1SZ9A

The rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
143
structure length
143
Chain Sequence
DHDTEVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQKLYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGLPLFEGSALEKIEQFLIKASAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Recognition of RNA polymerase II carboxy-terminal domain by 3'-RNA-processing factors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords PCF11 protein
total genus 55
structure length 143
sequence length 143
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1sz9A00
4GZCA 2DIWA 2V8SE 3D9PA 3G2SA 1ELKA 4JXTA 1UJKA 3G2UA 2L0IA 3D9KA 3G2VA 1UJJA 5CMWA 1DVPA 1HFAA 1EYHA 3D9MA 1JUQA 4Q94A 2MOWA 3ZYQA 1HG2A 3ONLA 1INZA 1PY1A 4HFGA 5LOZA 3D9IA 3ZYLA 4FU3A 3RRUA 4AVXA 4Q96A 1HX8A 1MHQA 2L0TB 1JWGA 3LDZA 3G2WA 3ONKA 4FLBA 5LP0A 2BF0X 4GZDA 1SZ9A 5J08A 1JPLA 3ZYKA 3G2TA 1HF8A 1EDUA 4NACA 3CLJA 1HG5A 1X5BA 2LO6A 3ZYMA 3D9JA 1XGWA 3D9OA 3D9LA 2KM4A 3D9NA 2QY7A 1JWFA 1LF8A 2DCPA 5CMYA 1SZAA 1H0AA 1VDYA
chains in the Genus database with same CATH superfamily
3UM0A 3S7FA 4GZCA 3G2SA 2ONDA 4L2LA 1E96B 1TJFA 5J90A 1TJCA 4UQXA 2RKKA 3ZIMA 5BUZA 2ZGDA 1S63A 1JCQA 5FJYA 3HXDA 3PVLA 4HOTA 2WXOA 4BESA 3ENEA 3SO8A 2WXQA 1OCOE 1OCZE 3NZUA 4BX9A 3MYVA 2LUHA 1SW6A 1OWLA 4KZ0A 1NZNA 3E33A 4UWGA 2KZTA 3EHRA 4G8LA 3MZLB 4GTVA 4H7XA 1ZB1A 3D9OA 2HYZA 4HRLA 3CKBA 2XS8A 4XIFA 3OAWA 4BTBA 3C98A 1MX2A 3PZ1A 2PZIA 3ML9A 1N94A 3CVVA 4GA0A 3L13A 1SA4A 2KBXA 4BEPA 2F37A 4BTAA 1JCRA 4DI3A 5FQ6A 2Y3AA 3ABME 3UI2A 1AP7A 4O60A 1OY3D 4Z68A 3OTNA 3RRUA 4M3OA 2PQRA 3Q49B 2WQ7A 2CG3A 5KNHD 5FQ7A 2WXLA 1MJ0A 1FT2A 3DRAA 3LJNA 2GW1A 2GRQB 3SHFA 2J8SD 1IQRA 4XX5A 3V30A 2IF4A 2HO1A 3SZ7A 4BETA 4FULA 4V3IA 4EHMA 3C3QA 4HRNA 1IQUA 2P9LG 3MKRA 3EU5A 3LXUX 3MKQB 2ZU6B 4FLBA 3SI5A 1SZ9A 3HXBA 4N5QA 4XZ4A 2LSUA 2J9QA 5ENQD 3D9NA 5AJDA 4EZLA 2PM7A 1UJKA 2WXHA 3I4RB 1W3BA 2WB2A 4IYPA 3LVQE 3VLDA 1MHQA 3LJ3A 1TEZA 2IONA 2KCKA 2CFUA 4U0SA 3AG3E 3TWRA 1OWMA 4HXIA 3FTSA 3URZA 3SFYA 2J49A 3CVUA 3PREA 4Y6CA 2WXJA 4PS3A 4LCTA 5CRVA 2E0IA 4NACA 3UT4A 2YINA 1XGWA 4BY6A 4BSXA 3GYZA 4JHKA 3E4BA 3O48A 4FJZA 1HXIA 3OXFA 1N4SA 4L23A 2Y69E 4MLPA 3PDNA 5CCLA 1KT1A 3IBEA 1DCEA 2I1KA 4LNUD 5JHAA 4O1OA 1IHGA 3QWWA 2OEVA 1U2VG 3MX3A 3G2UA 1OCRE 4DI4A 3DEPA 4N39A 1INZA 2WM9A 3FU0A 1N54A 4N3CA 3U9WA 3Q5MA 2P9PG 4KYOB 4GCNA 1HO8A 3PNLB 3FY4A 3V79K 2XZTG 3ZW3A 1IKND 3AU5A 3Q78A 4KZCA 2VGXB 3CHMA 3MJWA 5AN8A 3UKUG 3KEAA 4G23A 2X6FA 4ME2A 3LPZA 1MX6A 3V31A 3UM3A 2OEWA 1SZAA 3FU5A 2V4HC 1S70B 3TJPA 2XGOA 3SGHA 4N2SA 3ASOE 4U63A 3FTVA 1PY1A 4G25A 1PC2A 4XI9A 4GTOA 4Q96A 1YA0A 1ELRA 4W9RA 1FCHA 3KS2A 4EZKA 3PZ2A 2Y1LE 1KZPA 4GB9A 3FUIA 4JZYA 4AEZC 3PRZA 4ACLA 5A7DB 4FHJA 2JEKA 2BEDA 4BSZB 1BU9A 2F8XK 3C5RA 5ANLA 2ETCA 4E85A 5AYWD 3DSSA 4P29A 1N0QA 1OUVA 3FUJA 4AV7A 2OVBA 3LY7A 5BXUA 3Q9UC 4KXKB 4LUNU 4HQDA 4WNGA 4WWNA 4XI0A 2XS1A 4EECA 3TWVA 2FBNA 4YVQC 1N52A 2ILRA 3FUKA 3IXEA 3UIPC 1QBQA 4CGWA 3EHQA 1S0PA 4NURA 2L6JA 3B7TA 3FH5A 3QAQA 3CVPA 4RG9A 2VSXE 1TNYA 1DCQA 4UI9K 3RO3A 5G2NA 5HQ8A 4U04A 4UWKA 4APFA 2IO3C 2AXZA 3B13A 4MKTA 2VGEA 4C48B 1ELKA 1TN6A 4WNFA 1H6KA 2L6BA 1HG2A 2NXPA 5KJLA 2WXIA 2WPVA 2WXRA 3SFZA 3VLEA 2E2EA 1H2VC 1UN9A 3LCAA 2AVPA 4GZDA 5BXOA 4ILHB 3HRAA 4I1AA 4BERA 3KEZA 5EDSA 4I2WA 5BV1A 3T9KA 3ZYLA 4LNGA 3IV0A 4X8QA 4F1SA 4HNAD 3L54A 3FTZA 4FU3A 2P9KG 3QOUA 3CVXA 3TGOA 5JJ7A 5JHBA 5LFAA 4WWOA 4TXQA 3MV2B 4YNDA 3SBTB 3CSTA 2V5FA 3CK9A 2VJ8A 1O5MA 2R59A 2RFAA 5LCWC 4J0UA 3CSFA 5CBOA 2XENA 4TXPA 4L7TA 2EIKE 3Q79A 4RVBA 4RLYA 2LXMA 1WAO1 4QFVA 3X2QE 5T3RA 1BLXB 5AJLA 4CT4A 4B89A 1LF8A 1KZOA 4FHKA 4I2ZA 1YMPA 3T5XA 1Y6IA 4DJAA 3ASHA 3FH7A 4OVUA 2X3MA 4JHRA 3GZ2A 4OYSA 5FIOA 1TN8A 3I3NA 4U8HA 4UQYA 4KMOA 2OCCE 3RU0A 3Q15A 3DSUA 4I9CA 3DPYA 3UIOC 1OT8A 3UX4A 4HOQA 2IO2C 3QKYA 3APDA 2OVFA 2LO6A 3V2OA 4GTTA 5CEDB 3FUEA 2V0PA 3HXFA 4JA7A 3PEVB 1H2UA 3TWWA 2XEEA 1MQSA 5KJMA 1FVHA 2PQNA 4GU5A 3GZ1A 3SBSA 4UWHA 1QQEA 1SA5A 4K5AB 3RSEG 3UMVA 2Q7FA 1NI1A 4IRUA 2WXPA 3NF1A 3VLFA 4A3VA 5CERB 4J6IA 2A4ZA 1WDYA 4JC8A 2MOWA 3AS5A 1WY6A 4J8SA 1MYOA 3UXGA 4JHJA 2YQ8A 1EF1C 2IFUA 4K5CA 4DLOA 3Q47B 4ABNA 5LCWJ 1RW2A 4Y6WA 2XGMA 3JXIA 5G55A 4F7AA 4AY6A 3RJVA 2J07A 2DYRE 3FDHA 1N4RA 2CHWA 2C0LA 3EHNA 3DXKG 5EIDA 2DIWA 5T4YA 3UT8A 2IOLA 1HFAA 4ANXA 3Q73A 4HS2A 3TWUA 4GTQA 3NB2A 2WQ6A 1ZBPA 2CHZA 4HLLA 3ASDA 5E76A 4BX8A 3MGBA 2X6KA 4APOA 4TUUA 1H19A 4JA9A 1YYHA 2YHEA 3TL5A 3ML8A 4WNEA 3SNXA 4U7EB 4GYYA 5HI7A 3ZHEB 5EX3A 1O1TA 2XPYA 2C2LA 5FZQA 4U0ZA 3ZXSA 4XKBA 5HRYA 2AWIA 3ABLE 4AY5A 3ZU7B 3ESKA 4D10C 2V4LA 4A1GA 4NIKA 3CHQA 3FHEA 3D9MA 5AQ7A 2VTBB 1D8EA 2ZXWE 3MCXA 4G11A 4AVXA 3Q75A 2XRYA 4U0UA 3FEXA 2GROB 4GMRA 1JPLA 5H7PA 3C3RA 4EBAA 2XRZA 2DWZA 3RKVA 4HI8A 3PS6A 3B7RL 1LD8A 3D3MA 5IY5E 3KSQA 3ONKA 1RZ4A 3NQPA 3I4GA 4GZ3A 4HI9A 5ARFA 3EHMA 2J08A 3AG1E 5EYLA 3PUKA 2DBAA 4U95D 4GYWA 2DYSE 2PL2A 4RSYA 3OXGA 4HORA 2R2LA 4JW1A 3BG0B 5HS0A 3S7DA 1OWNA 5FTPA 3HIZA 5FQ8A 4GMJA 2AJAA 2BUGA 3G2WA 2JABA 3NAWA 5CRUA 4GZ5A 4CCAA 3J5PA 2KM4A 4I6GA 2DVWA 2RG8A 2Y0BG 4HLEA 1D8DA 3FTUA 4UUCA 3FTXA 4Q69A 2H6FA 4DX6D 3FWVA 3C3OA 3U3WA 2LAIA 3R7QA 1H0AA 4K5BA 3EJNA 3QNKA 2WXFA 2WMOA 4U07A 1TN7A 1QYMA 3NBNB 3AG2E 3E37A 4GMLA 2P2CP 1OWPA 4PH4B 1DNPA 1K3ZD 3JUIA 2FI7A 5B1AE 1UN8A 5FZSA 4TXRA 3E32A 2KATA 4ANVA 3OXLA 4TUMA 3RAUA 2QY7A 3ZFWA 1OCCE 4AIFA 3ZVVA 3SQVA 5ENOD 5HKPA 3JYSA 1V54E 3HYMB 4LSZE 2KC7A 2KCLA 2PM6A 1Y8MA 3QB2A 1E8XA 3GZSA 2GRPB 4OVVA 2QYUA 4CGVA 2UY1B 1E7UA 3CVYA 4A55A 2R02A 4H7YA 2NYJA 4YVOA 2R17C 3DXMG 3FUDA 2A5EA 5KJKA 3ULYA 4I9EA 2VTBA 3DSVA 5JJ6A 2LXLA 2L9BA 1LD7A 3CHRA 3U64A 5CEAA 1TNBA 4FA6A 3B7UX 3QDNA 2WQHA 4DPRA 5DBKA 1TYQG 2I9CA 4A1SA 2R5SA 3DSTA 3EUVA 3UKRG 4L1BA 4AM9A 5G04C 5ENNA 4XE0A 2P9SG 3PEUB 4XEIG 3DPDA 2X6IA 4IN3B 2DZOA 3MA5A 4I6JA 4UWLA 3AS4A 4U8VD 1A17A 4J8EA 4LNBA 2XCBA 3CR3A 3DSWA 3SY2A 1MZCA 4YDYA 1N4QA 2XEHA 4GTSA 3ZPJA 3CEQA 5FINA 3CHOA 3FFLA 1NP7A 4G1TA 2L0TB 3EU9A 5G04J 4R7LA 4N2QA 3L08A 4URKA 1EDUA 1Z3XA 4AJWA 2JLBA 4F3VA 4FP7A 2OV8A 4L2YA 3ABKE 3FH8A 3L9TA 3PUJA 3AG4E 4HB5A 1FVFA 1E7VA 3ESLA 3CHSA 2UWJG 4N3BA 3CQGB 5T8IA 4UWFA 4C0MA 2I1JA 4DLQA 4WAFA 2LAHA 3NOGD 2BKKB 2B0OE 2J09A 4JB8P 3LEWA 4DX1A 2V8SE 1UJJA 3FULA 3TXNA 2VSNA 4KBQA 3P2BA 4LRZA 3TWQA 3FUMA 5JJTA 3CVLA 2H6HA 2VSYA 4HBDA 3E34A 3ISMC 4B8AA 1L5JA 3F6QA 3D9PA 1G3NB 4ZFHA 2QFCA 4LG6A 3PNTB 2AW6A 1H2TC 5AARA 3EDTB 3DSXA 4A3TA 2XEVA 3TG5A 2F0YA 2VQ2A 4CRWA 2X6HA 3APCA 4ZHBA 2BKGA 2FO7A 3UINC 5G05C 3T5VA 2BTDA 1E8WA 4M7CA 5LX8A 1QZ2A 5BV0A 5BT1A 5KWDA 4WWPA 2AXVA 2XPZA 4HOUA 3ZRHA 4HOSA 3QARA 1K1BA 3CK7A 5ENRD 3UPVA 4EPZA 1O1SA 4UI9C 2P58C 3L16A 2ETAA 3MEKA 3SF4A 4HFGA 4ANWA 3QJZA 3EIJA 3UTMA 2Y4UA 4DX5D 2FF4A 4BWRA 2ZISA 4J8YA 4GCOA 2OOEA 1S64A 2GRMA 4DUIA 4G8KA 3L6AA 3NOCD 4J8FA 4OAUC 5A23A 2P9NG 3RRNB 1TNUA 5JMND 4YDEA 5B3SE 2RD0A 2YHCA 3CIAA 3R7RA 3ULEG 3NZSA 2WVIA 1TNOA 2FEZA 4DK5A 2R03A 4U8YD 3C72A 2XCCA 3L82A 4FADA 5ANRA 2B6CA 2ZIRA 4AP2A 5CECB 5ENPD 1BD8A 1HZ4A 3QC1A 1FT1A 3JQ1A 3T8KA 3ASGA 3HVEA 4EZJA 3TG4A 4L9PA 4NQ0A 5AQAA 4F6RD 3U4TA 3ZYQA 4UI9J 3ZN3A 3E30A 3FUHA 3FP3A 5D0QD 1O1RA 5BPPA 4CZ2D 4EBAG 4UQZA 4CDMA 3O4ZA 3D9JA 5CHEE 4I1OB 3K9IA 4DX7D 3LKUA 3S2AA 1YCSB 3ONLA 3CQCB 5C2YA 2IY0C 3R9AB 4I1MA 3BU8A 4I6EA 1E90A 3TWSA 1V55E 4K0RA 2A5UA 4MRUA 3VTYA 1ELWA 3UQ3A 4Q94A 4CYMD 4AXHA 4GTRA 4PS7A 3AS8A 2X38A 2IJGX 1HF8A 3WXXA 3B7BA 3JUEA 3AU4A 5FT9A 4TV3A 1PAQA 5ENSD 4DX2A 5AIJA 2IOSA 4QQIA 3QWVA 3ZGQA 2FULA 1Z5SC 3JCKC 4C9BB 3ZHEA 4G26A 3L22A 1HG5A 1HH8A 2XGSA 2EIJE 2H6GA 2XQ0A 3PE3A 2I2OA 2XHEA 4MS6A 1Z6TA 3JQ0A 4FJYA 2CHXA 3MKQA 4ANUA 4CT0A 3B7SA 1Q2ZA 4TRQA 3UM1A 4KVOA 5JA4D 2X6JA 5CMWA 4WUYA 2WXNA 3LY9A 2VSOE 4LERA 3FU3A 3IKOB 5FQ4A 2IQCA 4JVSA 1AWCB 3RK6A 3TXMA 3Q9NC 3G2TA 3AJIA 3TWXA 4HRMB 4KT6B 1A5EA 3D9HA 5LOZA 1X81A 3BG1B 3G2VA 1IHBA 3N71A 3ZXPA 4CDNA 1UW4B 4GTMA 2HM8A 2P9IG 3CGHA 3FTYA 4FLHA 4XKCA 4KVMA 2BF0X 2PNNA 1LTXA 2EIME 2P9UG 3CHPA 4BFRA 1IYGA 3HXCA 4GA1A 3Q4AB 1JWFA 4JPSA 3CV0A 1DVPA 4NRHB 3AAAC 4G24A 4GA2A 4ATZD 3L17A 3DBSA 4RQIA 4I17A 3UM2A 5EYPF 3PZ3A 3KAEA 3MV3B 4ATGA 1FPPA 4JXTA 2CG2A 4U96D 3RIBA 4O1PA 3IEGA 3BEEA 1U3CA 4IULA 2FO1E 1X5BA 2LSVA 2R05A 3QWPA 5FZRA 2VGXA 1N95A 3CVWA 2WXMA 3ASFA 3D9IA 3PE4A 5G05J 1SQMA 1BPOA 3Q7AA 3ULQA 2J4BA 2MYOA 1N4PA 4CDRA 5D0OD 1E8YA 1MX4A 4ILGA 5D66A 3FTWA 3BUAA 1N0RA 4OAVB 3V2XA 2H6IA 3HDXA 4E6HA 5E75A 3CVQA 4GZ6A 3CLJA 1TR4A 3HG0D 3D9LA 4JD2G 3LY8A 1VDYA 2UY1A 1Z3YA 2IU1A 3DWLG 1UOHA 2WXGA 2KZTB 3LDZA 4RG6A 2RFMA 3IHVA 4DRXE 1N9AA 3APFA 3ZYMA 3P1UA 1K8KG 3T8MA 1OXJA 2L0IA 4GPMA 5BW8C 1K1AA 2IEJA 4AOFA 1HX8A 1BI8B 1KT0A 5EKQD 1NA3A 5D2MC 1HE8A 1NA0A 2V5QC 5KBAA 3BQOA 1H6OA 1TNZA 2NC9A 4G2VA 4WNDA 2WXKA 1DC2A 2M63A 3KSLA 3RRMB 4J7WA 3WG7E 1WM5A 2QZAA 1N11A 3S7JA 1JCSA 4JL0A 2VGYA 3U66A 5EIBE 2GRRB 4YDWA 5AQ9A 4BT8A 2WMNA 2MHKA 5EILA 4YDOA 2QYJA 5B1BE 2GRNB 3UUXA 2C0MA 4B93B 4N3AA 2KXPC 3W9FA 1OWOA 4FC8A 1GW6A 3FEYA 2YNQA 3HXEA 4GTPA 4PUCA 3J5QB 4N5CA 2EILE 2Y4TA 3LYAA 4ILIA 5CBNA 3SD5A 3DEOA 3S7BA 2ETBA 4O6FA 4B0ZA 1H6PA 2XZDG 5FWQA 5KCMA 5C1DA 3LS8A 1UG3A 2DZNA 4EQFA 3ZNGA 4HVBA 2LNIA 5ARGA 5EX0A 1JWGA 1IXVA 4GYOA 2HR2A 3ZUVB 5J08A 2EINE 4I43A 4MBGA 5KNGA 3RO2A 2DCPA 4A63B 5CCMA 4GPKA 2KCVA 2F8YA 2GGFA 5DIZA 4B8CB 3IHYA 3TWTA 1B89A 2NSZA 2XPIA 5AQBA 3R9MA 5ENTD 1D9SA 1E8ZA 4CEMA 2QC9A 5EN5D 3CVNA 3TAXA 1SVXA 5M72A 5CMYA 3ZYKA 5KJNA 3D9KA 1JUQA 3EIQC 1HS6A 3VTXA 4F1PA 3FU6A 3W9GA 3KD7A 4PS8A 1HU3A 2GRLA 1U3DA 4LEUA 1BI7B 1EPUA 1NFIE 3I5PA 2HE0A 1ZU2A 2I6HA 5A6CA 3PH0C 3GW4A 4J8DA 2MRIA 3HHMA 1KLXA 1P5QA 1KPSB 3B95A 3Q7FA 1WG0A 5BNWA 3CK8A 3ZEFA 3HVEB 4B94A 2AXUA 4K03A 5ITZF 3PZ4A 1NL4A 4PDXA 3JXJA 3ASNE 4C0EA 3QK0A 4JEHA 3FUFA 3ZKJA 4JEUA 3PZDA 4ACKA 3SFXA 1XNFA 2VYIA 4BT9A 2CFZA 3CKCA 1EYHA 4F53A 2EQXA 3UT7A 2ZGGA 2J4DA 5LP0A 3LVRE 1QNFA 3FUNA 5AAOA 5AENA 4GAAA
chains in the Genus database with same CATH topology
4YVOA 2R17C 3FUDA 4GZCA 3G2SA 3S7FA 2ONDA 3IV0A 3BG1B 4L2LA 4F1SA 5KJKA 3G2VA 3L54A 1E96B 4I9EA 1TJFA 3FTZA 3N71A 2VTBA 5JJ6A 4CDNA 5J90A 1UW4B 1TJCA 2L9BA 3CHRA 2HM8A 4FU3A 4UQXA 3U64A 3CGHA 3FTYA 3QOUA 4FLHA 3ZIMA 4FA6A 3TGOA 3CVXA 5BUZA 5JJ7A 4XKCA 5JHBA 3B7UX 4KVMA 5LFAA 2BF0X 5FJYA 3PVLA 4WWOA 4BFRA 3CHPA 4HOTA 3QDNA 1IYGA 2WXOA 3MV2B 4GA1A 2WQHA 4YNDA 3ENEA 3SBTB 3CSTA 4DPRA 2V5FA 5DBKA 3CK9A 3Q4AB 1JWFA 2I9CA 2VJ8A 4JPSA 2R59A 2WXQA 5LCWC 3CV0A 4A1SA 4J0UA 3CSFA 1DVPA 2R5SA 4NRHB 3NZUA 4L7TA 4L1BA 4BX9A 3MYVA 4AM9A 5G04C 4RVBA 4G24A 5ENNA 4XE0A 1OWLA 4GA2A 1WAO1 3PEUB 4KZ0A 3L17A 1NZNA 4QFVA 3DPDA 2KZTA 4UWGA 5T3RA 3MZLB 2X6IA 3DBSA 5AJLA 4IN3B 3MA5A 4I17A 4I6JA 3AS4A 4UWLA 4H7XA 1A17A 3D9OA 4CT4A 4J8EA 2HYZA 4B89A 1LF8A 2XCBA 3CR3A 3KAEA 3MV3B 4FHKA 4ATGA 3CKBA 4I2ZA 4XIFA 4JXTA 3T5XA 1Y6IA 3OAWA 2CG2A 4DJAA 3ZPJA 4BTBA 3ASHA 3CEQA 3FH7A 3C98A 4OVUA 2X3MA 3RIBA 3CHOA 2PZIA 4JHRA 3GZ2A 4OYSA 3IEGA 3FFLA 1NP7A 3ML9A 4G1TA 2L0TB 5G04J 4R7LA 3BEEA 4N2QA 3L08A 1U3CA 3CVVA 3I3NA 4GA0A 3L13A 4IULA 4URKA 1EDUA 1X5BA 4U8HA 1Z3XA 4AJWA 2JLBA 4BTAA 4F3VA 4DI3A 2LSVA 4FP7A 4UQYA 5FQ6A 4KMOA 2Y3AA 3QWPA 2OV8A 4L2YA 5FZRA 3PUJA 3FH8A 3RU0A 1FVFA 3Q15A 2VGXA 1E7VA 3ESLA 3CVWA 3CHSA 4I9CA 2WXMA 2UWJG 3D9IA 3ASFA 4N3BA 3OTNA 3CQGB 5T8IA 3RRUA 4M3OA 3PE4A 4UWFA 5G05J 4C0MA 2I1JA 1SQMA 2PQRA 3Q49B 3UX4A 4HOQA 1BPOA 4DLQA 2WQ7A 4WAFA 2CG3A 2LAHA 3QKYA 3APDA 3ULQA 2J4BA 5FQ7A 2OVFA 2WXLA 2LO6A 4BT9A 2J09A 4CDRA 3LEWA 5D0OD 3FUEA 2V0PA 1E8YA 4ILGA 2V8SE 2GW1A 4JA7A 1UJJA 3FULA 3PEVB 1H2UA 3SHFA 3TXNA 2VSNA 1MQSA 3FTWA 5KJMA 4KBQA 1IQRA 4XX5A 1FVHA 3P2BA 4LRZA 2IF4A 2PQNA 4GU5A 3HDXA 3FUMA 4E6HA 2HO1A 3GZ1A 3SBSA 3SZ7A 5JJTA 5E75A 3CVQA 3CVLA 4UWHA 4FULA 2VSYA 1QQEA 4V3IA 4GZ6A 3CLJA 3UMVA 1IQUA 2Q7FA 3D9LA 4B8AA 3LY8A 4IRUA 1L5JA 1VDYA 2WXPA 4A3TA 3MKRA 3NF1A 3VLFA 3D9PA 4A3VA 2UY1A 4J6IA 2A4ZA 1Z3YA 2IU1A 4JC8A 2QFCA 2MOWA 3PNTB 2AW6A 3AS5A 1H2TC 1WY6A 3LXUX 4J8SA 4WUYA 2WXGA 3MKQB 2KZTB 3EDTB 2ZU6B 3LDZA 4FLBA 3IHVA 4JHJA 2YQ8A 2XEVA 4RG6A 1EF1C 3SI5A 1SZ9A 3TG5A 2IFUA 4DLOA 3APFA 2VQ2A 3Q47B 3ZYMA 4ABNA 4XZ4A 2LSUA 2X6HA 4CRWA 2J9QA 3APCA 3D9NA 3P1UA 5AJDA 3T8MA 5LCWJ 2FO7A 4EZLA 2PM7A 4Y6WA 1UJKA 5G05C 2WXHA 2L0IA 2XGMA 3T5VA 2BTDA 1E8WA 5BW8C 5LX8A 1QZ2A 3I4RB 1W3BA 2WB2A 5BV0A 4IYPA 3LVQE 5G55A 4F7AA 4AY6A 3RJVA 2J07A 3VLDA 5BT1A 4AOFA 1HX8A 1MHQA 3LJ3A 1KT0A 5EKQD 3FDHA 1NA3A 2IONA 4WWPA 1TEZA 2KCKA 2AXVA 2CFUA 2XPZA 4U0SA 4HOUA 3ZRHA 4HOSA 3QARA 2CHWA 1HE8A 1NA0A 3CK7A 1OWMA 4HXIA 3UPVA 3FTSA 2C0LA 3URZA 4EPZA 3EHNA 2J49A 4UI9C 2DIWA 2P58C 3L16A 5T4YA 2NC9A 3UT8A 3MEKA 4G2VA 2IOLA 4WNDA 1HFAA 3CVUA 4ANXA 2WXKA 3SF4A 4HS2A 2M63A 4HFGA 3PREA 4ANWA 3QJZA 3EIJA 2WQ6A 1ZBPA 2CHZA 2Y4UA 4Y6CA 2WXJA 3ASDA 4PS3A 3RRMB 5E76A 4LCTA 4BX8A 3MGBA 2E0IA 2X6KA 4APOA 2FF4A 4BWRA 1WM5A 4TUUA 4NACA 3S7JA 4JL0A 3UT4A 2VGYA 2YINA 1H19A 1XGWA 3U66A 4GCOA 4JA9A 2OOEA 4BY6A 2YHEA 3TL5A 3ML8A 4WNEA 4BSXA 3SNXA 2GRMA 3GYZA 4JHKA 3E4BA 4BT8A 3O48A 3L6AA 4GYYA 4F53A 4FJZA 1HXIA 2WMNA 2MHKA 4J8FA 3OXFA 5HI7A 4L23A 3ZHEB 5A23A 5EX3A 3RRNB 2XPYA 4MLPA 2C2LA 5FZQA 3PDNA 5CCLA 4U0ZA 2C0MA 3UUXA 1KT1A 3ZXSA 4XKBA 3IBEA 2RD0A 2YHCA 3CIAA 3R7RA 2AWIA 4AY5A 2I1KA 5JHAA 3NZSA 4N3AA 1IHGA 2WVIA 3QWWA 3ESKA 2FEZA 4D10C 2V4LA 4A1GA 1OWOA 4FC8A 4DK5A 1GW6A 3FEYA 3MX3A 2YNQA 2XCCA 3CHQA 3FHEA 3G2UA 4PUCA 4FADA 5ANRA 4DI4A 3D9MA 4N39A 4N5CA 2VTBB 1INZA 2WM9A 3FU0A 1N54A 2Y4TA 3LYAA 4ILIA 4N3CA 3MCXA 4G11A 4AVXA 3SD5A 3U9WA 4AP2A 3Q5MA 3S7BA 4O6FA 2XRYA 4U0UA 4B0ZA 3FEXA 4KYOB 1JPLA 1HZ4A 3QC1A 4GCNA 4AEZC 1HO8A 3PNLB 3FY4A 5FWQA 5KCMA 3JQ1A 5C1DA 4EBAA 3LS8A 3ZW3A 3ASGA 3HVEA 1UG3A 3AU5A 4EZJA 2XRZA 3TG4A 4KZCA 2VGXB 4NQ0A 3RKVA 4EQFA 4HVBA 3PS6A 3B7RL 3U4TA 3ZYQA 3CHMA 3D3MA 4UI9J 3ZN3A 3MJWA 2LNIA 3FUHA 3FP3A 5ARGA 5D0QD 5EX0A 1JWGA 3ONKA 4GYOA 5BPPA 2HR2A 4EBAG 3NQPA 5J08A 3I4GA 4GZ3A 4UQZA 4G23A 4CDMA 4I43A 2X6FA 3O4ZA 4ME2A 3LPZA 3EHMA 5ARFA 2J08A 3D9JA 3PUKA 2DBAA 3RO2A 2DCPA 4GYWA 5CHEE 1SZAA 2PL2A 5CCMA 3FU5A 4RSYA 3OXGA 4GPKA 2KCVA 4I1OB 4HORA 3K9IA 2XGOA 3SGHA 3TJPA 3LKUA 4N2SA 3S2AA 4JW1A 3BG0B 3S7DA 2GGFA 1OWNA 4U63A 5FTPA 3FTVA 3ONLA 5DIZA 1PY1A 3CQCB 3HIZA 4G25A 5FQ8A 5C2YA 4B8CB 1PC2A 4GMJA 3IHYA 1B89A 2NSZA 4XI9A 4Q96A 2BUGA 1YA0A 1ELRA 2XPIA 3G2WA 4W9RA 1FCHA 3R9AB 3KS2A 4EZKA 4I1MA 4I6EA 4GZ5A 4CCAA 1E8ZA 1E90A 4CEMA 4GB9A 3CVNA 3FUIA 4JZYA 3TAXA 4K0RA 2A5UA 2KM4A 4I6GA 4MRUA 1ELWA 3VTYA 5CMYA 3UQ3A 3PRZA 5M72A 3ZYKA 5KJNA 4ACLA 5A7DB 4FHJA 3D9KA 2JEKA 1JUQA 3EIQC 2RG8A 4Q94A 1HS6A 4AXHA 3VTXA 4HLEA 3FU6A 3FTUA 3KD7A 5ANLA 4PS7A 3AS8A 4E85A 2X38A 4PS8A 5AYWD 1HU3A 3FTXA 2GRLA 1U3DA 4LEUA 4Q69A 4P29A 2IJGX 1HF8A 1EPUA 3WXXA 3FWVA 3I5PA 1OUVA 3FUJA 3AU4A 3U3WA 2LAIA 5FT9A 3R7QA 4AV7A 4TV3A 1PAQA 1H0AA 1ZU2A 2I6HA 5A6CA 3PH0C 2OVBA 3LY7A 3GW4A 5CMWA 3EJNA 5AIJA 2IOSA 3QNKA 4J8DA 2MRIA 3QWVA 2WXFA 2WMOA 4KXKB 3HHMA 4U07A 3ZGQA 4LUNU 1KLXA 2FULA 1P5QA 3JCKC 4WNGA 4C9BB 3ZHEA 4GMLA 4XI0A 4G26A 4WWNA 3L22A 1HG5A 4EECA 2FBNA 1HH8A 5BNWA 4YVQC 3CK8A 3ZEFA 1N52A 3HVEB 1OWPA 4B94A 4PH4B 2ILRA 3FUKA 4CGWA 2AXUA 2XGSA 1DNPA 3JUIA 2XQ0A 2FI7A 3PE3A 2I2OA 4K03A 1S0PA 2XHEA 2L6JA 4MS6A 4NURA 3B7TA 1Z6TA 3JQ0A 4FJYA 4PDXA 2CHXA 1UN8A 3FH5A 3QAQA 5FZSA 3MKQA 4ANUA 3CVPA 3B7SA 4RG9A 4C0EA 4CT0A 2VSXE 3QK0A 2KATA 4UI9K 4JEHA 3RO3A 4ANVA 3OXLA 3FUFA 5G2NA 5HQ8A 4U04A 4UWKA 4APFA 4JEUA 3PZDA 2QY7A 3ZFWA 2AXZA 4TRQA 4AIFA 3ZVVA 3B13A 4MKTA 1ELKA 4KVOA 4ACKA 2X6JA 1XNFA 2VYIA 3JYSA 4WNFA 2CFZA 3CKCA 1EYHA 3HYMB 1H6KA 2WXNA 2KC7A 2VSOE 3LY9A 3FU3A 2EQXA 4LERA 1HG2A 2KCLA 2PM6A 2NXPA 3IKOB 5FQ4A 1Y8MA 2IQCA 5KJLA 2WXIA 1E8XA 3QB2A 4JVSA 3UT7A 2WPVA 2WXRA 3SFZA 3VLEA 2E2EA 3GZSA 1H2VC 1UN9A 2J4DA 3LCAA 3RK6A 2AVPA 4OVVA 5LP0A 4GZDA 3TXMA 4CGVA 2UY1B 4ILHB 1E7UA 3LVRE 3G2TA 3CVYA 4I1AA 4A55A 1QNFA 3KEZA 5EDSA 3FUNA 5AENA 4I2WA 5BV1A 4GAAA 4H7YA 4KT6B 5LOZA 3ZYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZC A;  2DIW A;  2V8S E;  3D9P A;  3G2S A;  1ELK A;  4JXT A;  1UJK A;  3G2U A;  2L0I A;  3D9K A;  3G2V A;  1UJJ A;  5CMW A;  1DVP A;  1HFA A;  1EYH A;  3D9M A;  1JUQ A;  4Q94 A;  2MOW A;  3ZYQ A;  1HG2 A;  3ONL A;  1INZ A;  1PY1 A;  4HFG A;  5LOZ A;  3D9I A;  3ZYL A;  4FU3 A;  3RRU A;  4AVX A;  4Q96 A;  1HX8 A;  1MHQ A;  2L0T B;  1JWG A;  3LDZ A;  3G2W A;  3ONK A;  4FLB A;  5LP0 A;  2BF0 X;  4GZD A;  1SZ9 A;  5J08 A;  1JPL A;  3ZYK A;  3G2T A;  1HF8 A;  1EDU A;  4NAC A;  3CLJ A;  1HG5 A;  1X5B A;  2LO6 A;  3ZYM A;  3D9J A;  1XGW A;  3D9O A;  3D9L A;  2KM4 A;  3D9N A;  2QY7 A;  1JWF A;  1LF8 A;  2DCP A;  5CMY A;  1SZA A;  1H0A A;  1VDY A; 
#chains in the Genus database with same CATH topology
 3UM0 A;  3S7F A;  4GZC A;  3G2S A;  2OND A;  4L2L A;  1E96 B;  1TJF A;  5J90 A;  1TJC A;  4UQX A;  2RKK A;  3ZIM A;  5BUZ A;  2ZGD A;  1S63 A;  1JCQ A;  5FJY A;  3HXD A;  3PVL A;  4HOT A;  2WXO A;  4BES A;  3ENE A;  3SO8 A;  2WXQ A;  1OCO E;  1OCZ E;  3NZU A;  4BX9 A;  3MYV A;  2LUH A;  1SW6 A;  1OWL A;  4KZ0 A;  1NZN A;  3E33 A;  4UWG A;  2KZT A;  3EHR A;  4G8L A;  3MZL B;  4GTV A;  4H7X A;  1ZB1 A;  3D9O A;  2HYZ A;  4HRL A;  3CKB A;  2XS8 A;  4XIF A;  3OAW A;  4BTB A;  3C98 A;  1MX2 A;  3PZ1 A;  2PZI A;  3ML9 A;  1N94 A;  3CVV A;  4GA0 A;  3L13 A;  1SA4 A;  2KBX A;  4BEP A;  2F37 A;  4BTA A;  1JCR A;  4DI3 A;  5FQ6 A;  2Y3A A;  3ABM E;  3UI2 A;  1AP7 A;  4O60 A;  1OY3 D;  4Z68 A;  3OTN A;  3RRU A;  4M3O A;  2PQR A;  3Q49 B;  2WQ7 A;  2CG3 A;  5KNH D;  5FQ7 A;  2WXL A;  1MJ0 A;  1FT2 A;  3DRA A;  3LJN A;  2GW1 A;  2GRQ B;  3SHF A;  2J8S D;  1IQR A;  4XX5 A;  3V30 A;  2IF4 A;  2HO1 A;  3SZ7 A;  4BET A;  4FUL A;  4V3I A;  4EHM A;  3C3Q A;  4HRN A;  1IQU A;  2P9L G;  3MKR A;  3EU5 A;  3LXU X;  3MKQ B;  2ZU6 B;  4FLB A;  3SI5 A;  1SZ9 A;  3HXB A;  4N5Q A;  4XZ4 A;  2LSU A;  2J9Q A;  5ENQ D;  3D9N A;  5AJD A;  4EZL A;  2PM7 A;  1UJK A;  2WXH A;  3I4R B;  1W3B A;  2WB2 A;  4IYP A;  3LVQ E;  3VLD A;  1MHQ A;  3LJ3 A;  1TEZ A;  2ION A;  2KCK A;  2CFU A;  4U0S A;  3AG3 E;  3TWR A;  1OWM A;  4HXI A;  3FTS A;  3URZ A;  3SFY A;  2J49 A;  3CVU A;  3PRE A;  4Y6C A;  2WXJ A;  4PS3 A;  4LCT A;  5CRV A;  2E0I A;  4NAC A;  3UT4 A;  2YIN A;  1XGW A;  4BY6 A;  4BSX A;  3GYZ A;  4JHK A;  3E4B A;  3O48 A;  4FJZ A;  1HXI A;  3OXF A;  1N4S A;  4L23 A;  2Y69 E;  4MLP A;  3PDN A;  5CCL A;  1KT1 A;  3IBE A;  1DCE A;  2I1K A;  4LNU D;  5JHA A;  4O1O A;  1IHG A;  3QWW A;  2OEV A;  1U2V G;  3MX3 A;  3G2U A;  1OCR E;  4DI4 A;  3DEP A;  4N39 A;  1INZ A;  2WM9 A;  3FU0 A;  1N54 A;  4N3C A;  3U9W A;  3Q5M A;  2P9P G;  4KYO B;  4GCN A;  1HO8 A;  3PNL B;  3FY4 A;  3V79 K;  2XZT G;  3ZW3 A;  1IKN D;  3AU5 A;  3Q78 A;  4KZC A;  2VGX B;  3CHM A;  3MJW A;  5AN8 A;  3UKU G;  3KEA A;  4G23 A;  2X6F A;  4ME2 A;  3LPZ A;  1MX6 A;  3V31 A;  3UM3 A;  2OEW A;  1SZA A;  3FU5 A;  2V4H C;  1S70 B;  3TJP A;  2XGO A;  3SGH A;  4N2S A;  3ASO E;  4U63 A;  3FTV A;  1PY1 A;  4G25 A;  1PC2 A;  4XI9 A;  4GTO A;  4Q96 A;  1YA0 A;  1ELR A;  4W9R A;  1FCH A;  3KS2 A;  4EZK A;  3PZ2 A;  2Y1L E;  1KZP A;  4GB9 A;  3FUI A;  4JZY A;  4AEZ C;  3PRZ A;  4ACL A;  5A7D B;  4FHJ A;  2JEK A;  2BED A;  4BSZ B;  1BU9 A;  2F8X K;  3C5R A;  5ANL A;  2ETC A;  4E85 A;  5AYW D;  3DSS A;  4P29 A;  1N0Q A;  1OUV A;  3FUJ A;  4AV7 A;  2OVB A;  3LY7 A;  5BXU A;  3Q9U C;  4KXK B;  4LUN U;  4HQD A;  4WNG A;  4WWN A;  4XI0 A;  2XS1 A;  4EEC A;  3TWV A;  2FBN A;  4YVQ C;  1N52 A;  2ILR A;  3FUK A;  3IXE A;  3UIP C;  1QBQ A;  4CGW A;  3EHQ A;  1S0P A;  4NUR A;  2L6J A;  3B7T A;  3FH5 A;  3QAQ A;  3CVP A;  4RG9 A;  2VSX E;  1TNY A;  1DCQ A;  4UI9 K;  3RO3 A;  5G2N A;  5HQ8 A;  4U04 A;  4UWK A;  4APF A;  2IO3 C;  2AXZ A;  3B13 A;  4MKT A;  2VGE A;  4C48 B;  1ELK A;  1TN6 A;  4WNF A;  1H6K A;  2L6B A;  1HG2 A;  2NXP A;  5KJL A;  2WXI A;  2WPV A;  2WXR A;  3SFZ A;  3VLE A;  2E2E A;  1H2V C;  1UN9 A;  3LCA A;  2AVP A;  4GZD A;  5BXO A;  4ILH B;  3HRA A;  4I1A A;  4BER A;  3KEZ A;  5EDS A;  4I2W A;  5BV1 A;  3T9K A;  3ZYL A;  4LNG A;  3IV0 A;  4X8Q A;  4F1S A;  4HNA D;  3L54 A;  3FTZ A;  4FU3 A;  2P9K G;  3QOU A;  3CVX A;  3TGO A;  5JJ7 A;  5JHB A;  5LFA A;  4WWO A;  4TXQ A;  3MV2 B;  4YND A;  3SBT B;  3CST A;  2V5F A;  3CK9 A;  2VJ8 A;  1O5M A;  2R59 A;  2RFA A;  5LCW C;  4J0U A;  3CSF A;  5CBO A;  2XEN A;  4TXP A;  4L7T A;  2EIK E;  3Q79 A;  4RVB A;  4RLY A;  2LXM A;  1WAO 1;  4QFV A;  3X2Q E;  5T3R A;  1BLX B;  5AJL A;  4CT4 A;  4B89 A;  1LF8 A;  1KZO A;  4FHK A;  4I2Z A;  1YMP A;  3T5X A;  1Y6I A;  4DJA A;  3ASH A;  3FH7 A;  4OVU A;  2X3M A;  4JHR A;  3GZ2 A;  4OYS A;  5FIO A;  1TN8 A;  3I3N A;  4U8H A;  4UQY A;  4KMO A;  2OCC E;  3RU0 A;  3Q15 A;  3DSU A;  4I9C A;  3DPY A;  3UIO C;  1OT8 A;  3UX4 A;  4HOQ A;  2IO2 C;  3QKY A;  3APD A;  2OVF A;  2LO6 A;  3V2O A;  4GTT A;  5CED B;  3FUE A;  2V0P A;  3HXF A;  4JA7 A;  3PEV B;  1H2U A;  3TWW A;  2XEE A;  1MQS A;  5KJM A;  1FVH A;  2PQN A;  4GU5 A;  3GZ1 A;  3SBS A;  4UWH A;  1QQE A;  1SA5 A;  4K5A B;  3RSE G;  3UMV A;  2Q7F A;  1NI1 A;  4IRU A;  2WXP A;  3NF1 A;  3VLF A;  4A3V A;  5CER B;  4J6I A;  2A4Z A;  1WDY A;  4JC8 A;  2MOW A;  3AS5 A;  1WY6 A;  4J8S A;  1MYO A;  3UXG A;  4JHJ A;  2YQ8 A;  1EF1 C;  2IFU A;  4K5C A;  4DLO A;  3Q47 B;  4ABN A;  5LCW J;  1RW2 A;  4Y6W A;  2XGM A;  3JXI A;  5G55 A;  4F7A A;  4AY6 A;  3RJV A;  2J07 A;  2DYR E;  3FDH A;  1N4R A;  2CHW A;  2C0L A;  3EHN A;  3DXK G;  5EID A;  2DIW A;  5T4Y A;  3UT8 A;  2IOL A;  1HFA A;  4ANX A;  3Q73 A;  4HS2 A;  3TWU A;  4GTQ A;  3NB2 A;  2WQ6 A;  1ZBP A;  2CHZ A;  4HLL A;  3ASD A;  5E76 A;  4BX8 A;  3MGB A;  2X6K A;  4APO A;  4TUU A;  1H19 A;  4JA9 A;  1YYH A;  2YHE A;  3TL5 A;  3ML8 A;  4WNE A;  3SNX A;  4U7E B;  4GYY A;  5HI7 A;  3ZHE B;  5EX3 A;  1O1T A;  2XPY A;  2C2L A;  5FZQ A;  4U0Z A;  3ZXS A;  4XKB A;  5HRY A;  2AWI A;  3ABL E;  4AY5 A;  3ZU7 B;  3ESK A;  4D10 C;  2V4L A;  4A1G A;  4NIK A;  3CHQ A;  3FHE A;  3D9M A;  5AQ7 A;  2VTB B;  1D8E A;  2ZXW E;  3MCX A;  4G11 A;  4AVX A;  3Q75 A;  2XRY A;  4U0U A;  3FEX A;  2GRO B;  4GMR A;  1JPL A;  5H7P A;  3C3R A;  4EBA A;  2XRZ A;  2DWZ A;  3RKV A;  4HI8 A;  3PS6 A;  3B7R L;  1LD8 A;  3D3M A;  5IY5 E;  3KSQ A;  3ONK A;  1RZ4 A;  3NQP A;  3I4G A;  4GZ3 A;  4HI9 A;  5ARF A;  3EHM A;  2J08 A;  3AG1 E;  5EYL A;  3PUK A;  2DBA A;  4U95 D;  4GYW A;  2DYS E;  2PL2 A;  4RSY A;  3OXG A;  4HOR A;  2R2L A;  4JW1 A;  3BG0 B;  5HS0 A;  3S7D A;  1OWN A;  5FTP A;  3HIZ A;  5FQ8 A;  4GMJ A;  2AJA A;  2BUG A;  3G2W A;  2JAB A;  3NAW A;  5CRU A;  4GZ5 A;  4CCA A;  3J5P A;  2KM4 A;  4I6G A;  2DVW A;  2RG8 A;  2Y0B G;  4HLE A;  1D8D A;  3FTU A;  4UUC A;  3FTX A;  4Q69 A;  2H6F A;  4DX6 D;  3FWV A;  3C3O A;  3U3W A;  2LAI A;  3R7Q A;  1H0A A;  4K5B A;  3EJN A;  3QNK A;  2WXF A;  2WMO A;  4U07 A;  1TN7 A;  1QYM A;  3NBN B;  3AG2 E;  3E37 A;  4GML A;  2P2C P;  1OWP A;  4PH4 B;  1DNP A;  1K3Z D;  3JUI A;  2FI7 A;  5B1A E;  1UN8 A;  5FZS A;  4TXR A;  3E32 A;  2KAT A;  4ANV A;  3OXL A;  4TUM A;  3RAU A;  2QY7 A;  3ZFW A;  1OCC E;  4AIF A;  3ZVV A;  3SQV A;  5ENO D;  5HKP A;  3JYS A;  1V54 E;  3HYM B;  4LSZ E;  2KC7 A;  2KCL A;  2PM6 A;  1Y8M A;  3QB2 A;  1E8X A;  3GZS A;  2GRP B;  4OVV A;  2QYU A;  4CGV A;  2UY1 B;  1E7U A;  3CVY A;  4A55 A;  2R02 A;  4H7Y A;  2NYJ A;  4YVO A;  2R17 C;  3DXM G;  3FUD A;  2A5E A;  5KJK A;  3ULY A;  4I9E A;  2VTB A;  3DSV A;  5JJ6 A;  2LXL A;  2L9B A;  1LD7 A;  3CHR A;  3U64 A;  5CEA A;  1TNB A;  4FA6 A;  3B7U X;  3QDN A;  2WQH A;  4DPR A;  5DBK A;  1TYQ G;  2I9C A;  4A1S A;  2R5S A;  3DST A;  3EUV A;  3UKR G;  4L1B A;  4AM9 A;  5G04 C;  5ENN A;  4XE0 A;  2P9S G;  3PEU B;  4XEI G;  3DPD A;  2X6I A;  4IN3 B;  2DZO A;  3MA5 A;  4I6J A;  4UWL A;  3AS4 A;  4U8V D;  1A17 A;  4J8E A;  4LNB A;  2XCB A;  3CR3 A;  3DSW A;  3SY2 A;  1MZC A;  4YDY A;  1N4Q A;  2XEH A;  4GTS A;  3ZPJ A;  3CEQ A;  5FIN A;  3CHO A;  3FFL A;  1NP7 A;  4G1T A;  2L0T B;  3EU9 A;  5G04 J;  4R7L A;  4N2Q A;  3L08 A;  4URK A;  1EDU A;  1Z3X A;  4AJW A;  2JLB A;  4F3V A;  4FP7 A;  2OV8 A;  4L2Y A;  3ABK E;  3FH8 A;  3L9T A;  3PUJ A;  3AG4 E;  4HB5 A;  1FVF A;  1E7V A;  3ESL A;  3CHS A;  2UWJ G;  4N3B A;  3CQG B;  5T8I A;  4UWF A;  4C0M A;  2I1J A;  4DLQ A;  4WAF A;  2LAH A;  3NOG D;  2BKK B;  2B0O E;  2J09 A;  4JB8 P;  3LEW A;  4DX1 A;  2V8S E;  1UJJ A;  3FUL A;  3TXN A;  2VSN A;  4KBQ A;  3P2B A;  4LRZ A;  3TWQ A;  3FUM A;  5JJT A;  3CVL A;  2H6H A;  2VSY A;  4HBD A;  3E34 A;  3ISM C;  4B8A A;  1L5J A;  3F6Q A;  3D9P A;  1G3N B;  4ZFH A;  2QFC A;  4LG6 A;  3PNT B;  2AW6 A;  1H2T C;  5AAR A;  3EDT B;  3DSX A;  4A3T A;  2XEV A;  3TG5 A;  2F0Y A;  2VQ2 A;  4CRW A;  2X6H A;  3APC A;  4ZHB A;  2BKG A;  2FO7 A;  3UIN C;  5G05 C;  3T5V A;  2BTD A;  1E8W A;  4M7C A;  5LX8 A;  1QZ2 A;  5BV0 A;  5BT1 A;  5KWD A;  4WWP A;  2AXV A;  2XPZ A;  4HOU A;  3ZRH A;  4HOS A;  3QAR A;  1K1B A;  3CK7 A;  5ENR D;  3UPV A;  4EPZ A;  1O1S A;  4UI9 C;  2P58 C;  3L16 A;  2ETA A;  3MEK A;  3SF4 A;  4HFG A;  4ANW A;  3QJZ A;  3EIJ A;  3UTM A;  2Y4U A;  4DX5 D;  2FF4 A;  4BWR A;  2ZIS A;  4J8Y A;  4GCO A;  2OOE A;  1S64 A;  2GRM A;  4DUI A;  4G8K A;  3L6A A;  3NOC D;  4J8F A;  4OAU C;  5A23 A;  2P9N G;  3RRN B;  1TNU A;  5JMN D;  4YDE A;  5B3S E;  2RD0 A;  2YHC A;  3CIA A;  3R7R A;  3ULE G;  3NZS A;  2WVI A;  1TNO A;  2FEZ A;  4DK5 A;  2R03 A;  4U8Y D;  3C72 A;  2XCC A;  3L82 A;  4FAD A;  5ANR A;  2B6C A;  2ZIR A;  4AP2 A;  5CEC B;  5ENP D;  1BD8 A;  1HZ4 A;  3QC1 A;  1FT1 A;  3JQ1 A;  3T8K A;  3ASG A;  3HVE A;  4EZJ A;  3TG4 A;  4L9P A;  4NQ0 A;  5AQA A;  4F6R D;  3U4T A;  3ZYQ A;  4UI9 J;  3ZN3 A;  3E30 A;  3FUH A;  3FP3 A;  5D0Q D;  1O1R A;  5BPP A;  4CZ2 D;  4EBA G;  4UQZ A;  4CDM A;  3O4Z A;  3D9J A;  5CHE E;  4I1O B;  3K9I A;  4DX7 D;  3LKU A;  3S2A A;  1YCS B;  3ONL A;  3CQC B;  5C2Y A;  2IY0 C;  3R9A B;  4I1M A;  3BU8 A;  4I6E A;  1E90 A;  3TWS A;  1V55 E;  4K0R A;  2A5U A;  4MRU A;  3VTY A;  1ELW A;  3UQ3 A;  4Q94 A;  4CYM D;  4AXH A;  4GTR A;  4PS7 A;  3AS8 A;  2X38 A;  2IJG X;  1HF8 A;  3WXX A;  3B7B A;  3JUE A;  3AU4 A;  5FT9 A;  4TV3 A;  1PAQ A;  5ENS D;  4DX2 A;  5AIJ A;  2IOS A;  4QQI A;  3QWV A;  3ZGQ A;  2FUL A;  1Z5S C;  3JCK C;  4C9B B;  3ZHE A;  4G26 A;  3L22 A;  1HG5 A;  1HH8 A;  2XGS A;  2EIJ E;  2H6G A;  2XQ0 A;  3PE3 A;  2I2O A;  2XHE A;  4MS6 A;  1Z6T A;  3JQ0 A;  4FJY A;  2CHX A;  3MKQ A;  4ANU A;  4CT0 A;  3B7S A;  1Q2Z A;  4TRQ A;  3UM1 A;  4KVO A;  5JA4 D;  2X6J A;  5CMW A;  4WUY A;  2WXN A;  3LY9 A;  2VSO E;  4LER A;  3FU3 A;  3IKO B;  5FQ4 A;  2IQC A;  4JVS A;  1AWC B;  3RK6 A;  3TXM A;  3Q9N C;  3G2T A;  3AJI A;  3TWX A;  4HRM B;  4KT6 B;  1A5E A;  3D9H A;  5LOZ A;  1X81 A;  3BG1 B;  3G2V A;  1IHB A;  3N71 A;  3ZXP A;  4CDN A;  1UW4 B;  4GTM A;  2HM8 A;  2P9I G;  3CGH A;  3FTY A;  4FLH A;  4XKC A;  4KVM A;  2BF0 X;  2PNN A;  1LTX A;  2EIM E;  2P9U G;  3CHP A;  4BFR A;  1IYG A;  3HXC A;  4GA1 A;  3Q4A B;  1JWF A;  4JPS A;  3CV0 A;  1DVP A;  4NRH B;  3AAA C;  4G24 A;  4GA2 A;  4ATZ D;  3L17 A;  3DBS A;  4RQI A;  4I17 A;  3UM2 A;  5EYP F;  3PZ3 A;  3KAE A;  3MV3 B;  4ATG A;  1FPP A;  4JXT A;  2CG2 A;  4U96 D;  3RIB A;  4O1P A;  3IEG A;  3BEE A;  1U3C A;  4IUL A;  2FO1 E;  1X5B A;  2LSV A;  2R05 A;  3QWP A;  5FZR A;  2VGX A;  1N95 A;  3CVW A;  2WXM A;  3ASF A;  3D9I A;  3PE4 A;  5G05 J;  1SQM A;  1BPO A;  3Q7A A;  3ULQ A;  2J4B A;  2MYO A;  1N4P A;  4CDR A;  5D0O D;  1E8Y A;  1MX4 A;  4ILG A;  5D66 A;  3FTW A;  3BUA A;  1N0R A;  4OAV B;  3V2X A;  2H6I A;  3HDX A;  4E6H A;  5E75 A;  3CVQ A;  4GZ6 A;  3CLJ A;  1TR4 A;  3HG0 D;  3D9L A;  4JD2 G;  3LY8 A;  1VDY A;  2UY1 A;  1Z3Y A;  2IU1 A;  3DWL G;  1UOH A;  2WXG A;  2KZT B;  3LDZ A;  4RG6 A;  2RFM A;  3IHV A;  4DRX E;  1N9A A;  3APF A;  3ZYM A;  3P1U A;  1K8K G;  3T8M A;  1OXJ A;  2L0I A;  4GPM A;  5BW8 C;  1K1A A;  2IEJ A;  4AOF A;  1HX8 A;  1BI8 B;  1KT0 A;  5EKQ D;  1NA3 A;  5D2M C;  1HE8 A;  1NA0 A;  2V5Q C;  5KBA A;  3BQO A;  1H6O A;  1TNZ A;  2NC9 A;  4G2V A;  4WND A;  2WXK A;  1DC2 A;  2M63 A;  3KSL A;  3RRM B;  4J7W A;  3WG7 E;  1WM5 A;  2QZA A;  1N11 A;  3S7J A;  1JCS A;  4JL0 A;  2VGY A;  3U66 A;  5EIB E;  2GRR B;  4YDW A;  5AQ9 A;  4BT8 A;  2WMN A;  2MHK A;  5EIL A;  4YDO A;  2QYJ A;  5B1B E;  2GRN B;  3UUX A;  2C0M A;  4B93 B;  4N3A A;  2KXP C;  3W9F A;  1OWO A;  4FC8 A;  1GW6 A;  3FEY A;  2YNQ A;  3HXE A;  4GTP A;  4PUC A;  3J5Q B;  4N5C A;  2EIL E;  2Y4T A;  3LYA A;  4ILI A;  5CBN A;  3SD5 A;  3DEO A;  3S7B A;  2ETB A;  4O6F A;  4B0Z A;  1H6P A;  2XZD G;  5FWQ A;  5KCM A;  5C1D A;  3LS8 A;  1UG3 A;  2DZN A;  4EQF A;  3ZNG A;  4HVB A;  2LNI A;  5ARG A;  5EX0 A;  1JWG A;  1IXV A;  4GYO A;  2HR2 A;  3ZUV B;  5J08 A;  2EIN E;  4I43 A;  4MBG A;  5KNG A;  3RO2 A;  2DCP A;  4A63 B;  5CCM A;  4GPK A;  2KCV A;  2F8Y A;  2GGF A;  5DIZ A;  4B8C B;  3IHY A;  3TWT A;  1B89 A;  2NSZ A;  2XPI A;  5AQB A;  3R9M A;  5ENT D;  1D9S A;  1E8Z A;  4CEM A;  2QC9 A;  5EN5 D;  3CVN A;  3TAX A;  1SVX A;  5M72 A;  5CMY A;  3ZYK A;  5KJN A;  3D9K A;  1JUQ A;  3EIQ C;  1HS6 A;  3VTX A;  4F1P A;  3FU6 A;  3W9G A;  3KD7 A;  4PS8 A;  1HU3 A;  2GRL A;  1U3D A;  4LEU A;  1BI7 B;  1EPU A;  1NFI E;  3I5P A;  2HE0 A;  1ZU2 A;  2I6H A;  5A6C A;  3PH0 C;  3GW4 A;  4J8D A;  2MRI A;  3HHM A;  1KLX A;  1P5Q A;  1KPS B;  3B95 A;  3Q7F A;  1WG0 A;  5BNW A;  3CK8 A;  3ZEF A;  3HVE B;  4B94 A;  2AXU A;  4K03 A;  5ITZ F;  3PZ4 A;  1NL4 A;  4PDX A;  3JXJ A;  3ASN E;  4C0E A;  3QK0 A;  4JEH A;  3FUF A;  3ZKJ A;  4JEU A;  3PZD A;  4ACK A;  3SFX A;  1XNF A;  2VYI A;  4BT9 A;  2CFZ A;  3CKC A;  1EYH A;  4F53 A;  2EQX A;  3UT7 A;  2ZGG A;  2J4D A;  5LP0 A;  3LVR E;  1QNF A;  3FUN A;  5AAO A;  5AEN A;  4GAA A; 
#chains in the Genus database with same CATH homology
 4YVO A;  2R17 C;  3FUD A;  4GZC A;  3G2S A;  3S7F A;  2OND A;  3IV0 A;  3BG1 B;  4L2L A;  4F1S A;  5KJK A;  3G2V A;  3L54 A;  1E96 B;  4I9E A;  1TJF A;  3FTZ A;  3N71 A;  2VTB A;  5JJ6 A;  4CDN A;  5J90 A;  1UW4 B;  1TJC A;  2L9B A;  3CHR A;  2HM8 A;  4FU3 A;  4UQX A;  3U64 A;  3CGH A;  3FTY A;  3QOU A;  4FLH A;  3ZIM A;  4FA6 A;  3TGO A;  3CVX A;  5BUZ A;  5JJ7 A;  4XKC A;  5JHB A;  3B7U X;  4KVM A;  5LFA A;  2BF0 X;  5FJY A;  3PVL A;  4WWO A;  4BFR A;  3CHP A;  4HOT A;  3QDN A;  1IYG A;  2WXO A;  3MV2 B;  4GA1 A;  2WQH A;  4YND A;  3ENE A;  3SBT B;  3CST A;  4DPR A;  2V5F A;  5DBK A;  3CK9 A;  3Q4A B;  1JWF A;  2I9C A;  2VJ8 A;  4JPS A;  2R59 A;  2WXQ A;  5LCW C;  3CV0 A;  4A1S A;  4J0U A;  3CSF A;  1DVP A;  2R5S A;  4NRH B;  3NZU A;  4L7T A;  4L1B A;  4BX9 A;  3MYV A;  4AM9 A;  5G04 C;  4RVB A;  4G24 A;  5ENN A;  4XE0 A;  1OWL A;  4GA2 A;  1WAO 1;  3PEU B;  4KZ0 A;  3L17 A;  1NZN A;  4QFV A;  3DPD A;  2KZT A;  4UWG A;  5T3R A;  3MZL B;  2X6I A;  3DBS A;  5AJL A;  4IN3 B;  3MA5 A;  4I17 A;  4I6J A;  3AS4 A;  4UWL A;  4H7X A;  1A17 A;  3D9O A;  4CT4 A;  4J8E A;  2HYZ A;  4B89 A;  1LF8 A;  2XCB A;  3CR3 A;  3KAE A;  3MV3 B;  4FHK A;  4ATG A;  3CKB A;  4I2Z A;  4XIF A;  4JXT A;  3T5X A;  1Y6I A;  3OAW A;  2CG2 A;  4DJA A;  3ZPJ A;  4BTB A;  3ASH A;  3CEQ A;  3FH7 A;  3C98 A;  4OVU A;  2X3M A;  3RIB A;  3CHO A;  2PZI A;  4JHR A;  3GZ2 A;  4OYS A;  3IEG A;  3FFL A;  1NP7 A;  3ML9 A;  4G1T A;  2L0T B;  5G04 J;  4R7L A;  3BEE A;  4N2Q A;  3L08 A;  1U3C A;  3CVV A;  3I3N A;  4GA0 A;  3L13 A;  4IUL A;  4URK A;  1EDU A;  1X5B A;  4U8H A;  1Z3X A;  4AJW A;  2JLB A;  4BTA A;  4F3V A;  4DI3 A;  2LSV A;  4FP7 A;  4UQY A;  5FQ6 A;  4KMO A;  2Y3A A;  3QWP A;  2OV8 A;  4L2Y A;  5FZR A;  3PUJ A;  3FH8 A;  3RU0 A;  1FVF A;  3Q15 A;  2VGX A;  1E7V A;  3ESL A;  3CVW A;  3CHS A;  4I9C A;  2WXM A;  2UWJ G;  3D9I A;  3ASF A;  4N3B A;  3OTN A;  3CQG B;  5T8I A;  3RRU A;  4M3O A;  3PE4 A;  4UWF A;  5G05 J;  4C0M A;  2I1J A;  1SQM A;  2PQR A;  3Q49 B;  3UX4 A;  4HOQ A;  1BPO A;  4DLQ A;  2WQ7 A;  4WAF A;  2CG3 A;  2LAH A;  3QKY A;  3APD A;  3ULQ A;  2J4B A;  5FQ7 A;  2OVF A;  2WXL A;  2LO6 A;  4BT9 A;  2J09 A;  4CDR A;  3LEW A;  5D0O D;  3FUE A;  2V0P A;  1E8Y A;  4ILG A;  2V8S E;  2GW1 A;  4JA7 A;  1UJJ A;  3FUL A;  3PEV B;  1H2U A;  3SHF A;  3TXN A;  2VSN A;  1MQS A;  3FTW A;  5KJM A;  4KBQ A;  1IQR A;  4XX5 A;  1FVH A;  3P2B A;  4LRZ A;  2IF4 A;  2PQN A;  4GU5 A;  3HDX A;  3FUM A;  4E6H A;  2HO1 A;  3GZ1 A;  3SBS A;  3SZ7 A;  5JJT A;  5E75 A;  3CVQ A;  3CVL A;  4UWH A;  4FUL A;  2VSY A;  1QQE A;  4V3I A;  4GZ6 A;  3CLJ A;  3UMV A;  1IQU A;  2Q7F A;  3D9L A;  4B8A A;  3LY8 A;  4IRU A;  1L5J A;  1VDY A;  2WXP A;  4A3T A;  3MKR A;  3NF1 A;  3VLF A;  3D9P A;  4A3V A;  2UY1 A;  4J6I A;  2A4Z A;  1Z3Y A;  2IU1 A;  4JC8 A;  2QFC A;  2MOW A;  3PNT B;  2AW6 A;  3AS5 A;  1H2T C;  1WY6 A;  3LXU X;  4J8S A;  4WUY A;  2WXG A;  3MKQ B;  2KZT B;  3EDT B;  2ZU6 B;  3LDZ A;  4FLB A;  3IHV A;  4JHJ A;  2YQ8 A;  2XEV A;  4RG6 A;  1EF1 C;  3SI5 A;  1SZ9 A;  3TG5 A;  2IFU A;  4DLO A;  3APF A;  2VQ2 A;  3Q47 B;  3ZYM A;  4ABN A;  4XZ4 A;  2LSU A;  2X6H A;  4CRW A;  2J9Q A;  3APC A;  3D9N A;  3P1U A;  5AJD A;  3T8M A;  5LCW J;  2FO7 A;  4EZL A;  2PM7 A;  4Y6W A;  1UJK A;  5G05 C;  2WXH A;  2L0I A;  2XGM A;  3T5V A;  2BTD A;  1E8W A;  5BW8 C;  5LX8 A;  1QZ2 A;  3I4R B;  1W3B A;  2WB2 A;  5BV0 A;  4IYP A;  3LVQ E;  5G55 A;  4F7A A;  4AY6 A;  3RJV A;  2J07 A;  3VLD A;  5BT1 A;  4AOF A;  1HX8 A;  1MHQ A;  3LJ3 A;  1KT0 A;  5EKQ D;  3FDH A;  1NA3 A;  2ION A;  4WWP A;  1TEZ A;  2KCK A;  2AXV A;  2CFU A;  2XPZ A;  4U0S A;  4HOU A;  3ZRH A;  4HOS A;  3QAR A;  2CHW A;  1HE8 A;  1NA0 A;  3CK7 A;  1OWM A;  4HXI A;  3UPV A;  3FTS A;  2C0L A;  3URZ A;  4EPZ A;  3EHN A;  2J49 A;  4UI9 C;  2DIW A;  2P58 C;  3L16 A;  5T4Y A;  2NC9 A;  3UT8 A;  3MEK A;  4G2V A;  2IOL A;  4WND A;  1HFA A;  3CVU A;  4ANX A;  2WXK A;  3SF4 A;  4HS2 A;  2M63 A;  4HFG A;  3PRE A;  4ANW A;  3QJZ A;  3EIJ A;  2WQ6 A;  1ZBP A;  2CHZ A;  2Y4U A;  4Y6C A;  2WXJ A;  3ASD A;  4PS3 A;  3RRM B;  5E76 A;  4LCT A;  4BX8 A;  3MGB A;  2E0I A;  2X6K A;  4APO A;  2FF4 A;  4BWR A;  1WM5 A;  4TUU A;  4NAC A;  3S7J A;  4JL0 A;  3UT4 A;  2VGY A;  2YIN A;  1H19 A;  1XGW A;  3U66 A;  4GCO A;  4JA9 A;  2OOE A;  4BY6 A;  2YHE A;  3TL5 A;  3ML8 A;  4WNE A;  4BSX A;  3SNX A;  2GRM A;  3GYZ A;  4JHK A;  3E4B A;  4BT8 A;  3O48 A;  3L6A A;  4GYY A;  4F53 A;  4FJZ A;  1HXI A;  2WMN A;  2MHK A;  4J8F A;  3OXF A;  5HI7 A;  4L23 A;  3ZHE B;  5A23 A;  5EX3 A;  3RRN B;  2XPY A;  4MLP A;  2C2L A;  5FZQ A;  3PDN A;  5CCL A;  4U0Z A;  2C0M A;  3UUX A;  1KT1 A;  3ZXS A;  4XKB A;  3IBE A;  2RD0 A;  2YHC A;  3CIA A;  3R7R A;  2AWI A;  4AY5 A;  2I1K A;  5JHA A;  3NZS A;  4N3A A;  1IHG A;  2WVI A;  3QWW A;  3ESK A;  2FEZ A;  4D10 C;  2V4L A;  4A1G A;  1OWO A;  4FC8 A;  4DK5 A;  1GW6 A;  3FEY A;  3MX3 A;  2YNQ A;  2XCC A;  3CHQ A;  3FHE A;  3G2U A;  4PUC A;  4FAD A;  5ANR A;  4DI4 A;  3D9M A;  4N39 A;  4N5C A;  2VTB B;  1INZ A;  2WM9 A;  3FU0 A;  1N54 A;  2Y4T A;  3LYA A;  4ILI A;  4N3C A;  3MCX A;  4G11 A;  4AVX A;  3SD5 A;  3U9W A;  4AP2 A;  3Q5M A;  3S7B A;  4O6F A;  2XRY A;  4U0U A;  4B0Z A;  3FEX A;  4KYO B;  1JPL A;  1HZ4 A;  3QC1 A;  4GCN A;  4AEZ C;  1HO8 A;  3PNL B;  3FY4 A;  5FWQ A;  5KCM A;  3JQ1 A;  5C1D A;  4EBA A;  3LS8 A;  3ZW3 A;  3ASG A;  3HVE A;  1UG3 A;  3AU5 A;  4EZJ A;  2XRZ A;  3TG4 A;  4KZC A;  2VGX B;  4NQ0 A;  3RKV A;  4EQF A;  4HVB A;  3PS6 A;  3B7R L;  3U4T A;  3ZYQ A;  3CHM A;  3D3M A;  4UI9 J;  3ZN3 A;  3MJW A;  2LNI A;  3FUH A;  3FP3 A;  5ARG A;  5D0Q D;  5EX0 A;  1JWG A;  3ONK A;  4GYO A;  5BPP A;  2HR2 A;  4EBA G;  3NQP A;  5J08 A;  3I4G A;  4GZ3 A;  4UQZ A;  4G23 A;  4CDM A;  4I43 A;  2X6F A;  3O4Z A;  4ME2 A;  3LPZ A;  3EHM A;  5ARF A;  2J08 A;  3D9J A;  3PUK A;  2DBA A;  3RO2 A;  2DCP A;  4GYW A;  5CHE E;  1SZA A;  2PL2 A;  5CCM A;  3FU5 A;  4RSY A;  3OXG A;  4GPK A;  2KCV A;  4I1O B;  4HOR A;  3K9I A;  2XGO A;  3SGH A;  3TJP A;  3LKU A;  4N2S A;  3S2A A;  4JW1 A;  3BG0 B;  3S7D A;  2GGF A;  1OWN A;  4U63 A;  5FTP A;  3FTV A;  3ONL A;  5DIZ A;  1PY1 A;  3CQC B;  3HIZ A;  4G25 A;  5FQ8 A;  5C2Y A;  4B8C B;  1PC2 A;  4GMJ A;  3IHY A;  1B89 A;  2NSZ A;  4XI9 A;  4Q96 A;  2BUG A;  1YA0 A;  1ELR A;  2XPI A;  3G2W A;  4W9R A;  1FCH A;  3R9A B;  3KS2 A;  4EZK A;  4I1M A;  4I6E A;  4GZ5 A;  4CCA A;  1E8Z A;  1E90 A;  4CEM A;  4GB9 A;  3CVN A;  3FUI A;  4JZY A;  3TAX A;  4K0R A;  2A5U A;  2KM4 A;  4I6G A;  4MRU A;  1ELW A;  3VTY A;  5CMY A;  3UQ3 A;  3PRZ A;  5M72 A;  3ZYK A;  5KJN A;  4ACL A;  5A7D B;  4FHJ A;  3D9K A;  2JEK A;  1JUQ A;  3EIQ C;  2RG8 A;  4Q94 A;  1HS6 A;  4AXH A;  3VTX A;  4HLE A;  3FU6 A;  3FTU A;  3KD7 A;  5ANL A;  4PS7 A;  3AS8 A;  4E85 A;  2X38 A;  4PS8 A;  5AYW D;  1HU3 A;  3FTX A;  2GRL A;  1U3D A;  4LEU A;  4Q69 A;  4P29 A;  2IJG X;  1HF8 A;  1EPU A;  3WXX A;  3FWV A;  3I5P A;  1OUV A;  3FUJ A;  3AU4 A;  3U3W A;  2LAI A;  5FT9 A;  3R7Q A;  4AV7 A;  4TV3 A;  1PAQ A;  1H0A A;  1ZU2 A;  2I6H A;  5A6C A;  3PH0 C;  2OVB A;  3LY7 A;  3GW4 A;  5CMW A;  3EJN A;  5AIJ A;  2IOS A;  3QNK A;  4J8D A;  2MRI A;  3QWV A;  2WXF A;  2WMO A;  4KXK B;  3HHM A;  4U07 A;  3ZGQ A;  4LUN U;  1KLX A;  2FUL A;  1P5Q A;  3JCK C;  4WNG A;  4C9B B;  3ZHE A;  4GML A;  4XI0 A;  4G26 A;  4WWN A;  3L22 A;  1HG5 A;  4EEC A;  2FBN A;  1HH8 A;  5BNW A;  4YVQ C;  3CK8 A;  3ZEF A;  1N52 A;  3HVE B;  1OWP A;  4B94 A;  4PH4 B;  2ILR A;  3FUK A;  4CGW A;  2AXU A;  2XGS A;  1DNP A;  3JUI A;  2XQ0 A;  2FI7 A;  3PE3 A;  2I2O A;  4K03 A;  1S0P A;  2XHE A;  2L6J A;  4MS6 A;  4NUR A;  3B7T A;  1Z6T A;  3JQ0 A;  4FJY A;  4PDX A;  2CHX A;  1UN8 A;  3FH5 A;  3QAQ A;  5FZS A;  3MKQ A;  4ANU A;  3CVP A;  3B7S A;  4RG9 A;  4C0E A;  4CT0 A;  2VSX E;  3QK0 A;  2KAT A;  4UI9 K;  4JEH A;  3RO3 A;  4ANV A;  3OXL A;  3FUF A;  5G2N A;  5HQ8 A;  4U04 A;  4UWK A;  4APF A;  4JEU A;  3PZD A;  2QY7 A;  3ZFW A;  2AXZ A;  4TRQ A;  4AIF A;  3ZVV A;  3B13 A;  4MKT A;  1ELK A;  4KVO A;  4ACK A;  2X6J A;  1XNF A;  2VYI A;  3JYS A;  4WNF A;  2CFZ A;  3CKC A;  1EYH A;  3HYM B;  1H6K A;  2WXN A;  2KC7 A;  2VSO E;  3LY9 A;  3FU3 A;  2EQX A;  4LER A;  1HG2 A;  2KCL A;  2PM6 A;  2NXP A;  3IKO B;  5FQ4 A;  1Y8M A;  2IQC A;  5KJL A;  2WXI A;  1E8X A;  3QB2 A;  4JVS A;  3UT7 A;  2WPV A;  2WXR A;  3SFZ A;  3VLE A;  2E2E A;  3GZS A;  1H2V C;  1UN9 A;  2J4D A;  3LCA A;  3RK6 A;  2AVP A;  4OVV A;  5LP0 A;  4GZD A;  3TXM A;  4CGV A;  2UY1 B;  4ILH B;  1E7U A;  3LVR E;  3G2T A;  3CVY A;  4I1A A;  4A55 A;  1QNF A;  3KEZ A;  5EDS A;  3FUN A;  5AEN A;  4I2W A;  5BV1 A;  4GAA A;  4H7Y A;  4KT6 B;  5LOZ A;  3ZYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...