5LP0A

Crystal structure of the zebra fish enth domain from epsin1 in 1.41 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
140
structure length
140
Chain Sequence
GAMGSSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHALKTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A bacterial genetic selection system for ubiquitylation cascade discovery.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
molecule keywords Epsin 1
total genus 59
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lp0A00
2L0IA 3D9NA 1JPLA 1ELKA 4FLBA 4AVXA 4Q96A 4NACA 2DIWA 3ONLA 3G2VA 3D9MA 3ZYQA 2BF0X 1UJKA 5LOZA 1VDYA 1HG5A 1JUQA 1INZA 2L0TB 4HFGA 1EYHA 1UJJA 3D9PA 3ZYMA 1EDUA 5J08A 2LO6A 1H0AA 2MOWA 4GZCA 1HX8A 1DVPA 5CMWA 3ONKA 3D9LA 3D9JA 2KM4A 3G2WA 3CLJA 3D9OA 3RRUA 1JWFA 2V8SE 2DCPA 1MHQA 3G2SA 1LF8A 3G2UA 1HFAA 3G2TA 4JXTA 1HF8A 3D9IA 3LDZA 3ZYKA 1JWGA 1SZ9A 3D9KA 4Q94A 5CMYA 4GZDA 3ZYLA 1PY1A 4FU3A 5LP0A 1HG2A 2QY7A 1SZAA 1XGWA 1X5BA
chains in the Genus database with same CATH superfamily
2R02A 2VSOE 3E33A 3Q7FA 1TYQG 3TG5A 3CHOA 4UWHA 4CGVA 2AW6A 2CHXA 3JQ1A 2C0MA 4CT4A 3AG2E 3PZ1A 3V2OA 2RKKA 3W9FA 3LJ3A 2DCPA 2I1KA 4UWKA 4DI3A 3JXJA 4BSZB 3R7RA 3ISMC 1Z3YA 2PM7A 4KZCA 3ONLA 4XEIG 2XZTG 4AV7A 1QYMA 2H6FA 3CEQA 2IU1A 3SFZA 4GTTA 5AQ7A 1IQRA 2XGOA 4HI8A 1KT0A 1XGWA 3DEOA 5AJDA 2R03A 3ZXSA 5EYLA 3FUFA 3ABKE 3P1UA 3SQVA 1TEZA 5D0OD 4BWRA 3D9JA 4EZKA 1TNBA 3ZIMA 2GRPB 1HE8A 3QC1A 3ZKJA 1D8DA 1KZOA 2BTDA 4BETA 1N4QA 1S64A 3D9HA 2B6CA 5KJMA 5E75A 3RJVA 1YYHA 3PZ3A 1OCRE 3TAXA 2IY0C 1LD7A 2YHCA 4ANXA 5CEDB 1DNPA 3R9AB 1WDYA 2CG2A 1HU3A 4C0EA 3IEGA 2LSVA 3J5PA 3FTWA 4WWNA 3AG4E 3AG1E 2XENA 5HKPA 3KSQA 4GPKA 3DEPA 1EYHA 4K03A 4JHRA 2DVWA 3EU5A 1OWMA 4LNUD 3SHFA 4Z68A 3PEVB 3WG7E 5BNWA 1Q2ZA 1RZ4A 4GTOA 1HXIA 3PREA 2EIKE 3FFLA 2CG3A 5T4YA 4FP7A 2E0IA 4TRQA 3QWVA 3CVYA 3UM3A 2J4BA 5M72A 4TXPA 2VGEA 1O5MA 3PUKA 3DXKG 4JXTA 2Y3AA 1OUVA 4BESA 1KLXA 3DRAA 1NP7A 4GB9A 3PS6A 1O1TA 5FQ6A 2VTBA 4WUYA 4OAVB 2ZISA 3FU6A 5KJLA 1SA5A 4XI9A 4I1MA 2PNNA 4GAAA 5EX3A 4CRWA 5ANLA 2VSYA 1OWLA 1S0PA 1HO8A 3FTYA 1E8ZA 4O60A 3AS8A 3EJNA 3ZHEB 4C48B 4GZCA 3FEXA 5CRUA 4FA6A 3FUDA 2Y69E 1ELKA 3PE4A 5A23A 1QBQA 2VSXE 1UN8A 2WQ6A 1BD8A 4K5CA 4HRNA 4AY5A 5EILA 3LEWA 3RRUA 2XCCA 1HF8A 4GA1A 2P9IG 5EIDA 3CHSA 5JHBA 4IYPA 3QARA 4JHKA 2J4DA 2HR2A 4JEUA 3ZYQA 1H2VC 2P9UG 2OOEA 3ZXPA 3HRAA 2OV8A 3DSSA 1HZ4A 1YCSB 1MYOA 1SA4A 3G2SA 3TWUA 3Q15A 3E32A 1BLXB 4YVOA 3BG0B 4D10C 2KZTA 3EUVA 3C98A 4HORA 2WXKA 4APFA 2VYIA 2P58C 4ILHB 2KZTB 1HS6A 2F8XK 4EPZA 5HQ8A 2V0PA 3D9KA 1WAO1 1JCQA 1ZU2A 4UWFA 5LP0A 4G23A 2X38A 4GTRA 1SW6A 1OT8A 4A1GA 1UJJA 3T8KA 3ZRHA 5ENQD 3SGHA 5IY5E 1WG0A 4ATGA 4GA2A 3ZYLA 3L6AA 2KXPC 3TL5A 3SO8A 5C1DA 2WXIA 4U8YD 5EYPF 3PRZA 3UX4A 4MKTA 4L9PA 2WQ7A 1IXVA 4J0UA 4AXHA 3SI5A 2UY1B 5FT9A 4G8LA 5AQ9A 4B93B 4L2LA 2L9BA 3ULEG 4U96D 2PZIA 3RRNB 1MZCA 2WXQA 2BKGA 4CDNA 3L13A 4DX6D 4U07A 1OY3D 1ZBPA 5D0QD 4GTPA 4J8YA 4ANVA 1Z5SC 2VGYA 3RKVA 1K1AA 4KYOB 1U2VG 2L0IA 4UI9C 2ETBA 1NL4A 3KEZA 1VDYA 3OXFA 2GRLA 2C0LA 3ULQA 3UIOC 3CVPA 4MRUA 2F37A 4B8CB 1MHQA 3FTUA 3CHRA 2WVIA 4DRXE 3B95A 4GYOA 2ETAA 4UI9J 3CVWA 3FH7A 3LY9A 3KEAA 4BTBA 4LNBA 2L0TB 3Q5MA 1EF1C 4PUCA 3L17A 2FO7A 3FDHA 3VLEA 3L08A 4AIFA 2DZNA 5JJTA 3C3RA 2WXRA 1OWPA 4ILGA 2DBAA 3ASOE 5BW8C 3ZHEA 4BEPA 3HVEB 4N39A 3Q47B 4HNAD 2EQXA 3SF4A 2H6IA 5FINA 2CFZA 5HRYA 5T8IA 2XPZA 3KSLA 4F1SA 3PZ2A 3G2TA 1UG3A 2AXVA 4M7CA 3BU8A 1AP7A 3UXGA 5A7DB 3NAWA 3EDTB 2MOWA 4W9RA 2HM8A 2QC9A 2OEWA 3MV3B 3MKRA 1N4PA 3Q7AA 5ENRD 5KNHD 5AAOA 3IBEA 2R05A 1SVXA 2F8YA 5CCLA 2PM6A 1FT2A 5AIJA 4L2YA 4WAFA 3R9MA 4ATZD 3Q79A 2P9SG 1KPSB 5A6CA 1BPOA 2Q7FA 1E90A 4LUNU 4HB5A 2EIJE 4U8HA 1H6OA 4TV3A 3QAQA 1E96B 1E7UA 3HIZA 5FQ8A 5ARFA 5B1BE 1IHGA 3ULYA 2WMNA 2AJAA 3FH5A 3MCXA 5KCMA 3FUHA 3NZSA 3BEEA 4I17A 2BEDA 2ZU6B 2X6HA 4H7XA 3RK6A 5BUZA 2XZDG 4ILIA 4H7YA 4J8EA 1K1BA 1JCRA 1E8WA 4GYYA 4L1BA 4Y6CA 5HS0A 3LS8A 1HG5A 4X8QA 2FBNA 2ZGGA 4HXIA 2I9CA 3U9WA 3W9GA 4MBGA 3MZLB 3IXEA 3UT7A 1K8KG 5BT1A 4XKCA 5D66A 1MX2A 4N2QA 1W3BA 3FTZA 4DK5A 3UPVA 3FY4A 3CVUA 3CQCB 1ZB1A 4UQZA 3QJZA 4YDYA 2YQ8A 2YNQA 4QFVA 3Q9UC 3OXGA 5FZQA 3U4TA 1QZ2A 3FU5A 3HXCA 4JA7A 2KATA 2BUGA 3T8MA 1TN7A 3AU5A 2P9PG 2XQ0A 4I9CA 3S7BA 2H6HA 3SY2A 2RFMA 4YDEA 1Y8MA 1N11A 3JUIA 4U7EB 3F6QA 5FZRA 5JJ7A 2ETCA 4I6JA 1JUQA 3SZ7A 2V5FA 4AM9A 3FULA 2GRMA 4PS7A 5JJ6A 4DUIA 3ESLA 2RG8A 2DYSE 3IHVA 3LKUA 3RO2A 3ASFA 4GA0A 3KAEA 2WXPA 4CEMA 1B89A 1N95A 4WNFA 3U3WA 2BKKB 4NQ0A 4MS6A 1IKND 2XEHA 1IQUA 4N5QA 1U3CA 1OCOE 4FJZA 4LRZA 1D8EA 1N94A 2V4HC 4BT9A 1G3NB 1O1SA 3S7FA 2Y0BG 3NB2A 3AS4A 3O4ZA 4U0UA 2I2OA 3QK0A 2NSZA 3ZYKA 4JC8A 4B94A 2CFUA 4HLLA 1MX4A 1P5QA 3Q73A 3MGBA 2MYOA 4DJAA 3JXIA 2LUHA 5JHAA 4PH4B 3B7RL 4B89A 3OXLA 3L16A 3NQPA 2NC9A 3I5PA 2A4ZA 4N2SA 2XRYA 2ZGDA 1QQEA 3LVRE 4A3VA 4Q69A 4EZJA 4HFGA 4J8DA 2OVBA 4TUMA 3CVVA 1V55E 5CMYA 4K0RA 4E6HA 4G11A 4FU3A 2IOSA 3URZA 3B7TA 1TR4A 4IRUA 5G55A 2FULA 3QNKA 2XHEA 2GRNB 4ABNA 3SFYA 1N4RA 1BI8B 5AN8A 4BFRA 3L22A 4UWGA 4WWOA 2HO1A 1SZ9A 5AQAA 2EINE 1XNFA 3Q75A 2X6FA 1H6PA 5JA4D 4L7TA 3HXDA 4I1AA 2ZIRA 4UWLA 3UMVA 1TJFA 3I4GA 4HOTA 5D2MC 4OAUC 3LCAA 4RSYA 3ML9A 4KBQA 4IN3B 4DLQA 5DBKA 1E7VA 1FT1A 3SNXA 3FTXA 5HI7A 3APCA 2DZOA 3MX3A 5CMWA 4JPSA 2XRZA 4CDRA 3P2BA 3PUJA 2FO1E 3LDZA 3Q49B 1BI7B 2WXGA 2B0OE 2QZAA 5ENTD 3D9NA 2VSNA 4RVBA 3ZFWA 2KBXA 5FQ4A 4Y6WA 5ARGA 4HLEA 3ZN3A 4ACKA 1SQMA 4JB8P 4LNGA 4L23A 3NOGD 4ME2A 2LAIA 3FUJA 3GYZA 3CVXA 4CGWA 2Y4UA 4APOA 1UOHA 1OCZE 3HYMB 2R59A 5AENA 2V8SE 5FQ7A 3UUXA 1HFAA 1IYGA 3RIBA 2XS8A 3QB2A 4HQDA 1MJ0A 3T5XA 3MYVA 3CSFA 5ENNA 2VGXA 4ZFHA 2WXHA 3J5QB 3JYSA 2V5QC 2X6KA 2WPVA 3MKQA 4BT8A 4RG6A 1TN6A 3CR3A 3Q78A 2JABA 2C2LA 4U04A 3CV0A 4XKBA 4C0MA 3Q9NC 5J08A 4I6EA 3ZNGA 4GTVA 3ASGA 5CEAA 3ASDA 3T5VA 2FF4A 4XX5A 2PQRA 5KWDA 2P9LG 3Q4AB 4K5AB 5KNGA 3AS5A 2DIWA 4G26A 2Y1LE 1LTXA 2LSUA 3I4RB 3FUKA 4A55A 3G2WA 3OAWA 3TJPA 3QDNA 2A5UA 1D9SA 1NZNA 4FULA 4XI0A 1U3DA 3HXEA 1PY1A 4JZYA 3APFA 2IEJA 3CVQA 4N3BA 2P2CP 3ZU7B 2GGFA 3BG1B 3MJWA 3AAAC 3DSVA 4DI4A 5EKQD 3JCKC 3EHRA 3R7QA 4GTSA 3APDA 3E34A 3B7BA 3IHYA 4F53A 5JMND 4LG6A 4CYMD 3UM1A 4BERA 3PE3A 4ACLA 2CHWA 3BQOA 4XE0A 2IF4A 4HI9A 4B0ZA 3IV0A 4FC8A 4E85A 3B13A 4HRMB 2I1JA 4UUCA 1QNFA 4OVUA 3FU3A 3LPZA 3UM0A 4XZ4A 1PC2A 5KJNA 3GZ1A 3PDNA 4CDMA 4KVMA 4KT6B 3T9KA 1N4SA 4I43A 3CHMA 1H2TC 3DXMG 4BY6A 3RU0A 2J08A 5CBNA 4JL0A 3L9TA 3L82A 2XPYA 3ZGQA 1S70B 2H6GA 1OCCE 4PS3A 3DSXA 1TJCA 3SBTB 2J07A 4JHJA 1HX8A 2NYJA 3CHPA 4GTMA 4O1OA 4GZ3A 1Y6IA 2PL2A 3U66A 5EIBE 3OTNA 2R17C 2XEVA 5DIZA 2QYJA 3V2XA 4B8AA 2QFCA 2LAHA 4NRHB 3BUAA 1WM5A 4HOUA 1A5EA 4CZ2D 1BU9A 4EECA 3QWWA 2AWIA 4KVOA 3RSEG 4KMOA 3TWSA 3HXBA 2GRRB 3RAUA 4QQIA 4G8KA 5C2YA 4YDWA 4GZDA 4YDOA 3LYAA 1N52A 4FLBA 4V3IA 1O1RA 4BX8A 3UINC 1S63A 3ZEFA 3ZYMA 2J49A 3D9LA 4JD2G 4OVVA 3UKRG 2IONA 4JW1A 4DX7D 3EHMA 4I2ZA 4PS8A 3D9MA 1N0RA 1TNUA 2OCCE 4J8SA 3NZUA 2LNIA 3E4BA 2IJGX 4TXQA 3B7SA 2J09A 1LF8A 1X81A 1PAQA 3UQ3A 3MA5A 4FADA 1IHBA 3D3MA 4NACA 3O48A 2NXPA 4ANWA 4HOSA 3AG3E 4ANUA 4BX9A 4GMRA 4GZ5A 3PEUB 1FVHA 1FPPA 3D9IA 3ZPJA 4EZLA 2IOLA 2IO2C 1N0QA 2VGXB 1TNOA 2IQCA 4TUUA 2UWJG 3PH0C 3DSTA 2EIME 3CVNA 3ABME 1KT1A 2HE0A 2AXZA 3ML8A 4N3CA 2CHZA 4F3VA 1HG2A 3V31A 5LCWC 4GTQA 1ELWA 1N54A 3IKOB 1TN8A 3D9PA 4EBAG 2HYZA 5FTPA 4WNDA 4U8VD 2WXMA 2QY7A 1EPUA 3DSUA 2P9KG 4BTAA 4NIKA 2JLBA 2L6BA 3EIQC 2LXMA 4N3AA 4DX1A 4I6GA 1H0AA 3CSTA 4HOQA 3NF1A 4YVQC 2MRIA 1N9AA 3G2UA 2JEKA 2X6JA 4CT0A 3VLFA 3MKQB 2XGSA 3S7JA 5LCWJ 3GW4A 3HDXA 3TXNA 2PQNA 5AQBA 4KZ0A 5H7PA 2L6JA 5T3RA 2XPIA 3CLJA 1LD8A 3PNLB 2XGMA 2VQ2A 3UI2A 1FVFA 1YA0A 5LFAA 3PNTB 3TXMA 1NI1A 5ITZF 1A17A 4TXRA 4A3TA 2LO6A 1H6KA 2RFAA 5CHEE 3MEKA 4R7LA 3X2QE 2KM4A 1OWOA 1JCSA 3JUEA 3PZ4A 3FTVA 4JA9A 3TWTA 4EBAA 3C72A 3FTSA 2WMOA 3DSWA 4JVSA 4AVXA 4ZHBA 1H2UA 5AJLA 3CIAA 2M63A 4I2WA 4RLYA 3PZDA 1DVPA 3ZUVB 1E8YA 3ASHA 3D9OA 3UT8A 4U95D 5ENPD 3DWLG 4P29A 3I3NA 3HG0D 5FZSA 5AYWD 3SD5A 5ENSD 4BSXA 4C9BB 4A1SA 3LVQE 3LXUX 3CKBA 3FP3A 2UY1A 4GCOA 2GRQB 5LOZA 3CK9A 3HVEA 2WM9A 5B1AE 5ANRA 2GW1A 4GPMA 4G24A 3N71A 1TNYA 3LY7A 2ONDA 5CECB 3TWRA 3GZ2A 4LEUA 4Q94A 3NOCD 3CKCA 5KBAA 1H19A 3C5RA 3SFXA 5J90A 1SZAA 1DCQA 1L5JA 5EDSA 3TWWA 3CVLA 5FIOA 2XEEA 2WXFA 3ONKA 1WY6A 2AXUA 2A5EA 3UKUG 3V79K 5CCMA 3V30A 1MX6A 4HRLA 3HHMA 2J9QA 5FJYA 5FWQA 3MV2B 2WXNA 4IULA 2IFUA 4GZ6A 3ABLE 1K3ZD 4EQFA 1DC2A 4WWPA 1DCEA 3S2AA 4U0SA 4DPRA 4J8FA 1AWCB 5CRVA 1NFIE 1YMPA 5AARA 3G2VA 2DWZA 3DPDA 2KC7A 4FJYA 3E37A 3TWQA 4O1PA 3FHEA 2ILRA 4G25A 2DYRE 3CK7A 4YNDA 4EHMA 3S7DA 3KS2A 4DX2A 2X6IA 1NA3A 3WXXA 5LX8A 3AU4A 2KCLA 5G05J 3EIJA 3FEYA 3VTYA 4FHKA 3ESKA 4FHJA 2WB2A 2J8SD 3TGOA 4J7WA 4LERA 1OWNA 2WXLA 3HXFA 4WNGA 4F6RD 4CCAA 2FEZA 1RW2A 4AEZC 3UIPC 4DX5D 2LXLA 2XCBA 1JWFA 1MQSA 2XS1A 3UT4A 3K9IA 4KXKB 1X5BA 3EHNA 1JPLA 2VTBB 2KCKA 4NURA 4N5CA 3PVLA 1ELRA 3U64A 3L54A 4HS2A 1UN9A 2IO3C 3VTXA 3CGHA 2EILE 1Z3XA 4F7AA 3FUMA 3C3OA 3FH8A 4HVBA 1V54E 2X3MA 4Q96A 4AP2A 2MHKA 5G2NA 1FCHA 4J6IA 1KZPA 2VJ8A 3FUEA 3QKYA 1JWGA 3QWPA 5G05C 3ZW3A 4M3OA 3EHQA 3TG4A 4WNEA 4XIFA 4F1PA 5CBOA 4MLPA 3QOUA 3AJIA 2KCVA 4GYWA 3TWVA 3DBSA 2ZXWE 2P9NG 4PDXA 4O6FA 4GU5A 4AOFA 2OVFA 2GROB 3VLDA 5G04C 2WQHA 2F0YA 4A63B 4LSZE 1TNZA 2AVPA 5ENOD 2Y4TA 1Z6TA 4HBDA 5BXUA 2I6HA 3DPYA 3LJNA 4I9EA 2RD0A 1NA0A 5BXOA 5EX0A 5EN5D 3CQGB 4U0ZA 4G2VA 4I1OB 3ZVVA 3ENEA 4RG9A 4GMJA 3CHQA 3RO3A 2BF0X 3TWXA 1GW6A 5BPPA 3FWVA 3E30A 2V4LA 2WXJA 5E76A 4DLOA 5CERB 2YHEA 4UQXA 4RQIA 3RRMB 3GZSA 4OYSA 1OXJA 3C3QA 3FUNA 3LY8A 3KD7A 2R5SA 3ASNE 3FU0A 1E8XA 4AJWA 4GMLA 3NBNB 2E2EA 4UQYA 1INZA 2OEVA 3UTMA 3FUIA 4JEHA 4UI9K 5BV1A 5KJKA 4K5BA 3SBSA 1HH8A 2WXOA 3B7UX 2YINA 4FLHA 4GCNA 1UJKA 4URKA 5G04J 1EDUA 3JQ0A 4LCTA 2QYUA 3EU9A 4G1TA 4U63A 2R2LA 5B3SE 1UW4B 3CK8A 2FI7A 4AY6A 3UM2A 5BV0A
chains in the Genus database with same CATH topology
4ME2A 2LAIA 3FUJA 3TXMA 2VSOE 2EQXA 3SF4A 1A17A 3GYZA 3CVXA 3TG5A 4CGWA 3CHOA 4UWHA 4CGVA 2AW6A 2Y4UA 4A3TA 4APOA 2CHXA 3HYMB 3JQ1A 2C0MA 1H6KA 2LO6A 2R59A 5CHEE 2CFZA 3MEKA 5T8IA 4CT4A 2XPZA 4R7LA 4F1SA 2KM4A 1OWOA 5AENA 3LJ3A 2V8SE 5FQ7A 2DCPA 2I1KA 3UUXA 1HFAA 3G2TA 1IYGA 3RIBA 3FTVA 4UWKA 4DI3A 1UG3A 2AXVA 3R7RA 3QB2A 4JA9A 1Z3YA 4EBAA 3FTSA 2WMOA 2PM7A 4KZCA 4JVSA 4AVXA 1H2UA 5AJLA 3CIAA 3ONLA 5A7DB 3T5XA 3MYVA 3CSFA 4AV7A 5ENNA 2VGXA 2M63A 3EDTB 4I2WA 3PZDA 2WXHA 2MOWA 1DVPA 3JYSA 1E8YA 3CEQA 2X6KA 4W9RA 3ASHA 2WPVA 3D9OA 3MKQA 3UT8A 4BT8A 2IU1A 3SFZA 2HM8A 1IQRA 4RG6A 4P29A 3I3NA 2XGOA 3CR3A 5FZSA 5AYWD 1KT0A 3SD5A 2C2LA 4U04A 4BSXA 4C9BB 4A1SA 1XGWA 3LVQE 3MV3B 3MKRA 3LXUX 3CKBA 3FP3A 2UY1A 3IBEA 4GCOA 5AJDA 3ZXSA 5LOZA 3FUFA 5CCLA 2PM6A 3CV0A 4XKBA 5AIJA 3CK9A 3P1UA 4L2YA 4WAFA 3HVEA 2WM9A 4C0MA 5J08A 1TEZA 5ANRA 2GW1A 4I6EA 5D0OD 4BWRA 5A6CA 4G24A 3D9JA 1BPOA 2Q7FA 3N71A 1E90A 4EZKA 3ASGA 4LUNU 3LY7A 3ZIMA 3ASDA 1HE8A 3QC1A 2ONDA 4U8HA 3T5VA 4TV3A 3GZ2A 4LEUA 2FF4A 4Q94A 3QAQA 3CKCA 2BTDA 1E96B 4XX5A 1E7UA 2PQRA 1H19A 5J90A 1SZAA 3Q4AB 3HIZA 5FQ8A 1L5JA 5ARFA 3AS5A 1IHGA 2DIWA 4G26A 5EDSA 2WMNA 3FH5A 3CVLA 3MCXA 5KJMA 5E75A 3RJVA 5KCMA 2LSUA 3FUHA 3TAXA 3I4RB 2WXFA 3NZSA 3BEEA 3ONKA 1WY6A 3FUKA 4A55A 2YHCA 4ANXA 2AXUA 3G2WA 4I17A 3OAWA 3TJPA 2ZU6B 3QDNA 2A5UA 2X6HA 1NZNA 4FULA 4H7XA 3RK6A 5BUZA 5CCMA 1DNPA 4XI0A 3R9AB 4ILIA 4H7YA 4J8EA 1U3DA 2J9QA 3HHMA 5FJYA 4JZYA 1PY1A 2CG2A 1HU3A 3APFA 4C0EA 3IEGA 5FWQA 1E8WA 2LSVA 3CVQA 3FTWA 4GYYA 4WWNA 4L1BA 4Y6CA 4N3BA 3MV2B 3LS8A 1HG5A 2WXNA 4IULA 4GPKA 2FBNA 2IFUA 1EYHA 4GZ6A 2GGFA 3BG1B 4JHRA 4K03A 4HXIA 2I9CA 3U9WA 4EQFA 4WWPA 3MJWA 3S2AA 4U0SA 1OWMA 4DPRA 4J8FA 3MZLB 4DI4A 5EKQD 3SHFA 3JCKC 3PEVB 5BNWA 3UT7A 1HXIA 3R7QA 3PREA 5BT1A 4XKCA 3APDA 3FFLA 4N2QA 1W3BA 3FTZA 4DK5A 3UPVA 3G2VA 3FY4A 3IHYA 3CVUA 2CG3A 3CQCB 5T4YA 4F53A 4FP7A 2E0IA 4TRQA 3DPDA 3QWVA 3CVYA 4UQZA 2KC7A 3QJZA 4FJYA 2YQ8A 3PE3A 2J4BA 4ACLA 3FHEA 5M72A 2CHWA 4XE0A 3PUKA 2YNQA 4JXTA 2IF4A 2Y3AA 1OUVA 4QFVA 2ILRA 4B0ZA 3IV0A 4G25A 4FC8A 4E85A 3CK7A 3B13A 3OXGA 4YNDA 5FZQA 1QZ2A 3U4TA 2I1JA 3FU5A 3S7DA 1KLXA 1QNFA 3KS2A 4OVUA 4JA7A 1NP7A 3FU3A 4GB9A 2KATA 2X6IA 1NA3A 3LPZA 3PS6A 3WXXA 5FQ6A 2VTBA 2BUGA 3T8MA 4WUYA 3AU5A 5LX8A 4XZ4A 3AU4A 2KCLA 1PC2A 5G05J 2XQ0A 3FU6A 5KJNA 4I9CA 3S7BA 3EIJA 3FEYA 5KJLA 3VTYA 3GZ1A 3PDNA 4FHKA 4I1MA 4XI9A 4CDMA 4GAAA 4KVMA 3ESKA 4KT6B 5EX3A 1Y8MA 4CRWA 4FHJA 4I43A 2WB2A 5ANLA 2VSYA 3TGOA 3CHMA 4LERA 3JUIA 1OWLA 1H2TC 1OWNA 2WXLA 5FZRA 4BY6A 3RU0A 2J08A 4JL0A 4WNGA 1S0PA 5JJ7A 1HO8A 2XPYA 4CCAA 3ZGQA 3FTYA 1E8ZA 2FEZA 3AS8A 4I6JA 1JUQA 3SZ7A 3EJNA 4PS3A 3ZHEB 4AEZC 1TJCA 3SBTB 2V5FA 2J07A 4AM9A 4JHJA 3FULA 4GZCA 1HX8A 2GRMA 3FEXA 4PS7A 3CHPA 5JJ6A 4GZ3A 2XCBA 1Y6IA 4FA6A 1JWFA 2PL2A 3FUDA 3U66A 1MQSA 3OTNA 2R17C 2XEVA 3ESLA 3K9IA 3UT4A 2RG8A 5DIZA 3IHVA 4KXKB 1ELKA 3PE4A 3LKUA 4B8AA 1X5BA 2QFCA 3EHNA 5A23A 2LAHA 4NRHB 3RO2A 1JPLA 3ASFA 4GA0A 2VTBB 2VSXE 3KAEA 2WXPA 2KCKA 1UN8A 1WM5A 4NURA 4N5CA 4HOUA 3PVLA 4CEMA 1ELRA 2WQ6A 3U64A 3L54A 4HS2A 4EECA 1B89A 3QWWA 1UN9A 4WNFA 2AWIA 4KVOA 4KMOA 3U3WA 3VTXA 4AY5A 4NQ0A 4MS6A 3LEWA 3RRUA 2XCCA 3CGHA 1HF8A 4GA1A 1Z3XA 5C2YA 4F7AA 3FUMA 3FH8A 1IQUA 4HVBA 4GZDA 3CHSA 5JHBA 1U3CA 2X3MA 3LYAA 4IYPA 1N52A 4FLBA 4V3IA 4Q96A 3QARA 4JHKA 4FJZA 2J4DA 4LRZA 2HR2A 4JEUA 3ZYQA 4AP2A 4BX8A 1H2VC 2MHKA 5G2NA 2OOEA 3ZEFA 1FCHA 3ZYMA 2J49A 2OV8A 4BT9A 4J6IA 1HZ4A 2VJ8A 3FUEA 3D9LA 3S7FA 3AS4A 4OVVA 3O4ZA 2IONA 3G2SA 3QKYA 4U0UA 2I2OA 3QK0A 2NSZA 3ZYKA 3Q15A 1JWGA 3QWPA 4JC8A 4JW1A 5G05C 4B94A 2CFUA 4YVOA 3BG0B 4D10C 3ZW3A 4M3OA 2KZTA 1P5QA 3EHMA 4I2ZA 3MGBA 4PS8A 3C98A 4HORA 3D9MA 4DJAA 5JHAA 2WXKA 4PH4B 3B7RL 4J8SA 3NZUA 4B89A 4APFA 2VYIA 2LNIA 3OXLA 3E4BA 4WNEA 2P58C 4XIFA 3TG4A 3L16A 4ILHB 3NQPA 2IJGX 2KZTB 1HS6A 3B7SA 2NC9A 3I5PA 4EPZA 5HQ8A 2J09A 2V0PA 1LF8A 3QOUA 4MLPA 2A4ZA 2KCVA 4GYWA 3D9KA 3DBSA 4N2SA 2XRYA 1PAQA 1WAO1 4PDXA 1ZU2A 5LP0A 4UWFA 1QQEA 4G23A 4O6FA 3UQ3A 3MA5A 4FADA 3LVRE 4GU5A 3D3MA 2X38A 4AOFA 2OVFA 4NACA 3O48A 4A3VA 4Q69A 2NXPA 4ANWA 4HOSA 3VLDA 4HFGA 5G04C 1UJJA 4J8DA 4A1GA 4ANUA 2WQHA 4BX9A 4EZJA 4GZ5A 2OVBA 3ZRHA 3PEUB 1FVHA 3SGHA 2AVPA 4ATGA 3D9IA 3CVVA 3ZPJA 2Y4TA 4EZLA 1Z6TA 4GA2A 2IOLA 5CMYA 4K0RA 3ZYLA 4E6HA 4G11A 3L6AA 2I6HA 4FU3A 2IOSA 2VGXB 3URZA 3B7TA 2IQCA 4IRUA 5G55A 4TUUA 3TL5A 4I9EA 2FULA 2UWJG 2RD0A 2WXIA 3QNKA 5C1DA 3PRZA 1NA0A 3PH0C 3UX4A 4MKTA 2XHEA 3CVNA 2WQ7A 4J0UA 5EX0A 1KT1A 4ABNA 4AXHA 3SI5A 2AXZA 3CQGB 2UY1B 5FT9A 4U0ZA 4G2VA 4BFRA 3L22A 3ML8A 4UWGA 4WWOA 4I1OB 2HO1A 4L2LA 1SZ9A 4N3CA 2CHZA 2L9BA 1XNFA 3ZVVA 4F3VA 1HG2A 3ENEA 2X6FA 4RG9A 2PZIA 3RRNB 4GMJA 5LCWC 3CHQA 4L7TA 1ELWA 1N54A 1GW6A 2BF0X 2WXQA 3FWVA 3IKOB 3RO3A 4CDNA 3L13A 5BPPA 4U07A 4I1AA 2V4LA 2WXJA 3D9PA 4EBAG 4UWLA 5E76A 1ZBPA 3UMVA 4DLOA 5D0QD 2YHEA 4ANVA 4UQXA 2HYZA 2VGYA 1TJFA 5FTPA 3RKVA 4WNDA 3RRMB 3GZSA 3I4GA 4OYSA 4KYOB 4HOTA 2WXMA 2QY7A 1EPUA 3LCAA 3FUNA 3ML9A 4KBQA 2L0IA 3LY8A 4IN3B 3KD7A 4RSYA 4UI9C 2R5SA 5DBKA 4BTAA 1E7VA 3SNXA 2JLBA 3FTXA 3EIQC 3KEZA 1VDYA 3OXFA 3APCA 5HI7A 2GRLA 3FU0A 4N3AA 1E8XA 2C0LA 3ULQA 4I6GA 3MX3A 1H0AA 3CSTA 4HOQA 5CMWA 4AJWA 4GMLA 4JPSA 2E2EA 3CVPA 4MRUA 3NF1A 4YVQC 4B8CB 2MRIA 2XRZA 4CDRA 4UQYA 3P2BA 3PUJA 1INZA 1MHQA 3G2UA 3FTUA 2JEKA 2X6JA 3LDZA 3Q49B 3FUIA 3CHRA 4JEHA 4UI9K 2WVIA 4CT0A 2WXGA 4GYOA 3VLFA 3MKQB 5BV1A 3D9NA 2XGSA 4DLQA 3S7JA 3SBSA 5KJKA 5LCWJ 2VSNA 1HH8A 2WXOA 3B7UX 2YINA 4UI9J 3CVWA 3FH7A 3LY9A 4FLHA 4GCNA 4RVBA 1UJKA 3GW4A 3HDXA 4BTBA 3TXNA 2PQNA 3ZFWA 2L0TB 3Q5MA 1EF1C 4PUCA 4URKA 3L17A 5G04J 1EDUA 4KZ0A 3JQ0A 5FQ4A 4LCTA 2L6JA 4Y6WA 4G1TA 2FO7A 3FDHA 5ARGA 5T3RA 3VLEA 2XPIA 4U63A 4HLEA 3L08A 3CLJA 3ZN3A 4AIFA 1UW4B 2WXRA 3CK8A 1OWPA 2FI7A 3PNLB 4ACKA 5JJTA 4AY6A 4ILGA 2DBAA 1SQMA 5BW8C 2XGMA 3ZHEA 2VQ2A 3HVEB 4L23A 5BV0A 1FVFA 1YA0A 3Q47B 4N39A 5LFAA 3PNTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L0I A;  3D9N A;  1JPL A;  1ELK A;  4FLB A;  4AVX A;  4Q96 A;  4NAC A;  2DIW A;  3ONL A;  3G2V A;  3D9M A;  3ZYQ A;  2BF0 X;  1UJK A;  5LOZ A;  1VDY A;  1HG5 A;  1JUQ A;  1INZ A;  2L0T B;  4HFG A;  1EYH A;  1UJJ A;  3D9P A;  3ZYM A;  1EDU A;  5J08 A;  2LO6 A;  1H0A A;  2MOW A;  4GZC A;  1HX8 A;  1DVP A;  5CMW A;  3ONK A;  3D9L A;  3D9J A;  2KM4 A;  3G2W A;  3CLJ A;  3D9O A;  3RRU A;  1JWF A;  2V8S E;  2DCP A;  1MHQ A;  3G2S A;  1LF8 A;  3G2U A;  1HFA A;  3G2T A;  4JXT A;  1HF8 A;  3D9I A;  3LDZ A;  3ZYK A;  1JWG A;  1SZ9 A;  3D9K A;  4Q94 A;  5CMY A;  4GZD A;  3ZYL A;  1PY1 A;  4FU3 A;  5LP0 A;  1HG2 A;  2QY7 A;  1SZA A;  1XGW A;  1X5B A; 
#chains in the Genus database with same CATH topology
 2R02 A;  2VSO E;  3E33 A;  3Q7F A;  1TYQ G;  3TG5 A;  3CHO A;  4UWH A;  4CGV A;  2AW6 A;  2CHX A;  3JQ1 A;  2C0M A;  4CT4 A;  3AG2 E;  3PZ1 A;  3V2O A;  2RKK A;  3W9F A;  3LJ3 A;  2DCP A;  2I1K A;  4UWK A;  4DI3 A;  3JXJ A;  4BSZ B;  3R7R A;  3ISM C;  1Z3Y A;  2PM7 A;  4KZC A;  3ONL A;  4XEI G;  2XZT G;  4AV7 A;  1QYM A;  2H6F A;  3CEQ A;  2IU1 A;  3SFZ A;  4GTT A;  5AQ7 A;  1IQR A;  2XGO A;  4HI8 A;  1KT0 A;  1XGW A;  3DEO A;  5AJD A;  2R03 A;  3ZXS A;  5EYL A;  3FUF A;  3ABK E;  3P1U A;  3SQV A;  1TEZ A;  5D0O D;  4BWR A;  3D9J A;  4EZK A;  1TNB A;  3ZIM A;  2GRP B;  1HE8 A;  3QC1 A;  3ZKJ A;  1D8D A;  1KZO A;  2BTD A;  4BET A;  1N4Q A;  1S64 A;  3D9H A;  2B6C A;  5KJM A;  5E75 A;  3RJV A;  1YYH A;  3PZ3 A;  1OCR E;  3TAX A;  2IY0 C;  1LD7 A;  2YHC A;  4ANX A;  5CED B;  1DNP A;  3R9A B;  1WDY A;  2CG2 A;  1HU3 A;  4C0E A;  3IEG A;  2LSV A;  3J5P A;  3FTW A;  4WWN A;  3AG4 E;  3AG1 E;  2XEN A;  5HKP A;  3KSQ A;  4GPK A;  3DEP A;  1EYH A;  4K03 A;  4JHR A;  2DVW A;  3EU5 A;  1OWM A;  4LNU D;  3SHF A;  4Z68 A;  3PEV B;  3WG7 E;  5BNW A;  1Q2Z A;  1RZ4 A;  4GTO A;  1HXI A;  3PRE A;  2EIK E;  3FFL A;  2CG3 A;  5T4Y A;  4FP7 A;  2E0I A;  4TRQ A;  3QWV A;  3CVY A;  3UM3 A;  2J4B A;  5M72 A;  4TXP A;  2VGE A;  1O5M A;  3PUK A;  3DXK G;  4JXT A;  2Y3A A;  1OUV A;  4BES A;  1KLX A;  3DRA A;  1NP7 A;  4GB9 A;  3PS6 A;  1O1T A;  5FQ6 A;  2VTB A;  4WUY A;  4OAV B;  2ZIS A;  3FU6 A;  5KJL A;  1SA5 A;  4XI9 A;  4I1M A;  2PNN A;  4GAA A;  5EX3 A;  4CRW A;  5ANL A;  2VSY A;  1OWL A;  1S0P A;  1HO8 A;  3FTY A;  1E8Z A;  4O60 A;  3AS8 A;  3EJN A;  3ZHE B;  4C48 B;  4GZC A;  3FEX A;  5CRU A;  4FA6 A;  3FUD A;  2Y69 E;  1ELK A;  3PE4 A;  5A23 A;  1QBQ A;  2VSX E;  1UN8 A;  2WQ6 A;  1BD8 A;  4K5C A;  4HRN A;  4AY5 A;  5EIL A;  3LEW A;  3RRU A;  2XCC A;  1HF8 A;  4GA1 A;  2P9I G;  5EID A;  3CHS A;  5JHB A;  4IYP A;  3QAR A;  4JHK A;  2J4D A;  2HR2 A;  4JEU A;  3ZYQ A;  1H2V C;  2P9U G;  2OOE A;  3ZXP A;  3HRA A;  2OV8 A;  3DSS A;  1HZ4 A;  1YCS B;  1MYO A;  1SA4 A;  3G2S A;  3TWU A;  3Q15 A;  3E32 A;  1BLX B;  4YVO A;  3BG0 B;  4D10 C;  2KZT A;  3EUV A;  3C98 A;  4HOR A;  2WXK A;  4APF A;  2VYI A;  2P58 C;  4ILH B;  2KZT B;  1HS6 A;  2F8X K;  4EPZ A;  5HQ8 A;  2V0P A;  3D9K A;  1WAO 1;  1JCQ A;  1ZU2 A;  4UWF A;  5LP0 A;  4G23 A;  2X38 A;  4GTR A;  1SW6 A;  1OT8 A;  4A1G A;  1UJJ A;  3T8K A;  3ZRH A;  5ENQ D;  3SGH A;  5IY5 E;  1WG0 A;  4ATG A;  4GA2 A;  3ZYL A;  3L6A A;  2KXP C;  3TL5 A;  3SO8 A;  5C1D A;  2WXI A;  4U8Y D;  5EYP F;  3PRZ A;  3UX4 A;  4MKT A;  4L9P A;  2WQ7 A;  1IXV A;  4J0U A;  4AXH A;  3SI5 A;  2UY1 B;  5FT9 A;  4G8L A;  5AQ9 A;  4B93 B;  4L2L A;  2L9B A;  3ULE G;  4U96 D;  2PZI A;  3RRN B;  1MZC A;  2WXQ A;  2BKG A;  4CDN A;  3L13 A;  4DX6 D;  4U07 A;  1OY3 D;  1ZBP A;  5D0Q D;  4GTP A;  4J8Y A;  4ANV A;  1Z5S C;  2VGY A;  3RKV A;  1K1A A;  4KYO B;  1U2V G;  2L0I A;  4UI9 C;  2ETB A;  1NL4 A;  3KEZ A;  1VDY A;  3OXF A;  2GRL A;  2C0L A;  3ULQ A;  3UIO C;  3CVP A;  4MRU A;  2F37 A;  4B8C B;  1MHQ A;  3FTU A;  3CHR A;  2WVI A;  4DRX E;  3B95 A;  4GYO A;  2ETA A;  4UI9 J;  3CVW A;  3FH7 A;  3LY9 A;  3KEA A;  4BTB A;  4LNB A;  2L0T B;  3Q5M A;  1EF1 C;  4PUC A;  3L17 A;  2FO7 A;  3FDH A;  3VLE A;  3L08 A;  4AIF A;  2DZN A;  5JJT A;  3C3R A;  2WXR A;  1OWP A;  4ILG A;  2DBA A;  3ASO E;  5BW8 C;  3ZHE A;  4BEP A;  3HVE B;  4N39 A;  3Q47 B;  4HNA D;  2EQX A;  3SF4 A;  2H6I A;  5FIN A;  2CFZ A;  5HRY A;  5T8I A;  2XPZ A;  3KSL A;  4F1S A;  3PZ2 A;  3G2T A;  1UG3 A;  2AXV A;  4M7C A;  3BU8 A;  1AP7 A;  3UXG A;  5A7D B;  3NAW A;  3EDT B;  2MOW A;  4W9R A;  2HM8 A;  2QC9 A;  2OEW A;  3MV3 B;  3MKR A;  1N4P A;  3Q7A A;  5ENR D;  5KNH D;  5AAO A;  3IBE A;  2R05 A;  1SVX A;  2F8Y A;  5CCL A;  2PM6 A;  1FT2 A;  5AIJ A;  4L2Y A;  4WAF A;  3R9M A;  4ATZ D;  3Q79 A;  2P9S G;  1KPS B;  5A6C A;  1BPO A;  2Q7F A;  1E90 A;  4LUN U;  4HB5 A;  2EIJ E;  4U8H A;  1H6O A;  4TV3 A;  3QAQ A;  1E96 B;  1E7U A;  3HIZ A;  5FQ8 A;  5ARF A;  5B1B E;  1IHG A;  3ULY A;  2WMN A;  2AJA A;  3FH5 A;  3MCX A;  5KCM A;  3FUH A;  3NZS A;  3BEE A;  4I17 A;  2BED A;  2ZU6 B;  2X6H A;  4H7X A;  3RK6 A;  5BUZ A;  2XZD G;  4ILI A;  4H7Y A;  4J8E A;  1K1B A;  1JCR A;  1E8W A;  4GYY A;  4L1B A;  4Y6C A;  5HS0 A;  3LS8 A;  1HG5 A;  4X8Q A;  2FBN A;  2ZGG A;  4HXI A;  2I9C A;  3U9W A;  3W9G A;  4MBG A;  3MZL B;  3IXE A;  3UT7 A;  1K8K G;  5BT1 A;  4XKC A;  5D66 A;  1MX2 A;  4N2Q A;  1W3B A;  3FTZ A;  4DK5 A;  3UPV A;  3FY4 A;  3CVU A;  3CQC B;  1ZB1 A;  4UQZ A;  3QJZ A;  4YDY A;  2YQ8 A;  2YNQ A;  4QFV A;  3Q9U C;  3OXG A;  5FZQ A;  3U4T A;  1QZ2 A;  3FU5 A;  3HXC A;  4JA7 A;  2KAT A;  2BUG A;  3T8M A;  1TN7 A;  3AU5 A;  2P9P G;  2XQ0 A;  4I9C A;  3S7B A;  2H6H A;  3SY2 A;  2RFM A;  4YDE A;  1Y8M A;  1N11 A;  3JUI A;  4U7E B;  3F6Q A;  5FZR A;  5JJ7 A;  2ETC A;  4I6J A;  1JUQ A;  3SZ7 A;  2V5F A;  4AM9 A;  3FUL A;  2GRM A;  4PS7 A;  5JJ6 A;  4DUI A;  3ESL A;  2RG8 A;  2DYS E;  3IHV A;  3LKU A;  3RO2 A;  3ASF A;  4GA0 A;  3KAE A;  2WXP A;  4CEM A;  1B89 A;  1N95 A;  4WNF A;  3U3W A;  2BKK B;  4NQ0 A;  4MS6 A;  1IKN D;  2XEH A;  1IQU A;  4N5Q A;  1U3C A;  1OCO E;  4FJZ A;  4LRZ A;  1D8E A;  1N94 A;  2V4H C;  4BT9 A;  1G3N B;  1O1S A;  3S7F A;  2Y0B G;  3NB2 A;  3AS4 A;  3O4Z A;  4U0U A;  2I2O A;  3QK0 A;  2NSZ A;  3ZYK A;  4JC8 A;  4B94 A;  2CFU A;  4HLL A;  1MX4 A;  1P5Q A;  3Q73 A;  3MGB A;  2MYO A;  4DJA A;  3JXI A;  2LUH A;  5JHA A;  4PH4 B;  3B7R L;  4B89 A;  3OXL A;  3L16 A;  3NQP A;  2NC9 A;  3I5P A;  2A4Z A;  4N2S A;  2XRY A;  2ZGD A;  1QQE A;  3LVR E;  4A3V A;  4Q69 A;  4EZJ A;  4HFG A;  4J8D A;  2OVB A;  4TUM A;  3CVV A;  1V55 E;  5CMY A;  4K0R A;  4E6H A;  4G11 A;  4FU3 A;  2IOS A;  3URZ A;  3B7T A;  1TR4 A;  4IRU A;  5G55 A;  2FUL A;  3QNK A;  2XHE A;  2GRN B;  4ABN A;  3SFY A;  1N4R A;  1BI8 B;  5AN8 A;  4BFR A;  3L22 A;  4UWG A;  4WWO A;  2HO1 A;  1SZ9 A;  5AQA A;  2EIN E;  1XNF A;  3Q75 A;  2X6F A;  1H6P A;  5JA4 D;  4L7T A;  3HXD A;  4I1A A;  2ZIR A;  4UWL A;  3UMV A;  1TJF A;  3I4G A;  4HOT A;  5D2M C;  4OAU C;  3LCA A;  4RSY A;  3ML9 A;  4KBQ A;  4IN3 B;  4DLQ A;  5DBK A;  1E7V A;  1FT1 A;  3SNX A;  3FTX A;  5HI7 A;  3APC A;  2DZO A;  3MX3 A;  5CMW A;  4JPS A;  2XRZ A;  4CDR A;  3P2B A;  3PUJ A;  2FO1 E;  3LDZ A;  3Q49 B;  1BI7 B;  2WXG A;  2B0O E;  2QZA A;  5ENT D;  3D9N A;  2VSN A;  4RVB A;  3ZFW A;  2KBX A;  5FQ4 A;  4Y6W A;  5ARG A;  4HLE A;  3ZN3 A;  4ACK A;  1SQM A;  4JB8 P;  4LNG A;  4L23 A;  3NOG D;  4ME2 A;  2LAI A;  3FUJ A;  3GYZ A;  3CVX A;  4CGW A;  2Y4U A;  4APO A;  1UOH A;  1OCZ E;  3HYM B;  2R59 A;  5AEN A;  2V8S E;  5FQ7 A;  3UUX A;  1HFA A;  1IYG A;  3RIB A;  2XS8 A;  3QB2 A;  4HQD A;  1MJ0 A;  3T5X A;  3MYV A;  3CSF A;  5ENN A;  2VGX A;  4ZFH A;  2WXH A;  3J5Q B;  3JYS A;  2V5Q C;  2X6K A;  2WPV A;  3MKQ A;  4BT8 A;  4RG6 A;  1TN6 A;  3CR3 A;  3Q78 A;  2JAB A;  2C2L A;  4U04 A;  3CV0 A;  4XKB A;  4C0M A;  3Q9N C;  5J08 A;  4I6E A;  3ZNG A;  4GTV A;  3ASG A;  5CEA A;  3ASD A;  3T5V A;  2FF4 A;  4XX5 A;  2PQR A;  5KWD A;  2P9L G;  3Q4A B;  4K5A B;  5KNG A;  3AS5 A;  2DIW A;  4G26 A;  2Y1L E;  1LTX A;  2LSU A;  3I4R B;  3FUK A;  4A55 A;  3G2W A;  3OAW A;  3TJP A;  3QDN A;  2A5U A;  1D9S A;  1NZN A;  4FUL A;  4XI0 A;  1U3D A;  3HXE A;  1PY1 A;  4JZY A;  3APF A;  2IEJ A;  3CVQ A;  4N3B A;  2P2C P;  3ZU7 B;  2GGF A;  3BG1 B;  3MJW A;  3AAA C;  3DSV A;  4DI4 A;  5EKQ D;  3JCK C;  3EHR A;  3R7Q A;  4GTS A;  3APD A;  3E34 A;  3B7B A;  3IHY A;  4F53 A;  5JMN D;  4LG6 A;  4CYM D;  3UM1 A;  4BER A;  3PE3 A;  4ACL A;  2CHW A;  3BQO A;  4XE0 A;  2IF4 A;  4HI9 A;  4B0Z A;  3IV0 A;  4FC8 A;  4E85 A;  3B13 A;  4HRM B;  2I1J A;  4UUC A;  1QNF A;  4OVU A;  3FU3 A;  3LPZ A;  3UM0 A;  4XZ4 A;  1PC2 A;  5KJN A;  3GZ1 A;  3PDN A;  4CDM A;  4KVM A;  4KT6 B;  3T9K A;  1N4S A;  4I43 A;  3CHM A;  1H2T C;  3DXM G;  4BY6 A;  3RU0 A;  2J08 A;  5CBN A;  4JL0 A;  3L9T A;  3L82 A;  2XPY A;  3ZGQ A;  1S70 B;  2H6G A;  1OCC E;  4PS3 A;  3DSX A;  1TJC A;  3SBT B;  2J07 A;  4JHJ A;  1HX8 A;  2NYJ A;  3CHP A;  4GTM A;  4O1O A;  4GZ3 A;  1Y6I A;  2PL2 A;  3U66 A;  5EIB E;  3OTN A;  2R17 C;  2XEV A;  5DIZ A;  2QYJ A;  3V2X A;  4B8A A;  2QFC A;  2LAH A;  4NRH B;  3BUA A;  1WM5 A;  4HOU A;  1A5E A;  4CZ2 D;  1BU9 A;  4EEC A;  3QWW A;  2AWI A;  4KVO A;  3RSE G;  4KMO A;  3TWS A;  3HXB A;  2GRR B;  3RAU A;  4QQI A;  4G8K A;  5C2Y A;  4YDW A;  4GZD A;  4YDO A;  3LYA A;  1N52 A;  4FLB A;  4V3I A;  1O1R A;  4BX8 A;  3UIN C;  1S63 A;  3ZEF A;  3ZYM A;  2J49 A;  3D9L A;  4JD2 G;  4OVV A;  3UKR G;  2ION A;  4JW1 A;  4DX7 D;  3EHM A;  4I2Z A;  4PS8 A;  3D9M A;  1N0R A;  1TNU A;  2OCC E;  4J8S A;  3NZU A;  2LNI A;  3E4B A;  2IJG X;  4TXQ A;  3B7S A;  2J09 A;  1LF8 A;  1X81 A;  1PAQ A;  3UQ3 A;  3MA5 A;  4FAD A;  1IHB A;  3D3M A;  4NAC A;  3O48 A;  2NXP A;  4ANW A;  4HOS A;  3AG3 E;  4ANU A;  4BX9 A;  4GMR A;  4GZ5 A;  3PEU B;  1FVH A;  1FPP A;  3D9I A;  3ZPJ A;  4EZL A;  2IOL A;  2IO2 C;  1N0Q A;  2VGX B;  1TNO A;  2IQC A;  4TUU A;  2UWJ G;  3PH0 C;  3DST A;  2EIM E;  3CVN A;  3ABM E;  1KT1 A;  2HE0 A;  2AXZ A;  3ML8 A;  4N3C A;  2CHZ A;  4F3V A;  1HG2 A;  3V31 A;  5LCW C;  4GTQ A;  1ELW A;  1N54 A;  3IKO B;  1TN8 A;  3D9P A;  4EBA G;  2HYZ A;  5FTP A;  4WND A;  4U8V D;  2WXM A;  2QY7 A;  1EPU A;  3DSU A;  2P9K G;  4BTA A;  4NIK A;  2JLB A;  2L6B A;  3EIQ C;  2LXM A;  4N3A A;  4DX1 A;  4I6G A;  1H0A A;  3CST A;  4HOQ A;  3NF1 A;  4YVQ C;  2MRI A;  1N9A A;  3G2U A;  2JEK A;  2X6J A;  4CT0 A;  3VLF A;  3MKQ B;  2XGS A;  3S7J A;  5LCW J;  3GW4 A;  3HDX A;  3TXN A;  2PQN A;  5AQB A;  4KZ0 A;  5H7P A;  2L6J A;  5T3R A;  2XPI A;  3CLJ A;  1LD8 A;  3PNL B;  2XGM A;  2VQ2 A;  3UI2 A;  1FVF A;  1YA0 A;  5LFA A;  3PNT B;  3TXM A;  1NI1 A;  5ITZ F;  1A17 A;  4TXR A;  4A3T A;  2LO6 A;  1H6K A;  2RFA A;  5CHE E;  3MEK A;  4R7L A;  3X2Q E;  2KM4 A;  1OWO A;  1JCS A;  3JUE A;  3PZ4 A;  3FTV A;  4JA9 A;  3TWT A;  4EBA A;  3C72 A;  3FTS A;  2WMO A;  3DSW A;  4JVS A;  4AVX A;  4ZHB A;  1H2U A;  5AJL A;  3CIA A;  2M63 A;  4I2W A;  4RLY A;  3PZD A;  1DVP A;  3ZUV B;  1E8Y A;  3ASH A;  3D9O A;  3UT8 A;  4U95 D;  5ENP D;  3DWL G;  4P29 A;  3I3N A;  3HG0 D;  5FZS A;  5AYW D;  3SD5 A;  5ENS D;  4BSX A;  4C9B B;  4A1S A;  3LVQ E;  3LXU X;  3CKB A;  3FP3 A;  2UY1 A;  4GCO A;  2GRQ B;  5LOZ A;  3CK9 A;  3HVE A;  2WM9 A;  5B1A E;  5ANR A;  2GW1 A;  4GPM A;  4G24 A;  3N71 A;  1TNY A;  3LY7 A;  2OND A;  5CEC B;  3TWR A;  3GZ2 A;  4LEU A;  4Q94 A;  3NOC D;  3CKC A;  5KBA A;  1H19 A;  3C5R A;  3SFX A;  5J90 A;  1SZA A;  1DCQ A;  1L5J A;  5EDS A;  3TWW A;  3CVL A;  5FIO A;  2XEE A;  2WXF A;  3ONK A;  1WY6 A;  2AXU A;  2A5E A;  3UKU G;  3V79 K;  5CCM A;  3V30 A;  1MX6 A;  4HRL A;  3HHM A;  2J9Q A;  5FJY A;  5FWQ A;  3MV2 B;  2WXN A;  4IUL A;  2IFU A;  4GZ6 A;  3ABL E;  1K3Z D;  4EQF A;  1DC2 A;  4WWP A;  1DCE A;  3S2A A;  4U0S A;  4DPR A;  4J8F A;  1AWC B;  5CRV A;  1NFI E;  1YMP A;  5AAR A;  3G2V A;  2DWZ A;  3DPD A;  2KC7 A;  4FJY A;  3E37 A;  3TWQ A;  4O1P A;  3FHE A;  2ILR A;  4G25 A;  2DYR E;  3CK7 A;  4YND A;  4EHM A;  3S7D A;  3KS2 A;  4DX2 A;  2X6I A;  1NA3 A;  3WXX A;  5LX8 A;  3AU4 A;  2KCL A;  5G05 J;  3EIJ A;  3FEY A;  3VTY A;  4FHK A;  3ESK A;  4FHJ A;  2WB2 A;  2J8S D;  3TGO A;  4J7W A;  4LER A;  1OWN A;  2WXL A;  3HXF A;  4WNG A;  4F6R D;  4CCA A;  2FEZ A;  1RW2 A;  4AEZ C;  3UIP C;  4DX5 D;  2LXL A;  2XCB A;  1JWF A;  1MQS A;  2XS1 A;  3UT4 A;  3K9I A;  4KXK B;  1X5B A;  3EHN A;  1JPL A;  2VTB B;  2KCK A;  4NUR A;  4N5C A;  3PVL A;  1ELR A;  3U64 A;  3L54 A;  4HS2 A;  1UN9 A;  2IO3 C;  3VTX A;  3CGH A;  2EIL E;  1Z3X A;  4F7A A;  3FUM A;  3C3O A;  3FH8 A;  4HVB A;  1V54 E;  2X3M A;  4Q96 A;  4AP2 A;  2MHK A;  5G2N A;  1FCH A;  4J6I A;  1KZP A;  2VJ8 A;  3FUE A;  3QKY A;  1JWG A;  3QWP A;  5G05 C;  3ZW3 A;  4M3O A;  3EHQ A;  3TG4 A;  4WNE A;  4XIF A;  4F1P A;  5CBO A;  4MLP A;  3QOU A;  3AJI A;  2KCV A;  4GYW A;  3TWV A;  3DBS A;  2ZXW E;  2P9N G;  4PDX A;  4O6F A;  4GU5 A;  4AOF A;  2OVF A;  2GRO B;  3VLD A;  5G04 C;  2WQH A;  2F0Y A;  4A63 B;  4LSZ E;  1TNZ A;  2AVP A;  5ENO D;  2Y4T A;  1Z6T A;  4HBD A;  5BXU A;  2I6H A;  3DPY A;  3LJN A;  4I9E A;  2RD0 A;  1NA0 A;  5BXO A;  5EX0 A;  5EN5 D;  3CQG B;  4U0Z A;  4G2V A;  4I1O B;  3ZVV A;  3ENE A;  4RG9 A;  4GMJ A;  3CHQ A;  3RO3 A;  2BF0 X;  3TWX A;  1GW6 A;  5BPP A;  3FWV A;  3E30 A;  2V4L A;  2WXJ A;  5E76 A;  4DLO A;  5CER B;  2YHE A;  4UQX A;  4RQI A;  3RRM B;  3GZS A;  4OYS A;  1OXJ A;  3C3Q A;  3FUN A;  3LY8 A;  3KD7 A;  2R5S A;  3ASN E;  3FU0 A;  1E8X A;  4AJW A;  4GML A;  3NBN B;  2E2E A;  4UQY A;  1INZ A;  2OEV A;  3UTM A;  3FUI A;  4JEH A;  4UI9 K;  5BV1 A;  5KJK A;  4K5B A;  3SBS A;  1HH8 A;  2WXO A;  3B7U X;  2YIN A;  4FLH A;  4GCN A;  1UJK A;  4URK A;  5G04 J;  1EDU A;  3JQ0 A;  4LCT A;  2QYU A;  3EU9 A;  4G1T A;  4U63 A;  2R2L A;  5B3S E;  1UW4 B;  3CK8 A;  2FI7 A;  4AY6 A;  3UM2 A;  5BV0 A; 
#chains in the Genus database with same CATH homology
 4ME2 A;  2LAI A;  3FUJ A;  3TXM A;  2VSO E;  2EQX A;  3SF4 A;  1A17 A;  3GYZ A;  3CVX A;  3TG5 A;  4CGW A;  3CHO A;  4UWH A;  4CGV A;  2AW6 A;  2Y4U A;  4A3T A;  4APO A;  2CHX A;  3HYM B;  3JQ1 A;  2C0M A;  1H6K A;  2LO6 A;  2R59 A;  5CHE E;  2CFZ A;  3MEK A;  5T8I A;  4CT4 A;  2XPZ A;  4R7L A;  4F1S A;  2KM4 A;  1OWO A;  5AEN A;  3LJ3 A;  2V8S E;  5FQ7 A;  2DCP A;  2I1K A;  3UUX A;  1HFA A;  3G2T A;  1IYG A;  3RIB A;  3FTV A;  4UWK A;  4DI3 A;  1UG3 A;  2AXV A;  3R7R A;  3QB2 A;  4JA9 A;  1Z3Y A;  4EBA A;  3FTS A;  2WMO A;  2PM7 A;  4KZC A;  4JVS A;  4AVX A;  1H2U A;  5AJL A;  3CIA A;  3ONL A;  5A7D B;  3T5X A;  3MYV A;  3CSF A;  4AV7 A;  5ENN A;  2VGX A;  2M63 A;  3EDT B;  4I2W A;  3PZD A;  2WXH A;  2MOW A;  1DVP A;  3JYS A;  1E8Y A;  3CEQ A;  2X6K A;  4W9R A;  3ASH A;  2WPV A;  3D9O A;  3MKQ A;  3UT8 A;  4BT8 A;  2IU1 A;  3SFZ A;  2HM8 A;  1IQR A;  4RG6 A;  4P29 A;  3I3N A;  2XGO A;  3CR3 A;  5FZS A;  5AYW D;  1KT0 A;  3SD5 A;  2C2L A;  4U04 A;  4BSX A;  4C9B B;  4A1S A;  1XGW A;  3LVQ E;  3MV3 B;  3MKR A;  3LXU X;  3CKB A;  3FP3 A;  2UY1 A;  3IBE A;  4GCO A;  5AJD A;  3ZXS A;  5LOZ A;  3FUF A;  5CCL A;  2PM6 A;  3CV0 A;  4XKB A;  5AIJ A;  3CK9 A;  3P1U A;  4L2Y A;  4WAF A;  3HVE A;  2WM9 A;  4C0M A;  5J08 A;  1TEZ A;  5ANR A;  2GW1 A;  4I6E A;  5D0O D;  4BWR A;  5A6C A;  4G24 A;  3D9J A;  1BPO A;  2Q7F A;  3N71 A;  1E90 A;  4EZK A;  3ASG A;  4LUN U;  3LY7 A;  3ZIM A;  3ASD A;  1HE8 A;  3QC1 A;  2OND A;  4U8H A;  3T5V A;  4TV3 A;  3GZ2 A;  4LEU A;  2FF4 A;  4Q94 A;  3QAQ A;  3CKC A;  2BTD A;  1E96 B;  4XX5 A;  1E7U A;  2PQR A;  1H19 A;  5J90 A;  1SZA A;  3Q4A B;  3HIZ A;  5FQ8 A;  1L5J A;  5ARF A;  3AS5 A;  1IHG A;  2DIW A;  4G26 A;  5EDS A;  2WMN A;  3FH5 A;  3CVL A;  3MCX A;  5KJM A;  5E75 A;  3RJV A;  5KCM A;  2LSU A;  3FUH A;  3TAX A;  3I4R B;  2WXF A;  3NZS A;  3BEE A;  3ONK A;  1WY6 A;  3FUK A;  4A55 A;  2YHC A;  4ANX A;  2AXU A;  3G2W A;  4I17 A;  3OAW A;  3TJP A;  2ZU6 B;  3QDN A;  2A5U A;  2X6H A;  1NZN A;  4FUL A;  4H7X A;  3RK6 A;  5BUZ A;  5CCM A;  1DNP A;  4XI0 A;  3R9A B;  4ILI A;  4H7Y A;  4J8E A;  1U3D A;  2J9Q A;  3HHM A;  5FJY A;  4JZY A;  1PY1 A;  2CG2 A;  1HU3 A;  3APF A;  4C0E A;  3IEG A;  5FWQ A;  1E8W A;  2LSV A;  3CVQ A;  3FTW A;  4GYY A;  4WWN A;  4L1B A;  4Y6C A;  4N3B A;  3MV2 B;  3LS8 A;  1HG5 A;  2WXN A;  4IUL A;  4GPK A;  2FBN A;  2IFU A;  1EYH A;  4GZ6 A;  2GGF A;  3BG1 B;  4JHR A;  4K03 A;  4HXI A;  2I9C A;  3U9W A;  4EQF A;  4WWP A;  3MJW A;  3S2A A;  4U0S A;  1OWM A;  4DPR A;  4J8F A;  3MZL B;  4DI4 A;  5EKQ D;  3SHF A;  3JCK C;  3PEV B;  5BNW A;  3UT7 A;  1HXI A;  3R7Q A;  3PRE A;  5BT1 A;  4XKC A;  3APD A;  3FFL A;  4N2Q A;  1W3B A;  3FTZ A;  4DK5 A;  3UPV A;  3G2V A;  3FY4 A;  3IHY A;  3CVU A;  2CG3 A;  3CQC B;  5T4Y A;  4F53 A;  4FP7 A;  2E0I A;  4TRQ A;  3DPD A;  3QWV A;  3CVY A;  4UQZ A;  2KC7 A;  3QJZ A;  4FJY A;  2YQ8 A;  3PE3 A;  2J4B A;  4ACL A;  3FHE A;  5M72 A;  2CHW A;  4XE0 A;  3PUK A;  2YNQ A;  4JXT A;  2IF4 A;  2Y3A A;  1OUV A;  4QFV A;  2ILR A;  4B0Z A;  3IV0 A;  4G25 A;  4FC8 A;  4E85 A;  3CK7 A;  3B13 A;  3OXG A;  4YND A;  5FZQ A;  1QZ2 A;  3U4T A;  2I1J A;  3FU5 A;  3S7D A;  1KLX A;  1QNF A;  3KS2 A;  4OVU A;  4JA7 A;  1NP7 A;  3FU3 A;  4GB9 A;  2KAT A;  2X6I A;  1NA3 A;  3LPZ A;  3PS6 A;  3WXX A;  5FQ6 A;  2VTB A;  2BUG A;  3T8M A;  4WUY A;  3AU5 A;  5LX8 A;  4XZ4 A;  3AU4 A;  2KCL A;  1PC2 A;  5G05 J;  2XQ0 A;  3FU6 A;  5KJN A;  4I9C A;  3S7B A;  3EIJ A;  3FEY A;  5KJL A;  3VTY A;  3GZ1 A;  3PDN A;  4FHK A;  4I1M A;  4XI9 A;  4CDM A;  4GAA A;  4KVM A;  3ESK A;  4KT6 B;  5EX3 A;  1Y8M A;  4CRW A;  4FHJ A;  4I43 A;  2WB2 A;  5ANL A;  2VSY A;  3TGO A;  3CHM A;  4LER A;  3JUI A;  1OWL A;  1H2T C;  1OWN A;  2WXL A;  5FZR A;  4BY6 A;  3RU0 A;  2J08 A;  4JL0 A;  4WNG A;  1S0P A;  5JJ7 A;  1HO8 A;  2XPY A;  4CCA A;  3ZGQ A;  3FTY A;  1E8Z A;  2FEZ A;  3AS8 A;  4I6J A;  1JUQ A;  3SZ7 A;  3EJN A;  4PS3 A;  3ZHE B;  4AEZ C;  1TJC A;  3SBT B;  2V5F A;  2J07 A;  4AM9 A;  4JHJ A;  3FUL A;  4GZC A;  1HX8 A;  2GRM A;  3FEX A;  4PS7 A;  3CHP A;  5JJ6 A;  4GZ3 A;  2XCB A;  1Y6I A;  4FA6 A;  1JWF A;  2PL2 A;  3FUD A;  3U66 A;  1MQS A;  3OTN A;  2R17 C;  2XEV A;  3ESL A;  3K9I A;  3UT4 A;  2RG8 A;  5DIZ A;  3IHV A;  4KXK B;  1ELK A;  3PE4 A;  3LKU A;  4B8A A;  1X5B A;  2QFC A;  3EHN A;  5A23 A;  2LAH A;  4NRH B;  3RO2 A;  1JPL A;  3ASF A;  4GA0 A;  2VTB B;  2VSX E;  3KAE A;  2WXP A;  2KCK A;  1UN8 A;  1WM5 A;  4NUR A;  4N5C A;  4HOU A;  3PVL A;  4CEM A;  1ELR A;  2WQ6 A;  3U64 A;  3L54 A;  4HS2 A;  4EEC A;  1B89 A;  3QWW A;  1UN9 A;  4WNF A;  2AWI A;  4KVO A;  4KMO A;  3U3W A;  3VTX A;  4AY5 A;  4NQ0 A;  4MS6 A;  3LEW A;  3RRU A;  2XCC A;  3CGH A;  1HF8 A;  4GA1 A;  1Z3X A;  5C2Y A;  4F7A A;  3FUM A;  3FH8 A;  1IQU A;  4HVB A;  4GZD A;  3CHS A;  5JHB A;  1U3C A;  2X3M A;  3LYA A;  4IYP A;  1N52 A;  4FLB A;  4V3I A;  4Q96 A;  3QAR A;  4JHK A;  4FJZ A;  2J4D A;  4LRZ A;  2HR2 A;  4JEU A;  3ZYQ A;  4AP2 A;  4BX8 A;  1H2V C;  2MHK A;  5G2N A;  2OOE A;  3ZEF A;  1FCH A;  3ZYM A;  2J49 A;  2OV8 A;  4BT9 A;  4J6I A;  1HZ4 A;  2VJ8 A;  3FUE A;  3D9L A;  3S7F A;  3AS4 A;  4OVV A;  3O4Z A;  2ION A;  3G2S A;  3QKY A;  4U0U A;  2I2O A;  3QK0 A;  2NSZ A;  3ZYK A;  3Q15 A;  1JWG A;  3QWP A;  4JC8 A;  4JW1 A;  5G05 C;  4B94 A;  2CFU A;  4YVO A;  3BG0 B;  4D10 C;  3ZW3 A;  4M3O A;  2KZT A;  1P5Q A;  3EHM A;  4I2Z A;  3MGB A;  4PS8 A;  3C98 A;  4HOR A;  3D9M A;  4DJA A;  5JHA A;  2WXK A;  4PH4 B;  3B7R L;  4J8S A;  3NZU A;  4B89 A;  4APF A;  2VYI A;  2LNI A;  3OXL A;  3E4B A;  4WNE A;  2P58 C;  4XIF A;  3TG4 A;  3L16 A;  4ILH B;  3NQP A;  2IJG X;  2KZT B;  1HS6 A;  3B7S A;  2NC9 A;  3I5P A;  4EPZ A;  5HQ8 A;  2J09 A;  2V0P A;  1LF8 A;  3QOU A;  4MLP A;  2A4Z A;  2KCV A;  4GYW A;  3D9K A;  3DBS A;  4N2S A;  2XRY A;  1PAQ A;  1WAO 1;  4PDX A;  1ZU2 A;  5LP0 A;  4UWF A;  1QQE A;  4G23 A;  4O6F A;  3UQ3 A;  3MA5 A;  4FAD A;  3LVR E;  4GU5 A;  3D3M A;  2X38 A;  4AOF A;  2OVF A;  4NAC A;  3O48 A;  4A3V A;  4Q69 A;  2NXP A;  4ANW A;  4HOS A;  3VLD A;  4HFG A;  5G04 C;  1UJJ A;  4J8D A;  4A1G A;  4ANU A;  2WQH A;  4BX9 A;  4EZJ A;  4GZ5 A;  2OVB A;  3ZRH A;  3PEU B;  1FVH A;  3SGH A;  2AVP A;  4ATG A;  3D9I A;  3CVV A;  3ZPJ A;  2Y4T A;  4EZL A;  1Z6T A;  4GA2 A;  2IOL A;  5CMY A;  4K0R A;  3ZYL A;  4E6H A;  4G11 A;  3L6A A;  2I6H A;  4FU3 A;  2IOS A;  2VGX B;  3URZ A;  3B7T A;  2IQC A;  4IRU A;  5G55 A;  4TUU A;  3TL5 A;  4I9E A;  2FUL A;  2UWJ G;  2RD0 A;  2WXI A;  3QNK A;  5C1D A;  3PRZ A;  1NA0 A;  3PH0 C;  3UX4 A;  4MKT A;  2XHE A;  3CVN A;  2WQ7 A;  4J0U A;  5EX0 A;  1KT1 A;  4ABN A;  4AXH A;  3SI5 A;  2AXZ A;  3CQG B;  2UY1 B;  5FT9 A;  4U0Z A;  4G2V A;  4BFR A;  3L22 A;  3ML8 A;  4UWG A;  4WWO A;  4I1O B;  2HO1 A;  4L2L A;  1SZ9 A;  4N3C A;  2CHZ A;  2L9B A;  1XNF A;  3ZVV A;  4F3V A;  1HG2 A;  3ENE A;  2X6F A;  4RG9 A;  2PZI A;  3RRN B;  4GMJ A;  5LCW C;  3CHQ A;  4L7T A;  1ELW A;  1N54 A;  1GW6 A;  2BF0 X;  2WXQ A;  3FWV A;  3IKO B;  3RO3 A;  4CDN A;  3L13 A;  5BPP A;  4U07 A;  4I1A A;  2V4L A;  2WXJ A;  3D9P A;  4EBA G;  4UWL A;  5E76 A;  1ZBP A;  3UMV A;  4DLO A;  5D0Q D;  2YHE A;  4ANV A;  4UQX A;  2HYZ A;  2VGY A;  1TJF A;  5FTP A;  3RKV A;  4WND A;  3RRM B;  3GZS A;  3I4G A;  4OYS A;  4KYO B;  4HOT A;  2WXM A;  2QY7 A;  1EPU A;  3LCA A;  3FUN A;  3ML9 A;  4KBQ A;  2L0I A;  3LY8 A;  4IN3 B;  3KD7 A;  4RSY A;  4UI9 C;  2R5S A;  5DBK A;  4BTA A;  1E7V A;  3SNX A;  2JLB A;  3FTX A;  3EIQ C;  3KEZ A;  1VDY A;  3OXF A;  3APC A;  5HI7 A;  2GRL A;  3FU0 A;  4N3A A;  1E8X A;  2C0L A;  3ULQ A;  4I6G A;  3MX3 A;  1H0A A;  3CST A;  4HOQ A;  5CMW A;  4AJW A;  4GML A;  4JPS A;  2E2E A;  3CVP A;  4MRU A;  3NF1 A;  4YVQ C;  4B8C B;  2MRI A;  2XRZ A;  4CDR A;  4UQY A;  3P2B A;  3PUJ A;  1INZ A;  1MHQ A;  3G2U A;  3FTU A;  2JEK A;  2X6J A;  3LDZ A;  3Q49 B;  3FUI A;  3CHR A;  4JEH A;  4UI9 K;  2WVI A;  4CT0 A;  2WXG A;  4GYO A;  3VLF A;  3MKQ B;  5BV1 A;  3D9N A;  2XGS A;  4DLQ A;  3S7J A;  3SBS A;  5KJK A;  5LCW J;  2VSN A;  1HH8 A;  2WXO A;  3B7U X;  2YIN A;  4UI9 J;  3CVW A;  3FH7 A;  3LY9 A;  4FLH A;  4GCN A;  4RVB A;  1UJK A;  3GW4 A;  3HDX A;  4BTB A;  3TXN A;  2PQN A;  3ZFW A;  2L0T B;  3Q5M A;  1EF1 C;  4PUC A;  4URK A;  3L17 A;  5G04 J;  1EDU A;  4KZ0 A;  3JQ0 A;  5FQ4 A;  4LCT A;  2L6J A;  4Y6W A;  4G1T A;  2FO7 A;  3FDH A;  5ARG A;  5T3R A;  3VLE A;  2XPI A;  4U63 A;  4HLE A;  3L08 A;  3CLJ A;  3ZN3 A;  4AIF A;  1UW4 B;  2WXR A;  3CK8 A;  1OWP A;  2FI7 A;  3PNL B;  4ACK A;  5JJT A;  4AY6 A;  4ILG A;  2DBA A;  1SQM A;  5BW8 C;  2XGM A;  3ZHE A;  2VQ2 A;  3HVE B;  4L23 A;  5BV0 A;  1FVF A;  1YA0 A;  3Q47 B;  4N39 A;  5LFA A;  3PNT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...