1TJCA

Crystal structure of peptide-substrate-binding domain of human type i collagen prolyl 4-hydroxylase
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
95
structure length
95
Chain Sequence
b'MFLTAEDSFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Prolyl 4-hydroxylase alpha-1 subunit
publication title The Peptide-Substrate-binding Domain of Collagen Prolyl 4-Hydroxylases Is a Tetratricopeptide Repeat Domain with Functional Aromatic Residues.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 40
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature ec 1.14.11.2: Procollagen-proline 4-dioxygenase.
pdb deposition date 2004-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1tjcA00
4WUYA 2UY1B 4I17A 4JL0A 4JA9A 4U04A 3ASHA 3FP3A 3QWWA 4B94A 2XGSA 4LEUA 5KJMA 2UWJG 4H7YA 4APOA 4BTBA 2PL2A 3CVPA 4WNEA 3IEGA 2HYZA 3UPVA 4UI9J 5HQ8A 3ZN3A 3GW4A 1KT0A 3S7DA 4CGVA 2Q7FA 4KBQA 3S7JA 4UQYA 5BW8C 5M72A 3NF1A 3VTYA 2FO7A 3QDNA 2L6JA 4GZ6A 3Q5MA 2QFCA 4UI9C 1IHGA 4GZ3A 3RJVA 3GZ1A 3ZGQA 4GPKA 4WNFA 3TAXA 4BWRA 3HYMB 1QZ2A 3LY7A 3QWPA 1E96B 3TGOA 1TJCA 4HOQA 4I2ZA 5D0OD 4UI9K 4G23A 2PQRA 4U0ZA 1KT1A 2FF4A 5KJNA 3UUXA 2WQHA 5G04J 3KAEA 1ZBPA 4GZ5A 3FWVA 2LSUA 3GZ2A 1HXIA 2HO1A 4JHRA 2XCBA 4I2WA 3ESKA 5EX3A 4ME2A 4RG9A 5FZQA 3CK8A 5G04C 5CCLA 2VGYA 3RO3A 4J8DA 1NA0A 3Q15A 2VSNA 4YVOA 4BT9A 3LKUA 2C0MA 3GYZA 2VYIA 4NRHB 3WXXA 3OXFA 3MV2B 3PDNA 2BUGA 4KXKB 3MA5A 3OXGA 2MHKA 2HR2A 1ELRA 5D0QD 3RO2A 3UQ3A 5JJTA 4CGWA 3SF4A 5LCWJ 5BNWA 5CCMA 3LYAA 1KLXA 3QOUA 4GA0A 3N71A 2XPIA 4UQXA 5A6CA 3URZA 4N5CA 3ZFWA 5C1DA 4NQ0A 4XI9A 3S7BA 4I9EA 2P58C 5FJYA 5LCWC 3MKRA 3ZHEA 3AS4A 1OUVA 4I1AA 5FZRA 4J8FA 4RG6A 3ZHEB 1B89A 3RU0A 4HOSA 4HOUA 1XNFA 3CK9A 4Y6CA 4YVQC 2OOEA 3LY8A 2LSVA 2FI7A 4N3BA 4GYWA 2Y4UA 1Y8MA 4JA7A 1PC2A 2DBAA 2IF4A 2KCVA 3OXLA 4U0SA 3JYSA 3Q49B 3ASGA 2XCCA 3KS2A 5JJ7A 1P5QA 4N39A 4EQFA 4A1SA 3AS5A 5EX0A 4J0UA 4YNDA 2XEVA 4AY6A 3K9IA 3KD7A 4BT8A 4GA2A 2KC7A 4G26A 4XIFA 5ARGA 2VGXA 5HI7A 4G1TA 3CEQA 3AS8A 3PE3A 2VGXB 1NZNA 2ONDA 4GCOA 4IN3B 2LNIA 2FBNA 4ABNA 3CVQA 4N3AA 3MV3B 4O6FA 3TG5A 4AM9A 4AY5A 4GCNA 3U4TA 3CVNA 3EDTB 4N3CA 2J9QA 4N2SA 5A7DB 3RIBA 2YQ8A 5CHEE 2C2LA 2JLBA 5JJ6A 4HOTA 1ELWA 3CK7A 3LY9A 4F3VA 3PE4A 2KCLA 3ZPJA 3R9AB 2KCKA 5ARFA 5FTPA 2NC9A 5KJKA 3LCAA 3SZ7A 2VQ2A 4Y6WA 4WNGA 2E2EA 5DIZA 3ASDA 4G25A 4GA1A 4KYOB 2PZIA 3RKVA 3CV0A 4HORA 1HZ4A 5FT9A 3FFLA 4U0UA 1NA3A 2Y4TA 3LPZA 2R5SA 5EKQD 4BTAA 2WPVA 5AYWD 1YA0A 1W3BA 5KJLA 3Q4AB 1WM5A 1ZU2A 1WAO1 2KATA 4G2VA 5FZSA 4UQZA 2XGOA 2IFUA 4CDRA 4W9RA 2V5FA 1A17A 1IYGA 1QQEA 5BT1A 3BEEA 4XI0A 2C0LA 3ASFA 4GYYA 3U3WA 2YHCA 5G05J 3MEKA 4AIFA 4H7XA 3CVLA 4GYOA 2VSYA 3ULQA 3CKCA 2GW1A 4J8EA 5DBKA 4N2QA 3TG4A 4U07A 2FEZA 3Q47B 3S7FA 5G05C 2AVPA 1FCHA 2I6HA 1HH8A 3E4BA 4WNDA 4G24A 2XGMA 3QWVA 3O48A 3VTXA 4I9CA 2UY1A 3CKBA 3QKYA 2PQNA
chains in the Genus database with same CATH superfamily
3QC1A 1U3DA 1SA4A 4I17A 4JL0A 1OWOA 2F8YA 4B94A 3B7SA 4BTBA 2PL2A 3HXBA 1OCZE 2HYZA 3APCA 4DX1A 4JXTA 4UI9J 4F1SA 4Q69A 1S0PA 3S7DA 2J49A 4LG6A 4CGVA 4B0ZA 2Q7FA 4FLHA 4KBQA 4YDEA 2QZAA 2ZXWE 3V2XA 2WB2A 5CRVA 3B7BA 4JB8P 2QFCA 5FQ6A 5BPPA 3EUVA 4Q96A 5ITZF 3D9MA 1MQSA 1N11A 3FTYA 3T5VA 3D9HA 4KZCA 3Q9NC 4WNFA 1MYOA 1BD8A 4O60A 4BWRA 3TGOA 1TJCA 4R7LA 3APFA 4G23A 4NIKA 2PQRA 1TN7A 2P9SG 1HFAA 3PREA 3UUXA 5G04J 2MOWA 3VLDA 3APDA 4OVVA 5ENOD 2J4BA 3DSUA 4L7TA 2XS8A 4M3OA 3GZ2A 1HXIA 4XEIG 2R17C 2DZNA 2XCBA 3CSTA 4HI9A 4I2WA 1E8ZA 3ESKA 4FA6A 1KPSB 5CCLA 3EHNA 3L9TA 4GAAA 2CFZA 3Q15A 3AAAC 5EIDA 5LX8A 4U63A 2P9KG 2OCCE 1S70B 3R9MA 1TNYA 1SZAA 4WWPA 2DVWA 3ZYKA 1K1AA 1E90A 3PDNA 4JVSA 1MHQA 3OXGA 4GTSA 4IULA 2IQCA 4U8VD 4M7CA 1ELRA 3FUMA 3PRZA 1JCSA 3UIPC 1MJ0A 5BV1A 5E76A 2DCPA 4DLQA 5BNWA 5FWQA 2CFUA 3FTUA 2DYSE 2J09A 3QOUA 3N71A 4CCAA 5KNGA 1IQUA 3URZA 5LFAA 3ZFWA 1O1TA 5JMND 3IHVA 4GZCA 3LDZA 2P58C 4LNBA 1E8WA 1OUVA 3T8KA 4I1AA 5T8IA 1WDYA 3ZHEB 1B89A 1OT8A 4Y6CA 4YVQC 4GTTA 3IHYA 2CHWA 2Y69E 2FI7A 3TWRA 3ZIMA 1DC2A 2ZGDA 4GTPA 1IHBA 2I2OA 3UM0A 3FH8A 3FDHA 3F6QA 3EU9A 2P9NG 5JJ7A 3AU5A 4EQFA 4A1SA 3UKRG 4TUMA 1N4SA 3D9NA 5ENPD 4YNDA 4HFGA 3DSTA 2FO1E 5T3RA 1H2VC 2Y0BG 3DSVA 4G26A 5AENA 4IRUA 4XIFA 4C9BB 3ZRHA 2WXFA 5HI7A 3SNXA 2WXQA 4G1TA 2BEDA 3ML8A 4BERA 3CVWA 3IV0A 2VGXB 1JWFA 3BG1B 4WWOA 4OVUA 3L54A 4ABNA 1O5MA 5CEAA 4HNAD 4UWHA 4JEUA 3SY2A 3TG5A 2LXMA 4N2SA 3MKQB 4KZ0A 4ILGA 4LUNU 3LY9A 3ZW3A 4F3VA 3RK6A 3G2TA 4A1GA 3ZPJA 4BY6A 2JEKA 5ARFA 3PNTB 4JHJA 4GTRA 4ANXA 1SA5A 5KJKA 3SZ7A 4Y6WA 1WG0A 3ASDA 3UM2A 4BX8A 4JD2G 1HZ4A 3JQ0A 5FT9A 4LCTA 3T5XA 3FFLA 3RRMB 3UT8A 2WXGA 4V3IA 5CBNA 2R5SA 3L22A 5EKQD 2IU1A 4FADA 3HDXA 3CLJA 3ZYMA 4C0EA 2CG3A 1ZU2A 3DSXA 2RG8A 1EPUA 2HM8A 1WAO1 4G2VA 3CHOA 4GZDA 4AEZC 3ZVVA 4QQIA 2ETCA 1INZA 1N54A 5BUZA 1FVFA 4GYYA 1H6KA 1DCQA 3CHMA 5G05J 3ZUVB 2FULA 4TXPA 2NSZA 4AIFA 4H7XA 5HKPA 2IO2C 3BU8A 3LJNA 4OAVB 3DRAA 3IKOB 3FUEA 3I4RB 1VDYA 2XPYA 1DNPA 4N2QA 3TG4A 3AU4A 4E85A 2FEZA 3S7FA 4TXQA 2AVPA 1FCHA 4GMJA 4B8AA 3SBSA 4FHJA 4JHKA 2I9CA 3W9GA 1TNOA 3CKBA 3LXUX 4WUYA 4JA9A 4L2LA 3ONKA 3I3NA 2BF0X 2GRPB 2XQ0A 3ASHA 3FP3A 1LTXA 3TWVA 4BSXA 3HXEA 3MYVA 2ZGGA 4E6HA 5KJMA 3CHRA 4KVMA 4APOA 4WNEA 1TYQG 5BXOA 1RW2A 4HVBA 4LRZA 2GGFA 4CDMA 4JW1A 3UX4A 1OCRE 1HU3A 3NF1A 3FH5A 2L6JA 1X5BA 3D9PA 2EQXA 4GZ6A 3G2UA 3T9KA 3HXCA 2R59A 3EU5A 2ETAA 3ULEG 4HRMB 3CHQA 3QWPA 1V54E 1UG3A 3DWLG 3MJWA 4U0ZA 1JPLA 4BSZB 5KJNA 2OV8A 2X3MA 3UKUG 1IKND 4EZLA 3KAEA 4EPZA 1ZBPA 5J08A 4GZ5A 1H19A 5LP0A 2EINE 1LD8A 2XZDG 3L13A 3ZU7B 1AP7A 5B1BE 2IONA 5EX3A 4KMOA 4U8YD 3RO3A 5ANLA 2DYRE 1K3ZD 2OEVA 2CG2A 4BT9A 1AWCB 2M63A 2QYJA 4J7WA 2H6IA 4YDYA 2VYIA 3SO8A 3D9LA 4HXIA 3WXXA 1OY3D 2VSOE 4OYSA 3RAUA 1KZOA 4UWFA 3FULA 3DXKG 4J6IA 3EIJA 1H2TC 4A63B 1G3NB 1FPPA 2H6FA 4DUIA 4CRWA 5CEDB 2WVIA 4ATZD 4ACKA 1UN9A 1LD7A 3UQ3A 3ML9A 1MZCA 4TV3A 3SF4A 4EBAG 5CCMA 3FY4A 1WY6A 4UWLA 5BV0A 4HS2A 3QNKA 1UJJA 3V2OA 1OWNA 4BETA 4BFRA 4UQXA 2XPIA 3MZLB 5ENTD 1U3CA 4N5CA 3UT4A 4NQ0A 3LVQE 3S7BA 2H6HA 1MX2A 4I9EA 4K5BA 5LCWC 3PZ2A 3ZHEA 5EYLA 3VLFA 5FZRA 4J8FA 3TWSA 4RG6A 4DX6D 3AJIA 3CSFA 2H6GA 5AQBA 4XKBA 1TN6A 3P2BA 1D8DA 4GYWA 1A5EA 3S2AA 3Q7FA 4JA7A 2DBAA 3OXLA 4U0SA 2CHZA 3L08A 2F0YA 4C48B 4FULA 3FTVA 2EIKE 4MLPA 3TWXA 3QARA 1E7VA 3AS5A 3UMVA 1HG2A 1NP7A 1E8YA 4GU5A 3K9IA 3KD7A 2IEJA 3NB2A 4NURA 2VGXA 1XGWA 3KSQA 3FUHA 4HI8A 3AS8A 1NZNA 2QC9A 4XZ4A 2J07A 3KEAA 4GCOA 4Z68A 2VTBB 3FH7A 2A4ZA 2FBNA 4DPRA 4N3AA 2RD0A 3MKQA 4O6FA 3B7RL 4AM9A 2V0PA 4GCNA 2PM6A 3CVNA 3EDTB 3AG4E 3RIBA 4UUCA 4GMRA 5CERB 2JLBA 5JJ6A 3CK7A 2VGEA 1V55E 3PE4A 4U95D 1HG5A 5CBOA 3R9AB 1MX4A 3D9JA 3OAWA 2VQ2A 3FU0A 4QFVA 4WNGA 3DPYA 4AJWA 4G25A 2RFMA 4L1BA 4GA1A 4EZKA 4KYOB 3RKVA 3QB2A 4NACA 2NXPA 5FIOA 3B7UX 4XE0A 4ZFHA 2WM9A 1NA3A 3LPZA 3V31A 3UTMA 1NL4A 3ASOE 1JWGA 3FUIA 4BTAA 3JXIA 4K0RA 2E0IA 4G11A 3RRNB 5KJLA 3O4ZA 1WM5A 2WXIA 3AG2E 2WXMA 3CIAA 5AN8A 4JC8A 2KATA 3DSWA 5FZSA 4UQZA 3Q73A 4FHKA 1HO8A 1A17A 1SZ9A 3BEEA 4XI0A 3KSLA 4LNUD 1H6OA 5LOZA 3PUKA 3U3WA 3I4GA 4I1MA 5FQ8A 4WAFA 2GRNB 3C3OA 3PNLB 4PS8A 3SHFA 3HXFA 1E8XA 3CQCB 3TXMA 1QBQA 5DBKA 1ELKA 2DWZA 5ENRD 4P29A 3FHEA 2I6HA 1O1SA 2R2LA 4G24A 2XGMA 3VTXA 2YNQA 3LVRE 5AIJA 3EHQA 5ANRA 2PQNA 2LUHA 5A6CA 3UM1A 2XENA 3D9IA 2V5QC 1IXVA 1N4PA 4LEUA 2IY0C 4H7YA 4DX7D 3UINC 3EHRA 3CVPA 4HRNA 3IEGA 5B1AE 1QNFA 3AG1E 4PH4B 4I6GA 3UT7A 2KBXA 5HQ8A 2LAHA 2WMOA 3MCXA 1JCRA 2IO3C 3ZN3A 1OCOE 4HRLA 3GW4A 2KZTB 1KT0A 3SGHA 4I43A 3JQ1A 3HG0D 3S7JA 4UQYA 1N9AA 3SBTB 3VTYA 3U64A 2FO7A 3QDNA 5EDSA 5E75A 4CT4A 3E37A 2ETBA 3Q5MA 1IHGA 4GZ3A 3RJVA 3ZGQA 1N0QA 3B7TA 4GPKA 3DEOA 2EILE 1PY1A 5KCMA 3FTZA 1QZ2A 3LY7A 1E96B 2A5EA 2V4LA 3I5PA 3TWWA 3C98A 4GTOA 3ZXSA 4HOQA 3CHSA 5IY5E 5D0OD 1K1BA 5ENQD 1KT1A 2OVFA 2YHEA 1X81A 3TL5A 5AAOA 3J5QB 4TRQA 1UJKA 3FU3A 3E30A 2WQ7A 3E34A 3V79K 2P9UG 3LJ3A 3PS6A 2Y3AA 3TJPA 4O1OA 5FZQA 2VGYA 4WWNA 4FC8A 1NA0A 5ENSD 3FU6A 4YVOA 4APFA 4EZJA 4J8SA 2LAIA 2IJGX 4G8LA 4XKCA 1TEZA 4U96D 5C2YA 4AV7A 4NRHB 3MV2B 3PZ3A 2BTDA 2RKKA 4G8KA 4MKTA 1UW4B 4DK5A 3NOCD 2RFAA 5KBAA 2IOLA 2R02A 4GMLA 2ILRA 3RO2A 4U7EB 4U8HA 4CGWA 5LCWJ 3HRAA 4UWKA 2LXLA 1BI8B 1YYHA 3ABLE 1N4RA 1S63A 4I1OB 1TNUA 1HS6A 2WMNA 5C1DA 4FU3A 4XI9A 4D10C 3HHMA 3MKRA 3AS4A 1D9SA 2P2CP 4TXRA 5T4YA 3ABKE 3RU0A 4HOSA 1XNFA 2VSXE 4L2YA 4YDWA 3FTWA 5HRYA 2LSVA 3Q75A 4CYMD 4AP2A 2NYJA 2Y4UA 2LO6A 2KM4A 3SQVA 4AVXA 2WXNA 1PC2A 2IF4A 3IBEA 3G2SA 2L9BA 2XCCA 5AQAA 3EHMA 1N95A 5G2NA 3KS2A 1P5QA 4N39A 4HB5A 2GRQB 5CMWA 3SFYA 5EX0A 3RRUA 3DSSA 4PS7A 1IQRA 4I6EA 1DVPA 4J0UA 3FUFA 4URKA 4AY6A 4ANWA 5ARGA 4LNGA 3Q9UC 1Z6TA 4DRXE 4RLYA 4LERA 3PUJA 2BKGA 2VTBA 4ILIA 4IN3B 2LNIA 2ZIRA 4DX2A 1OWMA 3PEUB 4B93B 1H6PA 1TNZA 1EDUA 3U4TA 2AXZA 1U2VG 3FTSA 4N3CA 2J9QA 1MX6A 2YINA 2YQ8A 5CHEE 3ZEFA 2XEHA 3CHPA 2KCLA 2ZISA 3FUJA 4ATGA 5AARA 3DEPA 5FTPA 1BI7B 2NC9A 2X6HA 4TUUA 3L82A 4GPMA 3P1UA 2E2EA 3U9WA 1H0AA 1PAQA 3Q79A 2L0TB 4HORA 1FT2A 1D8EA 3QAQA 3LEWA 5FQ4A 2BKKB 5H7PA 3ZXPA 1BPOA 2L6BA 4HLLA 2WPVA 2X6IA 5AYWD 3PZ4A 2F37A 3BQOA 3Q4AB 2XPZA 3C3RA 3ZKJA 2EIME 3FEXA 3PH0C 5D2MC 3NQPA 3DXMG 1NI1A 5AJDA 1OCCE 1DCEA 1BU9A 2IFUA 1EF1C 4C0MA 1NFIE 2X6FA 3E33A 4DI4A 2V5FA 4ILHB 4O1PA 1IYGA 3V30A 5BT1A 3CVVA 1EYHA 2WXRA 3ASFA 2AXVA 5CMYA 3FEYA 1FVHA 3JUEA 4F1PA 4ACLA 3JXJA 4K03A 4N5QA 4BX9A 4AOFA 2XRZA 1Q2ZA 3UM3A 5EN5D 3CVLA 2WXOA 2VSYA 4IYPA 3CR3A 5B3SE 1HE8A 4MRUA 4DJAA 5JHAA 1L5JA 3X2QE 3Q47B 3HVEB 1OWLA 3NOGD 3UIOC 2XZTG 3QWVA 3CQGB 3O48A 3OTNA 5FINA 4FJYA 3L16A 3QKYA 3BG0B 4PUCA 2UY1B 4CT0A 2WXHA 1O1RA 5ENNA 4U04A 3NAWA 3QJZA 4UWGA 3QWWA 2XGSA 4F7AA 2XHEA 5J90A 2UWJG 4RQIA 4HQDA 3JCKC 2XRYA 2R05A 5EILA 3D9OA 4KT6B 3UPVA 2KZTA 5AQ7A 3ULYA 4FLBA 5BXUA 5KNHD 1Z3XA 2MYOA 2WQ6A 3TWQA 2P9IG 4DI3A 5BW8C 5M72A 1SW6A 2R03A 2X38A 2P9LG 4UI9C 3SFZA 3R7QA 2AW6A 2V8SE 3GZ1A 3HXDA 3C3QA 2IOSA 3L6AA 1RZ4A 1GW6A 3ZYLA 3TAXA 3HYMB 2GROB 4L9PA 4JZYA 2P9PG 4I2ZA 4UI9K 2OVBA 4YDOA 1Z5SC 3TWUA 2FF4A 3VLEA 1K8KG 2WQHA 4HBDA 1N0RA 1QYMA 5HS0A 3GZSA 1TJFA 3NBNB 4ANVA 3CVYA 3FWVA 2LSUA 4ZHBA 2HO1A 4JHRA 5AQ9A 4ME2A 4RG9A 3B95A 3CK8A 5G04C 3TXNA 4J8DA 1FT1A 2I1JA 4K5AB 3Q7AA 2VSNA 3UXGA 2L0IA 3ZNGA 2J08A 3LKUA 3EIQC 2WXJA 2C0MA 3GYZA 2WXKA 5CRUA 3MGBA 3JUIA 3OXFA 4JEHA 3LS8A 3TWTA 4I6JA 4EECA 2BUGA 4KXKB 3MA5A 2B6CA 1TNBA 4PS3A 3E32A 2X6JA 2OEWA 2MHKA 2HR2A 5D0QD 2GRMA 2F8XK 2QYUA 5JJTA 2ZU6B 4A55A 3LYAA 1KLXA 1N52A 2HE0A 4GA0A 3AG3E 4GTQA 3L17A 3PZDA 2DIWA 2I1KA 4EHMA 3FUNA 1SVXA 5FJYA 4KVOA 1BLXB 2GRRB 4OAUC 5JHBA 4GB9A 3RSEG 3SD5A 4HOUA 3CK9A 3J5PA 2PM7A 2OOEA 3LY8A 4CDNA 1H2UA 4F6RD 4DX5D 4EBAA 4N3BA 4A3TA 1ZB1A 1Y8MA 2KCVA 2X6KA 5A23A 3JYSA 3Q49B 4LSZE 3ASGA 3ISMC 3FTXA 3MX3A 5JA4D 3R7RA 1YMPA 4X8QA 1JCQA 3DBSA 2XEVA 3W9FA 3CVXA 3C5RA 4A3VA 4BT8A 4GA2A 1S64A 2XS1A 2KC7A 4FJZA 4BESA 1TN8A 4GTVA 3CEQA 3PE3A 2WXLA 2KXPC 1SQMA 3G2VA 2ONDA 4L23A 1Y6IA 5EIBE 3CVQA 3MV3B 3KEZA 4CZ2D 4AY5A 3ONLA 1TR4A 1OWPA 5A7DB 4GTMA 3UI2A 3PEVB 3SI5A 2C2LA 3FUKA 4HOTA 1ELWA 3ENEA 4JPSA 4K5CA 4FP7A 2KCKA 4ANUA 4XX5A 2J4DA 4B89A 3LCAA 4MS6A 2QY7A 5DIZA 2A5UA 2EIJE 3IXEA 2PZIA 3CV0A 3CVUA 3BUAA 3CGHA 2AJAA 4CEMA 3HIZA 1Z3YA 4U0UA 2Y4TA 1JUQA 1KZPA 5CECB 3G2WA 2AWIA 1N4QA 3DPDA 3Q78A 4BEPA 1YA0A 3D9KA 1LF8A 5G55A 4MBGA 1W3BA 3FU5A 3ZYQA 1UOHA 4AXHA 2XEEA 2J8SD 2GRLA 3NZSA 2WXPA 3EJNA 3B13A 3PVLA 4F53A 3T8MA 3FUDA 2JABA 2CHXA 2XGOA 5FQ7A 1UN8A 4CDRA 4W9RA 1N94A 1OXJA 1HF8A 1HX8A 1QQEA 2VJ8A 5KWDA 2C0LA 2MRIA 2YHCA 2DZOA 3NZUA 3MEKA 1E7UA 2Y1LE 4RSYA 1YCSB 4PDXA 3ABME 4GYOA 3U66A 2AXUA 3ULQA 3CKCA 2GW1A 3HVEA 4HLEA 3PZ1A 4Q94A 4J8EA 3ESLA 3C72A 4U07A 2PNNA 5G05C 4J8YA 3WG7E 3QK0A 5AJLA 4RVBA 4B8CB 1HH8A 2B0OE 3E4BA 4WNDA 3SFXA 3D3MA 5EYPF 4DLOA 4I9CA 5D66A 2UY1A 2V4HC 3ASNE
chains in the Genus database with same CATH topology
3BG0B 3LXUX 4WUYA 3QC1A 4PUCA 1U3DA 2UY1B 4CT0A 2WXHA 4I17A 4JL0A 4JA9A 4L2LA 3ONKA 3I3NA 5ENNA 2BF0X 2XQ0A 1OWOA 4U04A 3ASHA 3FP3A 3D9IA 3QJZA 4UWGA 3QWWA 4B94A 2XGSA 4BSXA 4LEUA 2XHEA 3MYVA 4F7AA 4E6HA 5KJMA 2UWJG 5J90A 3CHRA 4H7YA 4KVMA 4APOA 3B7SA 4BTBA 2PL2A 3JCKC 2XRYA 3CVPA 4WNEA 3IEGA 2HYZA 1QNFA 3APCA 3D9OA 4KT6B 4PH4B 3UPVA 4I6GA 3UT7A 2KZTA 4JXTA 4UI9J 4F1SA 4HVBA 5HQ8A 4Q69A 2LAHA 2WMOA 4LRZA 2GGFA 3MCXA 1S0PA 3ZN3A 4FLBA 3GW4A 2KZTB 4CDMA 1Z3XA 2WQ6A 4JW1A 1KT0A 3S7DA 3SGHA 2J49A 4I43A 3UX4A 4B0ZA 4CGVA 3JQ1A 2Q7FA 4FLHA 4DI3A 4KBQA 3S7JA 4UQYA 5BW8C 3SBTB 5M72A 1HU3A 3NF1A 3VTYA 3FH5A 3U64A 2WB2A 2FO7A 3QDNA 2L6JA 5EDSA 2X38A 1X5BA 3D9PA 5E75A 2EQXA 4GZ6A 3G2UA 4CT4A 3Q5MA 2QFCA 4UI9C 5FQ6A 1IHGA 5BPPA 3SFZA 4Q96A 3R7QA 4GZ3A 3D9MA 3RJVA 2AW6A 1MQSA 2V8SE 3GZ1A 3ZGQA 3FTYA 3B7TA 3T5VA 4GPKA 2IOSA 4KZCA 2R59A 3L6AA 1PY1A 4WNFA 5KCMA 1GW6A 3FTZA 3ZYLA 3TAXA 4BWRA 3HYMB 1QZ2A 3LY7A 3CHQA 3QWPA 1E96B 2V4LA 3I5PA 3TGOA 1TJCA 3C98A 3ZXSA 4JZYA 4R7LA 4HOQA 3CHSA 4I2ZA 5D0OD 3APFA 4UI9K 2OVBA 1UG3A 4G23A 2PQRA 3MJWA 1KT1A 4U0ZA 2OVFA 1JPLA 1HFAA 2FF4A 3PREA 2YHEA 3VLEA 5KJNA 3TL5A 3UUXA 2OV8A 2WQHA 5G04J 2MOWA 2X3MA 4TRQA 4EZLA 3KAEA 4EPZA 1UJKA 1ZBPA 3FU3A 4GZ5A 5J08A 1H19A 3GZSA 3VLDA 1TJFA 3APDA 4OVVA 2WQ7A 5LP0A 4ANVA 2J4BA 4L7TA 3CVYA 4M3OA 3FWVA 2LSUA 3GZ2A 3LJ3A 3L13A 1HXIA 2HO1A 3PS6A 2R17C 4JHRA 2XCBA 2Y3AA 3CSTA 4I2WA 1E8ZA 3ESKA 3TJPA 2IONA 4ME2A 4RG9A 5EX3A 4FA6A 4KMOA 5FZQA 3CK8A 5G04C 3TXNA 5CCLA 3EHNA 2VGYA 3RO3A 5ANLA 4J8DA 4GAAA 2I1JA 2CFZA 4WWNA 4FC8A 1NA0A 3Q15A 2VSNA 2CG2A 3FU6A 4YVOA 5LX8A 4APFA 4EZJA 2L0IA 4J8SA 2LAIA 2IJGX 4BT9A 4U63A 2J08A 3LKUA 2M63A 3EIQC 2WXJA 2C0MA 3GYZA 4XKCA 2WXKA 1TEZA 2VYIA 3D9LA 5C2YA 4HXIA 4AV7A 4NRHB 1SZAA 3WXXA 3MGBA 3JUIA 3OXFA 4WWPA 2VSOE 4OYSA 3MV2B 4JEHA 3ZYKA 3LS8A 4I6JA 2BTDA 4UWFA 1E90A 3FULA 3PDNA 2BUGA 4EECA 4KXKB 3MA5A 4JVSA 1MHQA 1UW4B 4MKTA 4J6IA 3EIJA 4DK5A 1H2TC 3OXGA 4PS3A 4IULA 2IQCA 2X6JA 2IOLA 2MHKA 2HR2A 1ELRA 4GMLA 3FUMA 3PRZA 4CRWA 2WVIA 2ILRA 5D0QD 2GRMA 4ACKA 1UN9A 3RO2A 3UQ3A 5BV1A 3ML9A 5E76A 2DCPA 4U8HA 2ZU6B 4TV3A 3SF4A 4DLQA 4EBAG 5BNWA 4CGWA 5FWQA 5JJTA 5CCMA 3FY4A 3LYAA 4A55A 1KLXA 1WY6A 2CFUA 3FTUA 4HS2A 4UWLA 5BV0A 4UWKA 3QNKA 1UJJA 2J09A 1N52A 1OWNA 3QOUA 4BFRA 4GA0A 3N71A 2XPIA 4UQXA 4CCAA 3MZLB 5A6CA 1U3CA 3L17A 1IQUA 3PZDA 3URZA 4I1OB 4N5CA 2DIWA 5LFAA 1HS6A 2WMNA 3ZFWA 2I1KA 5C1DA 4FU3A 3UT4A 4NQ0A 3IHVA 3LVQE 4GZCA 4XI9A 3S7BA 3LDZA 3FUNA 4I9EA 2P58C 5FJYA 4KVOA 4D10C 3HHMA 1E8WA 5LCWC 3MKRA 3ZHEA 3AS4A 3VLFA 5JHBA 1OUVA 4I1AA 5FZRA 4J8FA 5T8IA 4GB9A 4RG6A 5T4YA 3ZHEB 1B89A 3SD5A 3RU0A 4HOSA 4HOUA 1XNFA 2VSXE 3CK9A 3CSFA 2PM7A 4L2YA 4Y6CA 3IHYA 4YVQC 2OOEA 3LY8A 4CDNA 1H2UA 2CHWA 3FTWA 4XKBA 2LSVA 4EBAA 3P2BA 2FI7A 4N3BA 4AP2A 4GYWA 2Y4UA 3S2AA 2LO6A 2KM4A 4A3TA 1Y8MA 4JA7A 4AVXA 3ZIMA 2WXNA 1PC2A 2DBAA 2IF4A 2KCVA 2X6KA 3OXLA 4U0SA 5A23A 3JYSA 3IBEA 3Q49B 2CHZA 3G2SA 2I2OA 2L9BA 3L08A 3FH8A 3ASGA 3FDHA 2XCCA 3FTXA 3MX3A 3EHMA 5G2NA 3R7RA 4FULA 3KS2A 3FTVA 5JJ7A 1P5QA 4N39A 4MLPA 3AU5A 4EQFA 4A1SA 3QARA 1E7VA 3AS5A 3UMVA 5CMWA 1HG2A 1NP7A 5EX0A 3RRUA 4PS7A 1IQRA 4I6EA 1E8YA 1DVPA 4J0UA 3D9NA 3FUFA 4YNDA 3DBSA 2XEVA 4GU5A 4URKA 3CVXA 4HFGA 4AY6A 3K9IA 3KD7A 4A3VA 5T3RA 4BT8A 4GA2A 1H2VC 4ANWA 2KC7A 4G26A 5AENA 4FJZA 4IRUA 4XIFA 5ARGA 3ZRHA 4C9BB 4NURA 2WXFA 2VGXA 5HI7A 3SNXA 1XGWA 2WXQA 1Z6TA 4G1TA 3FUHA 3ML8A 3CEQA 3AS8A 4LERA 3CVWA 3PE3A 3IV0A 2WXLA 3PUJA 2VGXB 1JWFA 1SQMA 1NZNA 3G2VA 3BG1B 4XZ4A 2J07A 2ONDA 2VTBA 4ILIA 4WWOA 4OVUA 4GCOA 4IN3B 4L23A 1Y6IA 2LNIA 3L54A 2VTBB 3FH7A 2A4ZA 2FBNA 4ABNA 4DPRA 3CVQA 4N3AA 1OWMA 3PEUB 3MV3B 4UWHA 3KEZA 4JEUA 2RD0A 3MKQA 4O6FA 3B7RL 3TG5A 4AM9A 3ONLA 4AY5A 2V0PA 4GCNA 1EDUA 2AXZA 2PM6A 3CVNA 3EDTB 3U4TA 3FTSA 4N3CA 2J9QA 4N2SA 1OWPA 3MKQB 2YINA 4KZ0A 5A7DB 2YQ8A 4ILGA 3RIBA 4LUNU 5CHEE 3PEVB 3ZEFA 3SI5A 2C2LA 2JLBA 3FUKA 3CHPA 5JJ6A 1ELWA 3CK7A 3ENEA 3LY9A 4JPSA 4HOTA 3ZW3A 4F3VA 3PE4A 2KCLA 3RK6A 1HG5A 3G2TA 3ZPJA 3R9AB 3FUJA 4A1GA 4FP7A 4ATGA 4BY6A 2KCKA 4ANUA 3D9JA 2JEKA 5ARFA 3PNTB 5FTPA 4XX5A 2NC9A 2X6HA 4JHJA 4TUUA 2J4DA 4ANXA 4B89A 5KJKA 3LCAA 3SZ7A 3OAWA 2VQ2A 3FU0A 4MS6A 3P1UA 4QFVA 4Y6WA 2QY7A 4WNGA 2E2EA 4AJWA 5DIZA 2A5UA 3ASDA 4G25A 3U9WA 1H0AA 4L1BA 1PAQA 4GA1A 4EZKA 4KYOB 2PZIA 3RKVA 3CV0A 3QB2A 2L0TB 4BX8A 4NACA 2NXPA 4HORA 3CVUA 1HZ4A 3B7UX 3JQ0A 5FT9A 4LCTA 3CGHA 4XE0A 4CEMA 3T5XA 2WM9A 1Z3YA 3FFLA 3HIZA 4U0UA 3RRMB 1NA3A 2Y4TA 3LPZA 1JUQA 3QAQA 3UT8A 3LEWA 2WXGA 4V3IA 5FQ4A 2R5SA 3L22A 3G2WA 5EKQD 1JWGA 1BPOA 3FUIA 4BTAA 2AWIA 2IU1A 2WPVA 2X6IA 3DPDA 5AYWD 1YA0A 4FADA 3HDXA 5LCWJ 4K0RA 3D9KA 1LF8A 2E0IA 5G55A 1W3BA 3FU5A 4G11A 3ZYQA 3RRNB 3CLJA 3ZYMA 5KJLA 3O4ZA 4AXHA 3Q4AB 4C0EA 2XPZA 2CG3A 1WM5A 2WXIA 1ZU2A 2GRLA 2RG8A 2WXMA 3NZSA 3FEXA 2WXPA 3PH0C 1EPUA 3CIAA 3EJNA 3B13A 3PVLA 2HM8A 3NQPA 4JC8A 1WAO1 2KATA 4G2VA 4F53A 3T8MA 3CHOA 5FZSA 3FUDA 5AJDA 4GZDA 2CHXA 2XGOA 2IFUA 4UQZA 1EF1C 1UN8A 5FQ7A 4C0MA 4CDRA 4FHKA 1HO8A 4W9RA 2X6FA 4DI4A 4AEZC 2V5FA 1HF8A 3ZVVA 1A17A 4ILHB 1HX8A 1IYGA 1QQEA 2VJ8A 5BT1A 1SZ9A 3CVVA 3BEEA 4XI0A 1INZA 1EYHA 1N54A 2C0LA 2WXRA 3ASFA 5LOZA 3PUKA 5BUZA 2AXVA 1FVFA 5CMYA 4GYYA 3FEYA 3U3WA 2MRIA 2YHCA 1FVHA 1H6KA 3I4GA 4I1MA 5FQ8A 3NZUA 3CHMA 4WAFA 5G05J 3MEKA 1E7UA 4ACLA 2FULA 4RSYA 2NSZA 4AIFA 4K03A 3PNLB 4PS8A 4BX9A 4AOFA 2XRZA 4H7XA 4PDXA 3CVLA 2WXOA 4GYOA 2VSYA 3SHFA 3U66A 4IYPA 2AXUA 3CR3A 3ULQA 3IKOB 1HE8A 3CKCA 1E8XA 3FUEA 3I4RB 2GW1A 3HVEA 3CQCB 4MRUA 4DJAA 4HLEA 5JHAA 4Q94A 1VDYA 2XPYA 1DNPA 4J8EA 1L5JA 5DBKA 3TXMA 1ELKA 4N2QA 3TG4A 3ESLA 3AU4A 4U07A 4E85A 2FEZA 3Q47B 3S7FA 3HVEB 1OWLA 5G05C 4P29A 2AVPA 3QK0A 3FHEA 1FCHA 5AJLA 4GMJA 2I6HA 4RVBA 4B8CB 1HH8A 3E4BA 4WNDA 4B8AA 3SBSA 4G24A 4FHJA 2XGMA 3D3MA 3QWVA 4JHKA 3CQGB 3O48A 3OTNA 2I9CA 3VTXA 4DLOA 4FJYA 4I9CA 2UY1A 3L16A 2YNQA 3LVRE 5AIJA 3CKBA 3QKYA 5ANRA 2PQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUY A;  2UY1 B;  4I17 A;  4JL0 A;  4JA9 A;  4U04 A;  3ASH A;  3FP3 A;  3QWW A;  4B94 A;  2XGS A;  4LEU A;  5KJM A;  2UWJ G;  4H7Y A;  4APO A;  4BTB A;  2PL2 A;  3CVP A;  4WNE A;  3IEG A;  2HYZ A;  3UPV A;  4UI9 J;  5HQ8 A;  3ZN3 A;  3GW4 A;  1KT0 A;  3S7D A;  4CGV A;  2Q7F A;  4KBQ A;  3S7J A;  4UQY A;  5BW8 C;  5M72 A;  3NF1 A;  3VTY A;  2FO7 A;  3QDN A;  2L6J A;  4GZ6 A;  3Q5M A;  2QFC A;  4UI9 C;  1IHG A;  4GZ3 A;  3RJV A;  3GZ1 A;  3ZGQ A;  4GPK A;  4WNF A;  3TAX A;  4BWR A;  3HYM B;  1QZ2 A;  3LY7 A;  3QWP A;  1E96 B;  3TGO A;  1TJC A;  4HOQ A;  4I2Z A;  5D0O D;  4UI9 K;  4G23 A;  2PQR A;  4U0Z A;  1KT1 A;  2FF4 A;  5KJN A;  3UUX A;  2WQH A;  5G04 J;  3KAE A;  1ZBP A;  4GZ5 A;  3FWV A;  2LSU A;  3GZ2 A;  1HXI A;  2HO1 A;  4JHR A;  2XCB A;  4I2W A;  3ESK A;  5EX3 A;  4ME2 A;  4RG9 A;  5FZQ A;  3CK8 A;  5G04 C;  5CCL A;  2VGY A;  3RO3 A;  4J8D A;  1NA0 A;  3Q15 A;  2VSN A;  4YVO A;  4BT9 A;  3LKU A;  2C0M A;  3GYZ A;  2VYI A;  4NRH B;  3WXX A;  3OXF A;  3MV2 B;  3PDN A;  2BUG A;  4KXK B;  3MA5 A;  3OXG A;  2MHK A;  2HR2 A;  1ELR A;  5D0Q D;  3RO2 A;  3UQ3 A;  5JJT A;  4CGW A;  3SF4 A;  5LCW J;  5BNW A;  5CCM A;  3LYA A;  1KLX A;  3QOU A;  4GA0 A;  3N71 A;  2XPI A;  4UQX A;  5A6C A;  3URZ A;  4N5C A;  3ZFW A;  5C1D A;  4NQ0 A;  4XI9 A;  3S7B A;  4I9E A;  2P58 C;  5FJY A;  5LCW C;  3MKR A;  3ZHE A;  3AS4 A;  1OUV A;  4I1A A;  5FZR A;  4J8F A;  4RG6 A;  3ZHE B;  1B89 A;  3RU0 A;  4HOS A;  4HOU A;  1XNF A;  3CK9 A;  4Y6C A;  4YVQ C;  2OOE A;  3LY8 A;  2LSV A;  2FI7 A;  4N3B A;  4GYW A;  2Y4U A;  1Y8M A;  4JA7 A;  1PC2 A;  2DBA A;  2IF4 A;  2KCV A;  3OXL A;  4U0S A;  3JYS A;  3Q49 B;  3ASG A;  2XCC A;  3KS2 A;  5JJ7 A;  1P5Q A;  4N39 A;  4EQF A;  4A1S A;  3AS5 A;  5EX0 A;  4J0U A;  4YND A;  2XEV A;  4AY6 A;  3K9I A;  3KD7 A;  4BT8 A;  4GA2 A;  2KC7 A;  4G26 A;  4XIF A;  5ARG A;  2VGX A;  5HI7 A;  4G1T A;  3CEQ A;  3AS8 A;  3PE3 A;  2VGX B;  1NZN A;  2OND A;  4GCO A;  4IN3 B;  2LNI A;  2FBN A;  4ABN A;  3CVQ A;  4N3A A;  3MV3 B;  4O6F A;  3TG5 A;  4AM9 A;  4AY5 A;  4GCN A;  3U4T A;  3CVN A;  3EDT B;  4N3C A;  2J9Q A;  4N2S A;  5A7D B;  3RIB A;  2YQ8 A;  5CHE E;  2C2L A;  2JLB A;  5JJ6 A;  4HOT A;  1ELW A;  3CK7 A;  3LY9 A;  4F3V A;  3PE4 A;  2KCL A;  3ZPJ A;  3R9A B;  2KCK A;  5ARF A;  5FTP A;  2NC9 A;  5KJK A;  3LCA A;  3SZ7 A;  2VQ2 A;  4Y6W A;  4WNG A;  2E2E A;  5DIZ A;  3ASD A;  4G25 A;  4GA1 A;  4KYO B;  2PZI A;  3RKV A;  3CV0 A;  4HOR A;  1HZ4 A;  5FT9 A;  3FFL A;  4U0U A;  1NA3 A;  2Y4T A;  3LPZ A;  2R5S A;  5EKQ D;  4BTA A;  2WPV A;  5AYW D;  1YA0 A;  1W3B A;  5KJL A;  3Q4A B;  1WM5 A;  1ZU2 A;  1WAO 1;  2KAT A;  4G2V A;  5FZS A;  4UQZ A;  2XGO A;  2IFU A;  4CDR A;  4W9R A;  2V5F A;  1A17 A;  1IYG A;  1QQE A;  5BT1 A;  3BEE A;  4XI0 A;  2C0L A;  3ASF A;  4GYY A;  3U3W A;  2YHC A;  5G05 J;  3MEK A;  4AIF A;  4H7X A;  3CVL A;  4GYO A;  2VSY A;  3ULQ A;  3CKC A;  2GW1 A;  4J8E A;  5DBK A;  4N2Q A;  3TG4 A;  4U07 A;  2FEZ A;  3Q47 B;  3S7F A;  5G05 C;  2AVP A;  1FCH A;  2I6H A;  1HH8 A;  3E4B A;  4WND A;  4G24 A;  2XGM A;  3QWV A;  3O48 A;  3VTX A;  4I9C A;  2UY1 A;  3CKB A;  3QKY A;  2PQN A; 
#chains in the Genus database with same CATH topology
 3QC1 A;  1U3D A;  1SA4 A;  4I17 A;  4JL0 A;  1OWO A;  2F8Y A;  4B94 A;  3B7S A;  4BTB A;  2PL2 A;  3HXB A;  1OCZ E;  2HYZ A;  3APC A;  4DX1 A;  4JXT A;  4UI9 J;  4F1S A;  4Q69 A;  1S0P A;  3S7D A;  2J49 A;  4LG6 A;  4CGV A;  4B0Z A;  2Q7F A;  4FLH A;  4KBQ A;  4YDE A;  2QZA A;  2ZXW E;  3V2X A;  2WB2 A;  5CRV A;  3B7B A;  4JB8 P;  2QFC A;  5FQ6 A;  5BPP A;  3EUV A;  4Q96 A;  5ITZ F;  3D9M A;  1MQS A;  1N11 A;  3FTY A;  3T5V A;  3D9H A;  4KZC A;  3Q9N C;  4WNF A;  1MYO A;  1BD8 A;  4O60 A;  4BWR A;  3TGO A;  1TJC A;  4R7L A;  3APF A;  4G23 A;  4NIK A;  2PQR A;  1TN7 A;  2P9S G;  1HFA A;  3PRE A;  3UUX A;  5G04 J;  2MOW A;  3VLD A;  3APD A;  4OVV A;  5ENO D;  2J4B A;  3DSU A;  4L7T A;  2XS8 A;  4M3O A;  3GZ2 A;  1HXI A;  4XEI G;  2R17 C;  2DZN A;  2XCB A;  3CST A;  4HI9 A;  4I2W A;  1E8Z A;  3ESK A;  4FA6 A;  1KPS B;  5CCL A;  3EHN A;  3L9T A;  4GAA A;  2CFZ A;  3Q15 A;  3AAA C;  5EID A;  5LX8 A;  4U63 A;  2P9K G;  2OCC E;  1S70 B;  3R9M A;  1TNY A;  1SZA A;  4WWP A;  2DVW A;  3ZYK A;  1K1A A;  1E90 A;  3PDN A;  4JVS A;  1MHQ A;  3OXG A;  4GTS A;  4IUL A;  2IQC A;  4U8V D;  4M7C A;  1ELR A;  3FUM A;  3PRZ A;  1JCS A;  3UIP C;  1MJ0 A;  5BV1 A;  5E76 A;  2DCP A;  4DLQ A;  5BNW A;  5FWQ A;  2CFU A;  3FTU A;  2DYS E;  2J09 A;  3QOU A;  3N71 A;  4CCA A;  5KNG A;  1IQU A;  3URZ A;  5LFA A;  3ZFW A;  1O1T A;  5JMN D;  3IHV A;  4GZC A;  3LDZ A;  2P58 C;  4LNB A;  1E8W A;  1OUV A;  3T8K A;  4I1A A;  5T8I A;  1WDY A;  3ZHE B;  1B89 A;  1OT8 A;  4Y6C A;  4YVQ C;  4GTT A;  3IHY A;  2CHW A;  2Y69 E;  2FI7 A;  3TWR A;  3ZIM A;  1DC2 A;  2ZGD A;  4GTP A;  1IHB A;  2I2O A;  3UM0 A;  3FH8 A;  3FDH A;  3F6Q A;  3EU9 A;  2P9N G;  5JJ7 A;  3AU5 A;  4EQF A;  4A1S A;  3UKR G;  4TUM A;  1N4S A;  3D9N A;  5ENP D;  4YND A;  4HFG A;  3DST A;  2FO1 E;  5T3R A;  1H2V C;  2Y0B G;  3DSV A;  4G26 A;  5AEN A;  4IRU A;  4XIF A;  4C9B B;  3ZRH A;  2WXF A;  5HI7 A;  3SNX A;  2WXQ A;  4G1T A;  2BED A;  3ML8 A;  4BER A;  3CVW A;  3IV0 A;  2VGX B;  1JWF A;  3BG1 B;  4WWO A;  4OVU A;  3L54 A;  4ABN A;  1O5M A;  5CEA A;  4HNA D;  4UWH A;  4JEU A;  3SY2 A;  3TG5 A;  2LXM A;  4N2S A;  3MKQ B;  4KZ0 A;  4ILG A;  4LUN U;  3LY9 A;  3ZW3 A;  4F3V A;  3RK6 A;  3G2T A;  4A1G A;  3ZPJ A;  4BY6 A;  2JEK A;  5ARF A;  3PNT B;  4JHJ A;  4GTR A;  4ANX A;  1SA5 A;  5KJK A;  3SZ7 A;  4Y6W A;  1WG0 A;  3ASD A;  3UM2 A;  4BX8 A;  4JD2 G;  1HZ4 A;  3JQ0 A;  5FT9 A;  4LCT A;  3T5X A;  3FFL A;  3RRM B;  3UT8 A;  2WXG A;  4V3I A;  5CBN A;  2R5S A;  3L22 A;  5EKQ D;  2IU1 A;  4FAD A;  3HDX A;  3CLJ A;  3ZYM A;  4C0E A;  2CG3 A;  1ZU2 A;  3DSX A;  2RG8 A;  1EPU A;  2HM8 A;  1WAO 1;  4G2V A;  3CHO A;  4GZD A;  4AEZ C;  3ZVV A;  4QQI A;  2ETC A;  1INZ A;  1N54 A;  5BUZ A;  1FVF A;  4GYY A;  1H6K A;  1DCQ A;  3CHM A;  5G05 J;  3ZUV B;  2FUL A;  4TXP A;  2NSZ A;  4AIF A;  4H7X A;  5HKP A;  2IO2 C;  3BU8 A;  3LJN A;  4OAV B;  3DRA A;  3IKO B;  3FUE A;  3I4R B;  1VDY A;  2XPY A;  1DNP A;  4N2Q A;  3TG4 A;  3AU4 A;  4E85 A;  2FEZ A;  3S7F A;  4TXQ A;  2AVP A;  1FCH A;  4GMJ A;  4B8A A;  3SBS A;  4FHJ A;  4JHK A;  2I9C A;  3W9G A;  1TNO A;  3CKB A;  3LXU X;  4WUY A;  4JA9 A;  4L2L A;  3ONK A;  3I3N A;  2BF0 X;  2GRP B;  2XQ0 A;  3ASH A;  3FP3 A;  1LTX A;  3TWV A;  4BSX A;  3HXE A;  3MYV A;  2ZGG A;  4E6H A;  5KJM A;  3CHR A;  4KVM A;  4APO A;  4WNE A;  1TYQ G;  5BXO A;  1RW2 A;  4HVB A;  4LRZ A;  2GGF A;  4CDM A;  4JW1 A;  3UX4 A;  1OCR E;  1HU3 A;  3NF1 A;  3FH5 A;  2L6J A;  1X5B A;  3D9P A;  2EQX A;  4GZ6 A;  3G2U A;  3T9K A;  3HXC A;  2R59 A;  3EU5 A;  2ETA A;  3ULE G;  4HRM B;  3CHQ A;  3QWP A;  1V54 E;  1UG3 A;  3DWL G;  3MJW A;  4U0Z A;  1JPL A;  4BSZ B;  5KJN A;  2OV8 A;  2X3M A;  3UKU G;  1IKN D;  4EZL A;  3KAE A;  4EPZ A;  1ZBP A;  5J08 A;  4GZ5 A;  1H19 A;  5LP0 A;  2EIN E;  1LD8 A;  2XZD G;  3L13 A;  3ZU7 B;  1AP7 A;  5B1B E;  2ION A;  5EX3 A;  4KMO A;  4U8Y D;  3RO3 A;  5ANL A;  2DYR E;  1K3Z D;  2OEV A;  2CG2 A;  4BT9 A;  1AWC B;  2M63 A;  2QYJ A;  4J7W A;  2H6I A;  4YDY A;  2VYI A;  3SO8 A;  3D9L A;  4HXI A;  3WXX A;  1OY3 D;  2VSO E;  4OYS A;  3RAU A;  1KZO A;  4UWF A;  3FUL A;  3DXK G;  4J6I A;  3EIJ A;  1H2T C;  4A63 B;  1G3N B;  1FPP A;  2H6F A;  4DUI A;  4CRW A;  5CED B;  2WVI A;  4ATZ D;  4ACK A;  1UN9 A;  1LD7 A;  3UQ3 A;  3ML9 A;  1MZC A;  4TV3 A;  3SF4 A;  4EBA G;  5CCM A;  3FY4 A;  1WY6 A;  4UWL A;  5BV0 A;  4HS2 A;  3QNK A;  1UJJ A;  3V2O A;  1OWN A;  4BET A;  4BFR A;  4UQX A;  2XPI A;  3MZL B;  5ENT D;  1U3C A;  4N5C A;  3UT4 A;  4NQ0 A;  3LVQ E;  3S7B A;  2H6H A;  1MX2 A;  4I9E A;  4K5B A;  5LCW C;  3PZ2 A;  3ZHE A;  5EYL A;  3VLF A;  5FZR A;  4J8F A;  3TWS A;  4RG6 A;  4DX6 D;  3AJI A;  3CSF A;  2H6G A;  5AQB A;  4XKB A;  1TN6 A;  3P2B A;  1D8D A;  4GYW A;  1A5E A;  3S2A A;  3Q7F A;  4JA7 A;  2DBA A;  3OXL A;  4U0S A;  2CHZ A;  3L08 A;  2F0Y A;  4C48 B;  4FUL A;  3FTV A;  2EIK E;  4MLP A;  3TWX A;  3QAR A;  1E7V A;  3AS5 A;  3UMV A;  1HG2 A;  1NP7 A;  1E8Y A;  4GU5 A;  3K9I A;  3KD7 A;  2IEJ A;  3NB2 A;  4NUR A;  2VGX A;  1XGW A;  3KSQ A;  3FUH A;  4HI8 A;  3AS8 A;  1NZN A;  2QC9 A;  4XZ4 A;  2J07 A;  3KEA A;  4GCO A;  4Z68 A;  2VTB B;  3FH7 A;  2A4Z A;  2FBN A;  4DPR A;  4N3A A;  2RD0 A;  3MKQ A;  4O6F A;  3B7R L;  4AM9 A;  2V0P A;  4GCN A;  2PM6 A;  3CVN A;  3EDT B;  3AG4 E;  3RIB A;  4UUC A;  4GMR A;  5CER B;  2JLB A;  5JJ6 A;  3CK7 A;  2VGE A;  1V55 E;  3PE4 A;  4U95 D;  1HG5 A;  5CBO A;  3R9A B;  1MX4 A;  3D9J A;  3OAW A;  2VQ2 A;  3FU0 A;  4QFV A;  4WNG A;  3DPY A;  4AJW A;  4G25 A;  2RFM A;  4L1B A;  4GA1 A;  4EZK A;  4KYO B;  3RKV A;  3QB2 A;  4NAC A;  2NXP A;  5FIO A;  3B7U X;  4XE0 A;  4ZFH A;  2WM9 A;  1NA3 A;  3LPZ A;  3V31 A;  3UTM A;  1NL4 A;  3ASO E;  1JWG A;  3FUI A;  4BTA A;  3JXI A;  4K0R A;  2E0I A;  4G11 A;  3RRN B;  5KJL A;  3O4Z A;  1WM5 A;  2WXI A;  3AG2 E;  2WXM A;  3CIA A;  5AN8 A;  4JC8 A;  2KAT A;  3DSW A;  5FZS A;  4UQZ A;  3Q73 A;  4FHK A;  1HO8 A;  1A17 A;  1SZ9 A;  3BEE A;  4XI0 A;  3KSL A;  4LNU D;  1H6O A;  5LOZ A;  3PUK A;  3U3W A;  3I4G A;  4I1M A;  5FQ8 A;  4WAF A;  2GRN B;  3C3O A;  3PNL B;  4PS8 A;  3SHF A;  3HXF A;  1E8X A;  3CQC B;  3TXM A;  1QBQ A;  5DBK A;  1ELK A;  2DWZ A;  5ENR D;  4P29 A;  3FHE A;  2I6H A;  1O1S A;  2R2L A;  4G24 A;  2XGM A;  3VTX A;  2YNQ A;  3LVR E;  5AIJ A;  3EHQ A;  5ANR A;  2PQN A;  2LUH A;  5A6C A;  3UM1 A;  2XEN A;  3D9I A;  2V5Q C;  1IXV A;  1N4P A;  4LEU A;  2IY0 C;  4H7Y A;  4DX7 D;  3UIN C;  3EHR A;  3CVP A;  4HRN A;  3IEG A;  5B1A E;  1QNF A;  3AG1 E;  4PH4 B;  4I6G A;  3UT7 A;  2KBX A;  5HQ8 A;  2LAH A;  2WMO A;  3MCX A;  1JCR A;  2IO3 C;  3ZN3 A;  1OCO E;  4HRL A;  3GW4 A;  2KZT B;  1KT0 A;  3SGH A;  4I43 A;  3JQ1 A;  3HG0 D;  3S7J A;  4UQY A;  1N9A A;  3SBT B;  3VTY A;  3U64 A;  2FO7 A;  3QDN A;  5EDS A;  5E75 A;  4CT4 A;  3E37 A;  2ETB A;  3Q5M A;  1IHG A;  4GZ3 A;  3RJV A;  3ZGQ A;  1N0Q A;  3B7T A;  4GPK A;  3DEO A;  2EIL E;  1PY1 A;  5KCM A;  3FTZ A;  1QZ2 A;  3LY7 A;  1E96 B;  2A5E A;  2V4L A;  3I5P A;  3TWW A;  3C98 A;  4GTO A;  3ZXS A;  4HOQ A;  3CHS A;  5IY5 E;  5D0O D;  1K1B A;  5ENQ D;  1KT1 A;  2OVF A;  2YHE A;  1X81 A;  3TL5 A;  5AAO A;  3J5Q B;  4TRQ A;  1UJK A;  3FU3 A;  3E30 A;  2WQ7 A;  3E34 A;  3V79 K;  2P9U G;  3LJ3 A;  3PS6 A;  2Y3A A;  3TJP A;  4O1O A;  5FZQ A;  2VGY A;  4WWN A;  4FC8 A;  1NA0 A;  5ENS D;  3FU6 A;  4YVO A;  4APF A;  4EZJ A;  4J8S A;  2LAI A;  2IJG X;  4G8L A;  4XKC A;  1TEZ A;  4U96 D;  5C2Y A;  4AV7 A;  4NRH B;  3MV2 B;  3PZ3 A;  2BTD A;  2RKK A;  4G8K A;  4MKT A;  1UW4 B;  4DK5 A;  3NOC D;  2RFA A;  5KBA A;  2IOL A;  2R02 A;  4GML A;  2ILR A;  3RO2 A;  4U7E B;  4U8H A;  4CGW A;  5LCW J;  3HRA A;  4UWK A;  2LXL A;  1BI8 B;  1YYH A;  3ABL E;  1N4R A;  1S63 A;  4I1O B;  1TNU A;  1HS6 A;  2WMN A;  5C1D A;  4FU3 A;  4XI9 A;  4D10 C;  3HHM A;  3MKR A;  3AS4 A;  1D9S A;  2P2C P;  4TXR A;  5T4Y A;  3ABK E;  3RU0 A;  4HOS A;  1XNF A;  2VSX E;  4L2Y A;  4YDW A;  3FTW A;  5HRY A;  2LSV A;  3Q75 A;  4CYM D;  4AP2 A;  2NYJ A;  2Y4U A;  2LO6 A;  2KM4 A;  3SQV A;  4AVX A;  2WXN A;  1PC2 A;  2IF4 A;  3IBE A;  3G2S A;  2L9B A;  2XCC A;  5AQA A;  3EHM A;  1N95 A;  5G2N A;  3KS2 A;  1P5Q A;  4N39 A;  4HB5 A;  2GRQ B;  5CMW A;  3SFY A;  5EX0 A;  3RRU A;  3DSS A;  4PS7 A;  1IQR A;  4I6E A;  1DVP A;  4J0U A;  3FUF A;  4URK A;  4AY6 A;  4ANW A;  5ARG A;  4LNG A;  3Q9U C;  1Z6T A;  4DRX E;  4RLY A;  4LER A;  3PUJ A;  2BKG A;  2VTB A;  4ILI A;  4IN3 B;  2LNI A;  2ZIR A;  4DX2 A;  1OWM A;  3PEU B;  4B93 B;  1H6P A;  1TNZ A;  1EDU A;  3U4T A;  2AXZ A;  1U2V G;  3FTS A;  4N3C A;  2J9Q A;  1MX6 A;  2YIN A;  2YQ8 A;  5CHE E;  3ZEF A;  2XEH A;  3CHP A;  2KCL A;  2ZIS A;  3FUJ A;  4ATG A;  5AAR A;  3DEP A;  5FTP A;  1BI7 B;  2NC9 A;  2X6H A;  4TUU A;  3L82 A;  4GPM A;  3P1U A;  2E2E A;  3U9W A;  1H0A A;  1PAQ A;  3Q79 A;  2L0T B;  4HOR A;  1FT2 A;  1D8E A;  3QAQ A;  3LEW A;  5FQ4 A;  2BKK B;  5H7P A;  3ZXP A;  1BPO A;  2L6B A;  4HLL A;  2WPV A;  2X6I A;  5AYW D;  3PZ4 A;  2F37 A;  3BQO A;  3Q4A B;  2XPZ A;  3C3R A;  3ZKJ A;  2EIM E;  3FEX A;  3PH0 C;  5D2M C;  3NQP A;  3DXM G;  1NI1 A;  5AJD A;  1OCC E;  1DCE A;  1BU9 A;  2IFU A;  1EF1 C;  4C0M A;  1NFI E;  2X6F A;  3E33 A;  4DI4 A;  2V5F A;  4ILH B;  4O1P A;  1IYG A;  3V30 A;  5BT1 A;  3CVV A;  1EYH A;  2WXR A;  3ASF A;  2AXV A;  5CMY A;  3FEY A;  1FVH A;  3JUE A;  4F1P A;  4ACL A;  3JXJ A;  4K03 A;  4N5Q A;  4BX9 A;  4AOF A;  2XRZ A;  1Q2Z A;  3UM3 A;  5EN5 D;  3CVL A;  2WXO A;  2VSY A;  4IYP A;  3CR3 A;  5B3S E;  1HE8 A;  4MRU A;  4DJA A;  5JHA A;  1L5J A;  3X2Q E;  3Q47 B;  3HVE B;  1OWL A;  3NOG D;  3UIO C;  2XZT G;  3QWV A;  3CQG B;  3O48 A;  3OTN A;  5FIN A;  4FJY A;  3L16 A;  3QKY A;  3BG0 B;  4PUC A;  2UY1 B;  4CT0 A;  2WXH A;  1O1R A;  5ENN A;  4U04 A;  3NAW A;  3QJZ A;  4UWG A;  3QWW A;  2XGS A;  4F7A A;  2XHE A;  5J90 A;  2UWJ G;  4RQI A;  4HQD A;  3JCK C;  2XRY A;  2R05 A;  5EIL A;  3D9O A;  4KT6 B;  3UPV A;  2KZT A;  5AQ7 A;  3ULY A;  4FLB A;  5BXU A;  5KNH D;  1Z3X A;  2MYO A;  2WQ6 A;  3TWQ A;  2P9I G;  4DI3 A;  5BW8 C;  5M72 A;  1SW6 A;  2R03 A;  2X38 A;  2P9L G;  4UI9 C;  3SFZ A;  3R7Q A;  2AW6 A;  2V8S E;  3GZ1 A;  3HXD A;  3C3Q A;  2IOS A;  3L6A A;  1RZ4 A;  1GW6 A;  3ZYL A;  3TAX A;  3HYM B;  2GRO B;  4L9P A;  4JZY A;  2P9P G;  4I2Z A;  4UI9 K;  2OVB A;  4YDO A;  1Z5S C;  3TWU A;  2FF4 A;  3VLE A;  1K8K G;  2WQH A;  4HBD A;  1N0R A;  1QYM A;  5HS0 A;  3GZS A;  1TJF A;  3NBN B;  4ANV A;  3CVY A;  3FWV A;  2LSU A;  4ZHB A;  2HO1 A;  4JHR A;  5AQ9 A;  4ME2 A;  4RG9 A;  3B95 A;  3CK8 A;  5G04 C;  3TXN A;  4J8D A;  1FT1 A;  2I1J A;  4K5A B;  3Q7A A;  2VSN A;  3UXG A;  2L0I A;  3ZNG A;  2J08 A;  3LKU A;  3EIQ C;  2WXJ A;  2C0M A;  3GYZ A;  2WXK A;  5CRU A;  3MGB A;  3JUI A;  3OXF A;  4JEH A;  3LS8 A;  3TWT A;  4I6J A;  4EEC A;  2BUG A;  4KXK B;  3MA5 A;  2B6C A;  1TNB A;  4PS3 A;  3E32 A;  2X6J A;  2OEW A;  2MHK A;  2HR2 A;  5D0Q D;  2GRM A;  2F8X K;  2QYU A;  5JJT A;  2ZU6 B;  4A55 A;  3LYA A;  1KLX A;  1N52 A;  2HE0 A;  4GA0 A;  3AG3 E;  4GTQ A;  3L17 A;  3PZD A;  2DIW A;  2I1K A;  4EHM A;  3FUN A;  1SVX A;  5FJY A;  4KVO A;  1BLX B;  2GRR B;  4OAU C;  5JHB A;  4GB9 A;  3RSE G;  3SD5 A;  4HOU A;  3CK9 A;  3J5P A;  2PM7 A;  2OOE A;  3LY8 A;  4CDN A;  1H2U A;  4F6R D;  4DX5 D;  4EBA A;  4N3B A;  4A3T A;  1ZB1 A;  1Y8M A;  2KCV A;  2X6K A;  5A23 A;  3JYS A;  3Q49 B;  4LSZ E;  3ASG A;  3ISM C;  3FTX A;  3MX3 A;  5JA4 D;  3R7R A;  1YMP A;  4X8Q A;  1JCQ A;  3DBS A;  2XEV A;  3W9F A;  3CVX A;  3C5R A;  4A3V A;  4BT8 A;  4GA2 A;  1S64 A;  2XS1 A;  2KC7 A;  4FJZ A;  4BES A;  1TN8 A;  4GTV A;  3CEQ A;  3PE3 A;  2WXL A;  2KXP C;  1SQM A;  3G2V A;  2OND A;  4L23 A;  1Y6I A;  5EIB E;  3CVQ A;  3MV3 B;  3KEZ A;  4CZ2 D;  4AY5 A;  3ONL A;  1TR4 A;  1OWP A;  5A7D B;  4GTM A;  3UI2 A;  3PEV B;  3SI5 A;  2C2L A;  3FUK A;  4HOT A;  1ELW A;  3ENE A;  4JPS A;  4K5C A;  4FP7 A;  2KCK A;  4ANU A;  4XX5 A;  2J4D A;  4B89 A;  3LCA A;  4MS6 A;  2QY7 A;  5DIZ A;  2A5U A;  2EIJ E;  3IXE A;  2PZI A;  3CV0 A;  3CVU A;  3BUA A;  3CGH A;  2AJA A;  4CEM A;  3HIZ A;  1Z3Y A;  4U0U A;  2Y4T A;  1JUQ A;  1KZP A;  5CEC B;  3G2W A;  2AWI A;  1N4Q A;  3DPD A;  3Q78 A;  4BEP A;  1YA0 A;  3D9K A;  1LF8 A;  5G55 A;  4MBG A;  1W3B A;  3FU5 A;  3ZYQ A;  1UOH A;  4AXH A;  2XEE A;  2J8S D;  2GRL A;  3NZS A;  2WXP A;  3EJN A;  3B13 A;  3PVL A;  4F53 A;  3T8M A;  3FUD A;  2JAB A;  2CHX A;  2XGO A;  5FQ7 A;  1UN8 A;  4CDR A;  4W9R A;  1N94 A;  1OXJ A;  1HF8 A;  1HX8 A;  1QQE A;  2VJ8 A;  5KWD A;  2C0L A;  2MRI A;  2YHC A;  2DZO A;  3NZU A;  3MEK A;  1E7U A;  2Y1L E;  4RSY A;  1YCS B;  4PDX A;  3ABM E;  4GYO A;  3U66 A;  2AXU A;  3ULQ A;  3CKC A;  2GW1 A;  3HVE A;  4HLE A;  3PZ1 A;  4Q94 A;  4J8E A;  3ESL A;  3C72 A;  4U07 A;  2PNN A;  5G05 C;  4J8Y A;  3WG7 E;  3QK0 A;  5AJL A;  4RVB A;  4B8C B;  1HH8 A;  2B0O E;  3E4B A;  4WND A;  3SFX A;  3D3M A;  5EYP F;  4DLO A;  4I9C A;  5D66 A;  2UY1 A;  2V4H C;  3ASN E; 
#chains in the Genus database with same CATH homology
 3BG0 B;  3LXU X;  4WUY A;  3QC1 A;  4PUC A;  1U3D A;  2UY1 B;  4CT0 A;  2WXH A;  4I17 A;  4JL0 A;  4JA9 A;  4L2L A;  3ONK A;  3I3N A;  5ENN A;  2BF0 X;  2XQ0 A;  1OWO A;  4U04 A;  3ASH A;  3FP3 A;  3D9I A;  3QJZ A;  4UWG A;  3QWW A;  4B94 A;  2XGS A;  4BSX A;  4LEU A;  2XHE A;  3MYV A;  4F7A A;  4E6H A;  5KJM A;  2UWJ G;  5J90 A;  3CHR A;  4H7Y A;  4KVM A;  4APO A;  3B7S A;  4BTB A;  2PL2 A;  3JCK C;  2XRY A;  3CVP A;  4WNE A;  3IEG A;  2HYZ A;  1QNF A;  3APC A;  3D9O A;  4KT6 B;  4PH4 B;  3UPV A;  4I6G A;  3UT7 A;  2KZT A;  4JXT A;  4UI9 J;  4F1S A;  4HVB A;  5HQ8 A;  4Q69 A;  2LAH A;  2WMO A;  4LRZ A;  2GGF A;  3MCX A;  1S0P A;  3ZN3 A;  4FLB A;  3GW4 A;  2KZT B;  4CDM A;  1Z3X A;  2WQ6 A;  4JW1 A;  1KT0 A;  3S7D A;  3SGH A;  2J49 A;  4I43 A;  3UX4 A;  4B0Z A;  4CGV A;  3JQ1 A;  2Q7F A;  4FLH A;  4DI3 A;  4KBQ A;  3S7J A;  4UQY A;  5BW8 C;  3SBT B;  5M72 A;  1HU3 A;  3NF1 A;  3VTY A;  3FH5 A;  3U64 A;  2WB2 A;  2FO7 A;  3QDN A;  2L6J A;  5EDS A;  2X38 A;  1X5B A;  3D9P A;  5E75 A;  2EQX A;  4GZ6 A;  3G2U A;  4CT4 A;  3Q5M A;  2QFC A;  4UI9 C;  5FQ6 A;  1IHG A;  5BPP A;  3SFZ A;  4Q96 A;  3R7Q A;  4GZ3 A;  3D9M A;  3RJV A;  2AW6 A;  1MQS A;  2V8S E;  3GZ1 A;  3ZGQ A;  3FTY A;  3B7T A;  3T5V A;  4GPK A;  2IOS A;  4KZC A;  2R59 A;  3L6A A;  1PY1 A;  4WNF A;  5KCM A;  1GW6 A;  3FTZ A;  3ZYL A;  3TAX A;  4BWR A;  3HYM B;  1QZ2 A;  3LY7 A;  3CHQ A;  3QWP A;  1E96 B;  2V4L A;  3I5P A;  3TGO A;  1TJC A;  3C98 A;  3ZXS A;  4JZY A;  4R7L A;  4HOQ A;  3CHS A;  4I2Z A;  5D0O D;  3APF A;  4UI9 K;  2OVB A;  1UG3 A;  4G23 A;  2PQR A;  3MJW A;  1KT1 A;  4U0Z A;  2OVF A;  1JPL A;  1HFA A;  2FF4 A;  3PRE A;  2YHE A;  3VLE A;  5KJN A;  3TL5 A;  3UUX A;  2OV8 A;  2WQH A;  5G04 J;  2MOW A;  2X3M A;  4TRQ A;  4EZL A;  3KAE A;  4EPZ A;  1UJK A;  1ZBP A;  3FU3 A;  4GZ5 A;  5J08 A;  1H19 A;  3GZS A;  3VLD A;  1TJF A;  3APD A;  4OVV A;  2WQ7 A;  5LP0 A;  4ANV A;  2J4B A;  4L7T A;  3CVY A;  4M3O A;  3FWV A;  2LSU A;  3GZ2 A;  3LJ3 A;  3L13 A;  1HXI A;  2HO1 A;  3PS6 A;  2R17 C;  4JHR A;  2XCB A;  2Y3A A;  3CST A;  4I2W A;  1E8Z A;  3ESK A;  3TJP A;  2ION A;  4ME2 A;  4RG9 A;  5EX3 A;  4FA6 A;  4KMO A;  5FZQ A;  3CK8 A;  5G04 C;  3TXN A;  5CCL A;  3EHN A;  2VGY A;  3RO3 A;  5ANL A;  4J8D A;  4GAA A;  2I1J A;  2CFZ A;  4WWN A;  4FC8 A;  1NA0 A;  3Q15 A;  2VSN A;  2CG2 A;  3FU6 A;  4YVO A;  5LX8 A;  4APF A;  4EZJ A;  2L0I A;  4J8S A;  2LAI A;  2IJG X;  4BT9 A;  4U63 A;  2J08 A;  3LKU A;  2M63 A;  3EIQ C;  2WXJ A;  2C0M A;  3GYZ A;  4XKC A;  2WXK A;  1TEZ A;  2VYI A;  3D9L A;  5C2Y A;  4HXI A;  4AV7 A;  4NRH B;  1SZA A;  3WXX A;  3MGB A;  3JUI A;  3OXF A;  4WWP A;  2VSO E;  4OYS A;  3MV2 B;  4JEH A;  3ZYK A;  3LS8 A;  4I6J A;  2BTD A;  4UWF A;  1E90 A;  3FUL A;  3PDN A;  2BUG A;  4EEC A;  4KXK B;  3MA5 A;  4JVS A;  1MHQ A;  1UW4 B;  4MKT A;  4J6I A;  3EIJ A;  4DK5 A;  1H2T C;  3OXG A;  4PS3 A;  4IUL A;  2IQC A;  2X6J A;  2IOL A;  2MHK A;  2HR2 A;  1ELR A;  4GML A;  3FUM A;  3PRZ A;  4CRW A;  2WVI A;  2ILR A;  5D0Q D;  2GRM A;  4ACK A;  1UN9 A;  3RO2 A;  3UQ3 A;  5BV1 A;  3ML9 A;  5E76 A;  2DCP A;  4U8H A;  2ZU6 B;  4TV3 A;  3SF4 A;  4DLQ A;  4EBA G;  5BNW A;  4CGW A;  5FWQ A;  5JJT A;  5CCM A;  3FY4 A;  3LYA A;  4A55 A;  1KLX A;  1WY6 A;  2CFU A;  3FTU A;  4HS2 A;  4UWL A;  5BV0 A;  4UWK A;  3QNK A;  1UJJ A;  2J09 A;  1N52 A;  1OWN A;  3QOU A;  4BFR A;  4GA0 A;  3N71 A;  2XPI A;  4UQX A;  4CCA A;  3MZL B;  5A6C A;  1U3C A;  3L17 A;  1IQU A;  3PZD A;  3URZ A;  4I1O B;  4N5C A;  2DIW A;  5LFA A;  1HS6 A;  2WMN A;  3ZFW A;  2I1K A;  5C1D A;  4FU3 A;  3UT4 A;  4NQ0 A;  3IHV A;  3LVQ E;  4GZC A;  4XI9 A;  3S7B A;  3LDZ A;  3FUN A;  4I9E A;  2P58 C;  5FJY A;  4KVO A;  4D10 C;  3HHM A;  1E8W A;  5LCW C;  3MKR A;  3ZHE A;  3AS4 A;  3VLF A;  5JHB A;  1OUV A;  4I1A A;  5FZR A;  4J8F A;  5T8I A;  4GB9 A;  4RG6 A;  5T4Y A;  3ZHE B;  1B89 A;  3SD5 A;  3RU0 A;  4HOS A;  4HOU A;  1XNF A;  2VSX E;  3CK9 A;  3CSF A;  2PM7 A;  4L2Y A;  4Y6C A;  3IHY A;  4YVQ C;  2OOE A;  3LY8 A;  4CDN A;  1H2U A;  2CHW A;  3FTW A;  4XKB A;  2LSV A;  4EBA A;  3P2B A;  2FI7 A;  4N3B A;  4AP2 A;  4GYW A;  2Y4U A;  3S2A A;  2LO6 A;  2KM4 A;  4A3T A;  1Y8M A;  4JA7 A;  4AVX A;  3ZIM A;  2WXN A;  1PC2 A;  2DBA A;  2IF4 A;  2KCV A;  2X6K A;  3OXL A;  4U0S A;  5A23 A;  3JYS A;  3IBE A;  3Q49 B;  2CHZ A;  3G2S A;  2I2O A;  2L9B A;  3L08 A;  3FH8 A;  3ASG A;  3FDH A;  2XCC A;  3FTX A;  3MX3 A;  3EHM A;  5G2N A;  3R7R A;  4FUL A;  3KS2 A;  3FTV A;  5JJ7 A;  1P5Q A;  4N39 A;  4MLP A;  3AU5 A;  4EQF A;  4A1S A;  3QAR A;  1E7V A;  3AS5 A;  3UMV A;  5CMW A;  1HG2 A;  1NP7 A;  5EX0 A;  3RRU A;  4PS7 A;  1IQR A;  4I6E A;  1E8Y A;  1DVP A;  4J0U A;  3D9N A;  3FUF A;  4YND A;  3DBS A;  2XEV A;  4GU5 A;  4URK A;  3CVX A;  4HFG A;  4AY6 A;  3K9I A;  3KD7 A;  4A3V A;  5T3R A;  4BT8 A;  4GA2 A;  1H2V C;  4ANW A;  2KC7 A;  4G26 A;  5AEN A;  4FJZ A;  4IRU A;  4XIF A;  5ARG A;  3ZRH A;  4C9B B;  4NUR A;  2WXF A;  2VGX A;  5HI7 A;  3SNX A;  1XGW A;  2WXQ A;  1Z6T A;  4G1T A;  3FUH A;  3ML8 A;  3CEQ A;  3AS8 A;  4LER A;  3CVW A;  3PE3 A;  3IV0 A;  2WXL A;  3PUJ A;  2VGX B;  1JWF A;  1SQM A;  1NZN A;  3G2V A;  3BG1 B;  4XZ4 A;  2J07 A;  2OND A;  2VTB A;  4ILI A;  4WWO A;  4OVU A;  4GCO A;  4IN3 B;  4L23 A;  1Y6I A;  2LNI A;  3L54 A;  2VTB B;  3FH7 A;  2A4Z A;  2FBN A;  4ABN A;  4DPR A;  3CVQ A;  4N3A A;  1OWM A;  3PEU B;  3MV3 B;  4UWH A;  3KEZ A;  4JEU A;  2RD0 A;  3MKQ A;  4O6F A;  3B7R L;  3TG5 A;  4AM9 A;  3ONL A;  4AY5 A;  2V0P A;  4GCN A;  1EDU A;  2AXZ A;  2PM6 A;  3CVN A;  3EDT B;  3U4T A;  3FTS A;  4N3C A;  2J9Q A;  4N2S A;  1OWP A;  3MKQ B;  2YIN A;  4KZ0 A;  5A7D B;  2YQ8 A;  4ILG A;  3RIB A;  4LUN U;  5CHE E;  3PEV B;  3ZEF A;  3SI5 A;  2C2L A;  2JLB A;  3FUK A;  3CHP A;  5JJ6 A;  1ELW A;  3CK7 A;  3ENE A;  3LY9 A;  4JPS A;  4HOT A;  3ZW3 A;  4F3V A;  3PE4 A;  2KCL A;  3RK6 A;  1HG5 A;  3G2T A;  3ZPJ A;  3R9A B;  3FUJ A;  4A1G A;  4FP7 A;  4ATG A;  4BY6 A;  2KCK A;  4ANU A;  3D9J A;  2JEK A;  5ARF A;  3PNT B;  5FTP A;  4XX5 A;  2NC9 A;  2X6H A;  4JHJ A;  4TUU A;  2J4D A;  4ANX A;  4B89 A;  5KJK A;  3LCA A;  3SZ7 A;  3OAW A;  2VQ2 A;  3FU0 A;  4MS6 A;  3P1U A;  4QFV A;  4Y6W A;  2QY7 A;  4WNG A;  2E2E A;  4AJW A;  5DIZ A;  2A5U A;  3ASD A;  4G25 A;  3U9W A;  1H0A A;  4L1B A;  1PAQ A;  4GA1 A;  4EZK A;  4KYO B;  2PZI A;  3RKV A;  3CV0 A;  3QB2 A;  2L0T B;  4BX8 A;  4NAC A;  2NXP A;  4HOR A;  3CVU A;  1HZ4 A;  3B7U X;  3JQ0 A;  5FT9 A;  4LCT A;  3CGH A;  4XE0 A;  4CEM A;  3T5X A;  2WM9 A;  1Z3Y A;  3FFL A;  3HIZ A;  4U0U A;  3RRM B;  1NA3 A;  2Y4T A;  3LPZ A;  1JUQ A;  3QAQ A;  3UT8 A;  3LEW A;  2WXG A;  4V3I A;  5FQ4 A;  2R5S A;  3L22 A;  3G2W A;  5EKQ D;  1JWG A;  1BPO A;  3FUI A;  4BTA A;  2AWI A;  2IU1 A;  2WPV A;  2X6I A;  3DPD A;  5AYW D;  1YA0 A;  4FAD A;  3HDX A;  5LCW J;  4K0R A;  3D9K A;  1LF8 A;  2E0I A;  5G55 A;  1W3B A;  3FU5 A;  4G11 A;  3ZYQ A;  3RRN B;  3CLJ A;  3ZYM A;  5KJL A;  3O4Z A;  4AXH A;  3Q4A B;  4C0E A;  2XPZ A;  2CG3 A;  1WM5 A;  2WXI A;  1ZU2 A;  2GRL A;  2RG8 A;  2WXM A;  3NZS A;  3FEX A;  2WXP A;  3PH0 C;  1EPU A;  3CIA A;  3EJN A;  3B13 A;  3PVL A;  2HM8 A;  3NQP A;  4JC8 A;  1WAO 1;  2KAT A;  4G2V A;  4F53 A;  3T8M A;  3CHO A;  5FZS A;  3FUD A;  5AJD A;  4GZD A;  2CHX A;  2XGO A;  2IFU A;  4UQZ A;  1EF1 C;  1UN8 A;  5FQ7 A;  4C0M A;  4CDR A;  4FHK A;  1HO8 A;  4W9R A;  2X6F A;  4DI4 A;  4AEZ C;  2V5F A;  1HF8 A;  3ZVV A;  1A17 A;  4ILH B;  1HX8 A;  1IYG A;  1QQE A;  2VJ8 A;  5BT1 A;  1SZ9 A;  3CVV A;  3BEE A;  4XI0 A;  1INZ A;  1EYH A;  1N54 A;  2C0L A;  2WXR A;  3ASF A;  5LOZ A;  3PUK A;  5BUZ A;  2AXV A;  1FVF A;  5CMY A;  4GYY A;  3FEY A;  3U3W A;  2MRI A;  2YHC A;  1FVH A;  1H6K A;  3I4G A;  4I1M A;  5FQ8 A;  3NZU A;  3CHM A;  4WAF A;  5G05 J;  3MEK A;  1E7U A;  4ACL A;  2FUL A;  4RSY A;  2NSZ A;  4AIF A;  4K03 A;  3PNL B;  4PS8 A;  4BX9 A;  4AOF A;  2XRZ A;  4H7X A;  4PDX A;  3CVL A;  2WXO A;  4GYO A;  2VSY A;  3SHF A;  3U66 A;  4IYP A;  2AXU A;  3CR3 A;  3ULQ A;  3IKO B;  1HE8 A;  3CKC A;  1E8X A;  3FUE A;  3I4R B;  2GW1 A;  3HVE A;  3CQC B;  4MRU A;  4DJA A;  4HLE A;  5JHA A;  4Q94 A;  1VDY A;  2XPY A;  1DNP A;  4J8E A;  1L5J A;  5DBK A;  3TXM A;  1ELK A;  4N2Q A;  3TG4 A;  3ESL A;  3AU4 A;  4U07 A;  4E85 A;  2FEZ A;  3Q47 B;  3S7F A;  3HVE B;  1OWL A;  5G05 C;  4P29 A;  2AVP A;  3QK0 A;  3FHE A;  1FCH A;  5AJL A;  4GMJ A;  2I6H A;  4RVB A;  4B8C B;  1HH8 A;  3E4B A;  4WND A;  4B8A A;  3SBS A;  4G24 A;  4FHJ A;  2XGM A;  3D3M A;  3QWV A;  4JHK A;  3CQG B;  3O48 A;  3OTN A;  2I9C A;  3VTX A;  4DLO A;  4FJY A;  4I9C A;  2UY1 A;  3L16 A;  2YNQ A;  3LVR E;  5AIJ A;  3CKB A;  3QKY A;  5ANR A;  2PQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...