5LP0A

Crystal structure of the zebra fish enth domain from epsin1 in 1.41 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
140
structure length
140
Chain Sequence
GAMGSSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHALKTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epsin 1
publication title A bacterial genetic selection system for ubiquitylation cascade discovery.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
total genus 59
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lp0A00
4GZDA 3ZYLA 5J08A 3D9MA 1HX8A 3ZYKA 3D9LA 2DIWA 1DVPA 4NACA 5CMYA 3ZYMA 3G2WA 3LDZA 1XGWA 2KM4A 5LOZA 4Q94A 3D9IA 1H0AA 3D9KA 2MOWA 1HF8A 1JUQA 3ONKA 1EDUA 1EYHA 3G2SA 2V8SE 3ONLA 4Q96A 1HFAA 4GZCA 5CMWA 1JPLA 3G2VA 1HG5A 1MHQA 1PY1A 1ELKA 1JWFA 2L0TB 3RRUA 4AVXA 5LP0A 1JWGA 3D9NA 1LF8A 2LO6A 1SZAA 2DCPA 1HG2A 2BF0X 2L0IA 3D9JA 3D9OA 3G2UA 3G2TA 3CLJA 4JXTA 3ZYQA 1SZ9A 1VDYA 1X5BA 4FLBA 2QY7A 1UJJA 4FU3A 1UJKA 4HFGA 1INZA 3D9PA
chains in the Genus database with same CATH superfamily
4EZLA 3RJVA 2X3MA 2F0YA 3HHMA 4JEHA 4L2LA 2WXMA 3ZNGA 4JHKA 2RD0A 4IYPA 3CK8A 3TWSA 3UXGA 2IQCA 4EBAA 2I1JA 1U3DA 1D8DA 3IHYA 1HH8A 3ML8A 3JUIA 2XGSA 2EIKE 4YDYA 1MX4A 4U7EB 3T8MA 1DCEA 5B1BE 1MX6A 1IHGA 1INZA 2IOLA 4ANVA 2Y1LE 5AARA 3BG1B 1TEZA 3SFZA 5CCMA 4JPSA 1XGWA 3UIOC 3UUXA 3D9KA 4ANXA 3E34A 3MKQA 1YCSB 3FUHA 2H6FA 3LY7A 3PREA 4GTOA 1N0QA 5FIOA 3L13A 3ASFA 3VLFA 4ILGA 1E8YA 3TWVA 4F6RD 2WQ7A 3QWWA 5CERB 4RLYA 4XZ4A 1MQSA 3ASDA 5AQBA 2FO7A 2YINA 4I9EA 4BETA 1H19A 1UJJA 4BT8A 3D9PA 4J6IA 3UTMA 4D10C 4U8HA 4HBDA 3APCA 2Y0BG 5CRVA 3JYSA 1DCQA 5FQ7A 3ZGQA 5BXOA 3CKCA 5D66A 4IULA 4PS8A 2Y4UA 4UI9K 2GRRB 3QDNA 3ZUVB 4B89A 3L16A 3GZ2A 2J09A 2CG2A 2V0PA 3QNKA 1W3BA 3EHNA 4U8VD 3CVXA 1UW4B 3ASOE 2AXVA 5EN5D 3RK6A 4DLQA 3MEKA 3CHRA 4CDRA 4HOTA 4NRHB 3TL5A 3IKOB 5ITZF 4MBGA 4JXTA 3MA5A 3ESKA 3SO8A 2M63A 3FU6A 1KT1A 4G26A 2ZGGA 1QQEA 1N4PA 4PS3A 3U66A 4EHMA 1E96B 1JWFA 1NP7A 3CHQA 4B94A 2XGOA 2V5FA 4F7AA 5BXUA 1E8WA 4A1SA 4J0UA 3PH0C 4I43A 3SNXA 2MRIA 4GTTA 4H7XA 2WXNA 1D8EA 3ENEA 4K03A 1D9SA 4LUNU 3GYZA 4B8AA 3OXLA 4TXPA 3FWVA 2LO6A 1O1SA 4EECA 4GA1A 1DNPA 4DX1A 4N2SA 4UQYA 3FEXA 3LKUA 2R17C 3UM0A 3LDZA 5KNHD 1E8ZA 3G2VA 1NFIE 4U0UA 3EHRA 3FY4A 1Y6IA 2EINE 3QB2A 3DBSA 5CEDB 3ASHA 3NBNB 2EILE 2CG3A 5G2NA 5CEAA 5AIJA 5AQ7A 3AS8A 3APFA 4BY6A 2X6IA 3SI5A 3UMVA 3L17A 3LJNA 4L23A 3UT4A 2LXMA 1VDYA 3O4ZA 4CDNA 3OXFA 1TR4A 4DX7D 1TN8A 3D9LA 2B6CA 3DSWA 1H6KA 4Z68A 2E2EA 3QC1A 2C2LA 3BG0B 2HR2A 4HRNA 4LRZA 2WM9A 3HYMB 2BKKB 4N5QA 3QKYA 4BERA 1E7UA 3S7FA 3ZHEB 2GRNB 3NQPA 4O1PA 1EDUA 4HOQA 4DPRA 3ABME 3TJPA 1TNBA 1S63A 2FULA 3G2UA 3Q7AA 2P9NG 2IEJA 3LPZA 3K9IA 3UKRG 1HO8A 4XKBA 4FULA 4CEMA 4O1OA 1FCHA 3FUDA 1HG5A 5D0OD 4JZYA 5EYLA 4RG6A 1OWPA 2R02A 5CBOA 5BV1A 3PZ4A 2Y69E 1KPSB 3I5PA 2LAHA 4WNFA 2FF4A 4TRQA 3LVQE 1S0PA 3AU4A 2X38A 3JQ0A 4DK5A 5A7DB 4J7WA 1WY6A 3V79K 4WUYA 4UWHA 1JUQA 4JHRA 3UINC 3ZN3A 3AG1E 3FUKA 3FUFA 2XEVA 5FT9A 4WAFA 5IY5E 3UQ3A 2QFCA 5FQ6A 3AS4A 4WNDA 3HXDA 3PVLA 2A5EA 1E90A 4MS6A 3DPDA 4C9BB 4Q96A 3TWRA 2CHXA 4PS7A 2P9IG 3MV3B 3QJZA 5FQ4A 4MRUA 4GTQA 5FQ8A 3R7RA 3ULQA 2L6JA 4UWLA 2HYZA 1QBQA 1TN7A 5FWQA 2KCKA 5JJ6A 3DXKG 3T8KA 4AXHA 4LERA 3HXFA 3KS2A 4ILIA 3CSFA 1OT8A 1FVFA 1KZPA 1EPUA 3TG4A 1TJFA 3ZYQA 1IQUA 1YYHA 4A1GA 3ZU7B 3FDHA 5CECB 4B8CB 2XRZA 4Y6WA 3V30A 5G05C 3ZXPA 2IONA 3FUEA 4N39A 2QZAA 3HRAA 5CRUA 2ZXWE 5HI7A 2DYRE 1MJ0A 2WXQA 5EYPF 2F37A 1OWLA 1ZB1A 4N5CA 3CVUA 4FA6A 3L54A 1K1AA 5KBAA 5T4YA 4KVOA 1U3CA 3CHOA 3QWPA 1SQMA 2J4DA 1HF8A 2P9LG 3V2OA 3VLEA 2ZIRA 2ETCA 2FBNA 4GMLA 3FU0A 3FTXA 3KAEA 1OWOA 1UJKA 3RU0A 2OVFA 3UM2A 3C5RA 3UT8A 4WWPA 1HE8A 3TAXA 3NZUA 4GYOA 4HXIA 5C1DA 4C0EA 3O48A 3C72A 3RRNB 1IQRA 3JCKC 4I17A 2NC9A 1TNUA 4APFA 1OY3D 3WG7E 5HS0A 3PDNA 3L82A 3QARA 5KCMA 1GW6A 3N71A 3ESLA 3DSXA 3E37A 5ARGA 4AEZC 3V2XA 3UI2A 4FU3A 1S64A 5J08A 1YA0A 3KD7A 4C0MA 3EIQC 2JABA 4EBAG 4UI9C 1FT2A 2ETBA 2VGYA 5HQ8A 1Z5SC 5EIBE 2QYJA 4H7YA 3FH5A 1RW2A 3BQOA 2ETAA 4UWGA 3KEZA 1AP7A 3RO3A 2FEZA 1PC2A 1BD8A 3SQVA 4YNDA 3CQGB 2KATA 4FP7A 5AYWD 4AY5A 2WXRA 5DBKA 5KJNA 5LCWC 3TXNA 2KCVA 3EJNA 2WMNA 3CKBA 4I2WA 2PM6A 3ZEFA 4N3CA 5FINA 3AG3E 2J08A 2RFAA 4GB9A 3G2WA 4XEIG 4JHJA 2C0MA 5BW8C 2R59A 1BLXB 2Y3AA 5ANRA 4NIKA 2DVWA 3L9TA 4GA0A 3ZW3A 3HDXA 4KMOA 3U64A 2ZU6B 2J07A 3R7QA 4JL0A 5JHBA 2I2OA 3P1UA 2IF4A 4HS2A 4J8FA 3DXMG 2XZDG 4LSZE 5KNGA 1HG2A 2WPVA 4HI9A 2LNIA 4AJWA 4BTAA 2P9PG 4HFGA 3JXIA 4RSYA 5E76A 1BI7B 2X6FA 2VSXE 3ONKA 1TJCA 1MX2A 2BUGA 2AW6A 5ENQD 3EU9A 2VTBB 1PAQA 3LEWA 4AP2A 4G23A 2XQ0A 4DX6D 2VGXB 3ZKJA 4ACKA 2AWIA 4OVUA 2WXOA 3MX3A 4GTMA 3ZIMA 1K8KG 2L0TB 1MZCA 4GCNA 3CVVA 3CVLA 5JHAA 3Q73A 3UT7A 5T3RA 5KJKA 4JD2G 3ZHEA 1HXIA 4U95D 4QFVA 3CVWA 2PM7A 4BSZB 2EIJE 3CVQA 2IOSA 4DUIA 1JPLA 3ABLE 2FO1E 1V55E 3RO2A 3DWLG 2AXUA 3IV0A 3L22A 3G2TA 1HU3A 5E75A 3SFYA 3IEGA 4I1MA 2MYOA 3CEQA 4TUUA 2XCBA 1IHBA 2ONDA 4K5BA 2BEDA 4GZCA 3SF4A 3S7DA 4U07A 4GMJA 3DRAA 5EIDA 4CCAA 4MLPA 4YDOA 2DWZA 3HG0D 3TWWA 4AIFA 4PH4B 3SZ7A 4XE0A 4HVBA 1HX8A 3IHVA 2GRLA 4JA9A 5KJMA 1DC2A 4ME2A 4EQFA 2GRMA 4FJZA 2QYUA 3CIAA 4FADA 4J8EA 2LSUA 3D9OA 5ENRD 1X81A 4LNBA 3OAWA 3SHFA 3KEAA 2JLBA 4G8KA 3S7JA 3PE4A 3C3RA 2I9CA 3QWVA 3BU8A 1ZBPA 2KCLA 3UM3A 4K5CA 3E33A 3EIJA 3AJIA 1Y8MA 4AVXA 4A55A 4KT6B 1SZAA 1HZ4A 2OCCE 4HOUA 2Q7FA 3VTXA 2RFMA 2RG8A 4L1BA 1NA3A 3ZYKA 4U8YD 4DLOA 3DSUA 4CYMD 3IBEA 3QOUA 2GRQB 4R7LA 3NOCD 4W9RA 4TV3A 5C2YA 3PEVB 1N11A 3VLDA 2L0IA 4ANWA 2DBAA 5FZRA 4E85A 2WXLA 4BFRA 4HORA 1UN8A 4GZ6A 3MYVA 2OVBA 3URZA 3PZ2A 1ELRA 3DSSA 1XNFA 2J9QA 3RRUA 3FTUA 3HXEA 2ILRA 4LNGA 2NYJA 3DSTA 1B89A 2XCCA 2DIWA 5BT1A 1IYGA 4JEUA 4GMRA 4RVBA 5LOZA 3SY2A 4G2VA 4M3OA 4AOFA 4KXKB 3PUKA 3AU5A 3OTNA 4UWFA 3UPVA 1N54A 2GGFA 3DPYA 3RIBA 2LAIA 3CK9A 3TWXA 4K5AB 1N9AA 2V5QC 2WB2A 3PZ1A 2WVIA 3QAQA 4APOA 3I3NA 1N95A 5G04J 3Q7FA 3G2SA 1ELKA 1S70B 1JCSA 2XPIA 3CR3A 1Z3XA 3B13A 2OOEA 3LJ3A 3ZXSA 3ISMC 4NACA 5ENTD 5FTPA 3B7UX 5DIZA 5A23A 3Q5MA 1QNFA 4GZ3A 4FLHA 1ELWA 2PQRA 4GPKA 3D9NA 4CZ2D 2F8XK 1UG3A 3PE3A 5G55A 3EHMA 4I6GA 4F3VA 2DZOA 3Q15A 4GTVA 4U0ZA 3APDA 1SVXA 1TNOA 1EF1C 4TUMA 4G25A 3Q49B 4GU5A 3RKVA 5HKPA 1JWGA 2FI7A 4XKCA 4DX2A 4TXQA 1K3ZD 3TGOA 3PEUB 5JMND 2CHZA 2XHEA 2XGMA 3U9WA 1DVPA 1Q2ZA 5D2MC 2B0OE 3Q4AB 5G05J 1H0AA 1E8XA 1Z3YA 3MKRA 3AG4E 3E32A 3ASNE 3EHQA 4G11A 5KJLA 4YDEA 2NXPA 4BTBA 3ULEG 4X8QA 5AENA 1SW6A 3C3QA 5A6CA 3F6QA 4DX5D 1JCRA 3CQCB 3HVEB 5AN8A 4LCTA 4BESA 5B3SE 4WWOA 2VQ2A 3ZVVA 3FTZA 3PNTB 3I4RB 1H2UA 3FULA 3TWTA 4CT4A 5CMYA 4L9PA 1TNYA 2R5SA 3S2AA 1NZNA 5BNWA 3RSEG 3B95A 4I9CA 1NI1A 3RAUA 4UQZA 5FZQA 5BPPA 1OCCE 3TG5A 3B7TA 3TXMA 2NSZA 4TXRA 4HOSA 3MZLB 4HRLA 1OUVA 2R03A 5LFAA 4QQIA 3LY8A 3OXGA 4JC8A 3L08A 4N2QA 2XPYA 1Z6TA 2XS8A 1P5QA 4A3VA 4U63A 4DI3A 2YHCA 5EX0A 3SFXA 1FVHA 2KZTB 2H6HA 3J5QB 4G8LA 5EKQD 2H6GA 3SBSA 2PL2A 3P2BA 2QC9A 3FTVA 2X6JA 3GZ1A 1KZOA 3B7SA 2XENA 4UI9J 5EX3A 3Q75A 3T9KA 3Q47B 3FUIA 4Q69A 2VYIA 1V54E 5B1AE 2PQNA 4JA7A 3D9JA 2VTBA 3W9GA 5ENOD 1SA5A 4I1OB 1N0RA 3DSVA 5ENSD 2VGXA 3PZDA 3UKUG 4EPZA 5J90A 4GZ5A 2Y4TA 4U96D 4J8YA 2CFUA 4M7CA 1OCRE 5BV0A 3DEOA 2VSYA 1X5BA 3HXCA 3GZSA 2GROB 3Q9NC 4B93B 3RRMB 2ZISA 1NA0A 3FP3A 3NOGD 3MGBA 3T5XA 2MOWA 4KBQA 4A63B 2XRYA 3AG2E 2AXZA 4CGWA 1SZ9A 4FLBA 5KWDA 4HNAD 3ZYLA 3E30A 2P9UG 1BPOA 4MKTA 3NAWA 4CDMA 4G24A 1O5MA 3BUAA 2OV8A 2J4BA 3FTYA 4OAUC 4WWNA 1ZU2A 2XZTG 3KSQA 2WXHA 3AAAC 4O6FA 2L9BA 3WXXA 4JW1A 3UIPC 2VSOE 4L7TA 3C98A 2I6HA 3NB2A 4Y6CA 1H2VC 3KSLA 4HRMB 4HLLA 2LXLA 4RG9A 5JA4D 3TWQA 3HIZA 4PUCA 1A5EA 4GCOA 2H6IA 5CCLA 3B7BA 2XPZA 4KZ0A 3J5PA 3FHEA 5ENNA 4ZFHA 4BEPA 2DCPA 2X6HA 2IO2C 3CLJA 2UY1B 3ML9A 2V4HC 1IXVA 3IXEA 2VJ8A 1TN6A 2E0IA 4GTPA 1FT1A 1H2TC 2YHEA 4ABNA 1NL4A 1A17A 3DEPA 2WQ6A 1UOHA 2WMOA 3LY9A 4YVQC 4F53A 1MYOA 4ACLA 1IKND 3FH7A 4KZCA 2LSVA 2PNNA 2R2LA 4U04A 1BU9A 1RZ4A 5T8IA 2YNQA 3MV2B 4N3AA 1WM5A 1YMPA 4DJAA 4C48B 4CRWA 2LUHA 4J8SA 5M72A 4B0ZA 3D3MA 4RQIA 3Q79A 3ZRHA 3JXJA 4BX8A 3FTWA 2WXKA 3C3OA 3CVNA 2GW1A 1MHQA 4AM9A 3CHSA 4UQXA 4G1TA 5JJTA 4FHJA 3EDTB 3FU3A 3D9HA 4P29A 1TNZA 3SD5A 4BT9A 1HFAA 3SGHA 5EILA 1WAO1 4LNUD 4YDWA 1PY1A 3MKQB 1OCOE 4BSXA 2IO3C 2WXGA 2GRPB 3CVYA 5ENPD 5ARFA 2XEHA 1KT0A 2A4ZA 4XX5A 4BWRA 2VGEA 4URKA 1N94A 2UWJG 1H6OA 2EQXA 3HXBA 2WXFA 1SA4A 4DI4A 3FFLA 3NZSA 1O1TA 3ZPJA 2PZIA 3EUVA 1UN9A 5AQ9A 2BF0X 1BI8B 4I6EA 3CHMA 5ANLA 2IFUA 4O60A 2CFZA 3FU5A 2I1KA 4GPMA 3UX4A 3TWUA 4WNEA 2VSNA 5FJYA 5CBNA 4F1SA 4HLEA 4ATZD 2OEWA 4DRXE 1TYQG 2IU1A 3E4BA 4YVOA 1LD7A 4A3TA 3ASGA 1L5JA 1N4QA 2AJAA 2HO1A 4U0SA 3CHPA 2XS1A 3V31A 1OWMA 2P9KG 4GTSA 3FUNA 3R9MA 3HVEA 4N3BA 3PUJA 1KLXA 4NURA 1OWNA 4GTRA 4E6HA 4OYSA 1QZ2A 1WG0A 3B7RL 2J8SD 2IY0C 5BUZA 3FUMA 3ZFWA 3I4GA 3PNLB 4HI8A 4FC8A 4HQDA 2WXIA 2P9SG 1LTXA 2IJGX 2A5UA 1N4SA 3PZ3A 4GYYA 3JQ1A 3AS5A 3LXUX 3UM1A 2JEKA 3ULYA 5AJLA 3JUEA 4XI0A 2ZGDA 1EYHA 3ONLA 3CVPA 3FEYA 2KZTA 4BX9A 1LF8A 5EDSA 2YQ8A 3Q78A 4AY6A 2WXPA 3ABKE 5G04C 2R05A 2V4LA 2AVPA 4UUCA 5HRYA 1OXJA 2DYSE 5AAOA 4F1PA 4I1AA 5CHEE 4J8DA 2HE0A 1G3NB 5JJ7A 3FH8A 2KXPC 4FJYA 1LD8A 3FTSA 4IN3B 2OEVA 3GW4A 2MHKA 4K0RA 2KBXA 4HB5A 2WXJA 1O1RA 1N52A 1E7VA 3U3WA 1HS6A 4L2YA 2L6BA 3D9MA 3Q9UC 4OVVA 4ZHBA 4ILHB 4PDXA 4CT0A 1JCQA 5AJDA 4CGVA 3MCXA 3CK7A 5H7PA 4EZJA 2CHWA 2C0LA 2V8SE 4LG6A 5AQAA 3VTYA 4WNGA 3BEEA 3PS6A 2P2CP 2WQHA 4GA2A 2DZNA 1H6PA 1U2VG 4KYOB 3ZYMA 4Q94A 4V3IA 4AV7A 5CMWA 4OAVB 4IRUA 1N4RA 2RKKA 4NQ0A 4GYWA 4UWKA 3LCAA 4EZKA 2HM8A 3SBTB 3LVRE 3R9AB 4FHKA 2X6KA 3U4TA 2BKGA 3FUJA 1OCZE 5LP0A 3MJWA 3QK0A 4LEUA 3W9FA 5FZSA 1K1BA 3LS8A 3LYAA 2XEEA 3X2QE 4GZDA 3S7BA 3CSTA 2P58C 2KM4A 4XI9A 4I2ZA 2BTDA 2J49A 2EIME 1FPPA 1WDYA 4I6JA 2F8YA 3T5VA 2UY1A 4GAAA 1QYMA 2QY7A 3EU5A 3L6AA 4JVSA 3CGHA 4KVMA 3D9IA 3NF1A 4JB8P 2KC7A 3CV0A 4ATGA 5LX8A 5LCWJ 4ANUA 4XIFA 3PRZA 5D0QD 1AWCB
chains in the Genus database with same CATH topology
2WXLA 4EZLA 4U04A 3RJVA 4BFRA 4HORA 2L6JA 2X3MA 1UN8A 3HHMA 4JEHA 4L2LA 2HYZA 2WXMA 4GZ6A 3MYVA 4UWLA 5FWQA 2KCKA 2OVBA 5JJ6A 3URZA 5T8IA 4JHKA 2YNQA 3MV2B 4AXHA 4N3AA 1ELRA 4LERA 1WM5A 2RD0A 4IYPA 1XNFA 4DJAA 3KS2A 4ILIA 2J9QA 3RRUA 3CK8A 4CRWA 3CSFA 4J8SA 1FVFA 3FTUA 2IQCA 5M72A 4EBAA 1EPUA 3TG4A 1TJFA 3ZYQA 2I1JA 2ILRA 3D3MA 1IQUA 1U3DA 4B0ZA 4A1GA 3IHYA 1B89A 1HH8A 3ML8A 3JUIA 2XCCA 2XGSA 2DIWA 3FDHA 5BT1A 1IYGA 3ZRHA 4JEUA 4B8CB 2XRZA 4Y6WA 4BX8A 4RVBA 5G05C 2IONA 5LOZA 3FTWA 3FUEA 3T8MA 4N39A 2WXKA 3CVNA 1IHGA 5HI7A 4G2VA 4M3OA 4AOFA 4KXKB 2GW1A 1MHQA 4AM9A 1INZA 3PUKA 2IOLA 2WXQA 3AU5A 3CHSA 3OTNA 4UWFA 3UPVA 1N54A 4UQXA 4ANVA 2GGFA 3RIBA 2LAIA 4G1TA 1OWLA 3CK9A 4N5CA 3CVUA 5JJTA 4FA6A 4FHJA 3L54A 3EDTB 3BG1B 3FU3A 1TEZA 3SFZA 5CCMA 4JPSA 4P29A 5T4YA 2WB2A 4KVOA 1U3CA 3CHOA 2WVIA 3QWPA 3QAQA 1XGWA 4APOA 3I3NA 3UUXA 5G04J 1SQMA 3D9KA 4ANXA 2J4DA 3SD5A 1HF8A 4BT9A 3G2SA 1HFAA 3SGHA 1WAO1 3MKQA 3VLEA 1PY1A 1ELKA 3FUHA 3MKQB 4BSXA 2WXGA 3LY7A 3PREA 2FBNA 2XPIA 3CR3A 3CVYA 4GMLA 3FU0A 3FTXA 5ARFA 3KAEA 1OWOA 1KT0A 1Z3XA 1UJKA 2A4ZA 4XX5A 3B13A 2OOEA 3L13A 3LJ3A 3RU0A 4BWRA 2OVFA 3ASFA 3VLFA 3ZXSA 4ILGA 1E8YA 4URKA 4NACA 2WQ7A 3QWWA 2UWJG 5FTPA 3UT8A 3B7UX 4WWPA 2EQXA 1HE8A 3TAXA 3NZUA 5DIZA 5A23A 4XZ4A 4GYOA 4HXIA 2WXFA 4DI4A 1MQSA 3ASDA 3Q5MA 3FFLA 3O48A 1QNFA 4GZ3A 4C0EA 5C1DA 4FLHA 3RRNB 1ELWA 1IQRA 2PQRA 3JCKC 3NZSA 3ZPJA 2FO7A 4GPKA 2PZIA 3D9NA 4I17A 1UN9A 1UG3A 2BF0X 2NC9A 3PE3A 2YINA 4I9EA 5G55A 3EHMA 1H19A 4I6EA 1UJJA 4I6GA 4F3VA 3CHMA 3Q15A 4BT8A 3D9PA 4J6IA 4APFA 5ANLA 4U0ZA 2IFUA 3APDA 3PDNA 4U8HA 4D10C 3QARA 5KCMA 1GW6A 3APCA 2CFZA 3FU5A 2I1KA 3N71A 1EF1C 3ESLA 3JYSA 4G25A 3Q49B 5FQ7A 3ZGQA 4GU5A 3RKVA 3UX4A 4WNEA 1JWGA 2VSNA 5ARGA 2FI7A 4XKCA 5FJYA 3CKCA 4F1SA 4HLEA 3TGOA 4IULA 4PS8A 4AEZC 2Y4UA 4UI9K 3PEUB 2CHZA 2XHEA 2IU1A 2XGMA 3E4BA 3QDNA 4FU3A 4YVOA 3U9WA 4B89A 5J08A 1YA0A 4A3TA 3ASGA 3L16A 1DVPA 3GZ2A 2J09A 2CG2A 2V0PA 3KD7A 1W3BA 3QNKA 3EIQC 1L5JA 4C0MA 3EHNA 4EBAG 4UI9C 3Q4AB 5G05J 3CVXA 1H0AA 1UW4B 2AXVA 2VGYA 1E8XA 1Z3YA 3MKRA 5HQ8A 3RK6A 2HO1A 4DLQA 3MEKA 3CHRA 4CDRA 4HOTA 4H7YA 3FH5A 4G11A 4U0SA 5KJLA 3CHPA 2NXPA 4NRHB 4UWGA 3TL5A 4BTBA 3IKOB 3KEZA 3RO3A 1OWMA 4JXTA 2FEZA 3MA5A 3ESKA 1PC2A 2M63A 4YNDA 3CQGB 5AENA 2KATA 3FUNA 3FU6A 1KT1A 4FP7A 5AYWD 4AY5A 4G26A 2WXRA 5A6CA 5DBKA 1QQEA 3HVEA 5KJNA 4PS3A 3CQCB 5LCWC 3U66A 3HVEB 3TXNA 4N3BA 3PUJA 4LCTA 2KCVA 1E96B 1KLXA 1JWFA 1NP7A 4NURA 1OWNA 3EJNA 2WMNA 3CHQA 4B94A 2XGOA 4WWOA 4E6HA 2V5FA 2VQ2A 4F7AA 3ZVVA 3FTZA 3CKBA 3PNTB 4I2WA 1E8WA 3I4RB 2PM6A 4OYSA 3ZEFA 1QZ2A 4A1SA 3B7RL 4N3CA 1H2UA 3FULA 4J0UA 4CT4A 3PH0C 4I43A 2J08A 5CMYA 5BUZA 3FUMA 4GB9A 3G2WA 3SNXA 3ZFWA 2R5SA 2MRIA 3I4GA 3PNLB 4JHJA 3S2AA 4FC8A 4H7XA 2WXNA 1NZNA 2C0MA 3ENEA 4K03A 5BNWA 2WXIA 4I9CA 5BW8C 2R59A 4LUNU 4UQZA 3GYZA 5FZQA 4B8AA 3OXLA 5BPPA 2Y3AA 2IJGX 2A5UA 3FWVA 3TG5A 3B7TA 2LO6A 2NSZA 3TXMA 5ANRA 4EECA 4HOSA 3MZLB 4GA0A 3ZW3A 3HDXA 4KMOA 1OUVA 1DNPA 4GA1A 4GYYA 4N2SA 4UQYA 5LFAA 3U64A 3JQ1A 3AS5A 3LXUX 3FEXA 3LKUA 2ZU6B 2J07A 2R17C 2JEKA 3LDZA 3LY8A 3OXGA 3R7QA 4JC8A 3L08A 4XI0A 5AJLA 4JL0A 5JHBA 1EYHA 2XPYA 4N2QA 2I2OA 1E8ZA 3ONLA 3P1UA 2IF4A 1Z6TA 3CVPA 3G2VA 1P5QA 4A3VA 3FEYA 4HS2A 4U63A 4J8FA 4DI3A 2YHCA 2KZTA 5EX0A 4BX9A 1LF8A 4U0UA 3FY4A 5EDSA 1FVHA 1Y6IA 2YQ8A 1HG2A 2WPVA 3QB2A 2KZTB 2LNIA 4AJWA 4BTAA 4AY6A 5EKQD 2WXPA 4HFGA 3SBSA 3DBSA 2PL2A 3P2BA 4RSYA 3FTVA 2X6JA 3GZ1A 3ASHA 5G04C 3B7SA 2CG3A 5E76A 5G2NA 2V4LA 2VSXE 2X6FA 2AVPA 4UI9J 5AIJA 5EX3A 3ONKA 1TJCA 3AS8A 3APFA 3Q47B 3FUIA 4BY6A 2BUGA 4Q69A 2VYIA 2X6IA 3SI5A 2PQNA 3UMVA 2AW6A 4I1AA 4JA7A 3L17A 4L23A 4J8DA 5CHEE 3D9JA 5JJ7A 2VTBA 3UT4A 3FH8A 1VDYA 4FJYA 3O4ZA 4CDNA 3FTSA 2VTBB 3OXFA 4IN3B 4I1OB 1PAQA 3D9LA 3GW4A 3LEWA 4AP2A 2VGXA 3PZDA 2MHKA 4K0RA 1H6KA 4G23A 4EPZA 5J90A 4GZ5A 2E2EA 2WXJA 2XQ0A 2Y4TA 2C2LA 3QC1A 2VGXB 3BG0B 1N52A 4ACKA 2AWIA 4OVUA 2WXOA 3MX3A 2HR2A 3ZIMA 2CFUA 2L0TB 5BV0A 4GCNA 1E7VA 3CVLA 5JHAA 3CVVA 4LRZA 3U3WA 2VSYA 2WM9A 3UT7A 1HS6A 1X5BA 5T3RA 3GZSA 3HYMB 5KJKA 3RRMB 4L2YA 3QKYA 3D9MA 3ZHEA 1HXIA 1E7UA 4OVVA 3S7FA 4ILHB 4PDXA 1NA0A 3FP3A 3ZHEB 4CT0A 4QFVA 3CVWA 2PM7A 3MGBA 3NQPA 5AJDA 3T5XA 2MOWA 4CGVA 3MCXA 3CK7A 4EZJA 2CHWA 1EDUA 2C0LA 3CVQA 2V8SE 2IOSA 4HOQA 4KBQA 3VTYA 1JPLA 4DPRA 4WNGA 2XRYA 3BEEA 3RO2A 2AXUA 3PS6A 3IV0A 3L22A 3TJPA 2AXZA 2WQHA 4CGWA 2FULA 3G2UA 1HU3A 3G2TA 1SZ9A 4FLBA 3LPZA 4GA2A 5E75A 4HVBA 3K9IA 3IEGA 1HO8A 3ZYLA 4I1MA 4XKBA 1BPOA 4MKTA 3CEQA 4TUUA 4KYOB 3ZYMA 2XCBA 4CDMA 4G24A 4FULA 4Q94A 4V3IA 4AV7A 4CEMA 2OV8A 2J4BA 1FCHA 2ONDA 3FTYA 5CMWA 4WWNA 4GZCA 4IRUA 3SF4A 3FUDA 1ZU2A 3S7DA 4U07A 4NQ0A 4GMJA 2WXHA 1HG5A 4CCAA 4GYWA 4MLPA 4O6FA 4UWKA 5D0OD 4JZYA 4RG6A 1OWPA 4AIFA 2L9BA 3WXXA 4JW1A 4PH4B 5BV1A 2VSOE 3SZ7A 3I5PA 4L7TA 4XE0A 3LCAA 4EZKA 2HM8A 1HX8A 3C98A 2LAHA 3IHVA 3SBTB 2I6HA 3LVRE 3R9AB 4FHKA 2GRLA 4JA9A 2X6KA 4Y6CA 5KJMA 1H2VC 3U4TA 4WNFA 2FF4A 3FUJA 4ME2A 4TRQA 3LVQE 1S0PA 4RG9A 4EQFA 5LP0A 3MJWA 2GRMA 3QK0A 4FJZA 3CIAA 4FADA 4LEUA 4J8EA 3AU4A 2LSUA 3D9OA 3HIZA 4PUCA 5FZSA 2X38A 3LS8A 3OAWA 3LYAA 3SHFA 4GCOA 3JQ0A 2JLBA 4GZDA 3S7BA 4DK5A 3S7JA 3CSTA 3PE4A 5CCLA 2I9CA 2P58C 3QWVA 5A7DB 2KM4A 4XI9A 2XPZA 4I2ZA 1WY6A 2BTDA 4KZ0A 4WUYA 1ZBPA 4UWHA 1JUQA 2KCLA 2J49A 4JHRA 3FHEA 5ENNA 3EIJA 1Y8MA 3ZN3A 4AVXA 4A55A 4KT6B 3FUKA 4I6JA 1SZAA 2UY1A 1HZ4A 3T5VA 2DCPA 2X6HA 4GAAA 3FUFA 2XEVA 4HOUA 3CLJA 2Q7FA 5FT9A 3VTXA 2UY1B 2RG8A 2QY7A 3L6AA 3ML9A 4L1BA 4WAFA 3UQ3A 2QFCA 5FQ6A 1NA3A 3AS4A 3ZYKA 4WNDA 4DLOA 2VJ8A 3PVLA 4JVSA 1E90A 2E0IA 4MS6A 3IBEA 3QOUA 3CGHA 4KVMA 3D9IA 3NF1A 1H2TC 2YHEA 4R7LA 4ABNA 3DPDA 1A17A 2KC7A 4Q96A 4C9BB 2WQ6A 3CV0A 4W9RA 2CHXA 2WMOA 3LY9A 4PS7A 4ATGA 5LX8A 5LCWJ 4TV3A 4YVQC 3PEVB 5C2YA 4F53A 3MV3B 3QJZA 4ACLA 5FQ4A 4MRUA 4ANUA 4XIFA 5FQ8A 3VLDA 2L0IA 4ANWA 3FH7A 3PRZA 3R7RA 2DBAA 3ULQA 5D0QD 4KZCA 5FZRA 4E85A 2LSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GZD A;  3ZYL A;  5J08 A;  3D9M A;  1HX8 A;  3ZYK A;  3D9L A;  2DIW A;  1DVP A;  4NAC A;  5CMY A;  3ZYM A;  3G2W A;  3LDZ A;  1XGW A;  2KM4 A;  5LOZ A;  4Q94 A;  3D9I A;  1H0A A;  3D9K A;  2MOW A;  1HF8 A;  1JUQ A;  3ONK A;  1EDU A;  1EYH A;  3G2S A;  2V8S E;  3ONL A;  4Q96 A;  1HFA A;  4GZC A;  5CMW A;  1JPL A;  3G2V A;  1HG5 A;  1MHQ A;  1PY1 A;  1ELK A;  1JWF A;  2L0T B;  3RRU A;  4AVX A;  5LP0 A;  1JWG A;  3D9N A;  1LF8 A;  2LO6 A;  1SZA A;  2DCP A;  1HG2 A;  2BF0 X;  2L0I A;  3D9J A;  3D9O A;  3G2U A;  3G2T A;  3CLJ A;  4JXT A;  3ZYQ A;  1SZ9 A;  1VDY A;  1X5B A;  4FLB A;  2QY7 A;  1UJJ A;  4FU3 A;  1UJK A;  4HFG A;  1INZ A;  3D9P A; 
#chains in the Genus database with same CATH topology
 4EZL A;  3RJV A;  2X3M A;  2F0Y A;  3HHM A;  4JEH A;  4L2L A;  2WXM A;  3ZNG A;  4JHK A;  2RD0 A;  4IYP A;  3CK8 A;  3TWS A;  3UXG A;  2IQC A;  4EBA A;  2I1J A;  1U3D A;  1D8D A;  3IHY A;  1HH8 A;  3ML8 A;  3JUI A;  2XGS A;  2EIK E;  4YDY A;  1MX4 A;  4U7E B;  3T8M A;  1DCE A;  5B1B E;  1MX6 A;  1IHG A;  1INZ A;  2IOL A;  4ANV A;  2Y1L E;  5AAR A;  3BG1 B;  1TEZ A;  3SFZ A;  5CCM A;  4JPS A;  1XGW A;  3UIO C;  3UUX A;  3D9K A;  4ANX A;  3E34 A;  3MKQ A;  1YCS B;  3FUH A;  2H6F A;  3LY7 A;  3PRE A;  4GTO A;  1N0Q A;  5FIO A;  3L13 A;  3ASF A;  3VLF A;  4ILG A;  1E8Y A;  3TWV A;  4F6R D;  2WQ7 A;  3QWW A;  5CER B;  4RLY A;  4XZ4 A;  1MQS A;  3ASD A;  5AQB A;  2FO7 A;  2YIN A;  4I9E A;  4BET A;  1H19 A;  1UJJ A;  4BT8 A;  3D9P A;  4J6I A;  3UTM A;  4D10 C;  4U8H A;  4HBD A;  3APC A;  2Y0B G;  5CRV A;  3JYS A;  1DCQ A;  5FQ7 A;  3ZGQ A;  5BXO A;  3CKC A;  5D66 A;  4IUL A;  4PS8 A;  2Y4U A;  4UI9 K;  2GRR B;  3QDN A;  3ZUV B;  4B89 A;  3L16 A;  3GZ2 A;  2J09 A;  2CG2 A;  2V0P A;  3QNK A;  1W3B A;  3EHN A;  4U8V D;  3CVX A;  1UW4 B;  3ASO E;  2AXV A;  5EN5 D;  3RK6 A;  4DLQ A;  3MEK A;  3CHR A;  4CDR A;  4HOT A;  4NRH B;  3TL5 A;  3IKO B;  5ITZ F;  4MBG A;  4JXT A;  3MA5 A;  3ESK A;  3SO8 A;  2M63 A;  3FU6 A;  1KT1 A;  4G26 A;  2ZGG A;  1QQE A;  1N4P A;  4PS3 A;  3U66 A;  4EHM A;  1E96 B;  1JWF A;  1NP7 A;  3CHQ A;  4B94 A;  2XGO A;  2V5F A;  4F7A A;  5BXU A;  1E8W A;  4A1S A;  4J0U A;  3PH0 C;  4I43 A;  3SNX A;  2MRI A;  4GTT A;  4H7X A;  2WXN A;  1D8E A;  3ENE A;  4K03 A;  1D9S A;  4LUN U;  3GYZ A;  4B8A A;  3OXL A;  4TXP A;  3FWV A;  2LO6 A;  1O1S A;  4EEC A;  4GA1 A;  1DNP A;  4DX1 A;  4N2S A;  4UQY A;  3FEX A;  3LKU A;  2R17 C;  3UM0 A;  3LDZ A;  5KNH D;  1E8Z A;  3G2V A;  1NFI E;  4U0U A;  3EHR A;  3FY4 A;  1Y6I A;  2EIN E;  3QB2 A;  3DBS A;  5CED B;  3ASH A;  3NBN B;  2EIL E;  2CG3 A;  5G2N A;  5CEA A;  5AIJ A;  5AQ7 A;  3AS8 A;  3APF A;  4BY6 A;  2X6I A;  3SI5 A;  3UMV A;  3L17 A;  3LJN A;  4L23 A;  3UT4 A;  2LXM A;  1VDY A;  3O4Z A;  4CDN A;  3OXF A;  1TR4 A;  4DX7 D;  1TN8 A;  3D9L A;  2B6C A;  3DSW A;  1H6K A;  4Z68 A;  2E2E A;  3QC1 A;  2C2L A;  3BG0 B;  2HR2 A;  4HRN A;  4LRZ A;  2WM9 A;  3HYM B;  2BKK B;  4N5Q A;  3QKY A;  4BER A;  1E7U A;  3S7F A;  3ZHE B;  2GRN B;  3NQP A;  4O1P A;  1EDU A;  4HOQ A;  4DPR A;  3ABM E;  3TJP A;  1TNB A;  1S63 A;  2FUL A;  3G2U A;  3Q7A A;  2P9N G;  2IEJ A;  3LPZ A;  3K9I A;  3UKR G;  1HO8 A;  4XKB A;  4FUL A;  4CEM A;  4O1O A;  1FCH A;  3FUD A;  1HG5 A;  5D0O D;  4JZY A;  5EYL A;  4RG6 A;  1OWP A;  2R02 A;  5CBO A;  5BV1 A;  3PZ4 A;  2Y69 E;  1KPS B;  3I5P A;  2LAH A;  4WNF A;  2FF4 A;  4TRQ A;  3LVQ E;  1S0P A;  3AU4 A;  2X38 A;  3JQ0 A;  4DK5 A;  5A7D B;  4J7W A;  1WY6 A;  3V79 K;  4WUY A;  4UWH A;  1JUQ A;  4JHR A;  3UIN C;  3ZN3 A;  3AG1 E;  3FUK A;  3FUF A;  2XEV A;  5FT9 A;  4WAF A;  5IY5 E;  3UQ3 A;  2QFC A;  5FQ6 A;  3AS4 A;  4WND A;  3HXD A;  3PVL A;  2A5E A;  1E90 A;  4MS6 A;  3DPD A;  4C9B B;  4Q96 A;  3TWR A;  2CHX A;  4PS7 A;  2P9I G;  3MV3 B;  3QJZ A;  5FQ4 A;  4MRU A;  4GTQ A;  5FQ8 A;  3R7R A;  3ULQ A;  2L6J A;  4UWL A;  2HYZ A;  1QBQ A;  1TN7 A;  5FWQ A;  2KCK A;  5JJ6 A;  3DXK G;  3T8K A;  4AXH A;  4LER A;  3HXF A;  3KS2 A;  4ILI A;  3CSF A;  1OT8 A;  1FVF A;  1KZP A;  1EPU A;  3TG4 A;  1TJF A;  3ZYQ A;  1IQU A;  1YYH A;  4A1G A;  3ZU7 B;  3FDH A;  5CEC B;  4B8C B;  2XRZ A;  4Y6W A;  3V30 A;  5G05 C;  3ZXP A;  2ION A;  3FUE A;  4N39 A;  2QZA A;  3HRA A;  5CRU A;  2ZXW E;  5HI7 A;  2DYR E;  1MJ0 A;  2WXQ A;  5EYP F;  2F37 A;  1OWL A;  1ZB1 A;  4N5C A;  3CVU A;  4FA6 A;  3L54 A;  1K1A A;  5KBA A;  5T4Y A;  4KVO A;  1U3C A;  3CHO A;  3QWP A;  1SQM A;  2J4D A;  1HF8 A;  2P9L G;  3V2O A;  3VLE A;  2ZIR A;  2ETC A;  2FBN A;  4GML A;  3FU0 A;  3FTX A;  3KAE A;  1OWO A;  1UJK A;  3RU0 A;  2OVF A;  3UM2 A;  3C5R A;  3UT8 A;  4WWP A;  1HE8 A;  3TAX A;  3NZU A;  4GYO A;  4HXI A;  5C1D A;  4C0E A;  3O48 A;  3C72 A;  3RRN B;  1IQR A;  3JCK C;  4I17 A;  2NC9 A;  1TNU A;  4APF A;  1OY3 D;  3WG7 E;  5HS0 A;  3PDN A;  3L82 A;  3QAR A;  5KCM A;  1GW6 A;  3N71 A;  3ESL A;  3DSX A;  3E37 A;  5ARG A;  4AEZ C;  3V2X A;  3UI2 A;  4FU3 A;  1S64 A;  5J08 A;  1YA0 A;  3KD7 A;  4C0M A;  3EIQ C;  2JAB A;  4EBA G;  4UI9 C;  1FT2 A;  2ETB A;  2VGY A;  5HQ8 A;  1Z5S C;  5EIB E;  2QYJ A;  4H7Y A;  3FH5 A;  1RW2 A;  3BQO A;  2ETA A;  4UWG A;  3KEZ A;  1AP7 A;  3RO3 A;  2FEZ A;  1PC2 A;  1BD8 A;  3SQV A;  4YND A;  3CQG B;  2KAT A;  4FP7 A;  5AYW D;  4AY5 A;  2WXR A;  5DBK A;  5KJN A;  5LCW C;  3TXN A;  2KCV A;  3EJN A;  2WMN A;  3CKB A;  4I2W A;  2PM6 A;  3ZEF A;  4N3C A;  5FIN A;  3AG3 E;  2J08 A;  2RFA A;  4GB9 A;  3G2W A;  4XEI G;  4JHJ A;  2C0M A;  5BW8 C;  2R59 A;  1BLX B;  2Y3A A;  5ANR A;  4NIK A;  2DVW A;  3L9T A;  4GA0 A;  3ZW3 A;  3HDX A;  4KMO A;  3U64 A;  2ZU6 B;  2J07 A;  3R7Q A;  4JL0 A;  5JHB A;  2I2O A;  3P1U A;  2IF4 A;  4HS2 A;  4J8F A;  3DXM G;  2XZD G;  4LSZ E;  5KNG A;  1HG2 A;  2WPV A;  4HI9 A;  2LNI A;  4AJW A;  4BTA A;  2P9P G;  4HFG A;  3JXI A;  4RSY A;  5E76 A;  1BI7 B;  2X6F A;  2VSX E;  3ONK A;  1TJC A;  1MX2 A;  2BUG A;  2AW6 A;  5ENQ D;  3EU9 A;  2VTB B;  1PAQ A;  3LEW A;  4AP2 A;  4G23 A;  2XQ0 A;  4DX6 D;  2VGX B;  3ZKJ A;  4ACK A;  2AWI A;  4OVU A;  2WXO A;  3MX3 A;  4GTM A;  3ZIM A;  1K8K G;  2L0T B;  1MZC A;  4GCN A;  3CVV A;  3CVL A;  5JHA A;  3Q73 A;  3UT7 A;  5T3R A;  5KJK A;  4JD2 G;  3ZHE A;  1HXI A;  4U95 D;  4QFV A;  3CVW A;  2PM7 A;  4BSZ B;  2EIJ E;  3CVQ A;  2IOS A;  4DUI A;  1JPL A;  3ABL E;  2FO1 E;  1V55 E;  3RO2 A;  3DWL G;  2AXU A;  3IV0 A;  3L22 A;  3G2T A;  1HU3 A;  5E75 A;  3SFY A;  3IEG A;  4I1M A;  2MYO A;  3CEQ A;  4TUU A;  2XCB A;  1IHB A;  2OND A;  4K5B A;  2BED A;  4GZC A;  3SF4 A;  3S7D A;  4U07 A;  4GMJ A;  3DRA A;  5EID A;  4CCA A;  4MLP A;  4YDO A;  2DWZ A;  3HG0 D;  3TWW A;  4AIF A;  4PH4 B;  3SZ7 A;  4XE0 A;  4HVB A;  1HX8 A;  3IHV A;  2GRL A;  4JA9 A;  5KJM A;  1DC2 A;  4ME2 A;  4EQF A;  2GRM A;  4FJZ A;  2QYU A;  3CIA A;  4FAD A;  4J8E A;  2LSU A;  3D9O A;  5ENR D;  1X81 A;  4LNB A;  3OAW A;  3SHF A;  3KEA A;  2JLB A;  4G8K A;  3S7J A;  3PE4 A;  3C3R A;  2I9C A;  3QWV A;  3BU8 A;  1ZBP A;  2KCL A;  3UM3 A;  4K5C A;  3E33 A;  3EIJ A;  3AJI A;  1Y8M A;  4AVX A;  4A55 A;  4KT6 B;  1SZA A;  1HZ4 A;  2OCC E;  4HOU A;  2Q7F A;  3VTX A;  2RFM A;  2RG8 A;  4L1B A;  1NA3 A;  3ZYK A;  4U8Y D;  4DLO A;  3DSU A;  4CYM D;  3IBE A;  3QOU A;  2GRQ B;  4R7L A;  3NOC D;  4W9R A;  4TV3 A;  5C2Y A;  3PEV B;  1N11 A;  3VLD A;  2L0I A;  4ANW A;  2DBA A;  5FZR A;  4E85 A;  2WXL A;  4BFR A;  4HOR A;  1UN8 A;  4GZ6 A;  3MYV A;  2OVB A;  3URZ A;  3PZ2 A;  1ELR A;  3DSS A;  1XNF A;  2J9Q A;  3RRU A;  3FTU A;  3HXE A;  2ILR A;  4LNG A;  2NYJ A;  3DST A;  1B89 A;  2XCC A;  2DIW A;  5BT1 A;  1IYG A;  4JEU A;  4GMR A;  4RVB A;  5LOZ A;  3SY2 A;  4G2V A;  4M3O A;  4AOF A;  4KXK B;  3PUK A;  3AU5 A;  3OTN A;  4UWF A;  3UPV A;  1N54 A;  2GGF A;  3DPY A;  3RIB A;  2LAI A;  3CK9 A;  3TWX A;  4K5A B;  1N9A A;  2V5Q C;  2WB2 A;  3PZ1 A;  2WVI A;  3QAQ A;  4APO A;  3I3N A;  1N95 A;  5G04 J;  3Q7F A;  3G2S A;  1ELK A;  1S70 B;  1JCS A;  2XPI A;  3CR3 A;  1Z3X A;  3B13 A;  2OOE A;  3LJ3 A;  3ZXS A;  3ISM C;  4NAC A;  5ENT D;  5FTP A;  3B7U X;  5DIZ A;  5A23 A;  3Q5M A;  1QNF A;  4GZ3 A;  4FLH A;  1ELW A;  2PQR A;  4GPK A;  3D9N A;  4CZ2 D;  2F8X K;  1UG3 A;  3PE3 A;  5G55 A;  3EHM A;  4I6G A;  4F3V A;  2DZO A;  3Q15 A;  4GTV A;  4U0Z A;  3APD A;  1SVX A;  1TNO A;  1EF1 C;  4TUM A;  4G25 A;  3Q49 B;  4GU5 A;  3RKV A;  5HKP A;  1JWG A;  2FI7 A;  4XKC A;  4DX2 A;  4TXQ A;  1K3Z D;  3TGO A;  3PEU B;  5JMN D;  2CHZ A;  2XHE A;  2XGM A;  3U9W A;  1DVP A;  1Q2Z A;  5D2M C;  2B0O E;  3Q4A B;  5G05 J;  1H0A A;  1E8X A;  1Z3Y A;  3MKR A;  3AG4 E;  3E32 A;  3ASN E;  3EHQ A;  4G11 A;  5KJL A;  4YDE A;  2NXP A;  4BTB A;  3ULE G;  4X8Q A;  5AEN A;  1SW6 A;  3C3Q A;  5A6C A;  3F6Q A;  4DX5 D;  1JCR A;  3CQC B;  3HVE B;  5AN8 A;  4LCT A;  4BES A;  5B3S E;  4WWO A;  2VQ2 A;  3ZVV A;  3FTZ A;  3PNT B;  3I4R B;  1H2U A;  3FUL A;  3TWT A;  4CT4 A;  5CMY A;  4L9P A;  1TNY A;  2R5S A;  3S2A A;  1NZN A;  5BNW A;  3RSE G;  3B95 A;  4I9C A;  1NI1 A;  3RAU A;  4UQZ A;  5FZQ A;  5BPP A;  1OCC E;  3TG5 A;  3B7T A;  3TXM A;  2NSZ A;  4TXR A;  4HOS A;  3MZL B;  4HRL A;  1OUV A;  2R03 A;  5LFA A;  4QQI A;  3LY8 A;  3OXG A;  4JC8 A;  3L08 A;  4N2Q A;  2XPY A;  1Z6T A;  2XS8 A;  1P5Q A;  4A3V A;  4U63 A;  4DI3 A;  2YHC A;  5EX0 A;  3SFX A;  1FVH A;  2KZT B;  2H6H A;  3J5Q B;  4G8L A;  5EKQ D;  2H6G A;  3SBS A;  2PL2 A;  3P2B A;  2QC9 A;  3FTV A;  2X6J A;  3GZ1 A;  1KZO A;  3B7S A;  2XEN A;  4UI9 J;  5EX3 A;  3Q75 A;  3T9K A;  3Q47 B;  3FUI A;  4Q69 A;  2VYI A;  1V54 E;  5B1A E;  2PQN A;  4JA7 A;  3D9J A;  2VTB A;  3W9G A;  5ENO D;  1SA5 A;  4I1O B;  1N0R A;  3DSV A;  5ENS D;  2VGX A;  3PZD A;  3UKU G;  4EPZ A;  5J90 A;  4GZ5 A;  2Y4T A;  4U96 D;  4J8Y A;  2CFU A;  4M7C A;  1OCR E;  5BV0 A;  3DEO A;  2VSY A;  1X5B A;  3HXC A;  3GZS A;  2GRO B;  3Q9N C;  4B93 B;  3RRM B;  2ZIS A;  1NA0 A;  3FP3 A;  3NOG D;  3MGB A;  3T5X A;  2MOW A;  4KBQ A;  4A63 B;  2XRY A;  3AG2 E;  2AXZ A;  4CGW A;  1SZ9 A;  4FLB A;  5KWD A;  4HNA D;  3ZYL A;  3E30 A;  2P9U G;  1BPO A;  4MKT A;  3NAW A;  4CDM A;  4G24 A;  1O5M A;  3BUA A;  2OV8 A;  2J4B A;  3FTY A;  4OAU C;  4WWN A;  1ZU2 A;  2XZT G;  3KSQ A;  2WXH A;  3AAA C;  4O6F A;  2L9B A;  3WXX A;  4JW1 A;  3UIP C;  2VSO E;  4L7T A;  3C98 A;  2I6H A;  3NB2 A;  4Y6C A;  1H2V C;  3KSL A;  4HRM B;  4HLL A;  2LXL A;  4RG9 A;  5JA4 D;  3TWQ A;  3HIZ A;  4PUC A;  1A5E A;  4GCO A;  2H6I A;  5CCL A;  3B7B A;  2XPZ A;  4KZ0 A;  3J5P A;  3FHE A;  5ENN A;  4ZFH A;  4BEP A;  2DCP A;  2X6H A;  2IO2 C;  3CLJ A;  2UY1 B;  3ML9 A;  2V4H C;  1IXV A;  3IXE A;  2VJ8 A;  1TN6 A;  2E0I A;  4GTP A;  1FT1 A;  1H2T C;  2YHE A;  4ABN A;  1NL4 A;  1A17 A;  3DEP A;  2WQ6 A;  1UOH A;  2WMO A;  3LY9 A;  4YVQ C;  4F53 A;  1MYO A;  4ACL A;  1IKN D;  3FH7 A;  4KZC A;  2LSV A;  2PNN A;  2R2L A;  4U04 A;  1BU9 A;  1RZ4 A;  5T8I A;  2YNQ A;  3MV2 B;  4N3A A;  1WM5 A;  1YMP A;  4DJA A;  4C48 B;  4CRW A;  2LUH A;  4J8S A;  5M72 A;  4B0Z A;  3D3M A;  4RQI A;  3Q79 A;  3ZRH A;  3JXJ A;  4BX8 A;  3FTW A;  2WXK A;  3C3O A;  3CVN A;  2GW1 A;  1MHQ A;  4AM9 A;  3CHS A;  4UQX A;  4G1T A;  5JJT A;  4FHJ A;  3EDT B;  3FU3 A;  3D9H A;  4P29 A;  1TNZ A;  3SD5 A;  4BT9 A;  1HFA A;  3SGH A;  5EIL A;  1WAO 1;  4LNU D;  4YDW A;  1PY1 A;  3MKQ B;  1OCO E;  4BSX A;  2IO3 C;  2WXG A;  2GRP B;  3CVY A;  5ENP D;  5ARF A;  2XEH A;  1KT0 A;  2A4Z A;  4XX5 A;  4BWR A;  2VGE A;  4URK A;  1N94 A;  2UWJ G;  1H6O A;  2EQX A;  3HXB A;  2WXF A;  1SA4 A;  4DI4 A;  3FFL A;  3NZS A;  1O1T A;  3ZPJ A;  2PZI A;  3EUV A;  1UN9 A;  5AQ9 A;  2BF0 X;  1BI8 B;  4I6E A;  3CHM A;  5ANL A;  2IFU A;  4O60 A;  2CFZ A;  3FU5 A;  2I1K A;  4GPM A;  3UX4 A;  3TWU A;  4WNE A;  2VSN A;  5FJY A;  5CBN A;  4F1S A;  4HLE A;  4ATZ D;  2OEW A;  4DRX E;  1TYQ G;  2IU1 A;  3E4B A;  4YVO A;  1LD7 A;  4A3T A;  3ASG A;  1L5J A;  1N4Q A;  2AJA A;  2HO1 A;  4U0S A;  3CHP A;  2XS1 A;  3V31 A;  1OWM A;  2P9K G;  4GTS A;  3FUN A;  3R9M A;  3HVE A;  4N3B A;  3PUJ A;  1KLX A;  4NUR A;  1OWN A;  4GTR A;  4E6H A;  4OYS A;  1QZ2 A;  1WG0 A;  3B7R L;  2J8S D;  2IY0 C;  5BUZ A;  3FUM A;  3ZFW A;  3I4G A;  3PNL B;  4HI8 A;  4FC8 A;  4HQD A;  2WXI A;  2P9S G;  1LTX A;  2IJG X;  2A5U A;  1N4S A;  3PZ3 A;  4GYY A;  3JQ1 A;  3AS5 A;  3LXU X;  3UM1 A;  2JEK A;  3ULY A;  5AJL A;  3JUE A;  4XI0 A;  2ZGD A;  1EYH A;  3ONL A;  3CVP A;  3FEY A;  2KZT A;  4BX9 A;  1LF8 A;  5EDS A;  2YQ8 A;  3Q78 A;  4AY6 A;  2WXP A;  3ABK E;  5G04 C;  2R05 A;  2V4L A;  2AVP A;  4UUC A;  5HRY A;  1OXJ A;  2DYS E;  5AAO A;  4F1P A;  4I1A A;  5CHE E;  4J8D A;  2HE0 A;  1G3N B;  5JJ7 A;  3FH8 A;  2KXP C;  4FJY A;  1LD8 A;  3FTS A;  4IN3 B;  2OEV A;  3GW4 A;  2MHK A;  4K0R A;  2KBX A;  4HB5 A;  2WXJ A;  1O1R A;  1N52 A;  1E7V A;  3U3W A;  1HS6 A;  4L2Y A;  2L6B A;  3D9M A;  3Q9U C;  4OVV A;  4ZHB A;  4ILH B;  4PDX A;  4CT0 A;  1JCQ A;  5AJD A;  4CGV A;  3MCX A;  3CK7 A;  5H7P A;  4EZJ A;  2CHW A;  2C0L A;  2V8S E;  4LG6 A;  5AQA A;  3VTY A;  4WNG A;  3BEE A;  3PS6 A;  2P2C P;  2WQH A;  4GA2 A;  2DZN A;  1H6P A;  1U2V G;  4KYO B;  3ZYM A;  4Q94 A;  4V3I A;  4AV7 A;  5CMW A;  4OAV B;  4IRU A;  1N4R A;  2RKK A;  4NQ0 A;  4GYW A;  4UWK A;  3LCA A;  4EZK A;  2HM8 A;  3SBT B;  3LVR E;  3R9A B;  4FHK A;  2X6K A;  3U4T A;  2BKG A;  3FUJ A;  1OCZ E;  5LP0 A;  3MJW A;  3QK0 A;  4LEU A;  3W9F A;  5FZS A;  1K1B A;  3LS8 A;  3LYA A;  2XEE A;  3X2Q E;  4GZD A;  3S7B A;  3CST A;  2P58 C;  2KM4 A;  4XI9 A;  4I2Z A;  2BTD A;  2J49 A;  2EIM E;  1FPP A;  1WDY A;  4I6J A;  2F8Y A;  3T5V A;  2UY1 A;  4GAA A;  1QYM A;  2QY7 A;  3EU5 A;  3L6A A;  4JVS A;  3CGH A;  4KVM A;  3D9I A;  3NF1 A;  4JB8 P;  2KC7 A;  3CV0 A;  4ATG A;  5LX8 A;  5LCW J;  4ANU A;  4XIF A;  3PRZ A;  5D0Q D;  1AWC B; 
#chains in the Genus database with same CATH homology
 2WXL A;  4EZL A;  4U04 A;  3RJV A;  4BFR A;  4HOR A;  2L6J A;  2X3M A;  1UN8 A;  3HHM A;  4JEH A;  4L2L A;  2HYZ A;  2WXM A;  4GZ6 A;  3MYV A;  4UWL A;  5FWQ A;  2KCK A;  2OVB A;  5JJ6 A;  3URZ A;  5T8I A;  4JHK A;  2YNQ A;  3MV2 B;  4AXH A;  4N3A A;  1ELR A;  4LER A;  1WM5 A;  2RD0 A;  4IYP A;  1XNF A;  4DJA A;  3KS2 A;  4ILI A;  2J9Q A;  3RRU A;  3CK8 A;  4CRW A;  3CSF A;  4J8S A;  1FVF A;  3FTU A;  2IQC A;  5M72 A;  4EBA A;  1EPU A;  3TG4 A;  1TJF A;  3ZYQ A;  2I1J A;  2ILR A;  3D3M A;  1IQU A;  1U3D A;  4B0Z A;  4A1G A;  3IHY A;  1B89 A;  1HH8 A;  3ML8 A;  3JUI A;  2XCC A;  2XGS A;  2DIW A;  3FDH A;  5BT1 A;  1IYG A;  3ZRH A;  4JEU A;  4B8C B;  2XRZ A;  4Y6W A;  4BX8 A;  4RVB A;  5G05 C;  2ION A;  5LOZ A;  3FTW A;  3FUE A;  3T8M A;  4N39 A;  2WXK A;  3CVN A;  1IHG A;  5HI7 A;  4G2V A;  4M3O A;  4AOF A;  4KXK B;  2GW1 A;  1MHQ A;  4AM9 A;  1INZ A;  3PUK A;  2IOL A;  2WXQ A;  3AU5 A;  3CHS A;  3OTN A;  4UWF A;  3UPV A;  1N54 A;  4UQX A;  4ANV A;  2GGF A;  3RIB A;  2LAI A;  4G1T A;  1OWL A;  3CK9 A;  4N5C A;  3CVU A;  5JJT A;  4FA6 A;  4FHJ A;  3L54 A;  3EDT B;  3BG1 B;  3FU3 A;  1TEZ A;  3SFZ A;  5CCM A;  4JPS A;  4P29 A;  5T4Y A;  2WB2 A;  4KVO A;  1U3C A;  3CHO A;  2WVI A;  3QWP A;  3QAQ A;  1XGW A;  4APO A;  3I3N A;  3UUX A;  5G04 J;  1SQM A;  3D9K A;  4ANX A;  2J4D A;  3SD5 A;  1HF8 A;  4BT9 A;  3G2S A;  1HFA A;  3SGH A;  1WAO 1;  3MKQ A;  3VLE A;  1PY1 A;  1ELK A;  3FUH A;  3MKQ B;  4BSX A;  2WXG A;  3LY7 A;  3PRE A;  2FBN A;  2XPI A;  3CR3 A;  3CVY A;  4GML A;  3FU0 A;  3FTX A;  5ARF A;  3KAE A;  1OWO A;  1KT0 A;  1Z3X A;  1UJK A;  2A4Z A;  4XX5 A;  3B13 A;  2OOE A;  3L13 A;  3LJ3 A;  3RU0 A;  4BWR A;  2OVF A;  3ASF A;  3VLF A;  3ZXS A;  4ILG A;  1E8Y A;  4URK A;  4NAC A;  2WQ7 A;  3QWW A;  2UWJ G;  5FTP A;  3UT8 A;  3B7U X;  4WWP A;  2EQX A;  1HE8 A;  3TAX A;  3NZU A;  5DIZ A;  5A23 A;  4XZ4 A;  4GYO A;  4HXI A;  2WXF A;  4DI4 A;  1MQS A;  3ASD A;  3Q5M A;  3FFL A;  3O48 A;  1QNF A;  4GZ3 A;  4C0E A;  5C1D A;  4FLH A;  3RRN B;  1ELW A;  1IQR A;  2PQR A;  3JCK C;  3NZS A;  3ZPJ A;  2FO7 A;  4GPK A;  2PZI A;  3D9N A;  4I17 A;  1UN9 A;  1UG3 A;  2BF0 X;  2NC9 A;  3PE3 A;  2YIN A;  4I9E A;  5G55 A;  3EHM A;  1H19 A;  4I6E A;  1UJJ A;  4I6G A;  4F3V A;  3CHM A;  3Q15 A;  4BT8 A;  3D9P A;  4J6I A;  4APF A;  5ANL A;  4U0Z A;  2IFU A;  3APD A;  3PDN A;  4U8H A;  4D10 C;  3QAR A;  5KCM A;  1GW6 A;  3APC A;  2CFZ A;  3FU5 A;  2I1K A;  3N71 A;  1EF1 C;  3ESL A;  3JYS A;  4G25 A;  3Q49 B;  5FQ7 A;  3ZGQ A;  4GU5 A;  3RKV A;  3UX4 A;  4WNE A;  1JWG A;  2VSN A;  5ARG A;  2FI7 A;  4XKC A;  5FJY A;  3CKC A;  4F1S A;  4HLE A;  3TGO A;  4IUL A;  4PS8 A;  4AEZ C;  2Y4U A;  4UI9 K;  3PEU B;  2CHZ A;  2XHE A;  2IU1 A;  2XGM A;  3E4B A;  3QDN A;  4FU3 A;  4YVO A;  3U9W A;  4B89 A;  5J08 A;  1YA0 A;  4A3T A;  3ASG A;  3L16 A;  1DVP A;  3GZ2 A;  2J09 A;  2CG2 A;  2V0P A;  3KD7 A;  1W3B A;  3QNK A;  3EIQ C;  1L5J A;  4C0M A;  3EHN A;  4EBA G;  4UI9 C;  3Q4A B;  5G05 J;  3CVX A;  1H0A A;  1UW4 B;  2AXV A;  2VGY A;  1E8X A;  1Z3Y A;  3MKR A;  5HQ8 A;  3RK6 A;  2HO1 A;  4DLQ A;  3MEK A;  3CHR A;  4CDR A;  4HOT A;  4H7Y A;  3FH5 A;  4G11 A;  4U0S A;  5KJL A;  3CHP A;  2NXP A;  4NRH B;  4UWG A;  3TL5 A;  4BTB A;  3IKO B;  3KEZ A;  3RO3 A;  1OWM A;  4JXT A;  2FEZ A;  3MA5 A;  3ESK A;  1PC2 A;  2M63 A;  4YND A;  3CQG B;  5AEN A;  2KAT A;  3FUN A;  3FU6 A;  1KT1 A;  4FP7 A;  5AYW D;  4AY5 A;  4G26 A;  2WXR A;  5A6C A;  5DBK A;  1QQE A;  3HVE A;  5KJN A;  4PS3 A;  3CQC B;  5LCW C;  3U66 A;  3HVE B;  3TXN A;  4N3B A;  3PUJ A;  4LCT A;  2KCV A;  1E96 B;  1KLX A;  1JWF A;  1NP7 A;  4NUR A;  1OWN A;  3EJN A;  2WMN A;  3CHQ A;  4B94 A;  2XGO A;  4WWO A;  4E6H A;  2V5F A;  2VQ2 A;  4F7A A;  3ZVV A;  3FTZ A;  3CKB A;  3PNT B;  4I2W A;  1E8W A;  3I4R B;  2PM6 A;  4OYS A;  3ZEF A;  1QZ2 A;  4A1S A;  3B7R L;  4N3C A;  1H2U A;  3FUL A;  4J0U A;  4CT4 A;  3PH0 C;  4I43 A;  2J08 A;  5CMY A;  5BUZ A;  3FUM A;  4GB9 A;  3G2W A;  3SNX A;  3ZFW A;  2R5S A;  2MRI A;  3I4G A;  3PNL B;  4JHJ A;  3S2A A;  4FC8 A;  4H7X A;  2WXN A;  1NZN A;  2C0M A;  3ENE A;  4K03 A;  5BNW A;  2WXI A;  4I9C A;  5BW8 C;  2R59 A;  4LUN U;  4UQZ A;  3GYZ A;  5FZQ A;  4B8A A;  3OXL A;  5BPP A;  2Y3A A;  2IJG X;  2A5U A;  3FWV A;  3TG5 A;  3B7T A;  2LO6 A;  2NSZ A;  3TXM A;  5ANR A;  4EEC A;  4HOS A;  3MZL B;  4GA0 A;  3ZW3 A;  3HDX A;  4KMO A;  1OUV A;  1DNP A;  4GA1 A;  4GYY A;  4N2S A;  4UQY A;  5LFA A;  3U64 A;  3JQ1 A;  3AS5 A;  3LXU X;  3FEX A;  3LKU A;  2ZU6 B;  2J07 A;  2R17 C;  2JEK A;  3LDZ A;  3LY8 A;  3OXG A;  3R7Q A;  4JC8 A;  3L08 A;  4XI0 A;  5AJL A;  4JL0 A;  5JHB A;  1EYH A;  2XPY A;  4N2Q A;  2I2O A;  1E8Z A;  3ONL A;  3P1U A;  2IF4 A;  1Z6T A;  3CVP A;  3G2V A;  1P5Q A;  4A3V A;  3FEY A;  4HS2 A;  4U63 A;  4J8F A;  4DI3 A;  2YHC A;  2KZT A;  5EX0 A;  4BX9 A;  1LF8 A;  4U0U A;  3FY4 A;  5EDS A;  1FVH A;  1Y6I A;  2YQ8 A;  1HG2 A;  2WPV A;  3QB2 A;  2KZT B;  2LNI A;  4AJW A;  4BTA A;  4AY6 A;  5EKQ D;  2WXP A;  4HFG A;  3SBS A;  3DBS A;  2PL2 A;  3P2B A;  4RSY A;  3FTV A;  2X6J A;  3GZ1 A;  3ASH A;  5G04 C;  3B7S A;  2CG3 A;  5E76 A;  5G2N A;  2V4L A;  2VSX E;  2X6F A;  2AVP A;  4UI9 J;  5AIJ A;  5EX3 A;  3ONK A;  1TJC A;  3AS8 A;  3APF A;  3Q47 B;  3FUI A;  4BY6 A;  2BUG A;  4Q69 A;  2VYI A;  2X6I A;  3SI5 A;  2PQN A;  3UMV A;  2AW6 A;  4I1A A;  4JA7 A;  3L17 A;  4L23 A;  4J8D A;  5CHE E;  3D9J A;  5JJ7 A;  2VTB A;  3UT4 A;  3FH8 A;  1VDY A;  4FJY A;  3O4Z A;  4CDN A;  3FTS A;  2VTB B;  3OXF A;  4IN3 B;  4I1O B;  1PAQ A;  3D9L A;  3GW4 A;  3LEW A;  4AP2 A;  2VGX A;  3PZD A;  2MHK A;  4K0R A;  1H6K A;  4G23 A;  4EPZ A;  5J90 A;  4GZ5 A;  2E2E A;  2WXJ A;  2XQ0 A;  2Y4T A;  2C2L A;  3QC1 A;  2VGX B;  3BG0 B;  1N52 A;  4ACK A;  2AWI A;  4OVU A;  2WXO A;  3MX3 A;  2HR2 A;  3ZIM A;  2CFU A;  2L0T B;  5BV0 A;  4GCN A;  1E7V A;  3CVL A;  5JHA A;  3CVV A;  4LRZ A;  3U3W A;  2VSY A;  2WM9 A;  3UT7 A;  1HS6 A;  1X5B A;  5T3R A;  3GZS A;  3HYM B;  5KJK A;  3RRM B;  4L2Y A;  3QKY A;  3D9M A;  3ZHE A;  1HXI A;  1E7U A;  4OVV A;  3S7F A;  4ILH B;  4PDX A;  1NA0 A;  3FP3 A;  3ZHE B;  4CT0 A;  4QFV A;  3CVW A;  2PM7 A;  3MGB A;  3NQP A;  5AJD A;  3T5X A;  2MOW A;  4CGV A;  3MCX A;  3CK7 A;  4EZJ A;  2CHW A;  1EDU A;  2C0L A;  3CVQ A;  2V8S E;  2IOS A;  4HOQ A;  4KBQ A;  3VTY A;  1JPL A;  4DPR A;  4WNG A;  2XRY A;  3BEE A;  3RO2 A;  2AXU A;  3PS6 A;  3IV0 A;  3L22 A;  3TJP A;  2AXZ A;  2WQH A;  4CGW A;  2FUL A;  3G2U A;  1HU3 A;  3G2T A;  1SZ9 A;  4FLB A;  3LPZ A;  4GA2 A;  5E75 A;  4HVB A;  3K9I A;  3IEG A;  1HO8 A;  3ZYL A;  4I1M A;  4XKB A;  1BPO A;  4MKT A;  3CEQ A;  4TUU A;  4KYO B;  3ZYM A;  2XCB A;  4CDM A;  4G24 A;  4FUL A;  4Q94 A;  4V3I A;  4AV7 A;  4CEM A;  2OV8 A;  2J4B A;  1FCH A;  2OND A;  3FTY A;  5CMW A;  4WWN A;  4GZC A;  4IRU A;  3SF4 A;  3FUD A;  1ZU2 A;  3S7D A;  4U07 A;  4NQ0 A;  4GMJ A;  2WXH A;  1HG5 A;  4CCA A;  4GYW A;  4MLP A;  4O6F A;  4UWK A;  5D0O D;  4JZY A;  4RG6 A;  1OWP A;  4AIF A;  2L9B A;  3WXX A;  4JW1 A;  4PH4 B;  5BV1 A;  2VSO E;  3SZ7 A;  3I5P A;  4L7T A;  4XE0 A;  3LCA A;  4EZK A;  2HM8 A;  1HX8 A;  3C98 A;  2LAH A;  3IHV A;  3SBT B;  2I6H A;  3LVR E;  3R9A B;  4FHK A;  2GRL A;  4JA9 A;  2X6K A;  4Y6C A;  5KJM A;  1H2V C;  3U4T A;  4WNF A;  2FF4 A;  3FUJ A;  4ME2 A;  4TRQ A;  3LVQ E;  1S0P A;  4RG9 A;  4EQF A;  5LP0 A;  3MJW A;  2GRM A;  3QK0 A;  4FJZ A;  3CIA A;  4FAD A;  4LEU A;  4J8E A;  3AU4 A;  2LSU A;  3D9O A;  3HIZ A;  4PUC A;  5FZS A;  2X38 A;  3LS8 A;  3OAW A;  3LYA A;  3SHF A;  4GCO A;  3JQ0 A;  2JLB A;  4GZD A;  3S7B A;  4DK5 A;  3S7J A;  3CST A;  3PE4 A;  5CCL A;  2I9C A;  2P58 C;  3QWV A;  5A7D B;  2KM4 A;  4XI9 A;  2XPZ A;  4I2Z A;  1WY6 A;  2BTD A;  4KZ0 A;  4WUY A;  1ZBP A;  4UWH A;  1JUQ A;  2KCL A;  2J49 A;  4JHR A;  3FHE A;  5ENN A;  3EIJ A;  1Y8M A;  3ZN3 A;  4AVX A;  4A55 A;  4KT6 B;  3FUK A;  4I6J A;  1SZA A;  2UY1 A;  1HZ4 A;  3T5V A;  2DCP A;  2X6H A;  4GAA A;  3FUF A;  2XEV A;  4HOU A;  3CLJ A;  2Q7F A;  5FT9 A;  3VTX A;  2UY1 B;  2RG8 A;  2QY7 A;  3L6A A;  3ML9 A;  4L1B A;  4WAF A;  3UQ3 A;  2QFC A;  5FQ6 A;  1NA3 A;  3AS4 A;  3ZYK A;  4WND A;  4DLO A;  2VJ8 A;  3PVL A;  4JVS A;  1E90 A;  2E0I A;  4MS6 A;  3IBE A;  3QOU A;  3CGH A;  4KVM A;  3D9I A;  3NF1 A;  1H2T C;  2YHE A;  4R7L A;  4ABN A;  3DPD A;  1A17 A;  2KC7 A;  4Q96 A;  4C9B B;  2WQ6 A;  3CV0 A;  4W9R A;  2CHX A;  2WMO A;  3LY9 A;  4PS7 A;  4ATG A;  5LX8 A;  5LCW J;  4TV3 A;  4YVQ C;  3PEV B;  5C2Y A;  4F53 A;  3MV3 B;  3QJZ A;  4ACL A;  5FQ4 A;  4MRU A;  4ANU A;  4XIF A;  5FQ8 A;  3VLD A;  2L0I A;  4ANW A;  3FH7 A;  3PRZ A;  3R7R A;  2DBA A;  3ULQ A;  5D0Q D;  4KZC A;  5FZR A;  4E85 A;  2LSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...