HOS A;  2E2E A;  4WAF A;  2X6I A;  3D9K A;  3CQG B;  1UG3 A;  3KEZ A;  1JUQ A;  2KCK A;  2WVI A;  2MHK A;  4HOR A;  2C0M A;  3Q47 B;  3ZYK A;  4XE0 A;  3FUD A;  3FP3 A;  2PM6 A;  4JHK A;  3RO3 A;  1E8Z A;  1UW4 B;  2A5U A;  3T8M A;  4IRU A;  4CGV A;  2IF4 A;  2FEZ A;  2PQR A;  4O6F A;  3L16 A;  3WXX A;  3CVL A;  3FUK A;  3ESL A;  5KJK A;  3KD7 A;  5BNW A;  2PL2 A;  2WMO A;  3D9N A;  5G04 J;  4B89 A;  4AXH A;  4IUL A;  2WM9 A;  4EPZ A;  4J8F A;  3QWP A;  4UQY A;  5FZR A;  3ZW3 A;  4JA7 A;  3CKB A;  3CHS A;  3R7Q A;  3NZS A;  3ZIM A;  3RRM B;  3SGH A;  4CDM A;  2CFU A;  1HFA A;  5BV0 A;  5E75 A;  3D9P A;  2CFZ A;  3Q4A B;  4N3B A;  3PZD A;  2J49 A;  2BF0 X;  4BSX A;  1ZU2 A;  4LRZ A;  5BT1 A;  3CVY A;  3Q5M A;  2QFC A;  4DPR A;  3AS5 A;  4BTB A;  4Q94 A;  2MOW A;  1GW6 A;  3MYV A;  3FTS A;  2XGS A;  1Z3Y A;  3ZXS A;  1B89 A;  3OXL A;  4WNF A;  3VTX A;  3CVV A;  4BX9 A;  4B8C B;  4NRH B;  3UT4 A;  2XPI A;  2VSN A;  2NXP A;  2I1K A;  2LAH A;  3RKV A;  4C0E A;  5J90 A;  3L13 A;  3QB2 A;  3CIA A;  3ZGQ A;  4YND A;  4N3C A;  2VQ2 A;  3PRZ A;  3CSF A;  2KCL A;  1IQR A;  4H7X A;  4BT9 A;  2WPV A;  3FTU A;  1DNP A;  2KM4 A;  4GYO A;  4GZ5 A;  4AJW A;  3LVQ E;  3PEU B;  3HDX A;  4M3O A;  2RD0 A;  1TEZ A;  4I6G A;  4K0R A;  1H6K A;  3FUF A;  4AM9 A;  1HH8 A;  2XRY A;  3MEK A;  3FH8 A;  1VDY A;  3O48 A;  3RRU A;  5G04 C;  3LXU X;  5FT9 A;  2IJG X;  3E4B A;  1HF8 A;  3ZVV A;  2XHE A;  3QK0 A;  3S2A A;  2VJ8 A;  4WWN A;  4XI0 A;  4W9R A;  3EDT B;  1QQE A;  2IOL A;  2KC7 A;  3PH0 C;  4GML A;  3VTY A;  3L17 A;  3FTY A;  1UN8 A;  2WXK A;  2WXL A;  1HG2 A;  2I2O A;  5G2N A;  3L6A A;  2CG2 A;  1JWG A;  3D3M A;  3B13 A;  2V4L A;  2X38 A;  3LY9 A;  1HG5 A;  1JWF A;  3FEY A;  3QNK A;  4U8H A;  4AVX A;  5ANR A;  5JJT A;  3QJZ A;  4I6E A;  1OWL A;  3L08 A;  3EJN A;  3OXG A;  3PEV B;  2OOE A;  4R7L A;  1H2U A;  3FU6 A;  4AP2 A;  4GA2 A;  3LEW A;  3FFL A;  5LCW J;  3ZYQ A;  2WXP A;  3GZ2 A;  1EYH A;  2X6F A;  4CT4 A;  3EIJ A;  3Q15 A;  2GW1 A;  4HOU A;  3CLJ A;  1E8X A;  4A3T A;  5CCL A;  5G05 C;  2YNQ A;  3FUJ A;  5EKQ D;  3G2T A;  2NSZ A;  4DLQ A;  4EBA A;  4AV7 A;  4HOQ A;  3CHM A;  4CRW A;  4I43 A;  4JHR A;  2VGX A;  4NUR A;  2OVF A;  3CK7 A;  4JVS A;  2XEV A;  1Z3X A;  2P58 C;  3ENE A;  3LY7 A;  4MKT A;  1PAQ A;  4CDR A;  1E7U A;  3UT8 A;  4DLO A;  2ION A;  2L9B A;  2WXM A;  4U07 A;  5T4Y A;  3CQC B;  4FP7 A;  1ELK A;  2AXV A;  3TXM A;  3FU0 A;  3MKQ A;  2OVB A;  4I2Z A;  5A23 A;  4AOF A;  3CEQ A;  5DIZ A;  2A4Z A;  3APF A;  4ANU A;  3R9A B;  2L6J A;  1EPU A;  3LVR E;  4Y6C A;  4KBQ A;  3RK6 A;  1INZ A;  3SFZ A;  3GZ1 A;  4P29 A;  4GA1 A;  2VGY A;  3EHN A;  4A55 A;  3SBS A;  4FLB A;  4GZ6 A;  4G11 A;  3IV0 A;  2XRZ A;  3QKY A;  4GZ3 A;  1NZN A;  3MA5 A;  3HHM A;  4FHK A;  4KMO A;  3GW4 A;  3UT7 A;  2GRM A;  4I9C A;  4F3V A;  4JEH A;  4FA6 A;  5FQ8 A;  1NA0 A;  1Y6I A;  3I4R B;  2VYI A;  4J0U A;  2XQ0 A;  2WXG A;  3KS2 A;  4U0Z A;  5LCW C;  3PNL B;  4UI9 J;  3CVU A;  3SHF A;  4EEC A;  3RJV A;  3B7R L;  2VGX B;  4L23 A;  3ZYM A;  4J8D A;  4WWP A;  4N2S A;  2WXI A;  3OAW A;  2ILR A;  2UY1 A;  3FTW A;  4URK A;  3PRE A;  3JQ0 A;  3VLE A;  5J08 A;  2YIN A;  2WB2 A;  2AWI A;  2E0I A;  4B94 A;  4UWG A;  2BTD A;  3TGO A;  1UN9 A;  5BUZ A;  3SF4 A;  4D10 C;  3U66 A;  3MKR A;  5FQ6 A;  2WMN A;  2X6H A;  4J6I A;  4IYP A;  3MKQ B;  4JL0 A;  4RG9 A;  4F53 A;  1MQS A;  4Q96 A;  3G2W A;  3I3N A;  2RG8 A;  1QZ2 A;  1HO8 A;  3LYA A;  2X6K A;  3CVP A;  3FTX A;  3BG1 B;  3B7T A;  2OND A;  4RVB A;  3ZN3 A;  1LF8 A;  3CGH A;  3AS8 A;  3TAX A;  3CK8 A;  3JYS A;  2FBN A;  5LOZ A;  5D0O D;  1FCH A;  4TRQ A;  3ASG A;  4PS8 A;  1U3C A;  3BEE A;  4XKB A;  4N2Q A;  3HVE A;  1SQM A;  4FU3 A;  5T8I A;  4EZJ A;  1L5J A;  4WNG A;  1HZ4 A;  4GU5 A;  4AIF A;  2GRL A;  3ML9 A;  5AJL A;  4FUL A;  3ZEF A;  5A6C A;  5LP0 A;  1XGW A;  4PS7 A;  2HR2 A;  1JPL A;  5E76 A;  4WUY A;  1KT0 A;  2YHE A;  4I9E A;  3RRN B;  4HFG A;  2XGM A;  4FHJ A;  3MV3 B;  1E90 A;  3O4Z A;  4I6J A;  4MRU A;  3ZHE A;  4EQF A;  5M72 A;  3CVX A;  5G55 A;  4BTA A;  1ELR A;  3EIQ C;  2ZU6 B;  4G2V A;  4Y6W A;  2WQ6 A;  5FQ7 A;  2FI7 A;  5FZQ A;  2WXJ A;  3TG4 A;  4FC8 A;  4V3I A;  2J4B A;  2UY1 B;  2Y4U A;  3Q49 B;  4BX8 A;  3MX3 A;  5CMY A;  4A1S A;  3P2B A;  2PQN A;  4UI9 C;  3QDN A;  4ILH B;  1WAO 1;  4KVM A;  2WXF A;  4UWK A;  4OYS A;  3JCK C;  1H19 A;  3ONL A;  5T3R A;  2CHX A;  5EX0 A;  3RU0 A;  3HIZ A;  2WXH A;  4F7A A;  4CDN A;  2DIW A;  2WXQ A;  3IEG A;  3SNX A;  3RIB A;  3SD5 A;  3PUJ A;  2J4D A;  2J08 A;  4H7Y A;  4KVO A;  5DBK A;  4FJY A;  4FJZ A;  4GB9 A;  4XIF A;  3CHP A;  4XI9 A;  2XPY A;  4LER A;  4GYW A;  2KAT A;  3I5P A;  4I17 A;  3QC1 A;  2QY7 A;  3B7U X;  3L22 A;  1N54 A;  3MJW A;  4I2W A;  5ARF A;  5AYW D;  3APC A;  4GCO A;  4BWR A;  3HVE B;  4GZC A;  2CHZ A;  1FVF A;  4U63 A;  4GA0 A;  3B7S A;  3VLF A;  1IYG A;  1SZA A;  5BW8 C;  4HOT A;  4EZL A;  4WNE A;  2AXZ A;  3ML8 A;  3GZS A;  1HX8 A;  4LUN U;  1EDU A;  4JXT A;  3U4T A;  4G25 A;  3ULQ A;  3UUX A;  5EX3 A;  3ZHE B;  1HE8 A;  2DBA A;  4CCA A;  4CT0 A;  3L54 A;  2LO6 A;  3TL5 A;  1XNF A;  2IOS A;  3CHR A;  4N5C A;  4I1O B;  3VLD A;  2DCP A;  4BT8 A;  2J07 A;  4ABN A;  1ELW A;  3LCA A;  3LY8 A;  4C0M A;  3S7J A;  1H0A A;  2XCC A;  4A3V A;  3LJ3 A;  2I9C A;  2WXO A;  2C0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...