1SZ9A

The rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
143
structure length
143
Chain Sequence
DHDTEVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQKLYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGLPLFEGSALEKIEQFLIKASAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PCF11 protein
publication title Recognition of RNA polymerase II carboxy-terminal domain by 3'-RNA-processing factors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 55
structure length 143
sequence length 143
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1sz9A00
1HF8A 1VDYA 3ZYMA 2MOWA 1ELKA 5LP0A 2BF0X 1EYHA 1HX8A 1EDUA 1UJJA 3G2WA 2DIWA 4Q96A 2DCPA 1XGWA 3G2TA 1HFAA 3D9KA 3D9NA 3ZYKA 5CMYA 1DVPA 1MHQA 3ZYQA 4FU3A 3RRUA 1HG2A 1H0AA 4FLBA 5CMWA 1LF8A 3CLJA 2V8SE 3D9LA 1PY1A 1JWFA 3D9OA 5J08A 2L0TB 1HG5A 3G2UA 3D9IA 3LDZA 3ONLA 2QY7A 3D9PA 3G2VA 3ONKA 4JXTA 4AVXA 1X5BA 4GZDA 1SZ9A 1JPLA 4GZCA 4HFGA 2LO6A 1JUQA 4Q94A 1SZAA 4NACA 1UJKA 2L0IA 3D9MA 1INZA 3D9JA 5LOZA 2KM4A 3ZYLA 3G2SA 1JWGA
chains in the Genus database with same CATH superfamily
4EZKA 4CYMD 4KMOA 1EDUA 4GA0A 3DXKG 4HNAD 5KNHD 1TN8A 5EDSA 3HXCA 1Y6IA 2WXFA 4NQ0A 3T8MA 4M3OA 1D8EA 3DSSA 1H2TC 3JUEA 3LS8A 1SW6A 2AXUA 2F37A 4WWOA 3ABKE 3UPVA 3V79K 4EHMA 5BPPA 1HG2A 3DRAA 3JUIA 4UWHA 2IEJA 1H2VC 3EIJA 2A5UA 2KZTA 1OWOA 4DRXE 3CV0A 3FDHA 3K9IA 1KT0A 5LCWJ 3D9NA 3MEKA 3PUKA 4A63B 2DVWA 3FTYA 3OXFA 1OCCE 4L1BA 2QYJA 4L7TA 1MYOA 4MKTA 2H6HA 4L2YA 3CHPA 3QNKA 4N3AA 5FQ6A 3DWLG 3LY9A 3ZU7B 2UY1A 2J09A 1HXIA 4AXHA 2VTBA 3SF4A 4I6JA 4C0EA 4AY5A 3SY2A 3JQ1A 3UI2A 5J90A 2XPZA 1Z5SC 1BU9A 2WXQA 1W3BA 2HE0A 2P9IG 3V2OA 1ZBPA 4RG9A 4RSYA 3DPDA 4XEIG 5JJ6A 4CT0A 2OVFA 2AJAA 1MX4A 5C2YA 3E4BA 2KC7A 2OVBA 3UTMA 4PUCA 4G8LA 2Y69E 3DBSA 4U0ZA 1PY1A 3V30A 4UWGA 2RFMA 2VSYA 5T8IA 2L0IA 3TXNA 1JWGA 4UI9J 1WG0A 4JHKA 3PZ4A 4PDXA 1QZ2A 4HRLA 1FT2A 3UM1A 3V31A 4L23A 3FTUA 1E8XA 1YA0A 4U8YD 5BW8C 2PNNA 4TV3A 3PE3A 3Q73A 4QFVA 4B0ZA 2BF0X 2DIWA 3TXMA 2J4DA 4DX6D 1N0RA 3ESKA 3ENEA 4GA2A 5JMND 2V8SE 2HM8A 3TG4A 5KJLA 4UUCA 4JPSA 2J49A 1U3CA 3TWTA 3AS4A 4LCTA 1OT8A 3QWWA 3IHVA 1ZU2A 3BU8A 3CVQA 3NZUA 2MRIA 5EKQD 4AP2A 4CGVA 4WNDA 4K03A 1N54A 1IHGA 4DUIA 2WB2A 3EDTB 3FEXA 2FF4A 5T4YA 2OV8A 4I17A 2X6FA 3NOGD 3CHQA 3FUJA 3ML8A 4URKA 2XZDG 2IJGX 5ENOD 1KLXA 2IF4A 3O48A 2FO1E 2P2CP 4EZJA 1JCSA 3Q4AB 4NURA 4GCOA 2YQ8A 3PS6A 3UXGA 3R7RA 3G2UA 3LDZA 1U2VG 3OTNA 1OCOE 3Q75A 4I6GA 4ME2A 4N2SA 3L08A 3DEOA 3F6QA 4GZ6A 1KZOA 3NAWA 2AWIA 1N4PA 4UQYA 3QC1A 2DYSE 1MQSA 2I2OA 4HVBA 1EF1C 4IN3B 3EHQA 3FULA 1IHBA 3GW4A 4A55A 2LAIA 3BUAA 5EX3A 4EBAG 3ASGA 3UM0A 3L54A 3PEVB 5AQBA 1OCRE 1ZB1A 3C3RA 3L9TA 1TNYA 1K1AA 5CMYA 4GZ3A 4IYPA 2PL2A 1KZPA 3CVLA 2DWZA 4XI0A 2DZNA 1MZCA 5IY5E 1EPUA 4KBQA 1G3NB 3FWVA 1UW4B 2QC9A 3GYZA 4K5AB 3CK7A 3KSQA 4DI4A 4OVUA 1FVFA 3Q15A 2AXZA 4KZ0A 2ETBA 1H0AA 1LF8A 5J08A 5KJNA 3AU4A 3PUJA 5KNGA 2BKGA 4GMRA 3UKUG 2ZXWE 3ABLE 4I1OB 3RKVA 4O60A 1N94A 4HBDA 4HI8A 4BX9A 3UM2A 4LNGA 4BEPA 3RJVA 1XNFA 1LTXA 3SNXA 1BD8A 1DCQA 1DCEA 1ELWA 2A5EA 4CEMA 1S0PA 3Q9NC 2CG3A 1E7UA 3OXLA 4IULA 1JUQA 4HRMB 2GW1A 2NSZA 1BLXB 3AG1E 3MX3A 5D0QD 2CHXA 4APFA 3QWVA 2J07A 2FO7A 3MKQA 4WWNA 2XCBA 1H6KA 3C3QA 4JXTA 4K5BA 3CVWA 4U0SA 5ENSD 3E30A 2MOWA 3MCXA 2XQ0A 5HI7A 4O1OA 3Q49B 2LSVA 2ZISA 1N4RA 3E37A 1DNPA 1DC2A 3C72A 4BWRA 3CSTA 1JPLA 4MRUA 2I6HA 2L6BA 4BSXA 5LP0A 1Z3YA 4C0MA 4Q69A 3QK0A 3LYAA 3X2QE 3AG4E 2XHEA 4BETA 2P9PG 3FTSA 5CCMA 2VGXB 4NACA 2YNQA 3FY4A 4O1PA 2IFUA 1OWNA 4LUNU 4Y6WA 2H6IA 3S7DA 3RAUA 4GCNA 2L6JA 3FU0A 3EIQC 4GAAA 3FUKA 4QQIA 2Y3AA 5KBAA 4F1SA 3L22A 4M7CA 2GRLA 1IXVA 2J8SD 2I9CA 3PZDA 1V54E 2WXOA 3R7QA 1OWPA 3EHMA 2NXPA 4X8QA 2FULA 4LNUD 4PS7A 1SZAA 1H6PA 3PZ3A 5ANRA 4CDRA 1BPOA 4AIFA 3VLDA 4G23A 1SA4A 1KPSB 4GTQA 3OXGA 4UI9K 4HLEA 3J5QB 1D8DA 4J8SA 2MYOA 3VLEA 2LAHA 3IXEA 4YDOA 3TWXA 4NIKA 3UINC 3E33A 4N5CA 3FTZA 4Y6CA 4WWPA 1BI7B 4XIFA 4G25A 2AXVA 3R9AB 2ZIRA 5JHBA 3VTXA 3U4TA 4JEHA 2P9KG 2PQNA 2WMOA 4ILIA 1YMPA 3FFLA 3ASFA 1UG3A 5G04J 2WXRA 3L82A 2XPIA 4XKCA 5CMWA 3LJNA 4FADA 2P9SG 1TNUA 4GPMA 3CVPA 2ETAA 3QKYA 3URZA 3KEAA 3BG1B 2XRZA 3CHOA 4GYOA 1X81A 2XPYA 2DZOA 4I9EA 2M63A 1OUVA 1UJKA 3D9JA 5FINA 4B94A 4XI9A 3J5PA 3L16A 2Y4TA 3B13A 4U7EB 3HVEB 5FWQA 5LFAA 5DBKA 5A6CA 4GTRA 4MBGA 4TXRA 4GZ5A 4TXQA 4KT6B 5BXOA 3TWVA 4HXIA 4HOSA 3ASOE 5LX8A 3N71A 4DX1A 4JVSA 3FU5A 5E76A 3ULQA 3PE4A 3I4RB 2ZU6B 5ARGA 4JB8P 4ZFHA 3T9KA 2JEKA 5CBOA 3CVUA 4F53A 4I6EA 3SGHA 1TN7A 3ML9A 2X6JA 4I1AA 4U8HA 4JL0A 5C1DA 4YDWA 4XKBA 5DIZA 1TJCA 1UOHA 3D9OA 2E2EA 4HB5A 4ILGA 1TR4A 3LPZA 4WNFA 2WXGA 2Y1LE 3MA5A 2VGYA 4GPKA 4I1MA 5ENQD 1OCZE 3JYSA 4A1GA 3PEUB 1ELRA 2WPVA 3IEGA 3Q78A 4DK5A 3UIOC 4BFRA 1IQUA 1JCRA 4HFGA 3FUFA 4WUYA 4BT8A 5T3RA 4O6FA 5CRUA 4JW1A 5FQ8A 3JCKC 1L5JA 4U8VD 4ANXA 5EIDA 1S63A 2WXKA 5AJDA 2A4ZA 3MV3B 1FVHA 4ABNA 4JHRA 4YDYA 2IO2C 3APCA 5B1AE 1H2UA 1Z6TA 4N39A 1H6OA 2AVPA 1E90A 3C98A 2RFAA 2I1JA 3HRAA 3CVYA 2OEVA 5EIBE 1N9AA 5HS0A 2V4HC 3CSFA 5HKPA 3AG3E 3TWQA 1FT1A 2XS1A 1K1BA 3Q7AA 3SHFA 1JWFA 1HU3A 2YINA 3FUIA 4MS6A 3BEEA 2ZGGA 4DX5D 1YCSB 3HXDA 5AAOA 2R2LA 3CGHA 2WQ7A 4EPZA 3EJNA 1JCQA 1Z3XA 2KATA 1MX2A 4BTAA 2QY7A 3WG7E 4N5QA 4V3IA 3PZ2A 3W9FA 4Q94A 5BV1A 2WXIA 4AY6A 1N4SA 3QB2A 1QBQA 5M72A 3C3OA 2C0MA 1UN8A 1UJJA 4Z68A 5BV0A 4XE0A 3UUXA 4GZCA 4BESA 4RVBA 3U9WA 4DPRA 3TWSA 3PNTB 4EECA 2CG2A 4U07A 3E32A 3BQOA 1KT1A 2E0IA 3ASHA 1E8WA 3FUNA 2PZIA 3D9PA 4G8KA 3D9MA 4FJYA 2KBXA 3IKOB 2JLBA 4OVVA 2EINE 2CHZA 4UQXA 2V0PA 4I43A 3G2WA 5AN8A 4G24A 4FLBA 1V55E 2H6FA 4BTBA 1TYQG 4WNGA 4J6IA 2IONA 3RK6A 4U0UA 1XGWA 5B1BE 4CT4A 4N2QA 1RW2A 4RG6A 5ENTD 5FZQA 2WXHA 3MKRA 2C0LA 5CHEE 4CCAA 2F8XK 4PH4B 5D0OD 5KJKA 3APDA 3JQ0A 2EIME 3V2XA 3CHRA 3DSUA 3LCAA 2F0YA 4A1SA 1FCHA 5BT1A 2X6KA 3ZYQA 3T5XA 5KCMA 3IHYA 2B0OE 4U04A 1OXJA 5G05J 1NL4A 4ACKA 3NQPA 3SBSA 4J7WA 2FI7A 4KZCA 5EYPF 2LXMA 3DSTA 1TNZA 3T8KA 4D10C 5JA4D 3UIPC 4RQIA 2CHWA 3ZHEB 2KCKA 1X5BA 3CVVA 1SZ9A 3CQCB 4LG6A 2RG8A 1HE8A 3NB2A 4GA1A 4B93B 1GW6A 3QWPA 4AM9A 5AQ9A 1AP7A 3LY7A 4I2ZA 3HDXA 3S2AA 3B7RL 3FU3A 1P5QA 5AIJA 3NZSA 4K5CA 3T5VA 3GZSA 5AJLA 3IV0A 4PS8A 3L17A 4HORA 4GTSA 3CVXA 3P2BA 3AG2E 5G04C 2IOSA 5BUZA 3QOUA 2OEWA 3JXIA 4I2WA 4F6RD 2LSUA 5FZSA 3EU5A 2VSXE 3HXBA 2KM4A 1NZNA 1BI8B 3DPYA 4FJZA 4W9RA 1SA5A 3DSVA 3CHMA 4NRHB 5LCWC 4BT9A 2KZTB 2QYUA 4JZYA 3SD5A 3PRZA 2IO3C 4LEUA 3JXJA 4ACLA 4YVQC 5LOZA 3I3NA 3KEZA 3UKRG 5ITZF 5FT9A 1ELKA 4AV7A 2BTDA 3NF1A 3LVQE 4UWFA 4AVXA 4N3CA 4GTTA 3ZYLA 2DBAA 5EILA 5ENRD 2XEHA 2V4LA 3U66A 1WM5A 2RD0A 4Q96A 2VSOE 2UY1B 5H7PA 5ANLA 5KJMA 4CDMA 4FU3A 2VTBB 4AJWA 4HQDA 5HQ8A 5B3SE 2KCVA 2WM9A 3B7SA 3NBNB 2LO6A 4OYSA 4TUUA 2R02A 1NP7A 5EN5D 5CERB 2WXNA 3FUEA 4GMJA 3B95A 2WXMA 3FH8A 1N52A 3S7FA 5JJTA 5AYWD 1TEZA 1N95A 2WXJA 4BY6A 4GU5A 2WQ6A 2KCLA 2WVIA 1H19A 4L2LA 1INZA 2XCCA 3ESLA 3CQGB 3G2SA 3PVLA 1IQRA 2P9LG 3UT4A 4E6HA 4FHJA 3ZW3A 3ZNGA 3HXEA 1HX8A 4UI9C 4DI3A 1E8ZA 3AAAC 2LNIA 3FTXA 4U95D 3LEWA 1MX6A 3UMVA 2DYRE 3D9HA 1WDYA 4TRQA 2X6HA 1FPPA 2VGEA 2UWJG 1TNOA 2H6GA 5D2MC 3DSWA 1QNFA 3ZGQA 2R05A 2XGMA 4DX2A 3LY8A 2GRMA 3KD7A 2VGXA 3APFA 3L13A 2LXLA 5CCLA 3RRUA 3ASDA 1O1TA 3TWUA 3ZKJA 3FH5A 4H7XA 3PH0C 3GZ2A 3B7TA 2HR2A 5BXUA 3CKCA 4EQFA 5ENPD 4ATZD 2J4BA 4DJAA 2Y0BG 4YDEA 3EUVA 4G1TA 2VQ2A 2F8YA 4KVOA 2PM7A 3AS8A 1YYHA 4I9CA 3VLFA 3FUDA 3EHNA 4G26A 4JA9A 2AW6A 2DCPA 3FUMA 5A7DB 5AQ7A 4WNEA 2RKKA 3QDNA 3RO2A 3RRMB 1U3DA 1K8KG 3UQ3A 4TXPA 4A3TA 4PS3A 4KYOB 3S7JA 3ZEFA 4C48B 3G2VA 3SZ7A 1QQEA 3CKBA 2P9NG 2WXPA 1IKND 1D9SA 4K0RA 4KXKB 2L9BA 2R17C 2HO1A 4ANWA 2P58C 4UWKA 3Q7FA 2GRPB 4CRWA 4YVOA 3NOCD 3VTYA 3KSLA 2ONDA 4GTVA 4APOA 1NA0A 3EU9A 4H7YA 4HOUA 3MZLB 3R9MA 3PREA 1OWMA 3GZ1A 3S7BA 2P9UG 3OAWA 3FU6A 1UN9A 4ILHB 3ZYKA 3QAQA 2R03A 1B89A 3CK8A 3ONKA 4GB9A 3UM3A 3E34A 2NYJA 2ILRA 2VYIA 3Q79A 4A3VA 3HYMB 4U96D 2EQXA 1TN6A 1N4QA 3TL5A 2R59A 4IRUA 2BEDA 3D9KA 4G2VA 3ZIMA 1OWLA 2EIJE 1K3ZD 3W9GA 3SFYA 3RO3A 3D9IA 5CBNA 3HHMA 2X3MA 4FP7A 4ATGA 3LXUX 3ISMC 4R7LA 5AARA 4LSZE 3FTWA 3HVEA 3QARA 4FA6A 4HI9A 3IBEA 2XGOA 2NC9A 3I5PA 2J9QA 4YNDA 3RRNB 2GROB 3P1UA 2JABA 2PM6A 4HOQA 2WMNA 3DEPA 1AWCB 1E8YA 2FBNA 5G05C 2BUGA 3UT7A 2FEZA 4B8AA 4GTPA 3SI5A 3ZRHA 3TWWA 4U63A 2PQRA 2YHCA 4J8DA 4C9BB 3TG5A 3ONLA 3KS2A 2X6IA 3ZUVB 5FIOA 3MKQB 4B8CB 4J8EA 3B7UX 2GRRB 5G2NA 2I1KA 1SVXA 5G55A 1MJ0A 2WXLA 3BG0B 3DXMG 2KXPC 3FEYA 3B7BA 4WAFA 1PAQA 5CEDB 2ZGDA 2XGSA 4BSZB 3SQVA 1RZ4A 3CR3A 4JEUA 1HF8A 3ABME 3FHEA 3FH7A 4BERA 5JHAA 1O1RA 1NA3A 3I4GA 3HXFA 3ASNE 4CZ2D 1TJFA 5CEAA 4FC8A 3ULYA 4J0UA 4JA7A 4HLLA 3D3MA 3ZVVA 1NI1A 4JC8A 3AS5A 3ZN3A 3TGOA 5EYLA 4GYWA 4RLYA 1EYHA 5HRYA 4OAUC 3MJWA 1S64A 3HG0D 5CECB 5JJ7A 4JD2G 1HS6A 2CFUA 2LUHA 4ANUA 4P29A 5FQ7A 5ENNA 2CFZA 3O4ZA 4KVMA 1O1SA 3CEQA 3RIBA 3KAEA 4F3VA 2IU1A 2VJ8A 3PNLB 5BNWA 3UX4A 3SO8A 1SQMA 4BX8A 1PC2A 1Q2ZA 2L0TB 2GRNB 4HS2A 5FQ4A 3U3WA 4GZDA 2J08A 3LJ3A 2XENA 3U64A 4F7AA 2OCCE 3PDNA 2Q7FA 4TUMA 3FTVA 2V5FA 1IYGA 3LKUA 4FHKA 2GRQB 2B6CA 3D9LA 3SFXA 2IQCA 5E75A 5A23A 5ARFA 2C2LA 1QYMA 3DSXA 1Y8MA 1A5EA 1VDYA 3RU0A 4FLHA 2IOLA 3C5RA 3MV2B 3SBTB 4UQZA 2GGFA 3CK9A 1WY6A 3HIZA 2EIKE 3ZPJA 1TNBA 5D66A 4HRNA 4DX7D 4ANVA 5FJYA 4ZHBA 1HFAA 3CLJA 1HG5A 2OOEA 3TWRA 4E85A 4J8FA 4LRZA 3CHSA 1LD8A 3MGBA 1WAO1 5KWDA 1E96B 2ETCA 2VSNA 2Y4UA 4HOTA 4N3BA 1O5MA 2WQHA 4F1PA 1DVPA 1MHQA 3QJZA 3L6AA 4J8YA 2MHKA 1N0QA 4FULA 4EBAA 3TJPA 3ZFWA 3ZXSA 4AOFA 2XRYA 2XEVA 4L9PA 1NFIE 2R5SA 3LVRE 1N11A 5EX0A 3Q5MA 3WXXA 4MLPA 2V5QC 2YHEA 2QZAA 1LD7A 4EZLA 1HZ4A 3ULEG 4JHJA 3PZ1A 3EHRA 3UT8A 2BKKB 1OY3D 5AENA 1A17A 4DLQA 4XZ4A 3ZYMA 3FP3A 3TAXA 1E7VA 5CRVA 2XZTG 3G2TA 3MYVA 4LNBA 1HO8A 3CVNA 4GYYA 3Q9UC 5FTPA 4XX5A 4CGWA 3ZXPA 1S70B 2XS8A 4DLOA 4LERA 4UWLA 1HH8A 5AQAA 2EILE 2X38A 2HYZA 4GTMA 3ZHEA 4AEZC 3SFZA 4GTOA 4G11A 2IY0C 3FUHA 4B89A 2QFCA 4CDNA 5FZRA 3AU5A 3RSEG 2XEEA 4GMLA 3CIAA 4OAVB 3Q47B 3AJIA
chains in the Genus database with same CATH topology
4KXKB 2L9BA 2MOWA 2R17C 3MCXA 2CG2A 2HO1A 2XQ0A 4EZKA 4U07A 4ANWA 5HI7A 4KMOA 1EDUA 2P58C 4GA0A 4UWKA 3Q49B 4CRWA 2LSVA 1KT1A 4YVOA 5EDSA 2E0IA 3ASHA 1E8WA 1DNPA 3VTYA 1Y6IA 2WXFA 3FUNA 2ONDA 2PZIA 4NQ0A 3D9PA 4APOA 1NA0A 4BWRA 3CSTA 1JPLA 4HOUA 4H7YA 4MRUA 3D9MA 4FJYA 2I6HA 3MZLB 3T8MA 3PREA 3IKOB 4M3OA 1H2TC 2JLBA 4OVVA 1OWMA 3GZ1A 4BSXA 3S7BA 3LS8A 5LP0A 2CHZA 3OAWA 4UQXA 1Z3YA 2V0PA 3G2WA 3FU6A 4I43A 1UN9A 3QK0A 4ILHB 4C0MA 2AXUA 3LYAA 4Q69A 4WWOA 3UPVA 3ZYKA 3QAQA 4G24A 5BPPA 1HG2A 2XHEA 4FLBA 3JUIA 1B89A 3CK8A 3ONKA 4GB9A 4BTBA 3FTSA 4UWHA 5CCMA 2ILRA 2VGXB 2VYIA 4NACA 2YNQA 4WNGA 3FY4A 2IFUA 1OWNA 1H2VC 4LUNU 3EIJA 2A5UA 2KZTA 4J6IA 1OWOA 2IONA 4A3VA 3HYMB 3RK6A 2EQXA 3CV0A 3FDHA 3K9IA 4U0UA 1KT0A 4Y6WA 3S7DA 3TL5A 2R59A 1XGWA 4IRUA 3D9KA 4G2VA 5LCWJ 3ZIMA 1OWLA 3D9NA 3MEKA 4GCNA 4CT4A 4N2QA 2L6JA 4RG6A 3PUKA 3FU0A 3RO3A 3D9IA 3EIQC 5FZQA 4GAAA 2WXHA 3FUKA 3MKRA 2C0LA 3HHMA 2X3MA 3FTYA 5CHEE 2Y3AA 4FP7A 3OXFA 4ATGA 4CCAA 4F1SA 4L1BA 3LXUX 4PH4B 3L22A 4R7LA 4L7TA 5D0OD 5KJKA 2GRLA 3APDA 4MKTA 3JQ0A 3FTWA 3HVEA 2I9CA 4L2YA 3CHPA 3QARA 4FA6A 3IBEA 3CHRA 3PZDA 2WXOA 3R7QA 1OWPA 3EHMA 2XGOA 3LCAA 3QNKA 2NXPA 2NC9A 4A1SA 1FCHA 2J9QA 3I5PA 2X6KA 5BT1A 4N3AA 3ZYQA 3T5XA 2FULA 5FQ6A 4YNDA 3RRNB 3P1UA 2PM6A 5KCMA 4PS7A 3IHYA 4HOQA 2WMNA 4U04A 5G05J 3LY9A 4ACKA 2UY1A 1E8YA 1SZAA 2FBNA 2J09A 2BUGA 3NQPA 5G05C 3SBSA 3UT7A 1HXIA 4AXHA 2VTBA 3SF4A 4I6JA 5ANRA 4CDRA 2FI7A 4C0EA 1BPOA 4KZCA 4AY5A 2FEZA 4B8AA 4AIFA 3VLDA 3JQ1A 4G23A 3SI5A 4D10C 3ZRHA 3OXGA 4UI9K 5J90A 2XPZA 4U63A 4HLEA 2WXQA 1W3BA 4J8SA 2PQRA 2YHCA 4J8DA 4C9BB 3TG5A 1ZBPA 4RG9A 4RSYA 3ONLA 3VLEA 3DPDA 2CHWA 5JJ6A 2KCKA 3ZHEB 2LAHA 1X5BA 3CVVA 3KS2A 1SZ9A 2X6IA 3CQCB 4CT0A 3MKQB 2RG8A 1HE8A 2OVFA 4B8CB 4J8EA 3B7UX 4GA1A 5C2YA 5G2NA 2I1KA 1GW6A 4N5CA 3FTZA 3QWPA 4AM9A 5G55A 4Y6CA 4WWPA 3E4BA 2WXLA 3BG0B 2KC7A 3LY7A 2OVBA 4I2ZA 4XIFA 4G25A 3HDXA 3S2AA 4PUCA 3B7RL 3FEYA 3FU3A 3DBSA 4U0ZA 1PY1A 4WAFA 1PAQA 2AXVA 3R9AB 1P5QA 5JHBA 4UWGA 5AIJA 3NZSA 2VSYA 2XGSA 5T8IA 3T5VA 2L0IA 3TXNA 3VTXA 3GZSA 3CR3A 4JEHA 3U4TA 1JWGA 4JEUA 1HF8A 2PQNA 3FHEA 2WMOA 4ILIA 4UI9J 5AJLA 3IV0A 3FFLA 4PS8A 3ASFA 3L17A 4JHKA 1UG3A 4HORA 3CVXA 3FH7A 5JHAA 5G04J 2WXRA 4PDXA 3P2BA 1QZ2A 1NA3A 3I4GA 5G04C 2IOSA 5BUZA 2XPIA 4XKCA 3QOUA 1TJFA 5CMWA 4I2WA 4FADA 2LSUA 4L23A 4FC8A 5FZSA 4J0UA 3FTUA 4JA7A 2VSXE 1E8XA 3CVPA 3D3MA 1YA0A 3QKYA 3ZVVA 3URZA 4JC8A 5BW8C 2KM4A 3AS5A 4TV3A 3ZN3A 1NZNA 3PE3A 3TGOA 4QFVA 4B0ZA 4GYWA 3BG1B 4FJZA 2BF0X 2XRZA 1EYHA 3CHOA 4W9RA 2DIWA 3MJWA 4GYOA 3TXMA 2J4DA 5JJ7A 2XPYA 3ESKA 3ENEA 4GA2A 1HS6A 3CHMA 2CFUA 4NRHB 5LCWC 2V8SE 4ANUA 4BT9A 4I9EA 2KZTB 2HM8A 4JZYA 4P29A 3SD5A 3TG4A 5KJLA 5FQ7A 5ENNA 2M63A 3PRZA 2J49A 1OUVA 1U3CA 4JPSA 4LEUA 1UJKA 4ACLA 2CFZA 3O4ZA 3D9JA 4YVQC 5LOZA 3I3NA 4KVMA 3CEQA 3KEZA 3AS4A 4LCTA 3RIBA 3QWWA 5FT9A 1ELKA 3KAEA 4F3VA 2IU1A 3IHVA 4B94A 2VJ8A 4XI9A 3PNLB 1ZU2A 3CVQA 3NZUA 3UX4A 5BNWA 2MRIA 4AV7A 2BTDA 5EKQD 1SQMA 4AP2A 4CGVA 4BX8A 1PC2A 3L16A 2Y4TA 4WNDA 3NF1A 3B13A 3LVQE 2L0TB 3HVEB 4HS2A 4K03A 1N54A 5FQ4A 5FWQA 5LFAA 1IHGA 4UWFA 5DBKA 4AVXA 5A6CA 3U3WA 4GZDA 4N3CA 2WB2A 3EDTB 3FEXA 4GZ5A 4KT6B 2FF4A 2J08A 5T4YA 3LJ3A 3ZYLA 3U64A 2DBAA 4F7AA 2OV8A 4I17A 2X6FA 4HXIA 3PDNA 2Q7FA 3CHQA 2V4LA 3U66A 1WM5A 2RD0A 4HOSA 5LX8A 3FUJA 3FTVA 4Q96A 2V5FA 2VSOE 3ML8A 2UY1B 4K0RA 3N71A 5ANLA 5KJMA 4URKA 4JVSA 1IYGA 3LKUA 3FU5A 4FHKA 4CDMA 4FU3A 2IJGX 5E76A 3ULQA 2VTBB 3PE4A 3I4RB 3D9LA 4AJWA 2IQCA 5E75A 5A23A 5HQ8A 5ARFA 1KLXA 2C2LA 2ZU6B 2IF4A 2KCVA 2WM9A 5ARGA 1Y8MA 3B7SA 2LO6A 4OYSA 2JEKA 3O48A 3CVUA 4F53A 4I6EA 3SGHA 4EZJA 3Q4AB 1VDYA 4TUUA 3RU0A 3ML9A 4FLHA 4NURA 4GCOA 2X6JA 4I1AA 2YQ8A 4U8HA 3PS6A 1NP7A 4JL0A 2WXNA 2IOLA 3FUEA 4GMJA 5C1DA 2WXMA 3FH8A 3MV2B 3SBTB 1N52A 3R7RA 4XKBA 5DIZA 3S7FA 1TJCA 4UQZA 5AYWD 5JJTA 1TEZA 2GGFA 3D9OA 2E2EA 2WXJA 3G2UA 4BY6A 3LDZA 4GU5A 4ILGA 2WQ6A 2KCLA 3OTNA 2WVIA 3CK9A 1WY6A 1H19A 3LPZA 4L2LA 1INZA 4I6GA 4WNFA 3HIZA 2WXGA 2XCCA 4ME2A 3ESLA 4N2SA 3CQGB 3ZPJA 3G2SA 3L08A 3PVLA 1IQRA 3MA5A 2VGYA 3UT4A 4E6HA 4FHJA 3ZW3A 4GPKA 4I1MA 1HX8A 4UI9C 4ANVA 4GZ6A 2AWIA 5FJYA 3JYSA 4A1GA 4DI3A 1E8ZA 2LNIA 1HFAA 4UQYA 3FTXA 3PEUB 3LEWA 3QC1A 1ELRA 1MQSA 2WPVA 2I2OA 3IEGA 3UMVA 3CLJA 1HG5A 4TRQA 2OOEA 4DK5A 4E85A 2X6HA 1EF1C 4IN3B 4HVBA 4J8FA 3FULA 4BFRA 3GW4A 4LRZA 1IQUA 2UWJG 4A55A 4HFGA 3FUFA 3CHSA 4WUYA 2LAIA 4BT8A 3MGBA 5EX3A 4EBAG 1WAO1 5T3RA 4O6FA 4JW1A 1QNFA 5FQ8A 3JCKC 1E96B 1L5JA 3ASGA 3ZGQA 4ANXA 2VSNA 2Y4UA 3L54A 3PEVB 2WXKA 5AJDA 2A4ZA 4HOTA 3MV3B 2XGMA 1FVHA 4N3BA 3LY8A 4ABNA 2GRMA 2WQHA 3KD7A 2VGXA 4JHRA 3APFA 3L13A 3APCA 5CMYA 1DVPA 1MHQA 3QJZA 4GZ3A 3RRUA 3ASDA 5CCLA 1H2UA 1Z6TA 3L6AA 4N39A 4IYPA 2MHKA 2PL2A 3FH5A 4H7XA 2AVPA 4FULA 3PH0C 1E90A 4EBAA 3GZ2A 3TJPA 3ZFWA 3CVLA 3ZXSA 3B7TA 4XI0A 2XRYA 4AOFA 2XEVA 2HR2A 1EPUA 3C98A 4KBQA 3FWVA 2I1JA 1UW4B 3CVYA 3GYZA 3CKCA 2R5SA 3CK7A 3LVRE 4EQFA 4DI4A 4OVUA 1FVFA 5EX0A 3Q5MA 3Q15A 3WXXA 2AXZA 2J4BA 3CSFA 4MLPA 2YHEA 4DJAA 4KZ0A 4EZLA 1HZ4A 4G1TA 4JHJA 2VQ2A 1H0AA 1LF8A 3SHFA 5J08A 5KJNA 1JWFA 1HU3A 3UT8A 3AU4A 2YINA 4KVOA 3PUJA 3FUIA 4MS6A 2PM7A 3BEEA 5AENA 3AS8A 1A17A 4DLQA 4I9CA 4I1OB 3RKVA 3VLFA 3CGHA 2WQ7A 3FUDA 3EHNA 4XZ4A 4EPZA 4G26A 3EJNA 3FP3A 4JA9A 3ZYMA 3TAXA 1E7VA 2AW6A 4BX9A 1Z3XA 3RJVA 2DCPA 1XNFA 3G2TA 3FUMA 3MYVA 5A7DB 2KATA 4BTAA 3SNXA 1HO8A 1ELWA 3CVNA 4GYYA 4CEMA 4WNEA 1S0PA 5FTPA 3QDNA 3RO2A 2QY7A 4XX5A 2CG3A 4CGWA 3RRMB 1U3DA 4V3IA 1E7UA 3OXLA 4IULA 1JUQA 2GW1A 4Q94A 2WXIA 5BV1A 4AY6A 2NSZA 4DLOA 4LERA 3QB2A 1HH8A 4UWLA 3MX3A 2X38A 5D0QD 5M72A 2CHXA 2HYZA 4APFA 3UQ3A 3QWVA 3ZHEA 4A3TA 2C0MA 4AEZC 1UN8A 2J07A 1UJJA 2FO7A 3SFZA 3MKQA 4PS3A 4G11A 3FUHA 4KYOB 4WWNA 4B89A 2QFCA 2XCBA 3S7JA 5BV0A 4CDNA 3ZEFA 4XE0A 5FZRA 1H6KA 3G2VA 4JXTA 3UUXA 3AU5A 3SZ7A 4GMLA 1QQEA 3CIAA 4GZCA 3CKBA 4RVBA 3CVWA 3U9WA 2WXPA 3Q47B 4U0SA 4DPRA 3PNTB 4EECA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HF8 A;  1VDY A;  3ZYM A;  2MOW A;  1ELK A;  5LP0 A;  2BF0 X;  1EYH A;  1HX8 A;  1EDU A;  1UJJ A;  3G2W A;  2DIW A;  4Q96 A;  2DCP A;  1XGW A;  3G2T A;  1HFA A;  3D9K A;  3D9N A;  3ZYK A;  5CMY A;  1DVP A;  1MHQ A;  3ZYQ A;  4FU3 A;  3RRU A;  1HG2 A;  1H0A A;  4FLB A;  5CMW A;  1LF8 A;  3CLJ A;  2V8S E;  3D9L A;  1PY1 A;  1JWF A;  3D9O A;  5J08 A;  2L0T B;  1HG5 A;  3G2U A;  3D9I A;  3LDZ A;  3ONL A;  2QY7 A;  3D9P A;  3G2V A;  3ONK A;  4JXT A;  4AVX A;  1X5B A;  4GZD A;  1SZ9 A;  1JPL A;  4GZC A;  4HFG A;  2LO6 A;  1JUQ A;  4Q94 A;  1SZA A;  4NAC A;  1UJK A;  2L0I A;  3D9M A;  1INZ A;  3D9J A;  5LOZ A;  2KM4 A;  3ZYL A;  3G2S A;  1JWG A; 
#chains in the Genus database with same CATH topology
 4EZK A;  4CYM D;  4KMO A;  1EDU A;  4GA0 A;  3DXK G;  4HNA D;  5KNH D;  1TN8 A;  5EDS A;  3HXC A;  1Y6I A;  2WXF A;  4NQ0 A;  3T8M A;  4M3O A;  1D8E A;  3DSS A;  1H2T C;  3JUE A;  3LS8 A;  1SW6 A;  2AXU A;  2F37 A;  4WWO A;  3ABK E;  3UPV A;  3V79 K;  4EHM A;  5BPP A;  1HG2 A;  3DRA A;  3JUI A;  4UWH A;  2IEJ A;  1H2V C;  3EIJ A;  2A5U A;  2KZT A;  1OWO A;  4DRX E;  3CV0 A;  3FDH A;  3K9I A;  1KT0 A;  5LCW J;  3D9N A;  3MEK A;  3PUK A;  4A63 B;  2DVW A;  3FTY A;  3OXF A;  1OCC E;  4L1B A;  2QYJ A;  4L7T A;  1MYO A;  4MKT A;  2H6H A;  4L2Y A;  3CHP A;  3QNK A;  4N3A A;  5FQ6 A;  3DWL G;  3LY9 A;  3ZU7 B;  2UY1 A;  2J09 A;  1HXI A;  4AXH A;  2VTB A;  3SF4 A;  4I6J A;  4C0E A;  4AY5 A;  3SY2 A;  3JQ1 A;  3UI2 A;  5J90 A;  2XPZ A;  1Z5S C;  1BU9 A;  2WXQ A;  1W3B A;  2HE0 A;  2P9I G;  3V2O A;  1ZBP A;  4RG9 A;  4RSY A;  3DPD A;  4XEI G;  5JJ6 A;  4CT0 A;  2OVF A;  2AJA A;  1MX4 A;  5C2Y A;  3E4B A;  2KC7 A;  2OVB A;  3UTM A;  4PUC A;  4G8L A;  2Y69 E;  3DBS A;  4U0Z A;  1PY1 A;  3V30 A;  4UWG A;  2RFM A;  2VSY A;  5T8I A;  2L0I A;  3TXN A;  1JWG A;  4UI9 J;  1WG0 A;  4JHK A;  3PZ4 A;  4PDX A;  1QZ2 A;  4HRL A;  1FT2 A;  3UM1 A;  3V31 A;  4L23 A;  3FTU A;  1E8X A;  1YA0 A;  4U8Y D;  5BW8 C;  2PNN A;  4TV3 A;  3PE3 A;  3Q73 A;  4QFV A;  4B0Z A;  2BF0 X;  2DIW A;  3TXM A;  2J4D A;  4DX6 D;  1N0R A;  3ESK A;  3ENE A;  4GA2 A;  5JMN D;  2V8S E;  2HM8 A;  3TG4 A;  5KJL A;  4UUC A;  4JPS A;  2J49 A;  1U3C A;  3TWT A;  3AS4 A;  4LCT A;  1OT8 A;  3QWW A;  3IHV A;  1ZU2 A;  3BU8 A;  3CVQ A;  3NZU A;  2MRI A;  5EKQ D;  4AP2 A;  4CGV A;  4WND A;  4K03 A;  1N54 A;  1IHG A;  4DUI A;  2WB2 A;  3EDT B;  3FEX A;  2FF4 A;  5T4Y A;  2OV8 A;  4I17 A;  2X6F A;  3NOG D;  3CHQ A;  3FUJ A;  3ML8 A;  4URK A;  2XZD G;  2IJG X;  5ENO D;  1KLX A;  2IF4 A;  3O48 A;  2FO1 E;  2P2C P;  4EZJ A;  1JCS A;  3Q4A B;  4NUR A;  4GCO A;  2YQ8 A;  3PS6 A;  3UXG A;  3R7R A;  3G2U A;  3LDZ A;  1U2V G;  3OTN A;  1OCO E;  3Q75 A;  4I6G A;  4ME2 A;  4N2S A;  3L08 A;  3DEO A;  3F6Q A;  4GZ6 A;  1KZO A;  3NAW A;  2AWI A;  1N4P A;  4UQY A;  3QC1 A;  2DYS E;  1MQS A;  2I2O A;  4HVB A;  1EF1 C;  4IN3 B;  3EHQ A;  3FUL A;  1IHB A;  3GW4 A;  4A55 A;  2LAI A;  3BUA A;  5EX3 A;  4EBA G;  3ASG A;  3UM0 A;  3L54 A;  3PEV B;  5AQB A;  1OCR E;  1ZB1 A;  3C3R A;  3L9T A;  1TNY A;  1K1A A;  5CMY A;  4GZ3 A;  4IYP A;  2PL2 A;  1KZP A;  3CVL A;  2DWZ A;  4XI0 A;  2DZN A;  1MZC A;  5IY5 E;  1EPU A;  4KBQ A;  1G3N B;  3FWV A;  1UW4 B;  2QC9 A;  3GYZ A;  4K5A B;  3CK7 A;  3KSQ A;  4DI4 A;  4OVU A;  1FVF A;  3Q15 A;  2AXZ A;  4KZ0 A;  2ETB A;  1H0A A;  1LF8 A;  5J08 A;  5KJN A;  3AU4 A;  3PUJ A;  5KNG A;  2BKG A;  4GMR A;  3UKU G;  2ZXW E;  3ABL E;  4I1O B;  3RKV A;  4O60 A;  1N94 A;  4HBD A;  4HI8 A;  4BX9 A;  3UM2 A;  4LNG A;  4BEP A;  3RJV A;  1XNF A;  1LTX A;  3SNX A;  1BD8 A;  1DCQ A;  1DCE A;  1ELW A;  2A5E A;  4CEM A;  1S0P A;  3Q9N C;  2CG3 A;  1E7U A;  3OXL A;  4IUL A;  1JUQ A;  4HRM B;  2GW1 A;  2NSZ A;  1BLX B;  3AG1 E;  3MX3 A;  5D0Q D;  2CHX A;  4APF A;  3QWV A;  2J07 A;  2FO7 A;  3MKQ A;  4WWN A;  2XCB A;  1H6K A;  3C3Q A;  4JXT A;  4K5B A;  3CVW A;  4U0S A;  5ENS D;  3E30 A;  2MOW A;  3MCX A;  2XQ0 A;  5HI7 A;  4O1O A;  3Q49 B;  2LSV A;  2ZIS A;  1N4R A;  3E37 A;  1DNP A;  1DC2 A;  3C72 A;  4BWR A;  3CST A;  1JPL A;  4MRU A;  2I6H A;  2L6B A;  4BSX A;  5LP0 A;  1Z3Y A;  4C0M A;  4Q69 A;  3QK0 A;  3LYA A;  3X2Q E;  3AG4 E;  2XHE A;  4BET A;  2P9P G;  3FTS A;  5CCM A;  2VGX B;  4NAC A;  2YNQ A;  3FY4 A;  4O1P A;  2IFU A;  1OWN A;  4LUN U;  4Y6W A;  2H6I A;  3S7D A;  3RAU A;  4GCN A;  2L6J A;  3FU0 A;  3EIQ C;  4GAA A;  3FUK A;  4QQI A;  2Y3A A;  5KBA A;  4F1S A;  3L22 A;  4M7C A;  2GRL A;  1IXV A;  2J8S D;  2I9C A;  3PZD A;  1V54 E;  2WXO A;  3R7Q A;  1OWP A;  3EHM A;  2NXP A;  4X8Q A;  2FUL A;  4LNU D;  4PS7 A;  1SZA A;  1H6P A;  3PZ3 A;  5ANR A;  4CDR A;  1BPO A;  4AIF A;  3VLD A;  4G23 A;  1SA4 A;  1KPS B;  4GTQ A;  3OXG A;  4UI9 K;  4HLE A;  3J5Q B;  1D8D A;  4J8S A;  2MYO A;  3VLE A;  2LAH A;  3IXE A;  4YDO A;  3TWX A;  4NIK A;  3UIN C;  3E33 A;  4N5C A;  3FTZ A;  4Y6C A;  4WWP A;  1BI7 B;  4XIF A;  4G25 A;  2AXV A;  3R9A B;  2ZIR A;  5JHB A;  3VTX A;  3U4T A;  4JEH A;  2P9K G;  2PQN A;  2WMO A;  4ILI A;  1YMP A;  3FFL A;  3ASF A;  1UG3 A;  5G04 J;  2WXR A;  3L82 A;  2XPI A;  4XKC A;  5CMW A;  3LJN A;  4FAD A;  2P9S G;  1TNU A;  4GPM A;  3CVP A;  2ETA A;  3QKY A;  3URZ A;  3KEA A;  3BG1 B;  2XRZ A;  3CHO A;  4GYO A;  1X81 A;  2XPY A;  2DZO A;  4I9E A;  2M63 A;  1OUV A;  1UJK A;  3D9J A;  5FIN A;  4B94 A;  4XI9 A;  3J5P A;  3L16 A;  2Y4T A;  3B13 A;  4U7E B;  3HVE B;  5FWQ A;  5LFA A;  5DBK A;  5A6C A;  4GTR A;  4MBG A;  4TXR A;  4GZ5 A;  4TXQ A;  4KT6 B;  5BXO A;  3TWV A;  4HXI A;  4HOS A;  3ASO E;  5LX8 A;  3N71 A;  4DX1 A;  4JVS A;  3FU5 A;  5E76 A;  3ULQ A;  3PE4 A;  3I4R B;  2ZU6 B;  5ARG A;  4JB8 P;  4ZFH A;  3T9K A;  2JEK A;  5CBO A;  3CVU A;  4F53 A;  4I6E A;  3SGH A;  1TN7 A;  3ML9 A;  2X6J A;  4I1A A;  4U8H A;  4JL0 A;  5C1D A;  4YDW A;  4XKB A;  5DIZ A;  1TJC A;  1UOH A;  3D9O A;  2E2E A;  4HB5 A;  4ILG A;  1TR4 A;  3LPZ A;  4WNF A;  2WXG A;  2Y1L E;  3MA5 A;  2VGY A;  4GPK A;  4I1M A;  5ENQ D;  1OCZ E;  3JYS A;  4A1G A;  3PEU B;  1ELR A;  2WPV A;  3IEG A;  3Q78 A;  4DK5 A;  3UIO C;  4BFR A;  1IQU A;  1JCR A;  4HFG A;  3FUF A;  4WUY A;  4BT8 A;  5T3R A;  4O6F A;  5CRU A;  4JW1 A;  5FQ8 A;  3JCK C;  1L5J A;  4U8V D;  4ANX A;  5EID A;  1S63 A;  2WXK A;  5AJD A;  2A4Z A;  3MV3 B;  1FVH A;  4ABN A;  4JHR A;  4YDY A;  2IO2 C;  3APC A;  5B1A E;  1H2U A;  1Z6T A;  4N39 A;  1H6O A;  2AVP A;  1E90 A;  3C98 A;  2RFA A;  2I1J A;  3HRA A;  3CVY A;  2OEV A;  5EIB E;  1N9A A;  5HS0 A;  2V4H C;  3CSF A;  5HKP A;  3AG3 E;  3TWQ A;  1FT1 A;  2XS1 A;  1K1B A;  3Q7A A;  3SHF A;  1JWF A;  1HU3 A;  2YIN A;  3FUI A;  4MS6 A;  3BEE A;  2ZGG A;  4DX5 D;  1YCS B;  3HXD A;  5AAO A;  2R2L A;  3CGH A;  2WQ7 A;  4EPZ A;  3EJN A;  1JCQ A;  1Z3X A;  2KAT A;  1MX2 A;  4BTA A;  2QY7 A;  3WG7 E;  4N5Q A;  4V3I A;  3PZ2 A;  3W9F A;  4Q94 A;  5BV1 A;  2WXI A;  4AY6 A;  1N4S A;  3QB2 A;  1QBQ A;  5M72 A;  3C3O A;  2C0M A;  1UN8 A;  1UJJ A;  4Z68 A;  5BV0 A;  4XE0 A;  3UUX A;  4GZC A;  4BES A;  4RVB A;  3U9W A;  4DPR A;  3TWS A;  3PNT B;  4EEC A;  2CG2 A;  4U07 A;  3E32 A;  3BQO A;  1KT1 A;  2E0I A;  3ASH A;  1E8W A;  3FUN A;  2PZI A;  3D9P A;  4G8K A;  3D9M A;  4FJY A;  2KBX A;  3IKO B;  2JLB A;  4OVV A;  2EIN E;  2CHZ A;  4UQX A;  2V0P A;  4I43 A;  3G2W A;  5AN8 A;  4G24 A;  4FLB A;  1V55 E;  2H6F A;  4BTB A;  1TYQ G;  4WNG A;  4J6I A;  2ION A;  3RK6 A;  4U0U A;  1XGW A;  5B1B E;  4CT4 A;  4N2Q A;  1RW2 A;  4RG6 A;  5ENT D;  5FZQ A;  2WXH A;  3MKR A;  2C0L A;  5CHE E;  4CCA A;  2F8X K;  4PH4 B;  5D0O D;  5KJK A;  3APD A;  3JQ0 A;  2EIM E;  3V2X A;  3CHR A;  3DSU A;  3LCA A;  2F0Y A;  4A1S A;  1FCH A;  5BT1 A;  2X6K A;  3ZYQ A;  3T5X A;  5KCM A;  3IHY A;  2B0O E;  4U04 A;  1OXJ A;  5G05 J;  1NL4 A;  4ACK A;  3NQP A;  3SBS A;  4J7W A;  2FI7 A;  4KZC A;  5EYP F;  2LXM A;  3DST A;  1TNZ A;  3T8K A;  4D10 C;  5JA4 D;  3UIP C;  4RQI A;  2CHW A;  3ZHE B;  2KCK A;  1X5B A;  3CVV A;  1SZ9 A;  3CQC B;  4LG6 A;  2RG8 A;  1HE8 A;  3NB2 A;  4GA1 A;  4B93 B;  1GW6 A;  3QWP A;  4AM9 A;  5AQ9 A;  1AP7 A;  3LY7 A;  4I2Z A;  3HDX A;  3S2A A;  3B7R L;  3FU3 A;  1P5Q A;  5AIJ A;  3NZS A;  4K5C A;  3T5V A;  3GZS A;  5AJL A;  3IV0 A;  4PS8 A;  3L17 A;  4HOR A;  4GTS A;  3CVX A;  3P2B A;  3AG2 E;  5G04 C;  2IOS A;  5BUZ A;  3QOU A;  2OEW A;  3JXI A;  4I2W A;  4F6R D;  2LSU A;  5FZS A;  3EU5 A;  2VSX E;  3HXB A;  2KM4 A;  1NZN A;  1BI8 B;  3DPY A;  4FJZ A;  4W9R A;  1SA5 A;  3DSV A;  3CHM A;  4NRH B;  5LCW C;  4BT9 A;  2KZT B;  2QYU A;  4JZY A;  3SD5 A;  3PRZ A;  2IO3 C;  4LEU A;  3JXJ A;  4ACL A;  4YVQ C;  5LOZ A;  3I3N A;  3KEZ A;  3UKR G;  5ITZ F;  5FT9 A;  1ELK A;  4AV7 A;  2BTD A;  3NF1 A;  3LVQ E;  4UWF A;  4AVX A;  4N3C A;  4GTT A;  3ZYL A;  2DBA A;  5EIL A;  5ENR D;  2XEH A;  2V4L A;  3U66 A;  1WM5 A;  2RD0 A;  4Q96 A;  2VSO E;  2UY1 B;  5H7P A;  5ANL A;  5KJM A;  4CDM A;  4FU3 A;  2VTB B;  4AJW A;  4HQD A;  5HQ8 A;  5B3S E;  2KCV A;  2WM9 A;  3B7S A;  3NBN B;  2LO6 A;  4OYS A;  4TUU A;  2R02 A;  1NP7 A;  5EN5 D;  5CER B;  2WXN A;  3FUE A;  4GMJ A;  3B95 A;  2WXM A;  3FH8 A;  1N52 A;  3S7F A;  5JJT A;  5AYW D;  1TEZ A;  1N95 A;  2WXJ A;  4BY6 A;  4GU5 A;  2WQ6 A;  2KCL A;  2WVI A;  1H19 A;  4L2L A;  1INZ A;  2XCC A;  3ESL A;  3CQG B;  3G2S A;  3PVL A;  1IQR A;  2P9L G;  3UT4 A;  4E6H A;  4FHJ A;  3ZW3 A;  3ZNG A;  3HXE A;  1HX8 A;  4UI9 C;  4DI3 A;  1E8Z A;  3AAA C;  2LNI A;  3FTX A;  4U95 D;  3LEW A;  1MX6 A;  3UMV A;  2DYR E;  3D9H A;  1WDY A;  4TRQ A;  2X6H A;  1FPP A;  2VGE A;  2UWJ G;  1TNO A;  2H6G A;  5D2M C;  3DSW A;  1QNF A;  3ZGQ A;  2R05 A;  2XGM A;  4DX2 A;  3LY8 A;  2GRM A;  3KD7 A;  2VGX A;  3APF A;  3L13 A;  2LXL A;  5CCL A;  3RRU A;  3ASD A;  1O1T A;  3TWU A;  3ZKJ A;  3FH5 A;  4H7X A;  3PH0 C;  3GZ2 A;  3B7T A;  2HR2 A;  5BXU A;  3CKC A;  4EQF A;  5ENP D;  4ATZ D;  2J4B A;  4DJA A;  2Y0B G;  4YDE A;  3EUV A;  4G1T A;  2VQ2 A;  2F8Y A;  4KVO A;  2PM7 A;  3AS8 A;  1YYH A;  4I9C A;  3VLF A;  3FUD A;  3EHN A;  4G26 A;  4JA9 A;  2AW6 A;  2DCP A;  3FUM A;  5A7D B;  5AQ7 A;  4WNE A;  2RKK A;  3QDN A;  3RO2 A;  3RRM B;  1U3D A;  1K8K G;  3UQ3 A;  4TXP A;  4A3T A;  4PS3 A;  4KYO B;  3S7J A;  3ZEF A;  4C48 B;  3G2V A;  3SZ7 A;  1QQE A;  3CKB A;  2P9N G;  2WXP A;  1IKN D;  1D9S A;  4K0R A;  4KXK B;  2L9B A;  2R17 C;  2HO1 A;  4ANW A;  2P58 C;  4UWK A;  3Q7F A;  2GRP B;  4CRW A;  4YVO A;  3NOC D;  3VTY A;  3KSL A;  2OND A;  4GTV A;  4APO A;  1NA0 A;  3EU9 A;  4H7Y A;  4HOU A;  3MZL B;  3R9M A;  3PRE A;  1OWM A;  3GZ1 A;  3S7B A;  2P9U G;  3OAW A;  3FU6 A;  1UN9 A;  4ILH B;  3ZYK A;  3QAQ A;  2R03 A;  1B89 A;  3CK8 A;  3ONK A;  4GB9 A;  3UM3 A;  3E34 A;  2NYJ A;  2ILR A;  2VYI A;  3Q79 A;  4A3V A;  3HYM B;  4U96 D;  2EQX A;  1TN6 A;  1N4Q A;  3TL5 A;  2R59 A;  4IRU A;  2BED A;  3D9K A;  4G2V A;  3ZIM A;  1OWL A;  2EIJ E;  1K3Z D;  3W9G A;  3SFY A;  3RO3 A;  3D9I A;  5CBN A;  3HHM A;  2X3M A;  4FP7 A;  4ATG A;  3LXU X;  3ISM C;  4R7L A;  5AAR A;  4LSZ E;  3FTW A;  3HVE A;  3QAR A;  4FA6 A;  4HI9 A;  3IBE A;  2XGO A;  2NC9 A;  3I5P A;  2J9Q A;  4YND A;  3RRN B;  2GRO B;  3P1U A;  2JAB A;  2PM6 A;  4HOQ A;  2WMN A;  3DEP A;  1AWC B;  1E8Y A;  2FBN A;  5G05 C;  2BUG A;  3UT7 A;  2FEZ A;  4B8A A;  4GTP A;  3SI5 A;  3ZRH A;  3TWW A;  4U63 A;  2PQR A;  2YHC A;  4J8D A;  4C9B B;  3TG5 A;  3ONL A;  3KS2 A;  2X6I A;  3ZUV B;  5FIO A;  3MKQ B;  4B8C B;  4J8E A;  3B7U X;  2GRR B;  5G2N A;  2I1K A;  1SVX A;  5G55 A;  1MJ0 A;  2WXL A;  3BG0 B;  3DXM G;  2KXP C;  3FEY A;  3B7B A;  4WAF A;  1PAQ A;  5CED B;  2ZGD A;  2XGS A;  4BSZ B;  3SQV A;  1RZ4 A;  3CR3 A;  4JEU A;  1HF8 A;  3ABM E;  3FHE A;  3FH7 A;  4BER A;  5JHA A;  1O1R A;  1NA3 A;  3I4G A;  3HXF A;  3ASN E;  4CZ2 D;  1TJF A;  5CEA A;  4FC8 A;  3ULY A;  4J0U A;  4JA7 A;  4HLL A;  3D3M A;  3ZVV A;  1NI1 A;  4JC8 A;  3AS5 A;  3ZN3 A;  3TGO A;  5EYL A;  4GYW A;  4RLY A;  1EYH A;  5HRY A;  4OAU C;  3MJW A;  1S64 A;  3HG0 D;  5CEC B;  5JJ7 A;  4JD2 G;  1HS6 A;  2CFU A;  2LUH A;  4ANU A;  4P29 A;  5FQ7 A;  5ENN A;  2CFZ A;  3O4Z A;  4KVM A;  1O1S A;  3CEQ A;  3RIB A;  3KAE A;  4F3V A;  2IU1 A;  2VJ8 A;  3PNL B;  5BNW A;  3UX4 A;  3SO8 A;  1SQM A;  4BX8 A;  1PC2 A;  1Q2Z A;  2L0T B;  2GRN B;  4HS2 A;  5FQ4 A;  3U3W A;  4GZD A;  2J08 A;  3LJ3 A;  2XEN A;  3U64 A;  4F7A A;  2OCC E;  3PDN A;  2Q7F A;  4TUM A;  3FTV A;  2V5F A;  1IYG A;  3LKU A;  4FHK A;  2GRQ B;  2B6C A;  3D9L A;  3SFX A;  2IQC A;  5E75 A;  5A23 A;  5ARF A;  2C2L A;  1QYM A;  3DSX A;  1Y8M A;  1A5E A;  1VDY A;  3RU0 A;  4FLH A;  2IOL A;  3C5R A;  3MV2 B;  3SBT B;  4UQZ A;  2GGF A;  3CK9 A;  1WY6 A;  3HIZ A;  2EIK E;  3ZPJ A;  1TNB A;  5D66 A;  4HRN A;  4DX7 D;  4ANV A;  5FJY A;  4ZHB A;  1HFA A;  3CLJ A;  1HG5 A;  2OOE A;  3TWR A;  4E85 A;  4J8F A;  4LRZ A;  3CHS A;  1LD8 A;  3MGB A;  1WAO 1;  5KWD A;  1E96 B;  2ETC A;  2VSN A;  2Y4U A;  4HOT A;  4N3B A;  1O5M A;  2WQH A;  4F1P A;  1DVP A;  1MHQ A;  3QJZ A;  3L6A A;  4J8Y A;  2MHK A;  1N0Q A;  4FUL A;  4EBA A;  3TJP A;  3ZFW A;  3ZXS A;  4AOF A;  2XRY A;  2XEV A;  4L9P A;  1NFI E;  2R5S A;  3LVR E;  1N11 A;  5EX0 A;  3Q5M A;  3WXX A;  4MLP A;  2V5Q C;  2YHE A;  2QZA A;  1LD7 A;  4EZL A;  1HZ4 A;  3ULE G;  4JHJ A;  3PZ1 A;  3EHR A;  3UT8 A;  2BKK B;  1OY3 D;  5AEN A;  1A17 A;  4DLQ A;  4XZ4 A;  3ZYM A;  3FP3 A;  3TAX A;  1E7V A;  5CRV A;  2XZT G;  3G2T A;  3MYV A;  4LNB A;  1HO8 A;  3CVN A;  4GYY A;  3Q9U C;  5FTP A;  4XX5 A;  4CGW A;  3ZXP A;  1S70 B;  2XS8 A;  4DLO A;  4LER A;  4UWL A;  1HH8 A;  5AQA A;  2EIL E;  2X38 A;  2HYZ A;  4GTM A;  3ZHE A;  4AEZ C;  3SFZ A;  4GTO A;  4G11 A;  2IY0 C;  3FUH A;  4B89 A;  2QFC A;  4CDN A;  5FZR A;  3AU5 A;  3RSE G;  2XEE A;  4GML A;  3CIA A;  4OAV B;  3Q47 B;  3AJI A; 
#chains in the Genus database with same CATH homology
 4KXK B;  2L9B A;  2MOW A;  2R17 C;  3MCX A;  2CG2 A;  2HO1 A;  2XQ0 A;  4EZK A;  4U07 A;  4ANW A;  5HI7 A;  4KMO A;  1EDU A;  2P58 C;  4GA0 A;  4UWK A;  3Q49 B;  4CRW A;  2LSV A;  1KT1 A;  4YVO A;  5EDS A;  2E0I A;  3ASH A;  1E8W A;  1DNP A;  3VTY A;  1Y6I A;  2WXF A;  3FUN A;  2OND A;  2PZI A;  4NQ0 A;  3D9P A;  4APO A;  1NA0 A;  4BWR A;  3CST A;  1JPL A;  4HOU A;  4H7Y A;  4MRU A;  3D9M A;  4FJY A;  2I6H A;  3MZL B;  3T8M A;  3PRE A;  3IKO B;  4M3O A;  1H2T C;  2JLB A;  4OVV A;  1OWM A;  3GZ1 A;  4BSX A;  3S7B A;  3LS8 A;  5LP0 A;  2CHZ A;  3OAW A;  4UQX A;  1Z3Y A;  2V0P A;  3G2W A;  3FU6 A;  4I43 A;  1UN9 A;  3QK0 A;  4ILH B;  4C0M A;  2AXU A;  3LYA A;  4Q69 A;  4WWO A;  3UPV A;  3ZYK A;  3QAQ A;  4G24 A;  5BPP A;  1HG2 A;  2XHE A;  4FLB A;  3JUI A;  1B89 A;  3CK8 A;  3ONK A;  4GB9 A;  4BTB A;  3FTS A;  4UWH A;  5CCM A;  2ILR A;  2VGX B;  2VYI A;  4NAC A;  2YNQ A;  4WNG A;  3FY4 A;  2IFU A;  1OWN A;  1H2V C;  4LUN U;  3EIJ A;  2A5U A;  2KZT A;  4J6I A;  1OWO A;  2ION A;  4A3V A;  3HYM B;  3RK6 A;  2EQX A;  3CV0 A;  3FDH A;  3K9I A;  4U0U A;  1KT0 A;  4Y6W A;  3S7D A;  3TL5 A;  2R59 A;  1XGW A;  4IRU A;  3D9K A;  4G2V A;  5LCW J;  3ZIM A;  1OWL A;  3D9N A;  3MEK A;  4GCN A;  4CT4 A;  4N2Q A;  2L6J A;  4RG6 A;  3PUK A;  3FU0 A;  3RO3 A;  3D9I A;  3EIQ C;  5FZQ A;  4GAA A;  2WXH A;  3FUK A;  3MKR A;  2C0L A;  3HHM A;  2X3M A;  3FTY A;  5CHE E;  2Y3A A;  4FP7 A;  3OXF A;  4ATG A;  4CCA A;  4F1S A;  4L1B A;  3LXU X;  4PH4 B;  3L22 A;  4R7L A;  4L7T A;  5D0O D;  5KJK A;  2GRL A;  3APD A;  4MKT A;  3JQ0 A;  3FTW A;  3HVE A;  2I9C A;  4L2Y A;  3CHP A;  3QAR A;  4FA6 A;  3IBE A;  3CHR A;  3PZD A;  2WXO A;  3R7Q A;  1OWP A;  3EHM A;  2XGO A;  3LCA A;  3QNK A;  2NXP A;  2NC9 A;  4A1S A;  1FCH A;  2J9Q A;  3I5P A;  2X6K A;  5BT1 A;  4N3A A;  3ZYQ A;  3T5X A;  2FUL A;  5FQ6 A;  4YND A;  3RRN B;  3P1U A;  2PM6 A;  5KCM A;  4PS7 A;  3IHY A;  4HOQ A;  2WMN A;  4U04 A;  5G05 J;  3LY9 A;  4ACK A;  2UY1 A;  1E8Y A;  1SZA A;  2FBN A;  2J09 A;  2BUG A;  3NQP A;  5G05 C;  3SBS A;  3UT7 A;  1HXI A;  4AXH A;  2VTB A;  3SF4 A;  4I6J A;  5ANR A;  4CDR A;  2FI7 A;  4C0E A;  1BPO A;  4KZC A;  4AY5 A;  2FEZ A;  4B8A A;  4AIF A;  3VLD A;  3JQ1 A;  4G23 A;  3SI5 A;  4D10 C;  3ZRH A;  3OXG A;  4UI9 K;  5J90 A;  2XPZ A;  4U63 A;  4HLE A;  2WXQ A;  1W3B A;  4J8S A;  2PQR A;  2YHC A;  4J8D A;  4C9B B;  3TG5 A;  1ZBP A;  4RG9 A;  4RSY A;  3ONL A;  3VLE A;  3DPD A;  2CHW A;  5JJ6 A;  2KCK A;  3ZHE B;  2LAH A;  1X5B A;  3CVV A;  3KS2 A;  1SZ9 A;  2X6I A;  3CQC B;  4CT0 A;  3MKQ B;  2RG8 A;  1HE8 A;  2OVF A;  4B8C B;  4J8E A;  3B7U X;  4GA1 A;  5C2Y A;  5G2N A;  2I1K A;  1GW6 A;  4N5C A;  3FTZ A;  3QWP A;  4AM9 A;  5G55 A;  4Y6C A;  4WWP A;  3E4B A;  2WXL A;  3BG0 B;  2KC7 A;  3LY7 A;  2OVB A;  4I2Z A;  4XIF A;  4G25 A;  3HDX A;  3S2A A;  4PUC A;  3B7R L;  3FEY A;  3FU3 A;  3DBS A;  4U0Z A;  1PY1 A;  4WAF A;  1PAQ A;  2AXV A;  3R9A B;  1P5Q A;  5JHB A;  4UWG A;  5AIJ A;  3NZS A;  2VSY A;  2XGS A;  5T8I A;  3T5V A;  2L0I A;  3TXN A;  3VTX A;  3GZS A;  3CR3 A;  4JEH A;  3U4T A;  1JWG A;  4JEU A;  1HF8 A;  2PQN A;  3FHE A;  2WMO A;  4ILI A;  4UI9 J;  5AJL A;  3IV0 A;  3FFL A;  4PS8 A;  3ASF A;  3L17 A;  4JHK A;  1UG3 A;  4HOR A;  3CVX A;  3FH7 A;  5JHA A;  5G04 J;  2WXR A;  4PDX A;  3P2B A;  1QZ2 A;  1NA3 A;  3I4G A;  5G04 C;  2IOS A;  5BUZ A;  2XPI A;  4XKC A;  3QOU A;  1TJF A;  5CMW A;  4I2W A;  4FAD A;  2LSU A;  4L23 A;  4FC8 A;  5FZS A;  4J0U A;  3FTU A;  4JA7 A;  2VSX E;  1E8X A;  3CVP A;  3D3M A;  1YA0 A;  3QKY A;  3ZVV A;  3URZ A;  4JC8 A;  5BW8 C;  2KM4 A;  3AS5 A;  4TV3 A;  3ZN3 A;  1NZN A;  3PE3 A;  3TGO A;  4QFV A;  4B0Z A;  4GYW A;  3BG1 B;  4FJZ A;  2BF0 X;  2XRZ A;  1EYH A;  3CHO A;  4W9R A;  2DIW A;  3MJW A;  4GYO A;  3TXM A;  2J4D A;  5JJ7 A;  2XPY A;  3ESK A;  3ENE A;  4GA2 A;  1HS6 A;  3CHM A;  2CFU A;  4NRH B;  5LCW C;  2V8S E;  4ANU A;  4BT9 A;  4I9E A;  2KZT B;  2HM8 A;  4JZY A;  4P29 A;  3SD5 A;  3TG4 A;  5KJL A;  5FQ7 A;  5ENN A;  2M63 A;  3PRZ A;  2J49 A;  1OUV A;  1U3C A;  4JPS A;  4LEU A;  1UJK A;  4ACL A;  2CFZ A;  3O4Z A;  3D9J A;  4YVQ C;  5LOZ A;  3I3N A;  4KVM A;  3CEQ A;  3KEZ A;  3AS4 A;  4LCT A;  3RIB A;  3QWW A;  5FT9 A;  1ELK A;  3KAE A;  4F3V A;  2IU1 A;  3IHV A;  4B94 A;  2VJ8 A;  4XI9 A;  3PNL B;  1ZU2 A;  3CVQ A;  3NZU A;  3UX4 A;  5BNW A;  2MRI A;  4AV7 A;  2BTD A;  5EKQ D;  1SQM A;  4AP2 A;  4CGV A;  4BX8 A;  1PC2 A;  3L16 A;  2Y4T A;  4WND A;  3NF1 A;  3B13 A;  3LVQ E;  2L0T B;  3HVE B;  4HS2 A;  4K03 A;  1N54 A;  5FQ4 A;  5FWQ A;  5LFA A;  1IHG A;  4UWF A;  5DBK A;  4AVX A;  5A6C A;  3U3W A;  4GZD A;  4N3C A;  2WB2 A;  3EDT B;  3FEX A;  4GZ5 A;  4KT6 B;  2FF4 A;  2J08 A;  5T4Y A;  3LJ3 A;  3ZYL A;  3U64 A;  2DBA A;  4F7A A;  2OV8 A;  4I17 A;  2X6F A;  4HXI A;  3PDN A;  2Q7F A;  3CHQ A;  2V4L A;  3U66 A;  1WM5 A;  2RD0 A;  4HOS A;  5LX8 A;  3FUJ A;  3FTV A;  4Q96 A;  2V5F A;  2VSO E;  3ML8 A;  2UY1 B;  4K0R A;  3N71 A;  5ANL A;  5KJM A;  4URK A;  4JVS A;  1IYG A;  3LKU A;  3FU5 A;  4FHK A;  4CDM A;  4FU3 A;  2IJG X;  5E76 A;  3ULQ A;  2VTB B;  3PE4 A;  3I4R B;  3D9L A;  4AJW A;  2IQC A;  5E75 A;  5A23 A;  5HQ8 A;  5ARF A;  1KLX A;  2C2L A;  2ZU6 B;  2IF4 A;  2KCV A;  2WM9 A;  5ARG A;  1Y8M A;  3B7S A;  2LO6 A;  4OYS A;  2JEK A;  3O48 A;  3CVU A;  4F53 A;  4I6E A;  3SGH A;  4EZJ A;  3Q4A B;  1VDY A;  4TUU A;  3RU0 A;  3ML9 A;  4FLH A;  4NUR A;  4GCO A;  2X6J A;  4I1A A;  2YQ8 A;  4U8H A;  3PS6 A;  1NP7 A;  4JL0 A;  2WXN A;  2IOL A;  3FUE A;  4GMJ A;  5C1D A;  2WXM A;  3FH8 A;  3MV2 B;  3SBT B;  1N52 A;  3R7R A;  4XKB A;  5DIZ A;  3S7F A;  1TJC A;  4UQZ A;  5AYW D;  5JJT A;  1TEZ A;  2GGF A;  3D9O A;  2E2E A;  2WXJ A;  3G2U A;  4BY6 A;  3LDZ A;  4GU5 A;  4ILG A;  2WQ6 A;  2KCL A;  3OTN A;  2WVI A;  3CK9 A;  1WY6 A;  1H19 A;  3LPZ A;  4L2L A;  1INZ A;  4I6G A;  4WNF A;  3HIZ A;  2WXG A;  2XCC A;  4ME2 A;  3ESL A;  4N2S A;  3CQG B;  3ZPJ A;  3G2S A;  3L08 A;  3PVL A;  1IQR A;  3MA5 A;  2VGY A;  3UT4 A;  4E6H A;  4FHJ A;  3ZW3 A;  4GPK A;  4I1M A;  1HX8 A;  4UI9 C;  4ANV A;  4GZ6 A;  2AWI A;  5FJY A;  3JYS A;  4A1G A;  4DI3 A;  1E8Z A;  2LNI A;  1HFA A;  4UQY A;  3FTX A;  3PEU B;  3LEW A;  3QC1 A;  1ELR A;  1MQS A;  2WPV A;  2I2O A;  3IEG A;  3UMV A;  3CLJ A;  1HG5 A;  4TRQ A;  2OOE A;  4DK5 A;  4E85 A;  2X6H A;  1EF1 C;  4IN3 B;  4HVB A;  4J8F A;  3FUL A;  4BFR A;  3GW4 A;  4LRZ A;  1IQU A;  2UWJ G;  4A55 A;  4HFG A;  3FUF A;  3CHS A;  4WUY A;  2LAI A;  4BT8 A;  3MGB A;  5EX3 A;  4EBA G;  1WAO 1;  5T3R A;  4O6F A;  4JW1 A;  1QNF A;  5FQ8 A;  3JCK C;  1E96 B;  1L5J A;  3ASG A;  3ZGQ A;  4ANX A;  2VSN A;  2Y4U A;  3L54 A;  3PEV B;  2WXK A;  5AJD A;  2A4Z A;  4HOT A;  3MV3 B;  2XGM A;  1FVH A;  4N3B A;  3LY8 A;  4ABN A;  2GRM A;  2WQH A;  3KD7 A;  2VGX A;  4JHR A;  3APF A;  3L13 A;  3APC A;  5CMY A;  1DVP A;  1MHQ A;  3QJZ A;  4GZ3 A;  3RRU A;  3ASD A;  5CCL A;  1H2U A;  1Z6T A;  3L6A A;  4N39 A;  4IYP A;  2MHK A;  2PL2 A;  3FH5 A;  4H7X A;  2AVP A;  4FUL A;  3PH0 C;  1E90 A;  4EBA A;  3GZ2 A;  3TJP A;  3ZFW A;  3CVL A;  3ZXS A;  3B7T A;  4XI0 A;  2XRY A;  4AOF A;  2XEV A;  2HR2 A;  1EPU A;  3C98 A;  4KBQ A;  3FWV A;  2I1J A;  1UW4 B;  3CVY A;  3GYZ A;  3CKC A;  2R5S A;  3CK7 A;  3LVR E;  4EQF A;  4DI4 A;  4OVU A;  1FVF A;  5EX0 A;  3Q5M A;  3Q15 A;  3WXX A;  2AXZ A;  2J4B A;  3CSF A;  4MLP A;  2YHE A;  4DJA A;  4KZ0 A;  4EZL A;  1HZ4 A;  4G1T A;  4JHJ A;  2VQ2 A;  1H0A A;  1LF8 A;  3SHF A;  5J08 A;  5KJN A;  1JWF A;  1HU3 A;  3UT8 A;  3AU4 A;  2YIN A;  4KVO A;  3PUJ A;  3FUI A;  4MS6 A;  2PM7 A;  3BEE A;  5AEN A;  3AS8 A;  1A17 A;  4DLQ A;  4I9C A;  4I1O B;  3RKV A;  3VLF A;  3CGH A;  2WQ7 A;  3FUD A;  3EHN A;  4XZ4 A;  4EPZ A;  4G26 A;  3EJN A;  3FP3 A;  4JA9 A;  3ZYM A;  3TAX A;  1E7V A;  2AW6 A;  4BX9 A;  1Z3X A;  3RJV A;  2DCP A;  1XNF A;  3G2T A;  3FUM A;  3MYV A;  5A7D B;  2KAT A;  4BTA A;  3SNX A;  1HO8 A;  1ELW A;  3CVN A;  4GYY A;  4CEM A;  4WNE A;  1S0P A;  5FTP A;  3QDN A;  3RO2 A;  2QY7 A;  4XX5 A;  2CG3 A;  4CGW A;  3RRM B;  1U3D A;  4V3I A;  1E7U A;  3OXL A;  4IUL A;  1JUQ A;  2GW1 A;  4Q94 A;  2WXI A;  5BV1 A;  4AY6 A;  2NSZ A;  4DLO A;  4LER A;  3QB2 A;  1HH8 A;  4UWL A;  3MX3 A;  2X38 A;  5D0Q D;  5M72 A;  2CHX A;  2HYZ A;  4APF A;  3UQ3 A;  3QWV A;  3ZHE A;  4A3T A;  2C0M A;  4AEZ C;  1UN8 A;  2J07 A;  1UJJ A;  2FO7 A;  3SFZ A;  3MKQ A;  4PS3 A;  4G11 A;  3FUH A;  4KYO B;  4WWN A;  4B89 A;  2QFC A;  2XCB A;  3S7J A;  5BV0 A;  4CDN A;  3ZEF A;  4XE0 A;  5FZR A;  1H6K A;  3G2V A;  4JXT A;  3UUX A;  3AU5 A;  3SZ7 A;  4GML A;  1QQE A;  3CIA A;  4GZC A;  3CKB A;  4RVB A;  3CVW A;  3U9W A;  2WXP A;  3Q47 B;  4U0S A;  4DPR A;  3PNT B;  4EEC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...