3Q47B

Crystal structure of tpr domain of chip complexed with pseudophosphorylated smad1 peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
132
structure length
132
Chain Sequence
b'SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STIP1 homology and U box-containing protein 1
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/transcription
total genus 56
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q47B00
1ZBPA 4N3AA 4UQXA 4GZ5A 1HH8A 4XI0A 3EDTB 5C1DA 4G24A 5EX0A 3RU0A 3LYAA 2VGXB 4J8FA 4GPKA 2KC7A 2R5SA 3OXLA 2BUGA 5LCWJ 2Y4UA 2PQNA 3Q5MA 2PQRA 5FZRA 1QQEA 1NA0A 4GYYA 4W9RA 3LKUA 4I9EA 3ZGQA 4A1SA 4N2SA 1IHGA 2PZIA 1XNFA 3WXXA 4GA2A 4N39A 5BT1A 3LCAA 2HO1A 1FCHA 3AS5A 5M72A 3KS2A 4EQFA 4J8EA 3MEKA 5LCWC 3S7JA 3FP3A 3VTYA 3LPZA 5FJYA 5ARGA 3QWPA 5CCMA 3K9IA 3QWWA 4JL0A 3Q47B 3U3WA 2LSUA 2HYZA 3ULQA 4YNDA 2FI7A 4G25A 4Y6WA 3Q15A 3RKVA 3QKYA 4CGVA 1OUVA 1IYGA 3FWVA 2IF4A 2JLBA 4U07A 2MHKA 2FF4A 3JYSA 1HZ4A 2XGMA 3SF4A 1TJCA 4N2QA 3QOUA 4AY5A 3CV0A 3TG5A 3FFLA 3UUXA 4BT8A 4YVOA 4GYOA 3QWVA 2VSYA 3IEGA 1ZU2A 2VQ2A 3ASGA 2L6JA 2UY1A 4NRHB 5DIZA 1E96B 3LY8A 3ASHA 4GZ6A 4KXKB 4H7XA 3U4TA 3HYMB 2FEZA 3MA5A 4N3CA 2UY1B 3UPVA 4GCOA 4GYWA 2VGYA 3CK7A 3S7DA 3PE4A 4XIFA 5BNWA 4AM9A 4UI9K 4GCNA 3OXFA 4HOSA 3GW4A 2ONDA 4BTAA 3CVQA 2WPVA 4RG9A 4UI9J 1QZ2A 4G23A 3MV2B 3Q49B 1ELWA 5FZQA 2V5FA 1PC2A 3UQ3A 4BTBA 2OOEA 4G1TA 5KJLA 1W3BA 3BEEA 3ZHEA 3LY7A 4UQZA 3VTXA 4ME2A 3MV3B 4ABNA 3PDNA 1P5QA 3ZHEB 4O6FA 5KJKA 5HQ8A 4G2VA 1WM5A 1KT0A 4CDRA 4J8DA 3RIBA 1A17A 4UI9C 5CHEE 5JJ6A 3ASFA 4APOA 4HORA 2YHCA 4U0SA 2NC9A 5CCLA 2YQ8A 3CKCA 2C2LA 1ELRA 5D0OD 2QFCA 5FZSA 3CK9A 3E4BA 3R9AB 4BWRA 4N3BA 2KCLA 3GYZA 4I2ZA 2AVPA 4WNEA 5A7DB 2Q7FA 4HOQA 2GW1A 4JHRA 5EX3A 1NZNA 3RO3A 4HOUA 4G26A 5AYWD 4J0UA 5KJNA 4I2WA 2J9QA 4LEUA 4WNDA 2C0LA 2I6HA 4WUYA 2XCCA 4I9CA 4H7YA 3O48A 4YVQC 5HI7A 2KATA 4IN3B 2LSVA 2XGSA 1YA0A 4JA9A 1HXIA 5KJMA 5BW8C 1B89A 5JJTA 3CVNA 3GZ2A 3AS8A 4NQ0A 2FBNA 4I17A 2HR2A 5G05J 3ESKA 2E2EA 4WNFA 5DBKA 4F3VA 2VYIA 3CK8A 2KCVA 4KYOB 4BT9A 5G04J 3PE3A 3S7FA 3RO2A 4XI9A 3S7BA 5D0QD 3QDNA 5JJ7A 5EKQD 2C0MA 4GZ3A 3N71A 4AY6A 3ZN3A 3CEQA 3TAXA 1Y8MA 5G05C 4B94A 3CVPA 2LNIA 1WAO1 2FO7A 5FTPA 2PL2A 4KBQA 2WQHA 2DBAA 2XPIA 5FT9A 5ARFA 3ZFWA 3CKBA 4JA7A 4Y6CA 4U04A 3KAEA 5G04C 3LY9A 3ASDA 3AS4A 2XGOA 3KD7A 3MKRA 5A6CA 4HOTA 2UWJG 3OXGA 4GA0A 3CVLA 4RG6A 4GA1A 2Y4TA 2KCKA 3ZPJA 1NA3A 2XCBA 2IFUA 4N5CA 4AIFA 1KLXA 1KT1A 3GZ1A 2VSNA 4UQYA 4WNGA 2P58C 4CGWA 3RJVA 3URZA 3Q4AB 4U0UA 2XEVA 4U0ZA 4I1AA 3NF1A 3SZ7A 3TGOA 3TG4A 2VGXA
chains in the Genus database with same CATH superfamily
1ZBPA 4F7AA 4UQXA 3HXFA 3UXGA 3EDTB 5C1DA 2P9PG 4ILHB 5LP0A 3ZYMA 5EX0A 4LNBA 3X2QE 2KC7A 3CIAA 4L9PA 2EILE 5FZRA 4HI8A 3MKQA 3RRMB 3LKUA 2V4LA 1GW6A 1ZB1A 1IHGA 5ENQD 1E8ZA 3J5QB 5EDSA 4CRWA 3SBSA 4GAAA 2HO1A 2ZIRA 3EU9A 4U8YD 5T4YA 1NP7A 2EIKE 1FCHA 4URKA 4JEUA 5KCMA 3CLJA 1AWCB 4GTMA 2GRNB 3KS2A 5BXOA 4LSZE 4WAFA 3SO8A 3MEKA 1D9SA 4GMLA 2P9SG 3NOCD 5KBAA 3LJ3A 4F53A 4I43A 5AJLA 3QWPA 4M3OA 1TR4A 4ILIA 4U7EB 2AW6A 4MBGA 2IOLA 3E30A 3HVEA 3APCA 1ELKA 3BUAA 2XHEA 3E32A 5LX8A 1H6PA 1LTXA 3Q15A 3RKVA 1IQRA 4OVVA 1OUVA 1IYGA 2HE0A 1JCSA 3FWVA 1N94A 4U07A 2FF4A 3E37A 1PY1A 5ENRD 2XGMA 4KZ0A 3NB2A 4N2QA 2CG2A 3TG5A 2LXLA 3P1UA 4GYOA 2HM8A 3NQPA 3IEGA 1X5BA 3O4ZA 1PAQA 1TNBA 2L6JA 2WXJA 4LG6A 1TN6A 1E96B 2WQ7A 3MCXA 3ASHA 4GZ6A 2XPYA 3RK6A 4E6HA 4HRLA 2FEZA 4PDXA 3SI5A 4C0EA 2WM9A 3UPVA 1TN7A 4ACLA 3LJNA 3AU5A 4BESA 3QJZA 3PH0C 1QYMA 2GGFA 4A55A 2AXVA 5G2NA 3ABME 3AU4A 2ZXWE 4DX6D 5AJDA 1E90A 2OEVA 1X81A 1OCZE 1Z3YA 4HB5A 2RG8A 4UUCA 4AM9A 4XKBA 4YDYA 2E0IA 2MOWA 1N54A 2ONDA 4BTAA 1N0QA 3IKOB 3D9OA 2X6IA 4G23A 3MV2B 4KVMA 3E34A 4O1OA 3Q49B 2DVWA 3ENEA 3IXEA 2OCCE 3NZUA 1LD8A 1KZOA 1W3BA 3BEEA 3LY7A 4WWNA 3PDNA 2IO2C 3PS6A 3CQCB 4TRQA 4DX2A 4O6FA 4U8VD 5AQ9A 3EIJA 4TV3A 4CDRA 3FUDA 2IJGX 3ZUVB 5CHEE 5JJ6A 2XPZA 5KWDA 4GB9A 3UM3A 4U0SA 5CCLA 3L9TA 2YQ8A 2X38A 2Y69E 2LAHA 4TUMA 4DJAA 5AARA 2DWZA 3BG1B 3ML9A 3ZKJA 3LS8A 1U3DA 3E4BA 4WWOA 3MGBA 4HVBA 4N3BA 2KCLA 2I2OA 3RSEG 5J90A 2AVPA 3NAWA 4WNEA 4A1GA 3HHMA 2F8XK 4JC8A 2XEHA 5EX3A 1NZNA 1OWOA 4HQDA 4AP2A 5B1AE 2V5QC 3TWRA 1QBQA 1RW2A 4J0UA 4ZHBA 3QB2A 3EHNA 3D9LA 4I2WA 5BUZA 4LEUA 1OWLA 2WXNA 3SFXA 2LUHA 1V55E 4R7LA 2DYRE 3L54A 1LD7A 2X6KA 2XCCA 4I9CA 4H7YA 1O1SA 3ML8A 3FUEA 4JA9A 2ZGGA 3D9PA 5KJMA 2LXMA 5BW8C 1B89A 3IV0A 4HS2A 2WXLA 3AS8A 2GRPB 4DLQA 4I6GA 4I17A 2IONA 5DBKA 3CK8A 2KCVA 3WG7E 4KYOB 4ANUA 4LNUD 1H2TC 3S7BA 3SNXA 4EHMA 2P9UG 1YYHA 3UIOC 1G3NB 4L23A 4GZ3A 4C48B 3CVUA 3L16A 4UWGA 3FULA 3PZ2A 2R02A 5G05C 3CVPA 4AJWA 3FUFA 1D8EA 1OWPA 2DBAA 2XPIA 5FT9A 3DSWA 3CKBA 4JA7A 3KAEA 2VSOE 4QFVA 4L2YA 1S63A 3KD7A 1WG0A 3MKRA 1TNZA 5CRUA 3AG4E 5BXUA 2DYSE 1FT2A 5E75A 3OXGA 3CVLA 4AXHA 1EDUA 2JEKA 2KCKA 2VTBA 2XCBA 2IFUA 1KLXA 1KT1A 3VLFA 5AAOA 3NOGD 4M7CA 5CERB 3FH7A 4U0UA 2IO3C 4ACKA 2XEVA 4U0ZA 2LO6A 4I1AA 2XS1A 3TGOA 2VGXA 1H6KA 4N3AA 4GTRA 4JEHA 3TWVA 2GROB 2KZTA 2KM4A 1OT8A 2PNNA 3UKUG 4BFRA 4GMRA 1OWMA 4JZYA 4G24A 1UN8A 3DPYA 2R59A 2GRMA 3G2UA 4J8FA 2IOSA 4NIKA 3SFZA 4CT0A 2BUGA 5LCWJ 2L9BA 2Y4UA 2PQNA 3DXMG 2X3MA 1QQEA 1NI1A 1K1BA 3R7QA 3TL5A 4JXTA 3ZGQA 4N2SA 4UWFA 4P29A 1H19A 5D66A 1MJ0A 4GA2A 4N39A 3MKQB 3LCAA 2QYJA 3EJNA 5B3SE 1YCSB 5ENNA 5T8IA 3FHEA 2R05A 3T5VA 2NSZA 5BPPA 4J8EA 3S7JA 4OAVB 3FTWA 3FP3A 5ARGA 1SA4A 1KPSB 3K9IA 4HRNA 3V30A 3DXKG 2XZTG 3Q47B 4A63B 2WVIA 3JXJA 2B6CA 2PM6A 3FU0A 3D3MA 4YNDA 3TWWA 2CFUA 4Y6WA 2AXZA 3B95A 1H0AA 5JHBA 4DX5D 3HVEB 2H6GA 4CGVA 4OYSA 3FTVA 2IF4A 3D9KA 4UWHA 2KXPC 1HZ4A 2J09A 2CG3A 3FFLA 4YVOA 1IQUA 2BEDA 2VSYA 4V3IA 1TNOA 1ZU2A 4J6IA 4MS6A 4FADA 1FT1A 5HRYA 3FU3A 3I3NA 2RKKA 4HXIA 3MJWA 2H6HA 4Q94A 4KXKB 1BI7B 1HG2A 2A4ZA 1FPPA 4IULA 3HYMB 4N3CA 3S2AA 4JPSA 3Q9NC 2YINA 3DWLG 3I4GA 3G2SA 1N9AA 1BU9A 4PS7A 2AXUA 4HFGA 1Q2ZA 2VGEA 2F0YA 3Q78A 3Q79A 2YHEA 1S0PA 5ENOD 4DPRA 1K3ZD 3CK7A 3G2WA 4UWLA 1N4SA 2J49A 1BD8A 4CZ2D 2WXFA 3FTXA 1AP7A 5G55A 3R9MA 3SY2A 1N4QA 3ONLA 4GMJA 2WPVA 5BV1A 2P9NG 4PS3A 1D8DA 1QZ2A 4BERA 3DEOA 3HRAA 3OAWA 4QQIA 3PZ1A 5AN8A 5FZQA 2PM7A 1BLXB 2WB2A 3CVVA 4L2LA 4PH4B 4BTBA 5KJLA 4MKTA 4B0ZA 4CCAA 5H7PA 3VTXA 4B93B 3ZNGA 3MV3B 1P5QA 4XEIG 4CT4A 3DEPA 5HQ8A 1O1RA 2WXMA 1EF1C 3RIBA 4GU5A 4UI9C 3UI2A 1UJKA 4LCTA 3CGHA 5FWQA 4HORA 3HG0D 1HO8A 1RZ4A 3CKCA 3TWSA 5AENA 3C3QA 3LDZA 4U8HA 4YDEA 4B8AA 2R03A 3CSFA 5LOZA 3QK0A 1ELRA 4JB8P 2QFCA 5FZSA 2BKGA 5KNGA 5FQ4A 3TXMA 3GYZA 4I2ZA 3FTUA 5A7DB 1H2VC 2GW1A 2NXPA 3JQ0A 4HOUA 4G26A 4K5CA 3GZSA 4TXQA 3ABLE 1UW4B 5KJNA 3TJPA 2J9QA 3CHOA 3CVYA 2P2CP 2V0PA 3C72A 3PZ4A 1TN8A 1YMPA 3E33A 3ZVVA 3O48A 4YVQC 2QYUA 4XX5A 1YA0A 2F37A 1HS6A 1HXIA 3FTSA 2JABA 3FUHA 3ABKE 1U3CA 5LFAA 3GZ2A 4NQ0A 2WMNA 2HR2A 3FUIA 5FIOA 5EN5D 3ESKA 1NFIE 2V4HC 4NACA 2L0TB 3AG2E 3C3OA 4DLOA 3AJIA 1N4RA 5G04J 2IEJA 3CVWA 2WXRA 1OXJA 4GTTA 5CBNA 3CSTA 4JHKA 2RFAA 2L0IA 3Q7FA 4LNGA 3DPDA 4AY6A 4EZKA 3FUKA 2OVFA 1EYHA 3RRNB 1HU3A 3CEQA 1Y8MA 3DBSA 4RSYA 3FEYA 2FO7A 4LRZA 3ZW3A 2XRZA 4KBQA 3C98A 4Y6CA 2XS8A 4AV7A 3AS4A 4Q69A 2MYOA 3D9HA 1SW6A 3NZSA 5A6CA 2XZDG 4HOTA 1OY3D 4IYPA 1MX4A 4GA1A 4OVUA 1DC2A 4ANXA 3FEXA 3FH8A 4GTPA 5CEAA 4GZDA 3GZ1A 2VSNA 4Q96A 4GTQA 2P58C 4JHJA 4G11A 3IHYA 1Z5SC 2VTBB 1JPLA 3PNTB 3JXIA 1E8WA 1NL4A 4GZ5A 3TWTA 3T8KA 1OWNA 1MZCA 4JVSA 4B89A 3EHMA 2VGXB 3ULEG 3PNLB 3KEAA 3DSUA 2R5SA 2KZTB 2FULA 3SGHA 1DCQA 2PQRA 2J4BA 1HF8A 4K5AB 5JA4D 1NA0A 3D9MA 4GYYA 1FVFA 5AIJA 4DI3A 2PZIA 3UT7A 5CMWA 4AOFA 4UWKA 4K03A 4EQFA 1INZA 2BKKB 1UOHA 4G8KA 4A3VA 1QNFA 5FQ8A 3D9JA 3VTYA 5ENPD 3UT8A 4PS8A 5AQ7A 5CCMA 2GRRB 4TXRA 3V2OA 4LUNU 3B13A 1LF8A 3U3WA 2LSUA 3CR3A 3JUIA 2HYZA 3ULQA 2P9LG 5JHAA 2ETCA 4KT6B 1TEZA 1JCQA 3QKYA 2I9CA 3B7BA 2IU1A 2RD0A 3V79K 3LXUX 4XZ4A 2XEEA 4ILGA 3SF4A 3UM0A 1S70B 3EHQA 2GRLA 1TJCA 5C2YA 3UUXA 4NURA 2EIJE 4YDOA 4GPMA 4BT8A 3T8MA 4FULA 5CMYA 5T3RA 4APFA 3ZYLA 2DZOA 5EYPF 3ASGA 4FC8A 2UY1A 5DIZA 3U64A 3FUJA 4F1PA 4C9BB 3IHVA 3B7RL 3KSQA 3W9GA 1JCRA 4HRMB 2P9KG 3DSXA 4GYWA 4ZFHA 2WXKA 2ZGDA 3S7DA 3PE4A 4XIFA 4CDMA 2Y1LE 2XENA 4UI9K 4GCNA 3OXFA 3F6QA 2FO1E 5FINA 3GW4A 3PZDA 4J8YA 4FU3A 2BTDA 1TNUA 4BEPA 4O1PA 4U63A 3UM2A 1ELWA 4G8LA 2V5FA 1PC2A 3ONKA 5A23A 3UQ3A 2X6HA 1UN9A 3UT4A 3ZHEA 4J8SA 3EUVA 4F6RD 2OVBA 5ENSD 4ABNA 1SZ9A 3EHRA 3RAUA 5KJKA 3QARA 4I6JA 3BU8A 2DZNA 4G2VA 1WM5A 4HLLA 3SD5A 1A17A 1V54E 3UIPC 4E85A 1H2UA 3D9IA 4I1OB 2MRIA 2EIME 1MQSA 4A3TA 3DSTA 3BQOA 1E8XA 4DRXE 5EYLA 4HI9A 3CK9A 4LERA 2EQXA 1IHBA 4I6EA 4EZJA 2VSXE 3UM1A 2WXPA 2H6FA 5CEDB 4KVOA 4IRUA 2NYJA 1TYQG 3RO3A 3L22A 3AG1E 3QNKA 1EPUA 5ITZF 4I1MA 3EIQC 2WXHA 5JMND 1HX8A 1E7VA 4WNDA 4HNAD 2WXIA 4WUYA 3CHRA 4FHKA 1N11A 5IY5E 4O60A 4FHJA 2KATA 5HI7A 2DCPA 4GTOA 2A5UA 5EIBE 5EILA 3PEVB 3UKRG 4KMOA 4ATZD 2A5EA 3FDHA 3CVNA 2ILRA 2FBNA 2J4DA 3APDA 2P9IG 4GZCA 1WDYA 5G05J 2VYIA 3L82A 1OCRE 4BT9A 1U2VG 1O1TA 3PE3A 4BETA 3S7FA 1E7UA 5CRVA 4XI9A 4CEMA 5D0QD 3Q7AA 3BG0B 5EKQD 3I5PA 5EIDA 2H6IA 2M63A 3KSLA 3N71A 1DCEA 4FA6A 3ZN3A 3TAXA 2CHZA 2LNIA 2WXQA 5FTPA 2WQHA 4DI4A 4C0MA 1XGWA 4U04A 3LY9A 1MYOA 3LEWA 3ASDA 5KNHD 3EU5A 1L5JA 2XGOA 2WXOA 5B1BE 2I1JA 4D10C 4GA0A 5CECB 4BSXA 4AVXA 4L7TA 2CHXA 3ASOE 3ZPJA 3B7TA 2QC9A 1NA3A 4F1SA 4UQYA 1E8YA 3FY4A 4FJZA 3RJVA 1KZPA 3Q4AB 1TJFA 4K0RA 3FTYA 3CHPA 2GRQB 4DK5A 3W9FA 3TG4A 3L17A 3LVQE 3Q75A 1HH8A 4ANWA 4XI0A 3T5XA 4MLPA 3MYVA 3RU0A 3LYAA 3J5PA 3PUJA 3CHSA 4GPKA 3OXLA 2XQ0A 3Q5MA 5AQAA 3SBTB 2Y3AA 3MX3A 2LAIA 4K5BA 4W9RA 5BV0A 2ETBA 4I9EA 4A1SA 1XNFA 3U66A 1UJJA 3WXXA 5BT1A 4BX9A 2IY0C 3QAQA 4N5QA 3ESLA 4CYMD 3SFYA 1HFAA 3AS5A 3HXEA 3JUEA 5M72A 3APFA 3ASNE 3V31A 3D9NA 5LCWC 2ETAA 1FVHA 3LPZA 5FQ7A 5FJYA 3AAAC 3QWWA 4JL0A 3ZEFA 1SZAA 2J07A 4DX7D 4CDNA 1JWFA 3VLDA 3I4RB 3L13A 4TXPA 2QY7A 2FI7A 4G25A 4WWPA 3PEUB 5ANRA 1A5EA 2CFZA 3FU5A 2JLBA 2MHKA 3CQGB 3JYSA 3Q9UC 3CHQA 4B8CB 3TWUA 3QOUA 4AY5A 1K8KG 3CV0A 3ZXSA 3MZLB 3FH5A 4EPZA 3QWVA 4XE0A 1DNPA 3L6AA 2VQ2A 5AQBA 2AJAA 4NRHB 3LY8A 1JWGA 2OV8A 3DRAA 4H7XA 3U4TA 4FLBA 3MA5A 2UY1B 1TNYA 4GTSA 2L6BA 3KEZA 2WQ6A 1UG3A 4GCOA 2VGYA 3HDXA 3TWQA 2KBXA 3R7RA 3ULYA 1OCCE 5BNWA 1Z3XA 1Y6IA 1HG5A 4HOSA 1WY6A 4FP7A 1Z6TA 3CVQA 4DUIA 2CHWA 4RG9A 4UI9J 3B7SA 4YDWA 3V2XA 3SHFA 5J08A 4J7WA 1HE8A 3UMVA 3Q73A 4AEZC 1SVXA 2OOEA 4G1TA 4UQZA 3HXDA 4ME2A 1SA5A 2ZU6B 3PZ3A 4DX1A 4GTVA 3ZIMA 5ANLA 3ZHEB 2Y0BG 4EECA 1O5MA 1KT0A 4J8DA 2V8SE 3FU6A 2QZAA 1N95A 3ASFA 4APOA 4ATGA 2YHCA 4L1BA 2NC9A 3PRZA 1IKND 4FJYA 2C2LA 3OTNA 1S64A 4BY6A 2F8YA 5D0OD 3CHMA 3SQVA 2DIWA 2J8SD 3TWXA 3R9AB 4BWRA 2X6JA 3ZXPA 4EZLA 1H6OA 2Q7FA 4HOQA 1BPOA 4JHRA 3G2TA 5CBOA 3G2VA 3HIZA 2WXGA 2YNQA 3L08A 4HBDA 3ISMC 4RLYA 3ZU7B 4Z68A 3PREA 3IBEA 5AYWD 2BF0X 1MHQA 2I1KA 3U9WA 4KZCA 4OAUC 3PVLA 2C0LA 5HKPA 2I6HA 3DSVA 3VLEA 3RRUA 1N52A 2X6FA 3UTMA 4EBAG 2AWIA 1JUQA 4IN3B 2LSVA 2XGSA 3FUNA 3TXNA 3ZYQA 2R2LA 3ZRHA 4RVBA 3AG3E 2EINE 4XKCA 1K1AA 1N4PA 5JJTA 3PUKA 2XRYA 3ZYKA 2IQCA 1VDYA 3HXCA 3P2BA 2E2EA 4WNFA 4F3VA 1SQMA 4EBAA 4BSZB 4JW1A 3QC1A 3LVRE 4U96D 3RO2A 4U95D 3DSSA 2WMOA 5HS0A 5FQ6A 3C3RA 3QDNA 5JJ7A 2R17C 1MX2A 2C0MA 3JQ1A 3T9KA 4HLEA 3UINC 3CVXA 4JD2G 3C5RA 4BX8A 3FUMA 3B7UX 4B94A 1DVPA 1WAO1 2RFMA 2PL2A 5ARFA 3ZFWA 3HXBA 5G04C 4RQIA 1BI8B 5ENTD 2OEWA 3FTZA 1MX6A 1N0RA 2UWJG 5D2MC 2VJ8A 4RG6A 1OCOE 2B0OE 2Y4TA 4TUUA 4X8QA 4FLHA 4N5CA 5E76A 4AIFA 4PUCA 2ZISA 4WNGA 4CGWA 3NBNB 4ANVA 3URZA 2J08A 3JCKC 4MRUA 3UX4A 3NF1A 3SZ7A 1IXVA
chains in the Genus database with same CATH topology
1E8WA 1H6KA 1ZBPA 4N3AA 4JEHA 4F7AA 4UQXA 3LVQE 4GZ5A 4ANWA 1HH8A 4XI0A 1OWNA 2KZTA 2KM4A 3EDTB 4BFRA 5C1DA 1OWMA 4JVSA 3T5XA 4JZYA 4G24A 4ILHB 4MLPA 5EX0A 3ZYMA 4B89A 1UN8A 5LP0A 3MYVA 3RU0A 2R59A 2GRMA 3LYAA 3EHMA 3G2UA 2VGXB 4J8FA 2IOSA 3PUJA 3PNLB 3CHSA 4GPKA 2KC7A 2R5SA 3OXLA 3SFZA 4CT0A 2BUGA 5LCWJ 2L9BA 2Y4UA 2KZTB 2XQ0A 2FULA 2PQNA 3Q5MA 3SGHA 3SBTB 3CIAA 2Y3AA 2PQRA 2X3MA 3MX3A 2J4BA 5FZRA 1HF8A 2LAIA 1QQEA 1NA0A 3D9MA 4GYYA 4W9RA 3MKQA 1FVFA 3RRMB 5BV0A 3LKUA 3R7QA 2V4LA 3TL5A 4I9EA 4JXTA 3ZGQA 1GW6A 4A1SA 4DI3A 5AIJA 4N2SA 1IHGA 2PZIA 4UWFA 1XNFA 4P29A 3U66A 1H19A 1UJJA 3WXXA 1E8ZA 3UT7A 4GA2A 4N39A 5EDSA 5BT1A 4BX9A 3MKQB 4CRWA 3SBSA 5CMWA 3LCAA 4GAAA 2HO1A 3EJNA 4AOFA 3QAQA 5ENNA 3ESLA 5T4YA 4UWKA 5T8IA 1NP7A 1HFAA 1FCHA 3AS5A 4URKA 3FHEA 4JEUA 5KCMA 3CLJA 3T5VA 5M72A 3APFA 4K03A 2NSZA 3KS2A 4WAFA 4EQFA 5BPPA 4J8EA 1INZA 3MEKA 3D9NA 1QNFA 3S7JA 4A3VA 5FQ8A 5LCWC 4GMLA 3D9JA 3FTWA 3FP3A 1FVHA 3LJ3A 3VTYA 4F53A 3LPZA 5FQ7A 5FJYA 5ARGA 3UT8A 4I43A 5AJLA 3QWPA 4M3OA 4PS8A 5CCMA 4ILIA 3K9IA 2AW6A 3QWWA 2IOLA 4LUNU 3B13A 4JL0A 3ZEFA 1SZAA 3Q47B 2J07A 1LF8A 2WVIA 3HVEA 3APCA 1ELKA 3U3WA 2LSUA 1JWFA 2XHEA 3CR3A 3I4RB 3JUIA 3VLDA 4CDNA 3L13A 2HYZA 2PM6A 3FU0A 3D3MA 3ULQA 5LX8A 4YNDA 5JHAA 2CFUA 2QY7A 2FI7A 4G25A 4KT6B 4Y6WA 1TEZA 2AXZA 3Q15A 1H0AA 3RKVA 5JHBA 4WWPA 3HVEB 3QKYA 1IQRA 4OVVA 1OUVA 2I9CA 4DI4A 4CGVA 1IYGA 4OYSA 2IU1A 3FTVA 3PEUB 3FWVA 5ANRA 2IF4A 2CFZA 3D9KA 3FU5A 4UWHA 2JLBA 4U07A 2MHKA 2FF4A 3CQGB 2RD0A 3JYSA 1PY1A 3LXUX 3CHQA 1HZ4A 2J09A 2XGMA 4KZ0A 4ILGA 4XZ4A 3SF4A 2GRLA 4B8CB 1TJCA 5C2YA 2CG3A 4N2QA 2CG2A 3QOUA 4AY5A 3CV0A 3ZXSA 3TG5A 3FFLA 4NURA 3UUXA 4BT8A 3MZLB 1IQUA 3P1UA 3FH5A 4GYOA 4YVOA 4EPZA 2HM8A 3NQPA 3T8MA 4FULA 5CMYA 3QWVA 5T3RA 2VSYA 4APFA 3ZYLA 4XE0A 1DNPA 3IEGA 3L6AA 4V3IA 1X5BA 3O4ZA 1ZU2A 1PAQA 2VQ2A 4J6IA 4MS6A 4FADA 3ASGA 2L6JA 2WXJA 4FC8A 2UY1A 4NRHB 5DIZA 3FU3A 3I3NA 1E96B 3U64A 3FUJA 2WQ7A 4HXIA 3MCXA 3LY8A 3ASHA 3MJWA 1JWGA 4GZ6A 4Q94A 2XPYA 2OV8A 1HG2A 4KXKB 3RK6A 4C9BB 4E6HA 3IHVA 2A4ZA 4H7XA 3U4TA 4IULA 4FLBA 3HYMB 3B7RL 2FEZA 3MA5A 4N3CA 4PDXA 3SI5A 3S2AA 2UY1B 4JPSA 4C0EA 2WM9A 3UPVA 2YINA 3I4GA 3G2SA 4ACLA 3TG4A 3AU5A 3QJZA 3PH0C 4PS7A 3KEZA 2GGFA 4A55A 2AXUA 2AXVA 5G2NA 4HFGA 2WQ6A 1UG3A 3AU4A 4GCOA 2YHEA 4GYWA 2VGYA 3HDXA 5AJDA 1E90A 2WXKA 1S0PA 3R7RA 4DPRA 3CK7A 3G2WA 4UWLA 3S7DA 3PE4A 1Z3YA 4XIFA 2J49A 2RG8A 4CDMA 5BNWA 4AM9A 4UI9K 4GCNA 4XKBA 1Z3XA 2E0IA 1Y6IA 1HG5A 2MOWA 3OXFA 4HOSA 1WY6A 2WXFA 3FTXA 4FP7A 3GW4A 1N54A 2ONDA 3PZDA 5G55A 4BTAA 4FU3A 3ONLA 2BTDA 4GMJA 1Z6TA 3CVQA 2CHWA 2WPVA 5BV1A 4PS3A 4RG9A 4U63A 3IKOB 1QZ2A 3B7SA 3D9OA 4UI9J 3OAWA 5J08A 3SHFA 2X6IA 4G23A 3MV2B 4KVMA 3Q49B 1ELWA 5FZQA 2PM7A 2V5FA 1HE8A 1PC2A 3ONKA 3UMVA 3ENEA 5A23A 3UQ3A 2WB2A 3CVVA 3NZUA 4AEZC 2X6HA 4L2LA 4PH4B 4BTBA 1UN9A 2OOEA 4G1TA 4MKTA 4B0ZA 4CCAA 1W3BA 3BEEA 3UT4A 5KJLA 3ZHEA 3LY7A 4UQZA 3VTXA 4J8SA 4WWNA 2OVBA 4ME2A 3MV3B 4ABNA 3PDNA 2ZU6B 1P5QA 3PS6A 1SZ9A 3CQCB 4CT4A 4TRQA 3ZIMA 5ANLA 3ZHEB 4O6FA 5KJKA 3QARA 4I6JA 3EIJA 4EECA 5HQ8A 4G2VA 1WM5A 1KT0A 4TV3A 2WXMA 3SD5A 4CDRA 4J8DA 3FUDA 1EF1C 3RIBA 1A17A 2V8SE 4GU5A 3FU6A 2IJGX 4UI9C 5CHEE 1UJKA 3ASFA 5JJ6A 4APOA 4LCTA 2XPZA 4E85A 4ATGA 3CGHA 1H2UA 4GB9A 5FWQA 2YHCA 4HORA 4U0SA 1HO8A 4L1BA 2NC9A 3D9IA 5CCLA 4I1OB 3PRZA 2MRIA 2X38A 2YQ8A 3CKCA 2LAHA 5AENA 4DJAA 3LDZA 1MQSA 4A3TA 4U8HA 1E8XA 4FJYA 3BG1B 4B8AA 2C2LA 3OTNA 3CSFA 3ML9A 4BY6A 3LS8A 5LOZA 3QK0A 1ELRA 5D0OD 1U3DA 2QFCA 3CHMA 5FZSA 2DIWA 3CK9A 3E4BA 4WWOA 4LERA 3MGBA 2EQXA 4HVBA 3R9AB 4BWRA 4N3BA 5FQ4A 2KCLA 2I2OA 4I6EA 3GYZA 4I2ZA 2VSXE 3TXMA 4EZJA 5J90A 2AVPA 2WXPA 4WNEA 2X6JA 4A1GA 3FTUA 5A7DB 1H2VC 3HHMA 4EZLA 2Q7FA 4HOQA 4KVOA 4IRUA 2GW1A 1BPOA 2NXPA 3JQ0A 4JC8A 4JHRA 3G2TA 5EX3A 1NZNA 3G2VA 1OWOA 2WXGA 3HIZA 2YNQA 3RO3A 3L08A 4HOUA 4AP2A 3L22A 3QNKA 1EPUA 4G26A 3PREA 3GZSA 3IBEA 5AYWD 2BF0X 4J0UA 1UW4B 3QB2A 3EHNA 1MHQA 5KJNA 3D9LA 3TJPA 4I1MA 2I1KA 3EIQC 4I2WA 2J9QA 2WXHA 4KZCA 3U9WA 5BUZA 4LEUA 1OWLA 1HX8A 3CHOA 1E7VA 2WXNA 4WNDA 3CVYA 3PVLA 2C0LA 2I6HA 2WXIA 2V0PA 4WUYA 3CHRA 4R7LA 3VLEA 3RRUA 1N52A 3L54A 4FHKA 2X6KA 2X6FA 2XCCA 4I9CA 4H7YA 4EBAG 2AWIA 3ZVVA 3O48A 1JUQA 2KATA 4FHJA 4YVQC 5HI7A 2DCPA 4IN3B 2LSVA 2XGSA 3FUNA 3ML8A 3TXNA 4XX5A 3ZYQA 2A5UA 3FUEA 1YA0A 4JA9A 3ZRHA 1HS6A 1HXIA 3PEVB 4RVBA 4KMOA 3FTSA 3FUHA 3D9PA 5KJMA 1U3CA 5BW8C 4XKCA 1B89A 3IV0A 5LFAA 4HS2A 3FDHA 5JJTA 2WXLA 3PUKA 3CVNA 2ILRA 2XRYA 3GZ2A 3ZYKA 3AS8A 2IQCA 1VDYA 2FBNA 4NQ0A 2J4DA 4DLQA 2WMNA 4I6GA 3APDA 4I17A 2IONA 2HR2A 3FUIA 4GZCA 5G05J 3P2BA 3ESKA 2E2EA 4WNFA 5DBKA 4F3VA 2VYIA 3CK8A 4NACA 2KCVA 1SQMA 2L0TB 4DLOA 4KYOB 4EBAA 4BT9A 5G04J 3PE3A 4JW1A 3CVWA 2WXRA 3QC1A 3LVRE 3S7FA 3RO2A 1E7UA 3CSTA 4ANUA 2WMOA 4JHKA 4XI9A 5FQ6A 1H2TC 3S7BA 3SNXA 4CEMA 5D0QD 3QDNA 5JJ7A 2L0IA 2R17C 3BG0B 5EKQD 3I5PA 2C0MA 3JQ1A 2M63A 3DPDA 4L23A 4GZ3A 3N71A 4HLEA 4AY6A 4EZKA 3CVXA 3CVUA 4FA6A 3FUKA 2OVFA 4BX8A 3L16A 1EYHA 3FUMA 3ZN3A 4UWGA 3RRNB 3B7UX 1HU3A 3FULA 3CEQA 3TAXA 2CHZA 1Y8MA 3DBSA 4RSYA 5G05C 4B94A 3CVPA 3FEYA 2LNIA 2WXQA 1DVPA 4AJWA 1WAO1 2FO7A 4LRZA 3FUFA 3ZW3A 5FTPA 2PL2A 2XRZA 4KBQA 2WQHA 1OWPA 2DBAA 2XPIA 5ARFA 5FT9A 3C98A 3CKBA 3ZFWA 4JA7A 1XGWA 4C0MA 4Y6CA 4U04A 3KAEA 5G04C 3LY9A 2VSOE 3LEWA 3ASDA 4QFVA 4AV7A 3AS4A 4L2YA 4Q69A 1L5JA 2XGOA 3KD7A 2WXOA 3MKRA 3NZSA 3FTZA 5A6CA 2I1JA 4D10C 4HOTA 5E75A 4IYPA 2UWJG 3OXGA 4GA0A 3CVLA 2VJ8A 4AXHA 1EDUA 4RG6A 4BSXA 4AVXA 4GA1A 2Y4TA 2CHXA 4L7TA 2JEKA 4OVUA 4TUUA 2KCKA 3ZPJA 2VTBA 3B7TA 4ANXA 1NA3A 3FEXA 2XCBA 3FH8A 4FLHA 2IFUA 4N5CA 1KLXA 1KT1A 5E76A 4AIFA 4GZDA 4PUCA 3GZ1A 2VSNA 4Q96A 4UQYA 3VLFA 4F1SA 4WNGA 2P58C 1E8YA 4CGWA 4JHJA 4G11A 3IHYA 3FY4A 4FJZA 1JPLA 2VTBB 4ANVA 3RJVA 2J08A 3URZA 3PNTB 3FH7A 3Q4AB 4U0UA 3JCKC 2XEVA 4U0ZA 4MRUA 4ACKA 2LO6A 1TJFA 4I1AA 4K0RA 3UX4A 3FTYA 3CHPA 3NF1A 4DK5A 3SZ7A 3TGOA 3L17A 2VGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZBP A;  4N3A A;  4UQX A;  4GZ5 A;  1HH8 A;  4XI0 A;  3EDT B;  5C1D A;  4G24 A;  5EX0 A;  3RU0 A;  3LYA A;  2VGX B;  4J8F A;  4GPK A;  2KC7 A;  2R5S A;  3OXL A;  2BUG A;  5LCW J;  2Y4U A;  2PQN A;  3Q5M A;  2PQR A;  5FZR A;  1QQE A;  1NA0 A;  4GYY A;  4W9R A;  3LKU A;  4I9E A;  3ZGQ A;  4A1S A;  4N2S A;  1IHG A;  2PZI A;  1XNF A;  3WXX A;  4GA2 A;  4N39 A;  5BT1 A;  3LCA A;  2HO1 A;  1FCH A;  3AS5 A;  5M72 A;  3KS2 A;  4EQF A;  4J8E A;  3MEK A;  5LCW C;  3S7J A;  3FP3 A;  3VTY A;  3LPZ A;  5FJY A;  5ARG A;  3QWP A;  5CCM A;  3K9I A;  3QWW A;  4JL0 A;  3Q47 B;  3U3W A;  2LSU A;  2HYZ A;  3ULQ A;  4YND A;  2FI7 A;  4G25 A;  4Y6W A;  3Q15 A;  3RKV A;  3QKY A;  4CGV A;  1OUV A;  1IYG A;  3FWV A;  2IF4 A;  2JLB A;  4U07 A;  2MHK A;  2FF4 A;  3JYS A;  1HZ4 A;  2XGM A;  3SF4 A;  1TJC A;  4N2Q A;  3QOU A;  4AY5 A;  3CV0 A;  3TG5 A;  3FFL A;  3UUX A;  4BT8 A;  4YVO A;  4GYO A;  3QWV A;  2VSY A;  3IEG A;  1ZU2 A;  2VQ2 A;  3ASG A;  2L6J A;  2UY1 A;  4NRH B;  5DIZ A;  1E96 B;  3LY8 A;  3ASH A;  4GZ6 A;  4KXK B;  4H7X A;  3U4T A;  3HYM B;  2FEZ A;  3MA5 A;  4N3C A;  2UY1 B;  3UPV A;  4GCO A;  4GYW A;  2VGY A;  3CK7 A;  3S7D A;  3PE4 A;  4XIF A;  5BNW A;  4AM9 A;  4UI9 K;  4GCN A;  3OXF A;  4HOS A;  3GW4 A;  2OND A;  4BTA A;  3CVQ A;  2WPV A;  4RG9 A;  4UI9 J;  1QZ2 A;  4G23 A;  3MV2 B;  3Q49 B;  1ELW A;  5FZQ A;  2V5F A;  1PC2 A;  3UQ3 A;  4BTB A;  2OOE A;  4G1T A;  5KJL A;  1W3B A;  3BEE A;  3ZHE A;  3LY7 A;  4UQZ A;  3VTX A;  4ME2 A;  3MV3 B;  4ABN A;  3PDN A;  1P5Q A;  3ZHE B;  4O6F A;  5KJK A;  5HQ8 A;  4G2V A;  1WM5 A;  1KT0 A;  4CDR A;  4J8D A;  3RIB A;  1A17 A;  4UI9 C;  5CHE E;  5JJ6 A;  3ASF A;  4APO A;  4HOR A;  2YHC A;  4U0S A;  2NC9 A;  5CCL A;  2YQ8 A;  3CKC A;  2C2L A;  1ELR A;  5D0O D;  2QFC A;  5FZS A;  3CK9 A;  3E4B A;  3R9A B;  4BWR A;  4N3B A;  2KCL A;  3GYZ A;  4I2Z A;  2AVP A;  4WNE A;  5A7D B;  2Q7F A;  4HOQ A;  2GW1 A;  4JHR A;  5EX3 A;  1NZN A;  3RO3 A;  4HOU A;  4G26 A;  5AYW D;  4J0U A;  5KJN A;  4I2W A;  2J9Q A;  4LEU A;  4WND A;  2C0L A;  2I6H A;  4WUY A;  2XCC A;  4I9C A;  4H7Y A;  3O48 A;  4YVQ C;  5HI7 A;  2KAT A;  4IN3 B;  2LSV A;  2XGS A;  1YA0 A;  4JA9 A;  1HXI A;  5KJM A;  5BW8 C;  1B89 A;  5JJT A;  3CVN A;  3GZ2 A;  3AS8 A;  4NQ0 A;  2FBN A;  4I17 A;  2HR2 A;  5G05 J;  3ESK A;  2E2E A;  4WNF A;  5DBK A;  4F3V A;  2VYI A;  3CK8 A;  2KCV A;  4KYO B;  4BT9 A;  5G04 J;  3PE3 A;  3S7F A;  3RO2 A;  4XI9 A;  3S7B A;  5D0Q D;  3QDN A;  5JJ7 A;  5EKQ D;  2C0M A;  4GZ3 A;  3N71 A;  4AY6 A;  3ZN3 A;  3CEQ A;  3TAX A;  1Y8M A;  5G05 C;  4B94 A;  3CVP A;  2LNI A;  1WAO 1;  2FO7 A;  5FTP A;  2PL2 A;  4KBQ A;  2WQH A;  2DBA A;  2XPI A;  5FT9 A;  5ARF A;  3ZFW A;  3CKB A;  4JA7 A;  4Y6C A;  4U04 A;  3KAE A;  5G04 C;  3LY9 A;  3ASD A;  3AS4 A;  2XGO A;  3KD7 A;  3MKR A;  5A6C A;  4HOT A;  2UWJ G;  3OXG A;  4GA0 A;  3CVL A;  4RG6 A;  4GA1 A;  2Y4T A;  2KCK A;  3ZPJ A;  1NA3 A;  2XCB A;  2IFU A;  4N5C A;  4AIF A;  1KLX A;  1KT1 A;  3GZ1 A;  2VSN A;  4UQY A;  4WNG A;  2P58 C;  4CGW A;  3RJV A;  3URZ A;  3Q4A B;  4U0U A;  2XEV A;  4U0Z A;  4I1A A;  3NF1 A;  3SZ7 A;  3TGO A;  3TG4 A;  2VGX A; 
#chains in the Genus database with same CATH topology
 1ZBP A;  4F7A A;  4UQX A;  3HXF A;  3UXG A;  3EDT B;  5C1D A;  2P9P G;  4ILH B;  5LP0 A;  3ZYM A;  5EX0 A;  4LNB A;  3X2Q E;  2KC7 A;  3CIA A;  4L9P A;  2EIL E;  5FZR A;  4HI8 A;  3MKQ A;  3RRM B;  3LKU A;  2V4L A;  1GW6 A;  1ZB1 A;  1IHG A;  5ENQ D;  1E8Z A;  3J5Q B;  5EDS A;  4CRW A;  3SBS A;  4GAA A;  2HO1 A;  2ZIR A;  3EU9 A;  4U8Y D;  5T4Y A;  1NP7 A;  2EIK E;  1FCH A;  4URK A;  4JEU A;  5KCM A;  3CLJ A;  1AWC B;  4GTM A;  2GRN B;  3KS2 A;  5BXO A;  4LSZ E;  4WAF A;  3SO8 A;  3MEK A;  1D9S A;  4GML A;  2P9S G;  3NOC D;  5KBA A;  3LJ3 A;  4F53 A;  4I43 A;  5AJL A;  3QWP A;  4M3O A;  1TR4 A;  4ILI A;  4U7E B;  2AW6 A;  4MBG A;  2IOL A;  3E30 A;  3HVE A;  3APC A;  1ELK A;  3BUA A;  2XHE A;  3E32 A;  5LX8 A;  1H6P A;  1LTX A;  3Q15 A;  3RKV A;  1IQR A;  4OVV A;  1OUV A;  1IYG A;  2HE0 A;  1JCS A;  3FWV A;  1N94 A;  4U07 A;  2FF4 A;  3E37 A;  1PY1 A;  5ENR D;  2XGM A;  4KZ0 A;  3NB2 A;  4N2Q A;  2CG2 A;  3TG5 A;  2LXL A;  3P1U A;  4GYO A;  2HM8 A;  3NQP A;  3IEG A;  1X5B A;  3O4Z A;  1PAQ A;  1TNB A;  2L6J A;  2WXJ A;  4LG6 A;  1TN6 A;  1E96 B;  2WQ7 A;  3MCX A;  3ASH A;  4GZ6 A;  2XPY A;  3RK6 A;  4E6H A;  4HRL A;  2FEZ A;  4PDX A;  3SI5 A;  4C0E A;  2WM9 A;  3UPV A;  1TN7 A;  4ACL A;  3LJN A;  3AU5 A;  4BES A;  3QJZ A;  3PH0 C;  1QYM A;  2GGF A;  4A55 A;  2AXV A;  5G2N A;  3ABM E;  3AU4 A;  2ZXW E;  4DX6 D;  5AJD A;  1E90 A;  2OEV A;  1X81 A;  1OCZ E;  1Z3Y A;  4HB5 A;  2RG8 A;  4UUC A;  4AM9 A;  4XKB A;  4YDY A;  2E0I A;  2MOW A;  1N54 A;  2OND A;  4BTA A;  1N0Q A;  3IKO B;  3D9O A;  2X6I A;  4G23 A;  3MV2 B;  4KVM A;  3E34 A;  4O1O A;  3Q49 B;  2DVW A;  3ENE A;  3IXE A;  2OCC E;  3NZU A;  1LD8 A;  1KZO A;  1W3B A;  3BEE A;  3LY7 A;  4WWN A;  3PDN A;  2IO2 C;  3PS6 A;  3CQC B;  4TRQ A;  4DX2 A;  4O6F A;  4U8V D;  5AQ9 A;  3EIJ A;  4TV3 A;  4CDR A;  3FUD A;  2IJG X;  3ZUV B;  5CHE E;  5JJ6 A;  2XPZ A;  5KWD A;  4GB9 A;  3UM3 A;  4U0S A;  5CCL A;  3L9T A;  2YQ8 A;  2X38 A;  2Y69 E;  2LAH A;  4TUM A;  4DJA A;  5AAR A;  2DWZ A;  3BG1 B;  3ML9 A;  3ZKJ A;  3LS8 A;  1U3D A;  3E4B A;  4WWO A;  3MGB A;  4HVB A;  4N3B A;  2KCL A;  2I2O A;  3RSE G;  5J90 A;  2AVP A;  3NAW A;  4WNE A;  4A1G A;  3HHM A;  2F8X K;  4JC8 A;  2XEH A;  5EX3 A;  1NZN A;  1OWO A;  4HQD A;  4AP2 A;  5B1A E;  2V5Q C;  3TWR A;  1QBQ A;  1RW2 A;  4J0U A;  4ZHB A;  3QB2 A;  3EHN A;  3D9L A;  4I2W A;  5BUZ A;  4LEU A;  1OWL A;  2WXN A;  3SFX A;  2LUH A;  1V55 E;  4R7L A;  2DYR E;  3L54 A;  1LD7 A;  2X6K A;  2XCC A;  4I9C A;  4H7Y A;  1O1S A;  3ML8 A;  3FUE A;  4JA9 A;  2ZGG A;  3D9P A;  5KJM A;  2LXM A;  5BW8 C;  1B89 A;  3IV0 A;  4HS2 A;  2WXL A;  3AS8 A;  2GRP B;  4DLQ A;  4I6G A;  4I17 A;  2ION A;  5DBK A;  3CK8 A;  2KCV A;  3WG7 E;  4KYO B;  4ANU A;  4LNU D;  1H2T C;  3S7B A;  3SNX A;  4EHM A;  2P9U G;  1YYH A;  3UIO C;  1G3N B;  4L23 A;  4GZ3 A;  4C48 B;  3CVU A;  3L16 A;  4UWG A;  3FUL A;  3PZ2 A;  2R02 A;  5G05 C;  3CVP A;  4AJW A;  3FUF A;  1D8E A;  1OWP A;  2DBA A;  2XPI A;  5FT9 A;  3DSW A;  3CKB A;  4JA7 A;  3KAE A;  2VSO E;  4QFV A;  4L2Y A;  1S63 A;  3KD7 A;  1WG0 A;  3MKR A;  1TNZ A;  5CRU A;  3AG4 E;  5BXU A;  2DYS E;  1FT2 A;  5E75 A;  3OXG A;  3CVL A;  4AXH A;  1EDU A;  2JEK A;  2KCK A;  2VTB A;  2XCB A;  2IFU A;  1KLX A;  1KT1 A;  3VLF A;  5AAO A;  3NOG D;  4M7C A;  5CER B;  3FH7 A;  4U0U A;  2IO3 C;  4ACK A;  2XEV A;  4U0Z A;  2LO6 A;  4I1A A;  2XS1 A;  3TGO A;  2VGX A;  1H6K A;  4N3A A;  4GTR A;  4JEH A;  3TWV A;  2GRO B;  2KZT A;  2KM4 A;  1OT8 A;  2PNN A;  3UKU G;  4BFR A;  4GMR A;  1OWM A;  4JZY A;  4G24 A;  1UN8 A;  3DPY A;  2R59 A;  2GRM A;  3G2U A;  4J8F A;  2IOS A;  4NIK A;  3SFZ A;  4CT0 A;  2BUG A;  5LCW J;  2L9B A;  2Y4U A;  2PQN A;  3DXM G;  2X3M A;  1QQE A;  1NI1 A;  1K1B A;  3R7Q A;  3TL5 A;  4JXT A;  3ZGQ A;  4N2S A;  4UWF A;  4P29 A;  1H19 A;  5D66 A;  1MJ0 A;  4GA2 A;  4N39 A;  3MKQ B;  3LCA A;  2QYJ A;  3EJN A;  5B3S E;  1YCS B;  5ENN A;  5T8I A;  3FHE A;  2R05 A;  3T5V A;  2NSZ A;  5BPP A;  4J8E A;  3S7J A;  4OAV B;  3FTW A;  3FP3 A;  5ARG A;  1SA4 A;  1KPS B;  3K9I A;  4HRN A;  3V30 A;  3DXK G;  2XZT G;  3Q47 B;  4A63 B;  2WVI A;  3JXJ A;  2B6C A;  2PM6 A;  3FU0 A;  3D3M A;  4YND A;  3TWW A;  2CFU A;  4Y6W A;  2AXZ A;  3B95 A;  1H0A A;  5JHB A;  4DX5 D;  3HVE B;  2H6G A;  4CGV A;  4OYS A;  3FTV A;  2IF4 A;  3D9K A;  4UWH A;  2KXP C;  1HZ4 A;  2J09 A;  2CG3 A;  3FFL A;  4YVO A;  1IQU A;  2BED A;  2VSY A;  4V3I A;  1TNO A;  1ZU2 A;  4J6I A;  4MS6 A;  4FAD A;  1FT1 A;  5HRY A;  3FU3 A;  3I3N A;  2RKK A;  4HXI A;  3MJW A;  2H6H A;  4Q94 A;  4KXK B;  1BI7 B;  1HG2 A;  2A4Z A;  1FPP A;  4IUL A;  3HYM B;  4N3C A;  3S2A A;  4JPS A;  3Q9N C;  2YIN A;  3DWL G;  3I4G A;  3G2S A;  1N9A A;  1BU9 A;  4PS7 A;  2AXU A;  4HFG A;  1Q2Z A;  2VGE A;  2F0Y A;  3Q78 A;  3Q79 A;  2YHE A;  1S0P A;  5ENO D;  4DPR A;  1K3Z D;  3CK7 A;  3G2W A;  4UWL A;  1N4S A;  2J49 A;  1BD8 A;  4CZ2 D;  2WXF A;  3FTX A;  1AP7 A;  5G55 A;  3R9M A;  3SY2 A;  1N4Q A;  3ONL A;  4GMJ A;  2WPV A;  5BV1 A;  2P9N G;  4PS3 A;  1D8D A;  1QZ2 A;  4BER A;  3DEO A;  3HRA A;  3OAW A;  4QQI A;  3PZ1 A;  5AN8 A;  5FZQ A;  2PM7 A;  1BLX B;  2WB2 A;  3CVV A;  4L2L A;  4PH4 B;  4BTB A;  5KJL A;  4MKT A;  4B0Z A;  4CCA A;  5H7P A;  3VTX A;  4B93 B;  3ZNG A;  3MV3 B;  1P5Q A;  4XEI G;  4CT4 A;  3DEP A;  5HQ8 A;  1O1R A;  2WXM A;  1EF1 C;  3RIB A;  4GU5 A;  4UI9 C;  3UI2 A;  1UJK A;  4LCT A;  3CGH A;  5FWQ A;  4HOR A;  3HG0 D;  1HO8 A;  1RZ4 A;  3CKC A;  3TWS A;  5AEN A;  3C3Q A;  3LDZ A;  4U8H A;  4YDE A;  4B8A A;  2R03 A;  3CSF A;  5LOZ A;  3QK0 A;  1ELR A;  4JB8 P;  2QFC A;  5FZS A;  2BKG A;  5KNG A;  5FQ4 A;  3TXM A;  3GYZ A;  4I2Z A;  3FTU A;  5A7D B;  1H2V C;  2GW1 A;  2NXP A;  3JQ0 A;  4HOU A;  4G26 A;  4K5C A;  3GZS A;  4TXQ A;  3ABL E;  1UW4 B;  5KJN A;  3TJP A;  2J9Q A;  3CHO A;  3CVY A;  2P2C P;  2V0P A;  3C72 A;  3PZ4 A;  1TN8 A;  1YMP A;  3E33 A;  3ZVV A;  3O48 A;  4YVQ C;  2QYU A;  4XX5 A;  1YA0 A;  2F37 A;  1HS6 A;  1HXI A;  3FTS A;  2JAB A;  3FUH A;  3ABK E;  1U3C A;  5LFA A;  3GZ2 A;  4NQ0 A;  2WMN A;  2HR2 A;  3FUI A;  5FIO A;  5EN5 D;  3ESK A;  1NFI E;  2V4H C;  4NAC A;  2L0T B;  3AG2 E;  3C3O A;  4DLO A;  3AJI A;  1N4R A;  5G04 J;  2IEJ A;  3CVW A;  2WXR A;  1OXJ A;  4GTT A;  5CBN A;  3CST A;  4JHK A;  2RFA A;  2L0I A;  3Q7F A;  4LNG A;  3DPD A;  4AY6 A;  4EZK A;  3FUK A;  2OVF A;  1EYH A;  3RRN B;  1HU3 A;  3CEQ A;  1Y8M A;  3DBS A;  4RSY A;  3FEY A;  2FO7 A;  4LRZ A;  3ZW3 A;  2XRZ A;  4KBQ A;  3C98 A;  4Y6C A;  2XS8 A;  4AV7 A;  3AS4 A;  4Q69 A;  2MYO A;  3D9H A;  1SW6 A;  3NZS A;  5A6C A;  2XZD G;  4HOT A;  1OY3 D;  4IYP A;  1MX4 A;  4GA1 A;  4OVU A;  1DC2 A;  4ANX A;  3FEX A;  3FH8 A;  4GTP A;  5CEA A;  4GZD A;  3GZ1 A;  2VSN A;  4Q96 A;  4GTQ A;  2P58 C;  4JHJ A;  4G11 A;  3IHY A;  1Z5S C;  2VTB B;  1JPL A;  3PNT B;  3JXI A;  1E8W A;  1NL4 A;  4GZ5 A;  3TWT A;  3T8K A;  1OWN A;  1MZC A;  4JVS A;  4B89 A;  3EHM A;  2VGX B;  3ULE G;  3PNL B;  3KEA A;  3DSU A;  2R5S A;  2KZT B;  2FUL A;  3SGH A;  1DCQ A;  2PQR A;  2J4B A;  1HF8 A;  4K5A B;  5JA4 D;  1NA0 A;  3D9M A;  4GYY A;  1FVF A;  5AIJ A;  4DI3 A;  2PZI A;  3UT7 A;  5CMW A;  4AOF A;  4UWK A;  4K03 A;  4EQF A;  1INZ A;  2BKK B;  1UOH A;  4G8K A;  4A3V A;  1QNF A;  5FQ8 A;  3D9J A;  3VTY A;  5ENP D;  3UT8 A;  4PS8 A;  5AQ7 A;  5CCM A;  2GRR B;  4TXR A;  3V2O A;  4LUN U;  3B13 A;  1LF8 A;  3U3W A;  2LSU A;  3CR3 A;  3JUI A;  2HYZ A;  3ULQ A;  2P9L G;  5JHA A;  2ETC A;  4KT6 B;  1TEZ A;  1JCQ A;  3QKY A;  2I9C A;  3B7B A;  2IU1 A;  2RD0 A;  3V79 K;  3LXU X;  4XZ4 A;  2XEE A;  4ILG A;  3SF4 A;  3UM0 A;  1S70 B;  3EHQ A;  2GRL A;  1TJC A;  5C2Y A;  3UUX A;  4NUR A;  2EIJ E;  4YDO A;  4GPM A;  4BT8 A;  3T8M A;  4FUL A;  5CMY A;  5T3R A;  4APF A;  3ZYL A;  2DZO A;  5EYP F;  3ASG A;  4FC8 A;  2UY1 A;  5DIZ A;  3U64 A;  3FUJ A;  4F1P A;  4C9B B;  3IHV A;  3B7R L;  3KSQ A;  3W9G A;  1JCR A;  4HRM B;  2P9K G;  3DSX A;  4GYW A;  4ZFH A;  2WXK A;  2ZGD A;  3S7D A;  3PE4 A;  4XIF A;  4CDM A;  2Y1L E;  2XEN A;  4UI9 K;  4GCN A;  3OXF A;  3F6Q A;  2FO1 E;  5FIN A;  3GW4 A;  3PZD A;  4J8Y A;  4FU3 A;  2BTD A;  1TNU A;  4BEP A;  4O1P A;  4U63 A;  3UM2 A;  1ELW A;  4G8L A;  2V5F A;  1PC2 A;  3ONK A;  5A23 A;  3UQ3 A;  2X6H A;  1UN9 A;  3UT4 A;  3ZHE A;  4J8S A;  3EUV A;  4F6R D;  2OVB A;  5ENS D;  4ABN A;  1SZ9 A;  3EHR A;  3RAU A;  5KJK A;  3QAR A;  4I6J A;  3BU8 A;  2DZN A;  4G2V A;  1WM5 A;  4HLL A;  3SD5 A;  1A17 A;  1V54 E;  3UIP C;  4E85 A;  1H2U A;  3D9I A;  4I1O B;  2MRI A;  2EIM E;  1MQS A;  4A3T A;  3DST A;  3BQO A;  1E8X A;  4DRX E;  5EYL A;  4HI9 A;  3CK9 A;  4LER A;  2EQX A;  1IHB A;  4I6E A;  4EZJ A;  2VSX E;  3UM1 A;  2WXP A;  2H6F A;  5CED B;  4KVO A;  4IRU A;  2NYJ A;  1TYQ G;  3RO3 A;  3L22 A;  3AG1 E;  3QNK A;  1EPU A;  5ITZ F;  4I1M A;  3EIQ C;  2WXH A;  5JMN D;  1HX8 A;  1E7V A;  4WND A;  4HNA D;  2WXI A;  4WUY A;  3CHR A;  4FHK A;  1N11 A;  5IY5 E;  4O60 A;  4FHJ A;  2KAT A;  5HI7 A;  2DCP A;  4GTO A;  2A5U A;  5EIB E;  5EIL A;  3PEV B;  3UKR G;  4KMO A;  4ATZ D;  2A5E A;  3FDH A;  3CVN A;  2ILR A;  2FBN A;  2J4D A;  3APD A;  2P9I G;  4GZC A;  1WDY A;  5G05 J;  2VYI A;  3L82 A;  1OCR E;  4BT9 A;  1U2V G;  1O1T A;  3PE3 A;  4BET A;  3S7F A;  1E7U A;  5CRV A;  4XI9 A;  4CEM A;  5D0Q D;  3Q7A A;  3BG0 B;  5EKQ D;  3I5P A;  5EID A;  2H6I A;  2M63 A;  3KSL A;  3N71 A;  1DCE A;  4FA6 A;  3ZN3 A;  3TAX A;  2CHZ A;  2LNI A;  2WXQ A;  5FTP A;  2WQH A;  4DI4 A;  4C0M A;  1XGW A;  4U04 A;  3LY9 A;  1MYO A;  3LEW A;  3ASD A;  5KNH D;  3EU5 A;  1L5J A;  2XGO A;  2WXO A;  5B1B E;  2I1J A;  4D10 C;  4GA0 A;  5CEC B;  4BSX A;  4AVX A;  4L7T A;  2CHX A;  3ASO E;  3ZPJ A;  3B7T A;  2QC9 A;  1NA3 A;  4F1S A;  4UQY A;  1E8Y A;  3FY4 A;  4FJZ A;  3RJV A;  1KZP A;  3Q4A B;  1TJF A;  4K0R A;  3FTY A;  3CHP A;  2GRQ B;  4DK5 A;  3W9F A;  3TG4 A;  3L17 A;  3LVQ E;  3Q75 A;  1HH8 A;  4ANW A;  4XI0 A;  3T5X A;  4MLP A;  3MYV A;  3RU0 A;  3LYA A;  3J5P A;  3PUJ A;  3CHS A;  4GPK A;  3OXL A;  2XQ0 A;  3Q5M A;  5AQA A;  3SBT B;  2Y3A A;  3MX3 A;  2LAI A;  4K5B A;  4W9R A;  5BV0 A;  2ETB A;  4I9E A;  4A1S A;  1XNF A;  3U66 A;  1UJJ A;  3WXX A;  5BT1 A;  4BX9 A;  2IY0 C;  3QAQ A;  4N5Q A;  3ESL A;  4CYM D;  3SFY A;  1HFA A;  3AS5 A;  3HXE A;  3JUE A;  5M72 A;  3APF A;  3ASN E;  3V31 A;  3D9N A;  5LCW C;  2ETA A;  1FVH A;  3LPZ A;  5FQ7 A;  5FJY A;  3AAA C;  3QWW A;  4JL0 A;  3ZEF A;  1SZA A;  2J07 A;  4DX7 D;  4CDN A;  1JWF A;  3VLD A;  3I4R B;  3L13 A;  4TXP A;  2QY7 A;  2FI7 A;  4G25 A;  4WWP A;  3PEU B;  5ANR A;  1A5E A;  2CFZ A;  3FU5 A;  2JLB A;  2MHK A;  3CQG B;  3JYS A;  3Q9U C;  3CHQ A;  4B8C B;  3TWU A;  3QOU A;  4AY5 A;  1K8K G;  3CV0 A;  3ZXS A;  3MZL B;  3FH5 A;  4EPZ A;  3QWV A;  4XE0 A;  1DNP A;  3L6A A;  2VQ2 A;  5AQB A;  2AJA A;  4NRH B;  3LY8 A;  1JWG A;  2OV8 A;  3DRA A;  4H7X A;  3U4T A;  4FLB A;  3MA5 A;  2UY1 B;  1TNY A;  4GTS A;  2L6B A;  3KEZ A;  2WQ6 A;  1UG3 A;  4GCO A;  2VGY A;  3HDX A;  3TWQ A;  2KBX A;  3R7R A;  3ULY A;  1OCC E;  5BNW A;  1Z3X A;  1Y6I A;  1HG5 A;  4HOS A;  1WY6 A;  4FP7 A;  1Z6T A;  3CVQ A;  4DUI A;  2CHW A;  4RG9 A;  4UI9 J;  3B7S A;  4YDW A;  3V2X A;  3SHF A;  5J08 A;  4J7W A;  1HE8 A;  3UMV A;  3Q73 A;  4AEZ C;  1SVX A;  2OOE A;  4G1T A;  4UQZ A;  3HXD A;  4ME2 A;  1SA5 A;  2ZU6 B;  3PZ3 A;  4DX1 A;  4GTV A;  3ZIM A;  5ANL A;  3ZHE B;  2Y0B G;  4EEC A;  1O5M A;  1KT0 A;  4J8D A;  2V8S E;  3FU6 A;  2QZA A;  1N95 A;  3ASF A;  4APO A;  4ATG A;  2YHC A;  4L1B A;  2NC9 A;  3PRZ A;  1IKN D;  4FJY A;  2C2L A;  3OTN A;  1S64 A;  4BY6 A;  2F8Y A;  5D0O D;  3CHM A;  3SQV A;  2DIW A;  2J8S D;  3TWX A;  3R9A B;  4BWR A;  2X6J A;  3ZXP A;  4EZL A;  1H6O A;  2Q7F A;  4HOQ A;  1BPO A;  4JHR A;  3G2T A;  5CBO A;  3G2V A;  3HIZ A;  2WXG A;  2YNQ A;  3L08 A;  4HBD A;  3ISM C;  4RLY A;  3ZU7 B;  4Z68 A;  3PRE A;  3IBE A;  5AYW D;  2BF0 X;  1MHQ A;  2I1K A;  3U9W A;  4KZC A;  4OAU C;  3PVL A;  2C0L A;  5HKP A;  2I6H A;  3DSV A;  3VLE A;  3RRU A;  1N52 A;  2X6F A;  3UTM A;  4EBA G;  2AWI A;  1JUQ A;  4IN3 B;  2LSV A;  2XGS A;  3FUN A;  3TXN A;  3ZYQ A;  2R2L A;  3ZRH A;  4RVB A;  3AG3 E;  2EIN E;  4XKC A;  1K1A A;  1N4P A;  5JJT A;  3PUK A;  2XRY A;  3ZYK A;  2IQC A;  1VDY A;  3HXC A;  3P2B A;  2E2E A;  4WNF A;  4F3V A;  1SQM A;  4EBA A;  4BSZ B;  4JW1 A;  3QC1 A;  3LVR E;  4U96 D;  3RO2 A;  4U95 D;  3DSS A;  2WMO A;  5HS0 A;  5FQ6 A;  3C3R A;  3QDN A;  5JJ7 A;  2R17 C;  1MX2 A;  2C0M A;  3JQ1 A;  3T9K A;  4HLE A;  3UIN C;  3CVX A;  4JD2 G;  3C5R A;  4BX8 A;  3FUM A;  3B7U X;  4B94 A;  1DVP A;  1WAO 1;  2RFM A;  2PL2 A;  5ARF A;  3ZFW A;  3HXB A;  5G04 C;  4RQI A;  1BI8 B;  5ENT D;  2OEW A;  3FTZ A;  1MX6 A;  1N0R A;  2UWJ G;  5D2M C;  2VJ8 A;  4RG6 A;  1OCO E;  2B0O E;  2Y4T A;  4TUU A;  4X8Q A;  4FLH A;  4N5C A;  5E76 A;  4AIF A;  4PUC A;  2ZIS A;  4WNG A;  4CGW A;  3NBN B;  4ANV A;  3URZ A;  2J08 A;  3JCK C;  4MRU A;  3UX4 A;  3NF1 A;  3SZ7 A;  1IXV A; 
#chains in the Genus database with same CATH homology
 1E8W A;  1H6K A;  1ZBP A;  4N3A A;  4JEH A;  4F7A A;  4UQX A;  3LVQ E;  4GZ5 A;  4ANW A;  1HH8 A;  4XI0 A;  1OWN A;  2KZT A;  2KM4 A;  3EDT B;  4BFR A;  5C1D A;  1OWM A;  4JVS A;  3T5X A;  4JZY A;  4G24 A;  4ILH B;  4MLP A;  5EX0 A;  3ZYM A;  4B89 A;  1UN8 A;  5LP0 A;  3MYV A;  3RU0 A;  2R59 A;  2GRM A;  3LYA A;  3EHM A;  3G2U A;  2VGX B;  4J8F A;  2IOS A;  3PUJ A;  3PNL B;  3CHS A;  4GPK A;  2KC7 A;  2R5S A;  3OXL A;  3SFZ A;  4CT0 A;  2BUG A;  5LCW J;  2L9B A;  2Y4U A;  2KZT B;  2XQ0 A;  2FUL A;  2PQN A;  3Q5M A;  3SGH A;  3SBT B;  3CIA A;  2Y3A A;  2PQR A;  2X3M A;  3MX3 A;  2J4B A;  5FZR A;  1HF8 A;  2LAI A;  1QQE A;  1NA0 A;  3D9M A;  4GYY A;  4W9R A;  3MKQ A;  1FVF A;  3RRM B;  5BV0 A;  3LKU A;  3R7Q A;  2V4L A;  3TL5 A;  4I9E A;  4JXT A;  3ZGQ A;  1GW6 A;  4A1S A;  4DI3 A;  5AIJ A;  4N2S A;  1IHG A;  2PZI A;  4UWF A;  1XNF A;  4P29 A;  3U66 A;  1H19 A;  1UJJ A;  3WXX A;  1E8Z A;  3UT7 A;  4GA2 A;  4N39 A;  5EDS A;  5BT1 A;  4BX9 A;  3MKQ B;  4CRW A;  3SBS A;  5CMW A;  3LCA A;  4GAA A;  2HO1 A;  3EJN A;  4AOF A;  3QAQ A;  5ENN A;  3ESL A;  5T4Y A;  4UWK A;  5T8I A;  1NP7 A;  1HFA A;  1FCH A;  3AS5 A;  4URK A;  3FHE A;  4JEU A;  5KCM A;  3CLJ A;  3T5V A;  5M72 A;  3APF A;  4K03 A;  2NSZ A;  3KS2 A;  4WAF A;  4EQF A;  5BPP A;  4J8E A;  1INZ A;  3MEK A;  3D9N A;  1QNF A;  3S7J A;  4A3V A;  5FQ8 A;  5LCW C;  4GML A;  3D9J A;  3FTW A;  3FP3 A;  1FVH A;  3LJ3 A;  3VTY A;  4F53 A;  3LPZ A;  5FQ7 A;  5FJY A;  5ARG A;  3UT8 A;  4I43 A;  5AJL A;  3QWP A;  4M3O A;  4PS8 A;  5CCM A;  4ILI A;  3K9I A;  2AW6 A;  3QWW A;  2IOL A;  4LUN U;  3B13 A;  4JL0 A;  3ZEF A;  1SZA A;  3Q47 B;  2J07 A;  1LF8 A;  2WVI A;  3HVE A;  3APC A;  1ELK A;  3U3W A;  2LSU A;  1JWF A;  2XHE A;  3CR3 A;  3I4R B;  3JUI A;  3VLD A;  4CDN A;  3L13 A;  2HYZ A;  2PM6 A;  3FU0 A;  3D3M A;  3ULQ A;  5LX8 A;  4YND A;  5JHA A;  2CFU A;  2QY7 A;  2FI7 A;  4G25 A;  4KT6 B;  4Y6W A;  1TEZ A;  2AXZ A;  3Q15 A;  1H0A A;  3RKV A;  5JHB A;  4WWP A;  3HVE B;  3QKY A;  1IQR A;  4OVV A;  1OUV A;  2I9C A;  4DI4 A;  4CGV A;  1IYG A;  4OYS A;  2IU1 A;  3FTV A;  3PEU B;  3FWV A;  5ANR A;  2IF4 A;  2CFZ A;  3D9K A;  3FU5 A;  4UWH A;  2JLB A;  4U07 A;  2MHK A;  2FF4 A;  3CQG B;  2RD0 A;  3JYS A;  1PY1 A;  3LXU X;  3CHQ A;  1HZ4 A;  2J09 A;  2XGM A;  4KZ0 A;  4ILG A;  4XZ4 A;  3SF4 A;  2GRL A;  4B8C B;  1TJC A;  5C2Y A;  2CG3 A;  4N2Q A;  2CG2 A;  3QOU A;  4AY5 A;  3CV0 A;  3ZXS A;  3TG5 A;  3FFL A;  4NUR A;  3UUX A;  4BT8 A;  3MZL B;  1IQU A;  3P1U A;  3FH5 A;  4GYO A;  4YVO A;  4EPZ A;  2HM8 A;  3NQP A;  3T8M A;  4FUL A;  5CMY A;  3QWV A;  5T3R A;  2VSY A;  4APF A;  3ZYL A;  4XE0 A;  1DNP A;  3IEG A;  3L6A A;  4V3I A;  1X5B A;  3O4Z A;  1ZU2 A;  1PAQ A;  2VQ2 A;  4J6I A;  4MS6 A;  4FAD A;  3ASG A;  2L6J A;  2WXJ A;  4FC8 A;  2UY1 A;  4NRH B;  5DIZ A;  3FU3 A;  3I3N A;  1E96 B;  3U64 A;  3FUJ A;  2WQ7 A;  4HXI A;  3MCX A;  3LY8 A;  3ASH A;  3MJW A;  1JWG A;  4GZ6 A;  4Q94 A;  2XPY A;  2OV8 A;  1HG2 A;  4KXK B;  3RK6 A;  4C9B B;  4E6H A;  3IHV A;  2A4Z A;  4H7X A;  3U4T A;  4IUL A;  4FLB A;  3HYM B;  3B7R L;  2FEZ A;  3MA5 A;  4N3C A;  4PDX A;  3SI5 A;  3S2A A;  2UY1 B;  4JPS A;  4C0E A;  2WM9 A;  3UPV A;  2YIN A;  3I4G A;  3G2S A;  4ACL A;  3TG4 A;  3AU5 A;  3QJZ A;  3PH0 C;  4PS7 A;  3KEZ A;  2GGF A;  4A55 A;  2AXU A;  2AXV A;  5G2N A;  4HFG A;  2WQ6 A;  1UG3 A;  3AU4 A;  4GCO A;  2YHE A;  4GYW A;  2VGY A;  3HDX A;  5AJD A;  1E90 A;  2WXK A;  1S0P A;  3R7R A;  4DPR A;  3CK7 A;  3G2W A;  4UWL A;  3S7D A;  3PE4 A;  1Z3Y A;  4XIF A;  2J49 A;  2RG8 A;  4CDM A;  5BNW A;  4AM9 A;  4UI9 K;  4GCN A;  4XKB A;  1Z3X A;  2E0I A;  1Y6I A;  1HG5 A;  2MOW A;  3OXF A;  4HOS A;  1WY6 A;  2WXF A;  3FTX A;  4FP7 A;  3GW4 A;  1N54 A;  2OND A;  3PZD A;  5G55 A;  4BTA A;  4FU3 A;  3ONL A;  2BTD A;  4GMJ A;  1Z6T A;  3CVQ A;  2CHW A;  2WPV A;  5BV1 A;  4PS3 A;  4RG9 A;  4U63 A;  3IKO B;  1QZ2 A;  3B7S A;  3D9O A;  4UI9 J;  3OAW A;  5J08 A;  3SHF A;  2X6I A;  4G23 A;  3MV2 B;  4KVM A;  3Q49 B;  1ELW A;  5FZQ A;  2PM7 A;  2V5F A;  1HE8 A;  1PC2 A;  3ONK A;  3UMV A;  3ENE A;  5A23 A;  3UQ3 A;  2WB2 A;  3CVV A;  3NZU A;  4AEZ C;  2X6H A;  4L2L A;  4PH4 B;  4BTB A;  1UN9 A;  2OOE A;  4G1T A;  4MKT A;  4B0Z A;  4CCA A;  1W3B A;  3BEE A;  3UT4 A;  5KJL A;  3ZHE A;  3LY7 A;  4UQZ A;  3VTX A;  4J8S A;  4WWN A;  2OVB A;  4ME2 A;  3MV3 B;  4ABN A;  3PDN A;  2ZU6 B;  1P5Q A;  3PS6 A;  1SZ9 A;  3CQC B;  4CT4 A;  4TRQ A;  3ZIM A;  5ANL A;  3ZHE B;  4O6F A;  5KJK A;  3QAR A;  4I6J A;  3EIJ A;  4EEC A;  5HQ8 A;  4G2V A;  1WM5 A;  1KT0 A;  4TV3 A;  2WXM A;  3SD5 A;  4CDR A;  4J8D A;  3FUD A;  1EF1 C;  3RIB A;  1A17 A;  2V8S E;  4GU5 A;  3FU6 A;  2IJG X;  4UI9 C;  5CHE E;  1UJK A;  3ASF A;  5JJ6 A;  4APO A;  4LCT A;  2XPZ A;  4E85 A;  4ATG A;  3CGH A;  1H2U A;  4GB9 A;  5FWQ A;  2YHC A;  4HOR A;  4U0S A;  1HO8 A;  4L1B A;  2NC9 A;  3D9I A;  5CCL A;  4I1O B;  3PRZ A;  2MRI A;  2X38 A;  2YQ8 A;  3CKC A;  2LAH A;  5AEN A;  4DJA A;  3LDZ A;  1MQS A;  4A3T A;  4U8H A;  1E8X A;  4FJY A;  3BG1 B;  4B8A A;  2C2L A;  3OTN A;  3CSF A;  3ML9 A;  4BY6 A;  3LS8 A;  5LOZ A;  3QK0 A;  1ELR A;  5D0O D;  1U3D A;  2QFC A;  3CHM A;  5FZS A;  2DIW A;  3CK9 A;  3E4B A;  4WWO A;  4LER A;  3MGB A;  2EQX A;  4HVB A;  3R9A B;  4BWR A;  4N3B A;  5FQ4 A;  2KCL A;  2I2O A;  4I6E A;  3GYZ A;  4I2Z A;  2VSX E;  3TXM A;  4EZJ A;  5J90 A;  2AVP A;  2WXP A;  4WNE A;  2X6J A;  4A1G A;  3FTU A;  5A7D B;  1H2V C;  3HHM A;  4EZL A;  2Q7F A;  4HOQ A;  4KVO A;  4IRU A;  2GW1 A;  1BPO A;  2NXP A;  3JQ0 A;  4JC8 A;  4JHR A;  3G2T A;  5EX3 A;  1NZN A;  3G2V A;  1OWO A;  2WXG A;  3HIZ A;  2YNQ A;  3RO3 A;  3L08 A;  4HOU A;  4AP2 A;  3L22 A;  3QNK A;  1EPU A;  4G26 A;  3PRE A;  3GZS A;  3IBE A;  5AYW D;  2BF0 X;  4J0U A;  1UW4 B;  3QB2 A;  3EHN A;  1MHQ A;  5KJN A;  3D9L A;  3TJP A;  4I1M A;  2I1K A;  3EIQ C;  4I2W A;  2J9Q A;  2WXH A;  4KZC A;  3U9W A;  5BUZ A;  4LEU A;  1OWL A;  1HX8 A;  3CHO A;  1E7V A;  2WXN A;  4WND A;  3CVY A;  3PVL A;  2C0L A;  2I6H A;  2WXI A;  2V0P A;  4WUY A;  3CHR A;  4R7L A;  3VLE A;  3RRU A;  1N52 A;  3L54 A;  4FHK A;  2X6K A;  2X6F A;  2XCC A;  4I9C A;  4H7Y A;  4EBA G;  2AWI A;  3ZVV A;  3O48 A;  1JUQ A;  2KAT A;  4FHJ A;  4YVQ C;  5HI7 A;  2DCP A;  4IN3 B;  2LSV A;  2XGS A;  3FUN A;  3ML8 A;  3TXN A;  4XX5 A;  3ZYQ A;  2A5U A;  3FUE A;  1YA0 A;  4JA9 A;  3ZRH A;  1HS6 A;  1HXI A;  3PEV B;  4RVB A;  4KMO A;  3FTS A;  3FUH A;  3D9P A;  5KJM A;  1U3C A;  5BW8 C;  4XKC A;  1B89 A;  3IV0 A;  5LFA A;  4HS2 A;  3FDH A;  5JJT A;  2WXL A;  3PUK A;  3CVN A;  2ILR A;  2XRY A;  3GZ2 A;  3ZYK A;  3AS8 A;  2IQC A;  1VDY A;  2FBN A;  4NQ0 A;  2J4D A;  4DLQ A;  2WMN A;  4I6G A;  3APD A;  4I17 A;  2ION A;  2HR2 A;  3FUI A;  4GZC A;  5G05 J;  3P2B A;  3ESK A;  2E2E A;  4WNF A;  5DBK A;  4F3V A;  2VYI A;  3CK8 A;  4NAC A;  2KCV A;  1SQM A;  2L0T B;  4DLO A;  4KYO B;  4EBA A;  4BT9 A;  5G04 J;  3PE3 A;  4JW1 A;  3CVW A;  2WXR A;  3QC1 A;  3LVR E;  3S7F A;  3RO2 A;  1E7U A;  3CST A;  4ANU A;  2WMO A;  4JHK A;  4XI9 A;  5FQ6 A;  1H2T C;  3S7B A;  3SNX A;  4CEM A;  5D0Q D;  3QDN A;  5JJ7 A;  2L0I A;  2R17 C;  3BG0 B;  5EKQ D;  3I5P A;  2C0M A;  3JQ1 A;  2M63 A;  3DPD A;  4L23 A;  4GZ3 A;  3N71 A;  4HLE A;  4AY6 A;  4EZK A;  3CVX A;  3CVU A;  4FA6 A;  3FUK A;  2OVF A;  4BX8 A;  3L16 A;  1EYH A;  3FUM A;  3ZN3 A;  4UWG A;  3RRN B;  3B7U X;  1HU3 A;  3FUL A;  3CEQ A;  3TAX A;  2CHZ A;  1Y8M A;  3DBS A;  4RSY A;  5G05 C;  4B94 A;  3CVP A;  3FEY A;  2LNI A;  2WXQ A;  1DVP A;  4AJW A;  1WAO 1;  2FO7 A;  4LRZ A;  3FUF A;  3ZW3 A;  5FTP A;  2PL2 A;  2XRZ A;  4KBQ A;  2WQH A;  1OWP A;  2DBA A;  2XPI A;  5ARF A;  5FT9 A;  3C98 A;  3CKB A;  3ZFW A;  4JA7 A;  1XGW A;  4C0M A;  4Y6C A;  4U04 A;  3KAE A;  5G04 C;  3LY9 A;  2VSO E;  3LEW A;  3ASD A;  4QFV A;  4AV7 A;  3AS4 A;  4L2Y A;  4Q69 A;  1L5J A;  2XGO A;  3KD7 A;  2WXO A;  3MKR A;  3NZS A;  3FTZ A;  5A6C A;  2I1J A;  4D10 C;  4HOT A;  5E75 A;  4IYP A;  2UWJ G;  3OXG A;  4GA0 A;  3CVL A;  2VJ8 A;  4AXH A;  1EDU A;  4RG6 A;  4BSX A;  4AVX A;  4GA1 A;  2Y4T A;  2CHX A;  4L7T A;  2JEK A;  4OVU A;  4TUU A;  2KCK A;  3ZPJ A;  2VTB A;  3B7T A;  4ANX A;  1NA3 A;  3FEX A;  2XCB A;  3FH8 A;  4FLH A;  2IFU A;  4N5C A;  1KLX A;  1KT1 A;  5E76 A;  4AIF A;  4GZD A;  4PUC A;  3GZ1 A;  2VSN A;  4Q96 A;  4UQY A;  3VLF A;  4F1S A;  4WNG A;  2P58 C;  1E8Y A;  4CGW A;  4JHJ A;  4G11 A;  3IHY A;  3FY4 A;  4FJZ A;  1JPL A;  2VTB B;  4ANV A;  3RJV A;  2J08 A;  3URZ A;  3PNT B;  3FH7 A;  3Q4A B;  4U0U A;  3JCK C;  2XEV A;  4U0Z A;  4MRU A;  4ACK A;  2LO6 A;  1TJF A;  4I1A A;  4K0R A;  3UX4 A;  3FTY A;  3CHP A;  3NF1 A;  4DK5 A;  3SZ7 A;  3TGO A;  3L17 A;  2VGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...