1TJCA

Crystal structure of peptide-substrate-binding domain of human type i collagen prolyl 4-hydroxylase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
95
structure length
95
Chain Sequence
MFLTAEDSFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Prolyl 4-hydroxylase alpha-1 subunit
publication title The Peptide-Substrate-binding Domain of Collagen Prolyl 4-Hydroxylases Is a Tetratricopeptide Repeat Domain with Functional Aromatic Residues.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature ec 1.14.11.2: Procollagen-proline 4-dioxygenase.
pdb deposition date 2004-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1tjcA00
5G05C 5DIZA 4NRHB 3VTYA 4U0ZA 3MKRA 2PL2A 4G2VA 3TAXA 5ARFA 4G26A 3KAEA 3AS5A 4BT9A 4RG9A 4KYOB 4N3AA 3VTXA 3Q5MA 5D0QD 3QWPA 3RIBA 2VGYA 1ZU2A 5LCWC 3EDTB 2PZIA 3TG4A 4GYOA 3GW4A 2Q7FA 1W3BA 4N2SA 3ZN3A 1QZ2A 5HI7A 3GYZA 2ONDA 2V5FA 2WQHA 1YA0A 4YVQC 2JLBA 4I2ZA 4GA2A 4CDRA 4I1AA 4JA7A 4GCOA 4WNGA 4G23A 5BW8C 3CV0A 5KJLA 2AVPA 1ZBPA 4HOUA 2I6HA 3JYSA 3ASFA 4GZ5A 2HYZA 1B89A 2VQ2A 4XIFA 2UY1B 2XPIA 2XEVA 3QDNA 3LY8A 5FTPA 4GA0A 3TGOA 1A17A 3LPZA 2UY1A 4H7YA 3RO2A 3AS8A 4J0UA 2GW1A 4I17A 2BUGA 2FEZA 3AS4A 5JJTA 2KC7A 2MHKA 4N3BA 2XGOA 3WXXA 5KJMA 1NA3A 4GCNA 2J9QA 2XGMA 3ULQA 5JJ6A 5M72A 2XCCA 3CK7A 3N71A 2C0MA 5KJNA 3UQ3A 3CKBA 2R5SA 4N3CA 2YHCA 3ASGA 3NF1A 3MEKA 1PC2A 4APOA 3RKVA 4UQZA 4KXKB 1ELWA 3O48A 2DBAA 5JJ7A 5FJYA 4AY6A 4WNDA 4EQFA 3ZFWA 1HZ4A 3LKUA 5DBKA 2FO7A 3CKCA 4RG6A 4YVOA 1HH8A 4AIFA 1KT0A 4UQYA 1ELRA 5CCMA 4JA9A 4YNDA 2VSNA 3FP3A 2FF4A 4BWRA 4N5CA 3CEQA 3OXFA 5LCWJ 1P5QA 3HYMB 4HOQA 3MV2B 4G25A 4WNFA 4U0SA 2IFUA 4JHRA 4G1TA 4I9CA 4J8DA 5HQ8A 2P58C 3OXLA 3GZ2A 4U07A 4HORA 3QOUA 4N2QA 4CGWA 4JL0A 2WPVA 3CK9A 4H7XA 2VGXB 3MV3B 3PDNA 2NC9A 2FI7A 1IHGA 5FT9A 3U4TA 3ASDA 3K9IA 1KLXA 5D0OD 3UPVA 3RJVA 1WAO1 3ESKA 3SZ7A 2FBNA 4W9RA 4GZ6A 3IEGA 3ZPJA 1FCHA 4AY5A 3BEEA 2IF4A 1E96B 3Q49B 3KS2A 2LSVA 5BT1A 3QWVA 2Y4TA 3URZA 3E4BA 3R9AB 3Q15A 4U04A 4A1SA 2UWJG 3RO3A 4UI9K 5G04J 3CVQA 3LYAA 4GYWA 3ZHEB 3ASHA 1KT1A 4NQ0A 3Q4AB 5FZRA 4Y6CA 3RU0A 5ARGA 3CVPA 3CVLA 2L6JA 3ZHEA 4UI9J 4BT8A 4I2WA 1TJCA 4XI0A 5EX0A 2LNIA 2XGSA 4GA1A 3LY9A 4WNEA 2KCLA 1IYGA 5G05J 2VSYA 4U0UA 1Y8MA 3CK8A 2KCKA 4I9EA 2HR2A 5BNWA 5EKQD 1XNFA 3UUXA 3KD7A 5C1DA 4GZ3A 3S7BA 3FFLA 1HXIA 2HO1A 3OXGA 2PQRA 3FWVA 4GYYA 2XCBA 5CHEE 3CVNA 3TG5A 1NZNA 4UQXA 4F3VA 2Y4UA 2E2EA 3S7DA 5FZSA 3QWWA 4BTBA 2VYIA 1QQEA 5KJKA 3MA5A 3PE3A 1WM5A 5A7DB 3U3WA 4Y6WA 5EX3A 4ME2A 4CGVA 2QFCA 2OOEA 2VGXA 2LSUA 3GZ1A 4XI9A 4WUYA 3LCAA 3PE4A 3Q47B 1OUVA 3SF4A 4IN3B 4O6FA 2PQNA 3QKYA 4GPKA 5FZQA 2YQ8A 4J8EA 3ZGQA 3S7JA 2C2LA 4AM9A 5CCLA 4BTAA 2KATA 4B94A 4HOTA 4J8FA 3LY7A 2KCVA 5G04C 4KBQA 1NA0A 4LEUA 5AYWD 4G24A 4UI9C 4N39A 2C0LA 4ABNA 5A6CA 4HOSA 3S7FA
chains in the Genus database with same CATH superfamily
4AOFA 4I1OB 4UWLA 4FLBA 1TNYA 5ENOD 2PL2A 3IHVA 3ONKA 3TWTA 3ZEFA 4L9PA 5ARFA 3AAAC 3ABLE 1WY6A 1AWCB 4G26A 2ZISA 3CHMA 3AS5A 4BT9A 1ZB1A 3ML9A 3QWPA 4XX5A 3RIBA 3DXMG 5BV1A 4L2YA 2IU1A 4UUCA 2PZIA 3GW4A 4C0MA 3UT7A 3D9OA 3ZYLA 5HI7A 2ONDA 4HS2A 2KXPC 3DEPA 4CDRA 3QC1A 3BU8A 4I1AA 4WNGA 2A5EA 4G23A 2QYUA 2CFZA 3ZKJA 2GRMA 4GMRA 3JUEA 1U3DA 1B89A 3AG4E 5B1AE 3R7RA 2VQ2A 3MJWA 1OCOE 2UY1B 3QDNA 2WMOA 1SA4A 2R59A 5HKPA 3OTNA 4A3TA 4M7CA 3PZ2A 1OT8A 3DXKG 3FU3A 1A17A 3LPZA 5CMWA 4HRMB 3ESLA 4AVXA 5AARA 4QFVA 1EYHA 3EHMA 5KJMA 3E30A 4GCNA 2R02A 1JUQA 4XZ4A 4HNAD 4TUUA 3CHRA 3NAWA 3D9NA 4X8QA 2WXQA 4EPZA 4YDOA 2WXMA 3JCKC 3ASGA 4WWPA 5E75A 4EHMA 4LRZA 5BPPA 3FUJA 3UT4A 3V30A 1ELWA 3O48A 2DBAA 4AY6A 4EQFA 5LOZA 3LKUA 2FO7A 3B7UX 3CKCA 4YVOA 1HH8A 4BX8A 1ELRA 1Z5SC 4BETA 2RKKA 4CDNA 2P9IG 1P5QA 4IYPA 4UWGA 1TNZA 4DUIA 4R7LA 4K5AB 4AEZC 3EHQA 4QQIA 3Q9NC 4WNFA 3UIOC 1E8YA 1PAQA 2L9BA 4HLLA 1KPSB 4JHRA 2X6FA 1U3CA 3GZ2A 4UWKA 2X6JA 3QOUA 4N2QA 2QC9A 3DSSA 4JL0A 2WXKA 2ILRA 3CK9A 2WXFA 3MV3B 1IHGA 5CECB 2EIJE 3UPVA 2DYSE 4G11A 3I3NA 5EILA 4ANUA 5J90A 4GZ6A 3B7SA 3CSTA 3CIAA 3JXJA 1E7VA 2IF4A 3DPDA 5J08A 4EBAA 2WXPA 3D9KA 1AP7A 3DPYA 5EN5D 2V5QC 4F7AA 1FPPA 3FH7A 4U04A 1RZ4A 5AIJA 2GRNB 2UWJG 2JABA 1KT1A 4U63A 3FU5A 3D9PA 3KEZA 3CVLA 3LS8A 4CYMD 2L6JA 3G2TA 3ZHEA 3CVVA 3LJ3A 4MLPA 3ML8A 3UXGA 4B0ZA 5KCMA 4GA1A 2KCLA 1IYGA 2GROB 2VSYA 1N0QA 3CK8A 5KWDA 4FLHA 4C0EA 3HVEA 4CT4A 2XEEA 5EKQD 3UUXA 1H6OA 4HB5A 2FULA 1JCRA 2HO1A 4XE0A 1D8DA 3J5PA 4J6IA 3FWVA 1HX8A 4GYYA 5CHEE 3CVNA 4U95D 3G2UA 3TXMA 3D3MA 3S7DA 5FQ4A 3QWWA 5CERB 1QQEA 1TN8A 5AN8A 3PE3A 1H2UA 3SFZA 1IKND 2CHWA 4Y6WA 3SBSA 4EZKA 5T4YA 3V2OA 4URKA 3Q78A 1X81A 4CGVA 4U8YD 3RRNB 1S70B 2LSUA 3SFYA 3SO8A 4J7WA 1QNFA 4WUYA 4E85A 4WWNA 3Q47B 4KZCA 3FUMA 3QKYA 5KBAA 4YDYA 3Q7AA 4GPKA 5FZQA 2PNNA 3WG7E 3CHOA 4XKCA 3I5PA 2C2LA 3V79K 3VLDA 4ZHBA 4JXTA 3LY7A 2KCVA 2P9NG 4TXRA 3CVXA 3DBSA 3AG2E 5ENQD 4C48B 3DSVA 4K5CA 4CEMA 1Y6IA 5AYWD 5EYLA 4N39A 2LXLA 2C0LA 4M3OA 3AU4A 4AJWA 2Y0BG 3EHNA 2VJ8A 5G05C 1LTXA 3KSLA 5DIZA 1S64A 3TWVA 1NI1A 4GTVA 3MKRA 1SZAA 2JEKA 2I2OA 4OYSA 4GMLA 3KAEA 4RG9A 3VTXA 4MKTA 2IJGX 2MOWA 3FDHA 4UWHA 5AJDA 4HQDA 2WXHA 1ZU2A 5FQ7A 3ZRHA 1YCSB 3TG4A 4GTTA 2PM6A 3AU5A 4HRLA 2DVWA 5H7PA 2EIME 4HI9A 3ZN3A 1QZ2A 1DNPA 5ENNA 2MRIA 4JEUA 2WQHA 3LJNA 2BF0X 1YA0A 4YVQC 4GA2A 4FC8A 5AENA 4JA7A 3P1UA 1UJKA 5BW8C 5KJLA 3HIZA 4KZ0A 4WWOA 1L5JA 4U7EB 3ASFA 1A5EA 2IEJA 1BLXB 4XIFA 3L82A 2E0IA 3LY8A 5FTPA 4GA0A 3W9FA 2DZNA 3RO2A 4GTOA 2GRRB 3TJPA 3AS8A 1FT2A 5C2YA 2R2LA 2BUGA 4I17A 4NIKA 4FADA 3X2QE 3E34A 2FEZA 1OWLA 2RD0A 3FH5A 5JJTA 3MGBA 5G55A 2XGOA 3ULYA 4N5QA 2X3MA 1NA3A 3PNTB 2F37A 2XGMA 3ULQA 5BXOA 4ILGA 2XCCA 4ANXA 3EU5A 3PREA 3N71A 3UQ3A 3CKBA 2R5SA 1N4PA 4NACA 1INZA 3PS6A 3DSUA 4DX2A 1U2VG 3FTZA 4UQZA 4HXIA 4B89A 5AAOA 4GTRA 5JJ7A 1SQMA 2P9UG 5EYPF 4OAVB 2F0YA 4BY6A 4JEHA 3ZFWA 1HZ4A 3I4RB 1OXJA 5DBKA 1OCRE 1BI8B 4RG6A 2I9CA 4FULA 1IQRA 3C72A 1TN7A 1JWGA 4L7TA 2FF4A 4F6RD 3OXFA 3CR3A 3HYMB 2J4BA 2DCPA 5JA4D 4U8VD 4U8HA 2H6HA 4G25A 3DSTA 5ENRD 2VSXE 4YDEA 3TWRA 4GPMA 4I9CA 4O1OA 4J8DA 5HQ8A 2P58C 4DPRA 2GGFA 5KNHD 4CGWA 4DX5D 5AQ7A 2WPVA 3T5VA 4GMJA 4H7XA 3PZ4A 2VGXB 3PDNA 2NC9A 3HXBA 5CEDB 1FVHA 2J08A 3FUIA 4BEPA 3ASDA 1YMPA 3K9IA 3UTMA 1MX2A 2QY7A 3RJVA 3EIQC 4I43A 2XRZA 2AW6A 3JXIA 4LCTA 3ZPJA 4O1PA 1UN9A 1HFAA 4HLEA 3BEEA 3D9JA 3SQVA 1E96B 3NB2A 3Q9UC 1MZCA 2XHEA 3E32A 2Y4TA 1FT1A 1GW6A 3FUEA 3T8MA 1H6KA 3HXCA 2J49A 4UI9K 3SNXA 3LYAA 3ZHEB 4CDMA 3T8KA 4NQ0A 4UWFA 3L9TA 3Q4AB 4MRUA 4Y6CA 4PS3A 1JCSA 3RRMB 3PZDA 4UI9J 3NZSA 1TJCA 3SD5A 4GU5A 3LEWA 1N11A 2XGSA 3LY9A 2WQ6A 2AXUA 3HVEB 4ZFHA 3ZVVA 1Q2ZA 1OWNA 3VLFA 3B7RL 2F8YA 1MX4A 1K1AA 1XNFA 5C1DA 4I6GA 2XEHA 3PUKA 3S7BA 3Q75A 1EDUA 3TWQA 5HRYA 1TNOA 2KM4A 2QZAA 1ELKA 1NZNA 3HHMA 2E2EA 2AXVA 1TEZA 3ZU7B 4BTBA 2P9SG 4ILHB 3NOGD 4LNGA 3L17A 1E8ZA 2EQXA 2QYJA 4U96D 2WXGA 5EX3A 4ME2A 2KBXA 5A23A 4D10C 3W9GA 1UN8A 4DX6D 2VGXA 3RSEG 2XS1A 3ASNE 4RVBA 2M63A 3O4ZA 4Q96A 3LCAA 1E8XA 4GB9A 2ETBA 2OCCE 3QK0A 5CEAA 4Q94A 1OUVA 1O1SA 3E33A 4IN3B 2PM7A 2OV8A 2H6GA 4AV7A 1BU9A 2OEVA 4J8EA 2DYRE 3S7JA 4OAUC 1LD7A 4AM9A 1N4QA 3C3OA 4BTAA 2KATA 4A63B 3NOCD 4CZ2D 1V54E 5G04C 2AXZA 1TR4A 3BG0B 4E6HA 4GTPA 3J5QB 1NP7A 3SI5A 3SBTB 3CVYA 1XGWA 1BI7B 1HF8A 1MQSA 2I1KA 4RSYA 2IONA 2WXRA 3ONLA 2WXOA 3ZYQA 4HOSA 3S7FA 3ENEA 4NRHB 2ZXWE 4AP2A 3FUHA 4G2VA 1EF1C 4JPSA 3FTWA 3G2SA 3TAXA 3SY2A 4KT6B 3ASOE 1QYMA 4G8KA 2XQ0A 4RLYA 2Y69E 5AQBA 3DRAA 2EILE 2VGYA 4TXPA 3EDTB 4KVOA 5ENSD 4GYOA 2Q7FA 1UJJA 1W3BA 4N2SA 2XZDG 3GYZA 4XKBA 3FUKA 2JLBA 3IBEA 4BX9A 4I6JA 2WM9A 5FQ8A 4BERA 1D9SA 2I6HA 3JYSA 2R17C 4PS7A 1FVFA 2ETCA 2P9LG 3G2VA 2WQ7A 4ANVA 2XEVA 3FUDA 1TNBA 3TGOA 3ZYKA 3RAUA 4J0UA 2YNQA 3FTVA 2GW1A 5B3SE 2AWIA 3MKQA 1N54A 5LX8A 3AS4A 2KC7A 3UKRG 3IHYA 3CQCB 3WXXA 1TJFA 3L08A 2J9QA 3PZ1A 4L23A 1IHBA 4ANWA 4HI8A 3CK7A 2ZIRA 5KJNA 2P9KG 1N52A 4N3CA 2YHCA 4K03A 3NF1A 2CHZA 3DEOA 3AG1E 2VGEA 5CRVA 4TRQA 4K5BA 4PH4B 3CGHA 4B8CB 4APOA 3Q79A 4Q69A 4BESA 1LD8A 4APFA 4KXKB 4I1MA 4LUNU 4OVUA 1E8WA 1KZOA 5EIDA 1JCQA 5B1BE 4AIFA 1PY1A 1KT0A 4DLQA 4XEIG 4JHKA 4L2LA 4JA9A 4FU3A 1WG0A 1OWOA 2VSNA 3FP3A 3IKOB 3EJNA 3B7BA 1HS6A 4F1SA 4BWRA 3LXUX 4JZYA 3CEQA 1OY3D 1RW2A 4IRUA 1N4SA 4HOQA 3HDXA 2IOLA 1MHQA 3MV2B 3EUVA 2RFMA 3L54A 4JB8P 2CFUA 3FUFA 3BUAA 3UT8A 3UM2A 4HORA 3PH0C 3C3QA 4EECA 3APFA 3I4GA 5BXUA 2BEDA 3UI2A 2KZTA 1QBQA 2DWZA 2FI7A 2X6HA 1KLXA 3KSQA 3ULEG 2OVFA 2A4ZA 1WAO1 3SZ7A 2FBNA 2OEWA 1K3ZD 4JHJA 4W9RA 1N95A 3CHPA 3IEGA 4AY5A 1MX6A 3L13A 3PEVB 1N9AA 3FH8A 3B7TA 3ZUVB 4BFRA 1SA5A 2LSVA 3FHEA 3R9MA 3SHFA 3T5XA 3QWVA 3OAWA 2R03A 3URZA 3E4BA 2XPZA 3Q15A 5E76A 4A1SA 2VTBA 4LNUD 3RO3A 1HU3A 2X6KA 4GYWA 4LG6A 3D9HA 1OWMA 1BPOA 5ARGA 3CVPA 4GZDA 3BG1B 4CRWA 3MCXA 3KEAA 3Q73A 2H6FA 4P29A 4XI0A 4WNEA 3CLJA 5G05J 3QAQA 4U0UA 3R7QA 1Y8MA 4J8YA 2WXNA 2KCKA 5EIBE 2B0OE 1IXVA 3S2AA 2HR2A 4ATZD 5BNWA 2XRYA 4FJZA 1Z6TA 1YYHA 3FFLA 1HXIA 5ANLA 4KVMA 4PUCA 3FEXA 1BD8A 5FINA 1H0AA 4UQXA 2GRLA 3JQ1A 2Y4UA 2B6CA 1VDYA 3C3RA 3DSWA 1MYOA 2MYOA 2X38A 1LF8A 4CCAA 2VYIA 3CVUA 4GZCA 3MA5A 4JC8A 3CHQA 2LAIA 5BV0A 5T3RA 2OOEA 2WXIA 4A3VA 3GZ1A 5LFAA 1OCZE 3EU9A 3PE4A 3RK6A 1DC2A 2XPYA 4BSZB 4KMOA 3SF4A 4BSXA 3ZNGA 1DCQA 3D9IA 5ENPD 4RQIA 2PQNA 3ZYMA 3FUNA 2YQ8A 1UG3A 3ZGQA 2J07A 3PVLA 4A1GA 2WVIA 3UIPC 4DX1A 4B94A 3NBNB 4J8FA 3MYVA 5ITZF 4OVVA 1Z3XA 4LEUA 2CG3A 1D8EA 4DI3A 3HG0D 1JWFA 2XENA 3P2BA 4G24A 4JVSA 4HVBA 4MS6A 3LDZA 4ABNA 5A6CA 1HE8A 4GTSA 5CBNA 2V8SE 3PZ3A 3VTYA 2WXLA 4EZJA 4U0ZA 3UM0A 3GZSA 2P9PG 4KYOB 5FQ6A 2P2CP 4N3AA 3UKUG 2EIKE 3Q5MA 5D0QD 4DK5A 4DRXE 3FTUA 5LCWC 2DZOA 3B13A 3ZXPA 4FHJA 3FU0A 4F1PA 2V4HC 2ZU6B 2Y3AA 4ILIA 1SW6A 3EHRA 3HXEA 2X6IA 2V5FA 1H2VC 1O1RA 4LSZE 5FWQA 2WB2A 4I2ZA 1H19A 4A55A 4GCOA 5ENTD 3JUIA 4DX7D 3CV0A 2L0TB 2AVPA 1ZBPA 4HOUA 2LXMA 5JMND 4MBGA 4YDWA 3MZLB 2ZGGA 4GZ5A 2HYZA 3ZW3A 2GRPB 1MJ0A 2XPIA 3IXEA 1N0RA 3L16A 2BTDA 3AJIA 2YINA 5D66A 3MKQB 2A5UA 2UY1A 4H7YA 2IO3C 5IY5E 1IQUA 5HS0A 4HFGA 3L6AA 4Z68A 2H6IA 2MHKA 3UM1A 1G3NB 4N3BA 2YHEA 3DSXA 3MX3A 3FU6A 3BQOA 4DI4A 5JJ6A 5M72A 3ZIMA 4WAFA 4FA6A 2C0MA 5JHBA 2IO2C 3UINC 2XZTG 3EIJA 4GTQA 3TWXA 1UW4B 1O5MA 1JPLA 3MEKA 4TV3A 2R05A 3V31A 1PC2A 4K0RA 3RKVA 4ACLA 1Z3YA 5FJYA 3SFXA 3T9KA 3CQGB 4WNDA 2IOSA 2RFAA 3FTYA 1TNUA 1S0PA 4JW1A 4UQYA 3TXNA 5FIOA 2HM8A 3UM3A 4DLOA 5CCMA 4YNDA 1TN6A 5BUZA 4N5CA 3JQ0A 4GAAA 4HBDA 5LCWJ 5AJLA 4C9BB 3NZUA 3APDA 3IV0A 5T8IA 4U0SA 2IFUA 4G1TA 1TYQG 3OXLA 4U07A 2I1JA 2KZTB 2WXJA 1E90A 1UOHA 3ABME 1HG2A 1O1TA 1WDYA 2HE0A 5FT9A 3U4TA 3V2XA 1V55E 3F6QA 3LVRE 5AQAA 2ETAA 3DWLG 3QARA 5D0OD 4NURA 1S63A 3ESKA 4ACKA 4TXQA 2LAHA 3APCA 4PDXA 1FCHA 3L22A 4LERA 4EZLA 3Q49B 1HG5A 2VTBB 3KS2A 5BT1A 4GTMA 1OWPA 3RRUA 5JHAA 3R9AB 3LVQE 1K8KG 4B8AA 4JD2G 3CVQA 5G04J 3ASHA 2V0PA 1E7UA 4HRNA 4I6EA 3QNKA 5FZRA 3RU0A 4ATGA 4LNBA 3TWSA 3FULA 3FTXA 4PS8A 2CHXA 4BT8A 4I2WA 3TL5A 3UMVA 5LP0A 2NXPA 5EX0A 2LNIA 2XS8A 1N4RA 3UX4A 5CMYA 3U9WA 3CVWA 4FHKA 3ABKE 3TWUA 5CBOA 4I9EA 5D2MC 3C5RA 2F8XK 1DCEA 2GRQB 5KNGA 3KD7A 3U66A 4GZ3A 1X5BA 4O60A 4F53A 3PNLB 3CSFA 3AG3E 1SVXA 2BKGA 2IQCA 3ISMC 1N94A 2V4LA 3OXGA 2VSOE 2PQRA 5AQ9A 1K1BA 2NSZA 2XCBA 3D9LA 3TG5A 1KZPA 4EBAG 4F3VA 3B95A 1OCCE 2EINE 1H2TC 3ZXSA 2L6BA 2IY0C 4V3IA 5FZSA 1DVPA 3PEUB 2J09A 4AXHA 2BKKB 5KJKA 1WM5A 1SZ9A 5A7DB 3FY4A 3U3WA 2WMNA 2Y1LE 3C98A 1H6PA 2J4DA 3QJZA 2QFCA 4FP7A 2LUHA 3G2WA 4DJAA 4XI9A 1EPUA 5ANRA 3PUJA 4B93B 2DIWA 5EDSA 4O6FA 2L0IA 5G2NA 3HXFA 4IULA 3QB2A 4G8LA 2J8SD 2CG2A 3E37A 3NQPA 3SGHA 5CCLA 2LO6A 3HRAA 1HO8A 1NFIE 2RG8A 4HOTA 2AJAA 3U64A 4KBQA 3TWWA 3CHSA 1NA0A 4L1BA 4TUMA 5CRUA 2ZGDA 3HXDA 4CT0A 3FTSA 4J8SA 2NYJA 1NL4A 3FEYA 2OVBA 4FJYA 4UI9C 3Q7FA 3VLEA 3D9MA 2FO1E 3PRZA
chains in the Genus database with same CATH topology
2VJ8A 4AOFA 5G05C 4I1OB 3ENEA 2V8SE 5DIZA 4UWLA 4FLBA 4NRHB 3VTYA 2WXLA 4EZJA 4U0ZA 4AP2A 3MKRA 1SZAA 3FUHA 2PL2A 4G2VA 3IHVA 3ONKA 1EF1C 4JPSA 3FTWA 3ZEFA 3G2SA 3TAXA 2JEKA 5ARFA 2I2OA 1WY6A 4G26A 3CHMA 4KT6B 4OYSA 4GMLA 3KAEA 3GZSA 3AS5A 4BT9A 4RG9A 4KYOB 5FQ6A 2XQ0A 4N3AA 3VTXA 4MKTA 3ML9A 2IJGX 2MOWA 3FDHA 3Q5MA 5D0QD 3QWPA 4UWHA 4XX5A 4DK5A 5AJDA 3RIBA 5BV1A 2VGYA 1ZU2A 2WXHA 2IU1A 4L2YA 5FQ7A 3FTUA 3ZRHA 5LCWC 3EDTB 2PZIA 3TG4A 4KVOA 3B13A 2PM6A 3AU5A 4GYOA 4FHJA 3FU0A 3GW4A 2Q7FA 2ZU6B 1UJJA 2Y3AA 3UT7A 4C0MA 1W3BA 4ILIA 3D9OA 4N2SA 3ZYLA 3ZN3A 1QZ2A 1DNPA 5HI7A 2X6IA 2MRIA 5ENNA 4JEUA 3GYZA 2ONDA 2V5FA 1H2VC 2BF0X 2WQHA 4XKBA 4HS2A 1YA0A 3FUKA 5FWQA 2WB2A 4YVQC 2JLBA 3IBEA 4I2ZA 4GA2A 4CDRA 4FC8A 3QC1A 1H19A 5AENA 4A55A 4I1AA 4JA7A 3P1UA 4GCOA 4WNGA 3JUIA 4BX9A 1UJKA 4G23A 5BW8C 3CV0A 2L0TB 5KJLA 4I6JA 2CFZA 2AVPA 2WM9A 3HIZA 1ZBPA 4KZ0A 5FQ8A 4HOUA 2GRMA 2I6HA 4WWOA 1U3DA 1L5JA 3JYSA 2R17C 3ASFA 4PS7A 3MZLB 4GZ5A 2HYZA 1FVFA 1B89A 3ZW3A 3R7RA 2VQ2A 3MJWA 3G2VA 4XIFA 2WQ7A 2UY1B 2XPIA 4ANVA 2XEVA 3FUDA 3QDNA 2E0IA 2WMOA 2R59A 3L16A 3LY8A 5FTPA 3OTNA 4A3TA 4GA0A 2BTDA 3TGOA 2YINA 3ZYKA 3FU3A 1A17A 3MKQB 3LPZA 2A5UA 2UY1A 4H7YA 3RO2A 3TJPA 3AS8A 5CMWA 4J0UA 5C2YA 2YNQA 3FTVA 2GW1A 4I17A 2BUGA 3ESLA 4AVXA 4FADA 2AWIA 3MKQA 1IQUA 1N54A 4HFGA 5LX8A 4QFVA 1EYHA 3EHMA 3L6AA 2FEZA 3AS4A 1OWLA 2RD0A 3FH5A 5JJTA 2KC7A 2MHKA 3MGBA 3IHYA 4N3BA 5G55A 2XGOA 3CQCB 3WXXA 1TJFA 2YHEA 2X3MA 5KJMA 3L08A 1NA3A 3MX3A 3FU6A 4GCNA 3PNTB 2J9QA 1JUQA 4XZ4A 4TUUA 3CHRA 2XGMA 4L23A 3ULQA 4DI4A 5JJ6A 3D9NA 4ILGA 2XCCA 4ANXA 4ANWA 5M72A 2WXQA 3ZIMA 3PREA 3CK7A 3N71A 4WAFA 4EPZA 2C0MA 4FA6A 5KJNA 1N52A 3UQ3A 2WXMA 3CKBA 2R5SA 3JCKC 4N3CA 2YHCA 5JHBA 4K03A 3ASGA 3EIJA 4NACA 3NF1A 4WWPA 5E75A 2CHZA 1INZA 3PS6A 1UW4B 1JPLA 4TRQA 3MEKA 4TV3A 4PH4B 3CGHA 4LRZA 5BPPA 3FUJA 4B8CB 1PC2A 4K0RA 4APOA 4Q69A 3UT4A 3FTZA 3RKVA 4UQZA 4ACLA 4APFA 4HXIA 4KXKB 4I1MA 4B89A 1Z3YA 4LUNU 1ELWA 3O48A 2DBAA 4OVUA 5JJ7A 1SQMA 5FJYA 4AY6A 3CQGB 1E8WA 4WNDA 2IOSA 4EQFA 4BY6A 4JEHA 3ZFWA 5LOZA 1HZ4A 3I4RB 3LKUA 5DBKA 2FO7A 3B7UX 3CKCA 4RG6A 1HH8A 2I9CA 1PY1A 3FTYA 4YVOA 4AIFA 4BX8A 1KT0A 1S0PA 4FULA 4DLQA 4JW1A 4JHKA 4UQYA 4L2LA 3TXNA 1IQRA 1ELRA 2HM8A 5CCMA 4JA9A 4DLOA 4FU3A 4YNDA 1JWGA 1OWOA 2VSNA 2FF4A 3FP3A 3IKOB 4L7TA 3EJNA 1HS6A 5BUZA 4F1SA 4BWRA 4N5CA 3LXUX 4JZYA 4CDNA 3CEQA 3OXFA 3JQ0A 4GAAA 5LCWJ 5AJLA 1P5QA 3CR3A 4IYPA 3HYMB 4UWGA 4IRUA 4C9BB 3NZUA 4HOQA 4R7LA 2J4BA 3APDA 3HDXA 2DCPA 3IV0A 4U8HA 2IOLA 1MHQA 4AEZC 3MV2B 4G25A 5T8IA 4WNFA 3L54A 1E8YA 1PAQA 2L9BA 4U0SA 2VSXE 2IFUA 4JHRA 2X6FA 4G1TA 2CFUA 4I9CA 3FUFA 1U3CA 3UT8A 4J8DA 5HQ8A 2P58C 3OXLA 3GZ2A 4U07A 4DPRA 2GGFA 4HORA 3PH0C 4UWKA 2I1JA 2KZTB 2X6JA 3QOUA 4N2QA 4CGWA 4JL0A 2WXJA 2WXKA 3T5VA 1E90A 2ILRA 2WPVA 3APFA 3I4GA 4EECA 1HG2A 4GMJA 3CK9A 4H7XA 2WXFA 2VGXB 3MV3B 3PDNA 2NC9A 2KZTA 2FI7A 1FVHA 1IHGA 2X6HA 2J08A 3FUIA 5FT9A 3U4TA 3LVRE 3ASDA 3K9IA 3QARA 1KLXA 2QY7A 4NURA 5D0OD 3UPVA 4G11A 2OVFA 3RJVA 2A4ZA 1WAO1 3I3NA 3EIQC 3ESKA 4I43A 2XRZA 3SZ7A 2FBNA 2AW6A 4ANUA 4ACKA 2LAHA 3APCA 4JHJA 4W9RA 5J90A 4GZ6A 3CHPA 3IEGA 4LCTA 3ZPJA 3B7SA 4PDXA 1UN9A 3CSTA 1HFAA 1FCHA 4AY5A 3L22A 3CIAA 4HLEA 3BEEA 1E7VA 3L13A 3D9JA 3PEVB 4LERA 3FH8A 2IF4A 3B7TA 3DPDA 5J08A 1E96B 4EZLA 4BFRA 4EBAA 3Q49B 1HG5A 2VTBB 3KS2A 2LSVA 2WXPA 3FHEA 2XHEA 3T5XA 3SHFA 5BT1A 3D9KA 3QWVA 3OAWA 2Y4TA 1OWPA 3RRUA 1GW6A 3URZA 3E4BA 3FUEA 2XPZA 4F7AA 3FH7A 5JHAA 3R9AB 3Q15A 3T8MA 1H6KA 4U04A 5E76A 4A1SA 5AIJA 2VTBA 2J49A 3LVQE 2UWJG 3RO3A 1HU3A 4UI9K 3SNXA 5G04J 3CVQA 2X6KA 3LYAA 4GYWA 3ZHEB 4B8AA 3ASHA 4CDMA 1KT1A 2V0PA 1E7UA 4NQ0A 4UWFA 4U63A 1OWMA 4I6EA 3Q4AB 4MRUA 3QNKA 5FZRA 3FU5A 4Y6CA 3RU0A 1BPOA 3D9PA 5ARGA 4PS3A 3CVPA 3CVLA 3KEZA 3LS8A 4ATGA 2L6JA 3G2TA 4GZDA 3ZHEA 3FULA 3FTXA 3BG1B 3RRMB 3PZDA 3CVVA 4CRWA 4PS8A 3MCXA 4UI9J 3NZSA 2CHXA 4BT8A 3LJ3A 4I2WA 4MLPA 3ML8A 1TJCA 3TL5A 3UMVA 5LP0A 2NXPA 4P29A 3SD5A 4GU5A 3LEWA 4XI0A 4B0ZA 5EX0A 2LNIA 2XGSA 5KCMA 4GA1A 3LY9A 4WNEA 2WQ6A 2KCLA 2AXUA 3CLJA 3HVEB 5CMYA 5G05J 3UX4A 3QAQA 1IYGA 2VSYA 4U0UA 3R7QA 1Y8MA 3ZVVA 3CK8A 2WXNA 4FLHA 3U9WA 3CVWA 1OWNA 2KCKA 4FHKA 3VLFA 4C0EA 3S2AA 3HVEA 3B7RL 4I9EA 4CT4A 2HR2A 5BNWA 5EKQD 1XNFA 3UUXA 2XRYA 3KD7A 5C1DA 4I6GA 3U66A 4GZ3A 3PUKA 4FJZA 3S7BA 1Z6TA 1X5BA 4F53A 3PNLB 3CSFA 3FFLA 1EDUA 2FULA 1HXIA 2IQCA 2HO1A 5ANLA 4XE0A 4KVMA 4PUCA 3FEXA 2V4LA 3OXGA 2KM4A 4J6IA 2VSOE 1H0AA 2PQRA 3FWVA 1ELKA 1HX8A 4GYYA 2NSZA 2XCBA 3D9LA 5CHEE 3CVNA 3TG5A 1NZNA 4UQXA 4EBAG 4F3VA 2GRLA 3G2UA 3JQ1A 3TXMA 3HHMA 2Y4UA 2E2EA 3D3MA 1VDYA 1H2TC 3ZXSA 3S7DA 4V3IA 2AXVA 5FQ4A 5FZSA 1TEZA 1DVPA 3PEUB 2J09A 2X38A 1LF8A 3QWWA 4CCAA 4AXHA 4BTBA 2VYIA 3CVUA 1QQEA 4GZCA 5KJKA 3MA5A 4ILHB 4JC8A 3CHQA 3PE3A 3L17A 1H2UA 1E8ZA 1WM5A 2LAIA 1SZ9A 2EQXA 3FY4A 5A7DB 3SFZA 5BV0A 3U3WA 2CHWA 4Y6WA 3SBSA 2WMNA 2WXGA 4EZKA 5EX3A 3C98A 5T4YA 4ME2A 5T3RA 4URKA 2J4DA 5A23A 4D10C 3QJZA 4CGVA 3RRNB 2QFCA 2OOEA 1UN8A 4FP7A 2VGXA 2WXIA 4A3VA 2LSUA 3GZ1A 3G2WA 4RVBA 2M63A 4DJAA 3O4ZA 4Q96A 1QNFA 1EPUA 4WUYA 4XI9A 5ANRA 5LFAA 3LCAA 3PE4A 1E8XA 3PUJA 4GB9A 3RK6A 2DIWA 4E85A 3QK0A 4WWNA 2XPYA 4Q94A 3Q47B 4KMOA 1OUVA 3SF4A 4KZCA 4BSXA 5EDSA 3D9IA 3FUMA 4IN3B 4O6FA 2PM7A 2OV8A 2PQNA 4AV7A 2L0IA 3QKYA 5G2NA 3ZYMA 4GPKA 3FUNA 2YQ8A 4IULA 5FZQA 1UG3A 4J8EA 3ZGQA 2J07A 3QB2A 3PVLA 3S7JA 4A1GA 3CHOA 2WVIA 4XKCA 2CG2A 3I5PA 2C2LA 4AM9A 3NQPA 3VLDA 3SGHA 5CCLA 2LO6A 4BTAA 2KATA 1HO8A 2RG8A 4B94A 4HOTA 4J8FA 4JXTA 3LY7A 3MYVA 2KCVA 5G04C 3CVXA 3U64A 2AXZA 3DBSA 3BG0B 4KBQA 3CHSA 4OVVA 1NA0A 4E6HA 4L1BA 1NP7A 1Z3XA 4CT0A 4LEUA 3SI5A 3SBTB 2CG3A 3FTSA 1XGWA 4J8SA 4CEMA 3CVYA 1Y6IA 4DI3A 1HF8A 1MQSA 3FEYA 2OVBA 2I1KA 4FJYA 2IONA 4RSYA 1JWFA 5AYWD 3P2BA 2WXRA 4G24A 4JVSA 4UI9C 4HVBA 4N39A 3ONLA 2C0LA 4M3OA 3AU4A 3VLEA 4MS6A 4AJWA 3D9MA 3LDZA 4ABNA 2WXOA 5A6CA 3EHNA 1HE8A 3PRZA 3ZYQA 4HOSA 3S7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G05 C;  5DIZ A;  4NRH B;  3VTY A;  4U0Z A;  3MKR A;  2PL2 A;  4G2V A;  3TAX A;  5ARF A;  4G26 A;  3KAE A;  3AS5 A;  4BT9 A;  4RG9 A;  4KYO B;  4N3A A;  3VTX A;  3Q5M A;  5D0Q D;  3QWP A;  3RIB A;  2VGY A;  1ZU2 A;  5LCW C;  3EDT B;  2PZI A;  3TG4 A;  4GYO A;  3GW4 A;  2Q7F A;  1W3B A;  4N2S A;  3ZN3 A;  1QZ2 A;  5HI7 A;  3GYZ A;  2OND A;  2V5F A;  2WQH A;  1YA0 A;  4YVQ C;  2JLB A;  4I2Z A;  4GA2 A;  4CDR A;  4I1A A;  4JA7 A;  4GCO A;  4WNG A;  4G23 A;  5BW8 C;  3CV0 A;  5KJL A;  2AVP A;  1ZBP A;  4HOU A;  2I6H A;  3JYS A;  3ASF A;  4GZ5 A;  2HYZ A;  1B89 A;  2VQ2 A;  4XIF A;  2UY1 B;  2XPI A;  2XEV A;  3QDN A;  3LY8 A;  5FTP A;  4GA0 A;  3TGO A;  1A17 A;  3LPZ A;  2UY1 A;  4H7Y A;  3RO2 A;  3AS8 A;  4J0U A;  2GW1 A;  4I17 A;  2BUG A;  2FEZ A;  3AS4 A;  5JJT A;  2KC7 A;  2MHK A;  4N3B A;  2XGO A;  3WXX A;  5KJM A;  1NA3 A;  4GCN A;  2J9Q A;  2XGM A;  3ULQ A;  5JJ6 A;  5M72 A;  2XCC A;  3CK7 A;  3N71 A;  2C0M A;  5KJN A;  3UQ3 A;  3CKB A;  2R5S A;  4N3C A;  2YHC A;  3ASG A;  3NF1 A;  3MEK A;  1PC2 A;  4APO A;  3RKV A;  4UQZ A;  4KXK B;  1ELW A;  3O48 A;  2DBA A;  5JJ7 A;  5FJY A;  4AY6 A;  4WND A;  4EQF A;  3ZFW A;  1HZ4 A;  3LKU A;  5DBK A;  2FO7 A;  3CKC A;  4RG6 A;  4YVO A;  1HH8 A;  4AIF A;  1KT0 A;  4UQY A;  1ELR A;  5CCM A;  4JA9 A;  4YND A;  2VSN A;  3FP3 A;  2FF4 A;  4BWR A;  4N5C A;  3CEQ A;  3OXF A;  5LCW J;  1P5Q A;  3HYM B;  4HOQ A;  3MV2 B;  4G25 A;  4WNF A;  4U0S A;  2IFU A;  4JHR A;  4G1T A;  4I9C A;  4J8D A;  5HQ8 A;  2P58 C;  3OXL A;  3GZ2 A;  4U07 A;  4HOR A;  3QOU A;  4N2Q A;  4CGW A;  4JL0 A;  2WPV A;  3CK9 A;  4H7X A;  2VGX B;  3MV3 B;  3PDN A;  2NC9 A;  2FI7 A;  1IHG A;  5FT9 A;  3U4T A;  3ASD A;  3K9I A;  1KLX A;  5D0O D;  3UPV A;  3RJV A;  1WAO 1;  3ESK A;  3SZ7 A;  2FBN A;  4W9R A;  4GZ6 A;  3IEG A;  3ZPJ A;  1FCH A;  4AY5 A;  3BEE A;  2IF4 A;  1E96 B;  3Q49 B;  3KS2 A;  2LSV A;  5BT1 A;  3QWV A;  2Y4T A;  3URZ A;  3E4B A;  3R9A B;  3Q15 A;  4U04 A;  4A1S A;  2UWJ G;  3RO3 A;  4UI9 K;  5G04 J;  3CVQ A;  3LYA A;  4GYW A;  3ZHE B;  3ASH A;  1KT1 A;  4NQ0 A;  3Q4A B;  5FZR A;  4Y6C A;  3RU0 A;  5ARG A;  3CVP A;  3CVL A;  2L6J A;  3ZHE A;  4UI9 J;  4BT8 A;  4I2W A;  1TJC A;  4XI0 A;  5EX0 A;  2LNI A;  2XGS A;  4GA1 A;  3LY9 A;  4WNE A;  2KCL A;  1IYG A;  5G05 J;  2VSY A;  4U0U A;  1Y8M A;  3CK8 A;  2KCK A;  4I9E A;  2HR2 A;  5BNW A;  5EKQ D;  1XNF A;  3UUX A;  3KD7 A;  5C1D A;  4GZ3 A;  3S7B A;  3FFL A;  1HXI A;  2HO1 A;  3OXG A;  2PQR A;  3FWV A;  4GYY A;  2XCB A;  5CHE E;  3CVN A;  3TG5 A;  1NZN A;  4UQX A;  4F3V A;  2Y4U A;  2E2E A;  3S7D A;  5FZS A;  3QWW A;  4BTB A;  2VYI A;  1QQE A;  5KJK A;  3MA5 A;  3PE3 A;  1WM5 A;  5A7D B;  3U3W A;  4Y6W A;  5EX3 A;  4ME2 A;  4CGV A;  2QFC A;  2OOE A;  2VGX A;  2LSU A;  3GZ1 A;  4XI9 A;  4WUY A;  3LCA A;  3PE4 A;  3Q47 B;  1OUV A;  3SF4 A;  4IN3 B;  4O6F A;  2PQN A;  3QKY A;  4GPK A;  5FZQ A;  2YQ8 A;  4J8E A;  3ZGQ A;  3S7J A;  2C2L A;  4AM9 A;  5CCL A;  4BTA A;  2KAT A;  4B94 A;  4HOT A;  4J8F A;  3LY7 A;  2KCV A;  5G04 C;  4KBQ A;  1NA0 A;  4LEU A;  5AYW D;  4G24 A;  4UI9 C;  4N39 A;  2C0L A;  4ABN A;  5A6C A;  4HOS A;  3S7F A; 
#chains in the Genus database with same CATH topology
 4AOF A;  4I1O B;  4UWL A;  4FLB A;  1TNY A;  5ENO D;  2PL2 A;  3IHV A;  3ONK A;  3TWT A;  3ZEF A;  4L9P A;  5ARF A;  3AAA C;  3ABL E;  1WY6 A;  1AWC B;  4G26 A;  2ZIS A;  3CHM A;  3AS5 A;  4BT9 A;  1ZB1 A;  3ML9 A;  3QWP A;  4XX5 A;  3RIB A;  3DXM G;  5BV1 A;  4L2Y A;  2IU1 A;  4UUC A;  2PZI A;  3GW4 A;  4C0M A;  3UT7 A;  3D9O A;  3ZYL A;  5HI7 A;  2OND A;  4HS2 A;  2KXP C;  3DEP A;  4CDR A;  3QC1 A;  3BU8 A;  4I1A A;  4WNG A;  2A5E A;  4G23 A;  2QYU A;  2CFZ A;  3ZKJ A;  2GRM A;  4GMR A;  3JUE A;  1U3D A;  1B89 A;  3AG4 E;  5B1A E;  3R7R A;  2VQ2 A;  3MJW A;  1OCO E;  2UY1 B;  3QDN A;  2WMO A;  1SA4 A;  2R59 A;  5HKP A;  3OTN A;  4A3T A;  4M7C A;  3PZ2 A;  1OT8 A;  3DXK G;  3FU3 A;  1A17 A;  3LPZ A;  5CMW A;  4HRM B;  3ESL A;  4AVX A;  5AAR A;  4QFV A;  1EYH A;  3EHM A;  5KJM A;  3E30 A;  4GCN A;  2R02 A;  1JUQ A;  4XZ4 A;  4HNA D;  4TUU A;  3CHR A;  3NAW A;  3D9N A;  4X8Q A;  2WXQ A;  4EPZ A;  4YDO A;  2WXM A;  3JCK C;  3ASG A;  4WWP A;  5E75 A;  4EHM A;  4LRZ A;  5BPP A;  3FUJ A;  3UT4 A;  3V30 A;  1ELW A;  3O48 A;  2DBA A;  4AY6 A;  4EQF A;  5LOZ A;  3LKU A;  2FO7 A;  3B7U X;  3CKC A;  4YVO A;  1HH8 A;  4BX8 A;  1ELR A;  1Z5S C;  4BET A;  2RKK A;  4CDN A;  2P9I G;  1P5Q A;  4IYP A;  4UWG A;  1TNZ A;  4DUI A;  4R7L A;  4K5A B;  4AEZ C;  3EHQ A;  4QQI A;  3Q9N C;  4WNF A;  3UIO C;  1E8Y A;  1PAQ A;  2L9B A;  4HLL A;  1KPS B;  4JHR A;  2X6F A;  1U3C A;  3GZ2 A;  4UWK A;  2X6J A;  3QOU A;  4N2Q A;  2QC9 A;  3DSS A;  4JL0 A;  2WXK A;  2ILR A;  3CK9 A;  2WXF A;  3MV3 B;  1IHG A;  5CEC B;  2EIJ E;  3UPV A;  2DYS E;  4G11 A;  3I3N A;  5EIL A;  4ANU A;  5J90 A;  4GZ6 A;  3B7S A;  3CST A;  3CIA A;  3JXJ A;  1E7V A;  2IF4 A;  3DPD A;  5J08 A;  4EBA A;  2WXP A;  3D9K A;  1AP7 A;  3DPY A;  5EN5 D;  2V5Q C;  4F7A A;  1FPP A;  3FH7 A;  4U04 A;  1RZ4 A;  5AIJ A;  2GRN B;  2UWJ G;  2JAB A;  1KT1 A;  4U63 A;  3FU5 A;  3D9P A;  3KEZ A;  3CVL A;  3LS8 A;  4CYM D;  2L6J A;  3G2T A;  3ZHE A;  3CVV A;  3LJ3 A;  4MLP A;  3ML8 A;  3UXG A;  4B0Z A;  5KCM A;  4GA1 A;  2KCL A;  1IYG A;  2GRO B;  2VSY A;  1N0Q A;  3CK8 A;  5KWD A;  4FLH A;  4C0E A;  3HVE A;  4CT4 A;  2XEE A;  5EKQ D;  3UUX A;  1H6O A;  4HB5 A;  2FUL A;  1JCR A;  2HO1 A;  4XE0 A;  1D8D A;  3J5P A;  4J6I A;  3FWV A;  1HX8 A;  4GYY A;  5CHE E;  3CVN A;  4U95 D;  3G2U A;  3TXM A;  3D3M A;  3S7D A;  5FQ4 A;  3QWW A;  5CER B;  1QQE A;  1TN8 A;  5AN8 A;  3PE3 A;  1H2U A;  3SFZ A;  1IKN D;  2CHW A;  4Y6W A;  3SBS A;  4EZK A;  5T4Y A;  3V2O A;  4URK A;  3Q78 A;  1X81 A;  4CGV A;  4U8Y D;  3RRN B;  1S70 B;  2LSU A;  3SFY A;  3SO8 A;  4J7W A;  1QNF A;  4WUY A;  4E85 A;  4WWN A;  3Q47 B;  4KZC A;  3FUM A;  3QKY A;  5KBA A;  4YDY A;  3Q7A A;  4GPK A;  5FZQ A;  2PNN A;  3WG7 E;  3CHO A;  4XKC A;  3I5P A;  2C2L A;  3V79 K;  3VLD A;  4ZHB A;  4JXT A;  3LY7 A;  2KCV A;  2P9N G;  4TXR A;  3CVX A;  3DBS A;  3AG2 E;  5ENQ D;  4C48 B;  3DSV A;  4K5C A;  4CEM A;  1Y6I A;  5AYW D;  5EYL A;  4N39 A;  2LXL A;  2C0L A;  4M3O A;  3AU4 A;  4AJW A;  2Y0B G;  3EHN A;  2VJ8 A;  5G05 C;  1LTX A;  3KSL A;  5DIZ A;  1S64 A;  3TWV A;  1NI1 A;  4GTV A;  3MKR A;  1SZA A;  2JEK A;  2I2O A;  4OYS A;  4GML A;  3KAE A;  4RG9 A;  3VTX A;  4MKT A;  2IJG X;  2MOW A;  3FDH A;  4UWH A;  5AJD A;  4HQD A;  2WXH A;  1ZU2 A;  5FQ7 A;  3ZRH A;  1YCS B;  3TG4 A;  4GTT A;  2PM6 A;  3AU5 A;  4HRL A;  2DVW A;  5H7P A;  2EIM E;  4HI9 A;  3ZN3 A;  1QZ2 A;  1DNP A;  5ENN A;  2MRI A;  4JEU A;  2WQH A;  3LJN A;  2BF0 X;  1YA0 A;  4YVQ C;  4GA2 A;  4FC8 A;  5AEN A;  4JA7 A;  3P1U A;  1UJK A;  5BW8 C;  5KJL A;  3HIZ A;  4KZ0 A;  4WWO A;  1L5J A;  4U7E B;  3ASF A;  1A5E A;  2IEJ A;  1BLX B;  4XIF A;  3L82 A;  2E0I A;  3LY8 A;  5FTP A;  4GA0 A;  3W9F A;  2DZN A;  3RO2 A;  4GTO A;  2GRR B;  3TJP A;  3AS8 A;  1FT2 A;  5C2Y A;  2R2L A;  2BUG A;  4I17 A;  4NIK A;  4FAD A;  3X2Q E;  3E34 A;  2FEZ A;  1OWL A;  2RD0 A;  3FH5 A;  5JJT A;  3MGB A;  5G55 A;  2XGO A;  3ULY A;  4N5Q A;  2X3M A;  1NA3 A;  3PNT B;  2F37 A;  2XGM A;  3ULQ A;  5BXO A;  4ILG A;  2XCC A;  4ANX A;  3EU5 A;  3PRE A;  3N71 A;  3UQ3 A;  3CKB A;  2R5S A;  1N4P A;  4NAC A;  1INZ A;  3PS6 A;  3DSU A;  4DX2 A;  1U2V G;  3FTZ A;  4UQZ A;  4HXI A;  4B89 A;  5AAO A;  4GTR A;  5JJ7 A;  1SQM A;  2P9U G;  5EYP F;  4OAV B;  2F0Y A;  4BY6 A;  4JEH A;  3ZFW A;  1HZ4 A;  3I4R B;  1OXJ A;  5DBK A;  1OCR E;  1BI8 B;  4RG6 A;  2I9C A;  4FUL A;  1IQR A;  3C72 A;  1TN7 A;  1JWG A;  4L7T A;  2FF4 A;  4F6R D;  3OXF A;  3CR3 A;  3HYM B;  2J4B A;  2DCP A;  5JA4 D;  4U8V D;  4U8H A;  2H6H A;  4G25 A;  3DST A;  5ENR D;  2VSX E;  4YDE A;  3TWR A;  4GPM A;  4I9C A;  4O1O A;  4J8D A;  5HQ8 A;  2P58 C;  4DPR A;  2GGF A;  5KNH D;  4CGW A;  4DX5 D;  5AQ7 A;  2WPV A;  3T5V A;  4GMJ A;  4H7X A;  3PZ4 A;  2VGX B;  3PDN A;  2NC9 A;  3HXB A;  5CED B;  1FVH A;  2J08 A;  3FUI A;  4BEP A;  3ASD A;  1YMP A;  3K9I A;  3UTM A;  1MX2 A;  2QY7 A;  3RJV A;  3EIQ C;  4I43 A;  2XRZ A;  2AW6 A;  3JXI A;  4LCT A;  3ZPJ A;  4O1P A;  1UN9 A;  1HFA A;  4HLE A;  3BEE A;  3D9J A;  3SQV A;  1E96 B;  3NB2 A;  3Q9U C;  1MZC A;  2XHE A;  3E32 A;  2Y4T A;  1FT1 A;  1GW6 A;  3FUE A;  3T8M A;  1H6K A;  3HXC A;  2J49 A;  4UI9 K;  3SNX A;  3LYA A;  3ZHE B;  4CDM A;  3T8K A;  4NQ0 A;  4UWF A;  3L9T A;  3Q4A B;  4MRU A;  4Y6C A;  4PS3 A;  1JCS A;  3RRM B;  3PZD A;  4UI9 J;  3NZS A;  1TJC A;  3SD5 A;  4GU5 A;  3LEW A;  1N11 A;  2XGS A;  3LY9 A;  2WQ6 A;  2AXU A;  3HVE B;  4ZFH A;  3ZVV A;  1Q2Z A;  1OWN A;  3VLF A;  3B7R L;  2F8Y A;  1MX4 A;  1K1A A;  1XNF A;  5C1D A;  4I6G A;  2XEH A;  3PUK A;  3S7B A;  3Q75 A;  1EDU A;  3TWQ A;  5HRY A;  1TNO A;  2KM4 A;  2QZA A;  1ELK A;  1NZN A;  3HHM A;  2E2E A;  2AXV A;  1TEZ A;  3ZU7 B;  4BTB A;  2P9S G;  4ILH B;  3NOG D;  4LNG A;  3L17 A;  1E8Z A;  2EQX A;  2QYJ A;  4U96 D;  2WXG A;  5EX3 A;  4ME2 A;  2KBX A;  5A23 A;  4D10 C;  3W9G A;  1UN8 A;  4DX6 D;  2VGX A;  3RSE G;  2XS1 A;  3ASN E;  4RVB A;  2M63 A;  3O4Z A;  4Q96 A;  3LCA A;  1E8X A;  4GB9 A;  2ETB A;  2OCC E;  3QK0 A;  5CEA A;  4Q94 A;  1OUV A;  1O1S A;  3E33 A;  4IN3 B;  2PM7 A;  2OV8 A;  2H6G A;  4AV7 A;  1BU9 A;  2OEV A;  4J8E A;  2DYR E;  3S7J A;  4OAU C;  1LD7 A;  4AM9 A;  1N4Q A;  3C3O A;  4BTA A;  2KAT A;  4A63 B;  3NOC D;  4CZ2 D;  1V54 E;  5G04 C;  2AXZ A;  1TR4 A;  3BG0 B;  4E6H A;  4GTP A;  3J5Q B;  1NP7 A;  3SI5 A;  3SBT B;  3CVY A;  1XGW A;  1BI7 B;  1HF8 A;  1MQS A;  2I1K A;  4RSY A;  2ION A;  2WXR A;  3ONL A;  2WXO A;  3ZYQ A;  4HOS A;  3S7F A;  3ENE A;  4NRH B;  2ZXW E;  4AP2 A;  3FUH A;  4G2V A;  1EF1 C;  4JPS A;  3FTW A;  3G2S A;  3TAX A;  3SY2 A;  4KT6 B;  3ASO E;  1QYM A;  4G8K A;  2XQ0 A;  4RLY A;  2Y69 E;  5AQB A;  3DRA A;  2EIL E;  2VGY A;  4TXP A;  3EDT B;  4KVO A;  5ENS D;  4GYO A;  2Q7F A;  1UJJ A;  1W3B A;  4N2S A;  2XZD G;  3GYZ A;  4XKB A;  3FUK A;  2JLB A;  3IBE A;  4BX9 A;  4I6J A;  2WM9 A;  5FQ8 A;  4BER A;  1D9S A;  2I6H A;  3JYS A;  2R17 C;  4PS7 A;  1FVF A;  2ETC A;  2P9L G;  3G2V A;  2WQ7 A;  4ANV A;  2XEV A;  3FUD A;  1TNB A;  3TGO A;  3ZYK A;  3RAU A;  4J0U A;  2YNQ A;  3FTV A;  2GW1 A;  5B3S E;  2AWI A;  3MKQ A;  1N54 A;  5LX8 A;  3AS4 A;  2KC7 A;  3UKR G;  3IHY A;  3CQC B;  3WXX A;  1TJF A;  3L08 A;  2J9Q A;  3PZ1 A;  4L23 A;  1IHB A;  4ANW A;  4HI8 A;  3CK7 A;  2ZIR A;  5KJN A;  2P9K G;  1N52 A;  4N3C A;  2YHC A;  4K03 A;  3NF1 A;  2CHZ A;  3DEO A;  3AG1 E;  2VGE A;  5CRV A;  4TRQ A;  4K5B A;  4PH4 B;  3CGH A;  4B8C B;  4APO A;  3Q79 A;  4Q69 A;  4BES A;  1LD8 A;  4APF A;  4KXK B;  4I1M A;  4LUN U;  4OVU A;  1E8W A;  1KZO A;  5EID A;  1JCQ A;  5B1B E;  4AIF A;  1PY1 A;  1KT0 A;  4DLQ A;  4XEI G;  4JHK A;  4L2L A;  4JA9 A;  4FU3 A;  1WG0 A;  1OWO A;  2VSN A;  3FP3 A;  3IKO B;  3EJN A;  3B7B A;  1HS6 A;  4F1S A;  4BWR A;  3LXU X;  4JZY A;  3CEQ A;  1OY3 D;  1RW2 A;  4IRU A;  1N4S A;  4HOQ A;  3HDX A;  2IOL A;  1MHQ A;  3MV2 B;  3EUV A;  2RFM A;  3L54 A;  4JB8 P;  2CFU A;  3FUF A;  3BUA A;  3UT8 A;  3UM2 A;  4HOR A;  3PH0 C;  3C3Q A;  4EEC A;  3APF A;  3I4G A;  5BXU A;  2BED A;  3UI2 A;  2KZT A;  1QBQ A;  2DWZ A;  2FI7 A;  2X6H A;  1KLX A;  3KSQ A;  3ULE G;  2OVF A;  2A4Z A;  1WAO 1;  3SZ7 A;  2FBN A;  2OEW A;  1K3Z D;  4JHJ A;  4W9R A;  1N95 A;  3CHP A;  3IEG A;  4AY5 A;  1MX6 A;  3L13 A;  3PEV B;  1N9A A;  3FH8 A;  3B7T A;  3ZUV B;  4BFR A;  1SA5 A;  2LSV A;  3FHE A;  3R9M A;  3SHF A;  3T5X A;  3QWV A;  3OAW A;  2R03 A;  3URZ A;  3E4B A;  2XPZ A;  3Q15 A;  5E76 A;  4A1S A;  2VTB A;  4LNU D;  3RO3 A;  1HU3 A;  2X6K A;  4GYW A;  4LG6 A;  3D9H A;  1OWM A;  1BPO A;  5ARG A;  3CVP A;  4GZD A;  3BG1 B;  4CRW A;  3MCX A;  3KEA A;  3Q73 A;  2H6F A;  4P29 A;  4XI0 A;  4WNE A;  3CLJ A;  5G05 J;  3QAQ A;  4U0U A;  3R7Q A;  1Y8M A;  4J8Y A;  2WXN A;  2KCK A;  5EIB E;  2B0O E;  1IXV A;  3S2A A;  2HR2 A;  4ATZ D;  5BNW A;  2XRY A;  4FJZ A;  1Z6T A;  1YYH A;  3FFL A;  1HXI A;  5ANL A;  4KVM A;  4PUC A;  3FEX A;  1BD8 A;  5FIN A;  1H0A A;  4UQX A;  2GRL A;  3JQ1 A;  2Y4U A;  2B6C A;  1VDY A;  3C3R A;  3DSW A;  1MYO A;  2MYO A;  2X38 A;  1LF8 A;  4CCA A;  2VYI A;  3CVU A;  4GZC A;  3MA5 A;  4JC8 A;  3CHQ A;  2LAI A;  5BV0 A;  5T3R A;  2OOE A;  2WXI A;  4A3V A;  3GZ1 A;  5LFA A;  1OCZ E;  3EU9 A;  3PE4 A;  3RK6 A;  1DC2 A;  2XPY A;  4BSZ B;  4KMO A;  3SF4 A;  4BSX A;  3ZNG A;  1DCQ A;  3D9I A;  5ENP D;  4RQI A;  2PQN A;  3ZYM A;  3FUN A;  2YQ8 A;  1UG3 A;  3ZGQ A;  2J07 A;  3PVL A;  4A1G A;  2WVI A;  3UIP C;  4DX1 A;  4B94 A;  3NBN B;  4J8F A;  3MYV A;  5ITZ F;  4OVV A;  1Z3X A;  4LEU A;  2CG3 A;  1D8E A;  4DI3 A;  3HG0 D;  1JWF A;  2XEN A;  3P2B A;  4G24 A;  4JVS A;  4HVB A;  4MS6 A;  3LDZ A;  4ABN A;  5A6C A;  1HE8 A;  4GTS A;  5CBN A;  2V8S E;  3PZ3 A;  3VTY A;  2WXL A;  4EZJ A;  4U0Z A;  3UM0 A;  3GZS A;  2P9P G;  4KYO B;  5FQ6 A;  2P2C P;  4N3A A;  3UKU G;  2EIK E;  3Q5M A;  5D0Q D;  4DK5 A;  4DRX E;  3FTU A;  5LCW C;  2DZO A;  3B13 A;  3ZXP A;  4FHJ A;  3FU0 A;  4F1P A;  2V4H C;  2ZU6 B;  2Y3A A;  4ILI A;  1SW6 A;  3EHR A;  3HXE A;  2X6I A;  2V5F A;  1H2V C;  1O1R A;  4LSZ E;  5FWQ A;  2WB2 A;  4I2Z A;  1H19 A;  4A55 A;  4GCO A;  5ENT D;  3JUI A;  4DX7 D;  3CV0 A;  2L0T B;  2AVP A;  1ZBP A;  4HOU A;  2LXM A;  5JMN D;  4MBG A;  4YDW A;  3MZL B;  2ZGG A;  4GZ5 A;  2HYZ A;  3ZW3 A;  2GRP B;  1MJ0 A;  2XPI A;  3IXE A;  1N0R A;  3L16 A;  2BTD A;  3AJI A;  2YIN A;  5D66 A;  3MKQ B;  2A5U A;  2UY1 A;  4H7Y A;  2IO3 C;  5IY5 E;  1IQU A;  5HS0 A;  4HFG A;  3L6A A;  4Z68 A;  2H6I A;  2MHK A;  3UM1 A;  1G3N B;  4N3B A;  2YHE A;  3DSX A;  3MX3 A;  3FU6 A;  3BQO A;  4DI4 A;  5JJ6 A;  5M72 A;  3ZIM A;  4WAF A;  4FA6 A;  2C0M A;  5JHB A;  2IO2 C;  3UIN C;  2XZT G;  3EIJ A;  4GTQ A;  3TWX A;  1UW4 B;  1O5M A;  1JPL A;  3MEK A;  4TV3 A;  2R05 A;  3V31 A;  1PC2 A;  4K0R A;  3RKV A;  4ACL A;  1Z3Y A;  5FJY A;  3SFX A;  3T9K A;  3CQG B;  4WND A;  2IOS A;  2RFA A;  3FTY A;  1TNU A;  1S0P A;  4JW1 A;  4UQY A;  3TXN A;  5FIO A;  2HM8 A;  3UM3 A;  4DLO A;  5CCM A;  4YND A;  1TN6 A;  5BUZ A;  4N5C A;  3JQ0 A;  4GAA A;  4HBD A;  5LCW J;  5AJL A;  4C9B B;  3NZU A;  3APD A;  3IV0 A;  5T8I A;  4U0S A;  2IFU A;  4G1T A;  1TYQ G;  3OXL A;  4U07 A;  2I1J A;  2KZT B;  2WXJ A;  1E90 A;  1UOH A;  3ABM E;  1HG2 A;  1O1T A;  1WDY A;  2HE0 A;  5FT9 A;  3U4T A;  3V2X A;  1V55 E;  3F6Q A;  3LVR E;  5AQA A;  2ETA A;  3DWL G;  3QAR A;  5D0O D;  4NUR A;  1S63 A;  3ESK A;  4ACK A;  4TXQ A;  2LAH A;  3APC A;  4PDX A;  1FCH A;  3L22 A;  4LER A;  4EZL A;  3Q49 B;  1HG5 A;  2VTB B;  3KS2 A;  5BT1 A;  4GTM A;  1OWP A;  3RRU A;  5JHA A;  3R9A B;  3LVQ E;  1K8K G;  4B8A A;  4JD2 G;  3CVQ A;  5G04 J;  3ASH A;  2V0P A;  1E7U A;  4HRN A;  4I6E A;  3QNK A;  5FZR A;  3RU0 A;  4ATG A;  4LNB A;  3TWS A;  3FUL A;  3FTX A;  4PS8 A;  2CHX A;  4BT8 A;  4I2W A;  3TL5 A;  3UMV A;  5LP0 A;  2NXP A;  5EX0 A;  2LNI A;  2XS8 A;  1N4R A;  3UX4 A;  5CMY A;  3U9W A;  3CVW A;  4FHK A;  3ABK E;  3TWU A;  5CBO A;  4I9E A;  5D2M C;  3C5R A;  2F8X K;  1DCE A;  2GRQ B;  5KNG A;  3KD7 A;  3U66 A;  4GZ3 A;  1X5B A;  4O60 A;  4F53 A;  3PNL B;  3CSF A;  3AG3 E;  1SVX A;  2BKG A;  2IQC A;  3ISM C;  1N94 A;  2V4L A;  3OXG A;  2VSO E;  2PQR A;  5AQ9 A;  1K1B A;  2NSZ A;  2XCB A;  3D9L A;  3TG5 A;  1KZP A;  4EBA G;  4F3V A;  3B95 A;  1OCC E;  2EIN E;  1H2T C;  3ZXS A;  2L6B A;  2IY0 C;  4V3I A;  5FZS A;  1DVP A;  3PEU B;  2J09 A;  4AXH A;  2BKK B;  5KJK A;  1WM5 A;  1SZ9 A;  5A7D B;  3FY4 A;  3U3W A;  2WMN A;  2Y1L E;  3C98 A;  1H6P A;  2J4D A;  3QJZ A;  2QFC A;  4FP7 A;  2LUH A;  3G2W A;  4DJA A;  4XI9 A;  1EPU A;  5ANR A;  3PUJ A;  4B93 B;  2DIW A;  5EDS A;  4O6F A;  2L0I A;  5G2N A;  3HXF A;  4IUL A;  3QB2 A;  4G8L A;  2J8S D;  2CG2 A;  3E37 A;  3NQP A;  3SGH A;  5CCL A;  2LO6 A;  3HRA A;  1HO8 A;  1NFI E;  2RG8 A;  4HOT A;  2AJA A;  3U64 A;  4KBQ A;  3TWW A;  3CHS A;  1NA0 A;  4L1B A;  4TUM A;  5CRU A;  2ZGD A;  3HXD A;  4CT0 A;  3FTS A;  4J8S A;  2NYJ A;  1NL4 A;  3FEY A;  2OVB A;  4FJY A;  4UI9 C;  3Q7F A;  3VLE A;  3D9M A;  2FO1 E;  3PRZ A; 
#chains in the Genus database with same CATH homology
 2VJ8 A;  4AOF A;  5G05 C;  4I1O B;  3ENE A;  2V8S E;  5DIZ A;  4UWL A;  4FLB A;  4NRH B;  3VTY A;  2WXL A;  4EZJ A;  4U0Z A;  4AP2 A;  3MKR A;  1SZA A;  3FUH A;  2PL2 A;  4G2V A;  3IHV A;  3ONK A;  1EF1 C;  4JPS A;  3FTW A;  3ZEF A;  3G2S A;  3TAX A;  2JEK A;  5ARF A;  2I2O A;  1WY6 A;  4G26 A;  3CHM A;  4KT6 B;  4OYS A;  4GML A;  3KAE A;  3GZS A;  3AS5 A;  4BT9 A;  4RG9 A;  4KYO B;  5FQ6 A;  2XQ0 A;  4N3A A;  3VTX A;  4MKT A;  3ML9 A;  2IJG X;  2MOW A;  3FDH A;  3Q5M A;  5D0Q D;  3QWP A;  4UWH A;  4XX5 A;  4DK5 A;  5AJD A;  3RIB A;  5BV1 A;  2VGY A;  1ZU2 A;  2WXH A;  2IU1 A;  4L2Y A;  5FQ7 A;  3FTU A;  3ZRH A;  5LCW C;  3EDT B;  2PZI A;  3TG4 A;  4KVO A;  3B13 A;  2PM6 A;  3AU5 A;  4GYO A;  4FHJ A;  3FU0 A;  3GW4 A;  2Q7F A;  2ZU6 B;  1UJJ A;  2Y3A A;  3UT7 A;  4C0M A;  1W3B A;  4ILI A;  3D9O A;  4N2S A;  3ZYL A;  3ZN3 A;  1QZ2 A;  1DNP A;  5HI7 A;  2X6I A;  2MRI A;  5ENN A;  4JEU A;  3GYZ A;  2OND A;  2V5F A;  1H2V C;  2BF0 X;  2WQH A;  4XKB A;  4HS2 A;  1YA0 A;  3FUK A;  5FWQ A;  2WB2 A;  4YVQ C;  2JLB A;  3IBE A;  4I2Z A;  4GA2 A;  4CDR A;  4FC8 A;  3QC1 A;  1H19 A;  5AEN A;  4A55 A;  4I1A A;  4JA7 A;  3P1U A;  4GCO A;  4WNG A;  3JUI A;  4BX9 A;  1UJK A;  4G23 A;  5BW8 C;  3CV0 A;  2L0T B;  5KJL A;  4I6J A;  2CFZ A;  2AVP A;  2WM9 A;  3HIZ A;  1ZBP A;  4KZ0 A;  5FQ8 A;  4HOU A;  2GRM A;  2I6H A;  4WWO A;  1U3D A;  1L5J A;  3JYS A;  2R17 C;  3ASF A;  4PS7 A;  3MZL B;  4GZ5 A;  2HYZ A;  1FVF A;  1B89 A;  3ZW3 A;  3R7R A;  2VQ2 A;  3MJW A;  3G2V A;  4XIF A;  2WQ7 A;  2UY1 B;  2XPI A;  4ANV A;  2XEV A;  3FUD A;  3QDN A;  2E0I A;  2WMO A;  2R59 A;  3L16 A;  3LY8 A;  5FTP A;  3OTN A;  4A3T A;  4GA0 A;  2BTD A;  3TGO A;  2YIN A;  3ZYK A;  3FU3 A;  1A17 A;  3MKQ B;  3LPZ A;  2A5U A;  2UY1 A;  4H7Y A;  3RO2 A;  3TJP A;  3AS8 A;  5CMW A;  4J0U A;  5C2Y A;  2YNQ A;  3FTV A;  2GW1 A;  4I17 A;  2BUG A;  3ESL A;  4AVX A;  4FAD A;  2AWI A;  3MKQ A;  1IQU A;  1N54 A;  4HFG A;  5LX8 A;  4QFV A;  1EYH A;  3EHM A;  3L6A A;  2FEZ A;  3AS4 A;  1OWL A;  2RD0 A;  3FH5 A;  5JJT A;  2KC7 A;  2MHK A;  3MGB A;  3IHY A;  4N3B A;  5G55 A;  2XGO A;  3CQC B;  3WXX A;  1TJF A;  2YHE A;  2X3M A;  5KJM A;  3L08 A;  1NA3 A;  3MX3 A;  3FU6 A;  4GCN A;  3PNT B;  2J9Q A;  1JUQ A;  4XZ4 A;  4TUU A;  3CHR A;  2XGM A;  4L23 A;  3ULQ A;  4DI4 A;  5JJ6 A;  3D9N A;  4ILG A;  2XCC A;  4ANX A;  4ANW A;  5M72 A;  2WXQ A;  3ZIM A;  3PRE A;  3CK7 A;  3N71 A;  4WAF A;  4EPZ A;  2C0M A;  4FA6 A;  5KJN A;  1N52 A;  3UQ3 A;  2WXM A;  3CKB A;  2R5S A;  3JCK C;  4N3C A;  2YHC A;  5JHB A;  4K03 A;  3ASG A;  3EIJ A;  4NAC A;  3NF1 A;  4WWP A;  5E75 A;  2CHZ A;  1INZ A;  3PS6 A;  1UW4 B;  1JPL A;  4TRQ A;  3MEK A;  4TV3 A;  4PH4 B;  3CGH A;  4LRZ A;  5BPP A;  3FUJ A;  4B8C B;  1PC2 A;  4K0R A;  4APO A;  4Q69 A;  3UT4 A;  3FTZ A;  3RKV A;  4UQZ A;  4ACL A;  4APF A;  4HXI A;  4KXK B;  4I1M A;  4B89 A;  1Z3Y A;  4LUN U;  1ELW A;  3O48 A;  2DBA A;  4OVU A;  5JJ7 A;  1SQM A;  5FJY A;  4AY6 A;  3CQG B;  1E8W A;  4WND A;  2IOS A;  4EQF A;  4BY6 A;  4JEH A;  3ZFW A;  5LOZ A;  1HZ4 A;  3I4R B;  3LKU A;  5DBK A;  2FO7 A;  3B7U X;  3CKC A;  4RG6 A;  1HH8 A;  2I9C A;  1PY1 A;  3FTY A;  4YVO A;  4AIF A;  4BX8 A;  1KT0 A;  1S0P A;  4FUL A;  4DLQ A;  4JW1 A;  4JHK A;  4UQY A;  4L2L A;  3TXN A;  1IQR A;  1ELR A;  2HM8 A;  5CCM A;  4JA9 A;  4DLO A;  4FU3 A;  4YND A;  1JWG A;  1OWO A;  2VSN A;  2FF4 A;  3FP3 A;  3IKO B;  4L7T A;  3EJN A;  1HS6 A;  5BUZ A;  4F1S A;  4BWR A;  4N5C A;  3LXU X;  4JZY A;  4CDN A;  3CEQ A;  3OXF A;  3JQ0 A;  4GAA A;  5LCW J;  5AJL A;  1P5Q A;  3CR3 A;  4IYP A;  3HYM B;  4UWG A;  4IRU A;  4C9B B;  3NZU A;  4HOQ A;  4R7L A;  2J4B A;  3APD A;  3HDX A;  2DCP A;  3IV0 A;  4U8H A;  2IOL A;  1MHQ A;  4AEZ C;  3MV2 B;  4G25 A;  5T8I A;  4WNF A;  3L54 A;  1E8Y A;  1PAQ A;  2L9B A;  4U0S A;  2VSX E;  2IFU A;  4JHR A;  2X6F A;  4G1T A;  2CFU A;  4I9C A;  3FUF A;  1U3C A;  3UT8 A;  4J8D A;  5HQ8 A;  2P58 C;  3OXL A;  3GZ2 A;  4U07 A;  4DPR A;  2GGF A;  4HOR A;  3PH0 C;  4UWK A;  2I1J A;  2KZT B;  2X6J A;  3QOU A;  4N2Q A;  4CGW A;  4JL0 A;  2WXJ A;  2WXK A;  3T5V A;  1E90 A;  2ILR A;  2WPV A;  3APF A;  3I4G A;  4EEC A;  1HG2 A;  4GMJ A;  3CK9 A;  4H7X A;  2WXF A;  2VGX B;  3MV3 B;  3PDN A;  2NC9 A;  2KZT A;  2FI7 A;  1FVH A;  1IHG A;  2X6H A;  2J08 A;  3FUI A;  5FT9 A;  3U4T A;  3LVR E;  3ASD A;  3K9I A;  3QAR A;  1KLX A;  2QY7 A;  4NUR A;  5D0O D;  3UPV A;  4G11 A;  2OVF A;  3RJV A;  2A4Z A;  1WAO 1;  3I3N A;  3EIQ C;  3ESK A;  4I43 A;  2XRZ A;  3SZ7 A;  2FBN A;  2AW6 A;  4ANU A;  4ACK A;  2LAH A;  3APC A;  4JHJ A;  4W9R A;  5J90 A;  4GZ6 A;  3CHP A;  3IEG A;  4LCT A;  3ZPJ A;  3B7S A;  4PDX A;  1UN9 A;  3CST A;  1HFA A;  1FCH A;  4AY5 A;  3L22 A;  3CIA A;  4HLE A;  3BEE A;  1E7V A;  3L13 A;  3D9J A;  3PEV B;  4LER A;  3FH8 A;  2IF4 A;  3B7T A;  3DPD A;  5J08 A;  1E96 B;  4EZL A;  4BFR A;  4EBA A;  3Q49 B;  1HG5 A;  2VTB B;  3KS2 A;  2LSV A;  2WXP A;  3FHE A;  2XHE A;  3T5X A;  3SHF A;  5BT1 A;  3D9K A;  3QWV A;  3OAW A;  2Y4T A;  1OWP A;  3RRU A;  1GW6 A;  3URZ A;  3E4B A;  3FUE A;  2XPZ A;  4F7A A;  3FH7 A;  5JHA A;  3R9A B;  3Q15 A;  3T8M A;  1H6K A;  4U04 A;  5E76 A;  4A1S A;  5AIJ A;  2VTB A;  2J49 A;  3LVQ E;  2UWJ G;  3RO3 A;  1HU3 A;  4UI9 K;  3SNX A;  5G04 J;  3CVQ A;  2X6K A;  3LYA A;  4GYW A;  3ZHE B;  4B8A A;  3ASH A;  4CDM A;  1KT1 A;  2V0P A;  1E7U A;  4NQ0 A;  4UWF A;  4U63 A;  1OWM A;  4I6E A;  3Q4A B;  4MRU A;  3QNK A;  5FZR A;  3FU5 A;  4Y6C A;  3RU0 A;  1BPO A;  3D9P A;  5ARG A;  4PS3 A;  3CVP A;  3CVL A;  3KEZ A;  3LS8 A;  4ATG A;  2L6J A;  3G2T A;  4GZD A;  3ZHE A;  3FUL A;  3FTX A;  3BG1 B;  3RRM B;  3PZD A;  3CVV A;  4CRW A;  4PS8 A;  3MCX A;  4UI9 J;  3NZS A;  2CHX A;  4BT8 A;  3LJ3 A;  4I2W A;  4MLP A;  3ML8 A;  1TJC A;  3TL5 A;  3UMV A;  5LP0 A;  2NXP A;  4P29 A;  3SD5 A;  4GU5 A;  3LEW A;  4XI0 A;  4B0Z A;  5EX0 A;  2LNI A;  2XGS A;  5KCM A;  4GA1 A;  3LY9 A;  4WNE A;  2WQ6 A;  2KCL A;  2AXU A;  3CLJ A;  3HVE B;  5CMY A;  5G05 J;  3UX4 A;  3QAQ A;  1IYG A;  2VSY A;  4U0U A;  3R7Q A;  1Y8M A;  3ZVV A;  3CK8 A;  2WXN A;  4FLH A;  3U9W A;  3CVW A;  1OWN A;  2KCK A;  4FHK A;  3VLF A;  4C0E A;  3S2A A;  3HVE A;  3B7R L;  4I9E A;  4CT4 A;  2HR2 A;  5BNW A;  5EKQ D;  1XNF A;  3UUX A;  2XRY A;  3KD7 A;  5C1D A;  4I6G A;  3U66 A;  4GZ3 A;  3PUK A;  4FJZ A;  3S7B A;  1Z6T A;  1X5B A;  4F53 A;  3PNL B;  3CSF A;  3FFL A;  1EDU A;  2FUL A;  1HXI A;  2IQC A;  2HO1 A;  5ANL A;  4XE0 A;  4KVM A;  4PUC A;  3FEX A;  2V4L A;  3OXG A;  2KM4 A;  4J6I A;  2VSO E;  1H0A A;  2PQR A;  3FWV A;  1ELK A;  1HX8 A;  4GYY A;  2NSZ A;  2XCB A;  3D9L A;  5CHE E;  3CVN A;  3TG5 A;  1NZN A;  4UQX A;  4EBA G;  4F3V A;  2GRL A;  3G2U A;  3JQ1 A;  3TXM A;  3HHM A;  2Y4U A;  2E2E A;  3D3M A;  1VDY A;  1H2T C;  3ZXS A;  3S7D A;  4V3I A;  2AXV A;  5FQ4 A;  5FZS A;  1TEZ A;  1DVP A;  3PEU B;  2J09 A;  2X38 A;  1LF8 A;  3QWW A;  4CCA A;  4AXH A;  4BTB A;  2VYI A;  3CVU A;  1QQE A;  4GZC A;  5KJK A;  3MA5 A;  4ILH B;  4JC8 A;  3CHQ A;  3PE3 A;  3L17 A;  1H2U A;  1E8Z A;  1WM5 A;  2LAI A;  1SZ9 A;  2EQX A;  3FY4 A;  5A7D B;  3SFZ A;  5BV0 A;  3U3W A;  2CHW A;  4Y6W A;  3SBS A;  2WMN A;  2WXG A;  4EZK A;  5EX3 A;  3C98 A;  5T4Y A;  4ME2 A;  5T3R A;  4URK A;  2J4D A;  5A23 A;  4D10 C;  3QJZ A;  4CGV A;  3RRN B;  2QFC A;  2OOE A;  1UN8 A;  4FP7 A;  2VGX A;  2WXI A;  4A3V A;  2LSU A;  3GZ1 A;  3G2W A;  4RVB A;  2M63 A;  4DJA A;  3O4Z A;  4Q96 A;  1QNF A;  1EPU A;  4WUY A;  4XI9 A;  5ANR A;  5LFA A;  3LCA A;  3PE4 A;  1E8X A;  3PUJ A;  4GB9 A;  3RK6 A;  2DIW A;  4E85 A;  3QK0 A;  4WWN A;  2XPY A;  4Q94 A;  3Q47 B;  4KMO A;  1OUV A;  3SF4 A;  4KZC A;  4BSX A;  5EDS A;  3D9I A;  3FUM A;  4IN3 B;  4O6F A;  2PM7 A;  2OV8 A;  2PQN A;  4AV7 A;  2L0I A;  3QKY A;  5G2N A;  3ZYM A;  4GPK A;  3FUN A;  2YQ8 A;  4IUL A;  5FZQ A;  1UG3 A;  4J8E A;  3ZGQ A;  2J07 A;  3QB2 A;  3PVL A;  3S7J A;  4A1G A;  3CHO A;  2WVI A;  4XKC A;  2CG2 A;  3I5P A;  2C2L A;  4AM9 A;  3NQP A;  3VLD A;  3SGH A;  5CCL A;  2LO6 A;  4BTA A;  2KAT A;  1HO8 A;  2RG8 A;  4B94 A;  4HOT A;  4J8F A;  4JXT A;  3LY7 A;  3MYV A;  2KCV A;  5G04 C;  3CVX A;  3U64 A;  2AXZ A;  3DBS A;  3BG0 B;  4KBQ A;  3CHS A;  4OVV A;  1NA0 A;  4E6H A;  4L1B A;  1NP7 A;  1Z3X A;  4CT0 A;  4LEU A;  3SI5 A;  3SBT B;  2CG3 A;  3FTS A;  1XGW A;  4J8S A;  4CEM A;  3CVY A;  1Y6I A;  4DI3 A;  1HF8 A;  1MQS A;  3FEY A;  2OVB A;  2I1K A;  4FJY A;  2ION A;  4RSY A;  1JWF A;  5AYW D;  3P2B A;  2WXR A;  4G24 A;  4JVS A;  4UI9 C;  4HVB A;  4N39 A;  3ONL A;  2C0L A;  4M3O A;  3AU4 A;  3VLE A;  4MS6 A;  4AJW A;  3D9M A;  3LDZ A;  4ABN A;  2WXO A;  5A6C A;  3EHN A;  1HE8 A;  3PRZ A;  3ZYQ A;  4HOS A;  3S7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...