3Q47B

Crystal structure of tpr domain of chip complexed with pseudophosphorylated smad1 peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
132
structure length
132
Chain Sequence
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/transcription
molecule keywords STIP1 homology and U box-containing protein 1
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
total genus 56
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q47B00
5FJYA 5DBKA 4I9CA 5A6CA 3Q47B 1NA3A 2C0LA 2NC9A 3S7FA 4WNDA 5JJ7A 3LCAA 4BT8A 4G26A 4JHRA 4UI9C 4H7YA 2IFUA 1Y8MA 4AY6A 2UWJG 5G04J 2IF4A 4BTAA 3ZN3A 2WPVA 4H7XA 1A17A 5JJ6A 3AS8A 4KXKB 4I9EA 2WQHA 4IN3B 4NRHB 4G24A 3S7JA 4GCNA 4J8FA 4UQXA 1KLXA 1KT0A 1NA0A 3RKVA 2Q7FA 2KCVA 1QZ2A 1PC2A 4NQ0A 3QWPA 1NZNA 1WAO1 4N3AA 2YHCA 3IEGA 3CK9A 2AVPA 2ONDA 3GZ2A 3MEKA 4F3VA 3CVLA 3U3WA 4XI0A 1ELRA 4ME2A 2VGYA 2BUGA 3SZ7A 2JLBA 4N39A 1FCHA 5G04C 5DIZA 4KYOB 3FWVA 3HYMB 2VSYA 3BEEA 3KAEA 2KATA 3ASFA 3CEQA 5FTPA 3GW4A 3CK7A 5FZQA 4BTBA 4AY5A 3ZPJA 3ESKA 3AS4A 4RG6A 3WXXA 5FZRA 4YVOA 3CK8A 2XCBA 4UI9K 5HQ8A 3Q49B 4BWRA 4RG9A 4WNFA 4ABNA 3RJVA 3UUXA 4N2SA 3K9IA 1KT1A 2XCCA 3AS5A 2KCKA 2FI7A 2XGSA 4CGVA 2QFCA 3TG5A 1ZBPA 1XNFA 4GZ6A 3LPZA 5CCMA 2UY1B 3TG4A 3LYAA 3S7BA 1WM5A 3EDTB 4O6FA 4YVQC 3ULQA 3QWWA 3FP3A 3PE4A 2V5FA 4WUYA 4G23A 2KCLA 5CCLA 3QDNA 2FEZA 4U0UA 5D0OD 3RIBA 3U4TA 3TGOA 3Q4AB 5A7DB 3OXLA 4Y6CA 2OOEA 4U04A 3Q5MA 4XIFA 2VSNA 5G05J 5ARFA 3ASHA 4KBQA 5CHEE 2PQNA 4I2WA 3R9AB 4HOQA 3LKUA 3CV0A 3ZHEB 4GPKA 4EQFA 4N5CA 3SF4A 5EX0A 4UQYA 3OXGA 4HORA 4WNEA 4Y6WA 3ZGQA 5FT9A 3UQ3A 2FBNA 1HZ4A 2GW1A 2KC7A 5BW8C 4WNGA 2MHKA 4I2ZA 2HO1A 1ELWA 4HOUA 3MKRA 4A1SA 5BNWA 2PZIA 3N71A 4GA2A 4U0SA 2L6JA 3O48A 2XEVA 2DBAA 3S7DA 4UQZA 3CKBA 3VTXA 2I6HA 4U07A 2VYIA 4GZ3A 3FFLA 3LY8A 2VGXB 4J8EA 2VQ2A 3Q15A 5KJMA 1P5QA 2Y4UA 4G25A 3PDNA 3KD7A 3QOUA 3JYSA 2P58C 2PQRA 2HR2A 4G2VA 3NF1A 3QKYA 1YA0A 3KS2A 2LSUA 4GA1A 2UY1A 4B94A 5M72A 3ZFWA 3RU0A 3PE3A 5HI7A 2LNIA 1IHGA 5KJNA 5AYWD 4BT9A 5C1DA 3MA5A 3URZA 2R5SA 4U0ZA 3RO3A 2FF4A 2HYZA 4AM9A 5LCWJ 3QWVA 2C0MA 5FZSA 4JA9A 4APOA 2FO7A 4XI9A 2XGOA 1HH8A 1W3BA 2E2EA 4N2QA 3OXFA 4GYOA 4N3CA 5EKQD 4AIFA 3CKCA 5KJLA 4JL0A 4GCOA 3ZHEA 3LY9A 5ARGA 1OUVA 4I1AA 2PL2A 4I17A 4GA0A 4YNDA 4GZ5A 5D0QD 4G1TA 4J8DA 3E4BA 4UI9J 4N3BA 3GYZA 4HOSA 2Y4TA 4J0UA 1B89A 1ZU2A 3MV2B 3ASDA 3VTYA 3CVNA 2XGMA 4CGWA 4GYYA 4HOTA 1E96B 2LSVA 1IYGA 3CVQA 1QQEA 1HXIA 4LEUA 3GZ1A 3LY7A 3TAXA 3UPVA 5EX3A 5LCWC 3CVPA 2C2LA 5G05C 4JA7A 2YQ8A 3ASGA 4CDRA 5JJTA 5BT1A 2J9QA 1TJCA 4GYWA 4W9RA 5KJKA 2XPIA 2VGXA 3RO2A 3MV3B
chains in the Genus database with same CATH superfamily
4I6GA 4I9CA 1PAQA 4I1OB 2CHXA 2F37A 3S7FA 4WNDA 1BI7B 5JJ7A 1UW4B 4RSYA 4BT8A 1D8EA 2MRIA 2A4ZA 2CFUA 4H7YA 3Q9NC 3PZ2A 5G04J 4B93B 3ZN3A 3EHNA 5EYPF 4BESA 5BV1A 2I1JA 5JJ6A 1MX2A 3AS8A 4I9EA 3PUJA 5FQ4A 4IN3B 5ENQD 1SVXA 3S2AA 3LJNA 3TWRA 5HS0A 2V5QC 2PM7A 3SFYA 3P1UA 1NA0A 3ZNGA 1H2TC 5AENA 4PH4B 1QZ2A 1OCCE 4LNBA 5AN8A 3FTYA 1WAO1 1TNUA 3ZYLA 5BXOA 3V30A 2XS8A 4D10C 5B1AE 3FH5A 1MZCA 2WXNA 1WG0A 3G2VA 3TXMA 4KVOA 3MEKA 4F3VA 5LOZA 3IBEA 4BSZB 2NSZA 4CDMA 2QYUA 3PZ3A 5H7PA 4DX1A 4AXHA 2R17C 2R02A 5J90A 4E85A 3SZ7A 1FCHA 5G04C 5DIZA 2IO2C 4LNGA 4RVBA 2VSYA 3BEEA 4GMLA 3GW4A 3GZSA 2ZGGA 4BTBA 3CIAA 3B7BA 3ZPJA 1KZOA 4BEPA 1Z3XA 2L0IA 2QY7A 3FU3A 3Q9UC 1EPUA 3L82A 1UG3A 4NACA 3NOCD 2IU1A 2IONA 3PEVB 2R05A 2YHEA 1JCRA 3NAWA 3UKUG 3UT8A 3LS8A 1D9SA 3NB2A 1ZBPA 1XNFA 3D9MA 4R7LA 3AAAC 2EIME 2UY1B 2VSOE 1K1BA 3S7BA 3B7TA 3SI5A 2XZTG 1EYHA 4O6FA 4LUNU 3D9JA 3SGHA 4YVQC 3ULQA 4CZ2D 2FO1E 3U64A 3FP3A 1OWLA 2ZXWE 3HHMA 4G23A 2KCLA 3DSSA 2FEZA 2MYOA 3FH8A 3OAWA 3LXUX 1TYQG 3AG2E 1SA4A 3U4TA 4IRUA 1MQSA 4ANVA 3KSLA 3T8MA 3ZKJA 3EUVA 5ITZF 2OOEA 4KMOA 4KT6B 4U04A 4O1PA 3ASHA 4F1SA 3ONKA 3MYVA 2H6GA 3R9AB 4HOQA 3PZ1A 2X6HA 1FPPA 4O1OA 1X5BA 4DI3A 3APCA 3EHQA 3ZGQA 3DEOA 3UQ3A 4Q94A 4JVSA 2FBNA 3UXGA 4CRWA 2GRQB 2BKGA 4DRXE 2KC7A 1GW6A 3HXFA 4WNGA 4I2ZA 2IQCA 5ENOD 5AQ7A 4ACLA 3HVEB 1MYOA 4EBAG 3B7UX 2AWIA 2YINA 3PNTB 3IXEA 2J08A 3HXCA 2GROB 4C0EA 3BUAA 4MS6A 3T5VA 2DCPA 4AJWA 2ZIRA 1S63A 3FFLA 3L16A 4J8EA 3FTXA 3Q15A 3FUHA 4NURA 5KJMA 2Y4UA 2LO6A 3DBSA 4K5AB 3JYSA 2P58C 2PQRA 2A5UA 2XPZA 2XS1A 3QKYA 4B8CB 4HI9A 2CFZA 1U3CA 4JHKA 4ANXA 3MCXA 4CYMD 3RU0A 4UWLA 3PE3A 1V54E 5AQBA 3JXIA 5EILA 2IY0C 5KJNA 5C1DA 2ETBA 4DLOA 4FLBA 2GRPB 2R5SA 1TR4A 3L13A 2HYZA 4AM9A 5LCWJ 1DNPA 3QWVA 5B1BE 3OTNA 4JA9A 1TEZA 3SY2A 3P2BA 2HM8A 4L2YA 4YDEA 4DX7D 2J8SD 2DZOA 4N3CA 5EKQD 2KBXA 4JD2G 3CKCA 3R9MA 3KSQA 3FTSA 5B3SE 4I1AA 5ENRD 2PL2A 4BSXA 4J8DA 3E4BA 1UJJA 4OVVA 2Y4TA 2ETCA 4J0UA 4AV7A 2XZDG 3SHFA 3KEZA 2ZISA 4JW1A 3CVWA 3FH7A 1E90A 4GYYA 4HQDA 3ZRHA 3J5PA 4FC8A 1ZB1A 1N0QA 1OCOE 1Z3YA 1HXIA 4LEUA 4ILGA 2NYJA 3UPVA 4IYPA 5EX3A 5LCWC 2CHZA 2C2LA 2H6HA 3C3OA 2J9QA 4BETA 3CHOA 2XRZA 1E8ZA 3U66A 5AJDA 3G2SA 4W9RA 5KJKA 3RO2A 3MV3B 1N4RA 5FJYA 4F1PA 5DBKA 3C3RA 4Q69A 3NZSA 2WXRA 3WG7E 5HKPA 2C0LA 3T5XA 2NC9A 3LCAA 3AU5A 3ML9A 2Y69E 3DXMG 4XKCA 4WWOA 2IF4A 2WPVA 2BEDA 1A17A 4YDWA 3W9GA 1YYHA 2V8SE 5ENNA 4DX6D 4J8YA 3IKOB 3ABME 4G24A 5T8IA 3S7JA 3LDZA 4GCNA 5BV0A 4DX5D 3FHEA 3ZU7B 2QZAA 4I6EA 1KLXA 3V31A 3O4ZA 4QQIA 2KCVA 2A5EA 3C5RA 4NQ0A 1NZNA 4N3AA 3QJZA 4UWFA 3CHMA 1S0PA 2ONDA 4X8QA 3NOGD 3JUIA 2P2CP 3TWQA 3CVLA 3U3WA 5JMND 1TN6A 2X3MA 2VGYA 3UT4A 2X6IA 4PDXA 4JZYA 3ENEA 4KYOB 3HYMB 3LVQE 4LSZE 4J6IA 1QBQA 3I3NA 5FTPA 2F0YA 3C72A 4XZ4A 3UTMA 2P9SG 2J07A 3DXKG 3LEWA 3UM3A 3ESKA 1HFAA 4J7WA 1BI8B 4CT0A 2XCBA 4UI9K 5ENSD 5HQ8A 4BWRA 4RG9A 3ZYQA 3E34A 3RJVA 4GMRA 1JPLA 2WMOA 1IQUA 2XCCA 2DWZA 3AS5A 1H6OA 1OY3D 4APFA 2XGSA 4GU5A 1S70B 3TG5A 1EDUA 3SFZA 1E8WA 3L22A 1IQRA 2EIJE 3HIZA 2GRLA 3D3MA 5AQAA 2I9CA 1O5MA 4WWNA 4U8VD 4NIKA 2VJ8A 2WXOA 2GRRB 2CG2A 5ANLA 2WXKA 2KM4A 5CCLA 3RK6A 3HXBA 4HLEA 2KZTB 5AARA 3DPYA 3TGOA 3OXLA 4Y6CA 3Q5MA 1JCSA 1BPOA 5G05J 3PH0C 3C3QA 2PM6A 3Q7FA 1Q2ZA 4KBQA 5CHEE 1PY1A 2PQNA 3LKUA 3CV0A 3ZHEB 4CDNA 3UKRG 3DPDA 4N5CA 1SW6A 4EQFA 3MGBA 3PREA 3SF4A 5EX0A 2VGEA 2IOSA 4HORA 1YCSB 2R2LA 4WNEA 4EZLA 5FQ6A 2WXHA 3MKQB 5CEAA 5FT9A 4AOFA 5CECB 1G3NB 3FULA 2B0OE 4HFGA 1E7VA 4HNAD 3DSVA 4GTMA 4AP2A 1ELWA 2BKKB 4HLLA 5KNHD 3FEYA 5BNWA 2GGFA 3N71A 4XE0A 4BX9A 4GA2A 3TWUA 3PZDA 2ETAA 2WXFA 3S7DA 1A5EA 1O1SA 3FUDA 2V4LA 2I6HA 1SZ9A 2WXQA 5JA4D 3ULEG 5CERB 1KPSB 2VQ2A 3AJIA 5CMYA 1QNFA 4GAAA 4G25A 4TXRA 3KD7A 3QOUA 1IXVA 1N0RA 5FINA 2WXLA 3MX3A 2Y3AA 1LTXA 3ZYKA 1MHQA 4OVUA 3JQ0A 5EDSA 4YDOA 3ZFWA 4U96D 5HI7A 1O1RA 4PS7A 2XEHA 3PVLA 4HB5A 1IHGA 4V3IA 4MRUA 3MA5A 3VLEA 2EILE 3D9IA 2P9NG 5E75A 1DCQA 3DWLG 4HRMB 5FZSA 4APOA 3ABKE 2AXZA 1W3BA 3CR3A 3OXFA 4GYOA 5CMWA 4IULA 5KJLA 3IV0A 5LFAA 1SQMA 3LY9A 4U95D 5IY5E 4TUUA 5D0QD 2XEEA 4G1TA 3APDA 2X6JA 1HG2A 1B89A 3SD5A 1DC2A 3TL5A 3ASDA 3CVNA 1RW2A 1U3DA 4CGWA 2I1KA 4HOTA 1E96B 3Q75A 1IYGA 3JUEA 3CVQA 3QK0A 4TXPA 3SFXA 3ABLE 3GZ1A 2XPYA 5ENTD 3CVPA 1UOHA 4ANWA 4JA7A 1N9AA 3ASGA 4CDRA 3X2QE 1HF8A 1N4PA 2NXPA 3EU9A 4CT4A 3PRZA 1K3ZD 3EHRA 3L17A 3FTZA 3CQCB 3E33A 2VGXA 3CVXA 3FUIA 1RZ4A 4BERA 3TWWA 1NA3A 3ONLA 1N95A 5JHAA 2HE0A 3SQVA 4BY6A 4KZCA 4EECA 2P9PG 4G26A 1DVPA 4HRLA 1OCZE 1Y8MA 1JWGA 4ILIA 2WXPA 4A63B 4AY6A 2UWJG 1H2VC 4KZ0A 3CHQA 4KXKB 4HXIA 3D9NA 4DJAA 2CG3A 3ESLA 3TJPA 1X81A 4J8FA 4ATZD 3ZIMA 3G2TA 3PS6A 1TNOA 2KXPC 2J49A 1KT0A 4OYSA 3CHRA 1PC2A 4JEHA 4YDYA 5ANRA 3ZEFA 2XRYA 4F7AA 1HO8A 3PUKA 2YHCA 2RG8A 4U7EB 3CK9A 1DCEA 3Q7AA 2XENA 3J5QB 3FU6A 3UINC 1HS6A 4EZKA 4MLPA 4XI0A 3ZXPA 1L5JA 2H6FA 4UWHA 4ATGA 4ME2A 4I43A 5JHBA 2BUGA 2JLBA 3RRUA 2R59A 4N39A 1BLXB 3FWVA 3SBSA 5AIJA 3QNKA 4XKBA 2FULA 3KAEA 2KATA 5J08A 3U9WA 3CEQA 3ASNE 4I6JA 2X6FA 5FZQA 2IOLA 4CCAA 4AY5A 3FUFA 5G55A 1N94A 4LRZA 4RG6A 4FADA 2EINE 4YVOA 5FZRA 4K5CA 1JWFA 3W9FA 3EU5A 2GRMA 1KZPA 4WNFA 3R7QA 2OCCE 4N2SA 3K9IA 1KT1A 1TN7A 4FHKA 2KCKA 2FI7A 1N54A 1N11A 2AJAA 3L54A 3DSTA 4FJZA 3FU5A 4GZ6A 4B8AA 3LPZA 3T9KA 3TG4A 3NZUA 3Q73A 1WM5A 3L6AA 2QC9A 4HRNA 4A3TA 1FT1A 3ULYA 3L9TA 3QWWA 3D9KA 2EQXA 1N4SA 3BG0B 2IEJA 1TJFA 1TNYA 4JEUA 3QDNA 4TUMA 1TNBA 2BF0X 4FU3A 1O1TA 5CRVA 1UN8A 2WB2A 4DI4A 4C48B 5D0OD 2J09A 4GTQA 5A7DB 3FUMA 3JXJA 4XIFA 2VSNA 5KWDA 2RD0A 4WWPA 5ARFA 3QB2A 4HVBA 2JABA 4A55A 1FVHA 1AP7A 1TNZA 3FDHA 3OXGA 2X6KA 3CGHA 5LP0A 4LG6A 5AQ9A 2IJGX 4JHJA 5FIOA 2GW1A 3D9OA 4WAFA 3V2XA 2LAHA 5BW8C 3SNXA 2MHKA 2HO1A 3D9HA 2V4HC 3SBTB 3CVVA 4PUCA 4FHJA 3EJNA 3JCKC 4UWGA 1NI1A 3O48A 1BD8A 2ZGDA 2AXUA 2XEVA 1FT2A 3L08A 4DX2A 3QAQA 2DBAA 4JXTA 4JC8A 1E7UA 1H19A 2RFMA 4UQZA 3CKBA 1EF1C 3AG4E 1HU3A 4AVXA 4L1BA 3AG1E 3ML8A 4ACKA 2WXGA 3ZVVA 1P5QA 3PDNA 5KCMA 1E8XA 2VTBB 3EHMA 3RRMB 5T4YA 4GMJA 5CEDB 3NF1A 2RFAA 2OVFA 3AU4A 5T3RA 5D2MC 1YA0A 4ZFHA 3TWSA 4GB9A 4TV3A 2UY1A 5M72A 5EN5D 1XGWA 2WMNA 4K0RA 4URKA 2WXMA 4BX8A 3HG0D 2LXLA 3Q79A 3C98A 5AYWD 4BT9A 2CHWA 4QFVA 3URZA 4U0ZA 1LD7A 3CHSA 3CVUA 4L7TA 2F8XK 1S64A 1K1AA 2DIWA 5KBAA 2FO7A 3E37A 5AAOA 1HH8A 2E2EA 3CHPA 3I4GA 4FJYA 1WY6A 1N52A 4GCOA 2AXVA 5ARGA 2ZU6B 4U8YD 3BG1B 3V79K 4YNDA 4UI9J 4N3BA 4RLYA 4HS2A 3TWTA 3VTYA 1U2VG 3Q78A 4U8HA 2WM9A 3G2WA 3IHVA 3ZW3A 1QQEA 3HVEA 3ZUVB 4I1MA 3TAXA 4HI8A 5A23A 1JUQA 4A3VA 5G05C 2WQ7A 2YQ8A 3LVRE 3DRAA 2WQ6A 3ZYMA 1TJCA 2F8YA 3ISMC 2P9LG 5EYLA 3BQOA 1Y6IA 1K8KG 4ILHB 3B13A 4J8SA 5A6CA 3Q47B 1TN8A 2M63A 2E0IA 2Y0BG 3DEPA 4UI9C 4JHRA 2IFUA 2WVIA 3F6QA 2R03A 4XX5A 2EIKE 3UT7A 4BTAA 4FLHA 4EZJA 4H7XA 3ASOE 3DSWA 2WQHA 3UM0A 4F6RD 1SZAA 4NRHB 4FA6A 2WXIA 3RRNB 1ELKA 4RQIA 4AEZC 4Q96A 3SO8A 1JCQA 5KNGA 4UQXA 1AWCB 4EPZA 2LAIA 1SA5A 2VSXE 3RKVA 1OT8A 1YMPA 2Q7FA 4L9PA 1MJ0A 1IKND 3QC1A 3QWPA 4XEIG 3IEGA 4M7CA 2AVPA 1UN9A 1NP7A 3GZ2A 3AG3E 5CBNA 1Z6TA 4K5BA 4E6HA 3E30A 2P9UG 4EBAA 3TXNA 2RKKA 1ELRA 2I2OA 1BU9A 4P29A 2L9BA 3D9LA 1INZA 1IHBA 4UUCA 3ASFA 4LCTA 3APFA 3CK7A 4DK5A 2DVWA 3UX4A 1Z5SC 3FTVA 3PNLB 1OWPA 3AS4A 3WXXA 1VDYA 3G2UA 3CK8A 3Q49B 1N4QA 3E32A 4U63A 3EIJA 4ABNA 3MJWA 5C2YA 3FU0A 4GTPA 4B0ZA 2Y1LE 1E8YA 1QYMA 3UUXA 1HX8A 5G2NA 1OWOA 3FUEA 3CLJA 4CGVA 2QFCA 5FWQA 3HDXA 4GPMA 1LD8A 4GTVA 3TWXA 3UIOC 4UWKA 5CCMA 2GRNB 3LYAA 2OEVA 1NFIE 4DUIA 1LF8A 4JPSA 3B95A 4B89A 3EDTB 3FUNA 5BUZA 4ANUA 4C0MA 2J4BA 2WXJA 3PE4A 4PS8A 4MKTA 3RAUA 2V5FA 4WUYA 3PZ4A 2QYJA 3LJ3A 2OVBA 2BTDA 5FQ8A 2MOWA 5BXUA 4U0UA 3RIBA 3Q4AB 4N5QA 3UI2A 3KEAA 3QARA 3TWVA 5CRUA 3V2OA 3T8KA 4PS3A 5EIDA 1NL4A 4FP7A 4I2WA 4EHMA 5LX8A 4GPKA 3PEUB 1FVFA 4UQYA 2JEKA 3FTWA 2B6CA 3CQGB 4DPRA 1MX4A 4Y6WA 5D66A 3ZXSA 5HRYA 4JB8P 4L23A 3CSFA 1HZ4A 4FULA 1D8DA 2DZNA 3FUJA 3B7SA 4HOUA 3MKRA 3I5PA 4A1SA 2PZIA 4GTRA 1H6PA 2ILRA 2P9KG 4U0SA 2L6JA 2LUHA 2XHEA 4BFRA 4F53A 4C9BB 4OAUC 1UJKA 2OV8A 4M3OA 2H6IA 2DYSE 3R7RA 3VTXA 3HXEA 4LERA 1HG5A 4U07A 2VYIA 5ENPD 3MZLB 4GZ3A 1WDYA 3LY8A 2VGXB 3RSEG 4L2LA 1OWMA 3FTUA 4CEMA 4G11A 2HR2A 4G2VA 2X38A 3KS2A 2LSUA 1OXJA 4GA1A 2VTBA 3NBNB 5E76A 4B94A 2OEWA 3I4RB 2DYRE 4HBDA 4ZHBA 2LNIA 5EIBE 2AW6A 3IHYA 3VLFA 1OCRE 2L6BA 3D9PA 4GTTA 3RO3A 2FF4A 2YNQA 4O60A 2KZTA 3HRAA 2C0MA 3UM2A 4OAVB 5BPPA 5FQ7A 3FY4A 1H6KA 4TXQA 4DLQA 4XI9A 4G8KA 2XGOA 4K03A 4Z68A 4GZDA 4N2QA 2XQ0A 3UIPC 4AIFA 3FEXA 4JL0A 3ZHEA 4KVMA 3JQ1A 3CVYA 1OUVA 3B7RL 4I17A 4GTSA 4GA0A 4TRQA 4GZ5A 4MBGA 3BU8A 3MKQA 3GYZA 2PNNA 3HXDA 4HOSA 1H0AA 1V55E 1ZU2A 1MX6A 3MV2B 1HE8A 5CBOA 2XGMA 4A1GA 4LNUD 1OWNA 2P9IG 2LSVA 3DSXA 1H2UA 3UM1A 3LY7A 3VLDA 2L0TB 4GZCA 3CSTA 2V0PA 3UMVA 3EIQC 5BT1A 5JJTA 4G8LA 3FUKA 2J4DA 3NQPA 5AJLA 2LXMA 4GYWA 3DSUA 2IO3C 2XPIA 4GTOA
chains in the Genus database with same CATH topology
5FJYA 4J8SA 4I6GA 5DBKA 4Q69A 4I9CA 3NZSA 1PAQA 2WXRA 5A6CA 3Q47B 2M63A 4I1OB 1NA3A 2CHXA 2C0LA 3ONLA 3T5XA 2NC9A 3S7FA 5JHAA 4WNDA 2E0IA 5JJ7A 1UW4B 4RSYA 3LCAA 3AU5A 4BT8A 4KZCA 4BY6A 3ML9A 4EECA 4G26A 2MRIA 2A4ZA 1DVPA 2CFUA 4H7YA 4JHRA 2IFUA 2WVIA 4UI9C 1Y8MA 1JWGA 4XKCA 4ILIA 4WWOA 2WXPA 4XX5A 4AY6A 2UWJG 1H2VC 5G04J 3UT7A 2IF4A 4BTAA 3ZN3A 4FLHA 2WPVA 4EZJA 3EHNA 4KZ0A 4H7XA 5BV1A 1A17A 2I1JA 3CHQA 5JJ6A 3AS8A 4KXKB 4HXIA 4I9EA 3PUJA 5FQ4A 2WQHA 4IN3B 3D9NA 4DJAA 1SZAA 3S2AA 2CG3A 3ESLA 2V8SE 4NRHB 5ENNA 4FA6A 3IKOB 2WXIA 3RRNB 1ELKA 4G24A 3TJPA 5T8IA 2PM7A 3LDZA 4GCNA 4J8FA 3S7JA 4AEZC 5BV0A 3FHEA 4Q96A 3ZIMA 3G2TA 3PS6A 4I6EA 4UQXA 3P1UA 1KLXA 4EPZA 2LAIA 2J49A 3O4ZA 1KT0A 1NA0A 2VSXE 1H2TC 3RKVA 2Q7FA 2KCVA 5AENA 4PH4B 1QZ2A 4OYSA 3CHRA 1PC2A 3FTYA 4JEHA 3QC1A 4NQ0A 3QWPA 5ANRA 1NZNA 1WAO1 4N3AA 3ZEFA 2XRYA 4F7AA 3QJZA 1HO8A 3ZYLA 4UWFA 3PUKA 2YHCA 4D10C 3IEGA 2RG8A 3CHMA 1S0PA 2AVPA 1UN9A 3CK9A 2ONDA 1NP7A 3FH5A 3GZ2A 2WXNA 3FU6A 1Z6TA 3G2VA 3TXMA 4KVOA 1HS6A 4EZKA 3MEKA 4F3VA 3JUIA 4E6HA 5LOZA 3IBEA 4EBAA 2NSZA 4CDMA 3CVLA 3TXNA 3U3WA 4MLPA 4XI0A 1L5JA 4AXHA 2R17C 5J90A 1ELRA 4E85A 4UWHA 4ATGA 4ME2A 2X3MA 4I43A 2I2OA 2VGYA 5JHBA 3UT4A 2BUGA 2X6IA 4PDXA 3SZ7A 2JLBA 3RRUA 2R59A 4N39A 4JZYA 4P29A 1FCHA 3ENEA 5G04C 5DIZA 4KYOB 3FWVA 3HYMB 3SBSA 5AIJA 2L9BA 3QNKA 4RVBA 3LVQE 2VSYA 3D9LA 1INZA 4XKBA 2FULA 3BEEA 3KAEA 4GMLA 4J6IA 2KATA 5J08A 3ASFA 3U9WA 3CEQA 3I3NA 5FTPA 3GW4A 4XZ4A 4LCTA 3GZSA 3APFA 4I6JA 2X6FA 3CK7A 5FZQA 4DK5A 2IOLA 4BTBA 3CIAA 2J07A 3UX4A 4AY5A 3FTVA 3FUFA 5G55A 4CCAA 3ZPJA 3LEWA 3PNLB 1OWPA 1Z3XA 3ESKA 1HFAA 4LRZA 3AS4A 4RG6A 1VDYA 2L0IA 3WXXA 2QY7A 3G2UA 3CK8A 3FU3A 4YVOA 2XCBA 4UI9K 5FZRA 4CT0A 5HQ8A 1JWFA 3Q49B 4BWRA 4U63A 1EPUA 2GRMA 3EIJA 4RG9A 4WNFA 3MJWA 1UG3A 3FU0A 4NACA 5C2YA 3ZYQA 4ABNA 2IU1A 3R7QA 3RJVA 4B0ZA 1E8YA 3UUXA 1HX8A 5G2NA 4N2SA 3K9IA 2IONA 1JPLA 3PEVB 2WMOA 1IQUA 2YHEA 1KT1A 1OWOA 2XCCA 3AS5A 4FHKA 3FUEA 3UT8A 2KCKA 2FI7A 1N54A 3CLJA 4APFA 2XGSA 3LS8A 4GU5A 3L54A 4CGVA 2QFCA 3TG5A 4FJZA 3FU5A 1ZBPA 3HDXA 5FWQA 1XNFA 3D9MA 4GZ6A 4R7LA 3LPZA 4B8AA 4UWKA 1EDUA 5CCMA 2UY1B 2VSOE 3SFZA 1E8WA 3TG4A 3LYAA 3NZUA 3L22A 3S7BA 1IQRA 1WM5A 1LF8A 4JPSA 3B7TA 3HIZA 3L6AA 2GRLA 1EYHA 3SI5A 4B89A 3EDTB 4O6FA 3D3MA 3FUNA 4LUNU 5BUZA 4A3TA 4ANUA 2I9CA 3D9JA 4WWNA 4YVQC 3SGHA 3ULQA 2VJ8A 2WXOA 4C0MA 3QWWA 3U64A 2CG2A 2J4BA 2WXJA 3D9KA 3FP3A 1OWLA 2EQXA 3PE4A 5ANLA 2WXKA 4PS8A 3HHMA 4MKTA 3BG0B 2V5FA 4WUYA 4G23A 1TJFA 2KCLA 2KM4A 4JEUA 5CCLA 3QDNA 3RK6A 2FEZA 3LJ3A 2OVBA 2BTDA 5FQ8A 3FH8A 2BF0X 4FU3A 4HLEA 3OAWA 2KZTB 3LXUX 1UN8A 2MOWA 2WB2A 4DI4A 4U0UA 5D0OD 3RIBA 2J09A 3U4TA 4IRUA 3TGOA 3Q4AB 5A7DB 1MQSA 4ANVA 3OXLA 3T8MA 3FUMA 4Y6CA 3QARA 2OOEA 4KMOA 4KT6B 4U04A 3Q5MA 4XIFA 2VSNA 2RD0A 4PS3A 4WWPA 1BPOA 5G05J 3PH0C 5ARFA 2PM6A 3ASHA 4F1SA 4KBQA 4FP7A 5CHEE 3QB2A 4HVBA 1PY1A 3ONKA 2PQNA 3MYVA 4I2WA 4A55A 3R9AB 4HOQA 3LKUA 3CV0A 3ZHEB 4CDNA 5LX8A 4GPKA 4EQFA 1FVHA 3DPDA 4N5CA 3MGBA 3PEUB 3PREA 5EX0A 3SF4A 2X6HA 3FDHA 1FVFA 4UQYA 3OXGA 2IOSA 2JEKA 3FTWA 4HORA 1X5BA 2X6KA 3CGHA 4WNEA 4EZLA 3CQGB 5FQ6A 4DPRA 4DI3A 5LP0A 2WXHA 3APCA 3MKQB 4Y6WA 3ZGQA 3ZXSA 5FT9A 4AOFA 3UQ3A 2IJGX 4Q94A 4L23A 4JVSA 2FBNA 4JHJA 3CSFA 4CRWA 1HZ4A 4FULA 2GW1A 3D9OA 3FULA 2KC7A 4WAFA 2LAHA 1GW6A 5BW8C 3SNXA 4HFGA 3FUJA 1E7VA 4WNGA 2MHKA 3B7SA 4I2ZA 4AP2A 2HO1A 1ELWA 2IQCA 4HOUA 3MKRA 3FEYA 3I5PA 3SBTB 4A1SA 5BNWA 2PZIA 3CVVA 2GGFA 4PUCA 4ACLA 3N71A 4XE0A 4FHJA 3HVEB 2ILRA 4BX9A 4GA2A 4EBAG 4U0SA 3B7UX 3EJNA 3JCKC 2L6JA 3PZDA 4UWGA 2AWIA 2YINA 3O48A 2XHEA 3PNTB 2AXUA 2XEVA 3L08A 4BFRA 3QAQA 2DBAA 4JXTA 4JC8A 2WXFA 4F53A 1E7UA 1H19A 4C9BB 3S7DA 1UJKA 2J08A 2OV8A 4M3OA 3FUDA 4UQZA 3CKBA 3R7RA 3VTXA 2V4LA 4C0EA 2I6HA 1EF1C 4LERA 4MS6A 1SZ9A 2DCPA 1HG5A 3T5VA 1HU3A 4U07A 2VYIA 4AVXA 4AJWA 4L1BA 3MZLB 4GZ3A 3ML8A 4ACKA 2WXGA 3ZVVA 3FFLA 3LY8A 2VGXB 2WXQA 3L16A 4J8EA 1OWMA 4L2LA 3FTUA 4CEMA 3FTXA 2VQ2A 3Q15A 5CMYA 1QNFA 3FUHA 4NURA 5KJMA 1P5QA 2Y4UA 4G25A 4GAAA 2LO6A 3PDNA 3KD7A 5KCMA 1E8XA 3DBSA 3QOUA 2VTBB 3JYSA 2P58C 2PQRA 4G11A 3EHMA 2HR2A 4G2VA 3RRMB 2X38A 5T4YA 4GMJA 2A5UA 2WXLA 3NF1A 2XPZA 3QKYA 2OVFA 4B8CB 3MX3A 2Y3AA 3AU4A 5T3RA 1YA0A 3KS2A 3ZYKA 1MHQA 2LSUA 2CFZA 1U3CA 4GA1A 4OVUA 2VTBA 5E76A 4GB9A 4JHKA 2UY1A 4TV3A 4B94A 5M72A 4ANXA 3MCXA 3JQ0A 5EDSA 1XGWA 2WMNA 3I4RB 3ZFWA 4K0RA 3RU0A 4UWLA 3PE3A 5HI7A 4URKA 2WXMA 2LNIA 4PS7A 4BX8A 3PVLA 1IHGA 4V3IA 3C98A 5KJNA 5AYWD 4MRUA 2AW6A 3IHYA 4BT9A 5C1DA 2CHWA 4QFVA 3MA5A 4DLOA 3VLFA 4FLBA 3URZA 3VLEA 2R5SA 4U0ZA 3D9PA 3D9IA 3RO3A 5E75A 2FF4A 3L13A 2YNQA 2HYZA 2KZTA 4AM9A 5LCWJ 3CHSA 1DNPA 2C0MA 3QWVA 3CVUA 4L7TA 5BPPA 3OTNA 5FZSA 5FQ7A 4JA9A 3FY4A 4APOA 2DIWA 1TEZA 1H6KA 2FO7A 3P2BA 4DLQA 4XI9A 2HM8A 4L2YA 2AXZA 2XGOA 4K03A 1HH8A 1W3BA 3CR3A 2E2EA 3CHPA 3I4GA 4FJYA 3OXFA 4GZDA 4GYOA 4N3CA 5EKQD 2XQ0A 4AIFA 4FADA 5CMWA 1WY6A 3FEXA 4IULA 3CKCA 1N52A 5KJLA 3IV0A 5LFAA 4JL0A 1SQMA 4GCOA 3ZHEA 3FTSA 4KVMA 3JQ1A 2AXVA 3CVYA 3LY9A 5ARGA 1OUVA 3B7RL 2ZU6B 4I1AA 2PL2A 3BG1B 4I17A 4BSXA 4GA0A 4TUUA 4YNDA 4TRQA 4GZ5A 5D0QD 4G1TA 4J8DA 3APDA 3E4BA 3MKQA 4UI9J 4N3BA 3GYZA 4HS2A 1UJJA 4OVVA 2X6JA 4HOSA 2Y4TA 1H0AA 4J0UA 4AV7A 1HG2A 1B89A 1ZU2A 3SD5A 3TL5A 3MV2B 3ASDA 3VTYA 3CVNA 1HE8A 3SHFA 3KEZA 1U3DA 2XGMA 4N2QA 4JW1A 4CGWA 3CVWA 3FH7A 1E90A 4GYYA 2I1KA 4HOTA 4U8HA 4A1GA 1E96B 2WM9A 3ZRHA 4FC8A 1OWNA 3G2WA 2LSVA 1IYGA 1H2UA 3IHVA 3CVQA 3ZW3A 3QK0A 1QQEA 3HVEA 1Z3YA 1HXIA 4LEUA 4ILGA 3GZ1A 3LY7A 4I1MA 3VLDA 3TAXA 2L0TB 2XPYA 4GZCA 3CSTA 3UPVA 5A23A 2V0PA 4IYPA 5EX3A 5LCWC 2CHZA 3CVPA 1JUQA 4ANWA 2C2LA 4A3VA 5G05C 4JA7A 2WQ7A 3UMVA 2YQ8A 3ASGA 3LVRE 4CDRA 3EIQC 5BT1A 2J9QA 5JJTA 2WQ6A 3CHOA 2XRZA 1E8ZA 1HF8A 3U66A 3ZYMA 3FUKA 5AJDA 1TJCA 2J4DA 2NXPA 3G2SA 4CT4A 3NQPA 5AJLA 4GYWA 3PRZA 4W9RA 3L17A 3FTZA 5KJKA 2XPIA 3CQCB 2VGXA 3RO2A 3CVXA 3MV3B 1Y6IA 3FUIA 4ILHB 3B13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FJY A;  5DBK A;  4I9C A;  5A6C A;  3Q47 B;  1NA3 A;  2C0L A;  2NC9 A;  3S7F A;  4WND A;  5JJ7 A;  3LCA A;  4BT8 A;  4G26 A;  4JHR A;  4UI9 C;  4H7Y A;  2IFU A;  1Y8M A;  4AY6 A;  2UWJ G;  5G04 J;  2IF4 A;  4BTA A;  3ZN3 A;  2WPV A;  4H7X A;  1A17 A;  5JJ6 A;  3AS8 A;  4KXK B;  4I9E A;  2WQH A;  4IN3 B;  4NRH B;  4G24 A;  3S7J A;  4GCN A;  4J8F A;  4UQX A;  1KLX A;  1KT0 A;  1NA0 A;  3RKV A;  2Q7F A;  2KCV A;  1QZ2 A;  1PC2 A;  4NQ0 A;  3QWP A;  1NZN A;  1WAO 1;  4N3A A;  2YHC A;  3IEG A;  3CK9 A;  2AVP A;  2OND A;  3GZ2 A;  3MEK A;  4F3V A;  3CVL A;  3U3W A;  4XI0 A;  1ELR A;  4ME2 A;  2VGY A;  2BUG A;  3SZ7 A;  2JLB A;  4N39 A;  1FCH A;  5G04 C;  5DIZ A;  4KYO B;  3FWV A;  3HYM B;  2VSY A;  3BEE A;  3KAE A;  2KAT A;  3ASF A;  3CEQ A;  5FTP A;  3GW4 A;  3CK7 A;  5FZQ A;  4BTB A;  4AY5 A;  3ZPJ A;  3ESK A;  3AS4 A;  4RG6 A;  3WXX A;  5FZR A;  4YVO A;  3CK8 A;  2XCB A;  4UI9 K;  5HQ8 A;  3Q49 B;  4BWR A;  4RG9 A;  4WNF A;  4ABN A;  3RJV A;  3UUX A;  4N2S A;  3K9I A;  1KT1 A;  2XCC A;  3AS5 A;  2KCK A;  2FI7 A;  2XGS A;  4CGV A;  2QFC A;  3TG5 A;  1ZBP A;  1XNF A;  4GZ6 A;  3LPZ A;  5CCM A;  2UY1 B;  3TG4 A;  3LYA A;  3S7B A;  1WM5 A;  3EDT B;  4O6F A;  4YVQ C;  3ULQ A;  3QWW A;  3FP3 A;  3PE4 A;  2V5F A;  4WUY A;  4G23 A;  2KCL A;  5CCL A;  3QDN A;  2FEZ A;  4U0U A;  5D0O D;  3RIB A;  3U4T A;  3TGO A;  3Q4A B;  5A7D B;  3OXL A;  4Y6C A;  2OOE A;  4U04 A;  3Q5M A;  4XIF A;  2VSN A;  5G05 J;  5ARF A;  3ASH A;  4KBQ A;  5CHE E;  2PQN A;  4I2W A;  3R9A B;  4HOQ A;  3LKU A;  3CV0 A;  3ZHE B;  4GPK A;  4EQF A;  4N5C A;  3SF4 A;  5EX0 A;  4UQY A;  3OXG A;  4HOR A;  4WNE A;  4Y6W A;  3ZGQ A;  5FT9 A;  3UQ3 A;  2FBN A;  1HZ4 A;  2GW1 A;  2KC7 A;  5BW8 C;  4WNG A;  2MHK A;  4I2Z A;  2HO1 A;  1ELW A;  4HOU A;  3MKR A;  4A1S A;  5BNW A;  2PZI A;  3N71 A;  4GA2 A;  4U0S A;  2L6J A;  3O48 A;  2XEV A;  2DBA A;  3S7D A;  4UQZ A;  3CKB A;  3VTX A;  2I6H A;  4U07 A;  2VYI A;  4GZ3 A;  3FFL A;  3LY8 A;  2VGX B;  4J8E A;  2VQ2 A;  3Q15 A;  5KJM A;  1P5Q A;  2Y4U A;  4G25 A;  3PDN A;  3KD7 A;  3QOU A;  3JYS A;  2P58 C;  2PQR A;  2HR2 A;  4G2V A;  3NF1 A;  3QKY A;  1YA0 A;  3KS2 A;  2LSU A;  4GA1 A;  2UY1 A;  4B94 A;  5M72 A;  3ZFW A;  3RU0 A;  3PE3 A;  5HI7 A;  2LNI A;  1IHG A;  5KJN A;  5AYW D;  4BT9 A;  5C1D A;  3MA5 A;  3URZ A;  2R5S A;  4U0Z A;  3RO3 A;  2FF4 A;  2HYZ A;  4AM9 A;  5LCW J;  3QWV A;  2C0M A;  5FZS A;  4JA9 A;  4APO A;  2FO7 A;  4XI9 A;  2XGO A;  1HH8 A;  1W3B A;  2E2E A;  4N2Q A;  3OXF A;  4GYO A;  4N3C A;  5EKQ D;  4AIF A;  3CKC A;  5KJL A;  4JL0 A;  4GCO A;  3ZHE A;  3LY9 A;  5ARG A;  1OUV A;  4I1A A;  2PL2 A;  4I17 A;  4GA0 A;  4YND A;  4GZ5 A;  5D0Q D;  4G1T A;  4J8D A;  3E4B A;  4UI9 J;  4N3B A;  3GYZ A;  4HOS A;  2Y4T A;  4J0U A;  1B89 A;  1ZU2 A;  3MV2 B;  3ASD A;  3VTY A;  3CVN A;  2XGM A;  4CGW A;  4GYY A;  4HOT A;  1E96 B;  2LSV A;  1IYG A;  3CVQ A;  1QQE A;  1HXI A;  4LEU A;  3GZ1 A;  3LY7 A;  3TAX A;  3UPV A;  5EX3 A;  5LCW C;  3CVP A;  2C2L A;  5G05 C;  4JA7 A;  2YQ8 A;  3ASG A;  4CDR A;  5JJT A;  5BT1 A;  2J9Q A;  1TJC A;  4GYW A;  4W9R A;  5KJK A;  2XPI A;  2VGX A;  3RO2 A;  3MV3 B; 
#chains in the Genus database with same CATH topology
 4I6G A;  4I9C A;  1PAQ A;  4I1O B;  2CHX A;  2F37 A;  3S7F A;  4WND A;  1BI7 B;  5JJ7 A;  1UW4 B;  4RSY A;  4BT8 A;  1D8E A;  2MRI A;  2A4Z A;  2CFU A;  4H7Y A;  3Q9N C;  3PZ2 A;  5G04 J;  4B93 B;  3ZN3 A;  3EHN A;  5EYP F;  4BES A;  5BV1 A;  2I1J A;  5JJ6 A;  1MX2 A;  3AS8 A;  4I9E A;  3PUJ A;  5FQ4 A;  4IN3 B;  5ENQ D;  1SVX A;  3S2A A;  3LJN A;  3TWR A;  5HS0 A;  2V5Q C;  2PM7 A;  3SFY A;  3P1U A;  1NA0 A;  3ZNG A;  1H2T C;  5AEN A;  4PH4 B;  1QZ2 A;  1OCC E;  4LNB A;  5AN8 A;  3FTY A;  1WAO 1;  1TNU A;  3ZYL A;  5BXO A;  3V30 A;  2XS8 A;  4D10 C;  5B1A E;  3FH5 A;  1MZC A;  2WXN A;  1WG0 A;  3G2V A;  3TXM A;  4KVO A;  3MEK A;  4F3V A;  5LOZ A;  3IBE A;  4BSZ B;  2NSZ A;  4CDM A;  2QYU A;  3PZ3 A;  5H7P A;  4DX1 A;  4AXH A;  2R17 C;  2R02 A;  5J90 A;  4E85 A;  3SZ7 A;  1FCH A;  5G04 C;  5DIZ A;  2IO2 C;  4LNG A;  4RVB A;  2VSY A;  3BEE A;  4GML A;  3GW4 A;  3GZS A;  2ZGG A;  4BTB A;  3CIA A;  3B7B A;  3ZPJ A;  1KZO A;  4BEP A;  1Z3X A;  2L0I A;  2QY7 A;  3FU3 A;  3Q9U C;  1EPU A;  3L82 A;  1UG3 A;  4NAC A;  3NOC D;  2IU1 A;  2ION A;  3PEV B;  2R05 A;  2YHE A;  1JCR A;  3NAW A;  3UKU G;  3UT8 A;  3LS8 A;  1D9S A;  3NB2 A;  1ZBP A;  1XNF A;  3D9M A;  4R7L A;  3AAA C;  2EIM E;  2UY1 B;  2VSO E;  1K1B A;  3S7B A;  3B7T A;  3SI5 A;  2XZT G;  1EYH A;  4O6F A;  4LUN U;  3D9J A;  3SGH A;  4YVQ C;  3ULQ A;  4CZ2 D;  2FO1 E;  3U64 A;  3FP3 A;  1OWL A;  2ZXW E;  3HHM A;  4G23 A;  2KCL A;  3DSS A;  2FEZ A;  2MYO A;  3FH8 A;  3OAW A;  3LXU X;  1TYQ G;  3AG2 E;  1SA4 A;  3U4T A;  4IRU A;  1MQS A;  4ANV A;  3KSL A;  3T8M A;  3ZKJ A;  3EUV A;  5ITZ F;  2OOE A;  4KMO A;  4KT6 B;  4U04 A;  4O1P A;  3ASH A;  4F1S A;  3ONK A;  3MYV A;  2H6G A;  3R9A B;  4HOQ A;  3PZ1 A;  2X6H A;  1FPP A;  4O1O A;  1X5B A;  4DI3 A;  3APC A;  3EHQ A;  3ZGQ A;  3DEO A;  3UQ3 A;  4Q94 A;  4JVS A;  2FBN A;  3UXG A;  4CRW A;  2GRQ B;  2BKG A;  4DRX E;  2KC7 A;  1GW6 A;  3HXF A;  4WNG A;  4I2Z A;  2IQC A;  5ENO D;  5AQ7 A;  4ACL A;  3HVE B;  1MYO A;  4EBA G;  3B7U X;  2AWI A;  2YIN A;  3PNT B;  3IXE A;  2J08 A;  3HXC A;  2GRO B;  4C0E A;  3BUA A;  4MS6 A;  3T5V A;  2DCP A;  4AJW A;  2ZIR A;  1S63 A;  3FFL A;  3L16 A;  4J8E A;  3FTX A;  3Q15 A;  3FUH A;  4NUR A;  5KJM A;  2Y4U A;  2LO6 A;  3DBS A;  4K5A B;  3JYS A;  2P58 C;  2PQR A;  2A5U A;  2XPZ A;  2XS1 A;  3QKY A;  4B8C B;  4HI9 A;  2CFZ A;  1U3C A;  4JHK A;  4ANX A;  3MCX A;  4CYM D;  3RU0 A;  4UWL A;  3PE3 A;  1V54 E;  5AQB A;  3JXI A;  5EIL A;  2IY0 C;  5KJN A;  5C1D A;  2ETB A;  4DLO A;  4FLB A;  2GRP B;  2R5S A;  1TR4 A;  3L13 A;  2HYZ A;  4AM9 A;  5LCW J;  1DNP A;  3QWV A;  5B1B E;  3OTN A;  4JA9 A;  1TEZ A;  3SY2 A;  3P2B A;  2HM8 A;  4L2Y A;  4YDE A;  4DX7 D;  2J8S D;  2DZO A;  4N3C A;  5EKQ D;  2KBX A;  4JD2 G;  3CKC A;  3R9M A;  3KSQ A;  3FTS A;  5B3S E;  4I1A A;  5ENR D;  2PL2 A;  4BSX A;  4J8D A;  3E4B A;  1UJJ A;  4OVV A;  2Y4T A;  2ETC A;  4J0U A;  4AV7 A;  2XZD G;  3SHF A;  3KEZ A;  2ZIS A;  4JW1 A;  3CVW A;  3FH7 A;  1E90 A;  4GYY A;  4HQD A;  3ZRH A;  3J5P A;  4FC8 A;  1ZB1 A;  1N0Q A;  1OCO E;  1Z3Y A;  1HXI A;  4LEU A;  4ILG A;  2NYJ A;  3UPV A;  4IYP A;  5EX3 A;  5LCW C;  2CHZ A;  2C2L A;  2H6H A;  3C3O A;  2J9Q A;  4BET A;  3CHO A;  2XRZ A;  1E8Z A;  3U66 A;  5AJD A;  3G2S A;  4W9R A;  5KJK A;  3RO2 A;  3MV3 B;  1N4R A;  5FJY A;  4F1P A;  5DBK A;  3C3R A;  4Q69 A;  3NZS A;  2WXR A;  3WG7 E;  5HKP A;  2C0L A;  3T5X A;  2NC9 A;  3LCA A;  3AU5 A;  3ML9 A;  2Y69 E;  3DXM G;  4XKC A;  4WWO A;  2IF4 A;  2WPV A;  2BED A;  1A17 A;  4YDW A;  3W9G A;  1YYH A;  2V8S E;  5ENN A;  4DX6 D;  4J8Y A;  3IKO B;  3ABM E;  4G24 A;  5T8I A;  3S7J A;  3LDZ A;  4GCN A;  5BV0 A;  4DX5 D;  3FHE A;  3ZU7 B;  2QZA A;  4I6E A;  1KLX A;  3V31 A;  3O4Z A;  4QQI A;  2KCV A;  2A5E A;  3C5R A;  4NQ0 A;  1NZN A;  4N3A A;  3QJZ A;  4UWF A;  3CHM A;  1S0P A;  2OND A;  4X8Q A;  3NOG D;  3JUI A;  2P2C P;  3TWQ A;  3CVL A;  3U3W A;  5JMN D;  1TN6 A;  2X3M A;  2VGY A;  3UT4 A;  2X6I A;  4PDX A;  4JZY A;  3ENE A;  4KYO B;  3HYM B;  3LVQ E;  4LSZ E;  4J6I A;  1QBQ A;  3I3N A;  5FTP A;  2F0Y A;  3C72 A;  4XZ4 A;  3UTM A;  2P9S G;  2J07 A;  3DXK G;  3LEW A;  3UM3 A;  3ESK A;  1HFA A;  4J7W A;  1BI8 B;  4CT0 A;  2XCB A;  4UI9 K;  5ENS D;  5HQ8 A;  4BWR A;  4RG9 A;  3ZYQ A;  3E34 A;  3RJV A;  4GMR A;  1JPL A;  2WMO A;  1IQU A;  2XCC A;  2DWZ A;  3AS5 A;  1H6O A;  1OY3 D;  4APF A;  2XGS A;  4GU5 A;  1S70 B;  3TG5 A;  1EDU A;  3SFZ A;  1E8W A;  3L22 A;  1IQR A;  2EIJ E;  3HIZ A;  2GRL A;  3D3M A;  5AQA A;  2I9C A;  1O5M A;  4WWN A;  4U8V D;  4NIK A;  2VJ8 A;  2WXO A;  2GRR B;  2CG2 A;  5ANL A;  2WXK A;  2KM4 A;  5CCL A;  3RK6 A;  3HXB A;  4HLE A;  2KZT B;  5AAR A;  3DPY A;  3TGO A;  3OXL A;  4Y6C A;  3Q5M A;  1JCS A;  1BPO A;  5G05 J;  3PH0 C;  3C3Q A;  2PM6 A;  3Q7F A;  1Q2Z A;  4KBQ A;  5CHE E;  1PY1 A;  2PQN A;  3LKU A;  3CV0 A;  3ZHE B;  4CDN A;  3UKR G;  3DPD A;  4N5C A;  1SW6 A;  4EQF A;  3MGB A;  3PRE A;  3SF4 A;  5EX0 A;  2VGE A;  2IOS A;  4HOR A;  1YCS B;  2R2L A;  4WNE A;  4EZL A;  5FQ6 A;  2WXH A;  3MKQ B;  5CEA A;  5FT9 A;  4AOF A;  5CEC B;  1G3N B;  3FUL A;  2B0O E;  4HFG A;  1E7V A;  4HNA D;  3DSV A;  4GTM A;  4AP2 A;  1ELW A;  2BKK B;  4HLL A;  5KNH D;  3FEY A;  5BNW A;  2GGF A;  3N71 A;  4XE0 A;  4BX9 A;  4GA2 A;  3TWU A;  3PZD A;  2ETA A;  2WXF A;  3S7D A;  1A5E A;  1O1S A;  3FUD A;  2V4L A;  2I6H A;  1SZ9 A;  2WXQ A;  5JA4 D;  3ULE G;  5CER B;  1KPS B;  2VQ2 A;  3AJI A;  5CMY A;  1QNF A;  4GAA A;  4G25 A;  4TXR A;  3KD7 A;  3QOU A;  1IXV A;  1N0R A;  5FIN A;  2WXL A;  3MX3 A;  2Y3A A;  1LTX A;  3ZYK A;  1MHQ A;  4OVU A;  3JQ0 A;  5EDS A;  4YDO A;  3ZFW A;  4U96 D;  5HI7 A;  1O1R A;  4PS7 A;  2XEH A;  3PVL A;  4HB5 A;  1IHG A;  4V3I A;  4MRU A;  3MA5 A;  3VLE A;  2EIL E;  3D9I A;  2P9N G;  5E75 A;  1DCQ A;  3DWL G;  4HRM B;  5FZS A;  4APO A;  3ABK E;  2AXZ A;  1W3B A;  3CR3 A;  3OXF A;  4GYO A;  5CMW A;  4IUL A;  5KJL A;  3IV0 A;  5LFA A;  1SQM A;  3LY9 A;  4U95 D;  5IY5 E;  4TUU A;  5D0Q D;  2XEE A;  4G1T A;  3APD A;  2X6J A;  1HG2 A;  1B89 A;  3SD5 A;  1DC2 A;  3TL5 A;  3ASD A;  3CVN A;  1RW2 A;  1U3D A;  4CGW A;  2I1K A;  4HOT A;  1E96 B;  3Q75 A;  1IYG A;  3JUE A;  3CVQ A;  3QK0 A;  4TXP A;  3SFX A;  3ABL E;  3GZ1 A;  2XPY A;  5ENT D;  3CVP A;  1UOH A;  4ANW A;  4JA7 A;  1N9A A;  3ASG A;  4CDR A;  3X2Q E;  1HF8 A;  1N4P A;  2NXP A;  3EU9 A;  4CT4 A;  3PRZ A;  1K3Z D;  3EHR A;  3L17 A;  3FTZ A;  3CQC B;  3E33 A;  2VGX A;  3CVX A;  3FUI A;  1RZ4 A;  4BER A;  3TWW A;  1NA3 A;  3ONL A;  1N95 A;  5JHA A;  2HE0 A;  3SQV A;  4BY6 A;  4KZC A;  4EEC A;  2P9P G;  4G26 A;  1DVP A;  4HRL A;  1OCZ E;  1Y8M A;  1JWG A;  4ILI A;  2WXP A;  4A63 B;  4AY6 A;  2UWJ G;  1H2V C;  4KZ0 A;  3CHQ A;  4KXK B;  4HXI A;  3D9N A;  4DJA A;  2CG3 A;  3ESL A;  3TJP A;  1X81 A;  4J8F A;  4ATZ D;  3ZIM A;  3G2T A;  3PS6 A;  1TNO A;  2KXP C;  2J49 A;  1KT0 A;  4OYS A;  3CHR A;  1PC2 A;  4JEH A;  4YDY A;  5ANR A;  3ZEF A;  2XRY A;  4F7A A;  1HO8 A;  3PUK A;  2YHC A;  2RG8 A;  4U7E B;  3CK9 A;  1DCE A;  3Q7A A;  2XEN A;  3J5Q B;  3FU6 A;  3UIN C;  1HS6 A;  4EZK A;  4MLP A;  4XI0 A;  3ZXP A;  1L5J A;  2H6F A;  4UWH A;  4ATG A;  4ME2 A;  4I43 A;  5JHB A;  2BUG A;  2JLB A;  3RRU A;  2R59 A;  4N39 A;  1BLX B;  3FWV A;  3SBS A;  5AIJ A;  3QNK A;  4XKB A;  2FUL A;  3KAE A;  2KAT A;  5J08 A;  3U9W A;  3CEQ A;  3ASN E;  4I6J A;  2X6F A;  5FZQ A;  2IOL A;  4CCA A;  4AY5 A;  3FUF A;  5G55 A;  1N94 A;  4LRZ A;  4RG6 A;  4FAD A;  2EIN E;  4YVO A;  5FZR A;  4K5C A;  1JWF A;  3W9F A;  3EU5 A;  2GRM A;  1KZP A;  4WNF A;  3R7Q A;  2OCC E;  4N2S A;  3K9I A;  1KT1 A;  1TN7 A;  4FHK A;  2KCK A;  2FI7 A;  1N54 A;  1N11 A;  2AJA A;  3L54 A;  3DST A;  4FJZ A;  3FU5 A;  4GZ6 A;  4B8A A;  3LPZ A;  3T9K A;  3TG4 A;  3NZU A;  3Q73 A;  1WM5 A;  3L6A A;  2QC9 A;  4HRN A;  4A3T A;  1FT1 A;  3ULY A;  3L9T A;  3QWW A;  3D9K A;  2EQX A;  1N4S A;  3BG0 B;  2IEJ A;  1TJF A;  1TNY A;  4JEU A;  3QDN A;  4TUM A;  1TNB A;  2BF0 X;  4FU3 A;  1O1T A;  5CRV A;  1UN8 A;  2WB2 A;  4DI4 A;  4C48 B;  5D0O D;  2J09 A;  4GTQ A;  5A7D B;  3FUM A;  3JXJ A;  4XIF A;  2VSN A;  5KWD A;  2RD0 A;  4WWP A;  5ARF A;  3QB2 A;  4HVB A;  2JAB A;  4A55 A;  1FVH A;  1AP7 A;  1TNZ A;  3FDH A;  3OXG A;  2X6K A;  3CGH A;  5LP0 A;  4LG6 A;  5AQ9 A;  2IJG X;  4JHJ A;  5FIO A;  2GW1 A;  3D9O A;  4WAF A;  3V2X A;  2LAH A;  5BW8 C;  3SNX A;  2MHK A;  2HO1 A;  3D9H A;  2V4H C;  3SBT B;  3CVV A;  4PUC A;  4FHJ A;  3EJN A;  3JCK C;  4UWG A;  1NI1 A;  3O48 A;  1BD8 A;  2ZGD A;  2AXU A;  2XEV A;  1FT2 A;  3L08 A;  4DX2 A;  3QAQ A;  2DBA A;  4JXT A;  4JC8 A;  1E7U A;  1H19 A;  2RFM A;  4UQZ A;  3CKB A;  1EF1 C;  3AG4 E;  1HU3 A;  4AVX A;  4L1B A;  3AG1 E;  3ML8 A;  4ACK A;  2WXG A;  3ZVV A;  1P5Q A;  3PDN A;  5KCM A;  1E8X A;  2VTB B;  3EHM A;  3RRM B;  5T4Y A;  4GMJ A;  5CED B;  3NF1 A;  2RFA A;  2OVF A;  3AU4 A;  5T3R A;  5D2M C;  1YA0 A;  4ZFH A;  3TWS A;  4GB9 A;  4TV3 A;  2UY1 A;  5M72 A;  5EN5 D;  1XGW A;  2WMN A;  4K0R A;  4URK A;  2WXM A;  4BX8 A;  3HG0 D;  2LXL A;  3Q79 A;  3C98 A;  5AYW D;  4BT9 A;  2CHW A;  4QFV A;  3URZ A;  4U0Z A;  1LD7 A;  3CHS A;  3CVU A;  4L7T A;  2F8X K;  1S64 A;  1K1A A;  2DIW A;  5KBA A;  2FO7 A;  3E37 A;  5AAO A;  1HH8 A;  2E2E A;  3CHP A;  3I4G A;  4FJY A;  1WY6 A;  1N52 A;  4GCO A;  2AXV A;  5ARG A;  2ZU6 B;  4U8Y D;  3BG1 B;  3V79 K;  4YND A;  4UI9 J;  4N3B A;  4RLY A;  4HS2 A;  3TWT A;  3VTY A;  1U2V G;  3Q78 A;  4U8H A;  2WM9 A;  3G2W A;  3IHV A;  3ZW3 A;  1QQE A;  3HVE A;  3ZUV B;  4I1M A;  3TAX A;  4HI8 A;  5A23 A;  1JUQ A;  4A3V A;  5G05 C;  2WQ7 A;  2YQ8 A;  3LVR E;  3DRA A;  2WQ6 A;  3ZYM A;  1TJC A;  2F8Y A;  3ISM C;  2P9L G;  5EYL A;  3BQO A;  1Y6I A;  1K8K G;  4ILH B;  3B13 A;  4J8S A;  5A6C A;  3Q47 B;  1TN8 A;  2M63 A;  2E0I A;  2Y0B G;  3DEP A;  4UI9 C;  4JHR A;  2IFU A;  2WVI A;  3F6Q A;  2R03 A;  4XX5 A;  2EIK E;  3UT7 A;  4BTA A;  4FLH A;  4EZJ A;  4H7X A;  3ASO E;  3DSW A;  2WQH A;  3UM0 A;  4F6R D;  1SZA A;  4NRH B;  4FA6 A;  2WXI A;  3RRN B;  1ELK A;  4RQI A;  4AEZ C;  4Q96 A;  3SO8 A;  1JCQ A;  5KNG A;  4UQX A;  1AWC B;  4EPZ A;  2LAI A;  1SA5 A;  2VSX E;  3RKV A;  1OT8 A;  1YMP A;  2Q7F A;  4L9P A;  1MJ0 A;  1IKN D;  3QC1 A;  3QWP A;  4XEI G;  3IEG A;  4M7C A;  2AVP A;  1UN9 A;  1NP7 A;  3GZ2 A;  3AG3 E;  5CBN A;  1Z6T A;  4K5B A;  4E6H A;  3E30 A;  2P9U G;  4EBA A;  3TXN A;  2RKK A;  1ELR A;  2I2O A;  1BU9 A;  4P29 A;  2L9B A;  3D9L A;  1INZ A;  1IHB A;  4UUC A;  3ASF A;  4LCT A;  3APF A;  3CK7 A;  4DK5 A;  2DVW A;  3UX4 A;  1Z5S C;  3FTV A;  3PNL B;  1OWP A;  3AS4 A;  3WXX A;  1VDY A;  3G2U A;  3CK8 A;  3Q49 B;  1N4Q A;  3E32 A;  4U63 A;  3EIJ A;  4ABN A;  3MJW A;  5C2Y A;  3FU0 A;  4GTP A;  4B0Z A;  2Y1L E;  1E8Y A;  1QYM A;  3UUX A;  1HX8 A;  5G2N A;  1OWO A;  3FUE A;  3CLJ A;  4CGV A;  2QFC A;  5FWQ A;  3HDX A;  4GPM A;  1LD8 A;  4GTV A;  3TWX A;  3UIO C;  4UWK A;  5CCM A;  2GRN B;  3LYA A;  2OEV A;  1NFI E;  4DUI A;  1LF8 A;  4JPS A;  3B95 A;  4B89 A;  3EDT B;  3FUN A;  5BUZ A;  4ANU A;  4C0M A;  2J4B A;  2WXJ A;  3PE4 A;  4PS8 A;  4MKT A;  3RAU A;  2V5F A;  4WUY A;  3PZ4 A;  2QYJ A;  3LJ3 A;  2OVB A;  2BTD A;  5FQ8 A;  2MOW A;  5BXU A;  4U0U A;  3RIB A;  3Q4A B;  4N5Q A;  3UI2 A;  3KEA A;  3QAR A;  3TWV A;  5CRU A;  3V2O A;  3T8K A;  4PS3 A;  5EID A;  1NL4 A;  4FP7 A;  4I2W A;  4EHM A;  5LX8 A;  4GPK A;  3PEU B;  1FVF A;  4UQY A;  2JEK A;  3FTW A;  2B6C A;  3CQG B;  4DPR A;  1MX4 A;  4Y6W A;  5D66 A;  3ZXS A;  5HRY A;  4JB8 P;  4L23 A;  3CSF A;  1HZ4 A;  4FUL A;  1D8D A;  2DZN A;  3FUJ A;  3B7S A;  4HOU A;  3MKR A;  3I5P A;  4A1S A;  2PZI A;  4GTR A;  1H6P A;  2ILR A;  2P9K G;  4U0S A;  2L6J A;  2LUH A;  2XHE A;  4BFR A;  4F53 A;  4C9B B;  4OAU C;  1UJK A;  2OV8 A;  4M3O A;  2H6I A;  2DYS E;  3R7R A;  3VTX A;  3HXE A;  4LER A;  1HG5 A;  4U07 A;  2VYI A;  5ENP D;  3MZL B;  4GZ3 A;  1WDY A;  3LY8 A;  2VGX B;  3RSE G;  4L2L A;  1OWM A;  3FTU A;  4CEM A;  4G11 A;  2HR2 A;  4G2V A;  2X38 A;  3KS2 A;  2LSU A;  1OXJ A;  4GA1 A;  2VTB A;  3NBN B;  5E76 A;  4B94 A;  2OEW A;  3I4R B;  2DYR E;  4HBD A;  4ZHB A;  2LNI A;  5EIB E;  2AW6 A;  3IHY A;  3VLF A;  1OCR E;  2L6B A;  3D9P A;  4GTT A;  3RO3 A;  2FF4 A;  2YNQ A;  4O60 A;  2KZT A;  3HRA A;  2C0M A;  3UM2 A;  4OAV B;  5BPP A;  5FQ7 A;  3FY4 A;  1H6K A;  4TXQ A;  4DLQ A;  4XI9 A;  4G8K A;  2XGO A;  4K03 A;  4Z68 A;  4GZD A;  4N2Q A;  2XQ0 A;  3UIP C;  4AIF A;  3FEX A;  4JL0 A;  3ZHE A;  4KVM A;  3JQ1 A;  3CVY A;  1OUV A;  3B7R L;  4I17 A;  4GTS A;  4GA0 A;  4TRQ A;  4GZ5 A;  4MBG A;  3BU8 A;  3MKQ A;  3GYZ A;  2PNN A;  3HXD A;  4HOS A;  1H0A A;  1V55 E;  1ZU2 A;  1MX6 A;  3MV2 B;  1HE8 A;  5CBO A;  2XGM A;  4A1G A;  4LNU D;  1OWN A;  2P9I G;  2LSV A;  3DSX A;  1H2U A;  3UM1 A;  3LY7 A;  3VLD A;  2L0T B;  4GZC A;  3CST A;  2V0P A;  3UMV A;  3EIQ C;  5BT1 A;  5JJT A;  4G8L A;  3FUK A;  2J4D A;  3NQP A;  5AJL A;  2LXM A;  4GYW A;  3DSU A;  2IO3 C;  2XPI A;  4GTO A; 
#chains in the Genus database with same CATH homology
 5FJY A;  4J8S A;  4I6G A;  5DBK A;  4Q69 A;  4I9C A;  3NZS A;  1PAQ A;  2WXR A;  5A6C A;  3Q47 B;  2M63 A;  4I1O B;  1NA3 A;  2CHX A;  2C0L A;  3ONL A;  3T5X A;  2NC9 A;  3S7F A;  5JHA A;  4WND A;  2E0I A;  5JJ7 A;  1UW4 B;  4RSY A;  3LCA A;  3AU5 A;  4BT8 A;  4KZC A;  4BY6 A;  3ML9 A;  4EEC A;  4G26 A;  2MRI A;  2A4Z A;  1DVP A;  2CFU A;  4H7Y A;  4JHR A;  2IFU A;  2WVI A;  4UI9 C;  1Y8M A;  1JWG A;  4XKC A;  4ILI A;  4WWO A;  2WXP A;  4XX5 A;  4AY6 A;  2UWJ G;  1H2V C;  5G04 J;  3UT7 A;  2IF4 A;  4BTA A;  3ZN3 A;  4FLH A;  2WPV A;  4EZJ A;  3EHN A;  4KZ0 A;  4H7X A;  5BV1 A;  1A17 A;  2I1J A;  3CHQ A;  5JJ6 A;  3AS8 A;  4KXK B;  4HXI A;  4I9E A;  3PUJ A;  5FQ4 A;  2WQH A;  4IN3 B;  3D9N A;  4DJA A;  1SZA A;  3S2A A;  2CG3 A;  3ESL A;  2V8S E;  4NRH B;  5ENN A;  4FA6 A;  3IKO B;  2WXI A;  3RRN B;  1ELK A;  4G24 A;  3TJP A;  5T8I A;  2PM7 A;  3LDZ A;  4GCN A;  4J8F A;  3S7J A;  4AEZ C;  5BV0 A;  3FHE A;  4Q96 A;  3ZIM A;  3G2T A;  3PS6 A;  4I6E A;  4UQX A;  3P1U A;  1KLX A;  4EPZ A;  2LAI A;  2J49 A;  3O4Z A;  1KT0 A;  1NA0 A;  2VSX E;  1H2T C;  3RKV A;  2Q7F A;  2KCV A;  5AEN A;  4PH4 B;  1QZ2 A;  4OYS A;  3CHR A;  1PC2 A;  3FTY A;  4JEH A;  3QC1 A;  4NQ0 A;  3QWP A;  5ANR A;  1NZN A;  1WAO 1;  4N3A A;  3ZEF A;  2XRY A;  4F7A A;  3QJZ A;  1HO8 A;  3ZYL A;  4UWF A;  3PUK A;  2YHC A;  4D10 C;  3IEG A;  2RG8 A;  3CHM A;  1S0P A;  2AVP A;  1UN9 A;  3CK9 A;  2OND A;  1NP7 A;  3FH5 A;  3GZ2 A;  2WXN A;  3FU6 A;  1Z6T A;  3G2V A;  3TXM A;  4KVO A;  1HS6 A;  4EZK A;  3MEK A;  4F3V A;  3JUI A;  4E6H A;  5LOZ A;  3IBE A;  4EBA A;  2NSZ A;  4CDM A;  3CVL A;  3TXN A;  3U3W A;  4MLP A;  4XI0 A;  1L5J A;  4AXH A;  2R17 C;  5J90 A;  1ELR A;  4E85 A;  4UWH A;  4ATG A;  4ME2 A;  2X3M A;  4I43 A;  2I2O A;  2VGY A;  5JHB A;  3UT4 A;  2BUG A;  2X6I A;  4PDX A;  3SZ7 A;  2JLB A;  3RRU A;  2R59 A;  4N39 A;  4JZY A;  4P29 A;  1FCH A;  3ENE A;  5G04 C;  5DIZ A;  4KYO B;  3FWV A;  3HYM B;  3SBS A;  5AIJ A;  2L9B A;  3QNK A;  4RVB A;  3LVQ E;  2VSY A;  3D9L A;  1INZ A;  4XKB A;  2FUL A;  3BEE A;  3KAE A;  4GML A;  4J6I A;  2KAT A;  5J08 A;  3ASF A;  3U9W A;  3CEQ A;  3I3N A;  5FTP A;  3GW4 A;  4XZ4 A;  4LCT A;  3GZS A;  3APF A;  4I6J A;  2X6F A;  3CK7 A;  5FZQ A;  4DK5 A;  2IOL A;  4BTB A;  3CIA A;  2J07 A;  3UX4 A;  4AY5 A;  3FTV A;  3FUF A;  5G55 A;  4CCA A;  3ZPJ A;  3LEW A;  3PNL B;  1OWP A;  1Z3X A;  3ESK A;  1HFA A;  4LRZ A;  3AS4 A;  4RG6 A;  1VDY A;  2L0I A;  3WXX A;  2QY7 A;  3G2U A;  3CK8 A;  3FU3 A;  4YVO A;  2XCB A;  4UI9 K;  5FZR A;  4CT0 A;  5HQ8 A;  1JWF A;  3Q49 B;  4BWR A;  4U63 A;  1EPU A;  2GRM A;  3EIJ A;  4RG9 A;  4WNF A;  3MJW A;  1UG3 A;  3FU0 A;  4NAC A;  5C2Y A;  3ZYQ A;  4ABN A;  2IU1 A;  3R7Q A;  3RJV A;  4B0Z A;  1E8Y A;  3UUX A;  1HX8 A;  5G2N A;  4N2S A;  3K9I A;  2ION A;  1JPL A;  3PEV B;  2WMO A;  1IQU A;  2YHE A;  1KT1 A;  1OWO A;  2XCC A;  3AS5 A;  4FHK A;  3FUE A;  3UT8 A;  2KCK A;  2FI7 A;  1N54 A;  3CLJ A;  4APF A;  2XGS A;  3LS8 A;  4GU5 A;  3L54 A;  4CGV A;  2QFC A;  3TG5 A;  4FJZ A;  3FU5 A;  1ZBP A;  3HDX A;  5FWQ A;  1XNF A;  3D9M A;  4GZ6 A;  4R7L A;  3LPZ A;  4B8A A;  4UWK A;  1EDU A;  5CCM A;  2UY1 B;  2VSO E;  3SFZ A;  1E8W A;  3TG4 A;  3LYA A;  3NZU A;  3L22 A;  3S7B A;  1IQR A;  1WM5 A;  1LF8 A;  4JPS A;  3B7T A;  3HIZ A;  3L6A A;  2GRL A;  1EYH A;  3SI5 A;  4B89 A;  3EDT B;  4O6F A;  3D3M A;  3FUN A;  4LUN U;  5BUZ A;  4A3T A;  4ANU A;  2I9C A;  3D9J A;  4WWN A;  4YVQ C;  3SGH A;  3ULQ A;  2VJ8 A;  2WXO A;  4C0M A;  3QWW A;  3U64 A;  2CG2 A;  2J4B A;  2WXJ A;  3D9K A;  3FP3 A;  1OWL A;  2EQX A;  3PE4 A;  5ANL A;  2WXK A;  4PS8 A;  3HHM A;  4MKT A;  3BG0 B;  2V5F A;  4WUY A;  4G23 A;  1TJF A;  2KCL A;  2KM4 A;  4JEU A;  5CCL A;  3QDN A;  3RK6 A;  2FEZ A;  3LJ3 A;  2OVB A;  2BTD A;  5FQ8 A;  3FH8 A;  2BF0 X;  4FU3 A;  4HLE A;  3OAW A;  2KZT B;  3LXU X;  1UN8 A;  2MOW A;  2WB2 A;  4DI4 A;  4U0U A;  5D0O D;  3RIB A;  2J09 A;  3U4T A;  4IRU A;  3TGO A;  3Q4A B;  5A7D B;  1MQS A;  4ANV A;  3OXL A;  3T8M A;  3FUM A;  4Y6C A;  3QAR A;  2OOE A;  4KMO A;  4KT6 B;  4U04 A;  3Q5M A;  4XIF A;  2VSN A;  2RD0 A;  4PS3 A;  4WWP A;  1BPO A;  5G05 J;  3PH0 C;  5ARF A;  2PM6 A;  3ASH A;  4F1S A;  4KBQ A;  4FP7 A;  5CHE E;  3QB2 A;  4HVB A;  1PY1 A;  3ONK A;  2PQN A;  3MYV A;  4I2W A;  4A55 A;  3R9A B;  4HOQ A;  3LKU A;  3CV0 A;  3ZHE B;  4CDN A;  5LX8 A;  4GPK A;  4EQF A;  1FVH A;  3DPD A;  4N5C A;  3MGB A;  3PEU B;  3PRE A;  5EX0 A;  3SF4 A;  2X6H A;  3FDH A;  1FVF A;  4UQY A;  3OXG A;  2IOS A;  2JEK A;  3FTW A;  4HOR A;  1X5B A;  2X6K A;  3CGH A;  4WNE A;  4EZL A;  3CQG B;  5FQ6 A;  4DPR A;  4DI3 A;  5LP0 A;  2WXH A;  3APC A;  3MKQ B;  4Y6W A;  3ZGQ A;  3ZXS A;  5FT9 A;  4AOF A;  3UQ3 A;  2IJG X;  4Q94 A;  4L23 A;  4JVS A;  2FBN A;  4JHJ A;  3CSF A;  4CRW A;  1HZ4 A;  4FUL A;  2GW1 A;  3D9O A;  3FUL A;  2KC7 A;  4WAF A;  2LAH A;  1GW6 A;  5BW8 C;  3SNX A;  4HFG A;  3FUJ A;  1E7V A;  4WNG A;  2MHK A;  3B7S A;  4I2Z A;  4AP2 A;  2HO1 A;  1ELW A;  2IQC A;  4HOU A;  3MKR A;  3FEY A;  3I5P A;  3SBT B;  4A1S A;  5BNW A;  2PZI A;  3CVV A;  2GGF A;  4PUC A;  4ACL A;  3N71 A;  4XE0 A;  4FHJ A;  3HVE B;  2ILR A;  4BX9 A;  4GA2 A;  4EBA G;  4U0S A;  3B7U X;  3EJN A;  3JCK C;  2L6J A;  3PZD A;  4UWG A;  2AWI A;  2YIN A;  3O48 A;  2XHE A;  3PNT B;  2AXU A;  2XEV A;  3L08 A;  4BFR A;  3QAQ A;  2DBA A;  4JXT A;  4JC8 A;  2WXF A;  4F53 A;  1E7U A;  1H19 A;  4C9B B;  3S7D A;  1UJK A;  2J08 A;  2OV8 A;  4M3O A;  3FUD A;  4UQZ A;  3CKB A;  3R7R A;  3VTX A;  2V4L A;  4C0E A;  2I6H A;  1EF1 C;  4LER A;  4MS6 A;  1SZ9 A;  2DCP A;  1HG5 A;  3T5V A;  1HU3 A;  4U07 A;  2VYI A;  4AVX A;  4AJW A;  4L1B A;  3MZL B;  4GZ3 A;  3ML8 A;  4ACK A;  2WXG A;  3ZVV A;  3FFL A;  3LY8 A;  2VGX B;  2WXQ A;  3L16 A;  4J8E A;  1OWM A;  4L2L A;  3FTU A;  4CEM A;  3FTX A;  2VQ2 A;  3Q15 A;  5CMY A;  1QNF A;  3FUH A;  4NUR A;  5KJM A;  1P5Q A;  2Y4U A;  4G25 A;  4GAA A;  2LO6 A;  3PDN A;  3KD7 A;  5KCM A;  1E8X A;  3DBS A;  3QOU A;  2VTB B;  3JYS A;  2P58 C;  2PQR A;  4G11 A;  3EHM A;  2HR2 A;  4G2V A;  3RRM B;  2X38 A;  5T4Y A;  4GMJ A;  2A5U A;  2WXL A;  3NF1 A;  2XPZ A;  3QKY A;  2OVF A;  4B8C B;  3MX3 A;  2Y3A A;  3AU4 A;  5T3R A;  1YA0 A;  3KS2 A;  3ZYK A;  1MHQ A;  2LSU A;  2CFZ A;  1U3C A;  4GA1 A;  4OVU A;  2VTB A;  5E76 A;  4GB9 A;  4JHK A;  2UY1 A;  4TV3 A;  4B94 A;  5M72 A;  4ANX A;  3MCX A;  3JQ0 A;  5EDS A;  1XGW A;  2WMN A;  3I4R B;  3ZFW A;  4K0R A;  3RU0 A;  4UWL A;  3PE3 A;  5HI7 A;  4URK A;  2WXM A;  2LNI A;  4PS7 A;  4BX8 A;  3PVL A;  1IHG A;  4V3I A;  3C98 A;  5KJN A;  5AYW D;  4MRU A;  2AW6 A;  3IHY A;  4BT9 A;  5C1D A;  2CHW A;  4QFV A;  3MA5 A;  4DLO A;  3VLF A;  4FLB A;  3URZ A;  3VLE A;  2R5S A;  4U0Z A;  3D9P A;  3D9I A;  3RO3 A;  5E75 A;  2FF4 A;  3L13 A;  2YNQ A;  2HYZ A;  2KZT A;  4AM9 A;  5LCW J;  3CHS A;  1DNP A;  2C0M A;  3QWV A;  3CVU A;  4L7T A;  5BPP A;  3OTN A;  5FZS A;  5FQ7 A;  4JA9 A;  3FY4 A;  4APO A;  2DIW A;  1TEZ A;  1H6K A;  2FO7 A;  3P2B A;  4DLQ A;  4XI9 A;  2HM8 A;  4L2Y A;  2AXZ A;  2XGO A;  4K03 A;  1HH8 A;  1W3B A;  3CR3 A;  2E2E A;  3CHP A;  3I4G A;  4FJY A;  3OXF A;  4GZD A;  4GYO A;  4N3C A;  5EKQ D;  2XQ0 A;  4AIF A;  4FAD A;  5CMW A;  1WY6 A;  3FEX A;  4IUL A;  3CKC A;  1N52 A;  5KJL A;  3IV0 A;  5LFA A;  4JL0 A;  1SQM A;  4GCO A;  3ZHE A;  3FTS A;  4KVM A;  3JQ1 A;  2AXV A;  3CVY A;  3LY9 A;  5ARG A;  1OUV A;  3B7R L;  2ZU6 B;  4I1A A;  2PL2 A;  3BG1 B;  4I17 A;  4BSX A;  4GA0 A;  4TUU A;  4YND A;  4TRQ A;  4GZ5 A;  5D0Q D;  4G1T A;  4J8D A;  3APD A;  3E4B A;  3MKQ A;  4UI9 J;  4N3B A;  3GYZ A;  4HS2 A;  1UJJ A;  4OVV A;  2X6J A;  4HOS A;  2Y4T A;  1H0A A;  4J0U A;  4AV7 A;  1HG2 A;  1B89 A;  1ZU2 A;  3SD5 A;  3TL5 A;  3MV2 B;  3ASD A;  3VTY A;  3CVN A;  1HE8 A;  3SHF A;  3KEZ A;  1U3D A;  2XGM A;  4N2Q A;  4JW1 A;  4CGW A;  3CVW A;  3FH7 A;  1E90 A;  4GYY A;  2I1K A;  4HOT A;  4U8H A;  4A1G A;  1E96 B;  2WM9 A;  3ZRH A;  4FC8 A;  1OWN A;  3G2W A;  2LSV A;  1IYG A;  1H2U A;  3IHV A;  3CVQ A;  3ZW3 A;  3QK0 A;  1QQE A;  3HVE A;  1Z3Y A;  1HXI A;  4LEU A;  4ILG A;  3GZ1 A;  3LY7 A;  4I1M A;  3VLD A;  3TAX A;  2L0T B;  2XPY A;  4GZC A;  3CST A;  3UPV A;  5A23 A;  2V0P A;  4IYP A;  5EX3 A;  5LCW C;  2CHZ A;  3CVP A;  1JUQ A;  4ANW A;  2C2L A;  4A3V A;  5G05 C;  4JA7 A;  2WQ7 A;  3UMV A;  2YQ8 A;  3ASG A;  3LVR E;  4CDR A;  3EIQ C;  5BT1 A;  2J9Q A;  5JJT A;  2WQ6 A;  3CHO A;  2XRZ A;  1E8Z A;  1HF8 A;  3U66 A;  3ZYM A;  3FUK A;  5AJD A;  1TJC A;  2J4D A;  2NXP A;  3G2S A;  4CT4 A;  3NQP A;  5AJL A;  4GYW A;  3PRZ A;  4W9R A;  3L17 A;  3FTZ A;  5KJK A;  2XPI A;  3CQC B;  2VGX A;  3RO2 A;  3CVX A;  3MV3 B;  1Y6I A;  3FUI A;  4ILH B;  3B13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...