1TJCA

Crystal structure of peptide-substrate-binding domain of human type i collagen prolyl 4-hydroxylase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
95
structure length
95
Chain Sequence
MFLTAEDSFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Peptide-Substrate-binding Domain of Collagen Prolyl 4-Hydroxylases Is a Tetratricopeptide Repeat Domain with Functional Aromatic Residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Prolyl 4-hydroxylase alpha-1 subunit
total genus 40
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature ec 1.14.11.2: Procollagen-proline 4-dioxygenase.
pdb deposition date 2004-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1tjcA00
2C0LA 4ME2A 3OXLA 4HOTA 2Q7FA 4J8DA 5DIZA 4J8EA 5EKQD 3KAEA 2WPVA 3AS4A 4J0UA 3AS5A 3E4BA 4I9CA 3RU0A 4B94A 4GPKA 2DBAA 3SF4A 1P5QA 4RG6A 4AY5A 4N5CA 4O6FA 2BUGA 2UY1B 1HH8A 2C2LA 2J9QA 4I2ZA 2PZIA 5ARFA 2Y4UA 3ASFA 2L6JA 4G26A 4H7YA 1QQEA 5FZRA 4HOSA 4XIFA 2KATA 3EDTB 1FCHA 3HYMB 3O48A 3KS2A 3UPVA 1KLXA 3RO3A 3OXGA 4UQYA 3S7JA 2PQNA 5JJTA 5FZQA 4GZ6A 5BT1A 4Y6CA 5D0QD 2PQRA 2WQHA 4GCNA 3ASHA 4U0SA 5DBKA 2VYIA 3TGOA 3CK7A 2FBNA 4WNFA 3KD7A 1WM5A 2FO7A 2I6HA 4Y6WA 3ZHEA 5CCMA 4CDRA 2XEVA 1B89A 3Q47B 4BWRA 2LSVA 2IFUA 2HYZA 2KC7A 4N3AA 5D0OD 3QWWA 3ESKA 5EX0A 5KJMA 3LY9A 2QFCA 4N2SA 2LNIA 4H7XA 4BTBA 4XI0A 3PDNA 4A1SA 3GYZA 4W9RA 1WAO1 3GZ2A 3Q15A 5EX3A 5BW8C 3RKVA 3LY8A 5LCWC 3BEEA 1W3BA 2VSNA 4G2VA 4LEUA 1ZBPA 3OXFA 4YVQC 3RIBA 3WXXA 3ZGQA 5LCWJ 2YHCA 2UY1A 4NQ0A 2OOEA 3LYAA 5HI7A 4CGVA 1XNFA 2XPIA 4WUYA 1TJCA 3RJVA 4U04A 3RO2A 2VSYA 4U07A 3CVPA 3IEGA 2AVPA 4KBQA 3S7BA 3ASDA 4U0ZA 2E2EA 2HO1A 4NRHB 1KT0A 3ULQA 3TAXA 2YQ8A 4HORA 5AYWD 2XGOA 2FF4A 3VTXA 4WNGA 5CCLA 2VGYA 1NZNA 4G23A 3ZN3A 5A6CA 5HQ8A 1NA3A 2C0MA 4XI9A 3Q4AB 1A17A 3LKUA 4YNDA 5JJ7A 4HOQA 4G24A 4CGWA 3QKYA 1ELWA 4JA7A 4G1TA 5BNWA 3LY7A 4APOA 4YVOA 1YA0A 3JYSA 4WNDA 2XCBA 5KJNA 3CK9A 4BT8A 4BT9A 3CVLA 4JHRA 5C1DA 3MEKA 4I2WA 3FFLA 4I9EA 1E96B 4GYOA 3LPZA 3ASGA 1KT1A 3S7FA 1HXIA 5JJ6A 4U0UA 4GYWA 4RG9A 4N39A 1ELRA 3MV2B 4WNEA 2IF4A 1IHGA 3CKCA 3U3WA 3UUXA 4UI9J 4EQFA 2FEZA 1PC2A 3PE4A 2NC9A 2VGXA 3MA5A 4GZ3A 4BTAA 3K9IA 3LCAA 5FJYA 4GYYA 1OUVA 3Q49B 5FT9A 3S7DA 4IN3B 2JLBA 3QDNA 2UWJG 4UQZA 5ARGA 3U4TA 5FTPA 2ONDA 4HOUA 3ZHEB 3FWVA 4JA9A 1ZU2A 3URZA 3TG5A 3VTYA 4GZ5A 2V5FA 2VQ2A 3MV3B 3ZPJA 3QOUA 4N3CA 1QZ2A 5KJLA 4UI9K 5M72A 3GW4A 2FI7A 4I1AA 2KCLA 3Q5MA 2VGXB 4J8FA 4UQXA 3SZ7A 4AM9A 4N2QA 2HR2A 3FP3A 3CVNA 1NA0A 2KCKA 1Y8MA 3AS8A 3CEQA 3CK8A 3GZ1A 4G25A 4N3BA 5G05J 5G05C 3R9AB 3TG4A 4ABNA 2R5SA 2P58C 4KXKB 2XGMA 5CHEE 2Y4TA 4AY6A 3CKBA 3QWVA 4UI9C 3UQ3A 5FZSA 4GA1A 3NF1A 4KYOB 5KJKA 2XGSA 3CVQA 1HZ4A 3QWPA 2MHKA 4GA0A 2LSUA 3PE3A 4GCOA 5G04J 4AIFA 3ZFWA 4GA2A 3MKRA 4F3VA 5G04C 5A7DB 1IYGA 2GW1A 2KCVA 3CV0A 4JL0A 3N71A 4I17A 2XCCA 2PL2A
chains in the Genus database with same CATH superfamily
3OXLA 4GTVA 4O1OA 4FLHA 4RG6A 3G2VA 2CFUA 1NFIE 4MBGA 4A3TA 2P9PG 3B7RL 4U63A 5DBKA 3DSTA 4YDWA 1ZB1A 2ZIRA 2I6HA 3CQCB 3PZ2A 1E7VA 2HYZA 3ESKA 1H6OA 1W3BA 2DYRE 3C98A 2QYUA 2P9KG 4M7CA 4HRMB 4GZDA 4B8CB 3FUHA 4FADA 2XGOA 1LD7A 4CCAA 4C48B 4XZ4A 1O1TA 5C1DA 3MEKA 2P9UG 2WXMA 3LEWA 2XZTG 3B7SA 3HRAA 3SGHA 2NSZA 4HOUA 1XGWA 1YYHA 3FUIA 4NACA 2QZAA 1TN7A 4RSYA 4HBDA 4U7EB 3U64A 1MHQA 2I9CA 3TWRA 3ZU7B 5T8IA 4GA0A 4CT0A 3EUVA 2RFAA 1YCSB 4AIFA 2J4BA 3I4RB 4OAVB 2IOSA 3JQ1A 3AG4E 3OAWA 2XS1A 3UMVA 3PZ4A 2P9NG 4AY5A 2LXLA 4JVSA 4O6FA 5ARFA 2R03A 2X6JA 4CEMA 1OWLA 4XIFA 1KLXA 1Z3XA 4PH4B 5AQBA 3Q79A 3D9NA 4GU5A 1V54E 4RQIA 2AWIA 1OCRE 1B89A 2J8SD 5EN5D 5EX0A 3LY9A 5CRVA 1WAO1 3GZ2A 4AXHA 5KJMA 4GMRA 4DPRA 3LYAA 1S63A 2AXVA 4GTTA 3NQPA 4NRHB 1SZAA 3Q75A 4BEPA 2BF0X 3CHRA 3RSEG 2V0PA 2IOLA 1JPLA 3NZUA 1MX4A 1ELWA 1OWOA 3FFLA 2WXKA 3MYVA 2IJGX 3LS8A 4TXQA 4WWNA 4WNEA 3MV2B 1D9SA 5BUZA 3MA5A 4OVUA 4GZ3A 1BI7B 3VLFA 4DLOA 3CVWA 5FTPA 5KBAA 4LNBA 3QARA 2VSOE 3CVNA 3KSLA 3EIJA 3SFZA 5FIOA 4ATZD 3FULA 4FU3A 3HVEA 3R7QA 3QWPA 1UN8A 2YINA 5G04J 2DIWA 5EYPF 1UOHA 1S64A 1OWMA 2L9BA 3AAAC 2J08A 3KAEA 1DNPA 4U96D 1SW6A 1MJ0A 2C2LA 1OWPA 3B7UX 2WXFA 3OXGA 2VGEA 4NURA 3TXNA 4FC8A 2VYIA 4C0EA 1O1RA 4WNFA 3KD7A 2KC7A 3QWWA 4BTBA 4A1SA 3GYZA 2VSNA 4G2VA 4J6IA 1ZBPA 2IY0C 4KBQA 3ASDA 2WXJA 3FDHA 3T5VA 4XX5A 4I43A 4ILIA 3PZ1A 4APOA 3TWSA 3ZIMA 3NBNB 1TN6A 1N0QA 4O1PA 3NAWA 2P2CP 2R2LA 1BU9A 4K5BA 3B7BA 3ZEFA 1IHGA 3U3WA 4PUCA 1OUVA 4G8KA 4O60A 3SBTB 3HXEA 3WG7E 3VTYA 3MGBA 3DSSA 1E8WA 1IHBA 3DXMG 5E76A 3IBEA 3FP3A 1NA0A 1SA5A 4DX6D 4GPMA 1Z5SC 1IKND 5FQ8A 3HIZA 1HS6A 3CHPA 3ZRHA 3AU4A 3LJNA 5HRYA 4ACKA 2XCCA 2PL2A 4GTSA 4WWOA 3DSWA 2M63A 3L08A 2WQ7A 4I2ZA 2V5QC 2H6FA 2X3MA 1H2TC 2KATA 5EYLA 3UPVA 3E37A 3E34A 4L2LA 1TNYA 3QNKA 4GCNA 1INZA 1K8KG 1EYHA 4B0ZA 5A23A 3LXUX 3ZHEA 2R59A 3TL5A 3PVLA 3L82A 1H19A 3AG1E 5JMND 1OWNA 4U8YD 5EX3A 1A5EA 2V4HC 4ABNA 4KT6B 2OOEA 5HI7A 4GMJA 2F0YA 4U07A 4TUMA 4IRUA 1K1AA 3KSQA 4AP2A 5T4YA 4K5AB 2LXMA 1Z3YA 1N4RA 4RG9A 3EHNA 1FT2A 4UI9J 5EIBE 3T9KA 1NI1A 2VTBB 4L1BA 2KCLA 2I1KA 4UQXA 3SY2A 2CHZA 3ONLA 2R5SA 2P58C 5CHEE 4V3IA 3UQ3A 4GA1A 2XGSA 4QQIA 4JW1A 5ENTD 3N71A 3HDXA 3ZHEB 5EKQD 4GPKA 2H6GA 2ZISA 2WMNA 3V2OA 4BESA 2J49A 5CMWA 4FULA 2UY1B 4DK5A 3CVXA 3UT4A 4DX2A 3U66A 4F1PA 2R17C 3W9GA 3G2WA 4EZJA 2FO7A 5ITZF 1KPSB 2X6FA 2OEVA 3JQ0A 1EDUA 3ULYA 1FVFA 2AW6A 4N3AA 3AJIA 4YVQC 2X6KA 2WXRA 3V30A 3RO2A 2VSYA 4JC8A 3CVPA 3IEGA 4JPSA 3TAXA 2L0IA 5EILA 3V79K 4LNGA 3LY7A 5D66A 4BSXA 3PUKA 5AENA 3DPDA 3C3QA 2EIKE 4XKBA 1HXIA 3CGHA 3FTYA 4N39A 4XKCA 3TWQA 5ENPD 2CHWA 2WXHA 5ENQD 5ENRD 4BTAA 5FQ6A 4C0MA 1HU3A 4MLPA 1JWGA 3TG5A 4BFRA 4I6GA 4BETA 5IY5E 1QZ2A 4B93B 3GW4A 3E30A 3PS6A 4FHJA 3UINC 2XQ0A 3JCKC 2GRQB 3L9TA 2Y4TA 3DBSA 3D9JA 4KVMA 2GROB 3CVVA 3ONKA 5CBOA 4RVBA 3DPYA 1JCSA 3ESLA 3UIPC 1IYGA 3MZLB 3D9LA 3HYMB 4ME2A 4J8EA 2WPVA 3D3MA 4EECA 2BUGA 4HOSA 2WXPA 3CIAA 2B0OE 5D0QD 5KNHD 2Y1LE 4U0SA 4Y6WA 5JHBA 3G2SA 3Q47B 3I3NA 4DI4A 1JCQA 2YHEA 2EILE 4HRLA 3PDNA 3C3RA 1MYOA 3PREA 5LCWC 3LJ3A 2EQXA 3SBSA 3DEOA 3UKUG 3UX4A 5KNGA 2E2EA 1HFAA 3PEUB 4GB9A 3ULQA 3UI2A 5AARA 1V55E 4RLYA 4G1TA 1Q2ZA 4KMOA 2WXGA 1E96B 3DSVA 3ASGA 1TNOA 4GYWA 2BEDA 3LCAA 3O4ZA 3D9HA 3QC1A 2ILRA 2VQ2A 3B95A 3APFA 3RAUA 3Q5MA 3BQOA 2GRMA 2HR2A 4CDMA 1H0AA 4JB8P 2DZOA 2PNNA 2OV8A 5KJKA 4GTOA 2WXQA 1QNFA 1DVPA 4J8DA 5DIZA 3AS5A 5BV1A 1N52A 4HI8A 2VTBA 5AQ7A 1MZCA 1KZOA 4A1GA 4ZFHA 3UTMA 5B3SE 5LP0A 4CYMD 4F6RD 5G2NA 5FINA 2UY1A 2WVIA 1DC2A 4N5QA 4EPZA 4YVOA 4Q94A 5KJNA 1S0PA 3EU5A 2H6HA 3S7FA 5JJ6A 3L17A 1UJKA 2NC9A 3UKRG 2ZXWE 4WAFA 3RRUA 3U4TA 4HQDA 1U3CA 2WB2A 1TNBA 3FEXA 5J08A 3JXIA 3UIOC 3TG4A 5CCLA 2LAIA 1N94A 4LUNU 1N4QA 4HS2A 3CVUA 4LSZE 3CVQA 4TV3A 4GTRA 4YDEA 2LSUA 4FP7A 3CV0A 5BXUA 3PH0C 3ZYMA 4YDYA 2IQCA 5ENSD 3E4BA 3PNLB 4I9CA 4TUUA 3FTZA 2Y3AA 3FUFA 3EDTB 3SD5A 3ZYQA 3KS2A 4FLBA 1G3NB 3V31A 5BT1A 5AIJA 1L5JA 4UWFA 1Z6TA 5G55A 4TRQA 2L0TB 3UXGA 2A4ZA 4PS7A 4LNUD 3PRZA 4GAAA 3C72A 1H2UA 2RD0A 2GRLA 3E33A 1SA4A 4NQ0A 4M3OA 4J7WA 1TJFA 3SFYA 1SVXA 4F1SA 2EINE 3DXKG 4EZLA 1KT0A 1BD8A 4WNGA 1TNZA 3LKUA 4LRZA 4U95D 2I1JA 2XCBA 1E90A 3ZKJA 2GGFA 3FHEA 4Q69A 4HXIA 1JUQA 4KVOA 4U0UA 4ZHBA 2IF4A 5CECB 3CKCA 2J07A 3P2BA 2VGXA 2R05A 5FJYA 3FU5A 2UWJG 3FWVA 4E85A 1E7UA 3MV3B 1EPUA 4GTPA 5AJDA 3TWTA 1HG2A 2XENA 5G05J 3I4GA 3IV0A 5FZSA 2WM9A 1OT8A 3MKRA 2KCVA 5CERB 4BX8A 3MCXA 2C0LA 2DCPA 1UG3A 3RU0A 1NL4A 2XPZA 3Q9UC 4GZCA 3ABME 4AEZC 2KBXA 3ASHA 4FHKA 4CDRA 2LUHA 4BWRA 3ZXSA 4UWKA 5FQ4A 2WXLA 3PZ3A 4ANWA 2BKGA 3HHMA 5BW8C 1TEZA 1XNFA 2XPIA 3FEYA 4XE0A 1JWFA 5CEDB 1BLXB 4UWLA 1D8EA 2HE0A 4BSZB 4L23A 3JUIA 2FULA 4P29A 1N54A 4LG6A 3JYSA 5FWQA 3IHVA 4URKA 3APDA 4Z68A 1S70B 2P9IG 1KT1A 2WXOA 3E32A 4TXRA 4R7LA 3UUXA 3PE4A 4BX9A 1TR4A 3QB2A 4IN3B 4UQZA 3L16A 3QK0A 4DRXE 4GZ5A 4HNAD 5H7PA 5AQAA 4I1AA 2DYSE 1LD8A 3ZYKA 2KCKA 3J5QB 4X8QA 3EHRA 4A55A 3ZW3A 3CKBA 2AXUA 1PAQA 3PE3A 1MQSA 2J4DA 1OY3D 5G04C 4I17A 1HO8A 4OVVA 3DSXA 2X6IA 4N5CA 1WDYA 3RRMB 2CG2A 1RW2A 1N0RA 3TXMA 3SNXA 2JABA 3TGOA 3LVRE 5CCMA 4GTMA 1ELKA 5CEAA 4XI0A 1LTXA 5JA4D 4KZCA 3BEEA 1H6KA 2YHCA 5JHAA 1WG0A 4ANUA 4ILGA 1TJCA 4FJZA 3SI5A 2ETBA 4JHKA 2J09A 2HO1A 4A3VA 1WY6A 1E8XA 4JHJA 4FA6A 3F6QA 4HOQA 2PM6A 5LFAA 4JHRA 3PUJA 4HB5A 2R02A 4EBAA 2F37A 2Y0BG 2XRZA 3ML8A 5FQ7A 5FT9A 3CQGB 2A5UA 5ARGA 3L22A 4DX5D 1ZU2A 3NOCD 1GW6A 1Y8MA 3KEAA 4L7TA 2RG8A 4TXPA 4YDOA 5BV0A 3PEVB 1D8DA 5KWDA 4PDXA 4KYOB 1X81A 5A7DB 3CLJA 2EIME 4HOTA 3FUMA 1VDYA 1Y6IA 4HRNA 4ILHB 1JCRA 3SF4A 4DX1A 1O5MA 1HH8A 2Y4UA 1QQEA 2NXPA 5BPPA 3L6AA 2WMOA 5JJTA 5FZQA 4GZ6A 3CHSA 4I6EA 2PQRA 2WQHA 3AG2E 4JD2G 4CZ2D 2VJ8A 3FUDA 1IXVA 3G2TA 4H7XA 1HG5A 2OCCE 3LY8A 3FY4A 3WXXA 4UWGA 4ANXA 5J90A 1EF1C 1LF8A 5B1BE 2KZTA 2YQ8A 3G2UA 5D2MC 1E8ZA 3T8MA 5HQ8A 3D9MA 4XI9A 4LCTA 3NZSA 3C5RA 3FTXA 4WNDA 3UM2A 3CK9A 4BT8A 4MKTA 2KZTB 4BT9A 3R7RA 2B6CA 4GYOA 4B8AA 2H6IA 3BG1B 4F7AA 4EQFA 1U3DA 2DWZA 1OCZE 3FTVA 4EZKA 2AJAA 5B1AE 4UI9K 3HXBA 2OVBA 4J8FA 4K03A 3KEZA 3R9AB 2XGMA 3FUNA 2VSXE 3FTSA 2PM7A 3ZFWA 4GA2A 3BG0B 1NP7A 2KM4A 3ZVVA 3S2AA 3AS4A 1K3ZD 2IU1A 2MOWA 4LERA 1RZ4A 3EJNA 3CSTA 3J5PA 2J9QA 2PZIA 4GMLA 1BI8B 3TWXA 2L6JA 3ASOE 2PQNA 3W9FA 2CG3A 1HE8A 3MX3A 3QJZA 2XZDG 5D0OD 5CBNA 3Q15A 3AG3E 2OEWA 2RKKA 3HG0D 3ZNGA 3HXCA 4OYSA 3ZYLA 4A63B 2CHXA 2FF4A 3ZN3A 1O1SA 2XHEA 3FU0A 1N11A 3Q7FA 3ULEG 2E0IA 4CT4A 3R9MA 3EU9A 2DZNA 3FH8A 4QFVA 4IULA 3Q49B 4HLLA 3URZA 3FTUA 4KZ0A 3SHFA 2V5FA 3ZPJA 2F8YA 5M72A 3VLDA 2VGXB 4AM9A 4WWPA 2KXPC 4N3BA 5G05C 1BPOA 4UI9C 3QWVA 3NF1A 1OCCE 4GCOA 2LO6A 3RK6A 5CMYA 4FJYA 3UM0A 4HI9A 1SQMA 3FH7A 2X6HA 1FVHA 3D9KA 3T5XA 4G26A 5FZRA 2XPYA 1FCHA 1N4SA 3DRAA 3V2XA 3TJPA 4UWHA 2ETCA 3TWWA 2FBNA 4MS6A 2I2OA 5E75A 3ISMC 4N2SA 1OXJA 1UJJA 4G11A 4ATGA 4LEUA 4CRWA 3D9OA 4C9BB 4CGVA 2V4LA 2LAHA 1HF8A 1UW4B 3S7BA 2A5EA 2AVPA 4U0ZA 4I1MA 4ANVA 3FTWA 3VTXA 1NZNA 2ETAA 5A6CA 4YNDA 2BTDA 5ANLA 4HLEA 1UN9A 1YA0A 3HXDA 4CDNA 2IO3C 1TYQG 3Q7AA 3EHMA 3LPZA 4U8VD 3I5PA 2FO1E 3PNTB 1QYMA 3B7TA 4AJWA 2FEZA 2IONA 3K9IA 2HM8A 4IYPA 3DEPA 3ZXPA 1N9AA 1N95A 2X38A 3P1UA 1H2VC 3CEQA 3CK8A 2ZGDA 3SFXA 4L2YA 1DCQA 1HZ4A 3U9WA 4G8LA 2EIJE 1YMPA 3Q78A 4EHMA 1KZPA 4J0UA 4DJAA 5BXOA 2OVFA 1P5QA 4GTQA 3T8KA 1QBQA 3L13A 3NB2A 3LVQE 2XRYA 3O48A 1H6PA 3HVEB 2XEHA 1TN8A 3EHQA 1N4PA 3FU3A 4XEIG 2LSVA 4NIKA 3DWLG 2IFUA 3FU6A 2MRIA 3IXEA 3RIBA 3TWVA 4J8YA 5ENOD 4E6HA 4K0RA 2Y69E 3PZDA 3DSUA 2MYOA 3Q4AB 1FPPA 4CGWA 3QKYA 5ANRA 3ZUVB 3UM1A 4I2WA 2ZU6B 3QAQA 1ELRA 2P9SG 1E8YA 2F8XK 5LOZA 2RFMA 5KJLA 4N2QA 4G25A 3RO3A 4I6JA 3FH5A 3JXJA 4PS3A 4AY6A 4D10C 2WXNA 4AOFA 1X5BA 4F3VA 3Q9NC 2QYJA 4JL0A 3UM3A 4BY6A 4DLQA 1OCOE 4B94A 2QY7A 4J8SA 4AVXA 4HFGA 3IHYA 3CHOA 4L9PA 5HKPA 3ASFA 1K1BA 4H7YA 3CVYA 4U8HA 3MKQA 3OTNA 4Y6CA 4JZYA 2V8SE 1MX6A 2XS8A 1WM5A 3ENEA 2XEVA 2WQ6A 3X2QE 5AQ9A 3EIQC 3MKQB 3CHMA 1IQUA 3ABLE 5AJLA 4APFA 4W9RA 3C3OA 5C2YA 3OXFA 5LCWJ 3Q73A 3UT8A 1AWCB 4ACLA 1FT1A 2BKKB 4WUYA 3RJVA 4HORA 3BU8A 5EIDA 2VGYA 4G23A 1NA3A 5JJ7A 3FUEA 2QC9A 2NYJA 4DI3A 3JUEA 3RRNB 3CVLA 4AV7A 4I9EA 3NOGD 3SQVA 3ASNE 1PC2A 1TNUA 4GYYA 3L54A 3S7DA 3QDNA 3CSFA 1IQRA 3HXFA 2XEEA 4JA9A 5HS0A 4F53A 1U2VG 3QOUA 4N3CA 3LDZA 3FUKA 3GZ1A 3AS8A 2GRNB 4KXKB 3SO8A 4BERA 3D9IA 4OAUC 2MHKA 3CHQA 2ZGGA 1DCEA 3ML9A 2Q7FA 5BNWA 4HVBA 5KCMA 3D9PA 2DBAA 1AP7A 3ABKE 4JEHA 4DX7D 2P9LG 5AAOA 5LX8A 5ENNA 4UUCA 4PS8A 4UQYA 3S7JA 1HX8A 1SZ9A 2IEJA 2YNQA 3B13A 5CRUA 3CK7A 1PY1A 2GRPB 3VLEA 2GRRB 2WXIA 2QFCA 2LNIA 5T3RA 3RKVA 3TWUA 4JXTA 3ZGQA 3MJWA 2DVWA 4U04A 5EDSA 4JEUA 5AYWD 4K5CA 2C0MA 2CFZA 1A17A 3GZSA 3UT7A 4G24A 4JA7A 3CR3A 5AN8A 3FUJA 3AU5A 2JEKA 4Q96A 4MRUA 4B89A 3IKOB 1MX2A 2JLBA 2ONDA 4I1OB 2AXZA 2FI7A 3SZ7A 3APCA 2IO2C 3BUAA 2L6BA 4EBAG 2GW1A 4DUIA
chains in the Genus database with same CATH topology
2C0LA 2DCPA 4FJYA 3OXLA 3HDXA 3ZHEB 5EKQD 4GPKA 1UG3A 3RU0A 1SQMA 3FH7A 2X6HA 2XPZA 2WMNA 4FLHA 4RG6A 2J49A 5CMWA 4FULA 2UY1B 1FVHA 3D9KA 3T5XA 4G26A 4DK5A 3CVXA 3G2VA 5FZRA 4GZCA 2XPYA 3UT4A 3U66A 1FCHA 2CFUA 2R17C 4A3TA 3TJPA 4AEZC 3B7RL 4UWHA 3G2WA 3ASHA 4EZJA 4U63A 5DBKA 2FBNA 4MS6A 2FO7A 2I2OA 2I6HA 2X6FA 4FHKA 4CDRA 3JQ0A 1EDUA 3CQCB 4BWRA 5E75A 1FVFA 1E7VA 2AW6A 2HYZA 3ZXSA 4N3AA 4UWKA 5FQ4A 3ESKA 2WXLA 4ANWA 4N2SA 1UJJA 4G11A 3HHMA 5BW8C 4YVQC 1W3BA 4ATGA 2X6KA 4LEUA 1TEZA 3C98A 2WXRA 4CRWA 3D9OA 4C9BB 1XNFA 2XPIA 4CGVA 2V4LA 2LAHA 3RO2A 1HF8A 2VSYA 3FEYA 4JC8A 1UW4B 3CVPA 3IEGA 2AVPA 4GZDA 4XE0A 4U0ZA 3S7BA 4B8CB 1JWFA 3FUHA 4I1MA 4ANVA 4FADA 4JPSA 3TAXA 3FTWA 4UWLA 2XGOA 3VTXA 2L0IA 4CCAA 1NZNA 5A6CA 4L23A 3JUIA 4YNDA 2BTDA 2FULA 4P29A 3LY7A 4XZ4A 5ANLA 1N54A 1UN9A 1YA0A 3JYSA 4BSXA 3PUKA 4CDNA 5AENA 5FWQA 3IHVA 3DPDA 4URKA 3APDA 3EHMA 5C1DA 3MEKA 3LPZA 2WXMA 4XKBA 1KT1A 2WXOA 3I5PA 1HXIA 3LEWA 3PNTB 3CGHA 3FTYA 4N39A 4XKCA 3B7TA 2CHWA 4R7LA 4AJWA 2WXHA 3UUXA 2FEZA 3B7SA 3PE4A 4BTAA 2IONA 5FQ6A 3K9IA 4BX9A 2HM8A 3QB2A 4C0MA 4IN3B 1HU3A 4UQZA 3SGHA 3L16A 4IYPA 2NSZA 4MLPA 4HOUA 1XGWA 1JWGA 3FUIA 3QK0A 4NACA 3TG5A 4GZ5A 4I6GA 4BFRA 2X38A 1QZ2A 3GW4A 4FHJA 3PS6A 4I1AA 4RSYA 2XQ0A 3P1UA 3JCKC 3ZYKA 1H2VC 2KCKA 3CEQA 3CK8A 3U64A 4A55A 1MHQA 2I9CA 4L2YA 3ZW3A 2Y4TA 3CKBA 3DBSA 3D9JA 2AXUA 1PAQA 4KVMA 3CVVA 1HZ4A 3ONKA 3U9WA 5T8IA 4GA0A 4CT0A 3PE3A 1MQSA 4RVBA 3ESLA 2J4DA 5G04C 1IYGA 3MZLB 4I17A 3D9LA 4AIFA 2J4BA 3I4RB 3HYMB 4ME2A 1HO8A 2IOSA 3JQ1A 4OVVA 4J8EA 2WPVA 4J0UA 3OAWA 4DJAA 3D3MA 2OVFA 3UMVA 1P5QA 2X6IA 4AY5A 4EECA 4N5CA 4JVSA 2BUGA 4O6FA 5ARFA 3RRMB 2CG2A 3L13A 2X6JA 4CEMA 3TXMA 4HOSA 1OWLA 4XIFA 3LVQE 2WXPA 2XRYA 3O48A 1KLXA 1Z3XA 3SNXA 4PH4B 3HVEB 3CIAA 5D0QD 4U0SA 3TGOA 3D9NA 4Y6WA 3LVRE 4GU5A 3FU3A 5CCMA 2AWIA 5JHBA 1B89A 3G2SA 3Q47B 2LSVA 2IFUA 1ELKA 3FU6A 3I3NA 4DI4A 5EX0A 2YHEA 3LY9A 2MRIA 4XI0A 3PDNA 1WAO1 3GZ2A 4AXHA 3PREA 5LCWC 4KZCA 3LJ3A 3BEEA 5KJMA 3RIBA 1H6KA 2EQXA 4DPRA 2YHCA 5JHAA 3LYAA 3SBSA 4ANUA 4ILGA 1TJCA 4FJZA 3SI5A 2AXVA 4JHKA 4E6HA 3UX4A 2J09A 3NQPA 2E2EA 4K0RA 2HO1A 4NRHB 4A3VA 1HFAA 3PEUB 4GB9A 1SZAA 3ULQA 3PZDA 1WY6A 1E8XA 2BF0X 4JHJA 3CHRA 4FA6A 2V0PA 2IOLA 3Q4AB 4HOQA 1JPLA 3NZUA 4CGWA 3QKYA 1ELWA 2PM6A 4G1TA 1OWOA 5ANRA 4KMOA 2WXGA 5LFAA 4JHRA 4I2WA 3FFLA 2WXKA 1E96B 2IJGX 3MYVA 3PUJA 3ASGA 3LS8A 4WWNA 2ZU6B 4EBAA 3QAQA 4GYWA 4WNEA 1ELRA 3MV2B 2XRZA 3ML8A 1E8YA 5BUZA 3MA5A 4OVUA 4GZ3A 3VLFA 3LCAA 3O4ZA 5FQ7A 5FT9A 3QC1A 3CQGB 2A5UA 5ARGA 4DLOA 3CVWA 3L22A 5FTPA 1ZU2A 5LOZA 2ILRA 2VQ2A 5KJLA 3APFA 3Q5MA 1GW6A 3QARA 4N2QA 2VSOE 2GRMA 2HR2A 3CVNA 4G25A 3RO3A 1Y8MA 4CDMA 4I6JA 1H0AA 4L7TA 3EIJA 3SFZA 2RG8A 3FH5A 5BV0A 3PEVB 4PS3A 2OV8A 4AY6A 4D10C 3FULA 2WXNA 4FU3A 4PDXA 3HVEA 4KYOB 5KJKA 3R7QA 4AOFA 3QWPA 1UN8A 1X5BA 2YINA 5G04J 2DIWA 2WXQA 4F3VA 1QNFA 5A7DB 3CLJA 4JL0A 1OWMA 2L9BA 2J08A 4BY6A 1DVPA 4J8DA 5DIZA 4DLQA 4HOTA 3KAEA 1DNPA 1VDYA 3FUMA 3AS5A 1Y6IA 4B94A 2QY7A 4ILHB 4J8SA 4AVXA 3SF4A 4HFGA 3IHYA 3CHOA 5BV1A 1N52A 2C2LA 1HH8A 1OWPA 2VTBA 2Y4UA 3ASFA 3B7UX 4H7YA 1QQEA 3CVYA 2NXPA 5BPPA 2WXFA 3OXGA 3L6AA 2WMOA 3MKQA 3OTNA 4U8HA 5FZQA 5JJTA 4GZ6A 3CHSA 4NURA 3TXNA 4A1GA 4FC8A 4Y6CA 4I6EA 4JZYA 2PQRA 2WQHA 2V8SE 2VYIA 4C0EA 4WNFA 3KD7A 1WM5A 3ENEA 5LP0A 2XEVA 2WQ6A 2VJ8A 3FUDA 2KC7A 3EIQC 3MKQB 3QWWA 3CHMA 5G2NA 1IQUA 5AJLA 3G2TA 4H7XA 1HG5A 4A1SA 4APFA 4BTBA 3GYZA 4W9RA 3LY8A 2VSNA 4G2VA 3FY4A 4J6IA 1ZBPA 3OXFA 5C2YA 3UT8A 3WXXA 5LCWJ 2UY1A 4UWGA 4ACLA 4ANXA 4WUYA 3RJVA 5J90A 4KBQA 1EF1C 1LF8A 2WVIA 3ASDA 2WXJA 2KZTA 2YQ8A 4HORA 3FDHA 3G2UA 3T5VA 4XX5A 1E8ZA 2VGYA 4G23A 3T8MA 5HQ8A 3D9MA 1NA3A 4I43A 4ILIA 4XI9A 5JJ7A 3FUEA 4EPZA 4LCTA 3NZSA 3FTXA 4APOA 4YVOA 4WNDA 4DI3A 4Q94A 5KJNA 3RRNB 3CK9A 4BT8A 4MKTA 2KZTB 3CVLA 3ZIMA 4BT9A 1S0PA 4AV7A 3R7RA 4I9EA 4GYOA 4HLEA 4B8AA 3S7FA 3BG1B 5JJ6A 3ZEFA 4F7AA 1IHGA 3U3WA 3L17A 4EQFA 1PC2A 4PUCA 1UJKA 2NC9A 1U3DA 4GYYA 1OUVA 4WAFA 3L54A 3RRUA 3S7DA 3QDNA 3U4TA 3CSFA 3FTVA 1U3CA 3SBTB 1IQRA 4JA9A 3VTYA 4EZKA 4F53A 3MGBA 3QOUA 1E8WA 2WB2A 4N3CA 3LDZA 4UI9K 5E76A 3FEXA 2OVBA 3IBEA 3FUKA 4J8FA 5J08A 4K03A 3FP3A 3KEZA 3GZ1A 1NA0A 3AS8A 3TG4A 5CCLA 3R9AB 2LAIA 4KXKB 2XGMA 4LUNU 5FQ8A 3HIZA 3FUNA 4HS2A 3CVUA 3D9IA 2VSXE 3CVQA 4TV3A 1HS6A 2MHKA 3FTSA 3CHPA 2LSUA 3ZRHA 3AU4A 2PM7A 3ZFWA 4FP7A 4GA2A 4ACKA 3CV0A 3BG0B 1NP7A 2KM4A 3CHQA 2XCCA 3PH0C 2PL2A 3ZYMA 3ZVVA 2IQCA 3ML9A 2Q7FA 4WWOA 3S2AA 5BNWA 4HVBA 5KCMA 3AS4A 3E4BA 2M63A 3PNLB 4I9CA 2IU1A 3D9PA 2DBAA 2MOWA 3L08A 2WQ7A 4JEHA 4LERA 3EJNA 3CSTA 4TUUA 5LX8A 2J9QA 4I2ZA 2PZIA 2X3MA 3FTZA 1H2TC 4GMLA 2L6JA 2Y3AA 3FUFA 2KATA 3EDTB 5ENNA 3SD5A 3ZYQA 3KS2A 4FLBA 3UPVA 4PS8A 4UQYA 3S7JA 2PQNA 1HX8A 5BT1A 1INZA 1SZ9A 3QNKA 1L5JA 4GCNA 4L2LA 5AIJA 1EYHA 2YNQA 3B13A 4B0ZA 5A23A 3CK7A 1PY1A 4UWFA 2CG3A 1Z6TA 3LXUX 5G55A 2R59A 3ZHEA 1HE8A 3MX3A 3QJZA 4TRQA 3TL5A 2L0TB 3PVLA 2A4ZA 5D0OD 4PS7A 1H19A 3VLEA 3PRZA 4GAAA 2WXIA 2QFCA 1OWNA 2LNIA 5T3RA 1H2UA 2RD0A 3Q15A 2GRLA 5EX3A 3RKVA 4JXTA 4ABNA 3ZGQA 3MJWA 4KT6B 2OOEA 4NQ0A 5HI7A 4GMJA 4M3OA 4OYSA 4U04A 5EDSA 4U07A 1TJFA 4JEUA 4F1SA 3ZYLA 4EZLA 1KT0A 4IRUA 2CHXA 5AYWD 2FF4A 4WNGA 3ZN3A 4AP2A 2C0MA 2CFZA 1A17A 3GZSA 3LKUA 3UT7A 5T4YA 4G24A 4LRZA 2XHEA 4JA7A 3CR3A 3FU0A 2I1JA 2XCBA 1Z3YA 1E90A 3FUJA 3AU5A 2JEKA 2GGFA 4Q96A 3FHEA 2E0IA 4MRUA 4Q69A 4B89A 4CT4A 4HXIA 1JUQA 4KVOA 4RG9A 4U0UA 2IF4A 3IKOB 3EHNA 3CKCA 2J07A 3P2BA 4UI9J 2VGXA 3FH8A 4QFVA 4IULA 5FJYA 3Q49B 3FU5A 2JLBA 2UWJG 2ONDA 3FWVA 4E85A 4I1OB 3URZA 1E7UA 3FTUA 4KZ0A 3SHFA 2AXZA 2V5FA 1EPUA 3MV3B 3ZPJA 2VTBB 4L1BA 5AJDA 5M72A 1HG2A 2FI7A 3VLDA 2KCLA 2I1KA 2VGXB 4UQXA 3SZ7A 4AM9A 3APCA 2CHZA 4WWPA 5G05J 3ONLA 4N3BA 5G05C 3I4GA 2R5SA 2P58C 5CHEE 1BPOA 4V3IA 3IV0A 4UI9C 3QWVA 3UQ3A 4EBAG 5FZSA 4GA1A 3NF1A 2XGSA 2WM9A 4GCOA 2LO6A 3RK6A 5CMYA 3MKRA 4JW1A 2GW1A 2KCVA 3N71A 4BX8A 3MCXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C0L A;  4ME2 A;  3OXL A;  4HOT A;  2Q7F A;  4J8D A;  5DIZ A;  4J8E A;  5EKQ D;  3KAE A;  2WPV A;  3AS4 A;  4J0U A;  3AS5 A;  3E4B A;  4I9C A;  3RU0 A;  4B94 A;  4GPK A;  2DBA A;  3SF4 A;  1P5Q A;  4RG6 A;  4AY5 A;  4N5C A;  4O6F A;  2BUG A;  2UY1 B;  1HH8 A;  2C2L A;  2J9Q A;  4I2Z A;  2PZI A;  5ARF A;  2Y4U A;  3ASF A;  2L6J A;  4G26 A;  4H7Y A;  1QQE A;  5FZR A;  4HOS A;  4XIF A;  2KAT A;  3EDT B;  1FCH A;  3HYM B;  3O48 A;  3KS2 A;  3UPV A;  1KLX A;  3RO3 A;  3OXG A;  4UQY A;  3S7J A;  2PQN A;  5JJT A;  5FZQ A;  4GZ6 A;  5BT1 A;  4Y6C A;  5D0Q D;  2PQR A;  2WQH A;  4GCN A;  3ASH A;  4U0S A;  5DBK A;  2VYI A;  3TGO A;  3CK7 A;  2FBN A;  4WNF A;  3KD7 A;  1WM5 A;  2FO7 A;  2I6H A;  4Y6W A;  3ZHE A;  5CCM A;  4CDR A;  2XEV A;  1B89 A;  3Q47 B;  4BWR A;  2LSV A;  2IFU A;  2HYZ A;  2KC7 A;  4N3A A;  5D0O D;  3QWW A;  3ESK A;  5EX0 A;  5KJM A;  3LY9 A;  2QFC A;  4N2S A;  2LNI A;  4H7X A;  4BTB A;  4XI0 A;  3PDN A;  4A1S A;  3GYZ A;  4W9R A;  1WAO 1;  3GZ2 A;  3Q15 A;  5EX3 A;  5BW8 C;  3RKV A;  3LY8 A;  5LCW C;  3BEE A;  1W3B A;  2VSN A;  4G2V A;  4LEU A;  1ZBP A;  3OXF A;  4YVQ C;  3RIB A;  3WXX A;  3ZGQ A;  5LCW J;  2YHC A;  2UY1 A;  4NQ0 A;  2OOE A;  3LYA A;  5HI7 A;  4CGV A;  1XNF A;  2XPI A;  4WUY A;  1TJC A;  3RJV A;  4U04 A;  3RO2 A;  2VSY A;  4U07 A;  3CVP A;  3IEG A;  2AVP A;  4KBQ A;  3S7B A;  3ASD A;  4U0Z A;  2E2E A;  2HO1 A;  4NRH B;  1KT0 A;  3ULQ A;  3TAX A;  2YQ8 A;  4HOR A;  5AYW D;  2XGO A;  2FF4 A;  3VTX A;  4WNG A;  5CCL A;  2VGY A;  1NZN A;  4G23 A;  3ZN3 A;  5A6C A;  5HQ8 A;  1NA3 A;  2C0M A;  4XI9 A;  3Q4A B;  1A17 A;  3LKU A;  4YND A;  5JJ7 A;  4HOQ A;  4G24 A;  4CGW A;  3QKY A;  1ELW A;  4JA7 A;  4G1T A;  5BNW A;  3LY7 A;  4APO A;  4YVO A;  1YA0 A;  3JYS A;  4WND A;  2XCB A;  5KJN A;  3CK9 A;  4BT8 A;  4BT9 A;  3CVL A;  4JHR A;  5C1D A;  3MEK A;  4I2W A;  3FFL A;  4I9E A;  1E96 B;  4GYO A;  3LPZ A;  3ASG A;  1KT1 A;  3S7F A;  1HXI A;  5JJ6 A;  4U0U A;  4GYW A;  4RG9 A;  4N39 A;  1ELR A;  3MV2 B;  4WNE A;  2IF4 A;  1IHG A;  3CKC A;  3U3W A;  3UUX A;  4UI9 J;  4EQF A;  2FEZ A;  1PC2 A;  3PE4 A;  2NC9 A;  2VGX A;  3MA5 A;  4GZ3 A;  4BTA A;  3K9I A;  3LCA A;  5FJY A;  4GYY A;  1OUV A;  3Q49 B;  5FT9 A;  3S7D A;  4IN3 B;  2JLB A;  3QDN A;  2UWJ G;  4UQZ A;  5ARG A;  3U4T A;  5FTP A;  2OND A;  4HOU A;  3ZHE B;  3FWV A;  4JA9 A;  1ZU2 A;  3URZ A;  3TG5 A;  3VTY A;  4GZ5 A;  2V5F A;  2VQ2 A;  3MV3 B;  3ZPJ A;  3QOU A;  4N3C A;  1QZ2 A;  5KJL A;  4UI9 K;  5M72 A;  3GW4 A;  2FI7 A;  4I1A A;  2KCL A;  3Q5M A;  2VGX B;  4J8F A;  4UQX A;  3SZ7 A;  4AM9 A;  4N2Q A;  2HR2 A;  3FP3 A;  3CVN A;  1NA0 A;  2KCK A;  1Y8M A;  3AS8 A;  3CEQ A;  3CK8 A;  3GZ1 A;  4G25 A;  4N3B A;  5G05 J;  5G05 C;  3R9A B;  3TG4 A;  4ABN A;  2R5S A;  2P58 C;  4KXK B;  2XGM A;  5CHE E;  2Y4T A;  4AY6 A;  3CKB A;  3QWV A;  4UI9 C;  3UQ3 A;  5FZS A;  4GA1 A;  3NF1 A;  4KYO B;  5KJK A;  2XGS A;  3CVQ A;  1HZ4 A;  3QWP A;  2MHK A;  4GA0 A;  2LSU A;  3PE3 A;  4GCO A;  5G04 J;  4AIF A;  3ZFW A;  4GA2 A;  3MKR A;  4F3V A;  5G04 C;  5A7D B;  1IYG A;  2GW1 A;  2KCV A;  3CV0 A;  4JL0 A;  3N71 A;  4I17 A;  2XCC A;  2PL2 A; 
#chains in the Genus database with same CATH topology
 3OXL A;  4GTV A;  4O1O A;  4FLH A;  4RG6 A;  3G2V A;  2CFU A;  1NFI E;  4MBG A;  4A3T A;  2P9P G;  3B7R L;  4U63 A;  5DBK A;  3DST A;  4YDW A;  1ZB1 A;  2ZIR A;  2I6H A;  3CQC B;  3PZ2 A;  1E7V A;  2HYZ A;  3ESK A;  1H6O A;  1W3B A;  2DYR E;  3C98 A;  2QYU A;  2P9K G;  4M7C A;  4HRM B;  4GZD A;  4B8C B;  3FUH A;  4FAD A;  2XGO A;  1LD7 A;  4CCA A;  4C48 B;  4XZ4 A;  1O1T A;  5C1D A;  3MEK A;  2P9U G;  2WXM A;  3LEW A;  2XZT G;  3B7S A;  3HRA A;  3SGH A;  2NSZ A;  4HOU A;  1XGW A;  1YYH A;  3FUI A;  4NAC A;  2QZA A;  1TN7 A;  4RSY A;  4HBD A;  4U7E B;  3U64 A;  1MHQ A;  2I9C A;  3TWR A;  3ZU7 B;  5T8I A;  4GA0 A;  4CT0 A;  3EUV A;  2RFA A;  1YCS B;  4AIF A;  2J4B A;  3I4R B;  4OAV B;  2IOS A;  3JQ1 A;  3AG4 E;  3OAW A;  2XS1 A;  3UMV A;  3PZ4 A;  2P9N G;  4AY5 A;  2LXL A;  4JVS A;  4O6F A;  5ARF A;  2R03 A;  2X6J A;  4CEM A;  1OWL A;  4XIF A;  1KLX A;  1Z3X A;  4PH4 B;  5AQB A;  3Q79 A;  3D9N A;  4GU5 A;  1V54 E;  4RQI A;  2AWI A;  1OCR E;  1B89 A;  2J8S D;  5EN5 D;  5EX0 A;  3LY9 A;  5CRV A;  1WAO 1;  3GZ2 A;  4AXH A;  5KJM A;  4GMR A;  4DPR A;  3LYA A;  1S63 A;  2AXV A;  4GTT A;  3NQP A;  4NRH B;  1SZA A;  3Q75 A;  4BEP A;  2BF0 X;  3CHR A;  3RSE G;  2V0P A;  2IOL A;  1JPL A;  3NZU A;  1MX4 A;  1ELW A;  1OWO A;  3FFL A;  2WXK A;  3MYV A;  2IJG X;  3LS8 A;  4TXQ A;  4WWN A;  4WNE A;  3MV2 B;  1D9S A;  5BUZ A;  3MA5 A;  4OVU A;  4GZ3 A;  1BI7 B;  3VLF A;  4DLO A;  3CVW A;  5FTP A;  5KBA A;  4LNB A;  3QAR A;  2VSO E;  3CVN A;  3KSL A;  3EIJ A;  3SFZ A;  5FIO A;  4ATZ D;  3FUL A;  4FU3 A;  3HVE A;  3R7Q A;  3QWP A;  1UN8 A;  2YIN A;  5G04 J;  2DIW A;  5EYP F;  1UOH A;  1S64 A;  1OWM A;  2L9B A;  3AAA C;  2J08 A;  3KAE A;  1DNP A;  4U96 D;  1SW6 A;  1MJ0 A;  2C2L A;  1OWP A;  3B7U X;  2WXF A;  3OXG A;  2VGE A;  4NUR A;  3TXN A;  4FC8 A;  2VYI A;  4C0E A;  1O1R A;  4WNF A;  3KD7 A;  2KC7 A;  3QWW A;  4BTB A;  4A1S A;  3GYZ A;  2VSN A;  4G2V A;  4J6I A;  1ZBP A;  2IY0 C;  4KBQ A;  3ASD A;  2WXJ A;  3FDH A;  3T5V A;  4XX5 A;  4I43 A;  4ILI A;  3PZ1 A;  4APO A;  3TWS A;  3ZIM A;  3NBN B;  1TN6 A;  1N0Q A;  4O1P A;  3NAW A;  2P2C P;  2R2L A;  1BU9 A;  4K5B A;  3B7B A;  3ZEF A;  1IHG A;  3U3W A;  4PUC A;  1OUV A;  4G8K A;  4O60 A;  3SBT B;  3HXE A;  3WG7 E;  3VTY A;  3MGB A;  3DSS A;  1E8W A;  1IHB A;  3DXM G;  5E76 A;  3IBE A;  3FP3 A;  1NA0 A;  1SA5 A;  4DX6 D;  4GPM A;  1Z5S C;  1IKN D;  5FQ8 A;  3HIZ A;  1HS6 A;  3CHP A;  3ZRH A;  3AU4 A;  3LJN A;  5HRY A;  4ACK A;  2XCC A;  2PL2 A;  4GTS A;  4WWO A;  3DSW A;  2M63 A;  3L08 A;  2WQ7 A;  4I2Z A;  2V5Q C;  2H6F A;  2X3M A;  1H2T C;  2KAT A;  5EYL A;  3UPV A;  3E37 A;  3E34 A;  4L2L A;  1TNY A;  3QNK A;  4GCN A;  1INZ A;  1K8K G;  1EYH A;  4B0Z A;  5A23 A;  3LXU X;  3ZHE A;  2R59 A;  3TL5 A;  3PVL A;  3L82 A;  1H19 A;  3AG1 E;  5JMN D;  1OWN A;  4U8Y D;  5EX3 A;  1A5E A;  2V4H C;  4ABN A;  4KT6 B;  2OOE A;  5HI7 A;  4GMJ A;  2F0Y A;  4U07 A;  4TUM A;  4IRU A;  1K1A A;  3KSQ A;  4AP2 A;  5T4Y A;  4K5A B;  2LXM A;  1Z3Y A;  1N4R A;  4RG9 A;  3EHN A;  1FT2 A;  4UI9 J;  5EIB E;  3T9K A;  1NI1 A;  2VTB B;  4L1B A;  2KCL A;  2I1K A;  4UQX A;  3SY2 A;  2CHZ A;  3ONL A;  2R5S A;  2P58 C;  5CHE E;  4V3I A;  3UQ3 A;  4GA1 A;  2XGS A;  4QQI A;  4JW1 A;  5ENT D;  3N71 A;  3HDX A;  3ZHE B;  5EKQ D;  4GPK A;  2H6G A;  2ZIS A;  2WMN A;  3V2O A;  4BES A;  2J49 A;  5CMW A;  4FUL A;  2UY1 B;  4DK5 A;  3CVX A;  3UT4 A;  4DX2 A;  3U66 A;  4F1P A;  2R17 C;  3W9G A;  3G2W A;  4EZJ A;  2FO7 A;  5ITZ F;  1KPS B;  2X6F A;  2OEV A;  3JQ0 A;  1EDU A;  3ULY A;  1FVF A;  2AW6 A;  4N3A A;  3AJI A;  4YVQ C;  2X6K A;  2WXR A;  3V30 A;  3RO2 A;  2VSY A;  4JC8 A;  3CVP A;  3IEG A;  4JPS A;  3TAX A;  2L0I A;  5EIL A;  3V79 K;  4LNG A;  3LY7 A;  5D66 A;  4BSX A;  3PUK A;  5AEN A;  3DPD A;  3C3Q A;  2EIK E;  4XKB A;  1HXI A;  3CGH A;  3FTY A;  4N39 A;  4XKC A;  3TWQ A;  5ENP D;  2CHW A;  2WXH A;  5ENQ D;  5ENR D;  4BTA A;  5FQ6 A;  4C0M A;  1HU3 A;  4MLP A;  1JWG A;  3TG5 A;  4BFR A;  4I6G A;  4BET A;  5IY5 E;  1QZ2 A;  4B93 B;  3GW4 A;  3E30 A;  3PS6 A;  4FHJ A;  3UIN C;  2XQ0 A;  3JCK C;  2GRQ B;  3L9T A;  2Y4T A;  3DBS A;  3D9J A;  4KVM A;  2GRO B;  3CVV A;  3ONK A;  5CBO A;  4RVB A;  3DPY A;  1JCS A;  3ESL A;  3UIP C;  1IYG A;  3MZL B;  3D9L A;  3HYM B;  4ME2 A;  4J8E A;  2WPV A;  3D3M A;  4EEC A;  2BUG A;  4HOS A;  2WXP A;  3CIA A;  2B0O E;  5D0Q D;  5KNH D;  2Y1L E;  4U0S A;  4Y6W A;  5JHB A;  3G2S A;  3Q47 B;  3I3N A;  4DI4 A;  1JCQ A;  2YHE A;  2EIL E;  4HRL A;  3PDN A;  3C3R A;  1MYO A;  3PRE A;  5LCW C;  3LJ3 A;  2EQX A;  3SBS A;  3DEO A;  3UKU G;  3UX4 A;  5KNG A;  2E2E A;  1HFA A;  3PEU B;  4GB9 A;  3ULQ A;  3UI2 A;  5AAR A;  1V55 E;  4RLY A;  4G1T A;  1Q2Z A;  4KMO A;  2WXG A;  1E96 B;  3DSV A;  3ASG A;  1TNO A;  4GYW A;  2BED A;  3LCA A;  3O4Z A;  3D9H A;  3QC1 A;  2ILR A;  2VQ2 A;  3B95 A;  3APF A;  3RAU A;  3Q5M A;  3BQO A;  2GRM A;  2HR2 A;  4CDM A;  1H0A A;  4JB8 P;  2DZO A;  2PNN A;  2OV8 A;  5KJK A;  4GTO A;  2WXQ A;  1QNF A;  1DVP A;  4J8D A;  5DIZ A;  3AS5 A;  5BV1 A;  1N52 A;  4HI8 A;  2VTB A;  5AQ7 A;  1MZC A;  1KZO A;  4A1G A;  4ZFH A;  3UTM A;  5B3S E;  5LP0 A;  4CYM D;  4F6R D;  5G2N A;  5FIN A;  2UY1 A;  2WVI A;  1DC2 A;  4N5Q A;  4EPZ A;  4YVO A;  4Q94 A;  5KJN A;  1S0P A;  3EU5 A;  2H6H A;  3S7F A;  5JJ6 A;  3L17 A;  1UJK A;  2NC9 A;  3UKR G;  2ZXW E;  4WAF A;  3RRU A;  3U4T A;  4HQD A;  1U3C A;  2WB2 A;  1TNB A;  3FEX A;  5J08 A;  3JXI A;  3UIO C;  3TG4 A;  5CCL A;  2LAI A;  1N94 A;  4LUN U;  1N4Q A;  4HS2 A;  3CVU A;  4LSZ E;  3CVQ A;  4TV3 A;  4GTR A;  4YDE A;  2LSU A;  4FP7 A;  3CV0 A;  5BXU A;  3PH0 C;  3ZYM A;  4YDY A;  2IQC A;  5ENS D;  3E4B A;  3PNL B;  4I9C A;  4TUU A;  3FTZ A;  2Y3A A;  3FUF A;  3EDT B;  3SD5 A;  3ZYQ A;  3KS2 A;  4FLB A;  1G3N B;  3V31 A;  5BT1 A;  5AIJ A;  1L5J A;  4UWF A;  1Z6T A;  5G55 A;  4TRQ A;  2L0T B;  3UXG A;  2A4Z A;  4PS7 A;  4LNU D;  3PRZ A;  4GAA A;  3C72 A;  1H2U A;  2RD0 A;  2GRL A;  3E33 A;  1SA4 A;  4NQ0 A;  4M3O A;  4J7W A;  1TJF A;  3SFY A;  1SVX A;  4F1S A;  2EIN E;  3DXK G;  4EZL A;  1KT0 A;  1BD8 A;  4WNG A;  1TNZ A;  3LKU A;  4LRZ A;  4U95 D;  2I1J A;  2XCB A;  1E90 A;  3ZKJ A;  2GGF A;  3FHE A;  4Q69 A;  4HXI A;  1JUQ A;  4KVO A;  4U0U A;  4ZHB A;  2IF4 A;  5CEC B;  3CKC A;  2J07 A;  3P2B A;  2VGX A;  2R05 A;  5FJY A;  3FU5 A;  2UWJ G;  3FWV A;  4E85 A;  1E7U A;  3MV3 B;  1EPU A;  4GTP A;  5AJD A;  3TWT A;  1HG2 A;  2XEN A;  5G05 J;  3I4G A;  3IV0 A;  5FZS A;  2WM9 A;  1OT8 A;  3MKR A;  2KCV A;  5CER B;  4BX8 A;  3MCX A;  2C0L A;  2DCP A;  1UG3 A;  3RU0 A;  1NL4 A;  2XPZ A;  3Q9U C;  4GZC A;  3ABM E;  4AEZ C;  2KBX A;  3ASH A;  4FHK A;  4CDR A;  2LUH A;  4BWR A;  3ZXS A;  4UWK A;  5FQ4 A;  2WXL A;  3PZ3 A;  4ANW A;  2BKG A;  3HHM A;  5BW8 C;  1TEZ A;  1XNF A;  2XPI A;  3FEY A;  4XE0 A;  1JWF A;  5CED B;  1BLX B;  4UWL A;  1D8E A;  2HE0 A;  4BSZ B;  4L23 A;  3JUI A;  2FUL A;  4P29 A;  1N54 A;  4LG6 A;  3JYS A;  5FWQ A;  3IHV A;  4URK A;  3APD A;  4Z68 A;  1S70 B;  2P9I G;  1KT1 A;  2WXO A;  3E32 A;  4TXR A;  4R7L A;  3UUX A;  3PE4 A;  4BX9 A;  1TR4 A;  3QB2 A;  4IN3 B;  4UQZ A;  3L16 A;  3QK0 A;  4DRX E;  4GZ5 A;  4HNA D;  5H7P A;  5AQA A;  4I1A A;  2DYS E;  1LD8 A;  3ZYK A;  2KCK A;  3J5Q B;  4X8Q A;  3EHR A;  4A55 A;  3ZW3 A;  3CKB A;  2AXU A;  1PAQ A;  3PE3 A;  1MQS A;  2J4D A;  1OY3 D;  5G04 C;  4I17 A;  1HO8 A;  4OVV A;  3DSX A;  2X6I A;  4N5C A;  1WDY A;  3RRM B;  2CG2 A;  1RW2 A;  1N0R A;  3TXM A;  3SNX A;  2JAB A;  3TGO A;  3LVR E;  5CCM A;  4GTM A;  1ELK A;  5CEA A;  4XI0 A;  1LTX A;  5JA4 D;  4KZC A;  3BEE A;  1H6K A;  2YHC A;  5JHA A;  1WG0 A;  4ANU A;  4ILG A;  1TJC A;  4FJZ A;  3SI5 A;  2ETB A;  4JHK A;  2J09 A;  2HO1 A;  4A3V A;  1WY6 A;  1E8X A;  4JHJ A;  4FA6 A;  3F6Q A;  4HOQ A;  2PM6 A;  5LFA A;  4JHR A;  3PUJ A;  4HB5 A;  2R02 A;  4EBA A;  2F37 A;  2Y0B G;  2XRZ A;  3ML8 A;  5FQ7 A;  5FT9 A;  3CQG B;  2A5U A;  5ARG A;  3L22 A;  4DX5 D;  1ZU2 A;  3NOC D;  1GW6 A;  1Y8M A;  3KEA A;  4L7T A;  2RG8 A;  4TXP A;  4YDO A;  5BV0 A;  3PEV B;  1D8D A;  5KWD A;  4PDX A;  4KYO B;  1X81 A;  5A7D B;  3CLJ A;  2EIM E;  4HOT A;  3FUM A;  1VDY A;  1Y6I A;  4HRN A;  4ILH B;  1JCR A;  3SF4 A;  4DX1 A;  1O5M A;  1HH8 A;  2Y4U A;  1QQE A;  2NXP A;  5BPP A;  3L6A A;  2WMO A;  5JJT A;  5FZQ A;  4GZ6 A;  3CHS A;  4I6E A;  2PQR A;  2WQH A;  3AG2 E;  4JD2 G;  4CZ2 D;  2VJ8 A;  3FUD A;  1IXV A;  3G2T A;  4H7X A;  1HG5 A;  2OCC E;  3LY8 A;  3FY4 A;  3WXX A;  4UWG A;  4ANX A;  5J90 A;  1EF1 C;  1LF8 A;  5B1B E;  2KZT A;  2YQ8 A;  3G2U A;  5D2M C;  1E8Z A;  3T8M A;  5HQ8 A;  3D9M A;  4XI9 A;  4LCT A;  3NZS A;  3C5R A;  3FTX A;  4WND A;  3UM2 A;  3CK9 A;  4BT8 A;  4MKT A;  2KZT B;  4BT9 A;  3R7R A;  2B6C A;  4GYO A;  4B8A A;  2H6I A;  3BG1 B;  4F7A A;  4EQF A;  1U3D A;  2DWZ A;  1OCZ E;  3FTV A;  4EZK A;  2AJA A;  5B1A E;  4UI9 K;  3HXB A;  2OVB A;  4J8F A;  4K03 A;  3KEZ A;  3R9A B;  2XGM A;  3FUN A;  2VSX E;  3FTS A;  2PM7 A;  3ZFW A;  4GA2 A;  3BG0 B;  1NP7 A;  2KM4 A;  3ZVV A;  3S2A A;  3AS4 A;  1K3Z D;  2IU1 A;  2MOW A;  4LER A;  1RZ4 A;  3EJN A;  3CST A;  3J5P A;  2J9Q A;  2PZI A;  4GML A;  1BI8 B;  3TWX A;  2L6J A;  3ASO E;  2PQN A;  3W9F A;  2CG3 A;  1HE8 A;  3MX3 A;  3QJZ A;  2XZD G;  5D0O D;  5CBN A;  3Q15 A;  3AG3 E;  2OEW A;  2RKK A;  3HG0 D;  3ZNG A;  3HXC A;  4OYS A;  3ZYL A;  4A63 B;  2CHX A;  2FF4 A;  3ZN3 A;  1O1S A;  2XHE A;  3FU0 A;  1N11 A;  3Q7F A;  3ULE G;  2E0I A;  4CT4 A;  3R9M A;  3EU9 A;  2DZN A;  3FH8 A;  4QFV A;  4IUL A;  3Q49 B;  4HLL A;  3URZ A;  3FTU A;  4KZ0 A;  3SHF A;  2V5F A;  3ZPJ A;  2F8Y A;  5M72 A;  3VLD A;  2VGX B;  4AM9 A;  4WWP A;  2KXP C;  4N3B A;  5G05 C;  1BPO A;  4UI9 C;  3QWV A;  3NF1 A;  1OCC E;  4GCO A;  2LO6 A;  3RK6 A;  5CMY A;  4FJY A;  3UM0 A;  4HI9 A;  1SQM A;  3FH7 A;  2X6H A;  1FVH A;  3D9K A;  3T5X A;  4G26 A;  5FZR A;  2XPY A;  1FCH A;  1N4S A;  3DRA A;  3V2X A;  3TJP A;  4UWH A;  2ETC A;  3TWW A;  2FBN A;  4MS6 A;  2I2O A;  5E75 A;  3ISM C;  4N2S A;  1OXJ A;  1UJJ A;  4G11 A;  4ATG A;  4LEU A;  4CRW A;  3D9O A;  4C9B B;  4CGV A;  2V4L A;  2LAH A;  1HF8 A;  1UW4 B;  3S7B A;  2A5E A;  2AVP A;  4U0Z A;  4I1M A;  4ANV A;  3FTW A;  3VTX A;  1NZN A;  2ETA A;  5A6C A;  4YND A;  2BTD A;  5ANL A;  4HLE A;  1UN9 A;  1YA0 A;  3HXD A;  4CDN A;  2IO3 C;  1TYQ G;  3Q7A A;  3EHM A;  3LPZ A;  4U8V D;  3I5P A;  2FO1 E;  3PNT B;  1QYM A;  3B7T A;  4AJW A;  2FEZ A;  2ION A;  3K9I A;  2HM8 A;  4IYP A;  3DEP A;  3ZXP A;  1N9A A;  1N95 A;  2X38 A;  3P1U A;  1H2V C;  3CEQ A;  3CK8 A;  2ZGD A;  3SFX A;  4L2Y A;  1DCQ A;  1HZ4 A;  3U9W A;  4G8L A;  2EIJ E;  1YMP A;  3Q78 A;  4EHM A;  1KZP A;  4J0U A;  4DJA A;  5BXO A;  2OVF A;  1P5Q A;  4GTQ A;  3T8K A;  1QBQ A;  3L13 A;  3NB2 A;  3LVQ E;  2XRY A;  3O48 A;  1H6P A;  3HVE B;  2XEH A;  1TN8 A;  3EHQ A;  1N4P A;  3FU3 A;  4XEI G;  2LSV A;  4NIK A;  3DWL G;  2IFU A;  3FU6 A;  2MRI A;  3IXE A;  3RIB A;  3TWV A;  4J8Y A;  5ENO D;  4E6H A;  4K0R A;  2Y69 E;  3PZD A;  3DSU A;  2MYO A;  3Q4A B;  1FPP A;  4CGW A;  3QKY A;  5ANR A;  3ZUV B;  3UM1 A;  4I2W A;  2ZU6 B;  3QAQ A;  1ELR A;  2P9S G;  1E8Y A;  2F8X K;  5LOZ A;  2RFM A;  5KJL A;  4N2Q A;  4G25 A;  3RO3 A;  4I6J A;  3FH5 A;  3JXJ A;  4PS3 A;  4AY6 A;  4D10 C;  2WXN A;  4AOF A;  1X5B A;  4F3V A;  3Q9N C;  2QYJ A;  4JL0 A;  3UM3 A;  4BY6 A;  4DLQ A;  1OCO E;  4B94 A;  2QY7 A;  4J8S A;  4AVX A;  4HFG A;  3IHY A;  3CHO A;  4L9P A;  5HKP A;  3ASF A;  1K1B A;  4H7Y A;  3CVY A;  4U8H A;  3MKQ A;  3OTN A;  4Y6C A;  4JZY A;  2V8S E;  1MX6 A;  2XS8 A;  1WM5 A;  3ENE A;  2XEV A;  2WQ6 A;  3X2Q E;  5AQ9 A;  3EIQ C;  3MKQ B;  3CHM A;  1IQU A;  3ABL E;  5AJL A;  4APF A;  4W9R A;  3C3O A;  5C2Y A;  3OXF A;  5LCW J;  3Q73 A;  3UT8 A;  1AWC B;  4ACL A;  1FT1 A;  2BKK B;  4WUY A;  3RJV A;  4HOR A;  3BU8 A;  5EID A;  2VGY A;  4G23 A;  1NA3 A;  5JJ7 A;  3FUE A;  2QC9 A;  2NYJ A;  4DI3 A;  3JUE A;  3RRN B;  3CVL A;  4AV7 A;  4I9E A;  3NOG D;  3SQV A;  3ASN E;  1PC2 A;  1TNU A;  4GYY A;  3L54 A;  3S7D A;  3QDN A;  3CSF A;  1IQR A;  3HXF A;  2XEE A;  4JA9 A;  5HS0 A;  4F53 A;  1U2V G;  3QOU A;  4N3C A;  3LDZ A;  3FUK A;  3GZ1 A;  3AS8 A;  2GRN B;  4KXK B;  3SO8 A;  4BER A;  3D9I A;  4OAU C;  2MHK A;  3CHQ A;  2ZGG A;  1DCE A;  3ML9 A;  2Q7F A;  5BNW A;  4HVB A;  5KCM A;  3D9P A;  2DBA A;  1AP7 A;  3ABK E;  4JEH A;  4DX7 D;  2P9L G;  5AAO A;  5LX8 A;  5ENN A;  4UUC A;  4PS8 A;  4UQY A;  3S7J A;  1HX8 A;  1SZ9 A;  2IEJ A;  2YNQ A;  3B13 A;  5CRU A;  3CK7 A;  1PY1 A;  2GRP B;  3VLE A;  2GRR B;  2WXI A;  2QFC A;  2LNI A;  5T3R A;  3RKV A;  3TWU A;  4JXT A;  3ZGQ A;  3MJW A;  2DVW A;  4U04 A;  5EDS A;  4JEU A;  5AYW D;  4K5C A;  2C0M A;  2CFZ A;  1A17 A;  3GZS A;  3UT7 A;  4G24 A;  4JA7 A;  3CR3 A;  5AN8 A;  3FUJ A;  3AU5 A;  2JEK A;  4Q96 A;  4MRU A;  4B89 A;  3IKO B;  1MX2 A;  2JLB A;  2OND A;  4I1O B;  2AXZ A;  2FI7 A;  3SZ7 A;  3APC A;  2IO2 C;  3BUA A;  2L6B A;  4EBA G;  2GW1 A;  4DUI A; 
#chains in the Genus database with same CATH homology
 2C0L A;  2DCP A;  4FJY A;  3OXL A;  3HDX A;  3ZHE B;  5EKQ D;  4GPK A;  1UG3 A;  3RU0 A;  1SQM A;  3FH7 A;  2X6H A;  2XPZ A;  2WMN A;  4FLH A;  4RG6 A;  2J49 A;  5CMW A;  4FUL A;  2UY1 B;  1FVH A;  3D9K A;  3T5X A;  4G26 A;  4DK5 A;  3CVX A;  3G2V A;  5FZR A;  4GZC A;  2XPY A;  3UT4 A;  3U66 A;  1FCH A;  2CFU A;  2R17 C;  4A3T A;  3TJP A;  4AEZ C;  3B7R L;  4UWH A;  3G2W A;  3ASH A;  4EZJ A;  4U63 A;  5DBK A;  2FBN A;  4MS6 A;  2FO7 A;  2I2O A;  2I6H A;  2X6F A;  4FHK A;  4CDR A;  3JQ0 A;  1EDU A;  3CQC B;  4BWR A;  5E75 A;  1FVF A;  1E7V A;  2AW6 A;  2HYZ A;  3ZXS A;  4N3A A;  4UWK A;  5FQ4 A;  3ESK A;  2WXL A;  4ANW A;  4N2S A;  1UJJ A;  4G11 A;  3HHM A;  5BW8 C;  4YVQ C;  1W3B A;  4ATG A;  2X6K A;  4LEU A;  1TEZ A;  3C98 A;  2WXR A;  4CRW A;  3D9O A;  4C9B B;  1XNF A;  2XPI A;  4CGV A;  2V4L A;  2LAH A;  3RO2 A;  1HF8 A;  2VSY A;  3FEY A;  4JC8 A;  1UW4 B;  3CVP A;  3IEG A;  2AVP A;  4GZD A;  4XE0 A;  4U0Z A;  3S7B A;  4B8C B;  1JWF A;  3FUH A;  4I1M A;  4ANV A;  4FAD A;  4JPS A;  3TAX A;  3FTW A;  4UWL A;  2XGO A;  3VTX A;  2L0I A;  4CCA A;  1NZN A;  5A6C A;  4L23 A;  3JUI A;  4YND A;  2BTD A;  2FUL A;  4P29 A;  3LY7 A;  4XZ4 A;  5ANL A;  1N54 A;  1UN9 A;  1YA0 A;  3JYS A;  4BSX A;  3PUK A;  4CDN A;  5AEN A;  5FWQ A;  3IHV A;  3DPD A;  4URK A;  3APD A;  3EHM A;  5C1D A;  3MEK A;  3LPZ A;  2WXM A;  4XKB A;  1KT1 A;  2WXO A;  3I5P A;  1HXI A;  3LEW A;  3PNT B;  3CGH A;  3FTY A;  4N39 A;  4XKC A;  3B7T A;  2CHW A;  4R7L A;  4AJW A;  2WXH A;  3UUX A;  2FEZ A;  3B7S A;  3PE4 A;  4BTA A;  2ION A;  5FQ6 A;  3K9I A;  4BX9 A;  2HM8 A;  3QB2 A;  4C0M A;  4IN3 B;  1HU3 A;  4UQZ A;  3SGH A;  3L16 A;  4IYP A;  2NSZ A;  4MLP A;  4HOU A;  1XGW A;  1JWG A;  3FUI A;  3QK0 A;  4NAC A;  3TG5 A;  4GZ5 A;  4I6G A;  4BFR A;  2X38 A;  1QZ2 A;  3GW4 A;  4FHJ A;  3PS6 A;  4I1A A;  4RSY A;  2XQ0 A;  3P1U A;  3JCK C;  3ZYK A;  1H2V C;  2KCK A;  3CEQ A;  3CK8 A;  3U64 A;  4A55 A;  1MHQ A;  2I9C A;  4L2Y A;  3ZW3 A;  2Y4T A;  3CKB A;  3DBS A;  3D9J A;  2AXU A;  1PAQ A;  4KVM A;  3CVV A;  1HZ4 A;  3ONK A;  3U9W A;  5T8I A;  4GA0 A;  4CT0 A;  3PE3 A;  1MQS A;  4RVB A;  3ESL A;  2J4D A;  5G04 C;  1IYG A;  3MZL B;  4I17 A;  3D9L A;  4AIF A;  2J4B A;  3I4R B;  3HYM B;  4ME2 A;  1HO8 A;  2IOS A;  3JQ1 A;  4OVV A;  4J8E A;  2WPV A;  4J0U A;  3OAW A;  4DJA A;  3D3M A;  2OVF A;  3UMV A;  1P5Q A;  2X6I A;  4AY5 A;  4EEC A;  4N5C A;  4JVS A;  2BUG A;  4O6F A;  5ARF A;  3RRM B;  2CG2 A;  3L13 A;  2X6J A;  4CEM A;  3TXM A;  4HOS A;  1OWL A;  4XIF A;  3LVQ E;  2WXP A;  2XRY A;  3O48 A;  1KLX A;  1Z3X A;  3SNX A;  4PH4 B;  3HVE B;  3CIA A;  5D0Q D;  4U0S A;  3TGO A;  3D9N A;  4Y6W A;  3LVR E;  4GU5 A;  3FU3 A;  5CCM A;  2AWI A;  5JHB A;  1B89 A;  3G2S A;  3Q47 B;  2LSV A;  2IFU A;  1ELK A;  3FU6 A;  3I3N A;  4DI4 A;  5EX0 A;  2YHE A;  3LY9 A;  2MRI A;  4XI0 A;  3PDN A;  1WAO 1;  3GZ2 A;  4AXH A;  3PRE A;  5LCW C;  4KZC A;  3LJ3 A;  3BEE A;  5KJM A;  3RIB A;  1H6K A;  2EQX A;  4DPR A;  2YHC A;  5JHA A;  3LYA A;  3SBS A;  4ANU A;  4ILG A;  1TJC A;  4FJZ A;  3SI5 A;  2AXV A;  4JHK A;  4E6H A;  3UX4 A;  2J09 A;  3NQP A;  2E2E A;  4K0R A;  2HO1 A;  4NRH B;  4A3V A;  1HFA A;  3PEU B;  4GB9 A;  1SZA A;  3ULQ A;  3PZD A;  1WY6 A;  1E8X A;  2BF0 X;  4JHJ A;  3CHR A;  4FA6 A;  2V0P A;  2IOL A;  3Q4A B;  4HOQ A;  1JPL A;  3NZU A;  4CGW A;  3QKY A;  1ELW A;  2PM6 A;  4G1T A;  1OWO A;  5ANR A;  4KMO A;  2WXG A;  5LFA A;  4JHR A;  4I2W A;  3FFL A;  2WXK A;  1E96 B;  2IJG X;  3MYV A;  3PUJ A;  3ASG A;  3LS8 A;  4WWN A;  2ZU6 B;  4EBA A;  3QAQ A;  4GYW A;  4WNE A;  1ELR A;  3MV2 B;  2XRZ A;  3ML8 A;  1E8Y A;  5BUZ A;  3MA5 A;  4OVU A;  4GZ3 A;  3VLF A;  3LCA A;  3O4Z A;  5FQ7 A;  5FT9 A;  3QC1 A;  3CQG B;  2A5U A;  5ARG A;  4DLO A;  3CVW A;  3L22 A;  5FTP A;  1ZU2 A;  5LOZ A;  2ILR A;  2VQ2 A;  5KJL A;  3APF A;  3Q5M A;  1GW6 A;  3QAR A;  4N2Q A;  2VSO E;  2GRM A;  2HR2 A;  3CVN A;  4G25 A;  3RO3 A;  1Y8M A;  4CDM A;  4I6J A;  1H0A A;  4L7T A;  3EIJ A;  3SFZ A;  2RG8 A;  3FH5 A;  5BV0 A;  3PEV B;  4PS3 A;  2OV8 A;  4AY6 A;  4D10 C;  3FUL A;  2WXN A;  4FU3 A;  4PDX A;  3HVE A;  4KYO B;  5KJK A;  3R7Q A;  4AOF A;  3QWP A;  1UN8 A;  1X5B A;  2YIN A;  5G04 J;  2DIW A;  2WXQ A;  4F3V A;  1QNF A;  5A7D B;  3CLJ A;  4JL0 A;  1OWM A;  2L9B A;  2J08 A;  4BY6 A;  1DVP A;  4J8D A;  5DIZ A;  4DLQ A;  4HOT A;  3KAE A;  1DNP A;  1VDY A;  3FUM A;  3AS5 A;  1Y6I A;  4B94 A;  2QY7 A;  4ILH B;  4J8S A;  4AVX A;  3SF4 A;  4HFG A;  3IHY A;  3CHO A;  5BV1 A;  1N52 A;  2C2L A;  1HH8 A;  1OWP A;  2VTB A;  2Y4U A;  3ASF A;  3B7U X;  4H7Y A;  1QQE A;  3CVY A;  2NXP A;  5BPP A;  2WXF A;  3OXG A;  3L6A A;  2WMO A;  3MKQ A;  3OTN A;  4U8H A;  5FZQ A;  5JJT A;  4GZ6 A;  3CHS A;  4NUR A;  3TXN A;  4A1G A;  4FC8 A;  4Y6C A;  4I6E A;  4JZY A;  2PQR A;  2WQH A;  2V8S E;  2VYI A;  4C0E A;  4WNF A;  3KD7 A;  1WM5 A;  3ENE A;  5LP0 A;  2XEV A;  2WQ6 A;  2VJ8 A;  3FUD A;  2KC7 A;  3EIQ C;  3MKQ B;  3QWW A;  3CHM A;  5G2N A;  1IQU A;  5AJL A;  3G2T A;  4H7X A;  1HG5 A;  4A1S A;  4APF A;  4BTB A;  3GYZ A;  4W9R A;  3LY8 A;  2VSN A;  4G2V A;  3FY4 A;  4J6I A;  1ZBP A;  3OXF A;  5C2Y A;  3UT8 A;  3WXX A;  5LCW J;  2UY1 A;  4UWG A;  4ACL A;  4ANX A;  4WUY A;  3RJV A;  5J90 A;  4KBQ A;  1EF1 C;  1LF8 A;  2WVI A;  3ASD A;  2WXJ A;  2KZT A;  2YQ8 A;  4HOR A;  3FDH A;  3G2U A;  3T5V A;  4XX5 A;  1E8Z A;  2VGY A;  4G23 A;  3T8M A;  5HQ8 A;  3D9M A;  1NA3 A;  4I43 A;  4ILI A;  4XI9 A;  5JJ7 A;  3FUE A;  4EPZ A;  4LCT A;  3NZS A;  3FTX A;  4APO A;  4YVO A;  4WND A;  4DI3 A;  4Q94 A;  5KJN A;  3RRN B;  3CK9 A;  4BT8 A;  4MKT A;  2KZT B;  3CVL A;  3ZIM A;  4BT9 A;  1S0P A;  4AV7 A;  3R7R A;  4I9E A;  4GYO A;  4HLE A;  4B8A A;  3S7F A;  3BG1 B;  5JJ6 A;  3ZEF A;  4F7A A;  1IHG A;  3U3W A;  3L17 A;  4EQF A;  1PC2 A;  4PUC A;  1UJK A;  2NC9 A;  1U3D A;  4GYY A;  1OUV A;  4WAF A;  3L54 A;  3RRU A;  3S7D A;  3QDN A;  3U4T A;  3CSF A;  3FTV A;  1U3C A;  3SBT B;  1IQR A;  4JA9 A;  3VTY A;  4EZK A;  4F53 A;  3MGB A;  3QOU A;  1E8W A;  2WB2 A;  4N3C A;  3LDZ A;  4UI9 K;  5E76 A;  3FEX A;  2OVB A;  3IBE A;  3FUK A;  4J8F A;  5J08 A;  4K03 A;  3FP3 A;  3KEZ A;  3GZ1 A;  1NA0 A;  3AS8 A;  3TG4 A;  5CCL A;  3R9A B;  2LAI A;  4KXK B;  2XGM A;  4LUN U;  5FQ8 A;  3HIZ A;  3FUN A;  4HS2 A;  3CVU A;  3D9I A;  2VSX E;  3CVQ A;  4TV3 A;  1HS6 A;  2MHK A;  3FTS A;  3CHP A;  2LSU A;  3ZRH A;  3AU4 A;  2PM7 A;  3ZFW A;  4FP7 A;  4GA2 A;  4ACK A;  3CV0 A;  3BG0 B;  1NP7 A;  2KM4 A;  3CHQ A;  2XCC A;  3PH0 C;  2PL2 A;  3ZYM A;  3ZVV A;  2IQC A;  3ML9 A;  2Q7F A;  4WWO A;  3S2A A;  5BNW A;  4HVB A;  5KCM A;  3AS4 A;  3E4B A;  2M63 A;  3PNL B;  4I9C A;  2IU1 A;  3D9P A;  2DBA A;  2MOW A;  3L08 A;  2WQ7 A;  4JEH A;  4LER A;  3EJN A;  3CST A;  4TUU A;  5LX8 A;  2J9Q A;  4I2Z A;  2PZI A;  2X3M A;  3FTZ A;  1H2T C;  4GML A;  2L6J A;  2Y3A A;  3FUF A;  2KAT A;  3EDT B;  5ENN A;  3SD5 A;  3ZYQ A;  3KS2 A;  4FLB A;  3UPV A;  4PS8 A;  4UQY A;  3S7J A;  2PQN A;  1HX8 A;  5BT1 A;  1INZ A;  1SZ9 A;  3QNK A;  1L5J A;  4GCN A;  4L2L A;  5AIJ A;  1EYH A;  2YNQ A;  3B13 A;  4B0Z A;  5A23 A;  3CK7 A;  1PY1 A;  4UWF A;  2CG3 A;  1Z6T A;  3LXU X;  5G55 A;  2R59 A;  3ZHE A;  1HE8 A;  3MX3 A;  3QJZ A;  4TRQ A;  3TL5 A;  2L0T B;  3PVL A;  2A4Z A;  5D0O D;  4PS7 A;  1H19 A;  3VLE A;  3PRZ A;  4GAA A;  2WXI A;  2QFC A;  1OWN A;  2LNI A;  5T3R A;  1H2U A;  2RD0 A;  3Q15 A;  2GRL A;  5EX3 A;  3RKV A;  4JXT A;  4ABN A;  3ZGQ A;  3MJW A;  4KT6 B;  2OOE A;  4NQ0 A;  5HI7 A;  4GMJ A;  4M3O A;  4OYS A;  4U04 A;  5EDS A;  4U07 A;  1TJF A;  4JEU A;  4F1S A;  3ZYL A;  4EZL A;  1KT0 A;  4IRU A;  2CHX A;  5AYW D;  2FF4 A;  4WNG A;  3ZN3 A;  4AP2 A;  2C0M A;  2CFZ A;  1A17 A;  3GZS A;  3LKU A;  3UT7 A;  5T4Y A;  4G24 A;  4LRZ A;  2XHE A;  4JA7 A;  3CR3 A;  3FU0 A;  2I1J A;  2XCB A;  1Z3Y A;  1E90 A;  3FUJ A;  3AU5 A;  2JEK A;  2GGF A;  4Q96 A;  3FHE A;  2E0I A;  4MRU A;  4Q69 A;  4B89 A;  4CT4 A;  4HXI A;  1JUQ A;  4KVO A;  4RG9 A;  4U0U A;  2IF4 A;  3IKO B;  3EHN A;  3CKC A;  2J07 A;  3P2B A;  4UI9 J;  2VGX A;  3FH8 A;  4QFV A;  4IUL A;  5FJY A;  3Q49 B;  3FU5 A;  2JLB A;  2UWJ G;  2OND A;  3FWV A;  4E85 A;  4I1O B;  3URZ A;  1E7U A;  3FTU A;  4KZ0 A;  3SHF A;  2AXZ A;  2V5F A;  1EPU A;  3MV3 B;  3ZPJ A;  2VTB B;  4L1B A;  5AJD A;  5M72 A;  1HG2 A;  2FI7 A;  3VLD A;  2KCL A;  2I1K A;  2VGX B;  4UQX A;  3SZ7 A;  4AM9 A;  3APC A;  2CHZ A;  4WWP A;  5G05 J;  3ONL A;  4N3B A;  5G05 C;  3I4G A;  2R5S A;  2P58 C;  5CHE E;  1BPO A;  4V3I A;  3IV0 A;  4UI9 C;  3QWV A;  3UQ3 A;  4EBA G;  5FZS A;  4GA1 A;  3NF1 A;  2XGS A;  2WM9 A;  4GCO A;  2LO6 A;  3RK6 A;  5CMY A;  3MKR A;  4JW1 A;  2GW1 A;  2KCV A;  3N71 A;  4BX8 A;  3MCX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...