1TJCA

Crystal structure of peptide-substrate-binding domain of human type i collagen prolyl 4-hydroxylase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
95
structure length
95
Chain Sequence
MFLTAEDSFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl 4-hydroxylase alpha-1 subunit
publication title The Peptide-Substrate-binding Domain of Collagen Prolyl 4-Hydroxylases Is a Tetratricopeptide Repeat Domain with Functional Aromatic Residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 40
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature ec 1.14.11.2: Procollagen-proline 4-dioxygenase.
pdb deposition date 2004-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1tjcA00
5AYWD 3ZPJA 1IHGA 2XPIA 2ONDA 3ASDA 1ELRA 5A6CA 3AS8A 4GPKA 3SZ7A 5BW8C 3MV3B 4BTBA 3LY8A 3LYAA 5EX0A 3GZ1A 3ZHEB 3ULQA 1HZ4A 5D0QD 2Y4UA 4EQFA 4AM9A 2NC9A 4F3VA 2YHCA 4UQZA 5FZRA 4I2WA 3PE3A 2VSNA 4GYOA 2XGMA 4WNDA 4N2QA 5JJTA 4HOSA 4NQ0A 2VGYA 3Q15A 4I9EA 1P5QA 5HI7A 3CVPA 2HO1A 5G05C 4U0ZA 4G26A 4U04A 4U0SA 2KC7A 3BEEA 4BT8A 3LPZA 2KATA 3LKUA 5JJ6A 5A7DB 3UPVA 4J0UA 3CKCA 3QWVA 2PL2A 4GCOA 2V5FA 5KJLA 3PE4A 3NF1A 3CV0A 2L6JA 2LNIA 1NA0A 4ABNA 4I17A 1B89A 3OXGA 1QQEA 4KBQA 2DBAA 3VTXA 5FZSA 1A17A 4KYOB 2XCBA 3ZFWA 5ARGA 4UQXA 4UI9K 2MHKA 5G04J 4O6FA 1OUVA 3MEKA 3FFLA 3CEQA 2P58C 4BT9A 4YVQC 4I9CA 3AS4A 4GYYA 5ARFA 4UQYA 4N39A 4WNFA 4I1AA 2FEZA 2BUGA 2C0LA 3KD7A 3U4TA 2VGXB 2KCKA 3LCAA 5C1DA 2I6HA 4IN3B 5EX3A 5DIZA 3CVQA 3PDNA 5LCWJ 5EKQD 2AVPA 3RJVA 1IYGA 4CGVA 4HORA 3RU0A 1WM5A 3HYMB 4JHRA 5JJ7A 3OXLA 1QZ2A 5CCMA 3AS5A 5CCLA 3ASHA 3S7FA 1HXIA 4GA2A 4G24A 1KT0A 3ASGA 2UY1A 4XI9A 4H7YA 1NA3A 4BWRA 2UWJG 1WAO1 3SF4A 2XGOA 2IFUA 3Q5MA 4GA0A 2FI7A 2C2LA 2Y4TA 4XIFA 4Y6CA 2R5SA 4N2SA 1HH8A 5G05J 4WUYA 2JLBA 2HYZA 4Y6WA 3QWWA 4XI0A 2XCCA 2LSVA 3QOUA 5FZQA 3TGOA 4AIFA 4GYWA 5M72A 2KCVA 2VSYA 4UI9C 4JL0A 2J9QA 3ZGQA 2FBNA 2QFCA 3EDTB 3URZA 4KXKB 3R9AB 1ZU2A 1FCHA 3CK9A 4RG6A 5KJMA 2WPVA 4H7XA 4N5CA 4WNEA 3FP3A 4J8DA 3Q49B 4GA1A 2GW1A 3Q47B 4GZ3A 4GZ5A 1W3BA 3Q4AB 4U07A 2E2EA 4RG9A 1ZBPA 2XEVA 4BTAA 3S7JA 4G2VA 4GCNA 3RIBA 4G1TA 2IF4A 3LY9A 2HR2A 1XNFA 3TAXA 4WNGA 3K9IA 4U0UA 3FWVA 4GZ6A 5HQ8A 4JA9A 5CHEE 3WXXA 2PQRA 2OOEA 3MA5A 5D0OD 3TG4A 2KCLA 5FTPA 1E96B 4JA7A 1Y8MA 3RKVA 3N71A 3UUXA 5KJNA 5BNWA 4N3CA 3U3WA 3RO2A 1KLXA 3OXFA 5FT9A 3ZN3A 3IEGA 4ME2A 5BT1A 2FO7A 1TJCA 2C0MA 4N3AA 4J8FA 4HOTA 3LY7A 1KT1A 2YQ8A 3VTYA 3KAEA 4AY6A 2VYIA 2XGSA 2WQHA 4HOUA 2VQ2A 4J8EA 3O48A 2UY1B 5G04C 3E4BA 4CGWA 3QDNA 5KJKA 1NZNA 4YVOA 3RO3A 4G23A 4LEUA 3CKBA 3ASFA 3ESKA 4YNDA 4I2ZA 3GYZA 3MV2B 3CK8A 3MKRA 3QWPA 3CVLA 2PZIA 3CVNA 3S7BA 5FJYA 2PQNA 3CK7A 3S7DA 3GW4A 4B94A 1YA0A 3TG5A 2VGXA 2Q7FA 3KS2A 2FF4A 4A1SA 4AY5A 3QKYA 3ZHEA 4APOA 1PC2A 3UQ3A 3GZ2A 1ELWA 4G25A 5LCWC 2LSUA 4UI9J 4HOQA 4CDRA 4N3BA 5DBKA 3JYSA 4NRHB 4W9RA
chains in the Genus database with same CATH superfamily
3ZPJA 5B1BE 3AU4A 4WWPA 3L22A 1DCQA 3NZSA 2IONA 1ELRA 3AS8A 4JPSA 3ML8A 1FVFA 3MV3B 1N0QA 3LYAA 2E0IA 3GZ1A 3ZHEB 4YDEA 2IO3C 4U95D 3UM1A 4OVVA 4MLPA 4EQFA 2NC9A 4FU3A 4F3VA 5FZRA 4I2WA 2P9NG 1AWCB 5ENNA 5JJTA 4HOSA 4NQ0A 1S64A 5AJLA 2GRMA 1P5QA 3MX3A 3CHSA 3CVPA 2HO1A 4JD2G 1D8EA 2BKGA 3SFXA 2RD0A 4PH4B 3DPYA 4ACLA 3JQ1A 3BEEA 3WG7E 4U8HA 5J08A 4BT8A 2P9IG 1OXJA 4GZDA 3RAUA 3LKUA 5JJ6A 3ZNGA 3JXIA 1N11A 3DXMG 1H6KA 2EIJE 3UKUG 3UPVA 2P9PG 4XE0A 3RRNB 3AJIA 2QC9A 1JWGA 2PL2A 3EIQC 3SQVA 5CEAA 4GCOA 5KJLA 3G2WA 5CBNA 4DJAA 3HXEA 3CQCB 1Z6TA 1SW6A 2L6BA 4KBQA 2DBAA 2X6FA 4JZYA 3IHVA 3PZDA 4UWLA 2XCBA 2XENA 1OWNA 3ZFWA 3APDA 2DWZA 1OUVA 3EHRA 3MYVA 3EU9A 3SBTB 4ANWA 3I3NA 2VTBB 5CMWA 5AQ9A 4NIKA 1N4PA 4RLYA 3I4GA 2A5EA 1OCCE 4N39A 4AOFA 3LEWA 4GTVA 3ULEG 4I1AA 3FU3A 2C0LA 3EHMA 1BU9A 2VGXB 4XKCA 1VDYA 1H6PA 2EINE 5BV0A 5C1DA 2I6HA 5DIZA 1DVPA 3C3RA 5LCWJ 3NOGD 3LS8A 4L1BA 2ILRA 5EKQD 2AVPA 1IYGA 3ASOE 1WM5A 4K0RA 2J4BA 3PUJA 1A5EA 2I1JA 1QZ2A 3DEOA 4K03A 4IULA 3ASHA 3U66A 1BD8A 1E8XA 4GA2A 4G24A 5FQ4A 4JHJA 4LNUD 2NXPA 1E7VA 3DBSA 5LX8A 1NP7A 3FU0A 3U9WA 4UWHA 4TV3A 2YNQA 3FY4A 4GTOA 2CG2A 2FI7A 2C2LA 4XIFA 4U7EB 4C0EA 3HG0D 2DCPA 1MHQA 3ZYQA 4L2YA 1UW4B 4MRUA 2JLBA 2XEEA 4FLHA 3ASNE 3QWWA 4XI0A 5AQAA 2XCCA 3AU5A 3QJZA 5FQ7A 5ENOD 4A63B 4JL0A 4L2LA 3QARA 4CYMD 2J9QA 5ENSD 1HX8A 3EDTB 3SFZA 3URZA 2KM4A 3G2TA 1ZU2A 2X38A 4I6GA 4H7XA 1BI7B 4J8DA 3Q49B 2WXRA 2WXPA 2QYUA 4GZ3A 3DXKG 4GZ5A 3CHRA 3PVLA 5KWDA 5ANRA 1AP7A 3HDXA 3Q4AB 3DRAA 1S70B 4RG9A 4F7AA 1L5JA 4FJZA 2DYRE 2WXLA 4DX2A 4G2VA 1BPOA 3DSUA 4I43A 4XKBA 3TWXA 3FH5A 5ANLA 5A23A 3K9IA 4U0UA 3FWVA 3T9KA 1Y6IA 4APFA 1FT2A 4HI8A 3SBSA 3CHMA 2PQRA 1OT8A 5D0OD 3CHQA 1U3CA 5FQ6A 4B89A 2RFMA 3SHFA 2XEHA 1E96B 3Q9UC 2P9UG 4HS2A 5ENTD 1Y8MA 3RKVA 3UUXA 1WY6A 2LXMA 5BNWA 3B13A 4OVUA 3G2SA 3RO2A 4JW1A 3JUIA 3Q7AA 5BT1A 2LAIA 2X6HA 1TJCA 1UJKA 2C0MA 1X5BA 2Y69E 2WXJA 4FULA 1KT1A 2VGEA 2YQ8A 2IEJA 4ILIA 4WAFA 3D9OA 3KAEA 1KZOA 2WQHA 3KSLA 5T4YA 5LP0A 3PZ4A 4K5AB 4ZFHA 3O48A 3V2OA 4I1OB 2HE0A 4CGWA 1LD7A 1NZNA 4YVOA 3MKQA 3DSVA 3VLFA 3W9GA 2VSXE 3G2UA 1JCRA 4I2ZA 4JXTA 2CHWA 5HRYA 2JEKA 5B1AE 5KNGA 3CSTA 4GTPA 4ILGA 4Z68A 3T8MA 3SGHA 3UX4A 3DWLG 3TG5A 4C48B 3AAAC 1HF8A 1IHBA 4APOA 1PC2A 3FUIA 5FWQA 4X8QA 1ELWA 4G25A 3FEYA 2X6IA 2LSUA 4LRZA 3TWVA 4HBDA 3L54A 3LVRE 3EU5A 3CVUA 3I4RB 1IHGA 3BQOA 2XPIA 4FC8A 1FPPA 1BI8B 3Q7FA 4LNBA 4DK5A 4ATGA 3ZXPA 5A6CA 3SZ7A 3D9HA 3HVEA 3D9JA 3FTUA 1HZ4A 4GTMA 2Y4UA 1UOHA 2V4HC 2QYJA 4AM9A 4UQZA 3FU6A 5CRUA 4ZHBA 2XGMA 3E37A 3BUAA 5HS0A 3VLEA 3FUNA 3PREA 3X2QE 5G05C 5D66A 3EHNA 4G26A 2KBXA 5CERB 3J5QB 3AG1E 3DSWA 2CFZA 4DRXE 2KC7A 5CECB 4BX9A 5FQ8A 4BERA 3LPZA 2KATA 1HFAA 3CIAA 2NYJA 1Z5SC 2R59A 2XQ0A 3Q73A 5A7DB 3ZVVA 3TWSA 3RRMB 3CHOA 2DZNA 3PRZA 4PS7A 3NOCD 3NF1A 3E33A 4I1MA 3JCKC 3TWQA 2R2LA 1SVXA 4ATZD 2P9SG 5KCMA 3OXGA 1EDUA 2I1KA 1QQEA 1NFIE 2RKKA 2XS8A 5FZSA 2LXLA 3BU8A 3FTVA 2EQXA 5CEDB 4DX6D 5ARGA 3QC1A 4D10C 3IBEA 3MEKA 5C2YA 3CEQA 4EBAG 3FUFA 3TWUA 4GYYA 2WXMA 4XZ4A 2FEZA 2A5UA 2WMNA 1N4RA 3SI5A 3Q9NC 1MYOA 1FT1A 1OWOA 4R7LA 1MJ0A 2IJGX 4MBGA 4MS6A 4IN3B 4GZCA 3D9MA 1H6OA 2WXQA 3CVQA 4GAAA 1EF1C 4A3TA 4LSZE 5IY5E 4CGVA 3KSQA 1LF8A 3RU0A 1QNFA 3B7TA 3OAWA 4YDOA 5JJ7A 3OXLA 4U8VD 5JMND 5CCLA 3ZEFA 4GMRA 2WXHA 3CVVA 2X6JA 4DX5D 4Q69A 2HM8A 3LVQE 4B93B 5JHAA 4DI4A 1EPUA 4AEZC 3B7RL 4DX7D 1RW2A 1NA3A 1N52A 2OEWA 1WAO1 1TN7A 2XGOA 3Q5MA 4GA0A 1E8YA 1SQMA 4LERA 2KZTA 4UUCA 3D9LA 1N0RA 2MRIA 4N2SA 4O1PA 5G05J 5B3SE 4B0ZA 3L82A 2HYZA 1MX6A 3PEUB 3TL5A 3CVWA 5FZQA 3RRUA 3RSEG 4ANUA 4ANXA 2L9BA 4J8YA 4CRWA 4GB9A 3QAQA 1WG0A 4LCTA 3FTXA 3D3MA 1NL4A 2FBNA 3PNTB 5FIOA 4FP7A 1N9AA 2ETCA 3R9AB 4J6IA 1OCRE 3APCA 4GA1A 4ILHB 3CHPA 2GW1A 5EIBE 3ZU7B 3PUKA 1HG2A 4GTSA 2NSZA 1OWMA 2IOLA 4BEPA 1SA4A 3LXUX 2XEVA 3VLDA 4RSYA 2R05A 1N4QA 5EDSA 1BLXB 1S63A 4Q94A 4KZ0A 3ISMC 2HR2A 3TAXA 1S0PA 5AN8A 2J08A 4GZ6A 4HI9A 5BXOA 5HQ8A 4HRLA 2R17C 4C0MA 2M63A 3V31A 2OOEA 3MA5A 4F1PA 4JB8P 4QQIA 3N71A 1O1RA 5EN5D 5KJNA 4BX8A 4A1GA 1U2VG 1N54A 4TXQA 3IEGA 4CCAA 4EECA 2F8XK 4OAUC 2CFUA 2YHEA 4CT0A 3FUKA 1DCEA 2GRPB 1D9SA 3CQGB 3FTSA 4HOUA 4AJWA 1KZPA 4HLLA 4CDNA 4KZCA 3FH8A 2J4DA 2UY1B 5G04C 3E4BA 2DIWA 3QDNA 5KJKA 4LG6A 2J09A 4YNDA 2Y3AA 3GYZA 3Q78A 2P9KG 3MKRA 3QWPA 2A4ZA 4AP2A 3FTWA 2PZIA 2FULA 2PQNA 2V4LA 4F1SA 3ABLE 1E7UA 3L08A 4B8CB 2VGXA 3KS2A 3DSXA 4A1SA 2OEVA 3QKYA 3T8KA 3GZ2A 3SD5A 1WDYA 5T3RA 2WB2A 3FH7A 4HOQA 5BPPA 3V2XA 1UN9A 3ZW3A 5G2NA 3O4ZA 3UIPC 4AVXA 2B0OE 2ONDA 2I2OA 3FUDA 4GPMA 2ZU6B 4GPKA 5BW8C 4BTBA 3LY8A 3I5PA 4XEIG 5EX0A 1H2VC 2WVIA 2RG8A 3C3QA 2XZTG 4L9PA 2WMOA 4JEUA 3PE3A 2VSNA 4G11A 2WXOA 2XPYA 3JQ0A 3FHEA 1X81A 4WNDA 4N2QA 1TYQG 5EIDA 3Q15A 1K1AA 2GRRB 4G8KA 5J90A 5CMYA 4PS8A 3QB2A 1V55E 2WXKA 5ENPD 2X3MA 4K5BA 4GTQA 5BUZA 1EYHA 4ACKA 1PY1A 3KEAA 3CKCA 3QWVA 4O60A 4EBAA 1SZ9A 2IOSA 3CV0A 3TXNA 4EHMA 1O1TA 2LNIA 3L6AA 3BG1B 3ZXSA 4ABNA 1HO8A 1B89A 4BETA 2L0IA 3D9NA 3EHQA 3G2VA 4KYOB 3IV0A 2QZAA 1N95A 2L0TB 4UQXA 3FULA 2MHKA 5G04J 1UJJA 4O6FA 4TXRA 3FEXA 3CSFA 1FVHA 4EZLA 4YVQC 2MOWA 1XGWA 2LUHA 2IU1A 2Y1LE 3D9IA 2XRZA 1MX4A 4JEHA 4WNFA 2BUGA 3AG3E 3QK0A 2AXZA 3EUVA 3KD7A 5KNHD 2KCKA 3LCAA 2AJAA 4OAVB 5EX3A 3PZ1A 4FLBA 3CVYA 2OCCE 4BESA 3RJVA 3HXFA 4LUNU 3V30A 4JHRA 4FA6A 1N4SA 5CCMA 4DLOA 1JCSA 2WM9A 2WXGA 3E34A 3S7FA 2KXPC 1HXIA 3QNKA 2AWIA 4UWFA 4DLQA 3ABKE 4HXIA 4XX5A 3ASGA 4Q96A 3TXMA 4BWRA 2UWJG 3BG0B 4BFRA 1O5MA 3UI2A 2ZIRA 2GRNB 3FUHA 3SF4A 3ML9A 2Y4TA 4DI3A 1TN8A 3R9MA 1OWLA 3AG2E 4Y6CA 1HH8A 3UT7A 2QY7A 4Y6WA 2XS1A 2GGFA 4DPRA 5JA4D 3QOUA 3ZKJA 4GYWA 5M72A 3P1UA 3SY2A 3ZGQA 4IRUA 2QFCA 3CLJA 1YMPA 1HS6A 1Z3XA 4TXPA 1FCHA 3B7UX 1SZAA 3CK9A 4RG6A 3Q79A 2WPVA 4WNEA 3F6QA 3MGBA 1UN8A 3Q47B 2XRYA 1W3BA 1MZCA 2E2EA 5BV1A 5KBAA 5JHBA 3EJNA 3ULYA 4BTAA 2BTDA 3ONKA 2ZGGA 3J5PA 4I6EA 1SA5A 4G1TA 4FADA 4K5CA 2WQ7A 4WNGA 1V54E 3PZ2A 3SNXA 2JABA 3TWTA 3CVXA 4LNGA 2OVFA 3TG4A 2KCLA 3ENEA 5FTPA 3DSSA 2OV8A 2ZISA 4PS3A 4IYPA 2ZGDA 4U96D 3NAWA 3E32A 3U3WA 1JWFA 1KLXA 2V0PA 5FT9A 3ZYMA 4L7TA 3T5VA 3ZN3A 2IY0C 5LFAA 5G55A 3T5XA 2B6CA 4UWGA 2FO7A 3SO8A 4ANVA 4HQDA 2J8SD 4BY6A 2AW6A 3PNLB 4HOTA 3LY7A 2GRLA 4RQIA 2EIKE 3VTYA 3C72A 5EILA 2VYIA 2XGSA 3NB2A 4GMLA 3C3OA 4MKTA 2VQ2A 4P29A 4TUUA 2J07A 3FTZA 5AQBA 3HRAA 1D8DA 4V3IA 3EIJA 2XHEA 3C98A 4WWNA 3PH0C 4LEUA 3CKBA 3ESKA 3MV2B 2WXIA 3CK8A 3UM2A 3CVLA 4FHKA 4PUCA 2J49A 1U3DA 3CVNA 4BSZB 3S7BA 1DC2A 3UKRG 3C5RA 4M7CA 4B94A 3IHYA 1YA0A 5AAOA 2Q7FA 1MQSA 3NBNB 1H2UA 4AY5A 3ZHEA 3IXEA 1Z3YA 5AIJA 1DNPA 1UG3A 2FO1E 2F8YA 2XPZA 4AV7A 3JYSA 3JUEA 4GTRA 5AARA 2DVWA 4W9RA 4YDWA 5AYWD 1TNYA 3ZYKA 1QBQA 1KPSB 2R02A 1HG5A 4F6RD 1K3ZD 3ASDA 4JVSA 2DYSE 1RZ4A 5EYLA 4CEMA 4EZJA 2H6HA 1NI1A 3ULQA 2CG3A 5D0QD 3GZSA 2YHCA 4KVMA 3ABME 4GYOA 2OVBA 3KEZA 2VGYA 4I9EA 2CHZA 3L13A 2F37A 5HI7A 1N94A 1IXVA 4U0ZA 4A3VA 3UM3A 3HIZA 4TRQA 2YINA 2R03A 2PNNA 5T8IA 4U04A 4U0SA 4EPZA 2WQ6A 3FUEA 4CDMA 4I6JA 4TUMA 3ZUVB 1YYHA 4J0UA 3AG4E 2ETBA 1TNUA 4DX1A 2VTBA 3HHMA 2V5FA 3PE4A 1PAQA 5D2MC 2L6JA 4KVOA 1NA0A 4A55A 4I17A 3FDHA 3D9KA 2H6GA 2V8SE 3VTXA 1H0AA 4J8SA 3RK6A 5HKPA 1A17A 3UT8A 4CZ2D 3S2AA 4UWKA 3E30A 2VJ8A 4GMJA 4UI9K 4KT6B 4RVBA 4B8AA 3U64A 3FFLA 4F53A 2P58C 3MKQB 1MX2A 4BT9A 4E6HA 3DPDA 5CBOA 4I9CA 3AS4A 5ARFA 2BKKB 4UQYA 4O1OA 3B7SA 3FUMA 2PM6A 3TJPA 3FUJA 3W9FA 1OCZE 3ZYLA 4HRNA 1OCOE 3R7RA 3U4TA 4U8YD 3UTMA 4FHJA 3IKOB 2VSOE 3PDNA 5AQ7A 3TWWA 3UT4A 2RFAA 4HORA 3HYMB 3ESLA 2GROB 3HXCA 3R7QA 3AS5A 4M3OA 5H7PA 5LOZA 4BSXA 3ZIMA 3HVEB 3OTNA 3L9TA 3UIOC 1KT0A 4HFGA 2UY1A 4U63A 2AXVA 4XI9A 4H7YA 3SFYA 2CHXA 4YDYA 1JPLA 4WWOA 5EYPF 2IFUA 2WXFA 3L16A 3MZLB 4N5QA 3UINC 1E90A 3V79K 2MYOA 2R5SA 1TJFA 4C9BB 4WUYA 4HRMB 1INZA 1TNOA 1GW6A 5E75A 1JCQA 2P9LG 1TN6A 2LSVA 3LJ3A 3TWRA 3TGOA 5ITZF 1TEZA 4AIFA 3PS6A 2KCVA 2VSYA 4UI9C 4KXKB 1K1BA 4NURA 5KJMA 2BF0X 4L23A 3B7BA 5AENA 3FU5A 1QYMA 4N5CA 2LAHA 4KMOA 3FP3A 3LJNA 4GTTA 5E76A 3ZRHA 1IQUA 3NZUA 4U07A 4HVBA 1Q2ZA 3CR3A 3PEVB 1ZBPA 3B95A 4HLEA 5ENQD 3MCXA 3S7JA 2XZDG 5CRVA 1G3NB 4HB5A 4GCNA 3RIBA 4NACA 5FINA 2IF4A 1H19A 3LY9A 2X6KA 1XNFA 1K8KG 4J7WA 1OY3D 3DEPA 4JA9A 4EZKA 3D9PA 1TR4A 4GU5A 5CHEE 3WXXA 2F0YA 1ELKA 3LDZA 2Y0BG 2DZOA 2GRQB 4JA7A 2ZXWE 3UM0A 2V5QC 1H2TC 3JXJA 4N3CA 3MJWA 1OWPA 3ONLA 3APFA 5BXUA 3OXFA 3CGHA 1IKND 4G8LA 4ME2A 4N3AA 4J8FA 4FJYA 4URKA 4OYSA 4AY6A 4QFVA 4HNAD 4DUIA 2WXNA 4AXHA 3UMVA 4CT4A 4J8EA 2H6IA 4JHKA 3NQPA 1LD8A 1ZB1A 1HE8A 3UXGA 3RO3A 4G23A 4PDXA 2IQCA 3FTYA 3ASFA 2H6FA 5ENRD 2P2CP 3HXDA 3DSTA 1TNZA 1JUQA 2IO2C 3P2BA 1E8WA 2KZTB 1HU3A 5FJYA 1IQRA 1E8ZA 2I9CA 2BEDA 3Q75A 3S7DA 3CK7A 3GW4A 3PZ3A 2AXUA 2FF4A 1LTXA 1O1SA 2PM7A 2LO6A 1TNBA 3UQ3A 3HXBA 5AJDA 5LCWC 4UI9J 3L17A 4E85A 4CDRA 2ETAA 4N3BA 5DBKA 4JC8A 4NRHB 2EILE 2EIME 1YCSB
chains in the Genus database with same CATH topology
3I4RB 5AYWD 1IHGA 3ZPJA 4AVXA 3AU4A 2XPIA 4FC8A 3ZYKA 2ONDA 4WWPA 2I2OA 3L22A 4DK5A 1HG5A 4ATGA 3NZSA 3ASDA 2IONA 4JVSA 1ELRA 3FUDA 2ZU6B 5A6CA 3AS8A 4JPSA 3ML8A 4GPKA 3SZ7A 1FVFA 3HVEA 3D9JA 5BW8C 3MV3B 4BTBA 3LY8A 4CEMA 3I5PA 3LYAA 5EX0A 2E0IA 3GZ1A 3ZHEB 1H2VC 4EZJA 2WVIA 2RG8A 3ULQA 3FTUA 2CG3A 4OVVA 1HZ4A 5D0QD 2Y4UA 4MLPA 4EQFA 4AM9A 3GZSA 2NC9A 4FU3A 4F3VA 2YHCA 4UQZA 3FU6A 4KVMA 4I2WA 2WMOA 5FZRA 3PE3A 4G11A 2VSNA 4JEUA 2WXOA 4GYOA 2XPYA 3JQ0A 2XGMA 3FHEA 4WNDA 2OVBA 4N2QA 5ENNA 5JJTA 3KEZA 4NQ0A 4HOSA 4F53A 2VGYA 5AJLA 3Q15A 2GRMA 3VLEA 4I9EA 1P5QA 2CHZA 3MX3A 3CHSA 3L13A 5HI7A 3CVPA 2HO1A 3FUNA 3PREA 5G05C 2RD0A 4PH4B 4U0ZA 5J90A 4A3VA 5CMYA 3EHNA 3HIZA 4TRQA 4PS8A 2YINA 4ACLA 4G26A 3JQ1A 3QB2A 5T8IA 2CFZA 4U04A 2WXKA 4U0SA 4EPZA 2KC7A 3BEEA 4BX9A 2WQ6A 4U8HA 5J08A 5FQ8A 4BT8A 3FUEA 3LPZA 4CDMA 2X3MA 2KATA 1HFAA 5BUZA 3CIAA 1EYHA 2R59A 4ACKA 2XQ0A 4I6JA 4GZDA 3LKUA 5JJ6A 5A7DB 3ZVVA 1PY1A 1H6KA 3UPVA 4J0UA 3RRMB 3CHOA 4XE0A 3RRNB 3CKCA 3QWVA 1JWGA 2PL2A 3EIQC 3PRZA 4EBAA 4PS7A 1SZ9A 4GCOA 3HHMA 2V5FA 3G2WA 5KJLA 2VTBA 3PE4A 2IOSA 1PAQA 3NF1A 3CV0A 3TXNA 4I1MA 4DJAA 2L6JA 3JCKC 2LNIA 3L6AA 4KVOA 1NA0A 4A55A 3BG1B 3CQCB 1Z6TA 4I17A 3ZXSA 1HO8A 5KCMA 4ABNA 1B89A 3FDHA 1EDUA 2I1KA 1QQEA 3OXGA 4KBQA 3D9KA 2V8SE 2DBAA 3VTXA 2X6FA 2L0IA 5FZSA 1H0AA 4J8SA 4JZYA 3IHVA 3RK6A 3D9NA 3PZDA 3G2VA 1A17A 3UT8A 4KYOB 4UWLA 3IV0A 2XCBA 3FTVA 2EQXA 3S2AA 4UWKA 1OWNA 2L0TB 3ZFWA 5ARGA 3APDA 3QC1A 2VJ8A 4GMJA 4UQXA 3FULA 4UI9K 2MHKA 4D10C 5G04J 1UJJA 1OUVA 3IBEA 3MEKA 4KT6B 3FFLA 4O6FA 4RVBA 3CEQA 3FEXA 3MYVA 2P58C 5C2YA 3U64A 3CSFA 3MKQB 3SBTB 1FVHA 4EBAG 4BT9A 4ANWA 4EZLA 3I3NA 4YVQC 2VTBB 5CMWA 2MOWA 3DPDA 4E6HA 1XGWA 3FUFA 3AS4A 4GYYA 4I9CA 5ARFA 2WXMA 2IU1A 4UQYA 3I4GA 3B7SA 3D9IA 2XRZA 3FUMA 2PM6A 4JEHA 4XZ4A 4N39A 3TJPA 3FUJA 4WNFA 4AOFA 3LEWA 4I1AA 2FEZA 2A5UA 3ZYLA 2WMNA 2BUGA 3FU3A 2C0LA 3QK0A 2AXZA 3KD7A 3R7RA 3EHMA 3U4TA 2VGXB 2KCKA 4XKCA 1VDYA 3LCAA 3SI5A 1OWOA 4FHJA 4R7LA 2IJGX 3IKOB 5BV0A 5C1DA 2I6HA 4MS6A 4IN3B 2VSOE 5EX3A 4GZCA 3D9MA 4FLBA 5DIZA 3CVYA 3CVQA 2WXQA 1DVPA 4GAAA 3PDNA 5LCWJ 1EF1C 4A3TA 3LS8A 4L1BA 3UT4A 2ILRA 5EKQD 2AVPA 3RJVA 1IYGA 4CGVA 4HORA 1LF8A 3RU0A 1WM5A 1QNFA 4LUNU 4K0RA 3B7TA 3OAWA 3HYMB 3ESLA 2J4BA 4JHRA 3PUJA 5JJ7A 3OXLA 3R7QA 2I1JA 4FA6A 1QZ2A 5CCMA 3AS5A 4K03A 4DLOA 5CCLA 4M3OA 5LOZA 3ZEFA 2WM9A 4IULA 2WXGA 3ASHA 4BSXA 2WXHA 3S7FA 3ZIMA 1HXIA 3QNKA 3HVEB 3CVVA 3U66A 3OTNA 2AWIA 2X6JA 4Q69A 1E8XA 4GA2A 4G24A 2HM8A 4UWFA 5FQ4A 3LVQE 4DLQA 4HXIA 4JHJA 4XX5A 5JHAA 1KT0A 3ASGA 4HFGA 4DI4A 1EPUA 2NXPA 4Q96A 4AEZC 2UY1A 4U63A 1E7VA 3DBSA 3B7RL 2AXVA 5LX8A 4XI9A 1NP7A 3TXMA 4H7YA 3FU0A 2CHXA 1NA3A 3U9WA 4BWRA 1JPLA 2UWJG 1N52A 3BG0B 4UWHA 4BFRA 4TV3A 4WWOA 2YNQA 3FY4A 1WAO1 3FUHA 3SF4A 2XGOA 2IFUA 2CG2A 3Q5MA 1E8YA 2FI7A 2C2LA 2WXFA 2Y4TA 3L16A 3MZLB 3ML9A 4XIFA 1SQMA 4DI3A 4C0EA 4LERA 2DCPA 1MHQA 2KZTA 1E90A 3ZYQA 1OWLA 4Y6CA 3D9LA 2MRIA 2R5SA 4N2SA 4L2YA 1HH8A 1TJFA 5G05J 3UT7A 4C9BB 4WUYA 1INZA 1UW4B 4MRUA 1GW6A 2QY7A 2JLBA 4B0ZA 2HYZA 4FLHA 4Y6WA 3PEUB 3QWWA 5E75A 2GGFA 4XI0A 2XCCA 4DPRA 3TL5A 3CVWA 2LSVA 3LJ3A 3QOUA 5FZQA 3RRUA 3AU5A 3TGOA 1TEZA 4AIFA 3PS6A 4ANUA 4GYWA 4ANXA 3QJZA 2L9BA 3P1UA 5M72A 4CRWA 2KCVA 2VSYA 4GB9A 3QAQA 5FQ7A 4UI9C 4JL0A 4L2LA 3QARA 4LCTA 2J9QA 3FTXA 3D3MA 3ZGQA 1HX8A 4IRUA 3PNTB 2FBNA 2QFCA 3EDTB 4FP7A 3SFZA 3URZA 3CLJA 2KM4A 4KXKB 3R9AB 1HS6A 3G2TA 4B8AA 1Z3XA 4J6IA 4NURA 1ZU2A 1FCHA 3B7UX 1SZAA 2X38A 3CK9A 4I6GA 4RG6A 5KJMA 2BF0X 2WPVA 4H7XA 4L23A 5AENA 3FU5A 4N5CA 4WNEA 2LAHA 4KMOA 3APCA 3FP3A 4J8DA 3Q49B 4GA1A 4GA0A 3MGBA 2WXRA 4ILHB 3CHPA 2WXPA 2GW1A 1IQUA 1UN8A 5E76A 3Q47B 3ZRHA 4GZ3A 2XRYA 3CHRA 3PVLA 4GZ5A 1W3BA 3PUKA 1HG2A 5ANRA 3HDXA 3Q4AB 3NZUA 4U07A 2NSZA 4HVBA 2E2EA 4RG9A 3CR3A 5BV1A 4F7AA 3PEVB 1OWMA 1ZBPA 1L5JA 2IOLA 4FJZA 2WXLA 3EJNA 5JHBA 3LXUX 4HLEA 2XEVA 4BTAA 3MCXA 2BTDA 3S7JA 3VLDA 4RSYA 3ONKA 4G2VA 4GCNA 5EDSA 3RIBA 1BPOA 4I6EA 4I43A 4Q94A 4XKBA 4G1TA 4FADA 3FH5A 4NACA 2IF4A 4KZ0A 1H19A 3LY9A 2X6KA 2WQ7A 5ANLA 2HR2A 1XNFA 3TAXA 5A23A 4WNGA 1S0PA 3K9IA 4U0UA 3FWVA 2J08A 4GZ6A 1Y6IA 5HQ8A 4APFA 2R17C 4JA9A 4EZKA 3D9PA 3SNXA 3SBSA 4GU5A 5CHEE 4C0MA 2M63A 3CHMA 2PQRA 5D0OD 1ELKA 2OOEA 3MA5A 3WXXA 3CHQA 3LDZA 3CVXA 1U3CA 5FQ6A 4B89A 3SHFA 2OVFA 3TG4A 2KCLA 3ENEA 5FTPA 1E96B 4HS2A 4JA7A 2OV8A 1Y8MA 3RKVA 3N71A 3UUXA 1WY6A 4PS3A 5KJNA 4IYPA 5BNWA 4BX8A 1H2TC 3B13A 4N3CA 3MJWA 4OVUA 1OWPA 3ONLA 4A1GA 3APFA 3G2SA 3U3WA 3RO2A 1JWFA 1KLXA 1N54A 2V0PA 3OXFA 3CGHA 5FT9A 4L7TA 3ZYMA 3T5VA 3ZN3A 5LFAA 4JW1A 5G55A 3IEGA 4CCAA 3T5XA 4EECA 3JUIA 4ME2A 5BT1A 2CFUA 2LAIA 2YHEA 4UWGA 2FO7A 2X6HA 4ANVA 4CT0A 4BY6A 1TJCA 2AW6A 1UJKA 3PNLB 2C0MA 4N3AA 4J8FA 4HOTA 3FUKA 3LY7A 1X5BA 4FJYA 2WXJA 4URKA 4FULA 2GRLA 1KT1A 2YQ8A 4ILIA 4OYSA 4WAFA 3VTYA 3D9OA 3KAEA 4AY6A 2VYIA 2XGSA 2WQHA 4GMLA 4QFVA 3CQGB 3FTSA 5LP0A 5T4YA 4HOUA 4AJWA 4MKTA 2VQ2A 2WXNA 4AXHA 4P29A 4TUUA 2J07A 3UMVA 4KZCA 4CDNA 4CT4A 3FH8A 3FTZA 2J4DA 3O48A 4J8EA 4I1OB 2UY1B 5G04C 3E4BA 4JHKA 4CGWA 3NQPA 2DIWA 3QDNA 5KJKA 1NZNA 4V3IA 3EIJA 4YVOA 1HE8A 2XHEA 3C98A 4WWNA 3MKQA 3RO3A 2J09A 3PH0C 4G23A 4LEUA 3VLFA 4PDXA 2IQCA 3CKBA 2VSXE 3G2UA 3FTYA 3ASFA 3ESKA 4YNDA 4I2ZA 2Y3AA 3GYZA 3MV2B 2WXIA 3CK8A 3MKRA 3QWPA 2A4ZA 1JUQA 4JXTA 2CHWA 3CVLA 4FHKA 4AP2A 3P2BA 3FTWA 1E8WA 2KZTB 2PZIA 4PUCA 2J49A 1U3DA 3CVNA 3S7BA 1HU3A 2JEKA 2FULA 5FJYA 1IQRA 3CSTA 1E8ZA 4ILGA 2I9CA 3T8MA 2PQNA 3CK7A 3S7DA 3SGHA 2V4LA 3GW4A 4F1SA 4B94A 3IHYA 1YA0A 3TG5A 1E7UA 3UX4A 3L08A 4B8CB 2VGXA 1HF8A 2Q7FA 3KS2A 2AXUA 2FF4A 1MQSA 1H2UA 4A1SA 4AY5A 2PM7A 3QKYA 2LO6A 3ZHEA 4APOA 1PC2A 3FUIA 5FWQA 3UQ3A 3GZ2A 1Z3YA 5AIJA 1DNPA 3SD5A 1UG3A 1ELWA 4G25A 3FEYA 5AJDA 5LCWC 2X6IA 2LSUA 4UI9J 5T3RA 3L17A 4LRZA 2WB2A 3FH7A 4E85A 4HOQA 3L54A 4CDRA 2XPZA 3LVRE 4N3BA 5DBKA 4AV7A 3JYSA 4JC8A 5BPPA 3CVUA 1UN9A 4NRHB 3ZW3A 5G2NA 3O4ZA 4W9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYW D;  3ZPJ A;  1IHG A;  2XPI A;  2OND A;  3ASD A;  1ELR A;  5A6C A;  3AS8 A;  4GPK A;  3SZ7 A;  5BW8 C;  3MV3 B;  4BTB A;  3LY8 A;  3LYA A;  5EX0 A;  3GZ1 A;  3ZHE B;  3ULQ A;  1HZ4 A;  5D0Q D;  2Y4U A;  4EQF A;  4AM9 A;  2NC9 A;  4F3V A;  2YHC A;  4UQZ A;  5FZR A;  4I2W A;  3PE3 A;  2VSN A;  4GYO A;  2XGM A;  4WND A;  4N2Q A;  5JJT A;  4HOS A;  4NQ0 A;  2VGY A;  3Q15 A;  4I9E A;  1P5Q A;  5HI7 A;  3CVP A;  2HO1 A;  5G05 C;  4U0Z A;  4G26 A;  4U04 A;  4U0S A;  2KC7 A;  3BEE A;  4BT8 A;  3LPZ A;  2KAT A;  3LKU A;  5JJ6 A;  5A7D B;  3UPV A;  4J0U A;  3CKC A;  3QWV A;  2PL2 A;  4GCO A;  2V5F A;  5KJL A;  3PE4 A;  3NF1 A;  3CV0 A;  2L6J A;  2LNI A;  1NA0 A;  4ABN A;  4I17 A;  1B89 A;  3OXG A;  1QQE A;  4KBQ A;  2DBA A;  3VTX A;  5FZS A;  1A17 A;  4KYO B;  2XCB A;  3ZFW A;  5ARG A;  4UQX A;  4UI9 K;  2MHK A;  5G04 J;  4O6F A;  1OUV A;  3MEK A;  3FFL A;  3CEQ A;  2P58 C;  4BT9 A;  4YVQ C;  4I9C A;  3AS4 A;  4GYY A;  5ARF A;  4UQY A;  4N39 A;  4WNF A;  4I1A A;  2FEZ A;  2BUG A;  2C0L A;  3KD7 A;  3U4T A;  2VGX B;  2KCK A;  3LCA A;  5C1D A;  2I6H A;  4IN3 B;  5EX3 A;  5DIZ A;  3CVQ A;  3PDN A;  5LCW J;  5EKQ D;  2AVP A;  3RJV A;  1IYG A;  4CGV A;  4HOR A;  3RU0 A;  1WM5 A;  3HYM B;  4JHR A;  5JJ7 A;  3OXL A;  1QZ2 A;  5CCM A;  3AS5 A;  5CCL A;  3ASH A;  3S7F A;  1HXI A;  4GA2 A;  4G24 A;  1KT0 A;  3ASG A;  2UY1 A;  4XI9 A;  4H7Y A;  1NA3 A;  4BWR A;  2UWJ G;  1WAO 1;  3SF4 A;  2XGO A;  2IFU A;  3Q5M A;  4GA0 A;  2FI7 A;  2C2L A;  2Y4T A;  4XIF A;  4Y6C A;  2R5S A;  4N2S A;  1HH8 A;  5G05 J;  4WUY A;  2JLB A;  2HYZ A;  4Y6W A;  3QWW A;  4XI0 A;  2XCC A;  2LSV A;  3QOU A;  5FZQ A;  3TGO A;  4AIF A;  4GYW A;  5M72 A;  2KCV A;  2VSY A;  4UI9 C;  4JL0 A;  2J9Q A;  3ZGQ A;  2FBN A;  2QFC A;  3EDT B;  3URZ A;  4KXK B;  3R9A B;  1ZU2 A;  1FCH A;  3CK9 A;  4RG6 A;  5KJM A;  2WPV A;  4H7X A;  4N5C A;  4WNE A;  3FP3 A;  4J8D A;  3Q49 B;  4GA1 A;  2GW1 A;  3Q47 B;  4GZ3 A;  4GZ5 A;  1W3B A;  3Q4A B;  4U07 A;  2E2E A;  4RG9 A;  1ZBP A;  2XEV A;  4BTA A;  3S7J A;  4G2V A;  4GCN A;  3RIB A;  4G1T A;  2IF4 A;  3LY9 A;  2HR2 A;  1XNF A;  3TAX A;  4WNG A;  3K9I A;  4U0U A;  3FWV A;  4GZ6 A;  5HQ8 A;  4JA9 A;  5CHE E;  3WXX A;  2PQR A;  2OOE A;  3MA5 A;  5D0O D;  3TG4 A;  2KCL A;  5FTP A;  1E96 B;  4JA7 A;  1Y8M A;  3RKV A;  3N71 A;  3UUX A;  5KJN A;  5BNW A;  4N3C A;  3U3W A;  3RO2 A;  1KLX A;  3OXF A;  5FT9 A;  3ZN3 A;  3IEG A;  4ME2 A;  5BT1 A;  2FO7 A;  1TJC A;  2C0M A;  4N3A A;  4J8F A;  4HOT A;  3LY7 A;  1KT1 A;  2YQ8 A;  3VTY A;  3KAE A;  4AY6 A;  2VYI A;  2XGS A;  2WQH A;  4HOU A;  2VQ2 A;  4J8E A;  3O48 A;  2UY1 B;  5G04 C;  3E4B A;  4CGW A;  3QDN A;  5KJK A;  1NZN A;  4YVO A;  3RO3 A;  4G23 A;  4LEU A;  3CKB A;  3ASF A;  3ESK A;  4YND A;  4I2Z A;  3GYZ A;  3MV2 B;  3CK8 A;  3MKR A;  3QWP A;  3CVL A;  2PZI A;  3CVN A;  3S7B A;  5FJY A;  2PQN A;  3CK7 A;  3S7D A;  3GW4 A;  4B94 A;  1YA0 A;  3TG5 A;  2VGX A;  2Q7F A;  3KS2 A;  2FF4 A;  4A1S A;  4AY5 A;  3QKY A;  3ZHE A;  4APO A;  1PC2 A;  3UQ3 A;  3GZ2 A;  1ELW A;  4G25 A;  5LCW C;  2LSU A;  4UI9 J;  4HOQ A;  4CDR A;  4N3B A;  5DBK A;  3JYS A;  4NRH B;  4W9R A; 
#chains in the Genus database with same CATH topology
 3ZPJ A;  5B1B E;  3AU4 A;  4WWP A;  3L22 A;  1DCQ A;  3NZS A;  2ION A;  1ELR A;  3AS8 A;  4JPS A;  3ML8 A;  1FVF A;  3MV3 B;  1N0Q A;  3LYA A;  2E0I A;  3GZ1 A;  3ZHE B;  4YDE A;  2IO3 C;  4U95 D;  3UM1 A;  4OVV A;  4MLP A;  4EQF A;  2NC9 A;  4FU3 A;  4F3V A;  5FZR A;  4I2W A;  2P9N G;  1AWC B;  5ENN A;  5JJT A;  4HOS A;  4NQ0 A;  1S64 A;  5AJL A;  2GRM A;  1P5Q A;  3MX3 A;  3CHS A;  3CVP A;  2HO1 A;  4JD2 G;  1D8E A;  2BKG A;  3SFX A;  2RD0 A;  4PH4 B;  3DPY A;  4ACL A;  3JQ1 A;  3BEE A;  3WG7 E;  4U8H A;  5J08 A;  4BT8 A;  2P9I G;  1OXJ A;  4GZD A;  3RAU A;  3LKU A;  5JJ6 A;  3ZNG A;  3JXI A;  1N11 A;  3DXM G;  1H6K A;  2EIJ E;  3UKU G;  3UPV A;  2P9P G;  4XE0 A;  3RRN B;  3AJI A;  2QC9 A;  1JWG A;  2PL2 A;  3EIQ C;  3SQV A;  5CEA A;  4GCO A;  5KJL A;  3G2W A;  5CBN A;  4DJA A;  3HXE A;  3CQC B;  1Z6T A;  1SW6 A;  2L6B A;  4KBQ A;  2DBA A;  2X6F A;  4JZY A;  3IHV A;  3PZD A;  4UWL A;  2XCB A;  2XEN A;  1OWN A;  3ZFW A;  3APD A;  2DWZ A;  1OUV A;  3EHR A;  3MYV A;  3EU9 A;  3SBT B;  4ANW A;  3I3N A;  2VTB B;  5CMW A;  5AQ9 A;  4NIK A;  1N4P A;  4RLY A;  3I4G A;  2A5E A;  1OCC E;  4N39 A;  4AOF A;  3LEW A;  4GTV A;  3ULE G;  4I1A A;  3FU3 A;  2C0L A;  3EHM A;  1BU9 A;  2VGX B;  4XKC A;  1VDY A;  1H6P A;  2EIN E;  5BV0 A;  5C1D A;  2I6H A;  5DIZ A;  1DVP A;  3C3R A;  5LCW J;  3NOG D;  3LS8 A;  4L1B A;  2ILR A;  5EKQ D;  2AVP A;  1IYG A;  3ASO E;  1WM5 A;  4K0R A;  2J4B A;  3PUJ A;  1A5E A;  2I1J A;  1QZ2 A;  3DEO A;  4K03 A;  4IUL A;  3ASH A;  3U66 A;  1BD8 A;  1E8X A;  4GA2 A;  4G24 A;  5FQ4 A;  4JHJ A;  4LNU D;  2NXP A;  1E7V A;  3DBS A;  5LX8 A;  1NP7 A;  3FU0 A;  3U9W A;  4UWH A;  4TV3 A;  2YNQ A;  3FY4 A;  4GTO A;  2CG2 A;  2FI7 A;  2C2L A;  4XIF A;  4U7E B;  4C0E A;  3HG0 D;  2DCP A;  1MHQ A;  3ZYQ A;  4L2Y A;  1UW4 B;  4MRU A;  2JLB A;  2XEE A;  4FLH A;  3ASN E;  3QWW A;  4XI0 A;  5AQA A;  2XCC A;  3AU5 A;  3QJZ A;  5FQ7 A;  5ENO D;  4A63 B;  4JL0 A;  4L2L A;  3QAR A;  4CYM D;  2J9Q A;  5ENS D;  1HX8 A;  3EDT B;  3SFZ A;  3URZ A;  2KM4 A;  3G2T A;  1ZU2 A;  2X38 A;  4I6G A;  4H7X A;  1BI7 B;  4J8D A;  3Q49 B;  2WXR A;  2WXP A;  2QYU A;  4GZ3 A;  3DXK G;  4GZ5 A;  3CHR A;  3PVL A;  5KWD A;  5ANR A;  1AP7 A;  3HDX A;  3Q4A B;  3DRA A;  1S70 B;  4RG9 A;  4F7A A;  1L5J A;  4FJZ A;  2DYR E;  2WXL A;  4DX2 A;  4G2V A;  1BPO A;  3DSU A;  4I43 A;  4XKB A;  3TWX A;  3FH5 A;  5ANL A;  5A23 A;  3K9I A;  4U0U A;  3FWV A;  3T9K A;  1Y6I A;  4APF A;  1FT2 A;  4HI8 A;  3SBS A;  3CHM A;  2PQR A;  1OT8 A;  5D0O D;  3CHQ A;  1U3C A;  5FQ6 A;  4B89 A;  2RFM A;  3SHF A;  2XEH A;  1E96 B;  3Q9U C;  2P9U G;  4HS2 A;  5ENT D;  1Y8M A;  3RKV A;  3UUX A;  1WY6 A;  2LXM A;  5BNW A;  3B13 A;  4OVU A;  3G2S A;  3RO2 A;  4JW1 A;  3JUI A;  3Q7A A;  5BT1 A;  2LAI A;  2X6H A;  1TJC A;  1UJK A;  2C0M A;  1X5B A;  2Y69 E;  2WXJ A;  4FUL A;  1KT1 A;  2VGE A;  2YQ8 A;  2IEJ A;  4ILI A;  4WAF A;  3D9O A;  3KAE A;  1KZO A;  2WQH A;  3KSL A;  5T4Y A;  5LP0 A;  3PZ4 A;  4K5A B;  4ZFH A;  3O48 A;  3V2O A;  4I1O B;  2HE0 A;  4CGW A;  1LD7 A;  1NZN A;  4YVO A;  3MKQ A;  3DSV A;  3VLF A;  3W9G A;  2VSX E;  3G2U A;  1JCR A;  4I2Z A;  4JXT A;  2CHW A;  5HRY A;  2JEK A;  5B1A E;  5KNG A;  3CST A;  4GTP A;  4ILG A;  4Z68 A;  3T8M A;  3SGH A;  3UX4 A;  3DWL G;  3TG5 A;  4C48 B;  3AAA C;  1HF8 A;  1IHB A;  4APO A;  1PC2 A;  3FUI A;  5FWQ A;  4X8Q A;  1ELW A;  4G25 A;  3FEY A;  2X6I A;  2LSU A;  4LRZ A;  3TWV A;  4HBD A;  3L54 A;  3LVR E;  3EU5 A;  3CVU A;  3I4R B;  1IHG A;  3BQO A;  2XPI A;  4FC8 A;  1FPP A;  1BI8 B;  3Q7F A;  4LNB A;  4DK5 A;  4ATG A;  3ZXP A;  5A6C A;  3SZ7 A;  3D9H A;  3HVE A;  3D9J A;  3FTU A;  1HZ4 A;  4GTM A;  2Y4U A;  1UOH A;  2V4H C;  2QYJ A;  4AM9 A;  4UQZ A;  3FU6 A;  5CRU A;  4ZHB A;  2XGM A;  3E37 A;  3BUA A;  5HS0 A;  3VLE A;  3FUN A;  3PRE A;  3X2Q E;  5G05 C;  5D66 A;  3EHN A;  4G26 A;  2KBX A;  5CER B;  3J5Q B;  3AG1 E;  3DSW A;  2CFZ A;  4DRX E;  2KC7 A;  5CEC B;  4BX9 A;  5FQ8 A;  4BER A;  3LPZ A;  2KAT A;  1HFA A;  3CIA A;  2NYJ A;  1Z5S C;  2R59 A;  2XQ0 A;  3Q73 A;  5A7D B;  3ZVV A;  3TWS A;  3RRM B;  3CHO A;  2DZN A;  3PRZ A;  4PS7 A;  3NOC D;  3NF1 A;  3E33 A;  4I1M A;  3JCK C;  3TWQ A;  2R2L A;  1SVX A;  4ATZ D;  2P9S G;  5KCM A;  3OXG A;  1EDU A;  2I1K A;  1QQE A;  1NFI E;  2RKK A;  2XS8 A;  5FZS A;  2LXL A;  3BU8 A;  3FTV A;  2EQX A;  5CED B;  4DX6 D;  5ARG A;  3QC1 A;  4D10 C;  3IBE A;  3MEK A;  5C2Y A;  3CEQ A;  4EBA G;  3FUF A;  3TWU A;  4GYY A;  2WXM A;  4XZ4 A;  2FEZ A;  2A5U A;  2WMN A;  1N4R A;  3SI5 A;  3Q9N C;  1MYO A;  1FT1 A;  1OWO A;  4R7L A;  1MJ0 A;  2IJG X;  4MBG A;  4MS6 A;  4IN3 B;  4GZC A;  3D9M A;  1H6O A;  2WXQ A;  3CVQ A;  4GAA A;  1EF1 C;  4A3T A;  4LSZ E;  5IY5 E;  4CGV A;  3KSQ A;  1LF8 A;  3RU0 A;  1QNF A;  3B7T A;  3OAW A;  4YDO A;  5JJ7 A;  3OXL A;  4U8V D;  5JMN D;  5CCL A;  3ZEF A;  4GMR A;  2WXH A;  3CVV A;  2X6J A;  4DX5 D;  4Q69 A;  2HM8 A;  3LVQ E;  4B93 B;  5JHA A;  4DI4 A;  1EPU A;  4AEZ C;  3B7R L;  4DX7 D;  1RW2 A;  1NA3 A;  1N52 A;  2OEW A;  1WAO 1;  1TN7 A;  2XGO A;  3Q5M A;  4GA0 A;  1E8Y A;  1SQM A;  4LER A;  2KZT A;  4UUC A;  3D9L A;  1N0R A;  2MRI A;  4N2S A;  4O1P A;  5G05 J;  5B3S E;  4B0Z A;  3L82 A;  2HYZ A;  1MX6 A;  3PEU B;  3TL5 A;  3CVW A;  5FZQ A;  3RRU A;  3RSE G;  4ANU A;  4ANX A;  2L9B A;  4J8Y A;  4CRW A;  4GB9 A;  3QAQ A;  1WG0 A;  4LCT A;  3FTX A;  3D3M A;  1NL4 A;  2FBN A;  3PNT B;  5FIO A;  4FP7 A;  1N9A A;  2ETC A;  3R9A B;  4J6I A;  1OCR E;  3APC A;  4GA1 A;  4ILH B;  3CHP A;  2GW1 A;  5EIB E;  3ZU7 B;  3PUK A;  1HG2 A;  4GTS A;  2NSZ A;  1OWM A;  2IOL A;  4BEP A;  1SA4 A;  3LXU X;  2XEV A;  3VLD A;  4RSY A;  2R05 A;  1N4Q A;  5EDS A;  1BLX B;  1S63 A;  4Q94 A;  4KZ0 A;  3ISM C;  2HR2 A;  3TAX A;  1S0P A;  5AN8 A;  2J08 A;  4GZ6 A;  4HI9 A;  5BXO A;  5HQ8 A;  4HRL A;  2R17 C;  4C0M A;  2M63 A;  3V31 A;  2OOE A;  3MA5 A;  4F1P A;  4JB8 P;  4QQI A;  3N71 A;  1O1R A;  5EN5 D;  5KJN A;  4BX8 A;  4A1G A;  1U2V G;  1N54 A;  4TXQ A;  3IEG A;  4CCA A;  4EEC A;  2F8X K;  4OAU C;  2CFU A;  2YHE A;  4CT0 A;  3FUK A;  1DCE A;  2GRP B;  1D9S A;  3CQG B;  3FTS A;  4HOU A;  4AJW A;  1KZP A;  4HLL A;  4CDN A;  4KZC A;  3FH8 A;  2J4D A;  2UY1 B;  5G04 C;  3E4B A;  2DIW A;  3QDN A;  5KJK A;  4LG6 A;  2J09 A;  4YND A;  2Y3A A;  3GYZ A;  3Q78 A;  2P9K G;  3MKR A;  3QWP A;  2A4Z A;  4AP2 A;  3FTW A;  2PZI A;  2FUL A;  2PQN A;  2V4L A;  4F1S A;  3ABL E;  1E7U A;  3L08 A;  4B8C B;  2VGX A;  3KS2 A;  3DSX A;  4A1S A;  2OEV A;  3QKY A;  3T8K A;  3GZ2 A;  3SD5 A;  1WDY A;  5T3R A;  2WB2 A;  3FH7 A;  4HOQ A;  5BPP A;  3V2X A;  1UN9 A;  3ZW3 A;  5G2N A;  3O4Z A;  3UIP C;  4AVX A;  2B0O E;  2OND A;  2I2O A;  3FUD A;  4GPM A;  2ZU6 B;  4GPK A;  5BW8 C;  4BTB A;  3LY8 A;  3I5P A;  4XEI G;  5EX0 A;  1H2V C;  2WVI A;  2RG8 A;  3C3Q A;  2XZT G;  4L9P A;  2WMO A;  4JEU A;  3PE3 A;  2VSN A;  4G11 A;  2WXO A;  2XPY A;  3JQ0 A;  3FHE A;  1X81 A;  4WND A;  4N2Q A;  1TYQ G;  5EID A;  3Q15 A;  1K1A A;  2GRR B;  4G8K A;  5J90 A;  5CMY A;  4PS8 A;  3QB2 A;  1V55 E;  2WXK A;  5ENP D;  2X3M A;  4K5B A;  4GTQ A;  5BUZ A;  1EYH A;  4ACK A;  1PY1 A;  3KEA A;  3CKC A;  3QWV A;  4O60 A;  4EBA A;  1SZ9 A;  2IOS A;  3CV0 A;  3TXN A;  4EHM A;  1O1T A;  2LNI A;  3L6A A;  3BG1 B;  3ZXS A;  4ABN A;  1HO8 A;  1B89 A;  4BET A;  2L0I A;  3D9N A;  3EHQ A;  3G2V A;  4KYO B;  3IV0 A;  2QZA A;  1N95 A;  2L0T B;  4UQX A;  3FUL A;  2MHK A;  5G04 J;  1UJJ A;  4O6F A;  4TXR A;  3FEX A;  3CSF A;  1FVH A;  4EZL A;  4YVQ C;  2MOW A;  1XGW A;  2LUH A;  2IU1 A;  2Y1L E;  3D9I A;  2XRZ A;  1MX4 A;  4JEH A;  4WNF A;  2BUG A;  3AG3 E;  3QK0 A;  2AXZ A;  3EUV A;  3KD7 A;  5KNH D;  2KCK A;  3LCA A;  2AJA A;  4OAV B;  5EX3 A;  3PZ1 A;  4FLB A;  3CVY A;  2OCC E;  4BES A;  3RJV A;  3HXF A;  4LUN U;  3V30 A;  4JHR A;  4FA6 A;  1N4S A;  5CCM A;  4DLO A;  1JCS A;  2WM9 A;  2WXG A;  3E34 A;  3S7F A;  2KXP C;  1HXI A;  3QNK A;  2AWI A;  4UWF A;  4DLQ A;  3ABK E;  4HXI A;  4XX5 A;  3ASG A;  4Q96 A;  3TXM A;  4BWR A;  2UWJ G;  3BG0 B;  4BFR A;  1O5M A;  3UI2 A;  2ZIR A;  2GRN B;  3FUH A;  3SF4 A;  3ML9 A;  2Y4T A;  4DI3 A;  1TN8 A;  3R9M A;  1OWL A;  3AG2 E;  4Y6C A;  1HH8 A;  3UT7 A;  2QY7 A;  4Y6W A;  2XS1 A;  2GGF A;  4DPR A;  5JA4 D;  3QOU A;  3ZKJ A;  4GYW A;  5M72 A;  3P1U A;  3SY2 A;  3ZGQ A;  4IRU A;  2QFC A;  3CLJ A;  1YMP A;  1HS6 A;  1Z3X A;  4TXP A;  1FCH A;  3B7U X;  1SZA A;  3CK9 A;  4RG6 A;  3Q79 A;  2WPV A;  4WNE A;  3F6Q A;  3MGB A;  1UN8 A;  3Q47 B;  2XRY A;  1W3B A;  1MZC A;  2E2E A;  5BV1 A;  5KBA A;  5JHB A;  3EJN A;  3ULY A;  4BTA A;  2BTD A;  3ONK A;  2ZGG A;  3J5P A;  4I6E A;  1SA5 A;  4G1T A;  4FAD A;  4K5C A;  2WQ7 A;  4WNG A;  1V54 E;  3PZ2 A;  3SNX A;  2JAB A;  3TWT A;  3CVX A;  4LNG A;  2OVF A;  3TG4 A;  2KCL A;  3ENE A;  5FTP A;  3DSS A;  2OV8 A;  2ZIS A;  4PS3 A;  4IYP A;  2ZGD A;  4U96 D;  3NAW A;  3E32 A;  3U3W A;  1JWF A;  1KLX A;  2V0P A;  5FT9 A;  3ZYM A;  4L7T A;  3T5V A;  3ZN3 A;  2IY0 C;  5LFA A;  5G55 A;  3T5X A;  2B6C A;  4UWG A;  2FO7 A;  3SO8 A;  4ANV A;  4HQD A;  2J8S D;  4BY6 A;  2AW6 A;  3PNL B;  4HOT A;  3LY7 A;  2GRL A;  4RQI A;  2EIK E;  3VTY A;  3C72 A;  5EIL A;  2VYI A;  2XGS A;  3NB2 A;  4GML A;  3C3O A;  4MKT A;  2VQ2 A;  4P29 A;  4TUU A;  2J07 A;  3FTZ A;  5AQB A;  3HRA A;  1D8D A;  4V3I A;  3EIJ A;  2XHE A;  3C98 A;  4WWN A;  3PH0 C;  4LEU A;  3CKB A;  3ESK A;  3MV2 B;  2WXI A;  3CK8 A;  3UM2 A;  3CVL A;  4FHK A;  4PUC A;  2J49 A;  1U3D A;  3CVN A;  4BSZ B;  3S7B A;  1DC2 A;  3UKR G;  3C5R A;  4M7C A;  4B94 A;  3IHY A;  1YA0 A;  5AAO A;  2Q7F A;  1MQS A;  3NBN B;  1H2U A;  4AY5 A;  3ZHE A;  3IXE A;  1Z3Y A;  5AIJ A;  1DNP A;  1UG3 A;  2FO1 E;  2F8Y A;  2XPZ A;  4AV7 A;  3JYS A;  3JUE A;  4GTR A;  5AAR A;  2DVW A;  4W9R A;  4YDW A;  5AYW D;  1TNY A;  3ZYK A;  1QBQ A;  1KPS B;  2R02 A;  1HG5 A;  4F6R D;  1K3Z D;  3ASD A;  4JVS A;  2DYS E;  1RZ4 A;  5EYL A;  4CEM A;  4EZJ A;  2H6H A;  1NI1 A;  3ULQ A;  2CG3 A;  5D0Q D;  3GZS A;  2YHC A;  4KVM A;  3ABM E;  4GYO A;  2OVB A;  3KEZ A;  2VGY A;  4I9E A;  2CHZ A;  3L13 A;  2F37 A;  5HI7 A;  1N94 A;  1IXV A;  4U0Z A;  4A3V A;  3UM3 A;  3HIZ A;  4TRQ A;  2YIN A;  2R03 A;  2PNN A;  5T8I A;  4U04 A;  4U0S A;  4EPZ A;  2WQ6 A;  3FUE A;  4CDM A;  4I6J A;  4TUM A;  3ZUV B;  1YYH A;  4J0U A;  3AG4 E;  2ETB A;  1TNU A;  4DX1 A;  2VTB A;  3HHM A;  2V5F A;  3PE4 A;  1PAQ A;  5D2M C;  2L6J A;  4KVO A;  1NA0 A;  4A55 A;  4I17 A;  3FDH A;  3D9K A;  2H6G A;  2V8S E;  3VTX A;  1H0A A;  4J8S A;  3RK6 A;  5HKP A;  1A17 A;  3UT8 A;  4CZ2 D;  3S2A A;  4UWK A;  3E30 A;  2VJ8 A;  4GMJ A;  4UI9 K;  4KT6 B;  4RVB A;  4B8A A;  3U64 A;  3FFL A;  4F53 A;  2P58 C;  3MKQ B;  1MX2 A;  4BT9 A;  4E6H A;  3DPD A;  5CBO A;  4I9C A;  3AS4 A;  5ARF A;  2BKK B;  4UQY A;  4O1O A;  3B7S A;  3FUM A;  2PM6 A;  3TJP A;  3FUJ A;  3W9F A;  1OCZ E;  3ZYL A;  4HRN A;  1OCO E;  3R7R A;  3U4T A;  4U8Y D;  3UTM A;  4FHJ A;  3IKO B;  2VSO E;  3PDN A;  5AQ7 A;  3TWW A;  3UT4 A;  2RFA A;  4HOR A;  3HYM B;  3ESL A;  2GRO B;  3HXC A;  3R7Q A;  3AS5 A;  4M3O A;  5H7P A;  5LOZ A;  4BSX A;  3ZIM A;  3HVE B;  3OTN A;  3L9T A;  3UIO C;  1KT0 A;  4HFG A;  2UY1 A;  4U63 A;  2AXV A;  4XI9 A;  4H7Y A;  3SFY A;  2CHX A;  4YDY A;  1JPL A;  4WWO A;  5EYP F;  2IFU A;  2WXF A;  3L16 A;  3MZL B;  4N5Q A;  3UIN C;  1E90 A;  3V79 K;  2MYO A;  2R5S A;  1TJF A;  4C9B B;  4WUY A;  4HRM B;  1INZ A;  1TNO A;  1GW6 A;  5E75 A;  1JCQ A;  2P9L G;  1TN6 A;  2LSV A;  3LJ3 A;  3TWR A;  3TGO A;  5ITZ F;  1TEZ A;  4AIF A;  3PS6 A;  2KCV A;  2VSY A;  4UI9 C;  4KXK B;  1K1B A;  4NUR A;  5KJM A;  2BF0 X;  4L23 A;  3B7B A;  5AEN A;  3FU5 A;  1QYM A;  4N5C A;  2LAH A;  4KMO A;  3FP3 A;  3LJN A;  4GTT A;  5E76 A;  3ZRH A;  1IQU A;  3NZU A;  4U07 A;  4HVB A;  1Q2Z A;  3CR3 A;  3PEV B;  1ZBP A;  3B95 A;  4HLE A;  5ENQ D;  3MCX A;  3S7J A;  2XZD G;  5CRV A;  1G3N B;  4HB5 A;  4GCN A;  3RIB A;  4NAC A;  5FIN A;  2IF4 A;  1H19 A;  3LY9 A;  2X6K A;  1XNF A;  1K8K G;  4J7W A;  1OY3 D;  3DEP A;  4JA9 A;  4EZK A;  3D9P A;  1TR4 A;  4GU5 A;  5CHE E;  3WXX A;  2F0Y A;  1ELK A;  3LDZ A;  2Y0B G;  2DZO A;  2GRQ B;  4JA7 A;  2ZXW E;  3UM0 A;  2V5Q C;  1H2T C;  3JXJ A;  4N3C A;  3MJW A;  1OWP A;  3ONL A;  3APF A;  5BXU A;  3OXF A;  3CGH A;  1IKN D;  4G8L A;  4ME2 A;  4N3A A;  4J8F A;  4FJY A;  4URK A;  4OYS A;  4AY6 A;  4QFV A;  4HNA D;  4DUI A;  2WXN A;  4AXH A;  3UMV A;  4CT4 A;  4J8E A;  2H6I A;  4JHK A;  3NQP A;  1LD8 A;  1ZB1 A;  1HE8 A;  3UXG A;  3RO3 A;  4G23 A;  4PDX A;  2IQC A;  3FTY A;  3ASF A;  2H6F A;  5ENR D;  2P2C P;  3HXD A;  3DST A;  1TNZ A;  1JUQ A;  2IO2 C;  3P2B A;  1E8W A;  2KZT B;  1HU3 A;  5FJY A;  1IQR A;  1E8Z A;  2I9C A;  2BED A;  3Q75 A;  3S7D A;  3CK7 A;  3GW4 A;  3PZ3 A;  2AXU A;  2FF4 A;  1LTX A;  1O1S A;  2PM7 A;  2LO6 A;  1TNB A;  3UQ3 A;  3HXB A;  5AJD A;  5LCW C;  4UI9 J;  3L17 A;  4E85 A;  4CDR A;  2ETA A;  4N3B A;  5DBK A;  4JC8 A;  4NRH B;  2EIL E;  2EIM E;  1YCS B; 
#chains in the Genus database with same CATH homology
 3I4R B;  5AYW D;  1IHG A;  3ZPJ A;  4AVX A;  3AU4 A;  2XPI A;  4FC8 A;  3ZYK A;  2OND A;  4WWP A;  2I2O A;  3L22 A;  4DK5 A;  1HG5 A;  4ATG A;  3NZS A;  3ASD A;  2ION A;  4JVS A;  1ELR A;  3FUD A;  2ZU6 B;  5A6C A;  3AS8 A;  4JPS A;  3ML8 A;  4GPK A;  3SZ7 A;  1FVF A;  3HVE A;  3D9J A;  5BW8 C;  3MV3 B;  4BTB A;  3LY8 A;  4CEM A;  3I5P A;  3LYA A;  5EX0 A;  2E0I A;  3GZ1 A;  3ZHE B;  1H2V C;  4EZJ A;  2WVI A;  2RG8 A;  3ULQ A;  3FTU A;  2CG3 A;  4OVV A;  1HZ4 A;  5D0Q D;  2Y4U A;  4MLP A;  4EQF A;  4AM9 A;  3GZS A;  2NC9 A;  4FU3 A;  4F3V A;  2YHC A;  4UQZ A;  3FU6 A;  4KVM A;  4I2W A;  2WMO A;  5FZR A;  3PE3 A;  4G11 A;  2VSN A;  4JEU A;  2WXO A;  4GYO A;  2XPY A;  3JQ0 A;  2XGM A;  3FHE A;  4WND A;  2OVB A;  4N2Q A;  5ENN A;  5JJT A;  3KEZ A;  4NQ0 A;  4HOS A;  4F53 A;  2VGY A;  5AJL A;  3Q15 A;  2GRM A;  3VLE A;  4I9E A;  1P5Q A;  2CHZ A;  3MX3 A;  3CHS A;  3L13 A;  5HI7 A;  3CVP A;  2HO1 A;  3FUN A;  3PRE A;  5G05 C;  2RD0 A;  4PH4 B;  4U0Z A;  5J90 A;  4A3V A;  5CMY A;  3EHN A;  3HIZ A;  4TRQ A;  4PS8 A;  2YIN A;  4ACL A;  4G26 A;  3JQ1 A;  3QB2 A;  5T8I A;  2CFZ A;  4U04 A;  2WXK A;  4U0S A;  4EPZ A;  2KC7 A;  3BEE A;  4BX9 A;  2WQ6 A;  4U8H A;  5J08 A;  5FQ8 A;  4BT8 A;  3FUE A;  3LPZ A;  4CDM A;  2X3M A;  2KAT A;  1HFA A;  5BUZ A;  3CIA A;  1EYH A;  2R59 A;  4ACK A;  2XQ0 A;  4I6J A;  4GZD A;  3LKU A;  5JJ6 A;  5A7D B;  3ZVV A;  1PY1 A;  1H6K A;  3UPV A;  4J0U A;  3RRM B;  3CHO A;  4XE0 A;  3RRN B;  3CKC A;  3QWV A;  1JWG A;  2PL2 A;  3EIQ C;  3PRZ A;  4EBA A;  4PS7 A;  1SZ9 A;  4GCO A;  3HHM A;  2V5F A;  3G2W A;  5KJL A;  2VTB A;  3PE4 A;  2IOS A;  1PAQ A;  3NF1 A;  3CV0 A;  3TXN A;  4I1M A;  4DJA A;  2L6J A;  3JCK C;  2LNI A;  3L6A A;  4KVO A;  1NA0 A;  4A55 A;  3BG1 B;  3CQC B;  1Z6T A;  4I17 A;  3ZXS A;  1HO8 A;  5KCM A;  4ABN A;  1B89 A;  3FDH A;  1EDU A;  2I1K A;  1QQE A;  3OXG A;  4KBQ A;  3D9K A;  2V8S E;  2DBA A;  3VTX A;  2X6F A;  2L0I A;  5FZS A;  1H0A A;  4J8S A;  4JZY A;  3IHV A;  3RK6 A;  3D9N A;  3PZD A;  3G2V A;  1A17 A;  3UT8 A;  4KYO B;  4UWL A;  3IV0 A;  2XCB A;  3FTV A;  2EQX A;  3S2A A;  4UWK A;  1OWN A;  2L0T B;  3ZFW A;  5ARG A;  3APD A;  3QC1 A;  2VJ8 A;  4GMJ A;  4UQX A;  3FUL A;  4UI9 K;  2MHK A;  4D10 C;  5G04 J;  1UJJ A;  1OUV A;  3IBE A;  3MEK A;  4KT6 B;  3FFL A;  4O6F A;  4RVB A;  3CEQ A;  3FEX A;  3MYV A;  2P58 C;  5C2Y A;  3U64 A;  3CSF A;  3MKQ B;  3SBT B;  1FVH A;  4EBA G;  4BT9 A;  4ANW A;  4EZL A;  3I3N A;  4YVQ C;  2VTB B;  5CMW A;  2MOW A;  3DPD A;  4E6H A;  1XGW A;  3FUF A;  3AS4 A;  4GYY A;  4I9C A;  5ARF A;  2WXM A;  2IU1 A;  4UQY A;  3I4G A;  3B7S A;  3D9I A;  2XRZ A;  3FUM A;  2PM6 A;  4JEH A;  4XZ4 A;  4N39 A;  3TJP A;  3FUJ A;  4WNF A;  4AOF A;  3LEW A;  4I1A A;  2FEZ A;  2A5U A;  3ZYL A;  2WMN A;  2BUG A;  3FU3 A;  2C0L A;  3QK0 A;  2AXZ A;  3KD7 A;  3R7R A;  3EHM A;  3U4T A;  2VGX B;  2KCK A;  4XKC A;  1VDY A;  3LCA A;  3SI5 A;  1OWO A;  4FHJ A;  4R7L A;  2IJG X;  3IKO B;  5BV0 A;  5C1D A;  2I6H A;  4MS6 A;  4IN3 B;  2VSO E;  5EX3 A;  4GZC A;  3D9M A;  4FLB A;  5DIZ A;  3CVY A;  3CVQ A;  2WXQ A;  1DVP A;  4GAA A;  3PDN A;  5LCW J;  1EF1 C;  4A3T A;  3LS8 A;  4L1B A;  3UT4 A;  2ILR A;  5EKQ D;  2AVP A;  3RJV A;  1IYG A;  4CGV A;  4HOR A;  1LF8 A;  3RU0 A;  1WM5 A;  1QNF A;  4LUN U;  4K0R A;  3B7T A;  3OAW A;  3HYM B;  3ESL A;  2J4B A;  4JHR A;  3PUJ A;  5JJ7 A;  3OXL A;  3R7Q A;  2I1J A;  4FA6 A;  1QZ2 A;  5CCM A;  3AS5 A;  4K03 A;  4DLO A;  5CCL A;  4M3O A;  5LOZ A;  3ZEF A;  2WM9 A;  4IUL A;  2WXG A;  3ASH A;  4BSX A;  2WXH A;  3S7F A;  3ZIM A;  1HXI A;  3QNK A;  3HVE B;  3CVV A;  3U66 A;  3OTN A;  2AWI A;  2X6J A;  4Q69 A;  1E8X A;  4GA2 A;  4G24 A;  2HM8 A;  4UWF A;  5FQ4 A;  3LVQ E;  4DLQ A;  4HXI A;  4JHJ A;  4XX5 A;  5JHA A;  1KT0 A;  3ASG A;  4HFG A;  4DI4 A;  1EPU A;  2NXP A;  4Q96 A;  4AEZ C;  2UY1 A;  4U63 A;  1E7V A;  3DBS A;  3B7R L;  2AXV A;  5LX8 A;  4XI9 A;  1NP7 A;  3TXM A;  4H7Y A;  3FU0 A;  2CHX A;  1NA3 A;  3U9W A;  4BWR A;  1JPL A;  2UWJ G;  1N52 A;  3BG0 B;  4UWH A;  4BFR A;  4TV3 A;  4WWO A;  2YNQ A;  3FY4 A;  1WAO 1;  3FUH A;  3SF4 A;  2XGO A;  2IFU A;  2CG2 A;  3Q5M A;  1E8Y A;  2FI7 A;  2C2L A;  2WXF A;  2Y4T A;  3L16 A;  3MZL B;  3ML9 A;  4XIF A;  1SQM A;  4DI3 A;  4C0E A;  4LER A;  2DCP A;  1MHQ A;  2KZT A;  1E90 A;  3ZYQ A;  1OWL A;  4Y6C A;  3D9L A;  2MRI A;  2R5S A;  4N2S A;  4L2Y A;  1HH8 A;  1TJF A;  5G05 J;  3UT7 A;  4C9B B;  4WUY A;  1INZ A;  1UW4 B;  4MRU A;  1GW6 A;  2QY7 A;  2JLB A;  4B0Z A;  2HYZ A;  4FLH A;  4Y6W A;  3PEU B;  3QWW A;  5E75 A;  2GGF A;  4XI0 A;  2XCC A;  4DPR A;  3TL5 A;  3CVW A;  2LSV A;  3LJ3 A;  3QOU A;  5FZQ A;  3RRU A;  3AU5 A;  3TGO A;  1TEZ A;  4AIF A;  3PS6 A;  4ANU A;  4GYW A;  4ANX A;  3QJZ A;  2L9B A;  3P1U A;  5M72 A;  4CRW A;  2KCV A;  2VSY A;  4GB9 A;  3QAQ A;  5FQ7 A;  4UI9 C;  4JL0 A;  4L2L A;  3QAR A;  4LCT A;  2J9Q A;  3FTX A;  3D3M A;  3ZGQ A;  1HX8 A;  4IRU A;  3PNT B;  2FBN A;  2QFC A;  3EDT B;  4FP7 A;  3SFZ A;  3URZ A;  3CLJ A;  2KM4 A;  4KXK B;  3R9A B;  1HS6 A;  3G2T A;  4B8A A;  1Z3X A;  4J6I A;  4NUR A;  1ZU2 A;  1FCH A;  3B7U X;  1SZA A;  2X38 A;  3CK9 A;  4I6G A;  4RG6 A;  5KJM A;  2BF0 X;  2WPV A;  4H7X A;  4L23 A;  5AEN A;  3FU5 A;  4N5C A;  4WNE A;  2LAH A;  4KMO A;  3APC A;  3FP3 A;  4J8D A;  3Q49 B;  4GA1 A;  4GA0 A;  3MGB A;  2WXR A;  4ILH B;  3CHP A;  2WXP A;  2GW1 A;  1IQU A;  1UN8 A;  5E76 A;  3Q47 B;  3ZRH A;  4GZ3 A;  2XRY A;  3CHR A;  3PVL A;  4GZ5 A;  1W3B A;  3PUK A;  1HG2 A;  5ANR A;  3HDX A;  3Q4A B;  3NZU A;  4U07 A;  2NSZ A;  4HVB A;  2E2E A;  4RG9 A;  3CR3 A;  5BV1 A;  4F7A A;  3PEV B;  1OWM A;  1ZBP A;  1L5J A;  2IOL A;  4FJZ A;  2WXL A;  3EJN A;  5JHB A;  3LXU X;  4HLE A;  2XEV A;  4BTA A;  3MCX A;  2BTD A;  3S7J A;  3VLD A;  4RSY A;  3ONK A;  4G2V A;  4GCN A;  5EDS A;  3RIB A;  1BPO A;  4I6E A;  4I43 A;  4Q94 A;  4XKB A;  4G1T A;  4FAD A;  3FH5 A;  4NAC A;  2IF4 A;  4KZ0 A;  1H19 A;  3LY9 A;  2X6K A;  2WQ7 A;  5ANL A;  2HR2 A;  1XNF A;  3TAX A;  5A23 A;  4WNG A;  1S0P A;  3K9I A;  4U0U A;  3FWV A;  2J08 A;  4GZ6 A;  1Y6I A;  5HQ8 A;  4APF A;  2R17 C;  4JA9 A;  4EZK A;  3D9P A;  3SNX A;  3SBS A;  4GU5 A;  5CHE E;  4C0M A;  2M63 A;  3CHM A;  2PQR A;  5D0O D;  1ELK A;  2OOE A;  3MA5 A;  3WXX A;  3CHQ A;  3LDZ A;  3CVX A;  1U3C A;  5FQ6 A;  4B89 A;  3SHF A;  2OVF A;  3TG4 A;  2KCL A;  3ENE A;  5FTP A;  1E96 B;  4HS2 A;  4JA7 A;  2OV8 A;  1Y8M A;  3RKV A;  3N71 A;  3UUX A;  1WY6 A;  4PS3 A;  5KJN A;  4IYP A;  5BNW A;  4BX8 A;  1H2T C;  3B13 A;  4N3C A;  3MJW A;  4OVU A;  1OWP A;  3ONL A;  4A1G A;  3APF A;  3G2S A;  3U3W A;  3RO2 A;  1JWF A;  1KLX A;  1N54 A;  2V0P A;  3OXF A;  3CGH A;  5FT9 A;  4L7T A;  3ZYM A;  3T5V A;  3ZN3 A;  5LFA A;  4JW1 A;  5G55 A;  3IEG A;  4CCA A;  3T5X A;  4EEC A;  3JUI A;  4ME2 A;  5BT1 A;  2CFU A;  2LAI A;  2YHE A;  4UWG A;  2FO7 A;  2X6H A;  4ANV A;  4CT0 A;  4BY6 A;  1TJC A;  2AW6 A;  1UJK A;  3PNL B;  2C0M A;  4N3A A;  4J8F A;  4HOT A;  3FUK A;  3LY7 A;  1X5B A;  4FJY A;  2WXJ A;  4URK A;  4FUL A;  2GRL A;  1KT1 A;  2YQ8 A;  4ILI A;  4OYS A;  4WAF A;  3VTY A;  3D9O A;  3KAE A;  4AY6 A;  2VYI A;  2XGS A;  2WQH A;  4GML A;  4QFV A;  3CQG B;  3FTS A;  5LP0 A;  5T4Y A;  4HOU A;  4AJW A;  4MKT A;  2VQ2 A;  2WXN A;  4AXH A;  4P29 A;  4TUU A;  2J07 A;  3UMV A;  4KZC A;  4CDN A;  4CT4 A;  3FH8 A;  3FTZ A;  2J4D A;  3O48 A;  4J8E A;  4I1O B;  2UY1 B;  5G04 C;  3E4B A;  4JHK A;  4CGW A;  3NQP A;  2DIW A;  3QDN A;  5KJK A;  1NZN A;  4V3I A;  3EIJ A;  4YVO A;  1HE8 A;  2XHE A;  3C98 A;  4WWN A;  3MKQ A;  3RO3 A;  2J09 A;  3PH0 C;  4G23 A;  4LEU A;  3VLF A;  4PDX A;  2IQC A;  3CKB A;  2VSX E;  3G2U A;  3FTY A;  3ASF A;  3ESK A;  4YND A;  4I2Z A;  2Y3A A;  3GYZ A;  3MV2 B;  2WXI A;  3CK8 A;  3MKR A;  3QWP A;  2A4Z A;  1JUQ A;  4JXT A;  2CHW A;  3CVL A;  4FHK A;  4AP2 A;  3P2B A;  3FTW A;  1E8W A;  2KZT B;  2PZI A;  4PUC A;  2J49 A;  1U3D A;  3CVN A;  3S7B A;  1HU3 A;  2JEK A;  2FUL A;  5FJY A;  1IQR A;  3CST A;  1E8Z A;  4ILG A;  2I9C A;  3T8M A;  2PQN A;  3CK7 A;  3S7D A;  3SGH A;  2V4L A;  3GW4 A;  4F1S A;  4B94 A;  3IHY A;  1YA0 A;  3TG5 A;  1E7U A;  3UX4 A;  3L08 A;  4B8C B;  2VGX A;  1HF8 A;  2Q7F A;  3KS2 A;  2AXU A;  2FF4 A;  1MQS A;  1H2U A;  4A1S A;  4AY5 A;  2PM7 A;  3QKY A;  2LO6 A;  3ZHE A;  4APO A;  1PC2 A;  3FUI A;  5FWQ A;  3UQ3 A;  3GZ2 A;  1Z3Y A;  5AIJ A;  1DNP A;  3SD5 A;  1UG3 A;  1ELW A;  4G25 A;  3FEY A;  5AJD A;  5LCW C;  2X6I A;  2LSU A;  4UI9 J;  5T3R A;  3L17 A;  4LRZ A;  2WB2 A;  3FH7 A;  4E85 A;  4HOQ A;  3L54 A;  4CDR A;  2XPZ A;  3LVR E;  4N3B A;  5DBK A;  4AV7 A;  3JYS A;  4JC8 A;  5BPP A;  3CVU A;  1UN9 A;  4NRH B;  3ZW3 A;  5G2N A;  3O4Z A;  4W9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...