3Q47B

Crystal structure of tpr domain of chip complexed with pseudophosphorylated smad1 peptide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
132
structure length
132
Chain Sequence
SPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQPEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism of the Negative Regulation of Smad1/5 Protein by Carboxyl Terminus of Hsc70-interacting Protein (CHIP).
pubmed doi rcsb
source organism Mus musculus
molecule tags Ligase/transcription
molecule keywords STIP1 homology and U box-containing protein 1
total genus 56
structure length 132
sequence length 132
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2010-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3q47B00
4Y6CA 1Y8MA 1PC2A 4AY5A 3FFLA 3LY8A 3WXXA 4N5CA 4JL0A 1ZBPA 1HZ4A 1W3BA 2VSYA 3MV2B 2PQNA 2XEVA 4UQZA 2FO7A 3LY7A 3CK8A 3PE3A 3S7FA 1OUVA 3FP3A 5ARGA 3ZHEA 2WQHA 4GA1A 4N2SA 4GA2A 3CVNA 5ARFA 3MEKA 2R5SA 4BWRA 3LY9A 2YQ8A 2MHKA 1KLXA 2VSNA 3TG5A 1B89A 5CCLA 4AY6A 2VQ2A 3ZFWA 3TG4A 4CGVA 3LPZA 4KXKB 2QFCA 3QWVA 4U04A 2VGXB 2C0LA 2DBAA 2KCKA 5G05J 4RG6A 1QQEA 2PZIA 4LEUA 5CHEE 1KT0A 4WNDA 3R9AB 3FWVA 4G24A 5CCMA 1WAO1 2LSVA 2OOEA 3QDNA 2Y4UA 2XCBA 3ESKA 4GZ6A 3SZ7A 3RKVA 4J8FA 2NC9A 3N71A 4N3AA 5HQ8A 3OXLA 1ZU2A 2GW1A 5G04C 5EX3A 4BT9A 2XGSA 3CEQA 2WPVA 4XI9A 5BNWA 2KCLA 2YHCA 4Y6WA 2AVPA 2C0MA 4UI9C 2UY1B 1NA3A 2PL2A 4G2VA 3ASFA 5FT9A 3Q15A 3SF4A 2UWJG 4GCOA 4GPKA 2LSUA 5A6CA 2I6HA 3ZHEB 4GYYA 2HO1A 2KC7A 3QWPA 5D0QD 3TAXA 5FZSA 5EKQD 1IHGA 3MKRA 3CK7A 4BT8A 4G23A 4HORA 3U4TA 2L6JA 4G26A 4UI9J 3LKUA 5FZQA 4B94A 5BW8C 2Y4TA 5JJ6A 3VTYA 5KJKA 4GZ3A 4N3CA 1NZNA 2JLBA 2ONDA 1YA0A 4GA0A 3LCAA 1QZ2A 4GZ5A 2PQRA 5DIZA 1ELRA 1XNFA 5FTPA 2J9QA 4GYOA 3QOUA 3KAEA 2XGOA 3AS4A 1E96B 3CKCA 3EDTB 3RIBA 3RO2A 3TGOA 4JA9A 3S7JA 1WM5A 3CKBA 3RJVA 4HOQA 3CVQA 3HYMB 4U0ZA 3UPVA 5EX0A 3QWWA 4NRHB 4RG9A 4AM9A 4O6FA 5A7DB 2VGYA 3O48A 4I9EA 3MV3B 3PE4A 4IN3B 4JHRA 3RO3A 4KYOB 3IEGA 3GW4A 1KT1A 4AIFA 4CDRA 2BUGA 4HOSA 2HYZA 2IFUA 3ASHA 4J0UA 1HXIA 3GYZA 4EQFA 2E2EA 5D0OD 3ZGQA 3QKYA 2VGXA 4H7XA 4I9CA 5BT1A 3KS2A 4WNGA 2KATA 5C1DA 2KCVA 2UY1A 2XCCA 5G04J 4APOA 1P5QA 2HR2A 3AS5A 3Q49B 4J8EA 4N3BA 2Q7FA 4HOUA 5FJYA 2IF4A 5FZRA 1NA0A 3CVPA 5JJ7A 5KJLA 3GZ1A 4UI9K 1HH8A 3KD7A 3LYAA 3ULQA 4ABNA 4U0UA 2C2LA 3NF1A 3S7DA 3K9IA 5LCWC 4U0SA 5JJTA 3RU0A 2FBNA 2FEZA 4H7YA 3VTXA 3GZ2A 3AS8A 2XGMA 3OXGA 3ASDA 3Q5MA 5M72A 4I1AA 3UUXA 4G1TA 4JA7A 4UQYA 3ZN3A 4YVOA 2V5FA 3URZA 3S7BA 1A17A 2LNIA 4CGWA 4I2WA 3PDNA 4G25A 4KBQA 4U07A 4XIFA 3ZPJA 5KJMA 4W9RA 4ME2A 3CK9A 4J8DA 4N39A 4N2QA 1IYGA 3OXFA 4GCNA 3CVLA 3MA5A 4GYWA 4YNDA 5HI7A 4BTBA 4WUYA 2FI7A 3E4BA 1FCHA 1TJCA 3Q4AB 1ELWA 2VYIA 4WNFA 5AYWD 3UQ3A 4F3VA 4HOTA 4A1SA 4I2ZA 5LCWJ 4YVQC 4I17A 2XPIA 4WNEA 4XI0A 4UQXA 3JYSA 4NQ0A 5KJNA 5G05C 5DBKA 2FF4A 3ASGA 4BTAA 3BEEA 3U3WA 3Q47B 2P58C 3CV0A
chains in the Genus database with same CATH superfamily
3LY8A 4RQIA 4U96D 1W3BA 2IO2C 3FUJA 3APFA 1OCCE 2XZTG 3HXFA 3RK6A 4UWHA 5LFAA 2LO6A 3S2AA 4QQIA 4ACLA 1N94A 4I1OB 3RKVA 3RRUA 2OVFA 3LVQE 4BFRA 3PZ4A 4JHKA 4Z68A 4AEZC 4BEPA 2XS1A 3DSXA 4CCAA 2I1JA 3ZNGA 4EHMA 3I3NA 5JJ6A 4GZ3A 1YA0A 4I6EA 1QZ2A 3IV0A 3RO2A 4F7AA 4GMJA 3HXCA 1TEZA 2WXQA 2HE0A 5CMYA 4KYOB 1KT1A 2IOLA 4XE0A 4B89A 4ZHBA 5LP0A 3QK0A 3W9GA 5JJ7A 1NA0A 4KZCA 2YINA 5EYPF 3L6AA 1XGWA 3EHNA 4DLQA 3ZUVB 4GTVA 3RRNB 1BPOA 4XKBA 4YDWA 1U3CA 3CGHA 2CHXA 3V79K 4ME2A 3CK9A 4CDMA 5EIBE 3OXFA 2QYJA 1HE8A 5JHAA 3D9LA 4TUMA 1U2VG 1WG0A 1V55E 3U3WA 4AY5A 3WXXA 5FZRA 3FTUA 3IXEA 3SBSA 3FP3A 4U95D 2XEEA 3PRZA 4FLHA 3T8MA 1QYMA 3D9OA 3TWXA 5AQAA 4Q69A 5CHEE 3KSQA 3UM2A 3C72A 2J49A 5HQ8A 4ILGA 5BXOA 4OYSA 4K0RA 3I5PA 1FPPA 1S70B 3ZHEB 1MQSA 1UOHA 3EJNA 5LOZA 5ITZF 4KVOA 3KAEA 3X2QE 4AM9A 3AG3E 2QZAA 2BKKB 3IEGA 3GW4A 2BUGA 2WXIA 1Z5SC 2V4HC 2E2EA 2VGXA 3AS5A 1HS6A 5KJLA 3ULQA 4A3VA 3DPYA 4MS6A 1SQMA 3SFXA 3TXNA 3C3QA 1FVFA 4CRWA 4TRQA 1MZCA 4GYWA 3B7SA 4WUYA 2FI7A 2ETAA 3UQ3A 2ZIRA 4TUUA 3WG7E 5JMND 4I17A 5CECB 4UQXA 4HRNA 3ASGA 3SQVA 2M63A 4KZ0A 3LY7A 2I2OA 2WQHA 1KPSB 1X81A 3PEUB 4GA2A 4AOFA 1YMPA 3TG5A 2VQ2A 3CSFA 3ONKA 4KXKB 4CT0A 1MHQA 4U04A 4C0MA 2DBAA 2FULA 1IQUA 3R9AB 1NP7A 2XCBA 3ESKA 4BESA 5FWQA 2L0IA 2R03A 1E8XA 1N0QA 3B7BA 1N52A 3ZW3A 3QWPA 3HG0D 2X6HA 3QB2A 3CK7A 3LS8A 2Y4TA 4XZ4A 3NOCD 4FC8A 2KBXA 4EZJA 1BI7B 5A23A 1SW6A 4AJWA 1AP7A 3FH8A 2CG2A 2HM8A 3TL5A 4HB5A 5D0OD 1PY1A 4H7XA 5BT1A 5AAOA 3AAAC 4DX6D 4IULA 4BX8A 4TV3A 2FEZA 3VTXA 3UUXA 2EIME 4AVXA 3HXDA 3UM1A 2V5FA 2F8XK 2A5UA 2WXOA 1UN8A 3ASNE 1TYQG 1Z6TA 3BQOA 4D10C 2E0IA 1S64A 4XI0A 4HRMB 3DSUA 3JYSA 1N95A 2NSZA 3L13A 3ZHEA 3AU5A 3FFLA 4GTTA 4N5CA 3Q73A 1E7UA 3LY9A 3CVUA 5H7PA 3ZFWA 2QC9A 4A3TA 4GTMA 2KCKA 3ZXPA 3KEAA 2J08A 4KMOA 2R02A 2DYRE 5EX3A 5FQ7A 2XGSA 3CEQA 4OAUC 4XI9A 4G2VA 3DSWA 4K03A 2WMNA 4GYYA 5BV1A 3D9IA 5EKQD 1IHGA 3HVEA 4BT8A 4G23A 3TWRA 2P2CP 4G26A 5FZQA 4FULA 4HLLA 1MYOA 4BETA 4CZ2D 5FTPA 3CKBA 3B95A 3E32A 2ZGGA 4IN3B 1DCQA 2IOSA 4I9CA 4L7TA 1HG2A 4WNGA 4JW1A 2UY1A 2X38A 4JD2G 3SD5A 5HS0A 4AV7A 3KD7A 4E85A 5JJTA 3RU0A 3Q78A 4I1AA 4UQYA 4B8CB 3ULEG 5BXUA 2NYJA 2AWIA 4DUIA 5B1BE 3EIJA 4DJAA 5KJNA 2MOWA 3V2OA 5LX8A 3DXMG 4N5QA 3LVRE 4JL0A 5A6CA 5B3SE 4ANWA 4LSZE 3SBTB 3MEKA 2R5SA 4HRLA 1TNOA 3ABME 4GMRA 3DSSA 4PH4B 3ZEFA 2J09A 3Q9UC 1NFIE 1GW6A 3FULA 2EIJE 1OWMA 3FU5A 3OAWA 4EBAG 4RSYA 2XS8A 2KC7A 3C3OA 3L16A 3TWUA 3LCAA 5IY5E 2KZTA 3QOUA 3CVVA 3SO8A 4ILHB 5CRUA 1H6PA 4GTSA 4I9EA 3PE4A 3HVEB 3RAUA 3G2VA 3PUKA 2P9KG 3FDHA 2OCCE 1JUQA 3LYAA 4EECA 4BERA 2FBNA 4PS3A 3OXGA 3Q5MA 2XZDG 4JA7A 4UWLA 3DRAA 4YVOA 4LNGA 3EU9A 1OWLA 3CVLA 3FH5A 3CIAA 4O60A 1E8WA 3U9WA 3MZLB 1DVPA 1Y8MA 2AJAA 3LJNA 4BSXA 2VSYA 2F37A 2PQNA 4GMLA 5ARGA 5T8IA 4BWRA 3T8KA 2MHKA 1N4QA 2L6BA 2I9CA 1B89A 2R59A 2FO1E 4HI8A 2EIKE 2A5EA 5BNWA 2YHCA 5E76A 2UY1B 5FQ8A 2XENA 3NZUA 2UWJG 3GZSA 3FTXA 2IY0C 3IHYA 3MKRA 4URKA 2EQXA 4PDXA 5HKPA 4KVMA 3ENEA 3AG2E 4CEMA 1KZOA 2J9QA 1X5BA 3AS4A 3TGOA 4EZLA 5B1AE 3S7JA 3RJVA 4U63A 3E33A 1HXIA 1S0PA 2LUHA 5C1DA 2GRLA 5J08A 3TJPA 1OY3D 1UJKA 4I1MA 4HOUA 4U8VD 2X6FA 4K5AB 4YDEA 3L22A 3TWWA 2V8SE 3CVYA 3QNKA 1SA4A 2LNIA 4XIFA 3MCXA 5BPPA 1E90A 5CRVA 1IQRA 4WNFA 4WAFA 3U64A 3EHRA 2WM9A 2DZNA 1HO8A 4CT4A 4WWPA 3D9MA 5FIOA 3U66A 2FO7A 3ZYKA 3KSLA 3QARA 1KLXA 2L0TB 5EDSA 3QWVA 3NZSA 1KT0A 2I1KA 1LTXA 4GZ6A 3N71A 4N3AA 3D9NA 4Y6WA 4UI9C 5FT9A 3UXGA 1NA3A 3V30A 5FZSA 4UWFA 2WQ6A 4A1GA 3MJWA 2L6JA 4FP7A 1O1TA 3JQ0A 3BU8A 3CVXA 4X8QA 3CKCA 4BY6A 1JCSA 3HYMB 2CFUA 2V0PA 2XHEA 3MV3B 5EN5D 5C2YA 3ZKJA 4JEHA 4LUNU 1ZB1A 3KS2A 2KCVA 1HFAA 2HR2A 5ENNA 4OVVA 4FLBA 4DX7D 3CHQA 4U0SA 4FHKA 5M72A 1TNZA 2XPYA 2DWZA 2F8YA 5AQ7A 3FTSA 5FQ4A 3FUMA 2GRQB 4GCNA 3D3MA 4B93B 1RW2A 2R05A 4XKCA 3JUEA 4YVQC 4WNEA 2LAHA 2DVWA 5G05C 2Y1LE 5DBKA 1JCQA 3SGHA 2H6GA 4J6IA 5KWDA 2P58C 5ENOD 4MKTA 2P9IG 4FADA 3S7FA 3FUKA 4N2SA 3CVNA 4UWGA 1JPLA 3BUAA 2QFCA 2VGXB 4J8SA 4RG6A 5ANLA 4ANUA 1OWOA 4XEIG 1WAO1 1DCEA 2Y4UA 2GW1A 2J8SD 4AP2A 4I6JA 3CHSA 2LXMA 1Z3XA 3PH0C 3FTVA 4HI9A 5T4YA 5BUZA 1K3ZD 5KJKA 2RD0A 3JXJA 1XNFA 1HF8A 1E96B 4TXQA 3RSEG 5EX0A 4O6FA 2VGYA 3QJZA 3RO3A 3GYZA 1NI1A 5AN8A 3FTYA 1IHBA 3CHMA 3EHMA 4DI3A 3FUIA 2F0YA 4N3BA 2KXPC 3ZXSA 1N9AA 4HVBA 3CVPA 2BEDA 3ZU7B 4DI4A 3HXEA 3GZ2A 3ASDA 3ZN3A 1VDYA 3S7BA 3APDA 5ENSD 2RG8A 5KJMA 3T5VA 4W9RA 4N39A 2KM4A 3IBEA 5AQBA 2X3MA 3TWTA 2XPIA 3DSTA 2GRPB 3DPDA 5ENRD 3U4TA 4UQZA 3BG0B 3ML9A 3UKRG 1N0RA 3UT7A 3UI2A 3NAWA 3MGBA 2BTDA 5E75A 5FQ6A 4ACKA 1IKND 3VLEA 4J8YA 2DYSE 5CEAA 3HDXA 3UM0A 3QDNA 2NC9A 4FU3A 4TXPA 3SNXA 4DX2A 2VTBB 4LERA 3JXIA 2H6FA 3PNTB 2YNQA 2VJ8A 2AW6A 3Q7FA 3ULYA 4BX9A 1NZNA 2ONDA 3FY4A 5AIJA 4DX1A 2PQRA 1ELRA 3ZVVA 3RIBA 2XGOA 1OWPA 2Y69E 1WM5A 2B0OE 4DK5A 3UPVA 2P9UG 5CBOA 2OEWA 3MYVA 3B13A 4JHRA 4B0ZA 1E8YA 5G04J 3Q49B 3JQ1A 3HXBA 4R7LA 1YCSB 4G8KA 3NF1A 5EIDA 3P1UA 1MX4A 3ZPJA 3SI5A 2GROB 4J8DA 4OAVB 4C0EA 5KBAA 1UG3A 4C9BB 1TJCA 1ELWA 4HOTA 3ZYLA 4JC8A 4I6GA 2AXVA 3PZ3A 4E6HA 4LRZA 3PEVB 2Y3AA 5CMWA 1BI8B 1FVHA 3TWSA 4AY6A 3G2SA 4MRUA 5T3RA 3J5PA 3VLFA 1WDYA 3SZ7A 4J8FA 3KEZA 1QBQA 2J07A 2KCLA 3UT8A 1N4RA 1QNFA 1PAQA 3CQGB 4GPKA 4PS7A 3I4RB 4HBDA 3UIPC 1U3DA 4IRUA 3LKUA 2R17C 4B94A 3ISMC 1N11A 3Q75A 3PZDA 4GPMA 4G11A 4GZCA 2CG3A 2RFMA 5JA4D 2CHZA 1A5EA 3G2TA 4G8LA 3CR3A 4V3IA 1TN6A 3OTNA 3O4ZA 5AQ9A 4IYPA 3FUNA 5LCWC 3SFZA 2WVIA 4H7YA 3CHRA 2BF0X 4U07A 3DWLG 1H6OA 3FH7A 3MA5A 4JB8P 3DEPA 5EILA 5LCWJ 4DLOA 2LXLA 4K5BA 4OVUA 2V5QC 1UW4B 3Q7AA 1PC2A 2IJGX 1HZ4A 2XEVA 5CBNA 3PE3A 1OUVA 3MKQA 2L9BA 4RVBA 4PUCA 4YDOA 1N54A 2QYUA 2EINE 3CQCB 3LPZA 1OCOE 4CYMD 1QQEA 3AG4E 2Y0BG 3FWVA 2OOEA 4L1BA 2ILRA 2ZGDA 2PM7A 3E37A 3B7UX 3HRAA 5D0QD 1BD8A 5KNHD 3EU5A 4U8YD 2IONA 2WXPA 3VLDA 5BW8C 4P29A 2JLBA 3B7TA 3PZ2A 4Q94A 1OCRE 3DEOA 4JA9A 3CLJA 4TXRA 1IXVA 3FEXA 3O48A 1TNBA 4AIFA 2V4LA 3E30A 3IKOB 2YHEA 4LCTA 3FHEA 2IQCA 1NL4A 4GU5A 2C2LA 3S7DA 1K1BA 2BKGA 2XGMA 2AXUA 3ZYQA 2WB2A 1Q2ZA 1BU9A 1TNUA 1IYGA 3SHFA 4YNDA 3F6QA 4HFGA 2J4BA 4LNBA 2X6KA 4I2ZA 2OVBA 1SVXA 4C48B 1SA5A 3BEEA 3CHPA 4CGWA 3CV0A 1EPUA 3UTMA 2VSOE 2MYOA 5ARFA 1TJFA 1LF8A 2RKKA 2H6IA 1O1RA 1OT8A 4O1PA 4EBAA 5J90A 4GTPA 1ZU2A 3ASOE 5D66A 4BT9A 2PNNA 2ZISA 1DC2A 2PL2A 1H0AA 4GCOA 2I6HA 3V31A 3MKQB 2HO1A 2ZU6B 3R7RA 4WWNA 4UI9J 1MX2A 2QY7A 2XEHA 3ZRHA 3ML8A 3UX4A 3ABLE 3P2BA 1EF1C 1H2TC 4ILIA 5AJDA 3L54A 4F1SA 3L17A 2RFAA 3IHVA 3ZGQA 3EIQC 1UJJA 2NXPA 3AJIA 4APOA 1H2VC 2Q7FA 4EZKA 1AWCB 1HH8A 2B6CA 2WXMA 5ENPD 3PUJA 4ANVA 5CERB 3B7RL 1INZA 1EYHA 4GTOA 1TN7A 3FU0A 3PDNA 3UMVA 4EPZA 4HXIA 4HLEA 1D8DA 4BTBA 3E4BA 5EYLA 3AG1E 4A1SA 3PVLA 5JHBA 3C98A 2ETBA 2WMOA 4DRXE 4BTAA 3Q47B 3DXKG 2A4ZA 3PS6A 3APCA 3FUDA 1D9SA 1K1AA 2WXLA 3G2WA 3HHMA 2YQ8A 4CGVA 1UN9A 5KNGA 2IEJA 3L9TA 3E34A 4YDYA 2EILE 3PNLB 2LSVA 2P9SG 5G04C 3I4GA 2WPVA 4FJZA 4U7EB 1OWNA 1O1SA 2IO3C 3PZ1A 3EHQA 4I43A 3NB2A 5G2NA 5CEDB 3FTWA 2WXHA 4ANXA 4L9PA 4GZ5A 4UWKA 1OXJA 4L23A 1Z3YA 4GTRA 4M7CA 4NRHB 2KZTB 3AU4A 1SZ9A 4CDRA 4JXTA 3SY2A 4EQFA 3BG1B 1JWFA 2KATA 5G55A 1P5QA 2CFZA 5ENQD 2R2LA 3D9KA 2WXGA 4WWOA 4ABNA 4FJYA 5BV0A 4B8AA 3LDZA 2DCPA 4JPSA 4G1TA 2DZOA 3FU3A 2PM6A 1TNYA 3UKUG 5HRYA 1FCHA 3UINC 4O1OA 3CHOA 4JVSA 3NQPA 1G3NB 2XRYA 2X6JA 1ZBPA 3T9KA 4HOSA 4JHJA 1LD7A 2GRNB 4GA1A 4QFVA 3ZYMA 2VSNA 4PS8A 3TG4A 4GB9A 4AXHA 2C0LA 5G05J 4LEUA 4WNDA 4MLPA 4G24A 5CCMA 4ATZD 4J7WA 4U8HA 3OXLA 3HIZA 2AVPA 2C0MA 3ASFA 3C3RA 3Q15A 1H2UA 4JZYA 4HNAD 2P9PG 3C5RA 2GRMA 3V2XA 4N3CA 1LD8A 4M3OA 3NBNB 2WQ7A 3Q79A 4CDNA 4HOQA 4XX5A 3DBSA 2HYZA 2IFUA 1RZ4A 2XCCA 4FHJA 5FJYA 3Q9NC 2WXNA 3GZ1A 4K5CA 3QC1A 3RRMB 3FUHA 3LXUX 2MRIA 3AS8A 1L5JA 2VSXE 5AARA 3ZIMA 3FEYA 3URZA 4KBQA 3FUFA 2X6IA 3EUVA 1FT1A 4UUCA 2AXZA 2VYIA 4F3VA 3D9JA 1D8EA 4DPRA 4NIKA 3DSVA 2FF4A 3J5QB 1HG5A 5AYWD 4Y6CA 1DNPA 3D9HA 4Q96A 5ANRA 3R7QA 3TWQA 1SZAA 3FU6A 3LJ3A 2PZIA 3ESLA 4FA6A 3NOGD 5ENTD 1WY6A 3UIOC 2VTBA 2JABA 2WXJA 4RLYA 4JEUA 1S63A 3LEWA 1ELKA 3FUEA 1MX6A 2ETCA 4HORA 1TR4A 4GAAA 3G2UA 3D9PA 3VTYA 4MBGA 3FTZA 5DIZA 2WXRA 4GYOA 1YYHA 4KT6B 1H6KA 3JUIA 4NACA 3QWWA 5A7DB 2WXFA 4GZDA 4F1PA 1E7VA 3QKYA 3W9FA 3R9MA 2IF4A 4UI9K 1BLXB 1JWGA 3K9IA 1JCRA 3L08A 2P9NG 4DX5D 4LNUD 2GGFA 3L82A 2JEKA 1H19A 1E8ZA 4I2WA 5AJLA 5KCMA 5HI7A 4L2LA 3PREA 1Y6IA 1FT2A 1OCZE 4L2YA 4F53A 3MV2B 2J4DA 3ONLA 3CK8A 3JCKC 1N4PA 3CVWA 1MJ0A 5CCLA 2OV8A 1HX8A 3UT4A 5AENA 4HS2A 4A63B 2VGEA 5D2MC 4ATGA 1K8KG 4APFA 2IU1A 3SF4A 4NURA 1O5MA 2LSUA 2XPZA 3TAXA 2LAIA 4LG6A 1KZPA 4HQDA 2GRRB 4GA0A 3QAQA 4F6RD 3EDTB 3ABKE 1N4SA 3CVQA 4U0ZA 4RG9A 4BSZB 4N2QA 4GTQA 4A55A 3ASHA 4J0UA 2H6HA 3SFYA 1HU3A 3TWVA 4J8EA 4U0UA 2XRZA 3TXMA 2OEVA 2CHWA 3CSTA 2WXKA 1A17A 2P9LG 4ZFHA 1V54E 4G25A 5FINA 3T5XA 2ZXWE 2DIWA 1TN8A 1EDUA 3Q4AB 3UM3A 2XQ0A 4NQ0A 3MX3A
chains in the Genus database with same CATH topology
3LY8A 3DPDA 2A4ZA 3LVRE 3PS6A 4JL0A 4UQZA 3BG0B 1W3BA 3ML9A 3U4TA 3UT7A 3APCA 5A6CA 3FUDA 4ANWA 3FUJA 3MGBA 2WXLA 3APFA 2BTDA 3G2WA 3HHMA 3MEKA 2R5SA 5E75A 3SBTB 2YQ8A 5FQ6A 4ACKA 3VLEA 4CGVA 1UN9A 4PH4B 3ZEFA 2J09A 3RK6A 4UWHA 5LFAA 2LO6A 3S2AA 3HDXA 3PNLB 2LSVA 1GW6A 3QDNA 4ACLA 4I1OB 3RKVA 3RRUA 2OVFA 2NC9A 4FU3A 5G04C 3LVQE 3SNXA 3I4GA 3FULA 4BFRA 2WPVA 4FJZA 1OWMA 3FU5A 1OWNA 2VTBB 3OAWA 4LERA 4JHKA 4EBAG 4I43A 4RSYA 4AEZC 2KC7A 3L16A 3PNTB 2YNQA 5G2NA 4CCAA 2I1JA 2VJ8A 2AW6A 3FTWA 2WXHA 3I3NA 4ANXA 5JJ6A 4BX9A 4GZ3A 1NZNA 2ONDA 3FY4A 1YA0A 4I6EA 3LCAA 1QZ2A 3IV0A 2PQRA 4GZ5A 1ELRA 2KZTA 4UWKA 3ZVVA 3QOUA 4L23A 2XGOA 3RIBA 3RO2A 4F7AA 5AIJA 3CVVA 1OWPA 1Z3YA 4GMJA 1WM5A 4ILHB 4DK5A 3UPVA 1TEZA 3MYVA 4NRHB 2WXQA 2KZTB 3AU4A 3B13A 4I9EA 3PE4A 4JHRA 1SZ9A 4KYOB 5CMYA 4CDRA 1KT1A 4JXTA 3HVEB 2IOLA 4B0ZA 4XE0A 4B89A 3G2VA 3PUKA 4EQFA 3BG1B 3FDHA 1E8YA 1JWFA 2KATA 5LP0A 5G04J 3QK0A 5G55A 1P5QA 3Q49B 2CFZA 1JUQA 5JJ7A 1NA0A 2WXGA 3D9KA 3JQ1A 4KZCA 2YINA 4WWOA 4ABNA 3L6AA 3LYAA 4FJYA 4R7LA 1XGWA 3EHNA 4B8AA 5BV0A 3NF1A 4EECA 3LDZA 4DLQA 2DCPA 2FBNA 4JPSA 4PS3A 3RRNB 3OXGA 3P1UA 3Q5MA 1BPOA 4G1TA 4JA7A 4UWLA 4YVOA 4XKBA 1U3CA 3FU3A 1OWLA 3CGHA 3SI5A 2CHXA 3ZPJA 4ME2A 3CK9A 4J8DA 4CDMA 2PM6A 3OXFA 4C0EA 1UG3A 3CVLA 3FH5A 1HE8A 4C9BB 1FCHA 3CIAA 1TJCA 1ELWA 5JHAA 4HOTA 1E8WA 3ZYLA 3D9LA 3U9WA 3CHOA 4JVSA 3NQPA 4JC8A 4I6GA 2AXVA 3MZLB 3U3WA 1DVPA 1Y8MA 2XRYA 4AY5A 4E6HA 3WXXA 5FZRA 2X6JA 1ZBPA 2VSYA 3FTUA 4LRZA 4BSXA 2PQNA 4GMLA 4JHJA 3PEVB 4HOSA 2Y3AA 3FP3A 5ARGA 3SBSA 4GA1A 5T8IA 5CMWA 4QFVA 4BWRA 3PRZA 4FLHA 3ZYMA 1FVHA 2MHKA 2VSNA 2I9CA 3T8MA 1B89A 4PS8A 4AY6A 3TG4A 4GB9A 3G2SA 4AXHA 2R59A 3D9OA 2C0LA 4MRUA 5G05J 4LEUA 4Q69A 5CHEE 4WNDA 4MLPA 4G24A 5T3RA 3VLFA 5CCMA 4U8HA 3SZ7A 2J49A 4J8FA 5HQ8A 3OXLA 3KEZA 4ILGA 4OYSA 4K0RA 3HIZA 5BNWA 2J07A 2KCLA 2YHCA 2AVPA 2C0MA 3I5PA 2UY1B 5E76A 3UT8A 3ASFA 3Q15A 5FQ8A 3NZUA 1H2UA 2UWJG 1QNFA 1PAQA 3CQGB 3FTXA 3GZSA 4PS7A 3I4RB 1MQSA 3ZHEB 4JZYA 3IHYA 3MKRA 1U3DA 4IRUA 2EQXA 4DI3A 3LKUA 2R17C 3EJNA 4PDXA 4B94A 4URKA 4KVMA 2GRMA 3ENEA 5LOZA 4N3CA 4CEMA 3PZDA 4KVOA 4M3OA 2WQ7A 2J9QA 1X5BA 3KAEA 3AS4A 3TGOA 4CDNA 4G11A 4GZCA 2CG3A 4EZLA 3S7JA 3RJVA 4HOQA 4XX5A 4U63A 4AM9A 2CHZA 3DBSA 3G2TA 3IEGA 3GW4A 2BUGA 2WXIA 2HYZA 2IFUA 1HXIA 3CR3A 1S0PA 4V3IA 2E2EA 3OTNA 2VGXA 3O4ZA 5C1DA 2XCCA 2GRLA 4FHJA 5FJYA 3TJPA 1UJKA 3AS5A 1HS6A 4I1MA 5J08A 4HOUA 5KJLA 2WXNA 3GZ1A 4IYPA 3ULQA 2X6FA 3QC1A 3RRMB 4A3VA 3FUHA 4MS6A 3FUNA 5LCWC 3LXUX 3SFZA 2WVIA 3L22A 4H7YA 2MRIA 3AS8A 1L5JA 1SQMA 2VSXE 2V8SE 3CVYA 3QNKA 3ZIMA 3CHRA 3FEYA 3TXNA 3URZA 2BF0X 2LNIA 1FVFA 4KBQA 3FUFA 2X6IA 4U07A 4XIFA 4CRWA 4TRQA 3MCXA 2AXZA 5BPPA 3FH7A 1E90A 3MA5A 4GYWA 3B7SA 1IQRA 4WUYA 2FI7A 2VYIA 4WNFA 3UQ3A 4F3VA 3D9JA 4TUUA 4DPRA 5LCWJ 4WAFA 4DLOA 4I17A 4GPKA 4OVUA 4UQXA 3U64A 2WM9A 2FF4A 3ASGA 1UW4B 1HG5A 1HO8A 5AYWD 2M63A 4Y6CA 1PC2A 4CT4A 4WWPA 3D9MA 4KZ0A 3U66A 2IJGX 1HZ4A 1DNPA 2XEVA 2FO7A 2I2OA 3LY7A 3PE3A 4Q96A 1OUVA 3MKQA 2WQHA 2L9BA 3PEUB 4GA2A 3ZYKA 4RVBA 4AOFA 3QARA 5ANRA 3R7QA 1KLXA 2L0TB 1SZAA 3TG5A 4PUCA 1N54A 2VQ2A 5EDSA 3CSFA 3CQCB 3LPZA 3ONKA 3QWVA 1MHQA 3FU6A 4KXKB 3NZSA 4U04A 4C0MA 4CT0A 2DBAA 3LJ3A 1QQEA 2PZIA 3ESLA 2FULA 1IQUA 1KT0A 3R9AB 2I1KA 3FWVA 4FA6A 2OOEA 4L1BA 1NP7A 2XCBA 3ESKA 2ILRA 4GZ6A 1WY6A 3N71A 4N3AA 5FWQA 3D9NA 2VTBA 2L0IA 2PM7A 2WXJA 4Y6WA 4UI9C 1E8XA 5FT9A 1NA3A 4JEUA 3B7UX 1N52A 3ZW3A 3LEWA 3QWPA 2X6HA 1ELKA 4UWFA 5D0QD 5FZSA 3QB2A 2WQ6A 4A1GA 3CK7A 3MJWA 2IONA 3LS8A 2WXPA 3FUEA 4HORA 2L6JA 4FP7A 4GAAA 3G2UA 3JQ0A 4P29A 2Y4TA 3D9PA 5BW8C 3VLDA 3VTYA 2JLBA 3FTZA 5DIZA 3B7TA 4XZ4A 3CVXA 2WXRA 4GYOA 4FC8A 4Q94A 4EZJA 3CKCA 4KT6B 5A23A 1H6KA 4BY6A 4JA9A 3JUIA 3CLJA 4AJWA 3HYMB 2CFUA 3FH8A 3QWWA 4NACA 2V0PA 5A7DB 3FEXA 2XHEA 3MV3B 3O48A 4AIFA 2CG2A 2V4LA 5C2YA 2WXFA 4GZDA 2HM8A 3TL5A 3IKOB 5D0OD 1E7VA 1PY1A 3QKYA 4JEHA 4H7XA 4LUNU 5BT1A 3KS2A 2YHEA 2KCVA 4LCTA 3FHEA 1HFAA 2HR2A 5ENNA 2IQCA 2IF4A 4IULA 4BX8A 4OVVA 4UI9K 4GU5A 4FLBA 1JWGA 2C2LA 4TV3A 3S7DA 3CHQA 3K9IA 4U0SA 3L08A 2FEZA 3VTXA 2XGMA 4FHKA 2AXUA 5M72A 3ZYQA 3UUXA 2WB2A 2XPYA 2GGFA 4AVXA 2JEKA 1H19A 2V5FA 3FTSA 2A5UA 1E8ZA 4I2WA 2WXOA 5FQ4A 3FUMA 5AJLA 5KCMA 1UN8A 1IYGA 4GCNA 3D3MA 3SHFA 1Z6TA 4D10C 5HI7A 4YNDA 4HFGA 4L2LA 2J4BA 3PREA 4XKCA 2X6KA 2E0IA 4I2ZA 4YVQC 4XI0A 4WNEA 2LAHA 2OVBA 3JYSA 5G05C 5DBKA 2NSZA 3L13A 4J6IA 3SGHA 3BEEA 3CHPA 3AU5A 2P58C 3CV0A 3ZHEA 1EPUA 4CGWA 1Y6IA 3FFLA 4MKTA 4FADA 4L2YA 4N5CA 4F53A 3MV2B 2J4DA 3ONLA 3S7FA 3CK8A 2VSOE 3FUKA 3JCKC 4N2SA 3CVNA 5ARFA 4UWGA 1E7UA 1JPLA 3LY9A 3CVWA 1TJFA 5CCLA 3CVUA 3ZFWA 1LF8A 2QFCA 2OV8A 4A3TA 2VGXB 4J8SA 2KCKA 4RG6A 5ANLA 4ANUA 1HX8A 1OWOA 3UT4A 5AENA 2J08A 4KMOA 1WAO1 4HS2A 4EBAA 2Y4UA 5J90A 1ZU2A 2GW1A 5EX3A 5FQ7A 2XGSA 4BT9A 4ATGA 3CEQA 4XI9A 4AP2A 4APFA 4I6JA 2PL2A 4G2VA 3CHSA 1H0AA 1Z3XA 2IU1A 3SF4A 4K03A 2WMNA 3PH0C 4GCOA 4NURA 2LSUA 2I6HA 3MKQB 2XPZA 2HO1A 4GYYA 3TAXA 3D9IA 5BV1A 3FTVA 5EKQD 1IHGA 2ZU6B 3R7RA 2LAIA 3HVEA 5T4YA 4BT8A 4G23A 4WWNA 4G26A 5BUZA 4UI9J 5FZQA 4FULA 2QY7A 5KJKA 2RD0A 4GA0A 3QAQA 1XNFA 5FTPA 3ZRHA 3ML8A 3UX4A 1HF8A 1E96B 3EDTB 3P2BA 1EF1C 1H2TC 3CKBA 3CVQA 4U0ZA 5EX0A 4ILIA 4RG9A 4O6FA 2VGYA 5AJDA 3L54A 3QJZA 4IN3B 3RO3A 3L17A 4F1SA 4N2QA 4A55A 3ASHA 3IHVA 4J0UA 3GYZA 2IOSA 3ZGQA 3FTYA 4I9CA 3EHMA 3CHMA 1HU3A 1HG2A 3EIQC 1UJJA 3FUIA 4L7TA 2NXPA 4JW1A 2UY1A 4WNGA 2X38A 4APOA 4N3BA 4J8EA 1H2VC 3ZXSA 2Q7FA 4HVBA 3CVPA 3SD5A 4EZKA 1HH8A 4AV7A 2WXMA 3KD7A 4U0UA 4E85A 3PUJA 3TXMA 2XRZA 4DI4A 5JJTA 3RU0A 4ANVA 3GZ2A 3B7RL 3ASDA 2CHWA 4I1AA 4UQYA 3CSTA 1INZA 3ZN3A 1EYHA 1VDYA 2WXKA 4B8CB 3S7BA 1A17A 3APDA 3FU0A 3PDNA 2RG8A 4G25A 3T5XA 5KJMA 3T5VA 4W9RA 3UMVA 4N39A 2KM4A 3IBEA 4HXIA 4EPZA 2X3MA 2DIWA 4HLEA 2AWIA 4BTBA 3E4BA 1EDUA 3Q4AB 4A1SA 3EIJA 4DJAA 2XPIA 2XQ0A 3PVLA 4NQ0A 5KJNA 5JHBA 2MOWA 3C98A 2WMOA 3MX3A 5LX8A 4BTAA 3Q47B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y6C A;  1Y8M A;  1PC2 A;  4AY5 A;  3FFL A;  3LY8 A;  3WXX A;  4N5C A;  4JL0 A;  1ZBP A;  1HZ4 A;  1W3B A;  2VSY A;  3MV2 B;  2PQN A;  2XEV A;  4UQZ A;  2FO7 A;  3LY7 A;  3CK8 A;  3PE3 A;  3S7F A;  1OUV A;  3FP3 A;  5ARG A;  3ZHE A;  2WQH A;  4GA1 A;  4N2S A;  4GA2 A;  3CVN A;  5ARF A;  3MEK A;  2R5S A;  4BWR A;  3LY9 A;  2YQ8 A;  2MHK A;  1KLX A;  2VSN A;  3TG5 A;  1B89 A;  5CCL A;  4AY6 A;  2VQ2 A;  3ZFW A;  3TG4 A;  4CGV A;  3LPZ A;  4KXK B;  2QFC A;  3QWV A;  4U04 A;  2VGX B;  2C0L A;  2DBA A;  2KCK A;  5G05 J;  4RG6 A;  1QQE A;  2PZI A;  4LEU A;  5CHE E;  1KT0 A;  4WND A;  3R9A B;  3FWV A;  4G24 A;  5CCM A;  1WAO 1;  2LSV A;  2OOE A;  3QDN A;  2Y4U A;  2XCB A;  3ESK A;  4GZ6 A;  3SZ7 A;  3RKV A;  4J8F A;  2NC9 A;  3N71 A;  4N3A A;  5HQ8 A;  3OXL A;  1ZU2 A;  2GW1 A;  5G04 C;  5EX3 A;  4BT9 A;  2XGS A;  3CEQ A;  2WPV A;  4XI9 A;  5BNW A;  2KCL A;  2YHC A;  4Y6W A;  2AVP A;  2C0M A;  4UI9 C;  2UY1 B;  1NA3 A;  2PL2 A;  4G2V A;  3ASF A;  5FT9 A;  3Q15 A;  3SF4 A;  2UWJ G;  4GCO A;  4GPK A;  2LSU A;  5A6C A;  2I6H A;  3ZHE B;  4GYY A;  2HO1 A;  2KC7 A;  3QWP A;  5D0Q D;  3TAX A;  5FZS A;  5EKQ D;  1IHG A;  3MKR A;  3CK7 A;  4BT8 A;  4G23 A;  4HOR A;  3U4T A;  2L6J A;  4G26 A;  4UI9 J;  3LKU A;  5FZQ A;  4B94 A;  5BW8 C;  2Y4T A;  5JJ6 A;  3VTY A;  5KJK A;  4GZ3 A;  4N3C A;  1NZN A;  2JLB A;  2OND A;  1YA0 A;  4GA0 A;  3LCA A;  1QZ2 A;  4GZ5 A;  2PQR A;  5DIZ A;  1ELR A;  1XNF A;  5FTP A;  2J9Q A;  4GYO A;  3QOU A;  3KAE A;  2XGO A;  3AS4 A;  1E96 B;  3CKC A;  3EDT B;  3RIB A;  3RO2 A;  3TGO A;  4JA9 A;  3S7J A;  1WM5 A;  3CKB A;  3RJV A;  4HOQ A;  3CVQ A;  3HYM B;  4U0Z A;  3UPV A;  5EX0 A;  3QWW A;  4NRH B;  4RG9 A;  4AM9 A;  4O6F A;  5A7D B;  2VGY A;  3O48 A;  4I9E A;  3MV3 B;  3PE4 A;  4IN3 B;  4JHR A;  3RO3 A;  4KYO B;  3IEG A;  3GW4 A;  1KT1 A;  4AIF A;  4CDR A;  2BUG A;  4HOS A;  2HYZ A;  2IFU A;  3ASH A;  4J0U A;  1HXI A;  3GYZ A;  4EQF A;  2E2E A;  5D0O D;  3ZGQ A;  3QKY A;  2VGX A;  4H7X A;  4I9C A;  5BT1 A;  3KS2 A;  4WNG A;  2KAT A;  5C1D A;  2KCV A;  2UY1 A;  2XCC A;  5G04 J;  4APO A;  1P5Q A;  2HR2 A;  3AS5 A;  3Q49 B;  4J8E A;  4N3B A;  2Q7F A;  4HOU A;  5FJY A;  2IF4 A;  5FZR A;  1NA0 A;  3CVP A;  5JJ7 A;  5KJL A;  3GZ1 A;  4UI9 K;  1HH8 A;  3KD7 A;  3LYA A;  3ULQ A;  4ABN A;  4U0U A;  2C2L A;  3NF1 A;  3S7D A;  3K9I A;  5LCW C;  4U0S A;  5JJT A;  3RU0 A;  2FBN A;  2FEZ A;  4H7Y A;  3VTX A;  3GZ2 A;  3AS8 A;  2XGM A;  3OXG A;  3ASD A;  3Q5M A;  5M72 A;  4I1A A;  3UUX A;  4G1T A;  4JA7 A;  4UQY A;  3ZN3 A;  4YVO A;  2V5F A;  3URZ A;  3S7B A;  1A17 A;  2LNI A;  4CGW A;  4I2W A;  3PDN A;  4G25 A;  4KBQ A;  4U07 A;  4XIF A;  3ZPJ A;  5KJM A;  4W9R A;  4ME2 A;  3CK9 A;  4J8D A;  4N39 A;  4N2Q A;  1IYG A;  3OXF A;  4GCN A;  3CVL A;  3MA5 A;  4GYW A;  4YND A;  5HI7 A;  4BTB A;  4WUY A;  2FI7 A;  3E4B A;  1FCH A;  1TJC A;  3Q4A B;  1ELW A;  2VYI A;  4WNF A;  5AYW D;  3UQ3 A;  4F3V A;  4HOT A;  4A1S A;  4I2Z A;  5LCW J;  4YVQ C;  4I17 A;  2XPI A;  4WNE A;  4XI0 A;  4UQX A;  3JYS A;  4NQ0 A;  5KJN A;  5G05 C;  5DBK A;  2FF4 A;  3ASG A;  4BTA A;  3BEE A;  3U3W A;  3Q47 B;  2P58 C;  3CV0 A; 
#chains in the Genus database with same CATH topology
 3LY8 A;  4RQI A;  4U96 D;  1W3B A;  2IO2 C;  3FUJ A;  3APF A;  1OCC E;  2XZT G;  3HXF A;  3RK6 A;  4UWH A;  5LFA A;  2LO6 A;  3S2A A;  4QQI A;  4ACL A;  1N94 A;  4I1O B;  3RKV A;  3RRU A;  2OVF A;  3LVQ E;  4BFR A;  3PZ4 A;  4JHK A;  4Z68 A;  4AEZ C;  4BEP A;  2XS1 A;  3DSX A;  4CCA A;  2I1J A;  3ZNG A;  4EHM A;  3I3N A;  5JJ6 A;  4GZ3 A;  1YA0 A;  4I6E A;  1QZ2 A;  3IV0 A;  3RO2 A;  4F7A A;  4GMJ A;  3HXC A;  1TEZ A;  2WXQ A;  2HE0 A;  5CMY A;  4KYO B;  1KT1 A;  2IOL A;  4XE0 A;  4B89 A;  4ZHB A;  5LP0 A;  3QK0 A;  3W9G A;  5JJ7 A;  1NA0 A;  4KZC A;  2YIN A;  5EYP F;  3L6A A;  1XGW A;  3EHN A;  4DLQ A;  3ZUV B;  4GTV A;  3RRN B;  1BPO A;  4XKB A;  4YDW A;  1U3C A;  3CGH A;  2CHX A;  3V79 K;  4ME2 A;  3CK9 A;  4CDM A;  5EIB E;  3OXF A;  2QYJ A;  1HE8 A;  5JHA A;  3D9L A;  4TUM A;  1U2V G;  1WG0 A;  1V55 E;  3U3W A;  4AY5 A;  3WXX A;  5FZR A;  3FTU A;  3IXE A;  3SBS A;  3FP3 A;  4U95 D;  2XEE A;  3PRZ A;  4FLH A;  3T8M A;  1QYM A;  3D9O A;  3TWX A;  5AQA A;  4Q69 A;  5CHE E;  3KSQ A;  3UM2 A;  3C72 A;  2J49 A;  5HQ8 A;  4ILG A;  5BXO A;  4OYS A;  4K0R A;  3I5P A;  1FPP A;  1S70 B;  3ZHE B;  1MQS A;  1UOH A;  3EJN A;  5LOZ A;  5ITZ F;  4KVO A;  3KAE A;  3X2Q E;  4AM9 A;  3AG3 E;  2QZA A;  2BKK B;  3IEG A;  3GW4 A;  2BUG A;  2WXI A;  1Z5S C;  2V4H C;  2E2E A;  2VGX A;  3AS5 A;  1HS6 A;  5KJL A;  3ULQ A;  4A3V A;  3DPY A;  4MS6 A;  1SQM A;  3SFX A;  3TXN A;  3C3Q A;  1FVF A;  4CRW A;  4TRQ A;  1MZC A;  4GYW A;  3B7S A;  4WUY A;  2FI7 A;  2ETA A;  3UQ3 A;  2ZIR A;  4TUU A;  3WG7 E;  5JMN D;  4I17 A;  5CEC B;  4UQX A;  4HRN A;  3ASG A;  3SQV A;  2M63 A;  4KZ0 A;  3LY7 A;  2I2O A;  2WQH A;  1KPS B;  1X81 A;  3PEU B;  4GA2 A;  4AOF A;  1YMP A;  3TG5 A;  2VQ2 A;  3CSF A;  3ONK A;  4KXK B;  4CT0 A;  1MHQ A;  4U04 A;  4C0M A;  2DBA A;  2FUL A;  1IQU A;  3R9A B;  1NP7 A;  2XCB A;  3ESK A;  4BES A;  5FWQ A;  2L0I A;  2R03 A;  1E8X A;  1N0Q A;  3B7B A;  1N52 A;  3ZW3 A;  3QWP A;  3HG0 D;  2X6H A;  3QB2 A;  3CK7 A;  3LS8 A;  2Y4T A;  4XZ4 A;  3NOC D;  4FC8 A;  2KBX A;  4EZJ A;  1BI7 B;  5A23 A;  1SW6 A;  4AJW A;  1AP7 A;  3FH8 A;  2CG2 A;  2HM8 A;  3TL5 A;  4HB5 A;  5D0O D;  1PY1 A;  4H7X A;  5BT1 A;  5AAO A;  3AAA C;  4DX6 D;  4IUL A;  4BX8 A;  4TV3 A;  2FEZ A;  3VTX A;  3UUX A;  2EIM E;  4AVX A;  3HXD A;  3UM1 A;  2V5F A;  2F8X K;  2A5U A;  2WXO A;  1UN8 A;  3ASN E;  1TYQ G;  1Z6T A;  3BQO A;  4D10 C;  2E0I A;  1S64 A;  4XI0 A;  4HRM B;  3DSU A;  3JYS A;  1N95 A;  2NSZ A;  3L13 A;  3ZHE A;  3AU5 A;  3FFL A;  4GTT A;  4N5C A;  3Q73 A;  1E7U A;  3LY9 A;  3CVU A;  5H7P A;  3ZFW A;  2QC9 A;  4A3T A;  4GTM A;  2KCK A;  3ZXP A;  3KEA A;  2J08 A;  4KMO A;  2R02 A;  2DYR E;  5EX3 A;  5FQ7 A;  2XGS A;  3CEQ A;  4OAU C;  4XI9 A;  4G2V A;  3DSW A;  4K03 A;  2WMN A;  4GYY A;  5BV1 A;  3D9I A;  5EKQ D;  1IHG A;  3HVE A;  4BT8 A;  4G23 A;  3TWR A;  2P2C P;  4G26 A;  5FZQ A;  4FUL A;  4HLL A;  1MYO A;  4BET A;  4CZ2 D;  5FTP A;  3CKB A;  3B95 A;  3E32 A;  2ZGG A;  4IN3 B;  1DCQ A;  2IOS A;  4I9C A;  4L7T A;  1HG2 A;  4WNG A;  4JW1 A;  2UY1 A;  2X38 A;  4JD2 G;  3SD5 A;  5HS0 A;  4AV7 A;  3KD7 A;  4E85 A;  5JJT A;  3RU0 A;  3Q78 A;  4I1A A;  4UQY A;  4B8C B;  3ULE G;  5BXU A;  2NYJ A;  2AWI A;  4DUI A;  5B1B E;  3EIJ A;  4DJA A;  5KJN A;  2MOW A;  3V2O A;  5LX8 A;  3DXM G;  4N5Q A;  3LVR E;  4JL0 A;  5A6C A;  5B3S E;  4ANW A;  4LSZ E;  3SBT B;  3MEK A;  2R5S A;  4HRL A;  1TNO A;  3ABM E;  4GMR A;  3DSS A;  4PH4 B;  3ZEF A;  2J09 A;  3Q9U C;  1NFI E;  1GW6 A;  3FUL A;  2EIJ E;  1OWM A;  3FU5 A;  3OAW A;  4EBA G;  4RSY A;  2XS8 A;  2KC7 A;  3C3O A;  3L16 A;  3TWU A;  3LCA A;  5IY5 E;  2KZT A;  3QOU A;  3CVV A;  3SO8 A;  4ILH B;  5CRU A;  1H6P A;  4GTS A;  4I9E A;  3PE4 A;  3HVE B;  3RAU A;  3G2V A;  3PUK A;  2P9K G;  3FDH A;  2OCC E;  1JUQ A;  3LYA A;  4EEC A;  4BER A;  2FBN A;  4PS3 A;  3OXG A;  3Q5M A;  2XZD G;  4JA7 A;  4UWL A;  3DRA A;  4YVO A;  4LNG A;  3EU9 A;  1OWL A;  3CVL A;  3FH5 A;  3CIA A;  4O60 A;  1E8W A;  3U9W A;  3MZL B;  1DVP A;  1Y8M A;  2AJA A;  3LJN A;  4BSX A;  2VSY A;  2F37 A;  2PQN A;  4GML A;  5ARG A;  5T8I A;  4BWR A;  3T8K A;  2MHK A;  1N4Q A;  2L6B A;  2I9C A;  1B89 A;  2R59 A;  2FO1 E;  4HI8 A;  2EIK E;  2A5E A;  5BNW A;  2YHC A;  5E76 A;  2UY1 B;  5FQ8 A;  2XEN A;  3NZU A;  2UWJ G;  3GZS A;  3FTX A;  2IY0 C;  3IHY A;  3MKR A;  4URK A;  2EQX A;  4PDX A;  5HKP A;  4KVM A;  3ENE A;  3AG2 E;  4CEM A;  1KZO A;  2J9Q A;  1X5B A;  3AS4 A;  3TGO A;  4EZL A;  5B1A E;  3S7J A;  3RJV A;  4U63 A;  3E33 A;  1HXI A;  1S0P A;  2LUH A;  5C1D A;  2GRL A;  5J08 A;  3TJP A;  1OY3 D;  1UJK A;  4I1M A;  4HOU A;  4U8V D;  2X6F A;  4K5A B;  4YDE A;  3L22 A;  3TWW A;  2V8S E;  3CVY A;  3QNK A;  1SA4 A;  2LNI A;  4XIF A;  3MCX A;  5BPP A;  1E90 A;  5CRV A;  1IQR A;  4WNF A;  4WAF A;  3U64 A;  3EHR A;  2WM9 A;  2DZN A;  1HO8 A;  4CT4 A;  4WWP A;  3D9M A;  5FIO A;  3U66 A;  2FO7 A;  3ZYK A;  3KSL A;  3QAR A;  1KLX A;  2L0T B;  5EDS A;  3QWV A;  3NZS A;  1KT0 A;  2I1K A;  1LTX A;  4GZ6 A;  3N71 A;  4N3A A;  3D9N A;  4Y6W A;  4UI9 C;  5FT9 A;  3UXG A;  1NA3 A;  3V30 A;  5FZS A;  4UWF A;  2WQ6 A;  4A1G A;  3MJW A;  2L6J A;  4FP7 A;  1O1T A;  3JQ0 A;  3BU8 A;  3CVX A;  4X8Q A;  3CKC A;  4BY6 A;  1JCS A;  3HYM B;  2CFU A;  2V0P A;  2XHE A;  3MV3 B;  5EN5 D;  5C2Y A;  3ZKJ A;  4JEH A;  4LUN U;  1ZB1 A;  3KS2 A;  2KCV A;  1HFA A;  2HR2 A;  5ENN A;  4OVV A;  4FLB A;  4DX7 D;  3CHQ A;  4U0S A;  4FHK A;  5M72 A;  1TNZ A;  2XPY A;  2DWZ A;  2F8Y A;  5AQ7 A;  3FTS A;  5FQ4 A;  3FUM A;  2GRQ B;  4GCN A;  3D3M A;  4B93 B;  1RW2 A;  2R05 A;  4XKC A;  3JUE A;  4YVQ C;  4WNE A;  2LAH A;  2DVW A;  5G05 C;  2Y1L E;  5DBK A;  1JCQ A;  3SGH A;  2H6G A;  4J6I A;  5KWD A;  2P58 C;  5ENO D;  4MKT A;  2P9I G;  4FAD A;  3S7F A;  3FUK A;  4N2S A;  3CVN A;  4UWG A;  1JPL A;  3BUA A;  2QFC A;  2VGX B;  4J8S A;  4RG6 A;  5ANL A;  4ANU A;  1OWO A;  4XEI G;  1WAO 1;  1DCE A;  2Y4U A;  2GW1 A;  2J8S D;  4AP2 A;  4I6J A;  3CHS A;  2LXM A;  1Z3X A;  3PH0 C;  3FTV A;  4HI9 A;  5T4Y A;  5BUZ A;  1K3Z D;  5KJK A;  2RD0 A;  3JXJ A;  1XNF A;  1HF8 A;  1E96 B;  4TXQ A;  3RSE G;  5EX0 A;  4O6F A;  2VGY A;  3QJZ A;  3RO3 A;  3GYZ A;  1NI1 A;  5AN8 A;  3FTY A;  1IHB A;  3CHM A;  3EHM A;  4DI3 A;  3FUI A;  2F0Y A;  4N3B A;  2KXP C;  3ZXS A;  1N9A A;  4HVB A;  3CVP A;  2BED A;  3ZU7 B;  4DI4 A;  3HXE A;  3GZ2 A;  3ASD A;  3ZN3 A;  1VDY A;  3S7B A;  3APD A;  5ENS D;  2RG8 A;  5KJM A;  3T5V A;  4W9R A;  4N39 A;  2KM4 A;  3IBE A;  5AQB A;  2X3M A;  3TWT A;  2XPI A;  3DST A;  2GRP B;  3DPD A;  5ENR D;  3U4T A;  4UQZ A;  3BG0 B;  3ML9 A;  3UKR G;  1N0R A;  3UT7 A;  3UI2 A;  3NAW A;  3MGB A;  2BTD A;  5E75 A;  5FQ6 A;  4ACK A;  1IKN D;  3VLE A;  4J8Y A;  2DYS E;  5CEA A;  3HDX A;  3UM0 A;  3QDN A;  2NC9 A;  4FU3 A;  4TXP A;  3SNX A;  4DX2 A;  2VTB B;  4LER A;  3JXI A;  2H6F A;  3PNT B;  2YNQ A;  2VJ8 A;  2AW6 A;  3Q7F A;  3ULY A;  4BX9 A;  1NZN A;  2OND A;  3FY4 A;  5AIJ A;  4DX1 A;  2PQR A;  1ELR A;  3ZVV A;  3RIB A;  2XGO A;  1OWP A;  2Y69 E;  1WM5 A;  2B0O E;  4DK5 A;  3UPV A;  2P9U G;  5CBO A;  2OEW A;  3MYV A;  3B13 A;  4JHR A;  4B0Z A;  1E8Y A;  5G04 J;  3Q49 B;  3JQ1 A;  3HXB A;  4R7L A;  1YCS B;  4G8K A;  3NF1 A;  5EID A;  3P1U A;  1MX4 A;  3ZPJ A;  3SI5 A;  2GRO B;  4J8D A;  4OAV B;  4C0E A;  5KBA A;  1UG3 A;  4C9B B;  1TJC A;  1ELW A;  4HOT A;  3ZYL A;  4JC8 A;  4I6G A;  2AXV A;  3PZ3 A;  4E6H A;  4LRZ A;  3PEV B;  2Y3A A;  5CMW A;  1BI8 B;  1FVH A;  3TWS A;  4AY6 A;  3G2S A;  4MRU A;  5T3R A;  3J5P A;  3VLF A;  1WDY A;  3SZ7 A;  4J8F A;  3KEZ A;  1QBQ A;  2J07 A;  2KCL A;  3UT8 A;  1N4R A;  1QNF A;  1PAQ A;  3CQG B;  4GPK A;  4PS7 A;  3I4R B;  4HBD A;  3UIP C;  1U3D A;  4IRU A;  3LKU A;  2R17 C;  4B94 A;  3ISM C;  1N11 A;  3Q75 A;  3PZD A;  4GPM A;  4G11 A;  4GZC A;  2CG3 A;  2RFM A;  5JA4 D;  2CHZ A;  1A5E A;  3G2T A;  4G8L A;  3CR3 A;  4V3I A;  1TN6 A;  3OTN A;  3O4Z A;  5AQ9 A;  4IYP A;  3FUN A;  5LCW C;  3SFZ A;  2WVI A;  4H7Y A;  3CHR A;  2BF0 X;  4U07 A;  3DWL G;  1H6O A;  3FH7 A;  3MA5 A;  4JB8 P;  3DEP A;  5EIL A;  5LCW J;  4DLO A;  2LXL A;  4K5B A;  4OVU A;  2V5Q C;  1UW4 B;  3Q7A A;  1PC2 A;  2IJG X;  1HZ4 A;  2XEV A;  5CBN A;  3PE3 A;  1OUV A;  3MKQ A;  2L9B A;  4RVB A;  4PUC A;  4YDO A;  1N54 A;  2QYU A;  2EIN E;  3CQC B;  3LPZ A;  1OCO E;  4CYM D;  1QQE A;  3AG4 E;  2Y0B G;  3FWV A;  2OOE A;  4L1B A;  2ILR A;  2ZGD A;  2PM7 A;  3E37 A;  3B7U X;  3HRA A;  5D0Q D;  1BD8 A;  5KNH D;  3EU5 A;  4U8Y D;  2ION A;  2WXP A;  3VLD A;  5BW8 C;  4P29 A;  2JLB A;  3B7T A;  3PZ2 A;  4Q94 A;  1OCR E;  3DEO A;  4JA9 A;  3CLJ A;  4TXR A;  1IXV A;  3FEX A;  3O48 A;  1TNB A;  4AIF A;  2V4L A;  3E30 A;  3IKO B;  2YHE A;  4LCT A;  3FHE A;  2IQC A;  1NL4 A;  4GU5 A;  2C2L A;  3S7D A;  1K1B A;  2BKG A;  2XGM A;  2AXU A;  3ZYQ A;  2WB2 A;  1Q2Z A;  1BU9 A;  1TNU A;  1IYG A;  3SHF A;  4YND A;  3F6Q A;  4HFG A;  2J4B A;  4LNB A;  2X6K A;  4I2Z A;  2OVB A;  1SVX A;  4C48 B;  1SA5 A;  3BEE A;  3CHP A;  4CGW A;  3CV0 A;  1EPU A;  3UTM A;  2VSO E;  2MYO A;  5ARF A;  1TJF A;  1LF8 A;  2RKK A;  2H6I A;  1O1R A;  1OT8 A;  4O1P A;  4EBA A;  5J90 A;  4GTP A;  1ZU2 A;  3ASO E;  5D66 A;  4BT9 A;  2PNN A;  2ZIS A;  1DC2 A;  2PL2 A;  1H0A A;  4GCO A;  2I6H A;  3V31 A;  3MKQ B;  2HO1 A;  2ZU6 B;  3R7R A;  4WWN A;  4UI9 J;  1MX2 A;  2QY7 A;  2XEH A;  3ZRH A;  3ML8 A;  3UX4 A;  3ABL E;  3P2B A;  1EF1 C;  1H2T C;  4ILI A;  5AJD A;  3L54 A;  4F1S A;  3L17 A;  2RFA A;  3IHV A;  3ZGQ A;  3EIQ C;  1UJJ A;  2NXP A;  3AJI A;  4APO A;  1H2V C;  2Q7F A;  4EZK A;  1AWC B;  1HH8 A;  2B6C A;  2WXM A;  5ENP D;  3PUJ A;  4ANV A;  5CER B;  3B7R L;  1INZ A;  1EYH A;  4GTO A;  1TN7 A;  3FU0 A;  3PDN A;  3UMV A;  4EPZ A;  4HXI A;  4HLE A;  1D8D A;  4BTB A;  3E4B A;  5EYL A;  3AG1 E;  4A1S A;  3PVL A;  5JHB A;  3C98 A;  2ETB A;  2WMO A;  4DRX E;  4BTA A;  3Q47 B;  3DXK G;  2A4Z A;  3PS6 A;  3APC A;  3FUD A;  1D9S A;  1K1A A;  2WXL A;  3G2W A;  3HHM A;  2YQ8 A;  4CGV A;  1UN9 A;  5KNG A;  2IEJ A;  3L9T A;  3E34 A;  4YDY A;  2EIL E;  3PNL B;  2LSV A;  2P9S G;  5G04 C;  3I4G A;  2WPV A;  4FJZ A;  4U7E B;  1OWN A;  1O1S A;  2IO3 C;  3PZ1 A;  3EHQ A;  4I43 A;  3NB2 A;  5G2N A;  5CED B;  3FTW A;  2WXH A;  4ANX A;  4L9P A;  4GZ5 A;  4UWK A;  1OXJ A;  4L23 A;  1Z3Y A;  4GTR A;  4M7C A;  4NRH B;  2KZT B;  3AU4 A;  1SZ9 A;  4CDR A;  4JXT A;  3SY2 A;  4EQF A;  3BG1 B;  1JWF A;  2KAT A;  5G55 A;  1P5Q A;  2CFZ A;  5ENQ D;  2R2L A;  3D9K A;  2WXG A;  4WWO A;  4ABN A;  4FJY A;  5BV0 A;  4B8A A;  3LDZ A;  2DCP A;  4JPS A;  4G1T A;  2DZO A;  3FU3 A;  2PM6 A;  1TNY A;  3UKU G;  5HRY A;  1FCH A;  3UIN C;  4O1O A;  3CHO A;  4JVS A;  3NQP A;  1G3N B;  2XRY A;  2X6J A;  1ZBP A;  3T9K A;  4HOS A;  4JHJ A;  1LD7 A;  2GRN B;  4GA1 A;  4QFV A;  3ZYM A;  2VSN A;  4PS8 A;  3TG4 A;  4GB9 A;  4AXH A;  2C0L A;  5G05 J;  4LEU A;  4WND A;  4MLP A;  4G24 A;  5CCM A;  4ATZ D;  4J7W A;  4U8H A;  3OXL A;  3HIZ A;  2AVP A;  2C0M A;  3ASF A;  3C3R A;  3Q15 A;  1H2U A;  4JZY A;  4HNA D;  2P9P G;  3C5R A;  2GRM A;  3V2X A;  4N3C A;  1LD8 A;  4M3O A;  3NBN B;  2WQ7 A;  3Q79 A;  4CDN A;  4HOQ A;  4XX5 A;  3DBS A;  2HYZ A;  2IFU A;  1RZ4 A;  2XCC A;  4FHJ A;  5FJY A;  3Q9N C;  2WXN A;  3GZ1 A;  4K5C A;  3QC1 A;  3RRM B;  3FUH A;  3LXU X;  2MRI A;  3AS8 A;  1L5J A;  2VSX E;  5AAR A;  3ZIM A;  3FEY A;  3URZ A;  4KBQ A;  3FUF A;  2X6I A;  3EUV A;  1FT1 A;  4UUC A;  2AXZ A;  2VYI A;  4F3V A;  3D9J A;  1D8E A;  4DPR A;  4NIK A;  3DSV A;  2FF4 A;  3J5Q B;  1HG5 A;  5AYW D;  4Y6C A;  1DNP A;  3D9H A;  4Q96 A;  5ANR A;  3R7Q A;  3TWQ A;  1SZA A;  3FU6 A;  3LJ3 A;  2PZI A;  3ESL A;  4FA6 A;  3NOG D;  5ENT D;  1WY6 A;  3UIO C;  2VTB A;  2JAB A;  2WXJ A;  4RLY A;  4JEU A;  1S63 A;  3LEW A;  1ELK A;  3FUE A;  1MX6 A;  2ETC A;  4HOR A;  1TR4 A;  4GAA A;  3G2U A;  3D9P A;  3VTY A;  4MBG A;  3FTZ A;  5DIZ A;  2WXR A;  4GYO A;  1YYH A;  4KT6 B;  1H6K A;  3JUI A;  4NAC A;  3QWW A;  5A7D B;  2WXF A;  4GZD A;  4F1P A;  1E7V A;  3QKY A;  3W9F A;  3R9M A;  2IF4 A;  4UI9 K;  1BLX B;  1JWG A;  3K9I A;  1JCR A;  3L08 A;  2P9N G;  4DX5 D;  4LNU D;  2GGF A;  3L82 A;  2JEK A;  1H19 A;  1E8Z A;  4I2W A;  5AJL A;  5KCM A;  5HI7 A;  4L2L A;  3PRE A;  1Y6I A;  1FT2 A;  1OCZ E;  4L2Y A;  4F53 A;  3MV2 B;  2J4D A;  3ONL A;  3CK8 A;  3JCK C;  1N4P A;  3CVW A;  1MJ0 A;  5CCL A;  2OV8 A;  1HX8 A;  3UT4 A;  5AEN A;  4HS2 A;  4A63 B;  2VGE A;  5D2M C;  4ATG A;  1K8K G;  4APF A;  2IU1 A;  3SF4 A;  4NUR A;  1O5M A;  2LSU A;  2XPZ A;  3TAX A;  2LAI A;  4LG6 A;  1KZP A;  4HQD A;  2GRR B;  4GA0 A;  3QAQ A;  4F6R D;  3EDT B;  3ABK E;  1N4S A;  3CVQ A;  4U0Z A;  4RG9 A;  4BSZ B;  4N2Q A;  4GTQ A;  4A55 A;  3ASH A;  4J0U A;  2H6H A;  3SFY A;  1HU3 A;  3TWV A;  4J8E A;  4U0U A;  2XRZ A;  3TXM A;  2OEV A;  2CHW A;  3CST A;  2WXK A;  1A17 A;  2P9L G;  4ZFH A;  1V54 E;  4G25 A;  5FIN A;  3T5X A;  2ZXW E;  2DIW A;  1TN8 A;  1EDU A;  3Q4A B;  3UM3 A;  2XQ0 A;  4NQ0 A;  3MX3 A; 
#chains in the Genus database with same CATH homology
 3LY8 A;  3DPD A;  2A4Z A;  3LVR E;  3PS6 A;  4JL0 A;  4UQZ A;  3BG0 B;  1W3B A;  3ML9 A;  3U4T A;  3UT7 A;  3APC A;  5A6C A;  3FUD A;  4ANW A;  3FUJ A;  3MGB A;  2WXL A;  3APF A;  2BTD A;  3G2W A;  3HHM A;  3MEK A;  2R5S A;  5E75 A;  3SBT B;  2YQ8 A;  5FQ6 A;  4ACK A;  3VLE A;  4CGV A;  1UN9 A;  4PH4 B;  3ZEF A;  2J09 A;  3RK6 A;  4UWH A;  5LFA A;  2LO6 A;  3S2A A;  3HDX A;  3PNL B;  2LSV A;  1GW6 A;  3QDN A;  4ACL A;  4I1O B;  3RKV A;  3RRU A;  2OVF A;  2NC9 A;  4FU3 A;  5G04 C;  3LVQ E;  3SNX A;  3I4G A;  3FUL A;  4BFR A;  2WPV A;  4FJZ A;  1OWM A;  3FU5 A;  1OWN A;  2VTB B;  3OAW A;  4LER A;  4JHK A;  4EBA G;  4I43 A;  4RSY A;  4AEZ C;  2KC7 A;  3L16 A;  3PNT B;  2YNQ A;  5G2N A;  4CCA A;  2I1J A;  2VJ8 A;  2AW6 A;  3FTW A;  2WXH A;  3I3N A;  4ANX A;  5JJ6 A;  4BX9 A;  4GZ3 A;  1NZN A;  2OND A;  3FY4 A;  1YA0 A;  4I6E A;  3LCA A;  1QZ2 A;  3IV0 A;  2PQR A;  4GZ5 A;  1ELR A;  2KZT A;  4UWK A;  3ZVV A;  3QOU A;  4L23 A;  2XGO A;  3RIB A;  3RO2 A;  4F7A A;  5AIJ A;  3CVV A;  1OWP A;  1Z3Y A;  4GMJ A;  1WM5 A;  4ILH B;  4DK5 A;  3UPV A;  1TEZ A;  3MYV A;  4NRH B;  2WXQ A;  2KZT B;  3AU4 A;  3B13 A;  4I9E A;  3PE4 A;  4JHR A;  1SZ9 A;  4KYO B;  5CMY A;  4CDR A;  1KT1 A;  4JXT A;  3HVE B;  2IOL A;  4B0Z A;  4XE0 A;  4B89 A;  3G2V A;  3PUK A;  4EQF A;  3BG1 B;  3FDH A;  1E8Y A;  1JWF A;  2KAT A;  5LP0 A;  5G04 J;  3QK0 A;  5G55 A;  1P5Q A;  3Q49 B;  2CFZ A;  1JUQ A;  5JJ7 A;  1NA0 A;  2WXG A;  3D9K A;  3JQ1 A;  4KZC A;  2YIN A;  4WWO A;  4ABN A;  3L6A A;  3LYA A;  4FJY A;  4R7L A;  1XGW A;  3EHN A;  4B8A A;  5BV0 A;  3NF1 A;  4EEC A;  3LDZ A;  4DLQ A;  2DCP A;  2FBN A;  4JPS A;  4PS3 A;  3RRN B;  3OXG A;  3P1U A;  3Q5M A;  1BPO A;  4G1T A;  4JA7 A;  4UWL A;  4YVO A;  4XKB A;  1U3C A;  3FU3 A;  1OWL A;  3CGH A;  3SI5 A;  2CHX A;  3ZPJ A;  4ME2 A;  3CK9 A;  4J8D A;  4CDM A;  2PM6 A;  3OXF A;  4C0E A;  1UG3 A;  3CVL A;  3FH5 A;  1HE8 A;  4C9B B;  1FCH A;  3CIA A;  1TJC A;  1ELW A;  5JHA A;  4HOT A;  1E8W A;  3ZYL A;  3D9L A;  3U9W A;  3CHO A;  4JVS A;  3NQP A;  4JC8 A;  4I6G A;  2AXV A;  3MZL B;  3U3W A;  1DVP A;  1Y8M A;  2XRY A;  4AY5 A;  4E6H A;  3WXX A;  5FZR A;  2X6J A;  1ZBP A;  2VSY A;  3FTU A;  4LRZ A;  4BSX A;  2PQN A;  4GML A;  4JHJ A;  3PEV B;  4HOS A;  2Y3A A;  3FP3 A;  5ARG A;  3SBS A;  4GA1 A;  5T8I A;  5CMW A;  4QFV A;  4BWR A;  3PRZ A;  4FLH A;  3ZYM A;  1FVH A;  2MHK A;  2VSN A;  2I9C A;  3T8M A;  1B89 A;  4PS8 A;  4AY6 A;  3TG4 A;  4GB9 A;  3G2S A;  4AXH A;  2R59 A;  3D9O A;  2C0L A;  4MRU A;  5G05 J;  4LEU A;  4Q69 A;  5CHE E;  4WND A;  4MLP A;  4G24 A;  5T3R A;  3VLF A;  5CCM A;  4U8H A;  3SZ7 A;  2J49 A;  4J8F A;  5HQ8 A;  3OXL A;  3KEZ A;  4ILG A;  4OYS A;  4K0R A;  3HIZ A;  5BNW A;  2J07 A;  2KCL A;  2YHC A;  2AVP A;  2C0M A;  3I5P A;  2UY1 B;  5E76 A;  3UT8 A;  3ASF A;  3Q15 A;  5FQ8 A;  3NZU A;  1H2U A;  2UWJ G;  1QNF A;  1PAQ A;  3CQG B;  3FTX A;  3GZS A;  4PS7 A;  3I4R B;  1MQS A;  3ZHE B;  4JZY A;  3IHY A;  3MKR A;  1U3D A;  4IRU A;  2EQX A;  4DI3 A;  3LKU A;  2R17 C;  3EJN A;  4PDX A;  4B94 A;  4URK A;  4KVM A;  2GRM A;  3ENE A;  5LOZ A;  4N3C A;  4CEM A;  3PZD A;  4KVO A;  4M3O A;  2WQ7 A;  2J9Q A;  1X5B A;  3KAE A;  3AS4 A;  3TGO A;  4CDN A;  4G11 A;  4GZC A;  2CG3 A;  4EZL A;  3S7J A;  3RJV A;  4HOQ A;  4XX5 A;  4U63 A;  4AM9 A;  2CHZ A;  3DBS A;  3G2T A;  3IEG A;  3GW4 A;  2BUG A;  2WXI A;  2HYZ A;  2IFU A;  1HXI A;  3CR3 A;  1S0P A;  4V3I A;  2E2E A;  3OTN A;  2VGX A;  3O4Z A;  5C1D A;  2XCC A;  2GRL A;  4FHJ A;  5FJY A;  3TJP A;  1UJK A;  3AS5 A;  1HS6 A;  4I1M A;  5J08 A;  4HOU A;  5KJL A;  2WXN A;  3GZ1 A;  4IYP A;  3ULQ A;  2X6F A;  3QC1 A;  3RRM B;  4A3V A;  3FUH A;  4MS6 A;  3FUN A;  5LCW C;  3LXU X;  3SFZ A;  2WVI A;  3L22 A;  4H7Y A;  2MRI A;  3AS8 A;  1L5J A;  1SQM A;  2VSX E;  2V8S E;  3CVY A;  3QNK A;  3ZIM A;  3CHR A;  3FEY A;  3TXN A;  3URZ A;  2BF0 X;  2LNI A;  1FVF A;  4KBQ A;  3FUF A;  2X6I A;  4U07 A;  4XIF A;  4CRW A;  4TRQ A;  3MCX A;  2AXZ A;  5BPP A;  3FH7 A;  1E90 A;  3MA5 A;  4GYW A;  3B7S A;  1IQR A;  4WUY A;  2FI7 A;  2VYI A;  4WNF A;  3UQ3 A;  4F3V A;  3D9J A;  4TUU A;  4DPR A;  5LCW J;  4WAF A;  4DLO A;  4I17 A;  4GPK A;  4OVU A;  4UQX A;  3U64 A;  2WM9 A;  2FF4 A;  3ASG A;  1UW4 B;  1HG5 A;  1HO8 A;  5AYW D;  2M63 A;  4Y6C A;  1PC2 A;  4CT4 A;  4WWP A;  3D9M A;  4KZ0 A;  3U66 A;  2IJG X;  1HZ4 A;  1DNP A;  2XEV A;  2FO7 A;  2I2O A;  3LY7 A;  3PE3 A;  4Q96 A;  1OUV A;  3MKQ A;  2WQH A;  2L9B A;  3PEU B;  4GA2 A;  3ZYK A;  4RVB A;  4AOF A;  3QAR A;  5ANR A;  3R7Q A;  1KLX A;  2L0T B;  1SZA A;  3TG5 A;  4PUC A;  1N54 A;  2VQ2 A;  5EDS A;  3CSF A;  3CQC B;  3LPZ A;  3ONK A;  3QWV A;  1MHQ A;  3FU6 A;  4KXK B;  3NZS A;  4U04 A;  4C0M A;  4CT0 A;  2DBA A;  3LJ3 A;  1QQE A;  2PZI A;  3ESL A;  2FUL A;  1IQU A;  1KT0 A;  3R9A B;  2I1K A;  3FWV A;  4FA6 A;  2OOE A;  4L1B A;  1NP7 A;  2XCB A;  3ESK A;  2ILR A;  4GZ6 A;  1WY6 A;  3N71 A;  4N3A A;  5FWQ A;  3D9N A;  2VTB A;  2L0I A;  2PM7 A;  2WXJ A;  4Y6W A;  4UI9 C;  1E8X A;  5FT9 A;  1NA3 A;  4JEU A;  3B7U X;  1N52 A;  3ZW3 A;  3LEW A;  3QWP A;  2X6H A;  1ELK A;  4UWF A;  5D0Q D;  5FZS A;  3QB2 A;  2WQ6 A;  4A1G A;  3CK7 A;  3MJW A;  2ION A;  3LS8 A;  2WXP A;  3FUE A;  4HOR A;  2L6J A;  4FP7 A;  4GAA A;  3G2U A;  3JQ0 A;  4P29 A;  2Y4T A;  3D9P A;  5BW8 C;  3VLD A;  3VTY A;  2JLB A;  3FTZ A;  5DIZ A;  3B7T A;  4XZ4 A;  3CVX A;  2WXR A;  4GYO A;  4FC8 A;  4Q94 A;  4EZJ A;  3CKC A;  4KT6 B;  5A23 A;  1H6K A;  4BY6 A;  4JA9 A;  3JUI A;  3CLJ A;  4AJW A;  3HYM B;  2CFU A;  3FH8 A;  3QWW A;  4NAC A;  2V0P A;  5A7D B;  3FEX A;  2XHE A;  3MV3 B;  3O48 A;  4AIF A;  2CG2 A;  2V4L A;  5C2Y A;  2WXF A;  4GZD A;  2HM8 A;  3TL5 A;  3IKO B;  5D0O D;  1E7V A;  1PY1 A;  3QKY A;  4JEH A;  4H7X A;  4LUN U;  5BT1 A;  3KS2 A;  2YHE A;  2KCV A;  4LCT A;  3FHE A;  1HFA A;  2HR2 A;  5ENN A;  2IQC A;  2IF4 A;  4IUL A;  4BX8 A;  4OVV A;  4UI9 K;  4GU5 A;  4FLB A;  1JWG A;  2C2L A;  4TV3 A;  3S7D A;  3CHQ A;  3K9I A;  4U0S A;  3L08 A;  2FEZ A;  3VTX A;  2XGM A;  4FHK A;  2AXU A;  5M72 A;  3ZYQ A;  3UUX A;  2WB2 A;  2XPY A;  2GGF A;  4AVX A;  2JEK A;  1H19 A;  2V5F A;  3FTS A;  2A5U A;  1E8Z A;  4I2W A;  2WXO A;  5FQ4 A;  3FUM A;  5AJL A;  5KCM A;  1UN8 A;  1IYG A;  4GCN A;  3D3M A;  3SHF A;  1Z6T A;  4D10 C;  5HI7 A;  4YND A;  4HFG A;  4L2L A;  2J4B A;  3PRE A;  4XKC A;  2X6K A;  2E0I A;  4I2Z A;  4YVQ C;  4XI0 A;  4WNE A;  2LAH A;  2OVB A;  3JYS A;  5G05 C;  5DBK A;  2NSZ A;  3L13 A;  4J6I A;  3SGH A;  3BEE A;  3CHP A;  3AU5 A;  2P58 C;  3CV0 A;  3ZHE A;  1EPU A;  4CGW A;  1Y6I A;  3FFL A;  4MKT A;  4FAD A;  4L2Y A;  4N5C A;  4F53 A;  3MV2 B;  2J4D A;  3ONL A;  3S7F A;  3CK8 A;  2VSO E;  3FUK A;  3JCK C;  4N2S A;  3CVN A;  5ARF A;  4UWG A;  1E7U A;  1JPL A;  3LY9 A;  3CVW A;  1TJF A;  5CCL A;  3CVU A;  3ZFW A;  1LF8 A;  2QFC A;  2OV8 A;  4A3T A;  2VGX B;  4J8S A;  2KCK A;  4RG6 A;  5ANL A;  4ANU A;  1HX8 A;  1OWO A;  3UT4 A;  5AEN A;  2J08 A;  4KMO A;  1WAO 1;  4HS2 A;  4EBA A;  2Y4U A;  5J90 A;  1ZU2 A;  2GW1 A;  5EX3 A;  5FQ7 A;  2XGS A;  4BT9 A;  4ATG A;  3CEQ A;  4XI9 A;  4AP2 A;  4APF A;  4I6J A;  2PL2 A;  4G2V A;  3CHS A;  1H0A A;  1Z3X A;  2IU1 A;  3SF4 A;  4K03 A;  2WMN A;  3PH0 C;  4GCO A;  4NUR A;  2LSU A;  2I6H A;  3MKQ B;  2XPZ A;  2HO1 A;  4GYY A;  3TAX A;  3D9I A;  5BV1 A;  3FTV A;  5EKQ D;  1IHG A;  2ZU6 B;  3R7R A;  2LAI A;  3HVE A;  5T4Y A;  4BT8 A;  4G23 A;  4WWN A;  4G26 A;  5BUZ A;  4UI9 J;  5FZQ A;  4FUL A;  2QY7 A;  5KJK A;  2RD0 A;  4GA0 A;  3QAQ A;  1XNF A;  5FTP A;  3ZRH A;  3ML8 A;  3UX4 A;  1HF8 A;  1E96 B;  3EDT B;  3P2B A;  1EF1 C;  1H2T C;  3CKB A;  3CVQ A;  4U0Z A;  5EX0 A;  4ILI A;  4RG9 A;  4O6F A;  2VGY A;  5AJD A;  3L54 A;  3QJZ A;  4IN3 B;  3RO3 A;  3L17 A;  4F1S A;  4N2Q A;  4A55 A;  3ASH A;  3IHV A;  4J0U A;  3GYZ A;  2IOS A;  3ZGQ A;  3FTY A;  4I9C A;  3EHM A;  3CHM A;  1HU3 A;  1HG2 A;  3EIQ C;  1UJJ A;  3FUI A;  4L7T A;  2NXP A;  4JW1 A;  2UY1 A;  4WNG A;  2X38 A;  4APO A;  4N3B A;  4J8E A;  1H2V C;  3ZXS A;  2Q7F A;  4HVB A;  3CVP A;  3SD5 A;  4EZK A;  1HH8 A;  4AV7 A;  2WXM A;  3KD7 A;  4U0U A;  4E85 A;  3PUJ A;  3TXM A;  2XRZ A;  4DI4 A;  5JJT A;  3RU0 A;  4ANV A;  3GZ2 A;  3B7R L;  3ASD A;  2CHW A;  4I1A A;  4UQY A;  3CST A;  1INZ A;  3ZN3 A;  1EYH A;  1VDY A;  2WXK A;  4B8C B;  3S7B A;  1A17 A;  3APD A;  3FU0 A;  3PDN A;  2RG8 A;  4G25 A;  3T5X A;  5KJM A;  3T5V A;  4W9R A;  3UMV A;  4N39 A;  2KM4 A;  3IBE A;  4HXI A;  4EPZ A;  2X3M A;  2DIW A;  4HLE A;  2AWI A;  4BTB A;  3E4B A;  1EDU A;  3Q4A B;  4A1S A;  3EIJ A;  4DJA A;  2XPI A;  2XQ0 A;  3PVL A;  4NQ0 A;  5KJN A;  5JHB A;  2MOW A;  3C98 A;  2WMO A;  3MX3 A;  5LX8 A;  4BTA A;  3Q47 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...