1SZ9A

The rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
143
structure length
143
Chain Sequence
DHDTEVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQKLYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGLPLFEGSALEKIEQFLIKASAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of RNA polymerase II carboxy-terminal domain by 3'-RNA-processing factors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords PCF11 protein
total genus 55
structure length 143
sequence length 143
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1sz9A00
1JPLA 2QY7A 3G2SA 3D9MA 4Q94A 3D9IA 1LF8A 1EYHA 1HG5A 3D9PA 3ONLA 4JXTA 3ZYLA 4FLBA 1INZA 3LDZA 1HG2A 1HF8A 3D9JA 5CMWA 1HX8A 1X5BA 2KM4A 3G2VA 2DCPA 3G2TA 4AVXA 1EDUA 2MOWA 1JUQA 4GZCA 1PY1A 4NACA 2L0IA 3ZYQA 3ZYKA 1H0AA 4FU3A 1HFAA 2L0TB 1UJKA 2LO6A 4GZDA 3CLJA 3ONKA 5J08A 1MHQA 1JWFA 1DVPA 2DIWA 3G2UA 1XGWA 3RRUA 5LP0A 1JWGA 1SZ9A 1UJJA 3D9OA 3G2WA 4HFGA 5CMYA 2BF0X 3ZYMA 1SZAA 1ELKA 3D9KA 5LOZA 1VDYA 4Q96A 2V8SE 3D9LA 3D9NA
chains in the Genus database with same CATH superfamily
4GTSA 3CHQA 2WQ6A 2E2EA 3QDNA 2LXLA 3HXDA 5IY5E 3DRAA 1YCSB 4GTPA 2WVIA 3DSWA 1O1SA 1H0AA 3FTXA 2XZDG 3DEOA 5A6CA 3D9OA 5BUZA 3CHPA 2FO1E 1K1BA 1FT1A 3MZLB 4F3VA 4U96D 2X3MA 3SHFA 2Y3AA 1MJ0A 4UWKA 1TJCA 2AWIA 1XNFA 4A3TA 2DIWA 5LP0A 3G2WA 4URKA 3ZYMA 5FQ8A 1WG0A 2R03A 5M72A 4I43A 3D9IA 1K3ZD 4AY5A 2J9QA 5E76A 3HVEA 2PZIA 5CEDB 4W9RA 2F8YA 4A1GA 1KPSB 1X5BA 4ILGA 4MKTA 2J49A 4RSYA 4IULA 5EKQD 2I9CA 2ZXWE 3UKRG 1MHQA 4JA9A 2J08A 1D8EA 5FINA 1LD8A 3AJIA 3Q4AB 2A5UA 3EDTB 1AP7A 1FCHA 1UN8A 3R7QA 2M63A 3HRAA 2XS1A 3UM0A 4J8EA 3B7RL 2XQ0A 1DNPA 3CR3A 3JYSA 2IY0C 2EILE 2VGXB 1HE8A 4EZKA 2J4DA 3PZ4A 4G8KA 4N5QA 4N2QA 4XI9A 4C0MA 1WY6A 4DPRA 1HU3A 2VQ2A 3CVLA 2E0IA 3FTYA 4KBQA 4E85A 1BLXB 5T3RA 1TJFA 4A63B 5AQ9A 3NZUA 3CQGB 5AQAA 3LYAA 3FU3A 3ABKE 4B8AA 2XPYA 4XZ4A 3QAQA 2WXQA 5EYLA 3FULA 4K5BA 2VGEA 3Q47B 4OVVA 4R7LA 2VTBB 2FEZA 3CVUA 1LTXA 5CMYA 5BW8C 1E90A 2V8SE 4L9PA 1NA3A 2WXFA 4V3IA 4U63A 3UT7A 4TUUA 4DX1A 3LXUX 4KZ0A 3AS8A 3NB2A 3G2TA 4AVXA 3Q73A 4Y6WA 2YINA 3ULQA 1N0RA 3PRZA 4LEUA 5G55A 3DWLG 5FTPA 4N2SA 2RFMA 3MGBA 2EIJE 3PH0C 3DXMG 3DPDA 2VTBA 5DBKA 4OAUC 3QK0A 3FUNA 2LXMA 3HXCA 3U4TA 3IEGA 1A5EA 2J4BA 4DLOA 2V4HC 4HS2A 4ILIA 4FADA 1HH8A 1H6PA 3VTXA 5EILA 4L7TA 5FZRA 1KZOA 4N3AA 2MRIA 4KZCA 4GB9A 2EIME 3B7UX 4UWLA 2H6FA 2XEVA 2WXNA 3CKCA 5ENNA 3DSXA 1FT2A 3FTZA 4GTOA 3LCAA 3U66A 4GZ5A 4BFRA 3R9MA 1X81A 3JQ0A 4YDWA 3FUJA 4YVQC 4EECA 4EPZA 3I4RB 3ASHA 3ESKA 3V31A 4RQIA 1N9AA 1WAO1 4L2YA 3TWUA 3HDXA 1SQMA 2DZOA 2GRPB 4JC8A 3D9HA 5AAOA 3CGHA 1HS6A 1FVFA 3ONLA 4LERA 4AEZC 2GRMA 4DX7D 3FP3A 3MKQB 3SFZA 4U0ZA 3HVEB 3APDA 3FFLA 1Z5SC 1KZPA 3Q49B 1JPLA 2QY7A 3CK9A 4HBDA 4JXTA 5AARA 3BEEA 3FWVA 3Q15A 4I1OB 4GCNA 1TNUA 3O4ZA 5ENOD 4C0EA 1UN9A 3AG1E 5KJNA 2L6JA 3L22A 3B95A 3D9KA 3RK6A 2Y69E 5ANLA 3ESLA 3C5RA 4EBAG 4JL0A 3ULEG 4UQYA 3PS6A 5T8IA 2MOWA 4ZFHA 4HVBA 5KBAA 2LO6A 4BEPA 2A5EA 3ASGA 1K8KG 5EIDA 4BT8A 3OXFA 1Z3XA 5CBOA 4GU5A 3E4BA 1QNFA 2C0MA 2PQRA 4G1TA 2H6GA 4A3VA 5EX3A 1NZNA 2IONA 3UM1A 3ZIMA 3QARA 2XGOA 3ZVVA 1ELWA 4BESA 2XEEA 3B7SA 2P9UG 2FBNA 1TN6A 1IQRA 4G2VA 3EIQC 4FA6A 5HS0A 3UT4A 1TNOA 3J5QB 4Q94A 4XKBA 3NZSA 3UUXA 3MA5A 3FUKA 3DPYA 1BU9A 4U0SA 1MZCA 2HR2A 4EZLA 4U8VD 4AY6A 2BTDA 4LSZE 3GW4A 2ZIRA 4BT9A 2V5QC 3ASOE 4CGVA 4EHMA 3PEVB 3LS8A 4MBGA 4HNAD 3E30A 3TXNA 3PVLA 4CRWA 3ZW3A 3T8KA 4CDRA 5AIJA 2WXHA 3JXIA 5ENTD 4PS7A 2VSXE 3C3RA 1HG2A 4IYPA 2EIKE 4UQZA 3S7JA 4LNGA 2CHXA 4G24A 3PNTB 4DX2A 2Y1LE 3EHRA 4NIKA 3CVWA 5KJMA 2GRNB 4F53A 2X6HA 4FLHA 2P9LG 3Q9NC 3L08A 4B0ZA 2GRQB 3LDZA 2VSNA 3C3OA 3TGOA 5CMWA 3FTUA 4U04A 3CVNA 3E34A 2C2LA 2B0OE 2OEWA 4OYSA 1IQUA 2XPIA 1XGWA 3CVVA 4ANWA 4HOUA 4XIFA 4HFGA 1WDYA 5B1AE 2KCLA 3T8MA 1U3CA 3FTSA 5FT9A 4JZYA 4XEIG 4Z68A 3E33A 2LNIA 3PE3A 1NL4A 3AG4E 4GZ3A 1SW6A 3TWSA 2VGYA 4GYWA 3D3MA 2IOLA 4HLEA 5A23A 3ONKA 2UWJG 4JA7A 1O1RA 3FDHA 1SZAA 3Q7FA 1PAQA 3SFXA 4HLLA 1L5JA 1TNZA 3PREA 3TWWA 4G8LA 4IN3B 3JUIA 4GA1A 4YNDA 4LRZA 4WNDA 4U8YD 3MEKA 4ACLA 2JABA 3FY4A 3UMVA 3TG5A 4HRLA 3EHNA 2HM8A 2FI7A 4MLPA 3FH7A 5ARGA 3F6QA 3ZKJA 3EJNA 5E75A 3V79K 3QWVA 3ABLE 4U7EB 1S64A 4QFVA 4GPKA 1IKND 4J8YA 3KSQA 2BF0X 2XZTG 4CZ2D 3GYZA 3AS5A 5D0OD 3G2SA 4I9CA 1LF8A 4BY6A 1RZ4A 4AOFA 3ENEA 3LJNA 5BXUA 4UQXA 2P9PG 4N3BA 4AV7A 1N0QA 3MJWA 3WXXA 3PEUB 4B89A 5A7DB 4B94A 5HI7A 3P1UA 3Q9UC 2P9NG 3SF4A 3WG7E 3L13A 4WAFA 4WWOA 2CFUA 4I1MA 2WXMA 4N39A 3RRUA 3FUMA 3Q7AA 3TAXA 3MCXA 4UI9C 4JD2G 3APFA 3QJZA 4X8QA 3AAAC 3DEPA 2A4ZA 5CERB 4TXPA 3D9JA 1D9SA 1BI7B 3RU0A 4HOSA 1PY1A 2H6IA 3I5PA 2KZTA 3MKRA 4EBAA 2IJGX 4CCAA 4Y6CA 2UY1A 4HXIA 2I6HA 3Q5MA 5CBNA 3APCA 2J09A 4N3CA 3TWQA 4JHKA 4J6IA 4LG6A 4ACKA 2XENA 1OWOA 5CRUA 1KT1A 2RG8A 5BV0A 2MHKA 5CCLA 4DK5A 5B3SE 4L1BA 1RW2A 1OCRE 2CG3A 3PE4A 5LCWC 2WQHA 3ZYQA 1E8XA 1N54A 4GZDA 2OCCE 2ILRA 2PNNA 2GW1A 3GZ1A 2WM9A 4HB5A 1FVHA 5BV1A 1ELKA 4U8HA 4JEUA 5C1DA 2YNQA 4TV3A 5KWDA 4P29A 2AVPA 2P58C 3LPZA 2KBXA 4QQIA 3TWVA 1OWNA 5FQ4A 1VDYA 3ZUVB 1KT0A 1QZ2A 2KCVA 5EYPF 3L54A 1HF8A 4YDYA 5AQ7A 1MX2A 4GZCA 2BKKB 2XGSA 2HYZA 3DSTA 4F1SA 2XCCA 1NA0A 2OVBA 3ML9A 4YDOA 2CG2A 2MYOA 5BT1A 3PZDA 5AN8A 3TWRA 2P2CP 2WPVA 3TL5A 3PZ2A 2WXIA 3I4GA 4D10C 2VGXA 2GROB 3LJ3A 3KEAA 4ILHB 5G04C 3TWXA 3DSVA 5JJ7A 3TJPA 3SQVA 5EDSA 5J90A 1YA0A 3UQ3A 1BD8A 3S7FA 4XE0A 3ZYKA 3CHRA 3OAWA 4DX5D 2C0LA 4JHJA 2AW6A 3CSTA 3RO3A 3FEXA 2DVWA 3TG4A 2F0YA 2IO3C 2QC9A 3AU4A 4BX8A 4PDXA 4O1OA 3S7DA 4J7WA 1N95A 3CVPA 4ATZD 4U0UA 4GMRA 1H2TC 3KAEA 1KLXA 5FZQA 2X6FA 1V55E 3EHMA 3FUEA 1OT8A 2LAIA 4BSXA 4G23A 5HKPA 2P9KG 2BEDA 4BSZB 3AG2E 1DCQA 3IHVA 3HG0D 3MYVA 2NYJA 4CGWA 4G11A 3E32A 3ZN3A 4DRXE 1INZA 5LFAA 4WNEA 4E6HA 1JCRA 4UUCA 4BTBA 3C72A 3RAUA 1IXVA 2LSUA 4CT4A 5D2MC 3OTNA 1OCCE 3VLEA 4M3OA 2YHCA 2YQ8A 4MRUA 3ZRHA 3UM3A 2RD0A 1QBQA 4KYOB 3V2OA 3HIZA 4OAVB 1UW4B 2PM7A 1DC2A 4DLQA 3EIJA 4UWGA 3W9GA 3D9NA 4HOQA 4KVOA 2XRYA 4HRMB 3RSEG 2XRZA 4J8SA 3IBEA 1QQEA 2WXKA 2X6KA 3ZHEB 5G04J 4GA0A 3CK8A 2LUHA 3ZEFA 1Y8MA 4GCOA 4GYOA 3ASNE 5KNGA 4GZ6A 1TEZA 4ZHBA 2AXZA 3CVYA 2XHEA 4BETA 2P9SG 1OCOE 3FU0A 3S2AA 3FEYA 5C2YA 3SNXA 5J08A 3UIPC 4K5AB 4J0UA 4RVBA 4LNBA 5LOZA 1BPOA 4I17A 3OXLA 4TRQA 2JLBA 4LUNU 4BTAA 4JPSA 4UWHA 3TXMA 4O60A 4BERA 1D8DA 3QNKA 4K0RA 4FHKA 5H7PA 3KS2A 1SZ9A 4O6FA 5CHEE 3UT8A 5DIZA 5BPPA 5CEAA 2OEVA 3CK7A 4HQDA 3SY2A 2ONDA 3DSSA 3LY7A 3JQ1A 4YVOA 1EPUA 3ABME 3UI2A 2ETBA 5ANRA 3KSLA 3V2XA 1HO8A 2ZGDA 5LCWJ 4N5CA 1OUVA 2WXJA 3SI5A 2QYJA 2IO2C 3E37A 3ZNGA 3FU6A 1YMPA 1UJJA 2DZNA 4U07A 2KC7A 3RRNB 3J5PA 4RG6A 4WUYA 4APOA 4L23A 4GYYA 1TNYA 1TNBA 3CLJA 5AJDA 3NF1A 5ENPD 4K5CA 2ZGGA 3T5VA 2HE0A 3NAWA 1N4RA 1H6KA 3IV0A 3FTWA 2F8XK 1PC2A 3C3QA 3RJVA 2LSVA 4LCTA 4I6EA 4Q69A 3U64A 1HX8A 2XCBA 1Y6IA 3L82A 2WQ7A 4MS6A 3PUJA 4AXHA 3NOCD 4CEMA 3B13A 4FJYA 1MX6A 1N52A 5D0QD 3LEWA 3SBTB 5EX0A 1HG5A 2F37A 4KXKB 2P9IG 1EDUA 4FP7A 3S7BA 2I2OA 3CHOA 2BUGA 2XEHA 2XS8A 5KJLA 1V54E 4XI0A 4GTTA 1IHGA 2OOEA 3FH5A 1N94A 4B93B 2Y0BG 3D9PA 5HRYA 2KCKA 2L9BA 1SA5A 3DXKG 3MV3B 1GW6A 4PH4B 5KJKA 2R17C 4GTMA 1OCZE 4NURA 5EN5D 4AJWA 4ANXA 4NQ0A 4AM9A 4WWPA 4H7YA 2AJAA 3K9IA 2V5FA 1S70B 5ENQD 4I6GA 3U3WA 2QZAA 3ASFA 4KT6B 2OV8A 3L16A 3W9FA 4WNFA 3FUFA 2KM4A 4WWNA 2Y4UA 3AU5A 2DBAA 3QB2A 1N4SA 4K03A 4C48B 5JHAA 1U3DA 2LAHA 1NP7A 4FULA 2L6BA 3PDNA 2V0PA 3LKUA 1UG3A 3IKOB 5JA4D 4DI4A 1OY3D 1H2VC 4KMOA 1JUQA 3UIOC 1HFAA 4GAAA 5JMND 3KD7A 3LY9A 1Q2ZA 1O5MA 4B8CB 3LY8A 3EUVA 3Q78A 4GA2A 3CHSA 5T4YA 1O1TA 1S63A 4HI8A 2R02A 2BKGA 2VYIA 1Z6TA 4DUIA 2IF4A 3QWPA 3SFYA 3ZGQA 5AJLA 3ULYA 1AWCB 4U95D 2HO1A 3UX4A 1EF1C 3BQOA 4KVMA 3B7TA 1SA4A 3PZ1A 3LVQE 4TXQA 1ELRA 4BWRA 1HXIA 2WXPA 5ENSD 2X6JA 3C98A 4RLYA 3N71A 4HOTA 3LVRE 3QC1A 3CEQA 1E7UA 2NC9A 1H19A 5LX8A 4L2LA 4BX9A 3CIAA 2UY1B 4FLBA 5JHBA 2R05A 3SD5A 2WXRA 2ETCA 1TN7A 2WXLA 4EZJA 2KZTB 4I1AA 4GPMA 2OVFA 3QWWA 4CYMD 5ENRD 2NXPA 2Q7FA 2R59A 4LNUD 5JJ6A 3JCKC 3V30A 2J07A 1IYGA 3FUHA 4HRNA 3ZPJA 4JVSA 4I2WA 2XPZA 1TYQG 4PS3A 2KATA 5CRVA 5B1BE 2NSZA 4APFA 3RIBA 3MV2B 4A1SA 5BNWA 3IXEA 4G25A 3D9LA 3SBSA 4DJAA 1B89A 3BG1B 2PL2A 2X6IA 5G2NA 2FF4A 2QFCA 4PUCA 3FHEA 3ML8A 4O1PA 4GMJA 5D66A 3QKYA 2V4LA 3CV0A 3EU5A 3U9WA 3BUAA 3HXBA 4GTVA 4J8FA 3IHYA 3ASDA 3GZSA 3VLFA 2WXGA 5KNHD 4F6RD 5FWQA 4PS8A 1N4PA 3D9MA 2VSYA 2GRLA 1N4QA 5FIOA 4YDEA 3R9AB 3ZYLA 4JEHA 2X38A 2I1KA 1ZBPA 4M7CA 3T9KA 2I1JA 1JWFA 1YYHA 2ZU6B 5AYWD 4TXRA 3MX3A 4XX5A 2R2LA 1TR4A 2DWZA 2QYUA 5EIBE 3SGHA 3ZFWA 4UI9K 4ABNA 4F1PA 2XGMA 4G26A 4XKCA 3SZ7A 4NACA 1K1AA 3FTVA 3CVXA 1QYMA 4WNGA 4ATGA 4OVUA 1Z3YA 1ZB1A 1NI1A 2AXUA 1LD7A 3PNLB 1BI8B 2Y4TA 4IRUA 3O48A 4CDNA 2GGFA 2WB2A 1EYHA 3L6AA 3RRMB 3ZXSA 2IOSA 2PQNA 3G2VA 1WM5A 2IQCA 3FU5A 3DSUA 3X2QE 4J8DA 4GTQA 1MQSA 3URZA 3HXEA 3I3NA 2KXPC 1S0PA 1NFIE 3FUDA 3EU9A 3QOUA 4I9EA 3CVQA 3TWTA 4UI9J 1JWGA 1W3BA 2EINE 3ZXPA 3L9TA 3ISMC 4RG9A 3CKBA 1E8ZA 4FHJA 4F7AA 4C9BB 2ZISA 3NOGD 3FUIA 3VLDA 2DCPA 4AP2A 2CFZA 2IFUA 3HHMA 2CHWA 3R7RA 1UJKA 2ETAA 3JUEA 3B7BA 3UPVA 1IHBA 1P5QA 4JHRA 3UXGA 1E8WA 1MX4A 2GRRB 3Q75A 4HORA 2WMNA 3VTYA 4ME2A 3Q79A 3HYMB 1U2VG 3FH8A 1A17A 3CSFA 4I2ZA 2WXOA 2L0TB 4NRHB 3G2UA 3PUKA 4JB8P 4FU3A 2YHEA 5AQBA 3T5XA 3UTMA 4AIFA 1E8YA 2WMOA 2EQXA 2H6HA 5FJYA 1UOHA 4DI3A 2JEKA 2AXVA 2B6CA 3AS4A 1DCEA 2IEJA 5ARFA 2R5SA 5CCMA 3RKVA 3BU8A 3SO8A 4EQFA 5JJTA 5HQ8A 4CT0A 2DYRE 5G05C 5FQ7A 3NBNB 1G3NB 5FQ6A 2J8SD 1E96B 4JW1A 3KEZA 4HI9A 1OWLA 3AG3E 4UWFA 5FZSA 5G05J 3CHMA 1ZU2A 1MYOA 3UKUG 2VSOE 3HXFA 2RKKA 3EHQA 3CQCB 2FO7A 2RFAA 4TUMA 1OWMA 4FJZA 2L0IA 1H6OA 3GZ2A 4FC8A 4DX6D 1TN8A 3ZHEA 4Q96A 3MKQA 3L17A 4I6JA 1OWPA 3NQPA 4GMLA 2IU1A 4H7XA 1HZ4A 5BXOA 1H2UA 5CECB 4ANUA 1E7VA 1N11A 1DVPA 3UINC 1FPPA 2PM6A 3OXGA 5AENA 3PZ3A 3UM2A 4A55A 2FULA 5KCMA 1JCSA 3RO2A 3DBSA 3ZU7B 1SVXA 4GTRA 1OXJA 2CHZA 3JXJA 4CDMA 2DYSE 1JCQA 3P2BA 2VJ8A 5ITZF 3BG0B 4ANVA
chains in the Genus database with same CATH topology
2WXHA 3CHQA 4G11A 2WQ6A 4L2LA 4BX9A 3CIAA 3ZN3A 4PS7A 2E2EA 3QDNA 2VSXE 2UY1B 4FLBA 1INZA 5JHBA 1HG2A 5LFAA 4WNEA 3SD5A 2WXRA 4IYPA 4UQZA 4E6HA 2WVIA 3S7JA 4BTBA 1H0AA 3FTXA 2LSUA 2CHXA 2WXLA 4G24A 4CT4A 5A6CA 3PNTB 4EZJA 3D9OA 2KZTB 4I1AA 5BUZA 3CVWA 3OTNA 5KJMA 4F53A 2X6HA 4FLHA 3CHPA 2OVFA 3L08A 4B0ZA 3VLEA 4M3OA 2YHCA 2YQ8A 4MRUA 3MZLB 3ZRHA 4F3VA 3LDZA 2VSNA 3TGOA 3QWWA 5CMWA 2RD0A 3FTUA 4KYOB 4U04A 3CVNA 2X3MA 3HIZA 3SHFA 2Y3AA 2C2LA 2NXPA 4UWKA 1TJCA 2Q7FA 2AWIA 2R59A 1IQUA 1UW4B 1XNFA 2DIWA 2XPIA 1XGWA 2PM7A 4OYSA 4A3TA 4ANWA 4DLQA 5LP0A 3CVVA 3EIJA 4HOUA 3G2WA 4XIFA 4HFGA 4UWGA 3ZYMA 5JJ6A 4URKA 5FQ8A 3JCKC 2KCLA 3T8MA 1U3CA 3D9NA 3FTSA 2J07A 1IYGA 3FUHA 5M72A 4I43A 4HOQA 5FT9A 4JZYA 3D9IA 2LNIA 4KVOA 2XRYA 4AY5A 2J9QA 5E76A 3PE3A 4JVSA 3ZPJA 3HVEA 2PZIA 4I2WA 4W9RA 2XPZA 4GZ3A 4A1GA 2XRZA 4J8SA 1X5BA 4ILGA 3IBEA 4MKTA 4PS3A 2KATA 2J49A 4RSYA 2VGYA 1QQEA 4GYWA 2WXKA 3D3MA 2IOLA 2X6KA 4IULA 2I9CA 2NSZA 5EKQD 3ZHEB 5G04J 4HLEA 5A23A 3ONKA 4APFA 1MHQA 4JA9A 4GA0A 2J08A 2UWJG 3RIBA 4JA7A 3CK8A 3ZEFA 3MV2B 3FDHA 4A1SA 1SZAA 5BNWA 1Y8MA 1PAQA 3Q4AB 4G25A 4GCOA 3D9LA 4GYOA 2A5UA 3EDTB 3SBSA 1FCHA 4GZ6A 1TEZA 1L5JA 4DJAA 2AXZA 3CVYA 2XHEA 3PREA 1UN8A 3R7QA 1B89A 2M63A 3BG1B 4IN3B 3JUIA 3FU0A 3S2AA 2PL2A 2X6IA 4J8EA 5G2NA 3FEYA 2FF4A 2QFCA 3B7RL 2XQ0A 5C2YA 3SNXA 1DNPA 4GA1A 3CR3A 4YNDA 4PUCA 3JYSA 5J08A 4LRZA 2VGXB 3FHEA 4WNDA 3ML8A 1HE8A 3MEKA 4ACLA 4J0UA 3FY4A 4GMJA 4RVBA 3UMVA 2J4DA 4EZKA 3QKYA 5LOZA 1BPOA 4I17A 3TG5A 3EHNA 2HM8A 3OXLA 4TRQA 2V4LA 4N2QA 2FI7A 3CV0A 4XI9A 2JLBA 4MLPA 4C0MA 3FH7A 4LUNU 1WY6A 5ARGA 4BTAA 4JPSA 4UWHA 3TXMA 3U9WA 4DPRA 1HU3A 2VQ2A 3CVLA 3QNKA 2E0IA 3FTYA 4K0RA 4KBQA 3EJNA 4J8FA 4FHKA 5E75A 3IHYA 3QWVA 3ASDA 3GZSA 4E85A 3VLFA 2WXGA 3KS2A 4QFVA 5T3RA 4GPKA 1TJFA 5FWQA 1SZ9A 4O6FA 2BF0X 4PS8A 5CHEE 3NZUA 3GYZA 3CQGB 5DIZA 3UT8A 5BPPA 3AS5A 5D0OD 3LYAA 3G2SA 3FU3A 3D9MA 4B8AA 2VSYA 2GRLA 2XPYA 4I9CA 1LF8A 4BY6A 3CK7A 3R9AB 3ZYLA 4JEHA 4AOFA 2ONDA 3ENEA 4XZ4A 2X38A 3QAQA 2I1KA 2WXQA 1ZBPA 3FULA 2I1JA 3LY7A 3Q47B 4OVVA 3JQ1A 4UQXA 1JWFA 4R7LA 1EPUA 4YVOA 2VTBB 2ZU6B 2FEZA 4N3BA 4AV7A 5AYWD 3CVUA 3MJWA 5CMYA 5ANRA 5BW8C 3MX3A 4XX5A 1E90A 2V8SE 3WXXA 1NA3A 3PEUB 2WXFA 4V3IA 4U63A 3UT7A 4B89A 1HO8A 5A7DB 4TUUA 3SGHA 3ZFWA 4B94A 3LXUX 5HI7A 5LCWJ 4KZ0A 3P1UA 4UI9K 4ABNA 3AS8A 3SF4A 4N5CA 1OUVA 2WXJA 3G2TA 3L13A 2XGMA 4G26A 4XKCA 4WWOA 2CFUA 4NACA 4I1MA 4WAFA 3SI5A 3SZ7A 2WXMA 4Y6WA 2YINA 3ULQA 4N39A 3PRZA 4LEUA 3FTVA 3RRUA 3FU6A 3FUMA 3CVXA 4WNGA 1UJJA 5G55A 4ATGA 5FTPA 4U07A 2KC7A 4N2SA 4OVUA 1Z3YA 3RRNB 3MGBA 3TAXA 3MCXA 2AXUA 4UI9C 3PH0C 4RG6A 3PNLB 3APFA 3QJZA 3DPDA 2Y4TA 4IRUA 2VTBA 3O48A 4CDNA 2GGFA 2WB2A 5DBKA 1EYHA 3L6AA 3RRMB 2A4ZA 4WUYA 3D9JA 2IOSA 2PQNA 3ZXSA 3G2VA 3RU0A 4APOA 4HOSA 3QK0A 4L23A 3FUNA 4GYYA 1WM5A 2IQCA 1PY1A 3FU5A 3I5PA 3IEGA 3U4TA 2J4BA 2KZTA 3CLJA 5AJDA 4DLOA 4HS2A 3NF1A 3MKRA 4J8DA 4ILIA 4FADA 1MQSA 3URZA 4EBAA 3T5VA 2IJGX 3I3NA 1H6KA 1HH8A 4CCAA 3VTXA 4Y6CA 3IV0A 1S0PA 3FTWA 1PC2A 4L7TA 5FZRA 4N3AA 2UY1A 2MRIA 4HXIA 2I6HA 2LSVA 3Q5MA 3RJVA 4KZCA 4LCTA 4GB9A 4I6EA 4Q69A 3U64A 1HX8A 3FUDA 3B7UX 4UWLA 3APCA 2J09A 4N3CA 2XEVA 4JHKA 3QOUA 4I9EA 3CVQA 2WXNA 3CKCA 4J6IA 2XCBA 5ENNA 1Y6IA 4ACKA 2WQ7A 4MS6A 4UI9J 3PUJA 4AXHA 1JWGA 1OWOA 3FTZA 3LCAA 4CEMA 3U66A 1W3BA 1KT1A 2RG8A 5BV0A 2MHKA 4GZ5A 3B13A 4BFRA 4FJYA 1N52A 5D0QD 3LEWA 4DK5A 4RG9A 3CKBA 1E8ZA 4FHJA 5CCLA 4L1BA 4F7AA 3SBTB 5EX0A 1HG5A 4C9BB 3JQ0A 3FUJA 3FUIA 2CG3A 3PE4A 4KXKB 4YVQC 2DCPA 3VLDA 4AP2A 5LCWC 1EDUA 2CFZA 2IFUA 2WQHA 2CHWA 3HHMA 1E8XA 4FP7A 1N54A 3S7BA 3ZYQA 2I2OA 3I4RB 4EECA 3R7RA 3ASHA 3ESKA 1UJKA 4EPZA 4GZDA 3CHOA 2BUGA 2ILRA 5KJLA 1WAO1 2GW1A 4XI0A 3GZ1A 4L2YA 3UPVA 2WM9A 3HDXA 1FVHA 5BV1A 1ELKA 1SQMA 1IHGA 1P5QA 4JHRA 4U8HA 1E8WA 4JC8A 4JEUA 3CGHA 5C1DA 1HS6A 2YNQA 2OOEA 3FH5A 1FVFA 3D9PA 3ONLA 4TV3A 4LERA 4AEZC 2GRMA 4P29A 4HORA 2AVPA 2WMNA 3VTYA 4ME2A 3FP3A 3HYMB 2KCKA 3MKQB 3SFZA 4U0ZA 3FH8A 1A17A 2P58C 3CSFA 4I2ZA 2WXOA 2L0TB 2L9BA 3HVEB 3MV3B 4NRHB 1GW6A 3LPZA 3G2UA 3APDA 3PUKA 3FFLA 4PH4B 5KJKA 2R17C 1OWNA 5FQ4A 3Q49B 1VDYA 4FU3A 4NURA 1JPLA 2QY7A 1KT0A 1QZ2A 2YHEA 3CK9A 2KCVA 4AJWA 4ANXA 3T5XA 4JXTA 4NQ0A 4AIFA 3BEEA 1HF8A 3FWVA 3L54A 4AM9A 3Q15A 4I1OB 4GCNA 4WWPA 4H7YA 3O4ZA 4GZCA 1E8YA 4C0EA 1UN9A 2XGSA 2WMOA 2EQXA 3K9IA 2V5FA 5KJNA 2HYZA 2L6JA 4I6GA 4F1SA 2XCCA 3U3WA 3ASFA 3L22A 1NA0A 4KT6B 3D9KA 3RK6A 2OVBA 3ML9A 5FJYA 2OV8A 2CG2A 4DI3A 5ANLA 2JEKA 2AXVA 3ESLA 3L16A 5BT1A 4EBAG 4JL0A 4WNFA 3AS4A 3FUFA 4UQYA 3PZDA 5ARFA 2KM4A 2R5SA 3PS6A 5CCMA 3RKVA 4WWNA 5T8IA 2WPVA 2MOWA 3TL5A 2Y4UA 4EQFA 4HVBA 2WXIA 5HQ8A 5JJTA 3I4GA 2LO6A 3AU5A 4CT0A 4D10C 2DBAA 3ASGA 3QB2A 5G05C 5FQ7A 4BT8A 5FQ6A 2VGXA 4K03A 1E96B 4JW1A 3KEZA 3OXFA 3LJ3A 1OWLA 4UWFA 1Z3XA 5FZSA 5G05J 3CHMA 4ILHB 5JHAA 1U3DA 2LAHA 1NP7A 4GU5A 5G04C 3E4BA 4FULA 5JJ7A 1ZU2A 3TJPA 1QNFA 3PDNA 2C0MA 2V0PA 2PQRA 2VSOE 3LKUA 4G1TA 5EDSA 5J90A 1YA0A 3CQCB 4A3VA 1UG3A 2FO7A 3IKOB 5EX3A 1NZNA 2IONA 3UQ3A 4DI4A 1H2VC 3S7FA 3QARA 3ZIMA 2XGOA 4KMOA 1OWMA 4FJZA 1JUQA 4XE0A 3ZVVA 2L0IA 3ZYKA 3CHRA 1ELWA 3OAWA 1HFAA 4GAAA 3KD7A 3B7SA 3LY9A 3GZ2A 2C0LA 4FC8A 4B8CB 2FBNA 4JHJA 3LY8A 2AW6A 4GA2A 3CHSA 5T4YA 1IQRA 3ZHEA 4G2VA 4Q96A 3CSTA 3EIQC 4FA6A 3RO3A 3FEXA 3UT4A 2VYIA 3MKQA 1Z6TA 3TG4A 3L17A 4Q94A 4XKBA 4I6JA 1OWPA 3NQPA 2IF4A 3NZSA 2IU1A 3QWPA 4GMLA 4H7XA 3UUXA 3MA5A 3AU4A 3FUKA 4BX8A 1HZ4A 4U0SA 4PDXA 3ZGQA 2HR2A 3S7DA 4AVXA 4EZLA 1H2UA 4ANUA 3CVPA 2BTDA 5AJLA 4AY6A 1E7VA 2HO1A 1DVPA 4U0UA 2PM6A 3UX4A 1EF1C 3OXGA 3GW4A 1H2TC 4KVMA 3B7TA 5AENA 3KAEA 1KLXA 3LVQE 5FZQA 2X6FA 4A55A 3EHMA 3FUEA 4BT9A 2FULA 1ELRA 2LAIA 4BWRA 4BSXA 1HXIA 5KCMA 4CGVA 2WXPA 3RO2A 2X6JA 3C98A 3DBSA 4G23A 3PEVB 3N71A 4HOTA 3LS8A 3LVRE 3TXNA 3IHVA 3PVLA 4CRWA 2CHZA 3QC1A 4CDMA 3MYVA 3ZW3A 3P2BA 3CEQA 2VJ8A 4CDRA 1E7UA 2NC9A 4CGWA 3BG0B 1H19A 5LX8A 4ANVA 5AIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JPL A;  2QY7 A;  3G2S A;  3D9M A;  4Q94 A;  3D9I A;  1LF8 A;  1EYH A;  1HG5 A;  3D9P A;  3ONL A;  4JXT A;  3ZYL A;  4FLB A;  1INZ A;  3LDZ A;  1HG2 A;  1HF8 A;  3D9J A;  5CMW A;  1HX8 A;  1X5B A;  2KM4 A;  3G2V A;  2DCP A;  3G2T A;  4AVX A;  1EDU A;  2MOW A;  1JUQ A;  4GZC A;  1PY1 A;  4NAC A;  2L0I A;  3ZYQ A;  3ZYK A;  1H0A A;  4FU3 A;  1HFA A;  2L0T B;  1UJK A;  2LO6 A;  4GZD A;  3CLJ A;  3ONK A;  5J08 A;  1MHQ A;  1JWF A;  1DVP A;  2DIW A;  3G2U A;  1XGW A;  3RRU A;  5LP0 A;  1JWG A;  1SZ9 A;  1UJJ A;  3D9O A;  3G2W A;  4HFG A;  5CMY A;  2BF0 X;  3ZYM A;  1SZA A;  1ELK A;  3D9K A;  5LOZ A;  1VDY A;  4Q96 A;  2V8S E;  3D9L A;  3D9N A; 
#chains in the Genus database with same CATH topology
 4GTS A;  3CHQ A;  2WQ6 A;  2E2E A;  3QDN A;  2LXL A;  3HXD A;  5IY5 E;  3DRA A;  1YCS B;  4GTP A;  2WVI A;  3DSW A;  1O1S A;  1H0A A;  3FTX A;  2XZD G;  3DEO A;  5A6C A;  3D9O A;  5BUZ A;  3CHP A;  2FO1 E;  1K1B A;  1FT1 A;  3MZL B;  4F3V A;  4U96 D;  2X3M A;  3SHF A;  2Y3A A;  1MJ0 A;  4UWK A;  1TJC A;  2AWI A;  1XNF A;  4A3T A;  2DIW A;  5LP0 A;  3G2W A;  4URK A;  3ZYM A;  5FQ8 A;  1WG0 A;  2R03 A;  5M72 A;  4I43 A;  3D9I A;  1K3Z D;  4AY5 A;  2J9Q A;  5E76 A;  3HVE A;  2PZI A;  5CED B;  4W9R A;  2F8Y A;  4A1G A;  1KPS B;  1X5B A;  4ILG A;  4MKT A;  2J49 A;  4RSY A;  4IUL A;  5EKQ D;  2I9C A;  2ZXW E;  3UKR G;  1MHQ A;  4JA9 A;  2J08 A;  1D8E A;  5FIN A;  1LD8 A;  3AJI A;  3Q4A B;  2A5U A;  3EDT B;  1AP7 A;  1FCH A;  1UN8 A;  3R7Q A;  2M63 A;  3HRA A;  2XS1 A;  3UM0 A;  4J8E A;  3B7R L;  2XQ0 A;  1DNP A;  3CR3 A;  3JYS A;  2IY0 C;  2EIL E;  2VGX B;  1HE8 A;  4EZK A;  2J4D A;  3PZ4 A;  4G8K A;  4N5Q A;  4N2Q A;  4XI9 A;  4C0M A;  1WY6 A;  4DPR A;  1HU3 A;  2VQ2 A;  3CVL A;  2E0I A;  3FTY A;  4KBQ A;  4E85 A;  1BLX B;  5T3R A;  1TJF A;  4A63 B;  5AQ9 A;  3NZU A;  3CQG B;  5AQA A;  3LYA A;  3FU3 A;  3ABK E;  4B8A A;  2XPY A;  4XZ4 A;  3QAQ A;  2WXQ A;  5EYL A;  3FUL A;  4K5B A;  2VGE A;  3Q47 B;  4OVV A;  4R7L A;  2VTB B;  2FEZ A;  3CVU A;  1LTX A;  5CMY A;  5BW8 C;  1E90 A;  2V8S E;  4L9P A;  1NA3 A;  2WXF A;  4V3I A;  4U63 A;  3UT7 A;  4TUU A;  4DX1 A;  3LXU X;  4KZ0 A;  3AS8 A;  3NB2 A;  3G2T A;  4AVX A;  3Q73 A;  4Y6W A;  2YIN A;  3ULQ A;  1N0R A;  3PRZ A;  4LEU A;  5G55 A;  3DWL G;  5FTP A;  4N2S A;  2RFM A;  3MGB A;  2EIJ E;  3PH0 C;  3DXM G;  3DPD A;  2VTB A;  5DBK A;  4OAU C;  3QK0 A;  3FUN A;  2LXM A;  3HXC A;  3U4T A;  3IEG A;  1A5E A;  2J4B A;  4DLO A;  2V4H C;  4HS2 A;  4ILI A;  4FAD A;  1HH8 A;  1H6P A;  3VTX A;  5EIL A;  4L7T A;  5FZR A;  1KZO A;  4N3A A;  2MRI A;  4KZC A;  4GB9 A;  2EIM E;  3B7U X;  4UWL A;  2H6F A;  2XEV A;  2WXN A;  3CKC A;  5ENN A;  3DSX A;  1FT2 A;  3FTZ A;  4GTO A;  3LCA A;  3U66 A;  4GZ5 A;  4BFR A;  3R9M A;  1X81 A;  3JQ0 A;  4YDW A;  3FUJ A;  4YVQ C;  4EEC A;  4EPZ A;  3I4R B;  3ASH A;  3ESK A;  3V31 A;  4RQI A;  1N9A A;  1WAO 1;  4L2Y A;  3TWU A;  3HDX A;  1SQM A;  2DZO A;  2GRP B;  4JC8 A;  3D9H A;  5AAO A;  3CGH A;  1HS6 A;  1FVF A;  3ONL A;  4LER A;  4AEZ C;  2GRM A;  4DX7 D;  3FP3 A;  3MKQ B;  3SFZ A;  4U0Z A;  3HVE B;  3APD A;  3FFL A;  1Z5S C;  1KZP A;  3Q49 B;  1JPL A;  2QY7 A;  3CK9 A;  4HBD A;  4JXT A;  5AAR A;  3BEE A;  3FWV A;  3Q15 A;  4I1O B;  4GCN A;  1TNU A;  3O4Z A;  5ENO D;  4C0E A;  1UN9 A;  3AG1 E;  5KJN A;  2L6J A;  3L22 A;  3B95 A;  3D9K A;  3RK6 A;  2Y69 E;  5ANL A;  3ESL A;  3C5R A;  4EBA G;  4JL0 A;  3ULE G;  4UQY A;  3PS6 A;  5T8I A;  2MOW A;  4ZFH A;  4HVB A;  5KBA A;  2LO6 A;  4BEP A;  2A5E A;  3ASG A;  1K8K G;  5EID A;  4BT8 A;  3OXF A;  1Z3X A;  5CBO A;  4GU5 A;  3E4B A;  1QNF A;  2C0M A;  2PQR A;  4G1T A;  2H6G A;  4A3V A;  5EX3 A;  1NZN A;  2ION A;  3UM1 A;  3ZIM A;  3QAR A;  2XGO A;  3ZVV A;  1ELW A;  4BES A;  2XEE A;  3B7S A;  2P9U G;  2FBN A;  1TN6 A;  1IQR A;  4G2V A;  3EIQ C;  4FA6 A;  5HS0 A;  3UT4 A;  1TNO A;  3J5Q B;  4Q94 A;  4XKB A;  3NZS A;  3UUX A;  3MA5 A;  3FUK A;  3DPY A;  1BU9 A;  4U0S A;  1MZC A;  2HR2 A;  4EZL A;  4U8V D;  4AY6 A;  2BTD A;  4LSZ E;  3GW4 A;  2ZIR A;  4BT9 A;  2V5Q C;  3ASO E;  4CGV A;  4EHM A;  3PEV B;  3LS8 A;  4MBG A;  4HNA D;  3E30 A;  3TXN A;  3PVL A;  4CRW A;  3ZW3 A;  3T8K A;  4CDR A;  5AIJ A;  2WXH A;  3JXI A;  5ENT D;  4PS7 A;  2VSX E;  3C3R A;  1HG2 A;  4IYP A;  2EIK E;  4UQZ A;  3S7J A;  4LNG A;  2CHX A;  4G24 A;  3PNT B;  4DX2 A;  2Y1L E;  3EHR A;  4NIK A;  3CVW A;  5KJM A;  2GRN B;  4F53 A;  2X6H A;  4FLH A;  2P9L G;  3Q9N C;  3L08 A;  4B0Z A;  2GRQ B;  3LDZ A;  2VSN A;  3C3O A;  3TGO A;  5CMW A;  3FTU A;  4U04 A;  3CVN A;  3E34 A;  2C2L A;  2B0O E;  2OEW A;  4OYS A;  1IQU A;  2XPI A;  1XGW A;  3CVV A;  4ANW A;  4HOU A;  4XIF A;  4HFG A;  1WDY A;  5B1A E;  2KCL A;  3T8M A;  1U3C A;  3FTS A;  5FT9 A;  4JZY A;  4XEI G;  4Z68 A;  3E33 A;  2LNI A;  3PE3 A;  1NL4 A;  3AG4 E;  4GZ3 A;  1SW6 A;  3TWS A;  2VGY A;  4GYW A;  3D3M A;  2IOL A;  4HLE A;  5A23 A;  3ONK A;  2UWJ G;  4JA7 A;  1O1R A;  3FDH A;  1SZA A;  3Q7F A;  1PAQ A;  3SFX A;  4HLL A;  1L5J A;  1TNZ A;  3PRE A;  3TWW A;  4G8L A;  4IN3 B;  3JUI A;  4GA1 A;  4YND A;  4LRZ A;  4WND A;  4U8Y D;  3MEK A;  4ACL A;  2JAB A;  3FY4 A;  3UMV A;  3TG5 A;  4HRL A;  3EHN A;  2HM8 A;  2FI7 A;  4MLP A;  3FH7 A;  5ARG A;  3F6Q A;  3ZKJ A;  3EJN A;  5E75 A;  3V79 K;  3QWV A;  3ABL E;  4U7E B;  1S64 A;  4QFV A;  4GPK A;  1IKN D;  4J8Y A;  3KSQ A;  2BF0 X;  2XZT G;  4CZ2 D;  3GYZ A;  3AS5 A;  5D0O D;  3G2S A;  4I9C A;  1LF8 A;  4BY6 A;  1RZ4 A;  4AOF A;  3ENE A;  3LJN A;  5BXU A;  4UQX A;  2P9P G;  4N3B A;  4AV7 A;  1N0Q A;  3MJW A;  3WXX A;  3PEU B;  4B89 A;  5A7D B;  4B94 A;  5HI7 A;  3P1U A;  3Q9U C;  2P9N G;  3SF4 A;  3WG7 E;  3L13 A;  4WAF A;  4WWO A;  2CFU A;  4I1M A;  2WXM A;  4N39 A;  3RRU A;  3FUM A;  3Q7A A;  3TAX A;  3MCX A;  4UI9 C;  4JD2 G;  3APF A;  3QJZ A;  4X8Q A;  3AAA C;  3DEP A;  2A4Z A;  5CER B;  4TXP A;  3D9J A;  1D9S A;  1BI7 B;  3RU0 A;  4HOS A;  1PY1 A;  2H6I A;  3I5P A;  2KZT A;  3MKR A;  4EBA A;  2IJG X;  4CCA A;  4Y6C A;  2UY1 A;  4HXI A;  2I6H A;  3Q5M A;  5CBN A;  3APC A;  2J09 A;  4N3C A;  3TWQ A;  4JHK A;  4J6I A;  4LG6 A;  4ACK A;  2XEN A;  1OWO A;  5CRU A;  1KT1 A;  2RG8 A;  5BV0 A;  2MHK A;  5CCL A;  4DK5 A;  5B3S E;  4L1B A;  1RW2 A;  1OCR E;  2CG3 A;  3PE4 A;  5LCW C;  2WQH A;  3ZYQ A;  1E8X A;  1N54 A;  4GZD A;  2OCC E;  2ILR A;  2PNN A;  2GW1 A;  3GZ1 A;  2WM9 A;  4HB5 A;  1FVH A;  5BV1 A;  1ELK A;  4U8H A;  4JEU A;  5C1D A;  2YNQ A;  4TV3 A;  5KWD A;  4P29 A;  2AVP A;  2P58 C;  3LPZ A;  2KBX A;  4QQI A;  3TWV A;  1OWN A;  5FQ4 A;  1VDY A;  3ZUV B;  1KT0 A;  1QZ2 A;  2KCV A;  5EYP F;  3L54 A;  1HF8 A;  4YDY A;  5AQ7 A;  1MX2 A;  4GZC A;  2BKK B;  2XGS A;  2HYZ A;  3DST A;  4F1S A;  2XCC A;  1NA0 A;  2OVB A;  3ML9 A;  4YDO A;  2CG2 A;  2MYO A;  5BT1 A;  3PZD A;  5AN8 A;  3TWR A;  2P2C P;  2WPV A;  3TL5 A;  3PZ2 A;  2WXI A;  3I4G A;  4D10 C;  2VGX A;  2GRO B;  3LJ3 A;  3KEA A;  4ILH B;  5G04 C;  3TWX A;  3DSV A;  5JJ7 A;  3TJP A;  3SQV A;  5EDS A;  5J90 A;  1YA0 A;  3UQ3 A;  1BD8 A;  3S7F A;  4XE0 A;  3ZYK A;  3CHR A;  3OAW A;  4DX5 D;  2C0L A;  4JHJ A;  2AW6 A;  3CST A;  3RO3 A;  3FEX A;  2DVW A;  3TG4 A;  2F0Y A;  2IO3 C;  2QC9 A;  3AU4 A;  4BX8 A;  4PDX A;  4O1O A;  3S7D A;  4J7W A;  1N95 A;  3CVP A;  4ATZ D;  4U0U A;  4GMR A;  1H2T C;  3KAE A;  1KLX A;  5FZQ A;  2X6F A;  1V55 E;  3EHM A;  3FUE A;  1OT8 A;  2LAI A;  4BSX A;  4G23 A;  5HKP A;  2P9K G;  2BED A;  4BSZ B;  3AG2 E;  1DCQ A;  3IHV A;  3HG0 D;  3MYV A;  2NYJ A;  4CGW A;  4G11 A;  3E32 A;  3ZN3 A;  4DRX E;  1INZ A;  5LFA A;  4WNE A;  4E6H A;  1JCR A;  4UUC A;  4BTB A;  3C72 A;  3RAU A;  1IXV A;  2LSU A;  4CT4 A;  5D2M C;  3OTN A;  1OCC E;  3VLE A;  4M3O A;  2YHC A;  2YQ8 A;  4MRU A;  3ZRH A;  3UM3 A;  2RD0 A;  1QBQ A;  4KYO B;  3V2O A;  3HIZ A;  4OAV B;  1UW4 B;  2PM7 A;  1DC2 A;  4DLQ A;  3EIJ A;  4UWG A;  3W9G A;  3D9N A;  4HOQ A;  4KVO A;  2XRY A;  4HRM B;  3RSE G;  2XRZ A;  4J8S A;  3IBE A;  1QQE A;  2WXK A;  2X6K A;  3ZHE B;  5G04 J;  4GA0 A;  3CK8 A;  2LUH A;  3ZEF A;  1Y8M A;  4GCO A;  4GYO A;  3ASN E;  5KNG A;  4GZ6 A;  1TEZ A;  4ZHB A;  2AXZ A;  3CVY A;  2XHE A;  4BET A;  2P9S G;  1OCO E;  3FU0 A;  3S2A A;  3FEY A;  5C2Y A;  3SNX A;  5J08 A;  3UIP C;  4K5A B;  4J0U A;  4RVB A;  4LNB A;  5LOZ A;  1BPO A;  4I17 A;  3OXL A;  4TRQ A;  2JLB A;  4LUN U;  4BTA A;  4JPS A;  4UWH A;  3TXM A;  4O60 A;  4BER A;  1D8D A;  3QNK A;  4K0R A;  4FHK A;  5H7P A;  3KS2 A;  1SZ9 A;  4O6F A;  5CHE E;  3UT8 A;  5DIZ A;  5BPP A;  5CEA A;  2OEV A;  3CK7 A;  4HQD A;  3SY2 A;  2OND A;  3DSS A;  3LY7 A;  3JQ1 A;  4YVO A;  1EPU A;  3ABM E;  3UI2 A;  2ETB A;  5ANR A;  3KSL A;  3V2X A;  1HO8 A;  2ZGD A;  5LCW J;  4N5C A;  1OUV A;  2WXJ A;  3SI5 A;  2QYJ A;  2IO2 C;  3E37 A;  3ZNG A;  3FU6 A;  1YMP A;  1UJJ A;  2DZN A;  4U07 A;  2KC7 A;  3RRN B;  3J5P A;  4RG6 A;  4WUY A;  4APO A;  4L23 A;  4GYY A;  1TNY A;  1TNB A;  3CLJ A;  5AJD A;  3NF1 A;  5ENP D;  4K5C A;  2ZGG A;  3T5V A;  2HE0 A;  3NAW A;  1N4R A;  1H6K A;  3IV0 A;  3FTW A;  2F8X K;  1PC2 A;  3C3Q A;  3RJV A;  2LSV A;  4LCT A;  4I6E A;  4Q69 A;  3U64 A;  1HX8 A;  2XCB A;  1Y6I A;  3L82 A;  2WQ7 A;  4MS6 A;  3PUJ A;  4AXH A;  3NOC D;  4CEM A;  3B13 A;  4FJY A;  1MX6 A;  1N52 A;  5D0Q D;  3LEW A;  3SBT B;  5EX0 A;  1HG5 A;  2F37 A;  4KXK B;  2P9I G;  1EDU A;  4FP7 A;  3S7B A;  2I2O A;  3CHO A;  2BUG A;  2XEH A;  2XS8 A;  5KJL A;  1V54 E;  4XI0 A;  4GTT A;  1IHG A;  2OOE A;  3FH5 A;  1N94 A;  4B93 B;  2Y0B G;  3D9P A;  5HRY A;  2KCK A;  2L9B A;  1SA5 A;  3DXK G;  3MV3 B;  1GW6 A;  4PH4 B;  5KJK A;  2R17 C;  4GTM A;  1OCZ E;  4NUR A;  5EN5 D;  4AJW A;  4ANX A;  4NQ0 A;  4AM9 A;  4WWP A;  4H7Y A;  2AJA A;  3K9I A;  2V5F A;  1S70 B;  5ENQ D;  4I6G A;  3U3W A;  2QZA A;  3ASF A;  4KT6 B;  2OV8 A;  3L16 A;  3W9F A;  4WNF A;  3FUF A;  2KM4 A;  4WWN A;  2Y4U A;  3AU5 A;  2DBA A;  3QB2 A;  1N4S A;  4K03 A;  4C48 B;  5JHA A;  1U3D A;  2LAH A;  1NP7 A;  4FUL A;  2L6B A;  3PDN A;  2V0P A;  3LKU A;  1UG3 A;  3IKO B;  5JA4 D;  4DI4 A;  1OY3 D;  1H2V C;  4KMO A;  1JUQ A;  3UIO C;  1HFA A;  4GAA A;  5JMN D;  3KD7 A;  3LY9 A;  1Q2Z A;  1O5M A;  4B8C B;  3LY8 A;  3EUV A;  3Q78 A;  4GA2 A;  3CHS A;  5T4Y A;  1O1T A;  1S63 A;  4HI8 A;  2R02 A;  2BKG A;  2VYI A;  1Z6T A;  4DUI A;  2IF4 A;  3QWP A;  3SFY A;  3ZGQ A;  5AJL A;  3ULY A;  1AWC B;  4U95 D;  2HO1 A;  3UX4 A;  1EF1 C;  3BQO A;  4KVM A;  3B7T A;  1SA4 A;  3PZ1 A;  3LVQ E;  4TXQ A;  1ELR A;  4BWR A;  1HXI A;  2WXP A;  5ENS D;  2X6J A;  3C98 A;  4RLY A;  3N71 A;  4HOT A;  3LVR E;  3QC1 A;  3CEQ A;  1E7U A;  2NC9 A;  1H19 A;  5LX8 A;  4L2L A;  4BX9 A;  3CIA A;  2UY1 B;  4FLB A;  5JHB A;  2R05 A;  3SD5 A;  2WXR A;  2ETC A;  1TN7 A;  2WXL A;  4EZJ A;  2KZT B;  4I1A A;  4GPM A;  2OVF A;  3QWW A;  4CYM D;  5ENR D;  2NXP A;  2Q7F A;  2R59 A;  4LNU D;  5JJ6 A;  3JCK C;  3V30 A;  2J07 A;  1IYG A;  3FUH A;  4HRN A;  3ZPJ A;  4JVS A;  4I2W A;  2XPZ A;  1TYQ G;  4PS3 A;  2KAT A;  5CRV A;  5B1B E;  2NSZ A;  4APF A;  3RIB A;  3MV2 B;  4A1S A;  5BNW A;  3IXE A;  4G25 A;  3D9L A;  3SBS A;  4DJA A;  1B89 A;  3BG1 B;  2PL2 A;  2X6I A;  5G2N A;  2FF4 A;  2QFC A;  4PUC A;  3FHE A;  3ML8 A;  4O1P A;  4GMJ A;  5D66 A;  3QKY A;  2V4L A;  3CV0 A;  3EU5 A;  3U9W A;  3BUA A;  3HXB A;  4GTV A;  4J8F A;  3IHY A;  3ASD A;  3GZS A;  3VLF A;  2WXG A;  5KNH D;  4F6R D;  5FWQ A;  4PS8 A;  1N4P A;  3D9M A;  2VSY A;  2GRL A;  1N4Q A;  5FIO A;  4YDE A;  3R9A B;  3ZYL A;  4JEH A;  2X38 A;  2I1K A;  1ZBP A;  4M7C A;  3T9K A;  2I1J A;  1JWF A;  1YYH A;  2ZU6 B;  5AYW D;  4TXR A;  3MX3 A;  4XX5 A;  2R2L A;  1TR4 A;  2DWZ A;  2QYU A;  5EIB E;  3SGH A;  3ZFW A;  4UI9 K;  4ABN A;  4F1P A;  2XGM A;  4G26 A;  4XKC A;  3SZ7 A;  4NAC A;  1K1A A;  3FTV A;  3CVX A;  1QYM A;  4WNG A;  4ATG A;  4OVU A;  1Z3Y A;  1ZB1 A;  1NI1 A;  2AXU A;  1LD7 A;  3PNL B;  1BI8 B;  2Y4T A;  4IRU A;  3O48 A;  4CDN A;  2GGF A;  2WB2 A;  1EYH A;  3L6A A;  3RRM B;  3ZXS A;  2IOS A;  2PQN A;  3G2V A;  1WM5 A;  2IQC A;  3FU5 A;  3DSU A;  3X2Q E;  4J8D A;  4GTQ A;  1MQS A;  3URZ A;  3HXE A;  3I3N A;  2KXP C;  1S0P A;  1NFI E;  3FUD A;  3EU9 A;  3QOU A;  4I9E A;  3CVQ A;  3TWT A;  4UI9 J;  1JWG A;  1W3B A;  2EIN E;  3ZXP A;  3L9T A;  3ISM C;  4RG9 A;  3CKB A;  1E8Z A;  4FHJ A;  4F7A A;  4C9B B;  2ZIS A;  3NOG D;  3FUI A;  3VLD A;  2DCP A;  4AP2 A;  2CFZ A;  2IFU A;  3HHM A;  2CHW A;  3R7R A;  1UJK A;  2ETA A;  3JUE A;  3B7B A;  3UPV A;  1IHB A;  1P5Q A;  4JHR A;  3UXG A;  1E8W A;  1MX4 A;  2GRR B;  3Q75 A;  4HOR A;  2WMN A;  3VTY A;  4ME2 A;  3Q79 A;  3HYM B;  1U2V G;  3FH8 A;  1A17 A;  3CSF A;  4I2Z A;  2WXO A;  2L0T B;  4NRH B;  3G2U A;  3PUK A;  4JB8 P;  4FU3 A;  2YHE A;  5AQB A;  3T5X A;  3UTM A;  4AIF A;  1E8Y A;  2WMO A;  2EQX A;  2H6H A;  5FJY A;  1UOH A;  4DI3 A;  2JEK A;  2AXV A;  2B6C A;  3AS4 A;  1DCE A;  2IEJ A;  5ARF A;  2R5S A;  5CCM A;  3RKV A;  3BU8 A;  3SO8 A;  4EQF A;  5JJT A;  5HQ8 A;  4CT0 A;  2DYR E;  5G05 C;  5FQ7 A;  3NBN B;  1G3N B;  5FQ6 A;  2J8S D;  1E96 B;  4JW1 A;  3KEZ A;  4HI9 A;  1OWL A;  3AG3 E;  4UWF A;  5FZS A;  5G05 J;  3CHM A;  1ZU2 A;  1MYO A;  3UKU G;  2VSO E;  3HXF A;  2RKK A;  3EHQ A;  3CQC B;  2FO7 A;  2RFA A;  4TUM A;  1OWM A;  4FJZ A;  2L0I A;  1H6O A;  3GZ2 A;  4FC8 A;  4DX6 D;  1TN8 A;  3ZHE A;  4Q96 A;  3MKQ A;  3L17 A;  4I6J A;  1OWP A;  3NQP A;  4GML A;  2IU1 A;  4H7X A;  1HZ4 A;  5BXO A;  1H2U A;  5CEC B;  4ANU A;  1E7V A;  1N11 A;  1DVP A;  3UIN C;  1FPP A;  2PM6 A;  3OXG A;  5AEN A;  3PZ3 A;  3UM2 A;  4A55 A;  2FUL A;  5KCM A;  1JCS A;  3RO2 A;  3DBS A;  3ZU7 B;  1SVX A;  4GTR A;  1OXJ A;  2CHZ A;  3JXJ A;  4CDM A;  2DYS E;  1JCQ A;  3P2B A;  2VJ8 A;  5ITZ F;  3BG0 B;  4ANV A; 
#chains in the Genus database with same CATH homology
 2WXH A;  3CHQ A;  4G11 A;  2WQ6 A;  4L2L A;  4BX9 A;  3CIA A;  3ZN3 A;  4PS7 A;  2E2E A;  3QDN A;  2VSX E;  2UY1 B;  4FLB A;  1INZ A;  5JHB A;  1HG2 A;  5LFA A;  4WNE A;  3SD5 A;  2WXR A;  4IYP A;  4UQZ A;  4E6H A;  2WVI A;  3S7J A;  4BTB A;  1H0A A;  3FTX A;  2LSU A;  2CHX A;  2WXL A;  4G24 A;  4CT4 A;  5A6C A;  3PNT B;  4EZJ A;  3D9O A;  2KZT B;  4I1A A;  5BUZ A;  3CVW A;  3OTN A;  5KJM A;  4F53 A;  2X6H A;  4FLH A;  3CHP A;  2OVF A;  3L08 A;  4B0Z A;  3VLE A;  4M3O A;  2YHC A;  2YQ8 A;  4MRU A;  3MZL B;  3ZRH A;  4F3V A;  3LDZ A;  2VSN A;  3TGO A;  3QWW A;  5CMW A;  2RD0 A;  3FTU A;  4KYO B;  4U04 A;  3CVN A;  2X3M A;  3HIZ A;  3SHF A;  2Y3A A;  2C2L A;  2NXP A;  4UWK A;  1TJC A;  2Q7F A;  2AWI A;  2R59 A;  1IQU A;  1UW4 B;  1XNF A;  2DIW A;  2XPI A;  1XGW A;  2PM7 A;  4OYS A;  4A3T A;  4ANW A;  4DLQ A;  5LP0 A;  3CVV A;  3EIJ A;  4HOU A;  3G2W A;  4XIF A;  4HFG A;  4UWG A;  3ZYM A;  5JJ6 A;  4URK A;  5FQ8 A;  3JCK C;  2KCL A;  3T8M A;  1U3C A;  3D9N A;  3FTS A;  2J07 A;  1IYG A;  3FUH A;  5M72 A;  4I43 A;  4HOQ A;  5FT9 A;  4JZY A;  3D9I A;  2LNI A;  4KVO A;  2XRY A;  4AY5 A;  2J9Q A;  5E76 A;  3PE3 A;  4JVS A;  3ZPJ A;  3HVE A;  2PZI A;  4I2W A;  4W9R A;  2XPZ A;  4GZ3 A;  4A1G A;  2XRZ A;  4J8S A;  1X5B A;  4ILG A;  3IBE A;  4MKT A;  4PS3 A;  2KAT A;  2J49 A;  4RSY A;  2VGY A;  1QQE A;  4GYW A;  2WXK A;  3D3M A;  2IOL A;  2X6K A;  4IUL A;  2I9C A;  2NSZ A;  5EKQ D;  3ZHE B;  5G04 J;  4HLE A;  5A23 A;  3ONK A;  4APF A;  1MHQ A;  4JA9 A;  4GA0 A;  2J08 A;  2UWJ G;  3RIB A;  4JA7 A;  3CK8 A;  3ZEF A;  3MV2 B;  3FDH A;  4A1S A;  1SZA A;  5BNW A;  1Y8M A;  1PAQ A;  3Q4A B;  4G25 A;  4GCO A;  3D9L A;  4GYO A;  2A5U A;  3EDT B;  3SBS A;  1FCH A;  4GZ6 A;  1TEZ A;  1L5J A;  4DJA A;  2AXZ A;  3CVY A;  2XHE A;  3PRE A;  1UN8 A;  3R7Q A;  1B89 A;  2M63 A;  3BG1 B;  4IN3 B;  3JUI A;  3FU0 A;  3S2A A;  2PL2 A;  2X6I A;  4J8E A;  5G2N A;  3FEY A;  2FF4 A;  2QFC A;  3B7R L;  2XQ0 A;  5C2Y A;  3SNX A;  1DNP A;  4GA1 A;  3CR3 A;  4YND A;  4PUC A;  3JYS A;  5J08 A;  4LRZ A;  2VGX B;  3FHE A;  4WND A;  3ML8 A;  1HE8 A;  3MEK A;  4ACL A;  4J0U A;  3FY4 A;  4GMJ A;  4RVB A;  3UMV A;  2J4D A;  4EZK A;  3QKY A;  5LOZ A;  1BPO A;  4I17 A;  3TG5 A;  3EHN A;  2HM8 A;  3OXL A;  4TRQ A;  2V4L A;  4N2Q A;  2FI7 A;  3CV0 A;  4XI9 A;  2JLB A;  4MLP A;  4C0M A;  3FH7 A;  4LUN U;  1WY6 A;  5ARG A;  4BTA A;  4JPS A;  4UWH A;  3TXM A;  3U9W A;  4DPR A;  1HU3 A;  2VQ2 A;  3CVL A;  3QNK A;  2E0I A;  3FTY A;  4K0R A;  4KBQ A;  3EJN A;  4J8F A;  4FHK A;  5E75 A;  3IHY A;  3QWV A;  3ASD A;  3GZS A;  4E85 A;  3VLF A;  2WXG A;  3KS2 A;  4QFV A;  5T3R A;  4GPK A;  1TJF A;  5FWQ A;  1SZ9 A;  4O6F A;  2BF0 X;  4PS8 A;  5CHE E;  3NZU A;  3GYZ A;  3CQG B;  5DIZ A;  3UT8 A;  5BPP A;  3AS5 A;  5D0O D;  3LYA A;  3G2S A;  3FU3 A;  3D9M A;  4B8A A;  2VSY A;  2GRL A;  2XPY A;  4I9C A;  1LF8 A;  4BY6 A;  3CK7 A;  3R9A B;  3ZYL A;  4JEH A;  4AOF A;  2OND A;  3ENE A;  4XZ4 A;  2X38 A;  3QAQ A;  2I1K A;  2WXQ A;  1ZBP A;  3FUL A;  2I1J A;  3LY7 A;  3Q47 B;  4OVV A;  3JQ1 A;  4UQX A;  1JWF A;  4R7L A;  1EPU A;  4YVO A;  2VTB B;  2ZU6 B;  2FEZ A;  4N3B A;  4AV7 A;  5AYW D;  3CVU A;  3MJW A;  5CMY A;  5ANR A;  5BW8 C;  3MX3 A;  4XX5 A;  1E90 A;  2V8S E;  3WXX A;  1NA3 A;  3PEU B;  2WXF A;  4V3I A;  4U63 A;  3UT7 A;  4B89 A;  1HO8 A;  5A7D B;  4TUU A;  3SGH A;  3ZFW A;  4B94 A;  3LXU X;  5HI7 A;  5LCW J;  4KZ0 A;  3P1U A;  4UI9 K;  4ABN A;  3AS8 A;  3SF4 A;  4N5C A;  1OUV A;  2WXJ A;  3G2T A;  3L13 A;  2XGM A;  4G26 A;  4XKC A;  4WWO A;  2CFU A;  4NAC A;  4I1M A;  4WAF A;  3SI5 A;  3SZ7 A;  2WXM A;  4Y6W A;  2YIN A;  3ULQ A;  4N39 A;  3PRZ A;  4LEU A;  3FTV A;  3RRU A;  3FU6 A;  3FUM A;  3CVX A;  4WNG A;  1UJJ A;  5G55 A;  4ATG A;  5FTP A;  4U07 A;  2KC7 A;  4N2S A;  4OVU A;  1Z3Y A;  3RRN B;  3MGB A;  3TAX A;  3MCX A;  2AXU A;  4UI9 C;  3PH0 C;  4RG6 A;  3PNL B;  3APF A;  3QJZ A;  3DPD A;  2Y4T A;  4IRU A;  2VTB A;  3O48 A;  4CDN A;  2GGF A;  2WB2 A;  5DBK A;  1EYH A;  3L6A A;  3RRM B;  2A4Z A;  4WUY A;  3D9J A;  2IOS A;  2PQN A;  3ZXS A;  3G2V A;  3RU0 A;  4APO A;  4HOS A;  3QK0 A;  4L23 A;  3FUN A;  4GYY A;  1WM5 A;  2IQC A;  1PY1 A;  3FU5 A;  3I5P A;  3IEG A;  3U4T A;  2J4B A;  2KZT A;  3CLJ A;  5AJD A;  4DLO A;  4HS2 A;  3NF1 A;  3MKR A;  4J8D A;  4ILI A;  4FAD A;  1MQS A;  3URZ A;  4EBA A;  3T5V A;  2IJG X;  3I3N A;  1H6K A;  1HH8 A;  4CCA A;  3VTX A;  4Y6C A;  3IV0 A;  1S0P A;  3FTW A;  1PC2 A;  4L7T A;  5FZR A;  4N3A A;  2UY1 A;  2MRI A;  4HXI A;  2I6H A;  2LSV A;  3Q5M A;  3RJV A;  4KZC A;  4LCT A;  4GB9 A;  4I6E A;  4Q69 A;  3U64 A;  1HX8 A;  3FUD A;  3B7U X;  4UWL A;  3APC A;  2J09 A;  4N3C A;  2XEV A;  4JHK A;  3QOU A;  4I9E A;  3CVQ A;  2WXN A;  3CKC A;  4J6I A;  2XCB A;  5ENN A;  1Y6I A;  4ACK A;  2WQ7 A;  4MS6 A;  4UI9 J;  3PUJ A;  4AXH A;  1JWG A;  1OWO A;  3FTZ A;  3LCA A;  4CEM A;  3U66 A;  1W3B A;  1KT1 A;  2RG8 A;  5BV0 A;  2MHK A;  4GZ5 A;  3B13 A;  4BFR A;  4FJY A;  1N52 A;  5D0Q D;  3LEW A;  4DK5 A;  4RG9 A;  3CKB A;  1E8Z A;  4FHJ A;  5CCL A;  4L1B A;  4F7A A;  3SBT B;  5EX0 A;  1HG5 A;  4C9B B;  3JQ0 A;  3FUJ A;  3FUI A;  2CG3 A;  3PE4 A;  4KXK B;  4YVQ C;  2DCP A;  3VLD A;  4AP2 A;  5LCW C;  1EDU A;  2CFZ A;  2IFU A;  2WQH A;  2CHW A;  3HHM A;  1E8X A;  4FP7 A;  1N54 A;  3S7B A;  3ZYQ A;  2I2O A;  3I4R B;  4EEC A;  3R7R A;  3ASH A;  3ESK A;  1UJK A;  4EPZ A;  4GZD A;  3CHO A;  2BUG A;  2ILR A;  5KJL A;  1WAO 1;  2GW1 A;  4XI0 A;  3GZ1 A;  4L2Y A;  3UPV A;  2WM9 A;  3HDX A;  1FVH A;  5BV1 A;  1ELK A;  1SQM A;  1IHG A;  1P5Q A;  4JHR A;  4U8H A;  1E8W A;  4JC8 A;  4JEU A;  3CGH A;  5C1D A;  1HS6 A;  2YNQ A;  2OOE A;  3FH5 A;  1FVF A;  3D9P A;  3ONL A;  4TV3 A;  4LER A;  4AEZ C;  2GRM A;  4P29 A;  4HOR A;  2AVP A;  2WMN A;  3VTY A;  4ME2 A;  3FP3 A;  3HYM B;  2KCK A;  3MKQ B;  3SFZ A;  4U0Z A;  3FH8 A;  1A17 A;  2P58 C;  3CSF A;  4I2Z A;  2WXO A;  2L0T B;  2L9B A;  3HVE B;  3MV3 B;  4NRH B;  1GW6 A;  3LPZ A;  3G2U A;  3APD A;  3PUK A;  3FFL A;  4PH4 B;  5KJK A;  2R17 C;  1OWN A;  5FQ4 A;  3Q49 B;  1VDY A;  4FU3 A;  4NUR A;  1JPL A;  2QY7 A;  1KT0 A;  1QZ2 A;  2YHE A;  3CK9 A;  2KCV A;  4AJW A;  4ANX A;  3T5X A;  4JXT A;  4NQ0 A;  4AIF A;  3BEE A;  1HF8 A;  3FWV A;  3L54 A;  4AM9 A;  3Q15 A;  4I1O B;  4GCN A;  4WWP A;  4H7Y A;  3O4Z A;  4GZC A;  1E8Y A;  4C0E A;  1UN9 A;  2XGS A;  2WMO A;  2EQX A;  3K9I A;  2V5F A;  5KJN A;  2HYZ A;  2L6J A;  4I6G A;  4F1S A;  2XCC A;  3U3W A;  3ASF A;  3L22 A;  1NA0 A;  4KT6 B;  3D9K A;  3RK6 A;  2OVB A;  3ML9 A;  5FJY A;  2OV8 A;  2CG2 A;  4DI3 A;  5ANL A;  2JEK A;  2AXV A;  3ESL A;  3L16 A;  5BT1 A;  4EBA G;  4JL0 A;  4WNF A;  3AS4 A;  3FUF A;  4UQY A;  3PZD A;  5ARF A;  2KM4 A;  2R5S A;  3PS6 A;  5CCM A;  3RKV A;  4WWN A;  5T8I A;  2WPV A;  2MOW A;  3TL5 A;  2Y4U A;  4EQF A;  4HVB A;  2WXI A;  5HQ8 A;  5JJT A;  3I4G A;  2LO6 A;  3AU5 A;  4CT0 A;  4D10 C;  2DBA A;  3ASG A;  3QB2 A;  5G05 C;  5FQ7 A;  4BT8 A;  5FQ6 A;  2VGX A;  4K03 A;  1E96 B;  4JW1 A;  3KEZ A;  3OXF A;  3LJ3 A;  1OWL A;  4UWF A;  1Z3X A;  5FZS A;  5G05 J;  3CHM A;  4ILH B;  5JHA A;  1U3D A;  2LAH A;  1NP7 A;  4GU5 A;  5G04 C;  3E4B A;  4FUL A;  5JJ7 A;  1ZU2 A;  3TJP A;  1QNF A;  3PDN A;  2C0M A;  2V0P A;  2PQR A;  2VSO E;  3LKU A;  4G1T A;  5EDS A;  5J90 A;  1YA0 A;  3CQC B;  4A3V A;  1UG3 A;  2FO7 A;  3IKO B;  5EX3 A;  1NZN A;  2ION A;  3UQ3 A;  4DI4 A;  1H2V C;  3S7F A;  3QAR A;  3ZIM A;  2XGO A;  4KMO A;  1OWM A;  4FJZ A;  1JUQ A;  4XE0 A;  3ZVV A;  2L0I A;  3ZYK A;  3CHR A;  1ELW A;  3OAW A;  1HFA A;  4GAA A;  3KD7 A;  3B7S A;  3LY9 A;  3GZ2 A;  2C0L A;  4FC8 A;  4B8C B;  2FBN A;  4JHJ A;  3LY8 A;  2AW6 A;  4GA2 A;  3CHS A;  5T4Y A;  1IQR A;  3ZHE A;  4G2V A;  4Q96 A;  3CST A;  3EIQ C;  4FA6 A;  3RO3 A;  3FEX A;  3UT4 A;  2VYI A;  3MKQ A;  1Z6T A;  3TG4 A;  3L17 A;  4Q94 A;  4XKB A;  4I6J A;  1OWP A;  3NQP A;  2IF4 A;  3NZS A;  2IU1 A;  3QWP A;  4GML A;  4H7X A;  3UUX A;  3MA5 A;  3AU4 A;  3FUK A;  4BX8 A;  1HZ4 A;  4U0S A;  4PDX A;  3ZGQ A;  2HR2 A;  3S7D A;  4AVX A;  4EZL A;  1H2U A;  4ANU A;  3CVP A;  2BTD A;  5AJL A;  4AY6 A;  1E7V A;  2HO1 A;  1DVP A;  4U0U A;  2PM6 A;  3UX4 A;  1EF1 C;  3OXG A;  3GW4 A;  1H2T C;  4KVM A;  3B7T A;  5AEN A;  3KAE A;  1KLX A;  3LVQ E;  5FZQ A;  2X6F A;  4A55 A;  3EHM A;  3FUE A;  4BT9 A;  2FUL A;  1ELR A;  2LAI A;  4BWR A;  4BSX A;  1HXI A;  5KCM A;  4CGV A;  2WXP A;  3RO2 A;  2X6J A;  3C98 A;  3DBS A;  4G23 A;  3PEV B;  3N71 A;  4HOT A;  3LS8 A;  3LVR E;  3TXN A;  3IHV A;  3PVL A;  4CRW A;  2CHZ A;  3QC1 A;  4CDM A;  3MYV A;  3ZW3 A;  3P2B A;  3CEQ A;  2VJ8 A;  4CDR A;  1E7U A;  2NC9 A;  4CGW A;  3BG0 B;  1H19 A;  5LX8 A;  4ANV A;  5AIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...