3Q47B

Crystal structure of tpr domain of chip complexed with pseudophosphorylated smad1 peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
132
structure length
132
Chain Sequence
b'SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIP1 homology and U box-containing protein 1
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/transcription
total genus 56
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q47B00
2PL2A 5KJKA 4GA1A 2LSVA 3UPVA 4U0UA 4AM9A 2VQ2A 3Q15A 3Q49B 4J0UA 3PE4A 2VSYA 4N5CA 2AVPA 2HO1A 4I9EA 5G04J 4UI9K 3QKYA 2PQRA 2OOEA 3QOUA 2FBNA 3VTXA 4HOQA 4A1SA 3FP3A 3CK7A 5ARGA 3AS4A 4BT9A 4I2ZA 3ASGA 5LCWC 2KCKA 1ELWA 1TJCA 3VTYA 4U04A 4H7YA 3ASFA 3Q47B 1NA3A 5FJYA 2Q7FA 3GYZA 2C0MA 3OXLA 5KJNA 2LSUA 5AYWD 5FTPA 3KAEA 1YA0A 5M72A 5EX3A 3RO3A 2IFUA 3QDNA 1QZ2A 3ZHEB 4I1AA 4WNFA 2VSNA 4J8DA 5HI7A 4N3CA 1HH8A 4G1TA 4AY5A 4BWRA 1WAO1 2WPVA 4ABNA 2HR2A 4O6FA 2VGYA 4GA2A 3ASDA 5FT9A 2E2EA 2HYZA 4LEUA 5FZRA 4EQFA 4HOTA 3QWPA 4CDRA 4JL0A 2XCCA 2LNIA 1ZU2A 3CVQA 3S7FA 1HXIA 4GYYA 4YVOA 3LPZA 2XPIA 1Y8MA 2BUGA 4N3AA 1ZBPA 2YQ8A 2P58C 3MKRA 4G23A 4HOUA 5BNWA 4RG9A 1W3BA 4UI9C 4KBQA 2V5FA 4IN3B 2IF4A 3UUXA 3LYAA 3MV3B 3ZPJA 3QWWA 3SF4A 3S7BA 4YVQC 4WUYA 4F3VA 5HQ8A 5G05C 3NF1A 4NQ0A 3R9AB 1IYGA 5KJLA 2VGXB 2PQNA 3IEGA 2UY1A 2XGSA 2KATA 3GW4A 5D0OD 3E4BA 3EDTB 4GA0A 4I17A 5A7DB 4BT8A 4UQZA 5D0QD 3CK8A 3GZ2A 3AS8A 3CEQA 4JHRA 1FCHA 2J9QA 3KD7A 1XNFA 4CGVA 2Y4UA 4NRHB 3CVLA 3MA5A 3LY7A 4G25A 5JJTA 2GW1A 3CV0A 5G04C 4RG6A 4GCOA 1KT1A 4U07A 3TG5A 2R5SA 4H7XA 2I6HA 3RIBA 3Q5MA 5CCLA 5FZSA 3CKCA 5CCMA 5DIZA 3PE3A 1HZ4A 3U4TA 3OXFA 2FEZA 2XGOA 4WNGA 5EX0A 4B94A 2DBAA 4CGWA 5FZQA 3CKBA 4N2SA 3JYSA 2UWJG 3RJVA 1KT0A 5BT1A 1WM5A 4APOA 2NC9A 4N2QA 4I2WA 4J8FA 3TG4A 4KXKB 1E96B 4KYOB 4ME2A 4G24A 3KS2A 3RU0A 3ZHEA 3GZ1A 4JA7A 4GYWA 4XI0A 3MEKA 4BTBA 1KLXA 2XCBA 5LCWJ 3ASHA 4G2VA 2WQHA 5JJ6A 3OXGA 4WNDA 4UQYA 3RO2A 1B89A 5CHEE 5KJMA 3ESKA 2Y4TA 3TAXA 2MHKA 5BW8C 3FWVA 3MV2B 4XIFA 3UQ3A 4BTAA 4XI9A 3ZFWA 3SZ7A 3QWVA 1QQEA 4GZ5A 2XGMA 4GYOA 3ZGQA 1A17A 4I9CA 1ELRA 5A6CA 1PC2A 4GPKA 2FI7A 3CVPA 5C1DA 5EKQD 4HORA 4N3BA 3S7DA 2QFCA 4U0ZA 2VGXA 3LKUA 3WXXA 3Q4AB 4W9RA 2KC7A 3LY8A 5ARFA 4G26A 4GZ3A 2FO7A 2KCVA 3PDNA 1OUVA 3BEEA 5JJ7A 4UI9J 2FF4A 3U3WA 2C2LA 3CVNA 3RKVA 4AIFA 2PZIA 4J8EA 3URZA 3FFLA 3ZN3A 3HYMB 3LCAA 3O48A 3S7JA 3TGOA 4GZ6A 4U0SA 2YHCA 3CK9A 4Y6WA 4UQXA 5G05J 2VYIA 4Y6CA 1IHGA 4HOSA 5DBKA 3AS5A 1P5QA 4YNDA 4N39A 2XEVA 3ULQA 3N71A 4WNEA 2L6JA 4AY6A 1NZNA 2ONDA 4JA9A 2UY1B 3K9IA 2C0LA 3LY9A 2KCLA 4GCNA 2JLBA 1NA0A
chains in the Genus database with same CATH superfamily
4TUMA 2EILE 2B6CA 5G55A 4V3IA 3BUAA 3Q15A 2ILRA 2VSYA 4FLBA 3OTNA 1N0QA 4DUIA 4JD2G 3UM2A 3UT7A 5BV1A 3TWTA 3APCA 3TXNA 3UM1A 5G2NA 2P9LG 2WXLA 4GB9A 2BF0X 4HLEA 2FBNA 4DK5A 4A3VA 4Q69A 1TYQG 1MX4A 2F8YA 3IXEA 3CR3A 2DWZA 3ULYA 3ASGA 3PH0C 3ZYMA 2KCKA 4PUCA 4G11A 2P2CP 1O1TA 3CSTA 1AWCB 4AVXA 4BY6A 1FT2A 2I2OA 4A1GA 3EJNA 4H7YA 3ASFA 4UWLA 2KM4A 2LSUA 2J4BA 1JCSA 2YNQA 5FTPA 3ONLA 4XKCA 4GZCA 1YA0A 2IFUA 3QDNA 2GROB 4JEUA 3ZHEB 3D9HA 4Z68A 4LERA 1V54E 2VSNA 4LSZE 2QY7A 2R2LA 1D9SA 4G1TA 4BWRA 5AIJA 1OT8A 2WPVA 1N52A 2XENA 4LNUD 3FTSA 4O6FA 3B95A 5FQ6A 4GA2A 5FT9A 1U3CA 5T8IA 5FZRA 3FY4A 5EYLA 3AG2E 2A4ZA 3SY2A 4EBAG 2WB2A 2IQCA 3ZW3A 2IOSA 2JEKA 4GYYA 4YVOA 3LPZA 5LX8A 2BUGA 4N3AA 3CVWA 1OCRE 2P58C 2WQ6A 4PDXA 4ANWA 1EDUA 4F6RD 1IQUA 2WXIA 4UI9C 5LP0A 1Q2ZA 2V5FA 4IN3B 2IF4A 1HO8A 2GGFA 4HI8A 3CIAA 1UOHA 4GZDA 5CBNA 1DC2A 1IYGA 3ABME 3ABLE 2VGXB 4K5BA 3VLDA 3EDTB 4HLLA 4UQZA 1DNPA 2X3MA 3CK8A 2IO2C 4GU5A 2AJAA 3I5PA 3CEQA 4JHRA 1FCHA 4YDEA 2ZGGA 1N4QA 5JHAA 3L54A 3MA5A 3TWSA 2OVBA 4GPMA 5JJTA 1N11A 2CFZA 3CV0A 3EU5A 3HVEA 4GCOA 2V4LA 3TG5A 4DRXE 5CERB 4TRQA 3ZIMA 1BPOA 2AXUA 3JXJA 2QC9A 1RW2A 3SD5A 4BX8A 3CKCA 4GTMA 2ETBA 2PM6A 3PE3A 3PREA 3OXFA 4B8AA 2XGOA 4WNGA 5EX0A 2DBAA 4CGWA 2ZGDA 3ZXSA 3CQCB 4GAAA 2WQ7A 5B3SE 3TG4A 3KSQA 3D9JA 5ENPD 4GTVA 5BUZA 1E96B 3E37A 2KXPC 4IYPA 3Q78A 3KS2A 3RU0A 2BTDA 2WXMA 4GYWA 4LUNU 3MX3A 5J90A 2XCBA 4JW1A 3C3OA 4C48B 4AJWA 3NQPA 4BETA 3GZSA 2CFUA 4WNDA 4DLOA 5ENRD 4AOFA 4AXHA 1GW6A 5CHEE 3SBSA 3SHFA 2F0YA 5KJMA 3UINC 3UM0A 2Y4TA 5BW8C 4DX5D 1HE8A 2OV8A 1MJ0A 2RFMA 5ENOD 4K5AB 1QQEA 5BXOA 3E34A 2XGMA 1OWMA 3G2UA 4I9CA 3FULA 5A6CA 4LCTA 3PZ2A 2FI7A 3PZ3A 1QYMA 5EYPF 3TXMA 2GRQB 4GMRA 4XEIG 5C1DA 4QFVA 5EKQD 3ESLA 4FJZA 4HI9A 3B7RL 3ASNE 4ANUA 3ENEA 1U2VG 4O1OA 4FADA 3Q4AB 4UWGA 1SVXA 3UT8A 3Q9NC 2KCVA 1OUVA 3TWXA 3LDZA 1HU3A 2X6FA 2CG3A 5A23A 4FJYA 2I1JA 4ANXA 3FTZA 3PS6A 3CVXA 4EPZA 3TGOA 3CK9A 4UQXA 5D2MC 5G05J 1UN9A 4HOSA 2J49A 3NZSA 1OWNA 3N71A 5EDSA 5KNGA 3PUKA 4WNEA 2NYJA 2MOWA 3NB2A 3K9IA 4PS3A 2LUHA 2C0LA 3LY9A 2ZISA 2PL2A 1BD8A 2ZIRA 1IXVA 1X81A 2LSVA 3B7SA 4U0UA 3NBNB 4LG6A 5CEDB 4UWHA 2LAHA 4GMJA 3PE4A 1S63A 3G2VA 2HO1A 4DPRA 3BG0B 3FTUA 4ACLA 4BFRA 3SFXA 2DYRE 4BERA 4KVMA 2PQRA 2OOEA 2WXHA 1EYHA 4GTSA 4XX5A 5AN8A 4ILGA 3FUHA 3VTXA 3HVEB 4APFA 4A1SA 4R7LA 3ML8A 4MKTA 3FP3A 3CK7A 3AS4A 4I2ZA 2H6HA 3PRZA 2AW6A 3J5PA 2XRZA 1INZA 1LD7A 2CHXA 2L9BA 3V79K 4U04A 3QK0A 3Q47B 1NI1A 5C2YA 1NA3A 2Q7FA 3UXGA 4LNGA 4MRUA 3ZYLA 3DXKG 4QQIA 3KAEA 5CEAA 4OVVA 3EHQA 5HKPA 4CCAA 1QZ2A 3Q75A 4C0EA 3QB2A 4EBAA 4WNFA 2DIWA 4J8DA 2P9PG 2J07A 2WXGA 3CGHA 4N3CA 2WM9A 3Q7AA 2V0PA 1WAO1 4ILIA 4ABNA 3T5VA 2CG2A 2IONA 4OYSA 4XKBA 3ZUVB 2M63A 4I43A 3QAQA 4I1OB 3QWPA 2WXOA 4PS7A 1BU9A 4GTTA 1TNBA 5ANRA 4DJAA 2LNIA 1ZU2A 4MS6A 3CQGB 3ZKJA 3CVQA 3HIZA 1Y8MA 3T8MA 1ZBPA 2H6IA 2X6JA 5ANLA 2E0IA 3MKRA 4G23A 4CRWA 2IJGX 4WAFA 5BNWA 3HXEA 1W3BA 1N4SA 3VLFA 3E30A 1NL4A 4KBQA 2IEJA 3C72A 5T3RA 3UKUG 3SF4A 3S7BA 1RZ4A 1H19A 5HS0A 3Q9UC 2BKKB 4FULA 2KZTA 4F3VA 5HQ8A 3FTYA 3NF1A 4XE0A 3T9KA 3E32A 4OAVB 4JXTA 1MX6A 3L22A 4FA6A 1IQRA 3GW4A 4FHJA 2JABA 3IBEA 2DYSE 3LEWA 5A7DB 4BT8A 3JUIA 2PNNA 1K1AA 2GRLA 2P9KG 3AS8A 5CMYA 3KD7A 1XNFA 3FH8A 3L6AA 2XQ0A 2R02A 2Y4UA 2WXPA 1JWFA 3G2WA 4TXPA 3CVLA 4G25A 3ZYQA 3EHRA 3FU6A 2MRIA 5G04C 3SBTB 2ZU6B 1TEZA 2R5SA 4U8YD 4H7XA 1VDYA 2B0OE 2LO6A 3Q5MA 5FZSA 4KMOA 3EU9A 3FEXA 3FUEA 5DIZA 2R17C 3Q73A 1S70B 4DI4A 3RJVA 3DBSA 2FULA 1SW6A 2AXVA 1OCOE 1WM5A 4APOA 5LOZA 2BKGA 2LXLA 4ZFHA 4A3TA 4ATGA 1A5EA 4KXKB 1HG2A 5EILA 3TJPA 2NXPA 4ME2A 4G24A 2VSXE 4WWOA 3FUJA 4GTQA 4WWPA 4JA7A 2IO3C 2WVIA 3DSSA 2DZOA 4XI0A 4BTBA 4CEMA 3D9IA 3AG4E 3EIQC 3EHMA 2WQHA 3SGHA 1U3DA 1TN8A 3S2AA 5FQ4A 3SI5A 4TV3A 3ML9A 1YCSB 4FC8A 3SO8A 1DCQA 3I3NA 3L9TA 3UQ3A 4XI9A 2V4HC 5KCMA 1Y6IA 5CBOA 4DI3A 3QC1A 3L82A 4FU3A 1A17A 1ELRA 1K8KG 2EIJE 2RG8A 4TUUA 1PY1A 3DSXA 2WMNA 3NOGD 3DPYA 1D8EA 2GRNB 4N3BA 3S7DA 3FEYA 1LTXA 1YMPA 2QFCA 4GTOA 4U0ZA 3PZ4A 1E8WA 2P9UG 3LKUA 4JZYA 3PNLB 3WXXA 3QARA 3MGBA 3JQ1A 5B1AE 1E8ZA 5ARFA 1WG0A 5BV0A 4UI9J 1MYOA 1H0AA 2P9IG 2PZIA 2OEWA 3URZA 1O1RA 3IHYA 3ZN3A 1K1BA 5AENA 4EZLA 1BI7B 3O48A 4U0SA 5H7PA 4BX9A 1AP7A 4BESA 1E8YA 3MKQA 3D3MA 5DBKA 4YNDA 1HG5A 2XEVA 2KZTB 2WXQA 4AP2A 3RRNB 2XRYA 1NZNA 2KBXA 3KSLA 5FINA 1N54A 4JVSA 3FH5A 4GCNA 2R03A 1NA0A 4ATZD 4IULA 1TN6A 4GA1A 4ILHB 4M7CA 3AU4A 4K0RA 4JPSA 4HXIA 3HHMA 3CHMA 4AM9A 2VJ8A 1OCCE 2HM8A 3FUFA 3LS8A 3Q49B 4N5QA 1KZPA 4N5CA 4AEZC 1NP7A 4U63A 3CHRA 3D9KA 2HE0A 1KZOA 2J4DA 1E90A 4A63B 3ZYKA 3QKYA 2QYJA 3FDHA 4AV7A 5JHBA 4CDNA 4HS2A 3FH7A 5AQBA 5JA4D 5KWDA 4HOQA 2NSZA 1OWOA 3DPDA 4BT9A 5LCWC 3HXBA 3G2SA 4YDWA 1EPUA 5JMND 3MZLB 1YYHA 1TJCA 4ANVA 3VTYA 3GYZA 5FJYA 5KJNA 3OXLA 4PH4B 4GTRA 3CHQA 2WMOA 1H2TC 4NURA 5EX3A 3TWWA 1OCZE 3ZXPA 1H2UA 1N0RA 1ZB1A 5KBAA 4I1AA 4I6GA 2VGEA 1E8XA 2EQXA 1HH8A 3FTXA 4OVUA 2DCPA 5FQ8A 1UW4B 4KZCA 4FHKA 2VGYA 1HX8A 3ASDA 3EHNA 2E2EA 2HYZA 4EQFA 2A5UA 5BXUA 2RD0A 4JL0A 2XCCA 4BSZB 4CYMD 4EZJA 1SZ9A 3S7FA 2F37A 3J5QB 3ZNGA 3MJWA 3SFZA 3G2TA 4JEHA 1DVPA 2XS1A 4RG9A 3RSEG 3DXMG 3PZ1A 2J09A 3CHSA 3FU0A 4B0ZA 3LYAA 4K03A 3QWWA 3FUMA 4YDYA 4HRLA 2Y69E 4RVBA 2RKKA 4WUYA 3SNXA 3UM3A 4YDOA 5D66A 1S64A 3Q79A 4LRZA 2PQNA 3IEGA 1TNUA 2UY1A 2KATA 4G8LA 1MHQA 3RRMB 4GTPA 4JB8P 3JCKC 2ETCA 2PM7A 4IRUA 3UKRG 4L1BA 4CGVA 1HFAA 3T5XA 3EIJA 5CMWA 2MYOA 2GW1A 3R7RA 2XEEA 3BQOA 4RLYA 5EN5D 1JUQA 1BI8B 4RG6A 4X8QA 3MKQB 3DWLG 1KT1A 4U07A 4TXQA 4U95D 5CCLA 3FUNA 3HXDA 1HZ4A 3U4TA 2IY0C 2FEZA 2ETAA 3CKBA 2YINA 3JYSA 2UWJG 5CRUA 1KT0A 5E75A 5BT1A 2GRMA 4C9BB 4I2WA 1N4PA 4J8FA 2XEHA 3HDXA 2RFAA 2LXMA 4KYOB 4RQIA 3FTVA 3AAAC 2XZDG 1E7VA 3L17A 2X6IA 3UT4A 4XZ4A 5FIOA 1JPLA 2F8XK 4DX6D 3D9OA 2P9SG 4LNBA 2R59A 5FWQA 3ASHA 1X5BA 1O1SA 5CECB 3Q7FA 3P2BA 4E85A 3OXGA 1D8DA 3SQVA 4U8HA 2GRRB 4UWKA 3U66A 4UQYA 4I1MA 1MX2A 3ZU7B 1B89A 2Y3AA 3FUIA 3ESKA 3TAXA 5HRYA 1K3ZD 2L0TB 3FWVA 4XIFA 3DRAA 3EUVA 4BTAA 2L6BA 4UUCA 3UMVA 3ZFWA 3SZ7A 3B13A 1DCEA 2V5QC 3PNTB 4GZ5A 4CZ2D 4HNAD 3ZGQA 2XZTG 3AU5A 1PC2A 1TNOA 5KNHD 1OWPA 5AARA 4GPKA 1IKND 2VSOE 3MYVA 1H6PA 3O4ZA 1EF1C 1SA5A 1Z3YA 3PEVB 4F1SA 4KZ0A 1Z6TA 2OCCE 2XS8A 1QNFA 2IU1A 2KC7A 2H6GA 1N95A 1N4RA 4L23A 3X2QE 3HXCA 1NFIE 3MCXA 5AJLA 3SFYA 4GZ3A 1H6OA 2FO7A 2DZNA 4MLPA 3LJ3A 3PDNA 1UG3A 3ASOE 3BEEA 3E33A 1TJFA 1UN8A 3U3WA 3CVNA 4TXRA 4AIFA 1LF8A 2CHWA 5ENNA 4J6IA 3HYMB 1TNYA 3LCAA 4HRNA 3LXUX 5EIDA 3S7JA 4GZ6A 3VLEA 2YHCA 3JQ0A 4I6JA 2VYIA 4EHMA 3U64A 3DEPA 2VTBA 2AWIA 1P5QA 1Z5SC 3ULQA 3B7TA 2Y1LE 2L6JA 4AY6A 4CDMA 2UY1B 4D10C 3UX4A 3UTMA 2KCLA 1OWLA 3FHEA 3RRUA 2JLBA 3D9LA 5KJKA 4I6EA 4E6HA 3UPVA 3NZUA 4B89A 5AQAA 4KVOA 3L16A 2VQ2A 4J0UA 2J08A 3CLJA 3APDA 1ELKA 2AVPA 2H6FA 3DEOA 4I9EA 5G04J 2Y0BG 4U96D 1N9AA 4UI9K 2IOLA 1XGWA 3V2OA 3QOUA 3KEAA 1TN7A 2WXKA 1S0PA 1L5JA 4NIKA 4DX7D 5ARGA 4J8SA 3ULEG 1E7UA 3D9PA 3HG0D 4MBGA 3DSTA 1UJJA 2XPYA 2OVFA 5IY5E 3T8KA 4U7EB 1ELWA 3TWVA 3ZEFA 2C0MA 1HS6A 5T4YA 5AYWD 3NOCD 1JWGA 3TL5A 2DVWA 3ONKA 5M72A 3RO3A 1FPPA 1FVHA 4FLHA 5J08A 1OY3D 4CT4A 4URKA 5HI7A 5AQ7A 4B93B 2WXJA 4AY5A 2HR2A 2EIKE 4BEPA 1Z3XA 2AXZA 3ZRHA 4LEUA 3IV0A 4HOTA 4K5CA 2WXNA 4CDRA 2R05A 1N94A 4EECA 1MQSA 2EIME 1HXIA 3L08A 2OEVA 2XPIA 3PUJA 4UWFA 3APFA 2YQ8A 4FP7A 1SQMA 1QBQA 4WWNA 4HOUA 4Q96A 5AAOA 3R9MA 4F53A 4M3OA 3C3RA 4O1PA 3UUXA 3MV3B 3ZPJA 3W9GA 3LVRE 4YVQC 2X38A 5G05C 4NQ0A 2L0IA 3R9AB 3FTWA 3HRAA 1BLXB 5KJLA 4L7TA 2WXRA 5B1BE 2XGSA 4JC8A 3B7UX 4F1PA 5D0OD 2X6HA 3E4BA 4RSYA 3AG1E 4I17A 4GA0A 5D0QD 1SZAA 3CVUA 2V8SE 3TWQA 1LD8A 5E76A 5BPPA 4F7AA 3GZ2A 5LFAA 3U9WA 2J9QA 4J8YA 1MZCA 4NRHB 3FU3A 3ISMC 3UIPC 3V30A 3QJZA 3CHPA 4ACKA 3LY7A 4PS8A 3ABKE 2GRPB 3JUEA 2QYUA 4G8KA 2VTBB 4HVBA 3CHOA 3DSUA 3KEZA 3DSVA 1IHBA 2I6HA 3RIBA 2I9CA 3LVQE 5CCMA 4J7WA 5ENSD 4DX1A 4JHJA 3F6QA 3TWRA 3R7QA 3CSFA 4B94A 5FZQA 4N2SA 1WY6A 4HQDA 2NC9A 4N2QA 4L2YA 2XHEA 4DX2A 1V55E 5ENQD 2P9NG 3CVVA 3QNKA 2X6KA 3BU8A 3UIOC 4BSXA 4HBDA 1PAQA 3AJIA 3ZHEA 3C5RA 2FO1E 3GZ1A 3PEUB 1SA4A 1H6KA 2LAIA 3MEKA 3L13A 1KLXA 3V2XA 3NAWA 4Q94A 5LCWJ 4NACA 2XPZA 1TNZA 4G2VA 1OXJA 4ZHBA 4HRMB 5JJ6A 1G3NB 3RK6A 3RO2A 2A5EA 4B8CB 2YHEA 5AJDA 2CHZA 4O60A 3OAWA 3FUDA 4P29A 1KPSB 2MHKA 3D9MA 3TWUA 3ZVVA 3CVYA 3C3QA 3MV2B 1JCRA 5ENTD 1FT1A 2BEDA 3IHVA 3FUKA 3JXIA 2WXFA 2I1KA 3QWVA 5EIBE 1WDYA 4GYOA 4C0MA 1H2VC 3I4RB 4HB5A 4JHKA 3CVPA 2J8SD 3W9FA 4HORA 4A55A 3V31A 4KT6B 4L9PA 4HFGA 3PVLA 4EZKA 4CT0A 1HF8A 2VGXA 1O5MA 3AG3E 4W9RA 3LY8A 3B7BA 1TR4A 1JCQA 3HXFA 3LJNA 3I4GA 4OAUC 4L2LA 4G26A 3RAUA 2EINE 5JJ7A 2FF4A 5FQ7A 2C2LA 4GMLA 3RKVA 3D9NA 3FU5A 4J8EA 4U8VD 3FFLA 3BG1B 3C98A 4Y6WA 1FVFA 4Y6CA 1IHGA 3WG7E 3DSWA 3AS5A 1UJKA 4N39A 5CRVA 3IKOB 3PZDA 3P1UA 4DLQA 2ONDA 4JA9A 3UI2A 2ZXWE 5ITZF 2QZAA 5AQ9A
chains in the Genus database with same CATH topology
2PL2A 3D9LA 5KJKA 4IULA 4GA1A 4I6EA 4ILHB 4E6HA 2LSVA 3UPVA 3AU4A 3B7SA 3NZUA 4U0UA 5G55A 4B89A 4K0RA 4KVOA 4HXIA 4JPSA 3HHMA 3L16A 4V3IA 3CHMA 4AM9A 4UWHA 2VQ2A 3Q15A 2VJ8A 2HM8A 3FUFA 2LAHA 3LS8A 2ILRA 3Q49B 4J0UA 4GMJA 3PE4A 2J08A 2VSYA 3CLJA 4FLBA 4N5CA 3APDA 3OTNA 1ELKA 2AVPA 1NP7A 4AEZC 3G2VA 2HO1A 4DPRA 3BG0B 4I9EA 3FTUA 4U63A 5G04J 3CHRA 3D9KA 3UT7A 4ACLA 5BV1A 4BFRA 3APCA 2J4DA 4UI9K 3TXNA 2IOLA 1E90A 3ZYKA 3QKYA 1XGWA 4KVMA 5G2NA 2PQRA 3FDHA 2OOEA 4AV7A 2WXHA 3QOUA 2WXLA 4GB9A 1EYHA 4HS2A 4CDNA 2BF0X 3FH7A 4XX5A 4HLEA 2FBNA 2WXKA 4ILGA 3FUHA 3VTXA 3HVEB 1S0PA 1L5JA 4APFA 4DK5A 4HOQA 4A1SA 4A3VA 4R7LA 3ML8A 2NSZA 1OWOA 4Q69A 3DPDA 4MKTA 3FP3A 3CK7A 5ARGA 3AS4A 4BT9A 4J8SA 4I2ZA 3CR3A 3ASGA 1E7UA 3D9PA 3PH0C 3ZYMA 5LCWC 2KCKA 3PRZA 1UJJA 2XPYA 4PUCA 2OVFA 2AW6A 4G11A 2XRZA 3G2SA 1ELWA 1INZA 3CSTA 1EPUA 3MZLB 4ANVA 1TJCA 2CHXA 2L9BA 4AVXA 4BY6A 2I2OA 3VTYA 4U04A 4A1GA 3EJNA 3QK0A 4H7YA 3ZEFA 3ASFA 3Q47B 3U3WA 4UWLA 5C2YA 1NA3A 2KM4A 2Q7FA 3GYZA 2C0MA 1HS6A 3OXLA 2LSUA 2J4BA 4PH4B 5FJYA 5AYWD 5T4YA 3CHQA 2YNQA 5FTPA 3ONLA 1JWGA 4MRUA 3TL5A 4XKCA 3ZYLA 4GZCA 2WMOA 1H2TC 3KAEA 1YA0A 3ONKA 4OVVA 5M72A 4NURA 5EX3A 3RO3A 2IFUA 1H2UA 1FVHA 3QDNA 4CCAA 4FLHA 1QZ2A 4JEUA 3QB2A 4I1AA 3ZHEB 4C0EA 4EBAA 4WNFA 4I6GA 4LERA 5J08A 2DIWA 1E8XA 2VSNA 4J8DA 4CT4A 4URKA 2J07A 2WXGA 5HI7A 5JHBA 3CGHA 2QY7A 2WM9A 4N3CA 2EQXA 1HH8A 3FTXA 4OVUA 2WXJA 2DCPA 4G1TA 4AY5A 2V0PA 5FQ8A 4BWRA 5AIJA 1WAO1 4ILIA 2WPVA 1N52A 4ABNA 2HR2A 3T5VA 1UW4B 2CG2A 2IONA 3FTSA 4KZCA 4O6FA 1Z3XA 4FHKA 2VGYA 5FQ6A 1HX8A 2AXZA 4GA2A 3ASDA 3EHNA 4OYSA 4XKBA 5FT9A 3ZRHA 2E2EA 2HYZA 4LEUA 3IV0A 1U3CA 5T8IA 2M63A 4I43A 5FZRA 3QAQA 4EQFA 4I1OB 3FY4A 4HOTA 2A4ZA 2WXNA 3QWPA 2WXOA 4PS7A 4EBAG 2A5UA 2RD0A 4CDRA 4JL0A 2XCCA 2WB2A 5ANRA 4EZJA 4DJAA 2LNIA 1ZU2A 2IQCA 4MS6A 3CQGB 4EECA 1SZ9A 3ZW3A 1MQSA 2IOSA 2JEKA 3CVQA 3S7FA 1HXIA 3L08A 4GYYA 4YVOA 3LPZA 2XPIA 3HIZA 1Y8MA 3PUJA 2BUGA 5LX8A 3T8MA 4N3AA 4UWFA 3CVWA 3MJWA 1ZBPA 3APFA 2X6JA 2YQ8A 5ANLA 4FP7A 2E0IA 2P58C 2WQ6A 1SQMA 3SFZA 4WWNA 3MKRA 4G23A 4CRWA 2IJGX 3G2TA 4HOUA 4PDXA 4WAFA 4Q96A 4JEHA 5BNWA 4ANWA 1DVPA 4RG9A 1EDUA 1IQUA 1W3BA 2WXIA 3VLFA 4UI9C 4F53A 4M3OA 5LP0A 4KBQA 2V5FA 2J09A 4IN3B 2IF4A 3CHSA 3FU0A 3UUXA 4B0ZA 5T3RA 1HO8A 3LYAA 2GGFA 3MV3B 4K03A 3ZPJA 3QWWA 3FUMA 3CIAA 3SF4A 3S7BA 1H19A 3LVRE 4GZDA 4FULA 4YVQC 4RVBA 4WUYA 3SNXA 2KZTA 2X38A 4F3VA 5HQ8A 3FTYA 5G05C 3NF1A 4NQ0A 2L0IA 4XE0A 3R9AB 3FTWA 4JXTA 1IYGA 4LRZA 5KJLA 2VGXB 2PQNA 3IEGA 2UY1A 4L7TA 2WXRA 3L22A 2XGSA 4JC8A 2KATA 4FA6A 1IQRA 3B7UX 3GW4A 4FHJA 5D0OD 2X6HA 3IBEA 3LEWA 3E4BA 3VLDA 4RSYA 3EDTB 4GA0A 4I17A 5A7DB 4BT8A 1MHQA 3JUIA 4UQZA 1DNPA 5D0QD 1SZAA 3RRMB 3CVUA 2V8SE 2GRLA 2X3MA 3CK8A 4GU5A 3JCKC 5E76A 5BPPA 4F7AA 3GZ2A 3AS8A 3CEQA 2PM7A 3I5PA 4JHRA 5CMYA 5LFAA 3U9WA 1FCHA 2J9QA 3KD7A 1XNFA 4IRUA 4L1BA 3FH8A 3L6AA 2XQ0A 4CGVA 2Y4UA 2WXPA 5JHAA 1JWFA 4NRHB 1HFAA 3FU3A 3L54A 3G2WA 3T5XA 3QJZA 3CVLA 3MA5A 3CHPA 4ACKA 3LY7A 4G25A 3EIJA 2OVBA 5CMWA 5JJTA 3ZYQA 2GW1A 3FU6A 4PS8A 3R7RA 2MRIA 2CFZA 3CV0A 5G04C 1JUQA 3SBTB 4RG6A 2ZU6B 1TEZA 3HVEA 4GCOA 2V4LA 3MKQB 2VTBB 1KT1A 4U07A 3TG5A 4HVBA 2R5SA 4TRQA 3ZIMA 3CHOA 4H7XA 1BPOA 3KEZA 2AXUA 1VDYA 2I6HA 3RIBA 2LO6A 2I9CA 3Q5MA 5CCLA 3FUNA 5FZSA 3SD5A 4KMOA 3LVQE 3CKCA 4BX8A 5CCMA 3FEXA 3FUEA 5DIZA 2PM6A 1HZ4A 3PE3A 3PREA 3U4TA 4JHJA 3OXFA 2R17C 2FEZA 4B8AA 4DI4A 2XGOA 4WNGA 3R7QA 5EX0A 3CSFA 4B94A 2DBAA 4CGWA 5FZQA 3CKBA 2YINA 3JYSA 2UWJG 3RJVA 3ZXSA 4N2SA 1WY6A 3CQCB 4GAAA 3DBSA 1KT0A 2FULA 5E75A 2AXVA 5BT1A 1WM5A 4APOA 2GRMA 2WQ7A 2NC9A 4C9BB 4N2QA 5LOZA 4I2WA 4L2YA 4J8FA 2XHEA 3TG4A 3D9JA 3HDXA 4A3TA 4ATGA 5BUZA 4KXKB 1E96B 1HG2A 3CVVA 3QNKA 4KYOB 2X6KA 2NXPA 3TJPA 4ME2A 4BSXA 4IYPA 3FTVA 4G24A 1PAQA 2VSXE 3KS2A 3RU0A 4WWOA 2BTDA 3ZHEA 1E7VA 3L17A 2X6IA 3FUJA 3GZ1A 2WXMA 3PEUB 4WWPA 3UT4A 4JA7A 4XZ4A 1JPLA 4GYWA 4LUNU 1H6KA 2LAIA 2WVIA 3D9OA 3MX3A 5J90A 4XI0A 3MEKA 3L13A 4BTBA 1KLXA 2XCBA 4JW1A 4CEMA 2R59A 3D9IA 4Q94A 5LCWJ 5FWQA 3EIQC 4AJWA 3ASHA 4NACA 1X5BA 3EHMA 2XPZA 4G2VA 2WQHA 3NQPA 5JJ6A 3GZSA 3SGHA 2CFUA 1U3DA 3P2BA 4E85A 3OXGA 3S2AA 5FQ4A 4WNDA 4DLOA 3RK6A 4U8HA 3SI5A 4AOFA 4UWKA 3U66A 4AXHA 4UQYA 1GW6A 3RO2A 4I1MA 3ML9A 4TV3A 4B8CB 2YHEA 5AJDA 2CHZA 1B89A 5CHEE 3OAWA 3SBSA 3SHFA 2Y3AA 5KJMA 3FUIA 3ESKA 3FUDA 4P29A 4FC8A 2Y4TA 3TAXA 2MHKA 3D9MA 5BW8C 3ZVVA 3CVYA 3FWVA 2L0TB 1HE8A 3I3NA 3MV2B 4XIFA 3UQ3A 3IHVA 3FUKA 4XI9A 4BTAA 2OV8A 3UMVA 3ZFWA 2WXFA 2I1KA 5KCMA 1Y6IA 3SZ7A 3B13A 5KJNA 3QWVA 1QQEA 3PNTB 4GZ5A 2XGMA 4DI3A 1OWMA 3G2UA 3QC1A 4FU3A 4GYOA 3ZGQA 1A17A 3FULA 1ELRA 3AU5A 4I9CA 5A6CA 1PC2A 1OWPA 4C0MA 1H2VC 4GPKA 2RG8A 3I4RB 4TUUA 1PY1A 2VSOE 3MYVA 4LCTA 2FI7A 3TXMA 2WMNA 4JHKA 3CVPA 3O4ZA 5C1DA 4QFVA 5EKQD 3ESLA 1EF1C 4HORA 4A55A 4KT6B 1Z3YA 4N3BA 3PEVB 3S7DA 3FEYA 2QFCA 4FJZA 4F1SA 4HFGA 3PVLA 4U0ZA 4KZ0A 1Z6TA 3B7RL 4EZKA 4ANUA 3ENEA 1E8WA 4CT0A 1HF8A 2VGXA 3LKUA 4JZYA 1QNFA 3PNLB 3WXXA 2IU1A 4FADA 3QARA 3Q4AB 4W9RA 3MGBA 4UWGA 2KC7A 3JQ1A 3LY8A 4L23A 1E8ZA 3UT8A 3I4GA 3MCXA 4L2LA 5AJLA 5ARFA 4G26A 4GZ3A 2FO7A 5BV0A 2KCVA 4MLPA 3LJ3A 3PDNA 1OUVA 1UG3A 3LDZA 1HU3A 3BEEA 5JJ7A 4UI9J 2FF4A 1TJFA 1UN8A 2X6FA 2CG3A 2C2LA 1H0AA 3CVNA 4GMLA 5FQ7A 3RKVA 5A23A 3D9NA 3FU5A 4AIFA 2PZIA 4J8EA 4FJYA 2I1JA 3URZA 4ANXA 1LF8A 3FFLA 2CHWA 3IHYA 5ENNA 3FTZA 3BG1B 3PS6A 3CVXA 3ZN3A 4J6IA 3HYMB 3LCAA 4EPZA 5AENA 3C98A 4EZLA 3LXUX 3O48A 3S7JA 3TGOA 4GZ6A 4U0SA 3VLEA 4BX9A 2YHCA 3CK9A 4Y6WA 3JQ0A 4I6JA 1FVFA 4UQXA 5G05J 2VYIA 4Y6CA 3U64A 1E8YA 1IHGA 1UN9A 3MKQA 2VTBA 4HOSA 3D3MA 5DBKA 3AS5A 2AWIA 1P5QA 1UJKA 4YNDA 2J49A 1HG5A 4N39A 2XEVA 3NZSA 1OWNA 3ULQA 3N71A 5EDSA 2KZTB 3B7TA 2WXQA 4AP2A 3IKOB 3PUKA 4WNEA 3RRNB 3PZDA 2L6JA 3P1UA 2XRYA 4AY6A 1NZNA 4DLQA 2MOWA 4CDMA 2ONDA 4JA9A 2UY1B 4D10C 3K9IA 4PS3A 3UX4A 2C0LA 3LY9A 1N54A 4JVSA 2KCLA 3FH5A 4GCNA 1OWLA 3FHEA 3RRUA 2JLBA 1NA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PL2 A;  5KJK A;  4GA1 A;  2LSV A;  3UPV A;  4U0U A;  4AM9 A;  2VQ2 A;  3Q15 A;  3Q49 B;  4J0U A;  3PE4 A;  2VSY A;  4N5C A;  2AVP A;  2HO1 A;  4I9E A;  5G04 J;  4UI9 K;  3QKY A;  2PQR A;  2OOE A;  3QOU A;  2FBN A;  3VTX A;  4HOQ A;  4A1S A;  3FP3 A;  3CK7 A;  5ARG A;  3AS4 A;  4BT9 A;  4I2Z A;  3ASG A;  5LCW C;  2KCK A;  1ELW A;  1TJC A;  3VTY A;  4U04 A;  4H7Y A;  3ASF A;  3Q47 B;  1NA3 A;  5FJY A;  2Q7F A;  3GYZ A;  2C0M A;  3OXL A;  5KJN A;  2LSU A;  5AYW D;  5FTP A;  3KAE A;  1YA0 A;  5M72 A;  5EX3 A;  3RO3 A;  2IFU A;  3QDN A;  1QZ2 A;  3ZHE B;  4I1A A;  4WNF A;  2VSN A;  4J8D A;  5HI7 A;  4N3C A;  1HH8 A;  4G1T A;  4AY5 A;  4BWR A;  1WAO 1;  2WPV A;  4ABN A;  2HR2 A;  4O6F A;  2VGY A;  4GA2 A;  3ASD A;  5FT9 A;  2E2E A;  2HYZ A;  4LEU A;  5FZR A;  4EQF A;  4HOT A;  3QWP A;  4CDR A;  4JL0 A;  2XCC A;  2LNI A;  1ZU2 A;  3CVQ A;  3S7F A;  1HXI A;  4GYY A;  4YVO A;  3LPZ A;  2XPI A;  1Y8M A;  2BUG A;  4N3A A;  1ZBP A;  2YQ8 A;  2P58 C;  3MKR A;  4G23 A;  4HOU A;  5BNW A;  4RG9 A;  1W3B A;  4UI9 C;  4KBQ A;  2V5F A;  4IN3 B;  2IF4 A;  3UUX A;  3LYA A;  3MV3 B;  3ZPJ A;  3QWW A;  3SF4 A;  3S7B A;  4YVQ C;  4WUY A;  4F3V A;  5HQ8 A;  5G05 C;  3NF1 A;  4NQ0 A;  3R9A B;  1IYG A;  5KJL A;  2VGX B;  2PQN A;  3IEG A;  2UY1 A;  2XGS A;  2KAT A;  3GW4 A;  5D0O D;  3E4B A;  3EDT B;  4GA0 A;  4I17 A;  5A7D B;  4BT8 A;  4UQZ A;  5D0Q D;  3CK8 A;  3GZ2 A;  3AS8 A;  3CEQ A;  4JHR A;  1FCH A;  2J9Q A;  3KD7 A;  1XNF A;  4CGV A;  2Y4U A;  4NRH B;  3CVL A;  3MA5 A;  3LY7 A;  4G25 A;  5JJT A;  2GW1 A;  3CV0 A;  5G04 C;  4RG6 A;  4GCO A;  1KT1 A;  4U07 A;  3TG5 A;  2R5S A;  4H7X A;  2I6H A;  3RIB A;  3Q5M A;  5CCL A;  5FZS A;  3CKC A;  5CCM A;  5DIZ A;  3PE3 A;  1HZ4 A;  3U4T A;  3OXF A;  2FEZ A;  2XGO A;  4WNG A;  5EX0 A;  4B94 A;  2DBA A;  4CGW A;  5FZQ A;  3CKB A;  4N2S A;  3JYS A;  2UWJ G;  3RJV A;  1KT0 A;  5BT1 A;  1WM5 A;  4APO A;  2NC9 A;  4N2Q A;  4I2W A;  4J8F A;  3TG4 A;  4KXK B;  1E96 B;  4KYO B;  4ME2 A;  4G24 A;  3KS2 A;  3RU0 A;  3ZHE A;  3GZ1 A;  4JA7 A;  4GYW A;  4XI0 A;  3MEK A;  4BTB A;  1KLX A;  2XCB A;  5LCW J;  3ASH A;  4G2V A;  2WQH A;  5JJ6 A;  3OXG A;  4WND A;  4UQY A;  3RO2 A;  1B89 A;  5CHE E;  5KJM A;  3ESK A;  2Y4T A;  3TAX A;  2MHK A;  5BW8 C;  3FWV A;  3MV2 B;  4XIF A;  3UQ3 A;  4BTA A;  4XI9 A;  3ZFW A;  3SZ7 A;  3QWV A;  1QQE A;  4GZ5 A;  2XGM A;  4GYO A;  3ZGQ A;  1A17 A;  4I9C A;  1ELR A;  5A6C A;  1PC2 A;  4GPK A;  2FI7 A;  3CVP A;  5C1D A;  5EKQ D;  4HOR A;  4N3B A;  3S7D A;  2QFC A;  4U0Z A;  2VGX A;  3LKU A;  3WXX A;  3Q4A B;  4W9R A;  2KC7 A;  3LY8 A;  5ARF A;  4G26 A;  4GZ3 A;  2FO7 A;  2KCV A;  3PDN A;  1OUV A;  3BEE A;  5JJ7 A;  4UI9 J;  2FF4 A;  3U3W A;  2C2L A;  3CVN A;  3RKV A;  4AIF A;  2PZI A;  4J8E A;  3URZ A;  3FFL A;  3ZN3 A;  3HYM B;  3LCA A;  3O48 A;  3S7J A;  3TGO A;  4GZ6 A;  4U0S A;  2YHC A;  3CK9 A;  4Y6W A;  4UQX A;  5G05 J;  2VYI A;  4Y6C A;  1IHG A;  4HOS A;  5DBK A;  3AS5 A;  1P5Q A;  4YND A;  4N39 A;  2XEV A;  3ULQ A;  3N71 A;  4WNE A;  2L6J A;  4AY6 A;  1NZN A;  2OND A;  4JA9 A;  2UY1 B;  3K9I A;  2C0L A;  3LY9 A;  2KCL A;  4GCN A;  2JLB A;  1NA0 A; 
#chains in the Genus database with same CATH topology
 4TUM A;  2EIL E;  2B6C A;  5G55 A;  4V3I A;  3BUA A;  3Q15 A;  2ILR A;  2VSY A;  4FLB A;  3OTN A;  1N0Q A;  4DUI A;  4JD2 G;  3UM2 A;  3UT7 A;  5BV1 A;  3TWT A;  3APC A;  3TXN A;  3UM1 A;  5G2N A;  2P9L G;  2WXL A;  4GB9 A;  2BF0 X;  4HLE A;  2FBN A;  4DK5 A;  4A3V A;  4Q69 A;  1TYQ G;  1MX4 A;  2F8Y A;  3IXE A;  3CR3 A;  2DWZ A;  3ULY A;  3ASG A;  3PH0 C;  3ZYM A;  2KCK A;  4PUC A;  4G11 A;  2P2C P;  1O1T A;  3CST A;  1AWC B;  4AVX A;  4BY6 A;  1FT2 A;  2I2O A;  4A1G A;  3EJN A;  4H7Y A;  3ASF A;  4UWL A;  2KM4 A;  2LSU A;  2J4B A;  1JCS A;  2YNQ A;  5FTP A;  3ONL A;  4XKC A;  4GZC A;  1YA0 A;  2IFU A;  3QDN A;  2GRO B;  4JEU A;  3ZHE B;  3D9H A;  4Z68 A;  4LER A;  1V54 E;  2VSN A;  4LSZ E;  2QY7 A;  2R2L A;  1D9S A;  4G1T A;  4BWR A;  5AIJ A;  1OT8 A;  2WPV A;  1N52 A;  2XEN A;  4LNU D;  3FTS A;  4O6F A;  3B95 A;  5FQ6 A;  4GA2 A;  5FT9 A;  1U3C A;  5T8I A;  5FZR A;  3FY4 A;  5EYL A;  3AG2 E;  2A4Z A;  3SY2 A;  4EBA G;  2WB2 A;  2IQC A;  3ZW3 A;  2IOS A;  2JEK A;  4GYY A;  4YVO A;  3LPZ A;  5LX8 A;  2BUG A;  4N3A A;  3CVW A;  1OCR E;  2P58 C;  2WQ6 A;  4PDX A;  4ANW A;  1EDU A;  4F6R D;  1IQU A;  2WXI A;  4UI9 C;  5LP0 A;  1Q2Z A;  2V5F A;  4IN3 B;  2IF4 A;  1HO8 A;  2GGF A;  4HI8 A;  3CIA A;  1UOH A;  4GZD A;  5CBN A;  1DC2 A;  1IYG A;  3ABM E;  3ABL E;  2VGX B;  4K5B A;  3VLD A;  3EDT B;  4HLL A;  4UQZ A;  1DNP A;  2X3M A;  3CK8 A;  2IO2 C;  4GU5 A;  2AJA A;  3I5P A;  3CEQ A;  4JHR A;  1FCH A;  4YDE A;  2ZGG A;  1N4Q A;  5JHA A;  3L54 A;  3MA5 A;  3TWS A;  2OVB A;  4GPM A;  5JJT A;  1N11 A;  2CFZ A;  3CV0 A;  3EU5 A;  3HVE A;  4GCO A;  2V4L A;  3TG5 A;  4DRX E;  5CER B;  4TRQ A;  3ZIM A;  1BPO A;  2AXU A;  3JXJ A;  2QC9 A;  1RW2 A;  3SD5 A;  4BX8 A;  3CKC A;  4GTM A;  2ETB A;  2PM6 A;  3PE3 A;  3PRE A;  3OXF A;  4B8A A;  2XGO A;  4WNG A;  5EX0 A;  2DBA A;  4CGW A;  2ZGD A;  3ZXS A;  3CQC B;  4GAA A;  2WQ7 A;  5B3S E;  3TG4 A;  3KSQ A;  3D9J A;  5ENP D;  4GTV A;  5BUZ A;  1E96 B;  3E37 A;  2KXP C;  4IYP A;  3Q78 A;  3KS2 A;  3RU0 A;  2BTD A;  2WXM A;  4GYW A;  4LUN U;  3MX3 A;  5J90 A;  2XCB A;  4JW1 A;  3C3O A;  4C48 B;  4AJW A;  3NQP A;  4BET A;  3GZS A;  2CFU A;  4WND A;  4DLO A;  5ENR D;  4AOF A;  4AXH A;  1GW6 A;  5CHE E;  3SBS A;  3SHF A;  2F0Y A;  5KJM A;  3UIN C;  3UM0 A;  2Y4T A;  5BW8 C;  4DX5 D;  1HE8 A;  2OV8 A;  1MJ0 A;  2RFM A;  5ENO D;  4K5A B;  1QQE A;  5BXO A;  3E34 A;  2XGM A;  1OWM A;  3G2U A;  4I9C A;  3FUL A;  5A6C A;  4LCT A;  3PZ2 A;  2FI7 A;  3PZ3 A;  1QYM A;  5EYP F;  3TXM A;  2GRQ B;  4GMR A;  4XEI G;  5C1D A;  4QFV A;  5EKQ D;  3ESL A;  4FJZ A;  4HI9 A;  3B7R L;  3ASN E;  4ANU A;  3ENE A;  1U2V G;  4O1O A;  4FAD A;  3Q4A B;  4UWG A;  1SVX A;  3UT8 A;  3Q9N C;  2KCV A;  1OUV A;  3TWX A;  3LDZ A;  1HU3 A;  2X6F A;  2CG3 A;  5A23 A;  4FJY A;  2I1J A;  4ANX A;  3FTZ A;  3PS6 A;  3CVX A;  4EPZ A;  3TGO A;  3CK9 A;  4UQX A;  5D2M C;  5G05 J;  1UN9 A;  4HOS A;  2J49 A;  3NZS A;  1OWN A;  3N71 A;  5EDS A;  5KNG A;  3PUK A;  4WNE A;  2NYJ A;  2MOW A;  3NB2 A;  3K9I A;  4PS3 A;  2LUH A;  2C0L A;  3LY9 A;  2ZIS A;  2PL2 A;  1BD8 A;  2ZIR A;  1IXV A;  1X81 A;  2LSV A;  3B7S A;  4U0U A;  3NBN B;  4LG6 A;  5CED B;  4UWH A;  2LAH A;  4GMJ A;  3PE4 A;  1S63 A;  3G2V A;  2HO1 A;  4DPR A;  3BG0 B;  3FTU A;  4ACL A;  4BFR A;  3SFX A;  2DYR E;  4BER A;  4KVM A;  2PQR A;  2OOE A;  2WXH A;  1EYH A;  4GTS A;  4XX5 A;  5AN8 A;  4ILG A;  3FUH A;  3VTX A;  3HVE B;  4APF A;  4A1S A;  4R7L A;  3ML8 A;  4MKT A;  3FP3 A;  3CK7 A;  3AS4 A;  4I2Z A;  2H6H A;  3PRZ A;  2AW6 A;  3J5P A;  2XRZ A;  1INZ A;  1LD7 A;  2CHX A;  2L9B A;  3V79 K;  4U04 A;  3QK0 A;  3Q47 B;  1NI1 A;  5C2Y A;  1NA3 A;  2Q7F A;  3UXG A;  4LNG A;  4MRU A;  3ZYL A;  3DXK G;  4QQI A;  3KAE A;  5CEA A;  4OVV A;  3EHQ A;  5HKP A;  4CCA A;  1QZ2 A;  3Q75 A;  4C0E A;  3QB2 A;  4EBA A;  4WNF A;  2DIW A;  4J8D A;  2P9P G;  2J07 A;  2WXG A;  3CGH A;  4N3C A;  2WM9 A;  3Q7A A;  2V0P A;  1WAO 1;  4ILI A;  4ABN A;  3T5V A;  2CG2 A;  2ION A;  4OYS A;  4XKB A;  3ZUV B;  2M63 A;  4I43 A;  3QAQ A;  4I1O B;  3QWP A;  2WXO A;  4PS7 A;  1BU9 A;  4GTT A;  1TNB A;  5ANR A;  4DJA A;  2LNI A;  1ZU2 A;  4MS6 A;  3CQG B;  3ZKJ A;  3CVQ A;  3HIZ A;  1Y8M A;  3T8M A;  1ZBP A;  2H6I A;  2X6J A;  5ANL A;  2E0I A;  3MKR A;  4G23 A;  4CRW A;  2IJG X;  4WAF A;  5BNW A;  3HXE A;  1W3B A;  1N4S A;  3VLF A;  3E30 A;  1NL4 A;  4KBQ A;  2IEJ A;  3C72 A;  5T3R A;  3UKU G;  3SF4 A;  3S7B A;  1RZ4 A;  1H19 A;  5HS0 A;  3Q9U C;  2BKK B;  4FUL A;  2KZT A;  4F3V A;  5HQ8 A;  3FTY A;  3NF1 A;  4XE0 A;  3T9K A;  3E32 A;  4OAV B;  4JXT A;  1MX6 A;  3L22 A;  4FA6 A;  1IQR A;  3GW4 A;  4FHJ A;  2JAB A;  3IBE A;  2DYS E;  3LEW A;  5A7D B;  4BT8 A;  3JUI A;  2PNN A;  1K1A A;  2GRL A;  2P9K G;  3AS8 A;  5CMY A;  3KD7 A;  1XNF A;  3FH8 A;  3L6A A;  2XQ0 A;  2R02 A;  2Y4U A;  2WXP A;  1JWF A;  3G2W A;  4TXP A;  3CVL A;  4G25 A;  3ZYQ A;  3EHR A;  3FU6 A;  2MRI A;  5G04 C;  3SBT B;  2ZU6 B;  1TEZ A;  2R5S A;  4U8Y D;  4H7X A;  1VDY A;  2B0O E;  2LO6 A;  3Q5M A;  5FZS A;  4KMO A;  3EU9 A;  3FEX A;  3FUE A;  5DIZ A;  2R17 C;  3Q73 A;  1S70 B;  4DI4 A;  3RJV A;  3DBS A;  2FUL A;  1SW6 A;  2AXV A;  1OCO E;  1WM5 A;  4APO A;  5LOZ A;  2BKG A;  2LXL A;  4ZFH A;  4A3T A;  4ATG A;  1A5E A;  4KXK B;  1HG2 A;  5EIL A;  3TJP A;  2NXP A;  4ME2 A;  4G24 A;  2VSX E;  4WWO A;  3FUJ A;  4GTQ A;  4WWP A;  4JA7 A;  2IO3 C;  2WVI A;  3DSS A;  2DZO A;  4XI0 A;  4BTB A;  4CEM A;  3D9I A;  3AG4 E;  3EIQ C;  3EHM A;  2WQH A;  3SGH A;  1U3D A;  1TN8 A;  3S2A A;  5FQ4 A;  3SI5 A;  4TV3 A;  3ML9 A;  1YCS B;  4FC8 A;  3SO8 A;  1DCQ A;  3I3N A;  3L9T A;  3UQ3 A;  4XI9 A;  2V4H C;  5KCM A;  1Y6I A;  5CBO A;  4DI3 A;  3QC1 A;  3L82 A;  4FU3 A;  1A17 A;  1ELR A;  1K8K G;  2EIJ E;  2RG8 A;  4TUU A;  1PY1 A;  3DSX A;  2WMN A;  3NOG D;  3DPY A;  1D8E A;  2GRN B;  4N3B A;  3S7D A;  3FEY A;  1LTX A;  1YMP A;  2QFC A;  4GTO A;  4U0Z A;  3PZ4 A;  1E8W A;  2P9U G;  3LKU A;  4JZY A;  3PNL B;  3WXX A;  3QAR A;  3MGB A;  3JQ1 A;  5B1A E;  1E8Z A;  5ARF A;  1WG0 A;  5BV0 A;  4UI9 J;  1MYO A;  1H0A A;  2P9I G;  2PZI A;  2OEW A;  3URZ A;  1O1R A;  3IHY A;  3ZN3 A;  1K1B A;  5AEN A;  4EZL A;  1BI7 B;  3O48 A;  4U0S A;  5H7P A;  4BX9 A;  1AP7 A;  4BES A;  1E8Y A;  3MKQ A;  3D3M A;  5DBK A;  4YND A;  1HG5 A;  2XEV A;  2KZT B;  2WXQ A;  4AP2 A;  3RRN B;  2XRY A;  1NZN A;  2KBX A;  3KSL A;  5FIN A;  1N54 A;  4JVS A;  3FH5 A;  4GCN A;  2R03 A;  1NA0 A;  4ATZ D;  4IUL A;  1TN6 A;  4GA1 A;  4ILH B;  4M7C A;  3AU4 A;  4K0R A;  4JPS A;  4HXI A;  3HHM A;  3CHM A;  4AM9 A;  2VJ8 A;  1OCC E;  2HM8 A;  3FUF A;  3LS8 A;  3Q49 B;  4N5Q A;  1KZP A;  4N5C A;  4AEZ C;  1NP7 A;  4U63 A;  3CHR A;  3D9K A;  2HE0 A;  1KZO A;  2J4D A;  1E90 A;  4A63 B;  3ZYK A;  3QKY A;  2QYJ A;  3FDH A;  4AV7 A;  5JHB A;  4CDN A;  4HS2 A;  3FH7 A;  5AQB A;  5JA4 D;  5KWD A;  4HOQ A;  2NSZ A;  1OWO A;  3DPD A;  4BT9 A;  5LCW C;  3HXB A;  3G2S A;  4YDW A;  1EPU A;  5JMN D;  3MZL B;  1YYH A;  1TJC A;  4ANV A;  3VTY A;  3GYZ A;  5FJY A;  5KJN A;  3OXL A;  4PH4 B;  4GTR A;  3CHQ A;  2WMO A;  1H2T C;  4NUR A;  5EX3 A;  3TWW A;  1OCZ E;  3ZXP A;  1H2U A;  1N0R A;  1ZB1 A;  5KBA A;  4I1A A;  4I6G A;  2VGE A;  1E8X A;  2EQX A;  1HH8 A;  3FTX A;  4OVU A;  2DCP A;  5FQ8 A;  1UW4 B;  4KZC A;  4FHK A;  2VGY A;  1HX8 A;  3ASD A;  3EHN A;  2E2E A;  2HYZ A;  4EQF A;  2A5U A;  5BXU A;  2RD0 A;  4JL0 A;  2XCC A;  4BSZ B;  4CYM D;  4EZJ A;  1SZ9 A;  3S7F A;  2F37 A;  3J5Q B;  3ZNG A;  3MJW A;  3SFZ A;  3G2T A;  4JEH A;  1DVP A;  2XS1 A;  4RG9 A;  3RSE G;  3DXM G;  3PZ1 A;  2J09 A;  3CHS A;  3FU0 A;  4B0Z A;  3LYA A;  4K03 A;  3QWW A;  3FUM A;  4YDY A;  4HRL A;  2Y69 E;  4RVB A;  2RKK A;  4WUY A;  3SNX A;  3UM3 A;  4YDO A;  5D66 A;  1S64 A;  3Q79 A;  4LRZ A;  2PQN A;  3IEG A;  1TNU A;  2UY1 A;  2KAT A;  4G8L A;  1MHQ A;  3RRM B;  4GTP A;  4JB8 P;  3JCK C;  2ETC A;  2PM7 A;  4IRU A;  3UKR G;  4L1B A;  4CGV A;  1HFA A;  3T5X A;  3EIJ A;  5CMW A;  2MYO A;  2GW1 A;  3R7R A;  2XEE A;  3BQO A;  4RLY A;  5EN5 D;  1JUQ A;  1BI8 B;  4RG6 A;  4X8Q A;  3MKQ B;  3DWL G;  1KT1 A;  4U07 A;  4TXQ A;  4U95 D;  5CCL A;  3FUN A;  3HXD A;  1HZ4 A;  3U4T A;  2IY0 C;  2FEZ A;  2ETA A;  3CKB A;  2YIN A;  3JYS A;  2UWJ G;  5CRU A;  1KT0 A;  5E75 A;  5BT1 A;  2GRM A;  4C9B B;  4I2W A;  1N4P A;  4J8F A;  2XEH A;  3HDX A;  2RFA A;  2LXM A;  4KYO B;  4RQI A;  3FTV A;  3AAA C;  2XZD G;  1E7V A;  3L17 A;  2X6I A;  3UT4 A;  4XZ4 A;  5FIO A;  1JPL A;  2F8X K;  4DX6 D;  3D9O A;  2P9S G;  4LNB A;  2R59 A;  5FWQ A;  3ASH A;  1X5B A;  1O1S A;  5CEC B;  3Q7F A;  3P2B A;  4E85 A;  3OXG A;  1D8D A;  3SQV A;  4U8H A;  2GRR B;  4UWK A;  3U66 A;  4UQY A;  4I1M A;  1MX2 A;  3ZU7 B;  1B89 A;  2Y3A A;  3FUI A;  3ESK A;  3TAX A;  5HRY A;  1K3Z D;  2L0T B;  3FWV A;  4XIF A;  3DRA A;  3EUV A;  4BTA A;  2L6B A;  4UUC A;  3UMV A;  3ZFW A;  3SZ7 A;  3B13 A;  1DCE A;  2V5Q C;  3PNT B;  4GZ5 A;  4CZ2 D;  4HNA D;  3ZGQ A;  2XZT G;  3AU5 A;  1PC2 A;  1TNO A;  5KNH D;  1OWP A;  5AAR A;  4GPK A;  1IKN D;  2VSO E;  3MYV A;  1H6P A;  3O4Z A;  1EF1 C;  1SA5 A;  1Z3Y A;  3PEV B;  4F1S A;  4KZ0 A;  1Z6T A;  2OCC E;  2XS8 A;  1QNF A;  2IU1 A;  2KC7 A;  2H6G A;  1N95 A;  1N4R A;  4L23 A;  3X2Q E;  3HXC A;  1NFI E;  3MCX A;  5AJL A;  3SFY A;  4GZ3 A;  1H6O A;  2FO7 A;  2DZN A;  4MLP A;  3LJ3 A;  3PDN A;  1UG3 A;  3ASO E;  3BEE A;  3E33 A;  1TJF A;  1UN8 A;  3U3W A;  3CVN A;  4TXR A;  4AIF A;  1LF8 A;  2CHW A;  5ENN A;  4J6I A;  3HYM B;  1TNY A;  3LCA A;  4HRN A;  3LXU X;  5EID A;  3S7J A;  4GZ6 A;  3VLE A;  2YHC A;  3JQ0 A;  4I6J A;  2VYI A;  4EHM A;  3U64 A;  3DEP A;  2VTB A;  2AWI A;  1P5Q A;  1Z5S C;  3ULQ A;  3B7T A;  2Y1L E;  2L6J A;  4AY6 A;  4CDM A;  2UY1 B;  4D10 C;  3UX4 A;  3UTM A;  2KCL A;  1OWL A;  3FHE A;  3RRU A;  2JLB A;  3D9L A;  5KJK A;  4I6E A;  4E6H A;  3UPV A;  3NZU A;  4B89 A;  5AQA A;  4KVO A;  3L16 A;  2VQ2 A;  4J0U A;  2J08 A;  3CLJ A;  3APD A;  1ELK A;  2AVP A;  2H6F A;  3DEO A;  4I9E A;  5G04 J;  2Y0B G;  4U96 D;  1N9A A;  4UI9 K;  2IOL A;  1XGW A;  3V2O A;  3QOU A;  3KEA A;  1TN7 A;  2WXK A;  1S0P A;  1L5J A;  4NIK A;  4DX7 D;  5ARG A;  4J8S A;  3ULE G;  1E7U A;  3D9P A;  3HG0 D;  4MBG A;  3DST A;  1UJJ A;  2XPY A;  2OVF A;  5IY5 E;  3T8K A;  4U7E B;  1ELW A;  3TWV A;  3ZEF A;  2C0M A;  1HS6 A;  5T4Y A;  5AYW D;  3NOC D;  1JWG A;  3TL5 A;  2DVW A;  3ONK A;  5M72 A;  3RO3 A;  1FPP A;  1FVH A;  4FLH A;  5J08 A;  1OY3 D;  4CT4 A;  4URK A;  5HI7 A;  5AQ7 A;  4B93 B;  2WXJ A;  4AY5 A;  2HR2 A;  2EIK E;  4BEP A;  1Z3X A;  2AXZ A;  3ZRH A;  4LEU A;  3IV0 A;  4HOT A;  4K5C A;  2WXN A;  4CDR A;  2R05 A;  1N94 A;  4EEC A;  1MQS A;  2EIM E;  1HXI A;  3L08 A;  2OEV A;  2XPI A;  3PUJ A;  4UWF A;  3APF A;  2YQ8 A;  4FP7 A;  1SQM A;  1QBQ A;  4WWN A;  4HOU A;  4Q96 A;  5AAO A;  3R9M A;  4F53 A;  4M3O A;  3C3R A;  4O1P A;  3UUX A;  3MV3 B;  3ZPJ A;  3W9G A;  3LVR E;  4YVQ C;  2X38 A;  5G05 C;  4NQ0 A;  2L0I A;  3R9A B;  3FTW A;  3HRA A;  1BLX B;  5KJL A;  4L7T A;  2WXR A;  5B1B E;  2XGS A;  4JC8 A;  3B7U X;  4F1P A;  5D0O D;  2X6H A;  3E4B A;  4RSY A;  3AG1 E;  4I17 A;  4GA0 A;  5D0Q D;  1SZA A;  3CVU A;  2V8S E;  3TWQ A;  1LD8 A;  5E76 A;  5BPP A;  4F7A A;  3GZ2 A;  5LFA A;  3U9W A;  2J9Q A;  4J8Y A;  1MZC A;  4NRH B;  3FU3 A;  3ISM C;  3UIP C;  3V30 A;  3QJZ A;  3CHP A;  4ACK A;  3LY7 A;  4PS8 A;  3ABK E;  2GRP B;  3JUE A;  2QYU A;  4G8K A;  2VTB B;  4HVB A;  3CHO A;  3DSU A;  3KEZ A;  3DSV A;  1IHB A;  2I6H A;  3RIB A;  2I9C A;  3LVQ E;  5CCM A;  4J7W A;  5ENS D;  4DX1 A;  4JHJ A;  3F6Q A;  3TWR A;  3R7Q A;  3CSF A;  4B94 A;  5FZQ A;  4N2S A;  1WY6 A;  4HQD A;  2NC9 A;  4N2Q A;  4L2Y A;  2XHE A;  4DX2 A;  1V55 E;  5ENQ D;  2P9N G;  3CVV A;  3QNK A;  2X6K A;  3BU8 A;  3UIO C;  4BSX A;  4HBD A;  1PAQ A;  3AJI A;  3ZHE A;  3C5R A;  2FO1 E;  3GZ1 A;  3PEU B;  1SA4 A;  1H6K A;  2LAI A;  3MEK A;  3L13 A;  1KLX A;  3V2X A;  3NAW A;  4Q94 A;  5LCW J;  4NAC A;  2XPZ A;  1TNZ A;  4G2V A;  1OXJ A;  4ZHB A;  4HRM B;  5JJ6 A;  1G3N B;  3RK6 A;  3RO2 A;  2A5E A;  4B8C B;  2YHE A;  5AJD A;  2CHZ A;  4O60 A;  3OAW A;  3FUD A;  4P29 A;  1KPS B;  2MHK A;  3D9M A;  3TWU A;  3ZVV A;  3CVY A;  3C3Q A;  3MV2 B;  1JCR A;  5ENT D;  1FT1 A;  2BED A;  3IHV A;  3FUK A;  3JXI A;  2WXF A;  2I1K A;  3QWV A;  5EIB E;  1WDY A;  4GYO A;  4C0M A;  1H2V C;  3I4R B;  4HB5 A;  4JHK A;  3CVP A;  2J8S D;  3W9F A;  4HOR A;  4A55 A;  3V31 A;  4KT6 B;  4L9P A;  4HFG A;  3PVL A;  4EZK A;  4CT0 A;  1HF8 A;  2VGX A;  1O5M A;  3AG3 E;  4W9R A;  3LY8 A;  3B7B A;  1TR4 A;  1JCQ A;  3HXF A;  3LJN A;  3I4G A;  4OAU C;  4L2L A;  4G26 A;  3RAU A;  2EIN E;  5JJ7 A;  2FF4 A;  5FQ7 A;  2C2L A;  4GML A;  3RKV A;  3D9N A;  3FU5 A;  4J8E A;  4U8V D;  3FFL A;  3BG1 B;  3C98 A;  4Y6W A;  1FVF A;  4Y6C A;  1IHG A;  3WG7 E;  3DSW A;  3AS5 A;  1UJK A;  4N39 A;  5CRV A;  3IKO B;  3PZD A;  3P1U A;  4DLQ A;  2OND A;  4JA9 A;  3UI2 A;  2ZXW E;  5ITZ F;  2QZA A;  5AQ9 A; 
#chains in the Genus database with same CATH homology
 2PL2 A;  3D9L A;  5KJK A;  4IUL A;  4GA1 A;  4I6E A;  4ILH B;  4E6H A;  2LSV A;  3UPV A;  3AU4 A;  3B7S A;  3NZU A;  4U0U A;  5G55 A;  4B89 A;  4K0R A;  4KVO A;  4HXI A;  4JPS A;  3HHM A;  3L16 A;  4V3I A;  3CHM A;  4AM9 A;  4UWH A;  2VQ2 A;  3Q15 A;  2VJ8 A;  2HM8 A;  3FUF A;  2LAH A;  3LS8 A;  2ILR A;  3Q49 B;  4J0U A;  4GMJ A;  3PE4 A;  2J08 A;  2VSY A;  3CLJ A;  4FLB A;  4N5C A;  3APD A;  3OTN A;  1ELK A;  2AVP A;  1NP7 A;  4AEZ C;  3G2V A;  2HO1 A;  4DPR A;  3BG0 B;  4I9E A;  3FTU A;  4U63 A;  5G04 J;  3CHR A;  3D9K A;  3UT7 A;  4ACL A;  5BV1 A;  4BFR A;  3APC A;  2J4D A;  4UI9 K;  3TXN A;  2IOL A;  1E90 A;  3ZYK A;  3QKY A;  1XGW A;  4KVM A;  5G2N A;  2PQR A;  3FDH A;  2OOE A;  4AV7 A;  2WXH A;  3QOU A;  2WXL A;  4GB9 A;  1EYH A;  4HS2 A;  4CDN A;  2BF0 X;  3FH7 A;  4XX5 A;  4HLE A;  2FBN A;  2WXK A;  4ILG A;  3FUH A;  3VTX A;  3HVE B;  1S0P A;  1L5J A;  4APF A;  4DK5 A;  4HOQ A;  4A1S A;  4A3V A;  4R7L A;  3ML8 A;  2NSZ A;  1OWO A;  4Q69 A;  3DPD A;  4MKT A;  3FP3 A;  3CK7 A;  5ARG A;  3AS4 A;  4BT9 A;  4J8S A;  4I2Z A;  3CR3 A;  3ASG A;  1E7U A;  3D9P A;  3PH0 C;  3ZYM A;  5LCW C;  2KCK A;  3PRZ A;  1UJJ A;  2XPY A;  4PUC A;  2OVF A;  2AW6 A;  4G11 A;  2XRZ A;  3G2S A;  1ELW A;  1INZ A;  3CST A;  1EPU A;  3MZL B;  4ANV A;  1TJC A;  2CHX A;  2L9B A;  4AVX A;  4BY6 A;  2I2O A;  3VTY A;  4U04 A;  4A1G A;  3EJN A;  3QK0 A;  4H7Y A;  3ZEF A;  3ASF A;  3Q47 B;  3U3W A;  4UWL A;  5C2Y A;  1NA3 A;  2KM4 A;  2Q7F A;  3GYZ A;  2C0M A;  1HS6 A;  3OXL A;  2LSU A;  2J4B A;  4PH4 B;  5FJY A;  5AYW D;  5T4Y A;  3CHQ A;  2YNQ A;  5FTP A;  3ONL A;  1JWG A;  4MRU A;  3TL5 A;  4XKC A;  3ZYL A;  4GZC A;  2WMO A;  1H2T C;  3KAE A;  1YA0 A;  3ONK A;  4OVV A;  5M72 A;  4NUR A;  5EX3 A;  3RO3 A;  2IFU A;  1H2U A;  1FVH A;  3QDN A;  4CCA A;  4FLH A;  1QZ2 A;  4JEU A;  3QB2 A;  4I1A A;  3ZHE B;  4C0E A;  4EBA A;  4WNF A;  4I6G A;  4LER A;  5J08 A;  2DIW A;  1E8X A;  2VSN A;  4J8D A;  4CT4 A;  4URK A;  2J07 A;  2WXG A;  5HI7 A;  5JHB A;  3CGH A;  2QY7 A;  2WM9 A;  4N3C A;  2EQX A;  1HH8 A;  3FTX A;  4OVU A;  2WXJ A;  2DCP A;  4G1T A;  4AY5 A;  2V0P A;  5FQ8 A;  4BWR A;  5AIJ A;  1WAO 1;  4ILI A;  2WPV A;  1N52 A;  4ABN A;  2HR2 A;  3T5V A;  1UW4 B;  2CG2 A;  2ION A;  3FTS A;  4KZC A;  4O6F A;  1Z3X A;  4FHK A;  2VGY A;  5FQ6 A;  1HX8 A;  2AXZ A;  4GA2 A;  3ASD A;  3EHN A;  4OYS A;  4XKB A;  5FT9 A;  3ZRH A;  2E2E A;  2HYZ A;  4LEU A;  3IV0 A;  1U3C A;  5T8I A;  2M63 A;  4I43 A;  5FZR A;  3QAQ A;  4EQF A;  4I1O B;  3FY4 A;  4HOT A;  2A4Z A;  2WXN A;  3QWP A;  2WXO A;  4PS7 A;  4EBA G;  2A5U A;  2RD0 A;  4CDR A;  4JL0 A;  2XCC A;  2WB2 A;  5ANR A;  4EZJ A;  4DJA A;  2LNI A;  1ZU2 A;  2IQC A;  4MS6 A;  3CQG B;  4EEC A;  1SZ9 A;  3ZW3 A;  1MQS A;  2IOS A;  2JEK A;  3CVQ A;  3S7F A;  1HXI A;  3L08 A;  4GYY A;  4YVO A;  3LPZ A;  2XPI A;  3HIZ A;  1Y8M A;  3PUJ A;  2BUG A;  5LX8 A;  3T8M A;  4N3A A;  4UWF A;  3CVW A;  3MJW A;  1ZBP A;  3APF A;  2X6J A;  2YQ8 A;  5ANL A;  4FP7 A;  2E0I A;  2P58 C;  2WQ6 A;  1SQM A;  3SFZ A;  4WWN A;  3MKR A;  4G23 A;  4CRW A;  2IJG X;  3G2T A;  4HOU A;  4PDX A;  4WAF A;  4Q96 A;  4JEH A;  5BNW A;  4ANW A;  1DVP A;  4RG9 A;  1EDU A;  1IQU A;  1W3B A;  2WXI A;  3VLF A;  4UI9 C;  4F53 A;  4M3O A;  5LP0 A;  4KBQ A;  2V5F A;  2J09 A;  4IN3 B;  2IF4 A;  3CHS A;  3FU0 A;  3UUX A;  4B0Z A;  5T3R A;  1HO8 A;  3LYA A;  2GGF A;  3MV3 B;  4K03 A;  3ZPJ A;  3QWW A;  3FUM A;  3CIA A;  3SF4 A;  3S7B A;  1H19 A;  3LVR E;  4GZD A;  4FUL A;  4YVQ C;  4RVB A;  4WUY A;  3SNX A;  2KZT A;  2X38 A;  4F3V A;  5HQ8 A;  3FTY A;  5G05 C;  3NF1 A;  4NQ0 A;  2L0I A;  4XE0 A;  3R9A B;  3FTW A;  4JXT A;  1IYG A;  4LRZ A;  5KJL A;  2VGX B;  2PQN A;  3IEG A;  2UY1 A;  4L7T A;  2WXR A;  3L22 A;  2XGS A;  4JC8 A;  2KAT A;  4FA6 A;  1IQR A;  3B7U X;  3GW4 A;  4FHJ A;  5D0O D;  2X6H A;  3IBE A;  3LEW A;  3E4B A;  3VLD A;  4RSY A;  3EDT B;  4GA0 A;  4I17 A;  5A7D B;  4BT8 A;  1MHQ A;  3JUI A;  4UQZ A;  1DNP A;  5D0Q D;  1SZA A;  3RRM B;  3CVU A;  2V8S E;  2GRL A;  2X3M A;  3CK8 A;  4GU5 A;  3JCK C;  5E76 A;  5BPP A;  4F7A A;  3GZ2 A;  3AS8 A;  3CEQ A;  2PM7 A;  3I5P A;  4JHR A;  5CMY A;  5LFA A;  3U9W A;  1FCH A;  2J9Q A;  3KD7 A;  1XNF A;  4IRU A;  4L1B A;  3FH8 A;  3L6A A;  2XQ0 A;  4CGV A;  2Y4U A;  2WXP A;  5JHA A;  1JWF A;  4NRH B;  1HFA A;  3FU3 A;  3L54 A;  3G2W A;  3T5X A;  3QJZ A;  3CVL A;  3MA5 A;  3CHP A;  4ACK A;  3LY7 A;  4G25 A;  3EIJ A;  2OVB A;  5CMW A;  5JJT A;  3ZYQ A;  2GW1 A;  3FU6 A;  4PS8 A;  3R7R A;  2MRI A;  2CFZ A;  3CV0 A;  5G04 C;  1JUQ A;  3SBT B;  4RG6 A;  2ZU6 B;  1TEZ A;  3HVE A;  4GCO A;  2V4L A;  3MKQ B;  2VTB B;  1KT1 A;  4U07 A;  3TG5 A;  4HVB A;  2R5S A;  4TRQ A;  3ZIM A;  3CHO A;  4H7X A;  1BPO A;  3KEZ A;  2AXU A;  1VDY A;  2I6H A;  3RIB A;  2LO6 A;  2I9C A;  3Q5M A;  5CCL A;  3FUN A;  5FZS A;  3SD5 A;  4KMO A;  3LVQ E;  3CKC A;  4BX8 A;  5CCM A;  3FEX A;  3FUE A;  5DIZ A;  2PM6 A;  1HZ4 A;  3PE3 A;  3PRE A;  3U4T A;  4JHJ A;  3OXF A;  2R17 C;  2FEZ A;  4B8A A;  4DI4 A;  2XGO A;  4WNG A;  3R7Q A;  5EX0 A;  3CSF A;  4B94 A;  2DBA A;  4CGW A;  5FZQ A;  3CKB A;  2YIN A;  3JYS A;  2UWJ G;  3RJV A;  3ZXS A;  4N2S A;  1WY6 A;  3CQC B;  4GAA A;  3DBS A;  1KT0 A;  2FUL A;  5E75 A;  2AXV A;  5BT1 A;  1WM5 A;  4APO A;  2GRM A;  2WQ7 A;  2NC9 A;  4C9B B;  4N2Q A;  5LOZ A;  4I2W A;  4L2Y A;  4J8F A;  2XHE A;  3TG4 A;  3D9J A;  3HDX A;  4A3T A;  4ATG A;  5BUZ A;  4KXK B;  1E96 B;  1HG2 A;  3CVV A;  3QNK A;  4KYO B;  2X6K A;  2NXP A;  3TJP A;  4ME2 A;  4BSX A;  4IYP A;  3FTV A;  4G24 A;  1PAQ A;  2VSX E;  3KS2 A;  3RU0 A;  4WWO A;  2BTD A;  3ZHE A;  1E7V A;  3L17 A;  2X6I A;  3FUJ A;  3GZ1 A;  2WXM A;  3PEU B;  4WWP A;  3UT4 A;  4JA7 A;  4XZ4 A;  1JPL A;  4GYW A;  4LUN U;  1H6K A;  2LAI A;  2WVI A;  3D9O A;  3MX3 A;  5J90 A;  4XI0 A;  3MEK A;  3L13 A;  4BTB A;  1KLX A;  2XCB A;  4JW1 A;  4CEM A;  2R59 A;  3D9I A;  4Q94 A;  5LCW J;  5FWQ A;  3EIQ C;  4AJW A;  3ASH A;  4NAC A;  1X5B A;  3EHM A;  2XPZ A;  4G2V A;  2WQH A;  3NQP A;  5JJ6 A;  3GZS A;  3SGH A;  2CFU A;  1U3D A;  3P2B A;  4E85 A;  3OXG A;  3S2A A;  5FQ4 A;  4WND A;  4DLO A;  3RK6 A;  4U8H A;  3SI5 A;  4AOF A;  4UWK A;  3U66 A;  4AXH A;  4UQY A;  1GW6 A;  3RO2 A;  4I1M A;  3ML9 A;  4TV3 A;  4B8C B;  2YHE A;  5AJD A;  2CHZ A;  1B89 A;  5CHE E;  3OAW A;  3SBS A;  3SHF A;  2Y3A A;  5KJM A;  3FUI A;  3ESK A;  3FUD A;  4P29 A;  4FC8 A;  2Y4T A;  3TAX A;  2MHK A;  3D9M A;  5BW8 C;  3ZVV A;  3CVY A;  3FWV A;  2L0T B;  1HE8 A;  3I3N A;  3MV2 B;  4XIF A;  3UQ3 A;  3IHV A;  3FUK A;  4XI9 A;  4BTA A;  2OV8 A;  3UMV A;  3ZFW A;  2WXF A;  2I1K A;  5KCM A;  1Y6I A;  3SZ7 A;  3B13 A;  5KJN A;  3QWV A;  1QQE A;  3PNT B;  4GZ5 A;  2XGM A;  4DI3 A;  1OWM A;  3G2U A;  3QC1 A;  4FU3 A;  4GYO A;  3ZGQ A;  1A17 A;  3FUL A;  1ELR A;  3AU5 A;  4I9C A;  5A6C A;  1PC2 A;  1OWP A;  4C0M A;  1H2V C;  4GPK A;  2RG8 A;  3I4R B;  4TUU A;  1PY1 A;  2VSO E;  3MYV A;  4LCT A;  2FI7 A;  3TXM A;  2WMN A;  4JHK A;  3CVP A;  3O4Z A;  5C1D A;  4QFV A;  5EKQ D;  3ESL A;  1EF1 C;  4HOR A;  4A55 A;  4KT6 B;  1Z3Y A;  4N3B A;  3PEV B;  3S7D A;  3FEY A;  2QFC A;  4FJZ A;  4F1S A;  4HFG A;  3PVL A;  4U0Z A;  4KZ0 A;  1Z6T A;  3B7R L;  4EZK A;  4ANU A;  3ENE A;  1E8W A;  4CT0 A;  1HF8 A;  2VGX A;  3LKU A;  4JZY A;  1QNF A;  3PNL B;  3WXX A;  2IU1 A;  4FAD A;  3QAR A;  3Q4A B;  4W9R A;  3MGB A;  4UWG A;  2KC7 A;  3JQ1 A;  3LY8 A;  4L23 A;  1E8Z A;  3UT8 A;  3I4G A;  3MCX A;  4L2L A;  5AJL A;  5ARF A;  4G26 A;  4GZ3 A;  2FO7 A;  5BV0 A;  2KCV A;  4MLP A;  3LJ3 A;  3PDN A;  1OUV A;  1UG3 A;  3LDZ A;  1HU3 A;  3BEE A;  5JJ7 A;  4UI9 J;  2FF4 A;  1TJF A;  1UN8 A;  2X6F A;  2CG3 A;  2C2L A;  1H0A A;  3CVN A;  4GML A;  5FQ7 A;  3RKV A;  5A23 A;  3D9N A;  3FU5 A;  4AIF A;  2PZI A;  4J8E A;  4FJY A;  2I1J A;  3URZ A;  4ANX A;  1LF8 A;  3FFL A;  2CHW A;  3IHY A;  5ENN A;  3FTZ A;  3BG1 B;  3PS6 A;  3CVX A;  3ZN3 A;  4J6I A;  3HYM B;  3LCA A;  4EPZ A;  5AEN A;  3C98 A;  4EZL A;  3LXU X;  3O48 A;  3S7J A;  3TGO A;  4GZ6 A;  4U0S A;  3VLE A;  4BX9 A;  2YHC A;  3CK9 A;  4Y6W A;  3JQ0 A;  4I6J A;  1FVF A;  4UQX A;  5G05 J;  2VYI A;  4Y6C A;  3U64 A;  1E8Y A;  1IHG A;  1UN9 A;  3MKQ A;  2VTB A;  4HOS A;  3D3M A;  5DBK A;  3AS5 A;  2AWI A;  1P5Q A;  1UJK A;  4YND A;  2J49 A;  1HG5 A;  4N39 A;  2XEV A;  3NZS A;  1OWN A;  3ULQ A;  3N71 A;  5EDS A;  2KZT B;  3B7T A;  2WXQ A;  4AP2 A;  3IKO B;  3PUK A;  4WNE A;  3RRN B;  3PZD A;  2L6J A;  3P1U A;  2XRY A;  4AY6 A;  1NZN A;  4DLQ A;  2MOW A;  4CDM A;  2OND A;  4JA9 A;  2UY1 B;  4D10 C;  3K9I A;  4PS3 A;  3UX4 A;  2C0L A;  3LY9 A;  1N54 A;  4JVS A;  2KCL A;  3FH5 A;  4GCN A;  1OWL A;  3FHE A;  3RRU A;  2JLB A;  1NA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...