5LP0A

Crystal structure of the zebra fish enth domain from epsin1 in 1.41 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
140
structure length
140
Chain Sequence
b'GAMGSSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHALKTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsin 1
publication title A bacterial genetic selection system for ubiquitylation cascade discovery.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
total genus 59
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lp0A00
1JWGA 5LOZA 1EYHA 1HFAA 1HF8A 4JXTA 1HX8A 3ZYQA 3D9MA 3D9NA 3G2WA 4Q94A 1SZAA 1X5BA 2L0IA 5CMYA 4HFGA 5LP0A 1INZA 1H0AA 5CMWA 4FLBA 2BF0X 2MOWA 3D9KA 3D9LA 1EDUA 1PY1A 3G2TA 3ONKA 1HG2A 2V8SE 4GZDA 3D9JA 3ZYMA 1HG5A 3CLJA 1LF8A 1JUQA 3ZYLA 4NACA 3D9OA 3D9PA 3LDZA 1UJJA 1XGWA 2LO6A 2L0TB 3G2VA 4FU3A 1MHQA 3G2SA 3G2UA 2QY7A 1JPLA 4Q96A 4GZCA 1VDYA 4AVXA 1DVPA 1SZ9A 2DIWA 3RRUA 1UJKA 3ONLA 3D9IA 1ELKA 5J08A 1JWFA 2DCPA 2KM4A 3ZYKA
chains in the Genus database with same CATH superfamily
4H7XA 2PNNA 3D9LA 2J8SD 3Q5MA 4IN3B 3O4ZA 3SD5A 2BKKB 3KEAA 1LD7A 2L6JA 3B7UX 2VTBB 3UM0A 4KVOA 1OCOE 3I4GA 1L5JA 2J4DA 4U0UA 1MQSA 4G25A 2BF0X 2AWIA 2F8YA 3TJPA 2KXPC 1IQUA 3UMVA 3OXFA 2J49A 1JCQA 4LG6A 3ISMC 1SA4A 1TNZA 4PS8A 4XX5A 4G1TA 5J08A 1TR4A 5FQ8A 2XPZA 4HRLA 2XGSA 3FU6A 2GRQB 2WVIA 2VYIA 4YDOA 3S7FA 4EZLA 4APFA 3ABME 3CLJA 1LF8A 5B3SE 2WPVA 2IU1A 5G05C 3L6AA 3DSTA 3SBTB 3MJWA 3CSFA 4O1PA 1SZ9A 4G8KA 5EN5D 3CHOA 2R5SA 2WQ7A 4RQIA 3FHEA 5C2YA 3ZHEA 1BI7B 3PE3A 2VGXB 4U95D 5EIBE 4BEPA 3CVUA 1N4RA 3SQVA 4F1PA 5CECB 3SFZA 4B93B 4GZCA 2LXLA 3QB2A 3C3OA 4URKA 5CBNA 3NZUA 3CQGB 1H0AA 5A23A 1OWMA 3PS6A 3QNKA 4NACA 3U4TA 3UT7A 2GRNB 3OXLA 4KT6B 1KZOA 3CSTA 2EIME 2B0OE 4JPSA 4ATZD 1WDYA 4ANXA 2X6HA 3KAEA 4XEIG 4L1BA 3HYMB 4XKBA 2XS1A 3DWLG 3LKUA 2LNIA 2PM7A 2VJ8A 4UI9C 1XGWA 3I3NA 3QOUA 4HXIA 4AEZC 3SZ7A 4FLHA 3LPZA 1XNFA 3VLFA 3D9IA 2X6KA 1FCHA 3ASOE 2RFMA 2WQHA 2WXPA 3FUIA 1X5BA 2RKKA 4PH4B 5LP0A 2EILE 3HG0D 1S70B 3ASFA 3DSWA 1HE8A 2RD0A 1OWOA 3FTZA 1KLXA 3IV0A 3UM2A 4L2YA 2FI7A 1SVXA 4TUUA 2XENA 3AJIA 3CKCA 3ML8A 2WXKA 4CZ2D 4I43A 3PREA 1EPUA 2BKGA 4WNGA 3SBSA 2IFUA 3CK7A 1DCQA 4AJWA 2LUHA 5JHAA 4J7WA 3S7BA 3F6QA 5D0QD 3LJ3A 3ASDA 3NQPA 2BTDA 3V79K 3QC1A 4MKTA 3L08A 2R17C 4UWFA 3MV3B 2XRZA 4C9BB 2NXPA 3URZA 5T8IA 2XQ0A 3FH7A 1EDUA 3ONKA 3T8MA 3NAWA 5CEDB 3UQ3A 3SFXA 4G2VA 3FUJA 2X6FA 2A5EA 4UUCA 3G2UA 3L9TA 2V0PA 4L2LA 4P29A 2ZGGA 3R9AB 2F37A 2YQ8A 3CVYA 3UXGA 1TNYA 4RLYA 5CBOA 4JHKA 5LCWC 1TN6A 2X6IA 2IJGX 3G2SA 4HBDA 3ZFWA 1A17A 1JWGA 2L6BA 4PS7A 3B7RL 5LOZA 4JXTA 4YVOA 4GZ5A 4WAFA 1YMPA 4ZFHA 3JXJA 1QBQA 4DX6D 3S7DA 4XZ4A 2KCVA 1V54E 5B1BE 3B95A 2DYRE 4PS3A 4LCTA 3AU5A 2VSYA 5JJ6A 4OVUA 2VTBA 1NA3A 3ABLE 4I1MA 3R7RA 2XRYA 2ZISA 2WMNA 3HXEA 3S2AA 1H6PA 3W9FA 5AJDA 3FUHA 4J0UA 5HQ8A 5CCLA 3DXKG 4IULA 4YVQC 3NOCD 5AAOA 5T4YA 2I2OA 1O1TA 4ANWA 3PNTB 2C2LA 1RZ4A 2UWJG 1IKND 4E6HA 2DYSE 3DPYA 3PZ2A 3I4RB 4IRUA 2ILRA 4BT9A 1TNOA 2OOEA 2V4LA 2R05A 1K1BA 2MRIA 4LNBA 3N71A 1FT1A 2DBAA 1MZCA 3VLDA 4WUYA 3DSSA 5ARFA 5KCMA 2VGXA 5BUZA 4JEHA 3FU0A 4O1OA 1UN8A 3TWXA 2LAHA 3FU5A 4U63A 4H7YA 1QZ2A 1Q2ZA 3RAUA 3B7TA 4HLEA 4L7TA 3CK9A 5C1DA 4AV7A 3L82A 1N94A 3C5RA 1ELKA 4V3IA 3MZLB 1WY6A 1OCZE 2NSZA 5KJLA 5LX8A 4Q69A 3T9KA 5G04J 3K9IA 2PQNA 5J90A 2WMOA 3FTXA 5CRVA 3HXFA 3FY4A 4GTSA 3D3MA 5IY5E 3GZSA 5KJNA 2J9QA 2J07A 2XCCA 4GTMA 4MBGA 4DRXE 4HRNA 4WWOA 3T5VA 3RK6A 4GTTA 3CK8A 3Q7FA 4HOQA 4UWHA 3CVQA 2P58C 4C0EA 2QZAA 4X8QA 4TXPA 2P9UG 2WXHA 4K03A 2X3MA 2IONA 3NOGD 3HXCA 3U64A 3CVNA 2HYZA 3VLEA 3D9OA 1W3BA 1UJJA 1H19A 4L9PA 4DLOA 3EU5A 1OUVA 2P9KG 3TWVA 4OAUC 2YINA 3G2WA 3Q15A 2CHWA 1ZB1A 5HI7A 3B7SA 4DLQA 3ZVVA 2F8XK 4NQ0A 1N4SA 1DCEA 4MRUA 5A7DB 1H6KA 2P9PG 1OWNA 3IKOB 5AQ7A 4TXRA 3LYAA 3ZYMA 1SW6A 3BEEA 5JMND 3ESLA 1V55E 1RW2A 3UT8A 3FP3A 2Y4UA 3RIBA 4KVMA 3SFYA 2B6CA 4N2SA 5ITZF 2RFAA 4G11A 1K8KG 1AP7A 3IHVA 3ABKE 3Q73A 4JZYA 3C72A 5FZRA 1NA0A 1MYOA 1TJFA 1NFIE 4MLPA 4ZHBA 3Q9NC 5BPPA 4F53A 3FEXA 2WXRA 1EF1C 3OTNA 3LCAA 4EZJA 4C48B 5M72A 4TV3A 3E32A 5E75A 3KEZA 1MX6A 2XPIA 4KYOB 3HIZA 1TJCA 1ZBPA 4DX5D 3Q7AA 4B8CB 1UN9A 3V30A 5AENA 1SA5A 3E33A 4EBAA 2I6HA 5A6CA 3DSVA 3EJNA 3ZGQA 5HKPA 3NF1A 2XCBA 3E30A 1O1RA 2WXNA 2XGMA 2WQ6A 1E8YA 4BERA 4AY6A 3GYZA 4O6FA 5G55A 4DJAA 1BD8A 2IF4A 5ENOD 3D9HA 1JWFA 5CHEE 1H2VC 2CG3A 5AQBA 4ILHB 4U8VD 4GTPA 3W9GA 5G2NA 3JUEA 2A4ZA 3GZ1A 3AAAC 2AJAA 4DX1A 2HR2A 4CT4A 3T5XA 2KATA 4B89A 4A1SA 2WXMA 3FWVA 4UQYA 2KM4A 4I6JA 4WNDA 2DZNA 3CHQA 1S63A 2C0MA 3JQ0A 2ZXWE 4BX8A 4XIFA 3EHNA 4D10C 3TGOA 1FPPA 5AIJA 1K3ZD 3V31A 2OEVA 3FTSA 3NB2A 4FADA 3RRNB 1Z3XA 4AP2A 3CHRA 3OXGA 4LRZA 2XEEA 4GA2A 3AS8A 3Q75A 4GA0A 5T3RA 4EECA 4AIFA 3R7QA 3CHSA 5ENQD 1JCRA 1OWLA 2WM9A 3MKRA 1S0PA 2XEVA 2E2EA 4EQFA 5AARA 3HRAA 3UUXA 2OVFA 3VTYA 3QKYA 4AVXA 4QQIA 3TWUA 3ONLA 2XZTG 4W9RA 3FDHA 3ZYQA 3FUMA 3CEQA 3R9MA 4FULA 3UPVA 1HG2A 3TWSA 3QWVA 5DBKA 3PVLA 4L23A 2Y0BG 2L9BA 3ZEFA 2EIJE 1E7VA 3AG3E 4WNFA 3I5PA 4B8AA 2CHZA 1ELWA 1TN8A 4LSZE 4EHMA 1D8EA 3C3QA 4GPKA 2WXOA 2KBXA 3AG4E 2XZDG 3HVEB 3MA5A 3U9WA 3FUKA 2E0IA 3LY9A 3ASHA 1HX8A 2C0LA 4AOFA 1H2UA 3EU9A 2ETAA 4N3CA 3IHYA 4JL0A 3SI5A 2MHKA 3NBNB 3MEKA 2GRRB 4EPZA 3C98A 3WG7E 4I2WA 4JD2G 4U7EB 1DNPA 4FHJA 3RRUA 3MKQB 3PUJA 1Z3YA 2PQRA 4FHKA 5ENSD 2KZTB 1WM5A 4I17A 1UOHA 4CRWA 4A1GA 3AG2E 1LTXA 4O60A 4RSYA 2AXZA 4Y6WA 4G26A 5HRYA 4N2QA 2YHEA 3FUDA 2JABA 2DWZA 2NYJA 3J5QB 3Q9UC 4JA7A 1H6OA 2GW1A 3FTVA 5G04C 3FTUA 4JHRA 3V2OA 3PZDA 4CEMA 2QY7A 1D9SA 3ZRHA 1PC2A 4Y6CA 1Z6TA 3IXEA 3LEWA 5JJ7A 3CVWA 4RG9A 4BFRA 1KZPA 4TUMA 2QYJA 3CR3A 4YDEA 4G24A 5KNHD 4GZ3A 4I9CA 3EHQA 3P1UA 4F3VA 3QWPA 4HRMB 2WXIA 2JLBA 3HHMA 1X81A 1N0RA 3RJVA 2WXFA 2Q7FA 4U0SA 5KJKA 3Q78A 5ENNA 3FFLA 1TNUA 4ATGA 4N5CA 3B7BA 2J08A 3D9KA 3UINC 2AXVA 2GRMA 4J8SA 4LNGA 2LO6A 4FA6A 1E96B 4LNUD 2IO2C 1U2VG 4FC8A 4RG6A 4DUIA 4U8YD 2H6HA 4IYPA 2P2CP 2WXJA 2PL2A 3TG5A 4GCOA 1INZA 5BT1A 2WXQA 2ONDA 2YNQA 4OAVB 1NZNA 2X38A 4BTBA 3RO3A 1HS6A 3LJNA 4M7CA 1QYMA 4XI0A 4I6EA 2RG8A 3LY7A 3BQOA 2LAIA 3L17A 1FVHA 3MGBA 3ZW3A 3DXMG 2IQCA 2M63A 4GMRA 4GYWA 4FJZA 2XS8A 3L16A 4GU5A 1DC2A 3CVPA 3ASNE 3U66A 4GMJA 4DX7D 5ANRA 1E8WA 5CMWA 4AXHA 5AYWD 1OXJA 2OV8A 4GAAA 2GRLA 4MS6A 4HQDA 3DSXA 3ZN3A 5EIDA 3FULA 4JA9A 2FBNA 3HXDA 1MX2A 3EIJA 5BV1A 1TN7A 1HZ4A 3PRZA 3DBSA 3D9MA 3TL5A 1SZAA 3UKUG 2MOWA 2P9IG 3L22A 3Q4AB 3CGHA 5E76A 3B13A 4YDWA 3NZSA 2VQ2A 1O5MA 2FULA 2QYUA 3UX4A 4BSXA 5ANLA 1N11A 2H6FA 3AS5A 3QAQA 2V8SE 1UG3A 4M3OA 3FH8A 4C0MA 5BXUA 5AN8A 3SY2A 4Q96A 5FTPA 3UT4A 3SGHA 5FINA 3TWTA 1EYHA 2IY0C 4GTRA 5BXOA 4ACLA 4FLBA 5FQ4A 3UM1A 1YCSB 1N4QA 4OVVA 3RSEG 1E7UA 5FZQA 4XE0A 4HOSA 4A63B 1P5QA 4HLLA 1IXVA 3ULEG 4EZKA 1HXIA 3MCXA 3HVEA 3L13A 2KC7A 1K1AA 2OVBA 1YA0A 3ENEA 1HG5A 2CG2A 3JQ1A 5FJYA 2X6JA 4FJYA 3KSLA 3PEUB 5EX3A 1ELRA 3BG0B 2F0YA 4HB5A 5AJLA 3QDNA 3PH0C 2OEWA 3IEGA 2FEZA 2J4BA 2NC9A 4FP7A 4N3AA 5D0OD 3MKQA 4GMLA 1WAO1 4I6GA 2R02A 4GZ6A 2KZTA 3BG1B 3ML9A 1OT8A 4ILGA 3PUKA 5CEAA 3JCKC 1FVFA 5HS0A 5D66A 3T8KA 4ANUA 2VSNA 2VSOE 5EYPF 5B1AE 2FF4A 4J8DA 5EKQD 3MX3A 5KBAA 3CHPA 1TNBA 3DEPA 4BTAA 2EQXA 4WNEA 4CT0A 2GROB 3KD7A 4U8HA 2LXMA 1OCRE 3E4BA 2IEJA 4HOTA 1KT1A 3QARA 3RKVA 4Q94A 2QC9A 3CV0A 1S64A 2H6GA 3PDNA 4ME2A 3DPDA 2EIKE 4YDYA 1A5EA 1NL4A 3AG1E 3LXUX 2P9SG 3AS4A 3S7JA 2A5UA 4HORA 2HO1A 4DI3A 2P9LG 4J8EA 3FU3A 5ARGA 4U0ZA 1ZU2A 5CCMA 2L0TB 4E85A 1B89A 3Q79A 3EUVA 3ULYA 4GA1A 4LEUA 5H7PA 1HFAA 4PDXA 1MX4A 3D9NA 3UM3A 1QNFA 4PUCA 4CGVA 2UY1B 1D8DA 4I1AA 4LERA 3E37A 1MHQA 1GW6A 4GCNA 1Y6IA 1JPLA 3V2XA 2XGOA 1BLXB 3PEVB 4A3TA 4A55A 2VGYA 4HI8A 4B0ZA 3L54A 3EDTB 4I2ZA 4I9EA 2KCKA 3TXMA 3GW4A 5DIZA 3DRAA 3AU4A 3QJZA 1E8XA 3PNLB 2BEDA 1IHBA 3CQCB 3X2QE 1TYQG 4KXKB 4U04A 2IO3C 1UJKA 3U3WA 3SNXA 4DPRA 2WB2A 4K5CA 2IOLA 4JEUA 4HFGA 4EBAG 3TWRA 3LDZA 4N3BA 4UWLA 5G05J 4JC8A 2J09A 2DIWA 3CIAA 3SF4A 2AW6A 4HNAD 4KZCA 3FUFA 1N95A 3ZYKA 4TXQA 3EIQC 4B94A 2GRPB 2JEKA 2WXLA 4GTQA 3D9PA 4GTOA 3UKRG 2DZOA 2Y69E 3CHMA 3RO2A 1HF8A 4UQXA 4HVBA 2R03A 4XI9A 4R7LA 1O1SA 5ENPD 4JW1A 1OWPA 4ABNA 4WWNA 3ASGA 4F6RD 3LS8A 5FQ6A 1N4PA 4N5QA 1N52A 4JHJA 3WXXA 4K0RA 2LSUA 4AY5A 3FUNA 2CFZA 4GYOA 3J5PA 3P2BA 4DI4A 5AQAA 3HXBA 2LSVA 3KSQA 4UI9J 4NRHB 4Z68A 3FH5A 5LFAA 4CDNA 3JXIA 3ZNGA 3DEOA 1N9AA 4LUNU 3JUIA 1IYGA 2KCLA 2I1KA 4UWGA 4ANVA 5BV0A 3G2TA 3FTYA 4CCAA 4U07A 3TWQA 4GB9A 2PM6A 3CVXA 4NIKA 4FU3A 3RRMB 2V4HC 4U96D 2FO1E 1OY3D 2XEHA 3CKBA 4CGWA 1YYHA 3DSUA 3UTMA 5FT9A 4XKCA 1G3NB 2ZIRA 3KS2A 2ZGDA 4CDRA 1IHGA 3ZPJA 1NP7A 4HS2A 3LVQE 1VDYA 4UWKA 4ACKA 3ZXPA 4NURA 3UIOC 4KMOA 4ILIA 5JA4D 1WG0A 2H6IA 5KJMA 4HOUA 5BW8C 5CRUA 2HE0A 1KPSB 4HI9A 2ZU6B 1MJ0A 3VTXA 3PZ3A 4K5AB 3MV2B 1DVPA 1H2TC 2PZIA 4OYSA 3ZHEB 2DCPA 5JHBA 2I1JA 3EHRA 1U3CA 2BUGA 3ZKJA 1IQRA 3OAWA 4N39A 2MYOA 5ENTD 5FIOA 2R59A 5KNGA 4K5BA 4G23A 3ZXSA 3TXNA 3BU8A 3FEYA 3GZ2A 3FUEA 4BX9A 3IBEA 2GGFA 1HU3A 4A3VA 1E8ZA 3HDXA 5LCWJ 3G2VA 1SQMA 3Q47B 1BI8B 5CERB 2ETBA 4G8LA 3UI2A 4AM9A 2Y4TA 2EINE 1QQEA 1PAQA 5CMYA 2YHCA 5KWDA 1PY1A 3C3RA 4GZDA 5EYLA 4UI9K 5EDSA 3BUAA 2AXUA 4DK5A 2I9CA 2UY1A 4JB8P 2XHEA 3QWWA 1E90A 3O48A 4KZ0A 2V5FA 1KT0A 1N0QA 2L0IA 3TG4A 5JJTA 4GTVA 4BY6A 3PZ1A 5FZSA 1TEZA 4KBQA 3ULQA 1U3DA 4BETA 2AVPA 2Y3AA 3Q49B 4RVBA 3ZIMA 1Z5SC 1JCSA 4JVSA 3UIPC 2R2LA 3CVLA 4J6IA 3LY8A 4GPMA 3APFA 5BNWA 4YNDA 2QFCA 5AQ9A 2IOSA 4TRQA 5EILA 4QFVA 3SO8A 2WXGA 1LD8A 4F7AA 3QK0A 3APDA 1BPOA 4DX2A 3ESKA 3FTWA 3RU0A 2Y1LE 5D2MC 4BESA 2HM8A 1FT2A 3PE4A 3CVVA 3LVRE 4F1SA 2XPYA 2VGEA 3APCA 5FQ7A 2VSXE 3JYSA 3PZ4A 1NI1A 4BWRA 2CFUA 4J8FA 3ZUVB 1BU9A 4I1OB 3D9JA 5FWQA 1HO8A 4BT8A 1JUQA 3ZYLA 3EHMA 5ENRD 4J8YA 1Y8MA 4APOA 2V5QC 1OCCE 2OCCE 3E34A 1UW4B 2FO7A 4UQZA 3TAXA 2CHXA 4CDMA 3TWWA 3SHFA 2P9NG 1AWCB 4CYMD 1HH8A 4WWPA 5EX0A 1N54A 2DVWA 2ETCA 4GYYA 3ZU7B 3MYVA 4BSZB
chains in the Genus database with same CATH topology
3EDTB 4H7XA 4I2ZA 2KZTB 1WM5A 4I17A 4CRWA 1WY6A 4A1GA 4I9EA 2KCKA 2NSZA 4RSYA 5KJLA 3D9LA 5LX8A 3TXMA 3GW4A 3Q5MA 5DIZA 3AU4A 4IN3B 3O4ZA 4Q69A 3QJZA 5G04J 3K9IA 3SD5A 1E8XA 2AXZA 2PQNA 2L6JA 4Y6WA 5J90A 2WMOA 3PNLB 3FTXA 4G26A 3CQCB 3B7UX 4KXKB 2VTBB 4U04A 4N2QA 4KVOA 2YHEA 3I4GA 3FY4A 1L5JA 3FUDA 3D3MA 1UJKA 3U3WA 2J4DA 4U0UA 3SNXA 4DPRA 3GZSA 2WB2A 5KJNA 2J9QA 1MQSA 2IOLA 4G25A 4JEUA 4HFGA 2J07A 2XCCA 4JA7A 2BF0X 2GW1A 3FTVA 2AWIA 4EBAG 5G04C 3TJPA 3FTUA 4JHRA 4WWOA 1IQUA 3UMVA 3LDZA 3OXFA 2J49A 4N3BA 3T5VA 3PZDA 4UWLA 4CEMA 4PS8A 4XX5A 5G05J 4G1TA 3RK6A 4JC8A 2QY7A 3CK8A 2J09A 4HOQA 2DIWA 3CIAA 3ZRHA 4UWHA 1PC2A 4Y6CA 1Z6TA 3SF4A 3LEWA 5JJ7A 2AW6A 5J08A 3CVWA 3CVQA 4KZCA 3FUFA 2P58C 4RG9A 4C0EA 5FQ8A 3ZYKA 2XPZA 4BFRA 2XGSA 3EIQC 4B94A 3FU6A 2JEKA 2WVIA 2WXHA 3CR3A 2VYIA 4K03A 2X3MA 2WXLA 4G24A 3S7FA 4EZLA 4GZ3A 4I9CA 2IONA 4APFA 3CLJA 1LF8A 3U64A 3CVNA 2HYZA 3VLEA 3P1UA 2WPVA 1W3BA 3D9OA 1UJJA 1H19A 2IU1A 3D9PA 3QWPA 4F3VA 4DLOA 2WXIA 2JLBA 3HHMA 3L6AA 5G05C 3SBTB 1OUVA 3MJWA 3CSFA 3RJVA 1SZ9A 2WXFA 2Q7FA 3CHOA 4U0SA 5KJKA 2YINA 3CHMA 5ENNA 3FFLA 2R5SA 3RO2A 1HF8A 4UQXA 2WQ7A 4ATGA 4HVBA 3G2WA 3FHEA 4N5CA 3Q15A 5C2YA 3ZHEA 4XI9A 2J08A 2CHWA 3D9KA 3PE3A 4R7LA 5HI7A 2VGXB 2AXVA 2GRMA 4J8SA 3B7SA 4DLQA 3ZVVA 4JW1A 1OWPA 3CVUA 2LO6A 4ABNA 4WWNA 3ASGA 4NQ0A 3LS8A 4FA6A 5FQ6A 1E96B 3SFZA 1N52A 4JHJA 4FC8A 4RG6A 3WXXA 4GZCA 4MRUA 3QB2A 4K0RA 5A7DB 4IYPA 1H6KA 4URKA 2LSUA 4AY5A 2WXJA 2PL2A 3FUNA 3NZUA 2CFZA 3CQGB 3TG5A 4GYOA 1OWNA 4GCOA 1INZA 5BT1A 1H0AA 3P2BA 1OWMA 2WXQA 3IKOB 3PS6A 4DI4A 5A23A 2ONDA 3LYAA 3ZYMA 3QNKA 2LSVA 2YNQA 1NZNA 3BEEA 4NACA 3U4TA 2X38A 3ESLA 4BTBA 3UT7A 4UI9J 4NRHB 3RO3A 1HS6A 3UT8A 3FH5A 5LFAA 3OXLA 3FP3A 4KT6B 4CDNA 2Y4UA 4XI0A 3CSTA 4I6EA 2RG8A 3LY7A 4LUNU 4JPSA 3RIBA 4ANXA 2X6HA 2LAIA 3KAEA 3L17A 4KVMA 3JUIA 1IYGA 4N2SA 2KCLA 1FVHA 2I1KA 3MGBA 3ZW3A 4UWGA 4L1BA 4ANVA 5BV0A 3G2TA 3FTYA 2IQCA 3HYMB 4G11A 4CCAA 4U07A 4XKBA 2M63A 3LKUA 4GYWA 4GB9A 2LNIA 2PM7A 2PM6A 2VJ8A 3IHVA 4UI9C 1XGWA 4FJZA 3CVXA 3L16A 3I3NA 4FU3A 3QOUA 3RRMB 4HXIA 4JZYA 4AEZC 5FZRA 1NA0A 3SZ7A 4FLHA 1TJFA 3LPZA 1XNFA 3VLFA 4GU5A 3CVPA 3D9IA 3CKBA 2X6KA 4CGWA 3U66A 4MLPA 1FCHA 2WQHA 2WXPA 5BPPA 3FUIA 1X5BA 4GMJA 4PH4B 5ANRA 4F53A 1E8WA 5LP0A 3FEXA 2WXRA 5FT9A 4AXHA 5CMWA 5AYWD 1EF1C 2OV8A 3ASFA 4GAAA 4XKCA 2GRLA 3OTNA 4MS6A 1HE8A 2RD0A 3LCAA 3ZN3A 4EZJA 1OWOA 3FTZA 3KS2A 4CDRA 3FULA 1KLXA 3IV0A 1IHGA 4JA9A 2FBNA 4TV3A 5M72A 4L2YA 5E75A 3ZPJA 2FI7A 3KEZA 3EIJA 1NP7A 4HS2A 3LVQE 1VDYA 2XPIA 5BV1A 4TUUA 4UWKA 4ACKA 1HZ4A 4KYOB 3HIZA 3PRZA 1TJCA 4NURA 3DBSA 1ZBPA 4KMOA 4ILIA 4B8CB 3D9MA 3TL5A 1UN9A 3CKCA 1SZAA 5KJMA 4HOUA 5AENA 5BW8C 2MOWA 3ML8A 3L22A 2WXKA 4I43A 3Q4AB 2ZU6B 3PREA 1EPUA 3CGHA 5E76A 4EBAA 2I6HA 4WNGA 3SBSA 5A6CA 2IFUA 3CK7A 3B13A 3VTXA 4AJWA 3MV2B 1DVPA 1H2TC 2PZIA 4OYSA 5JHAA 3NZSA 3ZHEB 3EJNA 2VQ2A 3ZGQA 3NF1A 2DCPA 2XCBA 2FULA 3RRNB 3S7BA 5JHBA 2I1JA 3UX4A 1U3CA 5D0QD 2WXNA 4BSXA 2BUGA 5ANLA 3LJ3A 3ASDA 1IQRA 2XGMA 3OAWA 3AS5A 4N39A 3QAQA 2WQ6A 1E8YA 3NQPA 2V8SE 2BTDA 1UG3A 4AY6A 3GYZA 4O6FA 4M3OA 2R59A 3FH8A 3QC1A 4C0MA 4G23A 3ZXSA 4MKTA 3TXNA 4Q96A 5FTPA 3L08A 5G55A 4DJAA 3FEYA 2R17C 2IF4A 4UWFA 3UT4A 3SGHA 1JWFA 3MV3B 2XRZA 3GZ2A 3FUEA 5CHEE 4C9BB 2NXPA 1H2VC 1EYHA 3URZA 5T8IA 2CG3A 4BX9A 2XQ0A 2GGFA 3FH7A 3IBEA 4ILHB 4ACLA 4FLBA 5FQ4A 5G2NA 1EDUA 3ONKA 2A4ZA 3T8MA 1HU3A 4A3VA 1E8ZA 3HDXA 3UQ3A 3GZ1A 4OVVA 5LCWJ 1E7UA 5FZQA 3G2VA 4XE0A 4G2VA 1SQMA 2HR2A 2X6FA 3FUJA 3Q47B 4HOSA 3G2UA 4CT4A 3T5XA 2V0PA 2KATA 1P5QA 4L2LA 4B89A 4P29A 4AM9A 2Y4TA 4A1SA 2WXMA 3FWVA 3R9AB 4UQYA 1QQEA 4EZKA 2KM4A 2YQ8A 3CVYA 4I6JA 1PAQA 4WNDA 1HXIA 3MCXA 5CMYA 2YHCA 3HVEA 3L13A 3CHQA 2KC7A 2C0MA 2OVBA 3JQ0A 1YA0A 1PY1A 3ENEA 4GZDA 4JHKA 1HG5A 2CG2A 3JQ1A 5FJYA 4BX8A 5LCWC 2X6JA 4FJYA 4XIFA 3EHNA 3PEUB 4D10C 2X6IA 1ELRA 5EX3A 3BG0B 4UI9K 5EDSA 3TGOA 2IJGX 4DK5A 2AXUA 3G2SA 2I9CA 3ZFWA 5AIJA 2UY1A 2XHEA 5AJLA 1A17A 3QDNA 3FTSA 3PH0C 3QWWA 1E90A 3O48A 3IEGA 2FEZA 4FADA 1JWGA 2J4BA 4PS7A 3B7RL 2V5FA 4JXTA 2NC9A 4FP7A 1Z3XA 4KZ0A 5LOZA 1KT0A 4N3AA 5D0OD 4YVOA 2L0IA 3TG4A 4AP2A 3MKQA 4GZ5A 4GMLA 1WAO1 3CHRA 4I6GA 4WAFA 4BY6A 3OXGA 5JJTA 5FZSA 1TEZA 4KBQA 4GZ6A 2KZTA 3BG1B 3ML9A 4LRZA 3S7DA 4XZ4A 2KCVA 4GA2A 4ILGA 3PUKA 3JCKC 3AS8A 1FVFA 3ULQA 4GA0A 1U3DA 5T3RA 4EECA 4AIFA 2AVPA 4ANUA 2Y3AA 3Q49B 2VSNA 4PS3A 3R7QA 4RVBA 3ZIMA 2VSOE 4LCTA 3CHSA 3AU5A 2VSYA 5JJ6A 4OVUA 2VTBA 2FF4A 1NA3A 4I1MA 1OWLA 4JVSA 4J8DA 3R7RA 3CVLA 2WM9A 5EKQD 2XRYA 3MKRA 4J6IA 3MX3A 3LY8A 2WMNA 3S2AA 3APFA 1S0PA 3CHPA 5BNWA 2XEVA 2E2EA 4YNDA 4EQFA 5AJDA 2QFCA 3FUHA 4J0UA 4BTAA 2EQXA 4WNEA 5HQ8A 2IOSA 4TRQA 5CCLA 4YVQC 4IULA 3UUXA 4QFVA 4CT0A 3KD7A 2OVFA 4U8HA 3VTYA 3QKYA 3E4BA 4AVXA 5T4YA 2WXGA 3ONLA 4HOTA 1KT1A 2I2OA 4ANWA 4W9RA 3FDHA 3PNTB 4F7AA 2C2LA 2UWJG 3QK0A 3APDA 3QARA 3RKVA 3ZYQA 1BPOA 3FUMA 4Q94A 3ESKA 3FTWA 3CV0A 3CEQA 3RU0A 4E6HA 4FULA 3PDNA 4ME2A 2HM8A 3UPVA 1HG2A 3DPDA 3PE4A 3CVVA 3I4RB 3LVRE 3QWVA 4IRUA 5DBKA 3LXUX 4F1SA 2XPYA 2ILRA 3APCA 5FQ7A 3PVLA 4L23A 3AS4A 4BT9A 3S7JA 2L9BA 2VSXE 2A5UA 4HORA 3ZEFA 2OOEA 2HO1A 3JYSA 4DI3A 2V4LA 1E7VA 4WNFA 4BWRA 2CFUA 3I5PA 4J8FA 4B8AA 2CHZA 1ELWA 2MRIA 3N71A 4I1OB 3D9JA 4J8EA 5FWQA 3FU3A 1HO8A 4BT8A 1JUQA 4GPKA 3ZYLA 3EHMA 5ARGA 2WXOA 2DBAA 4U0ZA 1ZU2A 3VLDA 4WUYA 5ARFA 2L0TB 5CCMA 5KCMA 1Y8MA 4APOA 4E85A 2VGXA 5BUZA 3HVEB 4JEHA 3FU0A 1UW4B 3MA5A 2FO7A 1B89A 3U9WA 1UN8A 3FUKA 4GA1A 2E0IA 3LY9A 4LEUA 4UQZA 3TAXA 1HFAA 3ASHA 4PDXA 1HX8A 2C0LA 3D9NA 4AOFA 1H2UA 2CHXA 4CDMA 1QNFA 3IHYA 4N3CA 4JL0A 4PUCA 2LAHA 4CGVA 3FU5A 4U63A 3SHFA 3SI5A 2MHKA 2UY1B 4H7YA 1QZ2A 3MEKA 4I1AA 3B7TA 4EPZA 4LERA 4HLEA 4L7TA 3CK9A 3C98A 4I2WA 1MHQA 1GW6A 1HH8A 4GCNA 1DNPA 1Y6IA 4WWPA 5C1DA 4FHJA 4AV7A 1JPLA 5EX0A 1N54A 4GYYA 3RRUA 3MKQB 3PUJA 2XGOA 3PEVB 1Z3YA 4A3TA 4A55A 1ELKA 2VGYA 4B0ZA 3MYVA 2PQRA 4V3IA 3MZLB 3L54A 4FHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JWG A;  5LOZ A;  1EYH A;  1HFA A;  1HF8 A;  4JXT A;  1HX8 A;  3ZYQ A;  3D9M A;  3D9N A;  3G2W A;  4Q94 A;  1SZA A;  1X5B A;  2L0I A;  5CMY A;  4HFG A;  5LP0 A;  1INZ A;  1H0A A;  5CMW A;  4FLB A;  2BF0 X;  2MOW A;  3D9K A;  3D9L A;  1EDU A;  1PY1 A;  3G2T A;  3ONK A;  1HG2 A;  2V8S E;  4GZD A;  3D9J A;  3ZYM A;  1HG5 A;  3CLJ A;  1LF8 A;  1JUQ A;  3ZYL A;  4NAC A;  3D9O A;  3D9P A;  3LDZ A;  1UJJ A;  1XGW A;  2LO6 A;  2L0T B;  3G2V A;  4FU3 A;  1MHQ A;  3G2S A;  3G2U A;  2QY7 A;  1JPL A;  4Q96 A;  4GZC A;  1VDY A;  4AVX A;  1DVP A;  1SZ9 A;  2DIW A;  3RRU A;  1UJK A;  3ONL A;  3D9I A;  1ELK A;  5J08 A;  1JWF A;  2DCP A;  2KM4 A;  3ZYK A; 
#chains in the Genus database with same CATH topology
 4H7X A;  2PNN A;  3D9L A;  2J8S D;  3Q5M A;  4IN3 B;  3O4Z A;  3SD5 A;  2BKK B;  3KEA A;  1LD7 A;  2L6J A;  3B7U X;  2VTB B;  3UM0 A;  4KVO A;  1OCO E;  3I4G A;  1L5J A;  2J4D A;  4U0U A;  1MQS A;  4G25 A;  2BF0 X;  2AWI A;  2F8Y A;  3TJP A;  2KXP C;  1IQU A;  3UMV A;  3OXF A;  2J49 A;  1JCQ A;  4LG6 A;  3ISM C;  1SA4 A;  1TNZ A;  4PS8 A;  4XX5 A;  4G1T A;  5J08 A;  1TR4 A;  5FQ8 A;  2XPZ A;  4HRL A;  2XGS A;  3FU6 A;  2GRQ B;  2WVI A;  2VYI A;  4YDO A;  3S7F A;  4EZL A;  4APF A;  3ABM E;  3CLJ A;  1LF8 A;  5B3S E;  2WPV A;  2IU1 A;  5G05 C;  3L6A A;  3DST A;  3SBT B;  3MJW A;  3CSF A;  4O1P A;  1SZ9 A;  4G8K A;  5EN5 D;  3CHO A;  2R5S A;  2WQ7 A;  4RQI A;  3FHE A;  5C2Y A;  3ZHE A;  1BI7 B;  3PE3 A;  2VGX B;  4U95 D;  5EIB E;  4BEP A;  3CVU A;  1N4R A;  3SQV A;  4F1P A;  5CEC B;  3SFZ A;  4B93 B;  4GZC A;  2LXL A;  3QB2 A;  3C3O A;  4URK A;  5CBN A;  3NZU A;  3CQG B;  1H0A A;  5A23 A;  1OWM A;  3PS6 A;  3QNK A;  4NAC A;  3U4T A;  3UT7 A;  2GRN B;  3OXL A;  4KT6 B;  1KZO A;  3CST A;  2EIM E;  2B0O E;  4JPS A;  4ATZ D;  1WDY A;  4ANX A;  2X6H A;  3KAE A;  4XEI G;  4L1B A;  3HYM B;  4XKB A;  2XS1 A;  3DWL G;  3LKU A;  2LNI A;  2PM7 A;  2VJ8 A;  4UI9 C;  1XGW A;  3I3N A;  3QOU A;  4HXI A;  4AEZ C;  3SZ7 A;  4FLH A;  3LPZ A;  1XNF A;  3VLF A;  3D9I A;  2X6K A;  1FCH A;  3ASO E;  2RFM A;  2WQH A;  2WXP A;  3FUI A;  1X5B A;  2RKK A;  4PH4 B;  5LP0 A;  2EIL E;  3HG0 D;  1S70 B;  3ASF A;  3DSW A;  1HE8 A;  2RD0 A;  1OWO A;  3FTZ A;  1KLX A;  3IV0 A;  3UM2 A;  4L2Y A;  2FI7 A;  1SVX A;  4TUU A;  2XEN A;  3AJI A;  3CKC A;  3ML8 A;  2WXK A;  4CZ2 D;  4I43 A;  3PRE A;  1EPU A;  2BKG A;  4WNG A;  3SBS A;  2IFU A;  3CK7 A;  1DCQ A;  4AJW A;  2LUH A;  5JHA A;  4J7W A;  3S7B A;  3F6Q A;  5D0Q D;  3LJ3 A;  3ASD A;  3NQP A;  2BTD A;  3V79 K;  3QC1 A;  4MKT A;  3L08 A;  2R17 C;  4UWF A;  3MV3 B;  2XRZ A;  4C9B B;  2NXP A;  3URZ A;  5T8I A;  2XQ0 A;  3FH7 A;  1EDU A;  3ONK A;  3T8M A;  3NAW A;  5CED B;  3UQ3 A;  3SFX A;  4G2V A;  3FUJ A;  2X6F A;  2A5E A;  4UUC A;  3G2U A;  3L9T A;  2V0P A;  4L2L A;  4P29 A;  2ZGG A;  3R9A B;  2F37 A;  2YQ8 A;  3CVY A;  3UXG A;  1TNY A;  4RLY A;  5CBO A;  4JHK A;  5LCW C;  1TN6 A;  2X6I A;  2IJG X;  3G2S A;  4HBD A;  3ZFW A;  1A17 A;  1JWG A;  2L6B A;  4PS7 A;  3B7R L;  5LOZ A;  4JXT A;  4YVO A;  4GZ5 A;  4WAF A;  1YMP A;  4ZFH A;  3JXJ A;  1QBQ A;  4DX6 D;  3S7D A;  4XZ4 A;  2KCV A;  1V54 E;  5B1B E;  3B95 A;  2DYR E;  4PS3 A;  4LCT A;  3AU5 A;  2VSY A;  5JJ6 A;  4OVU A;  2VTB A;  1NA3 A;  3ABL E;  4I1M A;  3R7R A;  2XRY A;  2ZIS A;  2WMN A;  3HXE A;  3S2A A;  1H6P A;  3W9F A;  5AJD A;  3FUH A;  4J0U A;  5HQ8 A;  5CCL A;  3DXK G;  4IUL A;  4YVQ C;  3NOC D;  5AAO A;  5T4Y A;  2I2O A;  1O1T A;  4ANW A;  3PNT B;  2C2L A;  1RZ4 A;  2UWJ G;  1IKN D;  4E6H A;  2DYS E;  3DPY A;  3PZ2 A;  3I4R B;  4IRU A;  2ILR A;  4BT9 A;  1TNO A;  2OOE A;  2V4L A;  2R05 A;  1K1B A;  2MRI A;  4LNB A;  3N71 A;  1FT1 A;  2DBA A;  1MZC A;  3VLD A;  4WUY A;  3DSS A;  5ARF A;  5KCM A;  2VGX A;  5BUZ A;  4JEH A;  3FU0 A;  4O1O A;  1UN8 A;  3TWX A;  2LAH A;  3FU5 A;  4U63 A;  4H7Y A;  1QZ2 A;  1Q2Z A;  3RAU A;  3B7T A;  4HLE A;  4L7T A;  3CK9 A;  5C1D A;  4AV7 A;  3L82 A;  1N94 A;  3C5R A;  1ELK A;  4V3I A;  3MZL B;  1WY6 A;  1OCZ E;  2NSZ A;  5KJL A;  5LX8 A;  4Q69 A;  3T9K A;  5G04 J;  3K9I A;  2PQN A;  5J90 A;  2WMO A;  3FTX A;  5CRV A;  3HXF A;  3FY4 A;  4GTS A;  3D3M A;  5IY5 E;  3GZS A;  5KJN A;  2J9Q A;  2J07 A;  2XCC A;  4GTM A;  4MBG A;  4DRX E;  4HRN A;  4WWO A;  3T5V A;  3RK6 A;  4GTT A;  3CK8 A;  3Q7F A;  4HOQ A;  4UWH A;  3CVQ A;  2P58 C;  4C0E A;  2QZA A;  4X8Q A;  4TXP A;  2P9U G;  2WXH A;  4K03 A;  2X3M A;  2ION A;  3NOG D;  3HXC A;  3U64 A;  3CVN A;  2HYZ A;  3VLE A;  3D9O A;  1W3B A;  1UJJ A;  1H19 A;  4L9P A;  4DLO A;  3EU5 A;  1OUV A;  2P9K G;  3TWV A;  4OAU C;  2YIN A;  3G2W A;  3Q15 A;  2CHW A;  1ZB1 A;  5HI7 A;  3B7S A;  4DLQ A;  3ZVV A;  2F8X K;  4NQ0 A;  1N4S A;  1DCE A;  4MRU A;  5A7D B;  1H6K A;  2P9P G;  1OWN A;  3IKO B;  5AQ7 A;  4TXR A;  3LYA A;  3ZYM A;  1SW6 A;  3BEE A;  5JMN D;  3ESL A;  1V55 E;  1RW2 A;  3UT8 A;  3FP3 A;  2Y4U A;  3RIB A;  4KVM A;  3SFY A;  2B6C A;  4N2S A;  5ITZ F;  2RFA A;  4G11 A;  1K8K G;  1AP7 A;  3IHV A;  3ABK E;  3Q73 A;  4JZY A;  3C72 A;  5FZR A;  1NA0 A;  1MYO A;  1TJF A;  1NFI E;  4MLP A;  4ZHB A;  3Q9N C;  5BPP A;  4F53 A;  3FEX A;  2WXR A;  1EF1 C;  3OTN A;  3LCA A;  4EZJ A;  4C48 B;  5M72 A;  4TV3 A;  3E32 A;  5E75 A;  3KEZ A;  1MX6 A;  2XPI A;  4KYO B;  3HIZ A;  1TJC A;  1ZBP A;  4DX5 D;  3Q7A A;  4B8C B;  1UN9 A;  3V30 A;  5AEN A;  1SA5 A;  3E33 A;  4EBA A;  2I6H A;  5A6C A;  3DSV A;  3EJN A;  3ZGQ A;  5HKP A;  3NF1 A;  2XCB A;  3E30 A;  1O1R A;  2WXN A;  2XGM A;  2WQ6 A;  1E8Y A;  4BER A;  4AY6 A;  3GYZ A;  4O6F A;  5G55 A;  4DJA A;  1BD8 A;  2IF4 A;  5ENO D;  3D9H A;  1JWF A;  5CHE E;  1H2V C;  2CG3 A;  5AQB A;  4ILH B;  4U8V D;  4GTP A;  3W9G A;  5G2N A;  3JUE A;  2A4Z A;  3GZ1 A;  3AAA C;  2AJA A;  4DX1 A;  2HR2 A;  4CT4 A;  3T5X A;  2KAT A;  4B89 A;  4A1S A;  2WXM A;  3FWV A;  4UQY A;  2KM4 A;  4I6J A;  4WND A;  2DZN A;  3CHQ A;  1S63 A;  2C0M A;  3JQ0 A;  2ZXW E;  4BX8 A;  4XIF A;  3EHN A;  4D10 C;  3TGO A;  1FPP A;  5AIJ A;  1K3Z D;  3V31 A;  2OEV A;  3FTS A;  3NB2 A;  4FAD A;  3RRN B;  1Z3X A;  4AP2 A;  3CHR A;  3OXG A;  4LRZ A;  2XEE A;  4GA2 A;  3AS8 A;  3Q75 A;  4GA0 A;  5T3R A;  4EEC A;  4AIF A;  3R7Q A;  3CHS A;  5ENQ D;  1JCR A;  1OWL A;  2WM9 A;  3MKR A;  1S0P A;  2XEV A;  2E2E A;  4EQF A;  5AAR A;  3HRA A;  3UUX A;  2OVF A;  3VTY A;  3QKY A;  4AVX A;  4QQI A;  3TWU A;  3ONL A;  2XZT G;  4W9R A;  3FDH A;  3ZYQ A;  3FUM A;  3CEQ A;  3R9M A;  4FUL A;  3UPV A;  1HG2 A;  3TWS A;  3QWV A;  5DBK A;  3PVL A;  4L23 A;  2Y0B G;  2L9B A;  3ZEF A;  2EIJ E;  1E7V A;  3AG3 E;  4WNF A;  3I5P A;  4B8A A;  2CHZ A;  1ELW A;  1TN8 A;  4LSZ E;  4EHM A;  1D8E A;  3C3Q A;  4GPK A;  2WXO A;  2KBX A;  3AG4 E;  2XZD G;  3HVE B;  3MA5 A;  3U9W A;  3FUK A;  2E0I A;  3LY9 A;  3ASH A;  1HX8 A;  2C0L A;  4AOF A;  1H2U A;  3EU9 A;  2ETA A;  4N3C A;  3IHY A;  4JL0 A;  3SI5 A;  2MHK A;  3NBN B;  3MEK A;  2GRR B;  4EPZ A;  3C98 A;  3WG7 E;  4I2W A;  4JD2 G;  4U7E B;  1DNP A;  4FHJ A;  3RRU A;  3MKQ B;  3PUJ A;  1Z3Y A;  2PQR A;  4FHK A;  5ENS D;  2KZT B;  1WM5 A;  4I17 A;  1UOH A;  4CRW A;  4A1G A;  3AG2 E;  1LTX A;  4O60 A;  4RSY A;  2AXZ A;  4Y6W A;  4G26 A;  5HRY A;  4N2Q A;  2YHE A;  3FUD A;  2JAB A;  2DWZ A;  2NYJ A;  3J5Q B;  3Q9U C;  4JA7 A;  1H6O A;  2GW1 A;  3FTV A;  5G04 C;  3FTU A;  4JHR A;  3V2O A;  3PZD A;  4CEM A;  2QY7 A;  1D9S A;  3ZRH A;  1PC2 A;  4Y6C A;  1Z6T A;  3IXE A;  3LEW A;  5JJ7 A;  3CVW A;  4RG9 A;  4BFR A;  1KZP A;  4TUM A;  2QYJ A;  3CR3 A;  4YDE A;  4G24 A;  5KNH D;  4GZ3 A;  4I9C A;  3EHQ A;  3P1U A;  4F3V A;  3QWP A;  4HRM B;  2WXI A;  2JLB A;  3HHM A;  1X81 A;  1N0R A;  3RJV A;  2WXF A;  2Q7F A;  4U0S A;  5KJK A;  3Q78 A;  5ENN A;  3FFL A;  1TNU A;  4ATG A;  4N5C A;  3B7B A;  2J08 A;  3D9K A;  3UIN C;  2AXV A;  2GRM A;  4J8S A;  4LNG A;  2LO6 A;  4FA6 A;  1E96 B;  4LNU D;  2IO2 C;  1U2V G;  4FC8 A;  4RG6 A;  4DUI A;  4U8Y D;  2H6H A;  4IYP A;  2P2C P;  2WXJ A;  2PL2 A;  3TG5 A;  4GCO A;  1INZ A;  5BT1 A;  2WXQ A;  2OND A;  2YNQ A;  4OAV B;  1NZN A;  2X38 A;  4BTB A;  3RO3 A;  1HS6 A;  3LJN A;  4M7C A;  1QYM A;  4XI0 A;  4I6E A;  2RG8 A;  3LY7 A;  3BQO A;  2LAI A;  3L17 A;  1FVH A;  3MGB A;  3ZW3 A;  3DXM G;  2IQC A;  2M63 A;  4GMR A;  4GYW A;  4FJZ A;  2XS8 A;  3L16 A;  4GU5 A;  1DC2 A;  3CVP A;  3ASN E;  3U66 A;  4GMJ A;  4DX7 D;  5ANR A;  1E8W A;  5CMW A;  4AXH A;  5AYW D;  1OXJ A;  2OV8 A;  4GAA A;  2GRL A;  4MS6 A;  4HQD A;  3DSX A;  3ZN3 A;  5EID A;  3FUL A;  4JA9 A;  2FBN A;  3HXD A;  1MX2 A;  3EIJ A;  5BV1 A;  1TN7 A;  1HZ4 A;  3PRZ A;  3DBS A;  3D9M A;  3TL5 A;  1SZA A;  3UKU G;  2MOW A;  2P9I G;  3L22 A;  3Q4A B;  3CGH A;  5E76 A;  3B13 A;  4YDW A;  3NZS A;  2VQ2 A;  1O5M A;  2FUL A;  2QYU A;  3UX4 A;  4BSX A;  5ANL A;  1N11 A;  2H6F A;  3AS5 A;  3QAQ A;  2V8S E;  1UG3 A;  4M3O A;  3FH8 A;  4C0M A;  5BXU A;  5AN8 A;  3SY2 A;  4Q96 A;  5FTP A;  3UT4 A;  3SGH A;  5FIN A;  3TWT A;  1EYH A;  2IY0 C;  4GTR A;  5BXO A;  4ACL A;  4FLB A;  5FQ4 A;  3UM1 A;  1YCS B;  1N4Q A;  4OVV A;  3RSE G;  1E7U A;  5FZQ A;  4XE0 A;  4HOS A;  4A63 B;  1P5Q A;  4HLL A;  1IXV A;  3ULE G;  4EZK A;  1HXI A;  3MCX A;  3HVE A;  3L13 A;  2KC7 A;  1K1A A;  2OVB A;  1YA0 A;  3ENE A;  1HG5 A;  2CG2 A;  3JQ1 A;  5FJY A;  2X6J A;  4FJY A;  3KSL A;  3PEU B;  5EX3 A;  1ELR A;  3BG0 B;  2F0Y A;  4HB5 A;  5AJL A;  3QDN A;  3PH0 C;  2OEW A;  3IEG A;  2FEZ A;  2J4B A;  2NC9 A;  4FP7 A;  4N3A A;  5D0O D;  3MKQ A;  4GML A;  1WAO 1;  4I6G A;  2R02 A;  4GZ6 A;  2KZT A;  3BG1 B;  3ML9 A;  1OT8 A;  4ILG A;  3PUK A;  5CEA A;  3JCK C;  1FVF A;  5HS0 A;  5D66 A;  3T8K A;  4ANU A;  2VSN A;  2VSO E;  5EYP F;  5B1A E;  2FF4 A;  4J8D A;  5EKQ D;  3MX3 A;  5KBA A;  3CHP A;  1TNB A;  3DEP A;  4BTA A;  2EQX A;  4WNE A;  4CT0 A;  2GRO B;  3KD7 A;  4U8H A;  2LXM A;  1OCR E;  3E4B A;  2IEJ A;  4HOT A;  1KT1 A;  3QAR A;  3RKV A;  4Q94 A;  2QC9 A;  3CV0 A;  1S64 A;  2H6G A;  3PDN A;  4ME2 A;  3DPD A;  2EIK E;  4YDY A;  1A5E A;  1NL4 A;  3AG1 E;  3LXU X;  2P9S G;  3AS4 A;  3S7J A;  2A5U A;  4HOR A;  2HO1 A;  4DI3 A;  2P9L G;  4J8E A;  3FU3 A;  5ARG A;  4U0Z A;  1ZU2 A;  5CCM A;  2L0T B;  4E85 A;  1B89 A;  3Q79 A;  3EUV A;  3ULY A;  4GA1 A;  4LEU A;  5H7P A;  1HFA A;  4PDX A;  1MX4 A;  3D9N A;  3UM3 A;  1QNF A;  4PUC A;  4CGV A;  2UY1 B;  1D8D A;  4I1A A;  4LER A;  3E37 A;  1MHQ A;  1GW6 A;  4GCN A;  1Y6I A;  1JPL A;  3V2X A;  2XGO A;  1BLX B;  3PEV B;  4A3T A;  4A55 A;  2VGY A;  4HI8 A;  4B0Z A;  3L54 A;  3EDT B;  4I2Z A;  4I9E A;  2KCK A;  3TXM A;  3GW4 A;  5DIZ A;  3DRA A;  3AU4 A;  3QJZ A;  1E8X A;  3PNL B;  2BED A;  1IHB A;  3CQC B;  3X2Q E;  1TYQ G;  4KXK B;  4U04 A;  2IO3 C;  1UJK A;  3U3W A;  3SNX A;  4DPR A;  2WB2 A;  4K5C A;  2IOL A;  4JEU A;  4HFG A;  4EBA G;  3TWR A;  3LDZ A;  4N3B A;  4UWL A;  5G05 J;  4JC8 A;  2J09 A;  2DIW A;  3CIA A;  3SF4 A;  2AW6 A;  4HNA D;  4KZC A;  3FUF A;  1N95 A;  3ZYK A;  4TXQ A;  3EIQ C;  4B94 A;  2GRP B;  2JEK A;  2WXL A;  4GTQ A;  3D9P A;  4GTO A;  3UKR G;  2DZO A;  2Y69 E;  3CHM A;  3RO2 A;  1HF8 A;  4UQX A;  4HVB A;  2R03 A;  4XI9 A;  4R7L A;  1O1S A;  5ENP D;  4JW1 A;  1OWP A;  4ABN A;  4WWN A;  3ASG A;  4F6R D;  3LS8 A;  5FQ6 A;  1N4P A;  4N5Q A;  1N52 A;  4JHJ A;  3WXX A;  4K0R A;  2LSU A;  4AY5 A;  3FUN A;  2CFZ A;  4GYO A;  3J5P A;  3P2B A;  4DI4 A;  5AQA A;  3HXB A;  2LSV A;  3KSQ A;  4UI9 J;  4NRH B;  4Z68 A;  3FH5 A;  5LFA A;  4CDN A;  3JXI A;  3ZNG A;  3DEO A;  1N9A A;  4LUN U;  3JUI A;  1IYG A;  2KCL A;  2I1K A;  4UWG A;  4ANV A;  5BV0 A;  3G2T A;  3FTY A;  4CCA A;  4U07 A;  3TWQ A;  4GB9 A;  2PM6 A;  3CVX A;  4NIK A;  4FU3 A;  3RRM B;  2V4H C;  4U96 D;  2FO1 E;  1OY3 D;  2XEH A;  3CKB A;  4CGW A;  1YYH A;  3DSU A;  3UTM A;  5FT9 A;  4XKC A;  1G3N B;  2ZIR A;  3KS2 A;  2ZGD A;  4CDR A;  1IHG A;  3ZPJ A;  1NP7 A;  4HS2 A;  3LVQ E;  1VDY A;  4UWK A;  4ACK A;  3ZXP A;  4NUR A;  3UIO C;  4KMO A;  4ILI A;  5JA4 D;  1WG0 A;  2H6I A;  5KJM A;  4HOU A;  5BW8 C;  5CRU A;  2HE0 A;  1KPS B;  4HI9 A;  2ZU6 B;  1MJ0 A;  3VTX A;  3PZ3 A;  4K5A B;  3MV2 B;  1DVP A;  1H2T C;  2PZI A;  4OYS A;  3ZHE B;  2DCP A;  5JHB A;  2I1J A;  3EHR A;  1U3C A;  2BUG A;  3ZKJ A;  1IQR A;  3OAW A;  4N39 A;  2MYO A;  5ENT D;  5FIO A;  2R59 A;  5KNG A;  4K5B A;  4G23 A;  3ZXS A;  3TXN A;  3BU8 A;  3FEY A;  3GZ2 A;  3FUE A;  4BX9 A;  3IBE A;  2GGF A;  1HU3 A;  4A3V A;  1E8Z A;  3HDX A;  5LCW J;  3G2V A;  1SQM A;  3Q47 B;  1BI8 B;  5CER B;  2ETB A;  4G8L A;  3UI2 A;  4AM9 A;  2Y4T A;  2EIN E;  1QQE A;  1PAQ A;  5CMY A;  2YHC A;  5KWD A;  1PY1 A;  3C3R A;  4GZD A;  5EYL A;  4UI9 K;  5EDS A;  3BUA A;  2AXU A;  4DK5 A;  2I9C A;  2UY1 A;  4JB8 P;  2XHE A;  3QWW A;  1E90 A;  3O48 A;  4KZ0 A;  2V5F A;  1KT0 A;  1N0Q A;  2L0I A;  3TG4 A;  5JJT A;  4GTV A;  4BY6 A;  3PZ1 A;  5FZS A;  1TEZ A;  4KBQ A;  3ULQ A;  1U3D A;  4BET A;  2AVP A;  2Y3A A;  3Q49 B;  4RVB A;  3ZIM A;  1Z5S C;  1JCS A;  4JVS A;  3UIP C;  2R2L A;  3CVL A;  4J6I A;  3LY8 A;  4GPM A;  3APF A;  5BNW A;  4YND A;  2QFC A;  5AQ9 A;  2IOS A;  4TRQ A;  5EIL A;  4QFV A;  3SO8 A;  2WXG A;  1LD8 A;  4F7A A;  3QK0 A;  3APD A;  1BPO A;  4DX2 A;  3ESK A;  3FTW A;  3RU0 A;  2Y1L E;  5D2M C;  4BES A;  2HM8 A;  1FT2 A;  3PE4 A;  3CVV A;  3LVR E;  4F1S A;  2XPY A;  2VGE A;  3APC A;  5FQ7 A;  2VSX E;  3JYS A;  3PZ4 A;  1NI1 A;  4BWR A;  2CFU A;  4J8F A;  3ZUV B;  1BU9 A;  4I1O B;  3D9J A;  5FWQ A;  1HO8 A;  4BT8 A;  1JUQ A;  3ZYL A;  3EHM A;  5ENR D;  4J8Y A;  1Y8M A;  4APO A;  2V5Q C;  1OCC E;  2OCC E;  3E34 A;  1UW4 B;  2FO7 A;  4UQZ A;  3TAX A;  2CHX A;  4CDM A;  3TWW A;  3SHF A;  2P9N G;  1AWC B;  4CYM D;  1HH8 A;  4WWP A;  5EX0 A;  1N54 A;  2DVW A;  2ETC A;  4GYY A;  3ZU7 B;  3MYV A;  4BSZ B; 
#chains in the Genus database with same CATH homology
 3EDT B;  4H7X A;  4I2Z A;  2KZT B;  1WM5 A;  4I17 A;  4CRW A;  1WY6 A;  4A1G A;  4I9E A;  2KCK A;  2NSZ A;  4RSY A;  5KJL A;  3D9L A;  5LX8 A;  3TXM A;  3GW4 A;  3Q5M A;  5DIZ A;  3AU4 A;  4IN3 B;  3O4Z A;  4Q69 A;  3QJZ A;  5G04 J;  3K9I A;  3SD5 A;  1E8X A;  2AXZ A;  2PQN A;  2L6J A;  4Y6W A;  5J90 A;  2WMO A;  3PNL B;  3FTX A;  4G26 A;  3CQC B;  3B7U X;  4KXK B;  2VTB B;  4U04 A;  4N2Q A;  4KVO A;  2YHE A;  3I4G A;  3FY4 A;  1L5J A;  3FUD A;  3D3M A;  1UJK A;  3U3W A;  2J4D A;  4U0U A;  3SNX A;  4DPR A;  3GZS A;  2WB2 A;  5KJN A;  2J9Q A;  1MQS A;  2IOL A;  4G25 A;  4JEU A;  4HFG A;  2J07 A;  2XCC A;  4JA7 A;  2BF0 X;  2GW1 A;  3FTV A;  2AWI A;  4EBA G;  5G04 C;  3TJP A;  3FTU A;  4JHR A;  4WWO A;  1IQU A;  3UMV A;  3LDZ A;  3OXF A;  2J49 A;  4N3B A;  3T5V A;  3PZD A;  4UWL A;  4CEM A;  4PS8 A;  4XX5 A;  5G05 J;  4G1T A;  3RK6 A;  4JC8 A;  2QY7 A;  3CK8 A;  2J09 A;  4HOQ A;  2DIW A;  3CIA A;  3ZRH A;  4UWH A;  1PC2 A;  4Y6C A;  1Z6T A;  3SF4 A;  3LEW A;  5JJ7 A;  2AW6 A;  5J08 A;  3CVW A;  3CVQ A;  4KZC A;  3FUF A;  2P58 C;  4RG9 A;  4C0E A;  5FQ8 A;  3ZYK A;  2XPZ A;  4BFR A;  2XGS A;  3EIQ C;  4B94 A;  3FU6 A;  2JEK A;  2WVI A;  2WXH A;  3CR3 A;  2VYI A;  4K03 A;  2X3M A;  2WXL A;  4G24 A;  3S7F A;  4EZL A;  4GZ3 A;  4I9C A;  2ION A;  4APF A;  3CLJ A;  1LF8 A;  3U64 A;  3CVN A;  2HYZ A;  3VLE A;  3P1U A;  2WPV A;  1W3B A;  3D9O A;  1UJJ A;  1H19 A;  2IU1 A;  3D9P A;  3QWP A;  4F3V A;  4DLO A;  2WXI A;  2JLB A;  3HHM A;  3L6A A;  5G05 C;  3SBT B;  1OUV A;  3MJW A;  3CSF A;  3RJV A;  1SZ9 A;  2WXF A;  2Q7F A;  3CHO A;  4U0S A;  5KJK A;  2YIN A;  3CHM A;  5ENN A;  3FFL A;  2R5S A;  3RO2 A;  1HF8 A;  4UQX A;  2WQ7 A;  4ATG A;  4HVB A;  3G2W A;  3FHE A;  4N5C A;  3Q15 A;  5C2Y A;  3ZHE A;  4XI9 A;  2J08 A;  2CHW A;  3D9K A;  3PE3 A;  4R7L A;  5HI7 A;  2VGX B;  2AXV A;  2GRM A;  4J8S A;  3B7S A;  4DLQ A;  3ZVV A;  4JW1 A;  1OWP A;  3CVU A;  2LO6 A;  4ABN A;  4WWN A;  3ASG A;  4NQ0 A;  3LS8 A;  4FA6 A;  5FQ6 A;  1E96 B;  3SFZ A;  1N52 A;  4JHJ A;  4FC8 A;  4RG6 A;  3WXX A;  4GZC A;  4MRU A;  3QB2 A;  4K0R A;  5A7D B;  4IYP A;  1H6K A;  4URK A;  2LSU A;  4AY5 A;  2WXJ A;  2PL2 A;  3FUN A;  3NZU A;  2CFZ A;  3CQG B;  3TG5 A;  4GYO A;  1OWN A;  4GCO A;  1INZ A;  5BT1 A;  1H0A A;  3P2B A;  1OWM A;  2WXQ A;  3IKO B;  3PS6 A;  4DI4 A;  5A23 A;  2OND A;  3LYA A;  3ZYM A;  3QNK A;  2LSV A;  2YNQ A;  1NZN A;  3BEE A;  4NAC A;  3U4T A;  2X38 A;  3ESL A;  4BTB A;  3UT7 A;  4UI9 J;  4NRH B;  3RO3 A;  1HS6 A;  3UT8 A;  3FH5 A;  5LFA A;  3OXL A;  3FP3 A;  4KT6 B;  4CDN A;  2Y4U A;  4XI0 A;  3CST A;  4I6E A;  2RG8 A;  3LY7 A;  4LUN U;  4JPS A;  3RIB A;  4ANX A;  2X6H A;  2LAI A;  3KAE A;  3L17 A;  4KVM A;  3JUI A;  1IYG A;  4N2S A;  2KCL A;  1FVH A;  2I1K A;  3MGB A;  3ZW3 A;  4UWG A;  4L1B A;  4ANV A;  5BV0 A;  3G2T A;  3FTY A;  2IQC A;  3HYM B;  4G11 A;  4CCA A;  4U07 A;  4XKB A;  2M63 A;  3LKU A;  4GYW A;  4GB9 A;  2LNI A;  2PM7 A;  2PM6 A;  2VJ8 A;  3IHV A;  4UI9 C;  1XGW A;  4FJZ A;  3CVX A;  3L16 A;  3I3N A;  4FU3 A;  3QOU A;  3RRM B;  4HXI A;  4JZY A;  4AEZ C;  5FZR A;  1NA0 A;  3SZ7 A;  4FLH A;  1TJF A;  3LPZ A;  1XNF A;  3VLF A;  4GU5 A;  3CVP A;  3D9I A;  3CKB A;  2X6K A;  4CGW A;  3U66 A;  4MLP A;  1FCH A;  2WQH A;  2WXP A;  5BPP A;  3FUI A;  1X5B A;  4GMJ A;  4PH4 B;  5ANR A;  4F53 A;  1E8W A;  5LP0 A;  3FEX A;  2WXR A;  5FT9 A;  4AXH A;  5CMW A;  5AYW D;  1EF1 C;  2OV8 A;  3ASF A;  4GAA A;  4XKC A;  2GRL A;  3OTN A;  4MS6 A;  1HE8 A;  2RD0 A;  3LCA A;  3ZN3 A;  4EZJ A;  1OWO A;  3FTZ A;  3KS2 A;  4CDR A;  3FUL A;  1KLX A;  3IV0 A;  1IHG A;  4JA9 A;  2FBN A;  4TV3 A;  5M72 A;  4L2Y A;  5E75 A;  3ZPJ A;  2FI7 A;  3KEZ A;  3EIJ A;  1NP7 A;  4HS2 A;  3LVQ E;  1VDY A;  2XPI A;  5BV1 A;  4TUU A;  4UWK A;  4ACK A;  1HZ4 A;  4KYO B;  3HIZ A;  3PRZ A;  1TJC A;  4NUR A;  3DBS A;  1ZBP A;  4KMO A;  4ILI A;  4B8C B;  3D9M A;  3TL5 A;  1UN9 A;  3CKC A;  1SZA A;  5KJM A;  4HOU A;  5AEN A;  5BW8 C;  2MOW A;  3ML8 A;  3L22 A;  2WXK A;  4I43 A;  3Q4A B;  2ZU6 B;  3PRE A;  1EPU A;  3CGH A;  5E76 A;  4EBA A;  2I6H A;  4WNG A;  3SBS A;  5A6C A;  2IFU A;  3CK7 A;  3B13 A;  3VTX A;  4AJW A;  3MV2 B;  1DVP A;  1H2T C;  2PZI A;  4OYS A;  5JHA A;  3NZS A;  3ZHE B;  3EJN A;  2VQ2 A;  3ZGQ A;  3NF1 A;  2DCP A;  2XCB A;  2FUL A;  3RRN B;  3S7B A;  5JHB A;  2I1J A;  3UX4 A;  1U3C A;  5D0Q D;  2WXN A;  4BSX A;  2BUG A;  5ANL A;  3LJ3 A;  3ASD A;  1IQR A;  2XGM A;  3OAW A;  3AS5 A;  4N39 A;  3QAQ A;  2WQ6 A;  1E8Y A;  3NQP A;  2V8S E;  2BTD A;  1UG3 A;  4AY6 A;  3GYZ A;  4O6F A;  4M3O A;  2R59 A;  3FH8 A;  3QC1 A;  4C0M A;  4G23 A;  3ZXS A;  4MKT A;  3TXN A;  4Q96 A;  5FTP A;  3L08 A;  5G55 A;  4DJA A;  3FEY A;  2R17 C;  2IF4 A;  4UWF A;  3UT4 A;  3SGH A;  1JWF A;  3MV3 B;  2XRZ A;  3GZ2 A;  3FUE A;  5CHE E;  4C9B B;  2NXP A;  1H2V C;  1EYH A;  3URZ A;  5T8I A;  2CG3 A;  4BX9 A;  2XQ0 A;  2GGF A;  3FH7 A;  3IBE A;  4ILH B;  4ACL A;  4FLB A;  5FQ4 A;  5G2N A;  1EDU A;  3ONK A;  2A4Z A;  3T8M A;  1HU3 A;  4A3V A;  1E8Z A;  3HDX A;  3UQ3 A;  3GZ1 A;  4OVV A;  5LCW J;  1E7U A;  5FZQ A;  3G2V A;  4XE0 A;  4G2V A;  1SQM A;  2HR2 A;  2X6F A;  3FUJ A;  3Q47 B;  4HOS A;  3G2U A;  4CT4 A;  3T5X A;  2V0P A;  2KAT A;  1P5Q A;  4L2L A;  4B89 A;  4P29 A;  4AM9 A;  2Y4T A;  4A1S A;  2WXM A;  3FWV A;  3R9A B;  4UQY A;  1QQE A;  4EZK A;  2KM4 A;  2YQ8 A;  3CVY A;  4I6J A;  1PAQ A;  4WND A;  1HXI A;  3MCX A;  5CMY A;  2YHC A;  3HVE A;  3L13 A;  3CHQ A;  2KC7 A;  2C0M A;  2OVB A;  3JQ0 A;  1YA0 A;  1PY1 A;  3ENE A;  4GZD A;  4JHK A;  1HG5 A;  2CG2 A;  3JQ1 A;  5FJY A;  4BX8 A;  5LCW C;  2X6J A;  4FJY A;  4XIF A;  3EHN A;  3PEU B;  4D10 C;  2X6I A;  1ELR A;  5EX3 A;  3BG0 B;  4UI9 K;  5EDS A;  3TGO A;  2IJG X;  4DK5 A;  2AXU A;  3G2S A;  2I9C A;  3ZFW A;  5AIJ A;  2UY1 A;  2XHE A;  5AJL A;  1A17 A;  3QDN A;  3FTS A;  3PH0 C;  3QWW A;  1E90 A;  3O48 A;  3IEG A;  2FEZ A;  4FAD A;  1JWG A;  2J4B A;  4PS7 A;  3B7R L;  2V5F A;  4JXT A;  2NC9 A;  4FP7 A;  1Z3X A;  4KZ0 A;  5LOZ A;  1KT0 A;  4N3A A;  5D0O D;  4YVO A;  2L0I A;  3TG4 A;  4AP2 A;  3MKQ A;  4GZ5 A;  4GML A;  1WAO 1;  3CHR A;  4I6G A;  4WAF A;  4BY6 A;  3OXG A;  5JJT A;  5FZS A;  1TEZ A;  4KBQ A;  4GZ6 A;  2KZT A;  3BG1 B;  3ML9 A;  4LRZ A;  3S7D A;  4XZ4 A;  2KCV A;  4GA2 A;  4ILG A;  3PUK A;  3JCK C;  3AS8 A;  1FVF A;  3ULQ A;  4GA0 A;  1U3D A;  5T3R A;  4EEC A;  4AIF A;  2AVP A;  4ANU A;  2Y3A A;  3Q49 B;  2VSN A;  4PS3 A;  3R7Q A;  4RVB A;  3ZIM A;  2VSO E;  4LCT A;  3CHS A;  3AU5 A;  2VSY A;  5JJ6 A;  4OVU A;  2VTB A;  2FF4 A;  1NA3 A;  4I1M A;  1OWL A;  4JVS A;  4J8D A;  3R7R A;  3CVL A;  2WM9 A;  5EKQ D;  2XRY A;  3MKR A;  4J6I A;  3MX3 A;  3LY8 A;  2WMN A;  3S2A A;  3APF A;  1S0P A;  3CHP A;  5BNW A;  2XEV A;  2E2E A;  4YND A;  4EQF A;  5AJD A;  2QFC A;  3FUH A;  4J0U A;  4BTA A;  2EQX A;  4WNE A;  5HQ8 A;  2IOS A;  4TRQ A;  5CCL A;  4YVQ C;  4IUL A;  3UUX A;  4QFV A;  4CT0 A;  3KD7 A;  2OVF A;  4U8H A;  3VTY A;  3QKY A;  3E4B A;  4AVX A;  5T4Y A;  2WXG A;  3ONL A;  4HOT A;  1KT1 A;  2I2O A;  4ANW A;  4W9R A;  3FDH A;  3PNT B;  4F7A A;  2C2L A;  2UWJ G;  3QK0 A;  3APD A;  3QAR A;  3RKV A;  3ZYQ A;  1BPO A;  3FUM A;  4Q94 A;  3ESK A;  3FTW A;  3CV0 A;  3CEQ A;  3RU0 A;  4E6H A;  4FUL A;  3PDN A;  4ME2 A;  2HM8 A;  3UPV A;  1HG2 A;  3DPD A;  3PE4 A;  3CVV A;  3I4R B;  3LVR E;  3QWV A;  4IRU A;  5DBK A;  3LXU X;  4F1S A;  2XPY A;  2ILR A;  3APC A;  5FQ7 A;  3PVL A;  4L23 A;  3AS4 A;  4BT9 A;  3S7J A;  2L9B A;  2VSX E;  2A5U A;  4HOR A;  3ZEF A;  2OOE A;  2HO1 A;  3JYS A;  4DI3 A;  2V4L A;  1E7V A;  4WNF A;  4BWR A;  2CFU A;  3I5P A;  4J8F A;  4B8A A;  2CHZ A;  1ELW A;  2MRI A;  3N71 A;  4I1O B;  3D9J A;  4J8E A;  5FWQ A;  3FU3 A;  1HO8 A;  4BT8 A;  1JUQ A;  4GPK A;  3ZYL A;  3EHM A;  5ARG A;  2WXO A;  2DBA A;  4U0Z A;  1ZU2 A;  3VLD A;  4WUY A;  5ARF A;  2L0T B;  5CCM A;  5KCM A;  1Y8M A;  4APO A;  4E85 A;  2VGX A;  5BUZ A;  3HVE B;  4JEH A;  3FU0 A;  1UW4 B;  3MA5 A;  2FO7 A;  1B89 A;  3U9W A;  1UN8 A;  3FUK A;  4GA1 A;  2E0I A;  3LY9 A;  4LEU A;  4UQZ A;  3TAX A;  1HFA A;  3ASH A;  4PDX A;  1HX8 A;  2C0L A;  3D9N A;  4AOF A;  1H2U A;  2CHX A;  4CDM A;  1QNF A;  3IHY A;  4N3C A;  4JL0 A;  4PUC A;  2LAH A;  4CGV A;  3FU5 A;  4U63 A;  3SHF A;  3SI5 A;  2MHK A;  2UY1 B;  4H7Y A;  1QZ2 A;  3MEK A;  4I1A A;  3B7T A;  4EPZ A;  4LER A;  4HLE A;  4L7T A;  3CK9 A;  3C98 A;  4I2W A;  1MHQ A;  1GW6 A;  1HH8 A;  4GCN A;  1DNP A;  1Y6I A;  4WWP A;  5C1D A;  4FHJ A;  4AV7 A;  1JPL A;  5EX0 A;  1N54 A;  4GYY A;  3RRU A;  3MKQ B;  3PUJ A;  2XGO A;  3PEV B;  1Z3Y A;  4A3T A;  4A55 A;  1ELK A;  2VGY A;  4B0Z A;  3MYV A;  2PQR A;  4V3I A;  3MZL B;  3L54 A;  4FHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...