5LP0A

Crystal structure of the zebra fish enth domain from epsin1 in 1.41 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
140
structure length
140
Chain Sequence
GAMGSSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHALKTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A bacterial genetic selection system for ubiquitylation cascade discovery.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
molecule keywords Epsin 1
total genus 59
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lp0A00
1UJJA 3D9NA 4JXTA 1JPLA 4AVXA 5CMYA 1HFAA 1MHQA 1UJKA 1DVPA 1JWFA 1X5BA 1VDYA 3G2SA 1HG5A 4Q94A 5LOZA 3G2VA 1SZ9A 3D9IA 3ZYQA 3ZYKA 3G2UA 3D9JA 3ZYLA 2LO6A 3ONKA 3D9MA 1ELKA 4NACA 4Q96A 3ZYMA 1PY1A 1JUQA 3CLJA 4FU3A 5LP0A 1XGWA 3D9OA 4HFGA 3G2TA 3RRUA 2L0IA 1JWGA 2DCPA 3D9LA 3G2WA 4FLBA 5CMWA 1HF8A 3D9PA 3LDZA 2DIWA 1INZA 2MOWA 1HX8A 4GZCA 1EDUA 3D9KA 1EYHA 1HG2A 1H0AA 2L0TB 1SZAA 2V8SE 5J08A 2BF0X 4GZDA 2QY7A 3ONLA 1LF8A 2KM4A
chains in the Genus database with same CATH superfamily
3CHOA 3OXLA 3E34A 3HRAA 3JUEA 3E37A 3RK6A 3L13A 3S7FA 1N11A 4DUIA 4UWKA 2MYOA 2XENA 5EIBE 4U8VD 4G1TA 2JEKA 1ZB1A 3BG1B 1N4QA 3D9NA 2ETAA 2GROB 3AU5A 5FT9A 3U9WA 3ZXPA 1HXIA 1Y6IA 5FIOA 2IOSA 3UT7A 5JJTA 3APCA 3P1UA 2J09A 3ULQA 4KXKB 5KJNA 1NA0A 1FCHA 2XGMA 4ANUA 3RU0A 3T5VA 2V5FA 1HS6A 4WWPA 2H6GA 1H0AA 3L16A 1HH8A 2Y0BG 3C98A 2WQ7A 4ZFHA 2EILE 4L1BA 3RRUA 3N71A 1TNOA 2XRZA 5AQ9A 2AXVA 1OWPA 1QZ2A 2QY7A 1H19A 4EZKA 4Q69A 3AU4A 4ANWA 3QDNA 3PUKA 2EIKE 2UY1B 2DYRE 2CFUA 3ENEA 1BU9A 2WM9A 5EKQD 2BEDA 5KJLA 3Q7AA 4KBQA 3TJPA 2L0IA 3NOGD 3UM3A 3CKCA 3JCKC 1S64A 5D0QD 4CT4A 3D3MA 3MEKA 1FVHA 2KM4A 3IKOB 3U4TA 4BFRA 4LRZA 3APFA 4ME2A 2XCBA 2Q7FA 4GA1A 1LD7A 2J08A 1E8XA 1IQUA 3UPVA 1MX2A 1HG2A 4RVBA 4LNGA 3MX3A 4APFA 3AG4E 3MCXA 2GRQB 3PDNA 5D0OD 4I6GA 5CMYA 2WXFA 4FC8A 3Q78A 4B94A 2CG2A 5AJLA 2Y4TA 4HS2A 2VSXE 5E76A 5T8IA 1E8YA 4ATZD 4TV3A 3UIPC 1JCQA 2YNQA 3K9IA 2IEJA 2R5SA 3T8KA 2RFMA 2ZU6B 2NSZA 5AQ7A 2GRMA 1N0RA 1BD8A 2WXJA 3VTXA 3FUIA 2DWZA 4U95D 3PNTB 3DBSA 3AG3E 2V0PA 5AJDA 1OCZE 2HR2A 1D8DA 3TWWA 2VQ2A 3FUKA 5HRYA 3NB2A 3ZYLA 4J0UA 3BU8A 4G2VA 3G2WA 3PS6A 3L9TA 3LJNA 1QBQA 2GW1A 4XI9A 3HG0D 3CK7A 5C2YA 3MKRA 1EPUA 2BKKB 5AQBA 3ULYA 2LUHA 1JCSA 4JC8A 4O6FA 4WNDA 3EJNA 2CG3A 2DBAA 3IHVA 3ZN3A 4NIKA 3GW4A 3DSTA 4GB9A 1U2VG 3JQ0A 2IFUA 5G04C 1YA0A 3HIZA 3RKVA 4KZCA 2KZTB 2P58C 3NZSA 4GZ6A 3D9MA 1O1SA 2B0OE 2NYJA 5LCWC 3RO2A 3O48A 4CCAA 3QC1A 3AAAC 3ASNE 4C0EA 3Q49B 2AJAA 2WXIA 5M72A 3Q47B 3PEUB 3Q75A 4HRLA 3MZLB 4AJWA 1TEZA 3CVXA 4OAVB 2R03A 1VDYA 4URKA 1N9AA 4MLPA 3ML9A 3KSQA 2VGYA 2E2EA 3FH7A 2AVPA 3SBSA 4HLLA 5BV0A 2QYUA 4U0SA 4JA9A 3BG0B 4F6RD 1YCSB 4N3CA 2XGOA 4GTVA 2J07A 4UI9K 1IHBA 2WMOA 4JW1A 1DNPA 3LYAA 2A5UA 4GZCA 3SD5A 1PC2A 1E90A 3J5PA 5FQ6A 3VLEA 2BF0X 3B7BA 4BT9A 4NQ0A 2EINE 5D66A 2PQNA 3VTYA 3FTWA 1FPPA 3CHPA 4PH4B 4HB5A 4GMLA 4K03A 2X6HA 3L17A 3APDA 3LY9A 4FA6A 2QC9A 3KEZA 3EUVA 1OWMA 4KMOA 1DCQA 1OWNA 3D9IA 3L54A 1XGWA 4FJZA 2I2OA 2CFZA 3C5RA 3WXXA 4OVUA 5ANRA 1YMPA 1TYQG 2V5QC 1L5JA 2A4ZA 1HE8A 3RO3A 1HG5A 1YYHA 4RQIA 4K5BA 1PY1A 3FEXA 3PZ2A 4U04A 1A17A 1IYGA 3TWXA 2P9LG 4L7TA 3FFLA 3MYVA 3V79K 5CRUA 2WXMA 4JHKA 3SNXA 4Q96A 3MGBA 3VLDA 3HXCA 2IU1A 3KSLA 4MS6A 1LTXA 4HXIA 2AXZA 5JHBA 3FUJA 3PNLB 3GYZA 4XIFA 5LCWJ 2RG8A 4HNAD 1Y8MA 3PEVB 4ILIA 2IONA 3ISMC 4D10C 3CEQA 5DIZA 3C3QA 4B8AA 1N94A 1H2TC 2WXQA 2Y1LE 2XPIA 3IHYA 4YVOA 1JPLA 4YNDA 4HORA 1O5MA 3CQGB 3V2XA 1AWCB 2F0YA 4PS3A 1QNFA 3S7BA 5CEDB 4C9BB 2A5EA 3NQPA 4C0MA 3FUHA 2VJ8A 4LG6A 2KBXA 3TWTA 4ANXA 4DPRA 3FU6A 3FH5A 3D9HA 2P9KG 3SQVA 3FULA 3FTSA 3UI2A 1V54E 4N3AA 5CMWA 4BETA 3UT4A 2BTDA 2FO7A 4DRXE 2XCCA 1Z3YA 1PAQA 2JABA 4GPKA 1MYOA 4ANVA 3FTYA 2NXPA 1RW2A 3CLJA 1OWLA 5G05J 1OWOA 4GA2A 3W9FA 1OCRE 1H2UA 5EDSA 3EHNA 4UWGA 4WAFA 3TWRA 5BT1A 5ENPD 4CGVA 4DX5D 3ASGA 4GMJA 2OVFA 2GRRB 5KBAA 4AP2A 4BERA 1HX8A 3E33A 3CGHA 4GU5A 2PQRA 3HVEA 1NL4A 5BUZA 1BI8B 4H7XA 3NAWA 3C3RA 2XRYA 3ESKA 5LOZA 4BSZB 2OVBA 1MJ0A 2ETBA 2P9PG 5AQAA 5KWDA 2X38A 4J8FA 4B93B 2C2LA 3C3OA 4HVBA 1SW6A 2X6JA 3NBNB 1KPSB 1WDYA 2VGEA 2J9QA 5EYPF 1LF8A 5E75A 1S63A 1X5BA 4DLQA 4C48B 1E8ZA 5G55A 2OOEA 4UWFA 4GTPA 4UWLA 4BSXA 3KS2A 5FQ8A 1X81A 4FHJA 5HI7A 5CCMA 3TWVA 4MKTA 3B95A 1E8WA 3QWPA 5CRVA 4FHKA 2GGFA 3ZXSA 3WG7E 3U66A 3CVVA 4AEZC 4TXPA 1NA3A 4HRNA 1TN7A 4GYOA 2IOLA 2ZIRA 3Q15A 2VGXB 4DI4A 5FINA 3HXDA 3V2OA 3UTMA 1V55E 3FH8A 5ARGA 3SI5A 3CSTA 3ML8A 1JUQA 3EHMA 4U0UA 4I1OB 1ELWA 1HF8A 3PVLA 2R02A 3UM1A 3MJWA 1Z5SC 1EDUA 2P2CP 2KC7A 3C72A 5HQ8A 4IYPA 3T8MA 4UI9C 1D8EA 5H7PA 3G2SA 3RRMB 1DVPA 3FU0A 2QFCA 5A6CA 2J8SD 1UOHA 1UN9A 3I3NA 2HO1A 2E0IA 4AOFA 2LXLA 1HO8A 1DC2A 3JYSA 3ZW3A 2PZIA 5LX8A 5FZQA 4HRMB 5C1DA 3OAWA 1NP7A 5G04J 4I2ZA 4JPSA 3FTUA 1OXJA 3FUNA 2RKKA 4BT8A 4I1AA 4U0ZA 3D9OA 2PNNA 3ZIMA 1H6OA 5JJ6A 4K5CA 3QAQA 1FVFA 1SZAA 4DJAA 3B7UX 3HHMA 3T9KA 3LDZA 4GTRA 4CGWA 3QKYA 4XE0A 4GTTA 4G8LA 2ZGGA 4F1PA 1MZCA 2C0LA 2FO1E 3QK0A 4G23A 2F8XK 2ZGDA 5ANLA 4ACKA 3FUEA 3NOCD 5FQ7A 2YHEA 3SGHA 5JA4D 4BWRA 4WNGA 5EN5D 4AVXA 5KJKA 3LKUA 4G11A 4QQIA 2IY0C 3I4GA 2LSVA 1OT8A 2QYJA 4Y6CA 2L6BA 3ABLE 3DEPA 3FTXA 4UQZA 4GA0A 1AP7A 1HU3A 1K1BA 3Q5MA 3IBEA 1Z6TA 5DBKA 5EX0A 3ZNGA 1N4SA 4XZ4A 3B7RL 3MV3B 4TXRA 3ZRHA 3LEWA 5FWQA 1N95A 5BXUA 3KAEA 3Q73A 4JA7A 5CERB 2OEVA 5J08A 3AS5A 1UJKA 1S70B 4TRQA 1WAO1 4I6EA 4XEIG 5ENQD 3S7DA 2AW6A 4RSYA 4J8EA 5EILA 2WPVA 3TXMA 3BQOA 3ABKE 3DEOA 3DSVA 2ILRA 3CHSA 4GTOA 4GZ3A 4WUYA 3ZYQA 2KCKA 4UUCA 1ELKA 2X6FA 3F6QA 5HKPA 4M3OA 2WXOA 4FLBA 3UXGA 4A63B 3ULEG 2WXKA 3L22A 1NFIE 4IULA 5LFAA 3HXBA 4GAAA 4JZYA 4GYWA 2GRPB 2HE0A 1N4RA 5KCMA 3RJVA 2UY1A 2LNIA 2XHEA 2VGXA 2P9SG 4J8SA 3NF1A 3UIOC 3CQCB 3FHEA 2KZTA 4A55A 2DZNA 3ZGQA 3KD7A 4EBAG 2X6KA 5ARFA 4CEMA 3PZ1A 4GYYA 4GZ5A 4KT6B 4P29A 4OAUC 4U63A 3I4RB 2XPZA 4NACA 3ZYMA 1H2VC 3AG1E 1OUVA 3R9AB 2PM7A 3LXUX 4TUUA 4BX8A 4N2QA 4EPZA 4U8HA 5EX3A 3QARA 3DSUA 3DSWA 4HOTA 5CECB 3RRNB 3LY7A 1MHQA 4PUCA 5EIDA 3EDTB 2XS8A 3DXMG 2VYIA 3UQ3A 4I17A 4HI8A 4AXHA 4WNFA 2GRNB 3CK8A 5HS0A 3ASOE 4KVMA 3CK9A 2OCCE 2JLBA 3TWUA 1SQMA 2EIJE 2LSUA 2X6IA 4FJYA 2CHWA 2EQXA 4G25A 3ONKA 4LCTA 4EQFA 4CDMA 3HXEA 2B6CA 3D9PA 3UM0A 4GMRA 2FI7A 4JVSA 2I6HA 3QWWA 4JHRA 4AY6A 4B0ZA 4ATGA 1N0QA 4LEUA 1TJFA 2I9CA 4YDYA 3TG4A 4EECA 4JEHA 5KJMA 5EYLA 3S2AA 5G05C 3LJ3A 4DK5A 4BEPA 2QZAA 3RSEG 1MQSA 1IQRA 3PE3A 3FU3A 2WXGA 4XX5A 1W3BA 4I1MA 4APOA 4B8CB 3UUXA 5AN8A 3CHQA 2IO2C 5CBNA 2EIME 3ZPJA 2L9BA 3Q7FA 2FBNA 3V30A 3SF4A 3FEYA 4JEUA 4R7LA 2PM6A 5ENSD 2VTBB 3UKRG 4HOSA 2AXUA 2IO3C 1BI7B 2LXMA 4G24A 2Y3AA 3NZUA 3URZA 5FTPA 2XPYA 5T4YA 3Q79A 1K1AA 3FTZA 3S7JA 2WXLA 4RG6A 4BY6A 4JD2G 3P2BA 3FUFA 4PS7A 2M63A 3CHMA 4DX1A 5ENOD 4UQYA 3DSSA 3PH0C 1INZA 2WB2A 4HI9A 2ETCA 4CZ2D 5B3SE 1SVXA 3FWVA 2Y69E 4Q94A 4FADA 4I6JA 2FF4A 3ABME 3FY4A 4LERA 3RAUA 3PZ3A 2R2LA 3SFZA 2P9NG 2AWIA 2XGSA 4XI0A 4IN3B 5CHEE 4X8QA 2H6FA 2DIWA 4FLHA 3ASHA 3QNKA 1QYMA 4V3IA 1H6KA 4YDEA 2XZTG 4BESA 3MKQA 2I1KA 3G2VA 5FZSA 5ENTD 1MX4A 4KZ0A 4HBDA 3J5QB 4YDWA 3B7SA 3Q4AB 1MX6A 2ZXWE 4JHJA 1UW4B 3DRAA 1O1TA 1TNYA 4RLYA 4PDXA 1ZBPA 4GPMA 1SA4A 2XZDG 4CDNA 4FULA 3DPDA 4F1SA 4YVQC 4HFGA 4JB8P 5FQ4A 3JXIA 4GTMA 4QFVA 4BX9A 3GZ1A 2PL2A 4EBAA 2WXNA 2OV8A 4E6HA 2V4HC 2MHKA 1NZNA 3FP3A 3JUIA 1ZU2A 4U07A 4RG9A 3TAXA 1BPOA 1N54A 3HDXA 4WWNA 3CV0A 5AENA 4A3TA 4L2LA 5AARA 3PUJA 2F8YA 1HFAA 4DLOA 3TGOA 4HOQA 3ZYKA 3ZHEA 1DCEA 3Q9UC 5B1AE 4DI3A 3BEEA 1P5QA 3D9LA 4LNUD 5D2MC 3QWVA 1RZ4A 3JQ1A 1QQEA 4M7CA 1K3ZD 3QOUA 2WQHA 4FP7A 3IEGA 4I9EA 4O1OA 2CHZA 3AS4A 4CRWA 3CVPA 5CBOA 3JXJA 3E4BA 3DSXA 3MV2B 2MRIA 1HZ4A 2FULA 4H7YA 4O60A 1ELRA 3TWQA 5CEAA 3L82A 3CHRA 1WG0A 2P9UG 5AAOA 3UINC 2CHXA 5A23A 2ZISA 4K0RA 3DXKG 1IHGA 2DYSE 3SY2A 4ABNA 4HOUA 1KZPA 4N5QA 3EIJA 4J8DA 2XQ0A 1D9SA 3PZDA 5AIJA 4ILHB 3CVLA 2H6IA 2WMNA 3AS8A 4W9RA 3HVEB 1KT0A 4LUNU 4NURA 5IY5E 4G26A 3UT8A 3SO8A 2OEWA 4TXQA 5ENRD 4GCOA 5BNWA 1TJCA 1UG3A 2P9IG 4N2SA 2X3MA 5FJYA 4ILGA 2L0TB 3GZ2A 3CVWA 4J6IA 2Y4UA 3ZFWA 5JMND 1N52A 3ASDA 5ITZF 3G2TA 2R17C 3ZU7B 3ZEFA 1KLXA 1U3DA 2V8SE 3O4ZA 3EU5A 1K8KG 4N39A 3IV0A 5BXOA 4A3VA 4A1SA 2UWJG 3E32A 1TN6A 2DZOA 4EZLA 4GTQA 1LD8A 3B7TA 5CCLA 3SFYA 3L6AA 2KCLA 1IKND 1Z3XA 1NI1A 3CVYA 4JXTA 5J90A 3SZ7A 2RFAA 2XEHA 2YINA 4J7WA 4OYSA 2WXPA 3SHFA 4N3BA 2WVIA 3L08A 4AV7A 2WXHA 2WQ6A 4CT0A 1TNUA 3E30A 3RIBA 2LAHA 4E85A 3FU5A 3ZKJA 3EHRA 3R9MA 4N5CA 3SFXA 3OTNA 4HLEA 4UQXA 4JL0A 3D9KA 2NC9A 3HYMB 1H6PA 5KNGA 1BLXB 4A1GA 2HYZA 4KYOB 3T5XA 3ZVVA 4LSZE 4GTSA 5JJ7A 3DPYA 4DX2A 2YQ8A 4KVOA 3Q9NC 4EHMA 4AY5A 3PREA 2XEVA 2I1JA 4EZJA 3CSFA 3TWSA 5BV1A 4I43A 3FUDA 2C0MA 2FEZA 5LP0A 1FT1A 4AIFA 1E7UA 4G8KA 3LCAA 3QB2A 4GZDA 4WNEA 3R7RA 2IF4A 4F53A 2BUGA 3MA5A 5T3RA 1E7VA 3CIAA 2J4BA 4L9PA 2VSOE 3ZHEB 2ONDA 1SA5A 1SZ9A 2V4LA 3BUAA 5BW8C 3AJIA 4L2YA 4I9CA 4MRUA 1TR4A 4AM9A 4GCNA 3EIQC 5ENNA 4J8YA 4YDOA 3R7QA 1XNFA 3ZUVB 3U64A 4U7EB 1JWFA 3EU9A 2F37A 2R05A 3PE4A 1OY3D 5A7DB 3CVNA 1A5EA 2KCVA 3EHQA 3CVQA 1S0PA 4WWOA 4U8YD 2J49A 4BTAA 2LAIA 2WXRA 4Y6WA 2GRLA 1FT2A 4MBGA 1N4PA 2LO6A 3B13A 3TXNA 4O1PA 3OXGA 5BPPA 4L23A 3LPZA 4XKCA 5FZRA 2HM8A 2VSYA 1TN8A 1IXVA 3V31A 4UI9J 5KNHD 3W9GA 5AYWD 4I2WA 4DX7D 4NRHB 5B1BE 3MKQB 2J4DA 1O1RA 3DWLG 2H6HA 1G3NB 1WM5A 3UKUG 3PZ4A 4BTBA 1KT1A 2MOWA 2VSNA 3ONLA 3CVUA 3FDHA 4U96D 1UN8A 2RD0A 2XEEA 1WY6A 3CKBA 4FU3A 1GW6A 3TG5A 1KZOA 1JWGA 3CR3A 4HQDA 5G2NA 3LS8A 4CDRA 1B89A 2L6JA 4OVVA 2BKGA 4DX6D 2IJGX 2KATA 3AG2E 3KEAA 3UM2A 1TNZA 3FTVA 3GZSA 1JCRA 2R59A 2DCPA 4F3VA 5JHAA 2DVWA 1UJJA 3HXFA 3VLFA 4F7AA 3TL5A 1Q2ZA 2VTBA 3X2QE 3LVQE 3SBTB 3UMVA 2YHCA 3ESLA 3QJZA 4XKBA 3IXEA 1E96B 1OCCE 3LY8A 1EF1C 4B89A 3U3WA 4LNBA 2XS1A 3FUMA 4IRUA 1TNBA 2IQCA 3UX4A 3G2UA 3D9JA 4UWHA 1U3CA 3OXFA 1OCOE 3I5PA 4PS8A 4K5AB 4ZHBA 4TUMA 1EYHA 4ACLA 3ASFA 2KXPC 4CYMD 3LVRE 3PRZA 4Z68A
chains in the Genus database with same CATH topology
2ILRA 3CHOA 3FFLA 3CHSA 3MYVA 3OXLA 3EIJA 4GZ3A 4J8DA 3RK6A 2XQ0A 2WXMA 4WUYA 3ZYQA 2KCKA 3L13A 4JHKA 3SNXA 1ELKA 2X6FA 4Q96A 3PZDA 4M3OA 3S7FA 3MGBA 5AIJA 2WXOA 3VLDA 4UWKA 4FLBA 4ILHB 3CVLA 2WMNA 2IU1A 3AS8A 4MS6A 2WXKA 2AXZA 3L22A 4HXIA 5JHBA 4W9RA 3FUJA 3HVEB 4IULA 1KT0A 3PNLB 5LFAA 3GYZA 2JEKA 4G1TA 4LUNU 4XIFA 5LCWJ 4GAAA 4JZYA 4NURA 2RG8A 3BG1B 3D9NA 4GYWA 4G26A 1Y8MA 3UT8A 3PEVB 5KCMA 4ILIA 3RJVA 2UY1A 2IONA 2LNIA 2XHEA 2VGXA 4D10C 3CEQA 5DIZA 4J8SA 3NF1A 4GCOA 3AU5A 4B8AA 3CQCB 3FHEA 5FT9A 2KZTA 5BNWA 1TJCA 1UG3A 4A55A 1H2TC 3U9WA 4N2SA 2WXQA 2XPIA 2X3MA 3ZGQA 1HXIA 1Y6IA 4ILGA 2L0TB 2IOSA 3IHYA 3KD7A 5FJYA 3UT7A 4EBAG 3GZ2A 5JJTA 2X6KA 5ARFA 3CVWA 3APCA 3P1UA 4CEMA 4J6IA 2J09A 3ULQA 2Y4UA 4YVOA 4GYYA 1JPLA 4KXKB 4GZ5A 4KT6B 3ZFWA 5KJNA 4P29A 4YNDA 1N52A 4HORA 1NA0A 3CQGB 3ASDA 4U63A 3I4RB 4PS3A 2XPZA 1FCHA 1QNFA 2XGMA 4NACA 3ZYMA 1H2VC 3S7BA 4ANUA 3RU0A 3G2TA 3T5VA 1OUVA 4C9BB 3R9AB 2PM7A 3LXUX 2R17C 2V5FA 3NQPA 3ZEFA 4C0MA 1HS6A 1KLXA 3FUHA 4TUUA 4WWPA 4BX8A 2VJ8A 4N2QA 4EPZA 4U8HA 1U3DA 1H0AA 3QARA 5EX3A 2V8SE 3L16A 1HH8A 3O4ZA 3C98A 4HOTA 3RRNB 2WQ7A 4N39A 3LY7A 3IV0A 1MHQA 4PUCA 4ANXA 4A3VA 4DPRA 3FU6A 3EDTB 3FH5A 2VYIA 4A1SA 2UWJG 3UQ3A 3FULA 4L1BA 3FTSA 4I17A 4EZLA 3RRUA 3N71A 3B7TA 4N3AA 4AXHA 4WNFA 5CMWA 5CCLA 3CK8A 3L6AA 4KVMA 2XRZA 2KCLA 2AXVA 3UT4A 1OWPA 2BTDA 2FO7A 1Z3XA 1QZ2A 2XCCA 2QY7A 1H19A 3CK9A 4EZKA 2JLBA 3CVYA 1SQMA 4Q69A 1Z3YA 3AU4A 1PAQA 4JXTA 4ANWA 4GPKA 3QDNA 5J90A 2LSUA 3PUKA 2X6IA 2YINA 3SZ7A 4ANVA 2UY1B 4FJYA 4OYSA 2CFUA 3ENEA 2NXPA 2CHWA 2WXPA 3FTYA 2EQXA 2WM9A 5EKQD 4G25A 3ONKA 5KJLA 4LCTA 4EQFA 3SHFA 3CLJA 4N3BA 1OWLA 4CDMA 5G05J 2WVIA 4KBQA 1OWOA 3TJPA 2L0IA 4GA2A 3CKCA 3JCKC 3L08A 3D9PA 5D0QD 4CT4A 4AV7A 2WXHA 3D3MA 1H2UA 2FI7A 3MEKA 4JVSA 2I6HA 4CT0A 5EDSA 3QWWA 2WQ6A 3EHNA 4JHRA 4AY6A 1FVHA 4B0ZA 2KM4A 3RIBA 3IKOB 4ATGA 2LAHA 4UWGA 4WAFA 3U4TA 4BFRA 4LEUA 4E85A 5BT1A 1TJFA 3FU5A 2I9CA 4LRZA 3TG4A 3APFA 4CGVA 4EECA 4JEHA 5KJMA 4ME2A 3ASGA 3S2AA 2XCBA 4GMJA 2OVFA 2Q7FA 4GA1A 5G05C 4N5CA 2J08A 3LJ3A 4AP2A 3OTNA 1E8XA 4UQXA 1HX8A 1IQUA 4DK5A 4HLEA 4JL0A 3UPVA 3CVVA 3D9KA 1HG2A 3CGHA 2NC9A 4GU5A 4RVBA 2PQRA 3HVEA 3MX3A 3HYMB 5BUZA 4APFA 1MQSA 4H7XA 3MCXA 3PDNA 5D0OD 1IQRA 4I6GA 5CMYA 2XRYA 3ESKA 4A1GA 5LOZA 2HYZA 2OVBA 3PE3A 3FU3A 2WXGA 2WXFA 4FC8A 4KYOB 4XX5A 3T5XA 4B94A 2X38A 4J8FA 3ZVVA 2C2LA 2CG2A 5AJLA 1W3BA 4HVBA 4I1MA 5JJ7A 2Y4TA 2X6JA 4HS2A 4APOA 4B8CB 3UUXA 2VSXE 3CHQA 5E76A 2YQ8A 4KVOA 5T8IA 1E8YA 3ZPJA 2J9QA 2L9BA 1LF8A 4TV3A 4AY5A 3PREA 2FBNA 2XEVA 2YNQA 2I1JA 5E75A 3SF4A 3K9IA 1X5BA 3FEYA 4DLQA 2R5SA 4EZJA 1E8ZA 5G55A 2OOEA 3CSFA 4JEUA 4R7LA 2ZU6B 2NSZA 2PM6A 4UWFA 5BV1A 2VTBB 4I43A 3FUDA 4HOSA 2AXUA 2C0MA 2FEZA 4UWLA 4BSXA 5LP0A 3KS2A 5FQ8A 2GRMA 4FHJA 5HI7A 4G24A 4AIFA 2Y3AA 1E7UA 5CCMA 2WXJA 3LCAA 3VTXA 3FUIA 4MKTA 3NZUA 3PNTB 3DBSA 3URZA 3QB2A 4GZDA 4WNEA 1E8WA 2XPYA 5FTPA 3QWPA 3R7RA 2IF4A 5T4YA 2BUGA 3MA5A 4F53A 2V0PA 1E7VA 2GGFA 3CIAA 4FHKA 2J4BA 3FTZA 5AJDA 5T3RA 3S7JA 2HR2A 3ZXSA 2WXLA 4RG6A 3U66A 4BY6A 2VSOE 3P2BA 2ONDA 2VQ2A 3FUKA 3FUFA 3ZHEB 1SZ9A 4PS7A 2M63A 4AEZC 3ZYLA 2V4LA 3CHMA 5BW8C 1NA3A 4L2YA 4GYOA 4J0UA 4I9CA 4G2VA 2IOLA 3G2WA 3PS6A 3Q15A 4UQYA 4MRUA 4AM9A 2VGXB 3PH0C 1INZA 4GCNA 3EIQC 5ENNA 2GW1A 3R7QA 2WB2A 4XI9A 4DI4A 1XNFA 3FWVA 3CK7A 4Q94A 4FADA 5C2YA 3MKRA 1EPUA 3U64A 4I6JA 3FH8A 5ARGA 1JWFA 2FF4A 3FY4A 3SI5A 4LERA 3CSTA 3ML8A 3PE4A 3SFZA 1JUQA 2AWIA 2XGSA 3CVNA 3EHMA 4JC8A 4O6FA 4U0UA 5A7DB 4I1OB 4WNDA 3EJNA 1ELWA 1HF8A 3PVLA 4XI0A 4IN3B 5CHEE 2KCVA 2CG3A 3MJWA 2DIWA 4FLHA 1EDUA 2DBAA 3CVQA 3ASHA 3IHVA 2KC7A 3ZN3A 3GW4A 3QNKA 1S0PA 4WWOA 2J49A 5HQ8A 4IYPA 4V3IA 3T8MA 4GB9A 4UI9C 2LAIA 4BTAA 1H6KA 3JQ0A 2IFUA 3G2SA 1YA0A 5G04C 1DVPA 3RRMB 3HIZA 3FU0A 2QFCA 2WXRA 3MKQA 4Y6WA 2GRLA 2I1KA 3G2VA 5FZSA 2KZTB 4KZCA 3RKVA 2P58C 1UN9A 3NZSA 2LO6A 4GZ6A 3B13A 3I3NA 3D9MA 2HO1A 4KZ0A 2E0IA 4AOFA 5LCWC 1HO8A 3JYSA 3RO2A 3TXNA 3B7SA 3O48A 3Q4AB 3ZW3A 4CCAA 3QC1A 4C0EA 3OXGA 3Q49B 1UW4B 4JHJA 2PZIA 4L23A 5BPPA 5FZQA 5LX8A 3LPZA 2WXIA 4XKCA 5FZRA 5M72A 3Q47B 3PEUB 2HM8A 2VSYA 3MZLB 4PDXA 4AJWA 5C1DA 3OAWA 1NP7A 1TEZA 1ZBPA 4UI9J 5G04J 3CVXA 4I2ZA 4JPSA 1VDYA 3FTUA 3FUNA 4URKA 4CDNA 5AYWD 4I2WA 4MLPA 4NRHB 3MKQB 2J4DA 3ML9A 2VGYA 4BT8A 1WM5A 4FULA 4I1AA 2E2EA 3DPDA 3FH7A 4U0ZA 3D9OA 4HFGA 4YVQC 2AVPA 4F1SA 3SBSA 3ZIMA 5JJ6A 5FQ4A 4BTBA 1KT1A 2MOWA 2VSNA 3QAQA 1FVFA 1SZAA 4DJAA 3ONLA 4QFVA 3B7UX 3HHMA 4BX9A 5BV0A 3LDZA 3GZ1A 2PL2A 4U0SA 4JA9A 4EBAA 4CGWA 3QKYA 4XE0A 3CVUA 3BG0B 2WXNA 3FDHA 1UN8A 2OV8A 4E6HA 2C0LA 4N3CA 2RD0A 2XGOA 2MHKA 1WY6A 2J07A 4UI9K 1NZNA 3CKBA 4FU3A 1GW6A 3TG5A 3FP3A 3JUIA 1ZU2A 2WMOA 1JWGA 4JW1A 4U07A 3CR3A 4RG9A 3QK0A 3TAXA 4G23A 1BPOA 1N54A 3HDXA 5G2NA 1DNPA 3LYAA 2A5UA 3LS8A 4WWNA 5ANLA 4GZCA 3CV0A 3FUEA 3SD5A 4ACKA 4CDRA 5AENA 1PC2A 1E90A 1B89A 4L2LA 5FQ6A 4A3TA 2L6JA 3PUJA 5FQ7A 2BF0X 3VLEA 2YHEA 3SGHA 4OVVA 4BWRA 2IJGX 2KATA 4WNGA 4NQ0A 4AVXA 4BT9A 1HFAA 4DLOA 3TGOA 5KJKA 3LKUA 2PQNA 3FTVA 4HOQA 4G11A 3ZYKA 3ZHEA 3GZSA 3VTYA 3I4GA 3FTWA 2LSVA 3CHPA 4PH4B 2R59A 4DI3A 4GMLA 4Y6CA 2DCPA 1P5QA 3BEEA 3D9LA 3QWVA 3FTXA 3JQ1A 4F3VA 4K03A 1QQEA 5JHAA 4UQZA 2X6HA 3L17A 3QOUA 3APDA 5A6CA 4GA0A 3LY9A 2WQHA 1HU3A 3Q5MA 4FP7A 4FA6A 3KEZA 3IBEA 1OWMA 1UJJA 3VLFA 3IEGA 4KMOA 4I9EA 4F7AA 3TL5A 1Z6TA 2VTBA 1OWNA 3D9IA 5DBKA 2CHZA 3AS4A 5EX0A 3LVQE 3CVPA 4XZ4A 4CRWA 3B7RL 3SBTB 3MV3B 3L54A 3E4BA 3UMVA 2YHCA 1XGWA 3MV2B 2MRIA 3ZRHA 1HZ4A 4FJZA 2FULA 3LEWA 4H7YA 5FWQA 2I2OA 2CFZA 1ELRA 3ESLA 3QJZA 3WXXA 4XKBA 4OVUA 5ANRA 3KAEA 1E96B 4JA7A 3LY8A 1EF1C 5J08A 4B89A 1L5JA 2A4ZA 1HE8A 3AS5A 3CHRA 3RO3A 3U3WA 1UJKA 3FUMA 4IRUA 1HG5A 2IQCA 4TRQA 3UX4A 3G2UA 3D9JA 4UWHA 2CHXA 1U3CA 3OXFA 1WAO1 4I6EA 1PY1A 3FEXA 5A23A 3I5PA 4K0RA 3S7DA 2AW6A 4RSYA 4J8EA 4PS8A 4U04A 1EYHA 1A17A 2WPVA 4ACLA 1IYGA 1IHGA 3ASFA 3TXMA 4L7TA 3LVRE 3PRZA 4ABNA 4HOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UJJ A;  3D9N A;  4JXT A;  1JPL A;  4AVX A;  5CMY A;  1HFA A;  1MHQ A;  1UJK A;  1DVP A;  1JWF A;  1X5B A;  1VDY A;  3G2S A;  1HG5 A;  4Q94 A;  5LOZ A;  3G2V A;  1SZ9 A;  3D9I A;  3ZYQ A;  3ZYK A;  3G2U A;  3D9J A;  3ZYL A;  2LO6 A;  3ONK A;  3D9M A;  1ELK A;  4NAC A;  4Q96 A;  3ZYM A;  1PY1 A;  1JUQ A;  3CLJ A;  4FU3 A;  5LP0 A;  1XGW A;  3D9O A;  4HFG A;  3G2T A;  3RRU A;  2L0I A;  1JWG A;  2DCP A;  3D9L A;  3G2W A;  4FLB A;  5CMW A;  1HF8 A;  3D9P A;  3LDZ A;  2DIW A;  1INZ A;  2MOW A;  1HX8 A;  4GZC A;  1EDU A;  3D9K A;  1EYH A;  1HG2 A;  1H0A A;  2L0T B;  1SZA A;  2V8S E;  5J08 A;  2BF0 X;  4GZD A;  2QY7 A;  3ONL A;  1LF8 A;  2KM4 A; 
#chains in the Genus database with same CATH topology
 3CHO A;  3OXL A;  3E34 A;  3HRA A;  3JUE A;  3E37 A;  3RK6 A;  3L13 A;  3S7F A;  1N11 A;  4DUI A;  4UWK A;  2MYO A;  2XEN A;  5EIB E;  4U8V D;  4G1T A;  2JEK A;  1ZB1 A;  3BG1 B;  1N4Q A;  3D9N A;  2ETA A;  2GRO B;  3AU5 A;  5FT9 A;  3U9W A;  3ZXP A;  1HXI A;  1Y6I A;  5FIO A;  2IOS A;  3UT7 A;  5JJT A;  3APC A;  3P1U A;  2J09 A;  3ULQ A;  4KXK B;  5KJN A;  1NA0 A;  1FCH A;  2XGM A;  4ANU A;  3RU0 A;  3T5V A;  2V5F A;  1HS6 A;  4WWP A;  2H6G A;  1H0A A;  3L16 A;  1HH8 A;  2Y0B G;  3C98 A;  2WQ7 A;  4ZFH A;  2EIL E;  4L1B A;  3RRU A;  3N71 A;  1TNO A;  2XRZ A;  5AQ9 A;  2AXV A;  1OWP A;  1QZ2 A;  2QY7 A;  1H19 A;  4EZK A;  4Q69 A;  3AU4 A;  4ANW A;  3QDN A;  3PUK A;  2EIK E;  2UY1 B;  2DYR E;  2CFU A;  3ENE A;  1BU9 A;  2WM9 A;  5EKQ D;  2BED A;  5KJL A;  3Q7A A;  4KBQ A;  3TJP A;  2L0I A;  3NOG D;  3UM3 A;  3CKC A;  3JCK C;  1S64 A;  5D0Q D;  4CT4 A;  3D3M A;  3MEK A;  1FVH A;  2KM4 A;  3IKO B;  3U4T A;  4BFR A;  4LRZ A;  3APF A;  4ME2 A;  2XCB A;  2Q7F A;  4GA1 A;  1LD7 A;  2J08 A;  1E8X A;  1IQU A;  3UPV A;  1MX2 A;  1HG2 A;  4RVB A;  4LNG A;  3MX3 A;  4APF A;  3AG4 E;  3MCX A;  2GRQ B;  3PDN A;  5D0O D;  4I6G A;  5CMY A;  2WXF A;  4FC8 A;  3Q78 A;  4B94 A;  2CG2 A;  5AJL A;  2Y4T A;  4HS2 A;  2VSX E;  5E76 A;  5T8I A;  1E8Y A;  4ATZ D;  4TV3 A;  3UIP C;  1JCQ A;  2YNQ A;  3K9I A;  2IEJ A;  2R5S A;  3T8K A;  2RFM A;  2ZU6 B;  2NSZ A;  5AQ7 A;  2GRM A;  1N0R A;  1BD8 A;  2WXJ A;  3VTX A;  3FUI A;  2DWZ A;  4U95 D;  3PNT B;  3DBS A;  3AG3 E;  2V0P A;  5AJD A;  1OCZ E;  2HR2 A;  1D8D A;  3TWW A;  2VQ2 A;  3FUK A;  5HRY A;  3NB2 A;  3ZYL A;  4J0U A;  3BU8 A;  4G2V A;  3G2W A;  3PS6 A;  3L9T A;  3LJN A;  1QBQ A;  2GW1 A;  4XI9 A;  3HG0 D;  3CK7 A;  5C2Y A;  3MKR A;  1EPU A;  2BKK B;  5AQB A;  3ULY A;  2LUH A;  1JCS A;  4JC8 A;  4O6F A;  4WND A;  3EJN A;  2CG3 A;  2DBA A;  3IHV A;  3ZN3 A;  4NIK A;  3GW4 A;  3DST A;  4GB9 A;  1U2V G;  3JQ0 A;  2IFU A;  5G04 C;  1YA0 A;  3HIZ A;  3RKV A;  4KZC A;  2KZT B;  2P58 C;  3NZS A;  4GZ6 A;  3D9M A;  1O1S A;  2B0O E;  2NYJ A;  5LCW C;  3RO2 A;  3O48 A;  4CCA A;  3QC1 A;  3AAA C;  3ASN E;  4C0E A;  3Q49 B;  2AJA A;  2WXI A;  5M72 A;  3Q47 B;  3PEU B;  3Q75 A;  4HRL A;  3MZL B;  4AJW A;  1TEZ A;  3CVX A;  4OAV B;  2R03 A;  1VDY A;  4URK A;  1N9A A;  4MLP A;  3ML9 A;  3KSQ A;  2VGY A;  2E2E A;  3FH7 A;  2AVP A;  3SBS A;  4HLL A;  5BV0 A;  2QYU A;  4U0S A;  4JA9 A;  3BG0 B;  4F6R D;  1YCS B;  4N3C A;  2XGO A;  4GTV A;  2J07 A;  4UI9 K;  1IHB A;  2WMO A;  4JW1 A;  1DNP A;  3LYA A;  2A5U A;  4GZC A;  3SD5 A;  1PC2 A;  1E90 A;  3J5P A;  5FQ6 A;  3VLE A;  2BF0 X;  3B7B A;  4BT9 A;  4NQ0 A;  2EIN E;  5D66 A;  2PQN A;  3VTY A;  3FTW A;  1FPP A;  3CHP A;  4PH4 B;  4HB5 A;  4GML A;  4K03 A;  2X6H A;  3L17 A;  3APD A;  3LY9 A;  4FA6 A;  2QC9 A;  3KEZ A;  3EUV A;  1OWM A;  4KMO A;  1DCQ A;  1OWN A;  3D9I A;  3L54 A;  1XGW A;  4FJZ A;  2I2O A;  2CFZ A;  3C5R A;  3WXX A;  4OVU A;  5ANR A;  1YMP A;  1TYQ G;  2V5Q C;  1L5J A;  2A4Z A;  1HE8 A;  3RO3 A;  1HG5 A;  1YYH A;  4RQI A;  4K5B A;  1PY1 A;  3FEX A;  3PZ2 A;  4U04 A;  1A17 A;  1IYG A;  3TWX A;  2P9L G;  4L7T A;  3FFL A;  3MYV A;  3V79 K;  5CRU A;  2WXM A;  4JHK A;  3SNX A;  4Q96 A;  3MGB A;  3VLD A;  3HXC A;  2IU1 A;  3KSL A;  4MS6 A;  1LTX A;  4HXI A;  2AXZ A;  5JHB A;  3FUJ A;  3PNL B;  3GYZ A;  4XIF A;  5LCW J;  2RG8 A;  4HNA D;  1Y8M A;  3PEV B;  4ILI A;  2ION A;  3ISM C;  4D10 C;  3CEQ A;  5DIZ A;  3C3Q A;  4B8A A;  1N94 A;  1H2T C;  2WXQ A;  2Y1L E;  2XPI A;  3IHY A;  4YVO A;  1JPL A;  4YND A;  4HOR A;  1O5M A;  3CQG B;  3V2X A;  1AWC B;  2F0Y A;  4PS3 A;  1QNF A;  3S7B A;  5CED B;  4C9B B;  2A5E A;  3NQP A;  4C0M A;  3FUH A;  2VJ8 A;  4LG6 A;  2KBX A;  3TWT A;  4ANX A;  4DPR A;  3FU6 A;  3FH5 A;  3D9H A;  2P9K G;  3SQV A;  3FUL A;  3FTS A;  3UI2 A;  1V54 E;  4N3A A;  5CMW A;  4BET A;  3UT4 A;  2BTD A;  2FO7 A;  4DRX E;  2XCC A;  1Z3Y A;  1PAQ A;  2JAB A;  4GPK A;  1MYO A;  4ANV A;  3FTY A;  2NXP A;  1RW2 A;  3CLJ A;  1OWL A;  5G05 J;  1OWO A;  4GA2 A;  3W9F A;  1OCR E;  1H2U A;  5EDS A;  3EHN A;  4UWG A;  4WAF A;  3TWR A;  5BT1 A;  5ENP D;  4CGV A;  4DX5 D;  3ASG A;  4GMJ A;  2OVF A;  2GRR B;  5KBA A;  4AP2 A;  4BER A;  1HX8 A;  3E33 A;  3CGH A;  4GU5 A;  2PQR A;  3HVE A;  1NL4 A;  5BUZ A;  1BI8 B;  4H7X A;  3NAW A;  3C3R A;  2XRY A;  3ESK A;  5LOZ A;  4BSZ B;  2OVB A;  1MJ0 A;  2ETB A;  2P9P G;  5AQA A;  5KWD A;  2X38 A;  4J8F A;  4B93 B;  2C2L A;  3C3O A;  4HVB A;  1SW6 A;  2X6J A;  3NBN B;  1KPS B;  1WDY A;  2VGE A;  2J9Q A;  5EYP F;  1LF8 A;  5E75 A;  1S63 A;  1X5B A;  4DLQ A;  4C48 B;  1E8Z A;  5G55 A;  2OOE A;  4UWF A;  4GTP A;  4UWL A;  4BSX A;  3KS2 A;  5FQ8 A;  1X81 A;  4FHJ A;  5HI7 A;  5CCM A;  3TWV A;  4MKT A;  3B95 A;  1E8W A;  3QWP A;  5CRV A;  4FHK A;  2GGF A;  3ZXS A;  3WG7 E;  3U66 A;  3CVV A;  4AEZ C;  4TXP A;  1NA3 A;  4HRN A;  1TN7 A;  4GYO A;  2IOL A;  2ZIR A;  3Q15 A;  2VGX B;  4DI4 A;  5FIN A;  3HXD A;  3V2O A;  3UTM A;  1V55 E;  3FH8 A;  5ARG A;  3SI5 A;  3CST A;  3ML8 A;  1JUQ A;  3EHM A;  4U0U A;  4I1O B;  1ELW A;  1HF8 A;  3PVL A;  2R02 A;  3UM1 A;  3MJW A;  1Z5S C;  1EDU A;  2P2C P;  2KC7 A;  3C72 A;  5HQ8 A;  4IYP A;  3T8M A;  4UI9 C;  1D8E A;  5H7P A;  3G2S A;  3RRM B;  1DVP A;  3FU0 A;  2QFC A;  5A6C A;  2J8S D;  1UOH A;  1UN9 A;  3I3N A;  2HO1 A;  2E0I A;  4AOF A;  2LXL A;  1HO8 A;  1DC2 A;  3JYS A;  3ZW3 A;  2PZI A;  5LX8 A;  5FZQ A;  4HRM B;  5C1D A;  3OAW A;  1NP7 A;  5G04 J;  4I2Z A;  4JPS A;  3FTU A;  1OXJ A;  3FUN A;  2RKK A;  4BT8 A;  4I1A A;  4U0Z A;  3D9O A;  2PNN A;  3ZIM A;  1H6O A;  5JJ6 A;  4K5C A;  3QAQ A;  1FVF A;  1SZA A;  4DJA A;  3B7U X;  3HHM A;  3T9K A;  3LDZ A;  4GTR A;  4CGW A;  3QKY A;  4XE0 A;  4GTT A;  4G8L A;  2ZGG A;  4F1P A;  1MZC A;  2C0L A;  2FO1 E;  3QK0 A;  4G23 A;  2F8X K;  2ZGD A;  5ANL A;  4ACK A;  3FUE A;  3NOC D;  5FQ7 A;  2YHE A;  3SGH A;  5JA4 D;  4BWR A;  4WNG A;  5EN5 D;  4AVX A;  5KJK A;  3LKU A;  4G11 A;  4QQI A;  2IY0 C;  3I4G A;  2LSV A;  1OT8 A;  2QYJ A;  4Y6C A;  2L6B A;  3ABL E;  3DEP A;  3FTX A;  4UQZ A;  4GA0 A;  1AP7 A;  1HU3 A;  1K1B A;  3Q5M A;  3IBE A;  1Z6T A;  5DBK A;  5EX0 A;  3ZNG A;  1N4S A;  4XZ4 A;  3B7R L;  3MV3 B;  4TXR A;  3ZRH A;  3LEW A;  5FWQ A;  1N95 A;  5BXU A;  3KAE A;  3Q73 A;  4JA7 A;  5CER B;  2OEV A;  5J08 A;  3AS5 A;  1UJK A;  1S70 B;  4TRQ A;  1WAO 1;  4I6E A;  4XEI G;  5ENQ D;  3S7D A;  2AW6 A;  4RSY A;  4J8E A;  5EIL A;  2WPV A;  3TXM A;  3BQO A;  3ABK E;  3DEO A;  3DSV A;  2ILR A;  3CHS A;  4GTO A;  4GZ3 A;  4WUY A;  3ZYQ A;  2KCK A;  4UUC A;  1ELK A;  2X6F A;  3F6Q A;  5HKP A;  4M3O A;  2WXO A;  4FLB A;  3UXG A;  4A63 B;  3ULE G;  2WXK A;  3L22 A;  1NFI E;  4IUL A;  5LFA A;  3HXB A;  4GAA A;  4JZY A;  4GYW A;  2GRP B;  2HE0 A;  1N4R A;  5KCM A;  3RJV A;  2UY1 A;  2LNI A;  2XHE A;  2VGX A;  2P9S G;  4J8S A;  3NF1 A;  3UIO C;  3CQC B;  3FHE A;  2KZT A;  4A55 A;  2DZN A;  3ZGQ A;  3KD7 A;  4EBA G;  2X6K A;  5ARF A;  4CEM A;  3PZ1 A;  4GYY A;  4GZ5 A;  4KT6 B;  4P29 A;  4OAU C;  4U63 A;  3I4R B;  2XPZ A;  4NAC A;  3ZYM A;  1H2V C;  3AG1 E;  1OUV A;  3R9A B;  2PM7 A;  3LXU X;  4TUU A;  4BX8 A;  4N2Q A;  4EPZ A;  4U8H A;  5EX3 A;  3QAR A;  3DSU A;  3DSW A;  4HOT A;  5CEC B;  3RRN B;  3LY7 A;  1MHQ A;  4PUC A;  5EID A;  3EDT B;  2XS8 A;  3DXM G;  2VYI A;  3UQ3 A;  4I17 A;  4HI8 A;  4AXH A;  4WNF A;  2GRN B;  3CK8 A;  5HS0 A;  3ASO E;  4KVM A;  3CK9 A;  2OCC E;  2JLB A;  3TWU A;  1SQM A;  2EIJ E;  2LSU A;  2X6I A;  4FJY A;  2CHW A;  2EQX A;  4G25 A;  3ONK A;  4LCT A;  4EQF A;  4CDM A;  3HXE A;  2B6C A;  3D9P A;  3UM0 A;  4GMR A;  2FI7 A;  4JVS A;  2I6H A;  3QWW A;  4JHR A;  4AY6 A;  4B0Z A;  4ATG A;  1N0Q A;  4LEU A;  1TJF A;  2I9C A;  4YDY A;  3TG4 A;  4EEC A;  4JEH A;  5KJM A;  5EYL A;  3S2A A;  5G05 C;  3LJ3 A;  4DK5 A;  4BEP A;  2QZA A;  3RSE G;  1MQS A;  1IQR A;  3PE3 A;  3FU3 A;  2WXG A;  4XX5 A;  1W3B A;  4I1M A;  4APO A;  4B8C B;  3UUX A;  5AN8 A;  3CHQ A;  2IO2 C;  5CBN A;  2EIM E;  3ZPJ A;  2L9B A;  3Q7F A;  2FBN A;  3V30 A;  3SF4 A;  3FEY A;  4JEU A;  4R7L A;  2PM6 A;  5ENS D;  2VTB B;  3UKR G;  4HOS A;  2AXU A;  2IO3 C;  1BI7 B;  2LXM A;  4G24 A;  2Y3A A;  3NZU A;  3URZ A;  5FTP A;  2XPY A;  5T4Y A;  3Q79 A;  1K1A A;  3FTZ A;  3S7J A;  2WXL A;  4RG6 A;  4BY6 A;  4JD2 G;  3P2B A;  3FUF A;  4PS7 A;  2M63 A;  3CHM A;  4DX1 A;  5ENO D;  4UQY A;  3DSS A;  3PH0 C;  1INZ A;  2WB2 A;  4HI9 A;  2ETC A;  4CZ2 D;  5B3S E;  1SVX A;  3FWV A;  2Y69 E;  4Q94 A;  4FAD A;  4I6J A;  2FF4 A;  3ABM E;  3FY4 A;  4LER A;  3RAU A;  3PZ3 A;  2R2L A;  3SFZ A;  2P9N G;  2AWI A;  2XGS A;  4XI0 A;  4IN3 B;  5CHE E;  4X8Q A;  2H6F A;  2DIW A;  4FLH A;  3ASH A;  3QNK A;  1QYM A;  4V3I A;  1H6K A;  4YDE A;  2XZT G;  4BES A;  3MKQ A;  2I1K A;  3G2V A;  5FZS A;  5ENT D;  1MX4 A;  4KZ0 A;  4HBD A;  3J5Q B;  4YDW A;  3B7S A;  3Q4A B;  1MX6 A;  2ZXW E;  4JHJ A;  1UW4 B;  3DRA A;  1O1T A;  1TNY A;  4RLY A;  4PDX A;  1ZBP A;  4GPM A;  1SA4 A;  2XZD G;  4CDN A;  4FUL A;  3DPD A;  4F1S A;  4YVQ C;  4HFG A;  4JB8 P;  5FQ4 A;  3JXI A;  4GTM A;  4QFV A;  4BX9 A;  3GZ1 A;  2PL2 A;  4EBA A;  2WXN A;  2OV8 A;  4E6H A;  2V4H C;  2MHK A;  1NZN A;  3FP3 A;  3JUI A;  1ZU2 A;  4U07 A;  4RG9 A;  3TAX A;  1BPO A;  1N54 A;  3HDX A;  4WWN A;  3CV0 A;  5AEN A;  4A3T A;  4L2L A;  5AAR A;  3PUJ A;  2F8Y A;  1HFA A;  4DLO A;  3TGO A;  4HOQ A;  3ZYK A;  3ZHE A;  1DCE A;  3Q9U C;  5B1A E;  4DI3 A;  3BEE A;  1P5Q A;  3D9L A;  4LNU D;  5D2M C;  3QWV A;  1RZ4 A;  3JQ1 A;  1QQE A;  4M7C A;  1K3Z D;  3QOU A;  2WQH A;  4FP7 A;  3IEG A;  4I9E A;  4O1O A;  2CHZ A;  3AS4 A;  4CRW A;  3CVP A;  5CBO A;  3JXJ A;  3E4B A;  3DSX A;  3MV2 B;  2MRI A;  1HZ4 A;  2FUL A;  4H7Y A;  4O60 A;  1ELR A;  3TWQ A;  5CEA A;  3L82 A;  3CHR A;  1WG0 A;  2P9U G;  5AAO A;  3UIN C;  2CHX A;  5A23 A;  2ZIS A;  4K0R A;  3DXK G;  1IHG A;  2DYS E;  3SY2 A;  4ABN A;  4HOU A;  1KZP A;  4N5Q A;  3EIJ A;  4J8D A;  2XQ0 A;  1D9S A;  3PZD A;  5AIJ A;  4ILH B;  3CVL A;  2H6I A;  2WMN A;  3AS8 A;  4W9R A;  3HVE B;  1KT0 A;  4LUN U;  4NUR A;  5IY5 E;  4G26 A;  3UT8 A;  3SO8 A;  2OEW A;  4TXQ A;  5ENR D;  4GCO A;  5BNW A;  1TJC A;  1UG3 A;  2P9I G;  4N2S A;  2X3M A;  5FJY A;  4ILG A;  2L0T B;  3GZ2 A;  3CVW A;  4J6I A;  2Y4U A;  3ZFW A;  5JMN D;  1N52 A;  3ASD A;  5ITZ F;  3G2T A;  2R17 C;  3ZU7 B;  3ZEF A;  1KLX A;  1U3D A;  2V8S E;  3O4Z A;  3EU5 A;  1K8K G;  4N39 A;  3IV0 A;  5BXO A;  4A3V A;  4A1S A;  2UWJ G;  3E32 A;  1TN6 A;  2DZO A;  4EZL A;  4GTQ A;  1LD8 A;  3B7T A;  5CCL A;  3SFY A;  3L6A A;  2KCL A;  1IKN D;  1Z3X A;  1NI1 A;  3CVY A;  4JXT A;  5J90 A;  3SZ7 A;  2RFA A;  2XEH A;  2YIN A;  4J7W A;  4OYS A;  2WXP A;  3SHF A;  4N3B A;  2WVI A;  3L08 A;  4AV7 A;  2WXH A;  2WQ6 A;  4CT0 A;  1TNU A;  3E30 A;  3RIB A;  2LAH A;  4E85 A;  3FU5 A;  3ZKJ A;  3EHR A;  3R9M A;  4N5C A;  3SFX A;  3OTN A;  4HLE A;  4UQX A;  4JL0 A;  3D9K A;  2NC9 A;  3HYM B;  1H6P A;  5KNG A;  1BLX B;  4A1G A;  2HYZ A;  4KYO B;  3T5X A;  3ZVV A;  4LSZ E;  4GTS A;  5JJ7 A;  3DPY A;  4DX2 A;  2YQ8 A;  4KVO A;  3Q9N C;  4EHM A;  4AY5 A;  3PRE A;  2XEV A;  2I1J A;  4EZJ A;  3CSF A;  3TWS A;  5BV1 A;  4I43 A;  3FUD A;  2C0M A;  2FEZ A;  5LP0 A;  1FT1 A;  4AIF A;  1E7U A;  4G8K A;  3LCA A;  3QB2 A;  4GZD A;  4WNE A;  3R7R A;  2IF4 A;  4F53 A;  2BUG A;  3MA5 A;  5T3R A;  1E7V A;  3CIA A;  2J4B A;  4L9P A;  2VSO E;  3ZHE B;  2OND A;  1SA5 A;  1SZ9 A;  2V4L A;  3BUA A;  5BW8 C;  3AJI A;  4L2Y A;  4I9C A;  4MRU A;  1TR4 A;  4AM9 A;  4GCN A;  3EIQ C;  5ENN A;  4J8Y A;  4YDO A;  3R7Q A;  1XNF A;  3ZUV B;  3U64 A;  4U7E B;  1JWF A;  3EU9 A;  2F37 A;  2R05 A;  3PE4 A;  1OY3 D;  5A7D B;  3CVN A;  1A5E A;  2KCV A;  3EHQ A;  3CVQ A;  1S0P A;  4WWO A;  4U8Y D;  2J49 A;  4BTA A;  2LAI A;  2WXR A;  4Y6W A;  2GRL A;  1FT2 A;  4MBG A;  1N4P A;  2LO6 A;  3B13 A;  3TXN A;  4O1P A;  3OXG A;  5BPP A;  4L23 A;  3LPZ A;  4XKC A;  5FZR A;  2HM8 A;  2VSY A;  1TN8 A;  1IXV A;  3V31 A;  4UI9 J;  5KNH D;  3W9G A;  5AYW D;  4I2W A;  4DX7 D;  4NRH B;  5B1B E;  3MKQ B;  2J4D A;  1O1R A;  3DWL G;  2H6H A;  1G3N B;  1WM5 A;  3UKU G;  3PZ4 A;  4BTB A;  1KT1 A;  2MOW A;  2VSN A;  3ONL A;  3CVU A;  3FDH A;  4U96 D;  1UN8 A;  2RD0 A;  2XEE A;  1WY6 A;  3CKB A;  4FU3 A;  1GW6 A;  3TG5 A;  1KZO A;  1JWG A;  3CR3 A;  4HQD A;  5G2N A;  3LS8 A;  4CDR A;  1B89 A;  2L6J A;  4OVV A;  2BKG A;  4DX6 D;  2IJG X;  2KAT A;  3AG2 E;  3KEA A;  3UM2 A;  1TNZ A;  3FTV A;  3GZS A;  1JCR A;  2R59 A;  2DCP A;  4F3V A;  5JHA A;  2DVW A;  1UJJ A;  3HXF A;  3VLF A;  4F7A A;  3TL5 A;  1Q2Z A;  2VTB A;  3X2Q E;  3LVQ E;  3SBT B;  3UMV A;  2YHC A;  3ESL A;  3QJZ A;  4XKB A;  3IXE A;  1E96 B;  1OCC E;  3LY8 A;  1EF1 C;  4B89 A;  3U3W A;  4LNB A;  2XS1 A;  3FUM A;  4IRU A;  1TNB A;  2IQC A;  3UX4 A;  3G2U A;  3D9J A;  4UWH A;  1U3C A;  3OXF A;  1OCO E;  3I5P A;  4PS8 A;  4K5A B;  4ZHB A;  4TUM A;  1EYH A;  4ACL A;  3ASF A;  2KXP C;  4CYM D;  3LVR E;  3PRZ A;  4Z68 A; 
#chains in the Genus database with same CATH homology
 2ILR A;  3CHO A;  3FFL A;  3CHS A;  3MYV A;  3OXL A;  3EIJ A;  4GZ3 A;  4J8D A;  3RK6 A;  2XQ0 A;  2WXM A;  4WUY A;  3ZYQ A;  2KCK A;  3L13 A;  4JHK A;  3SNX A;  1ELK A;  2X6F A;  4Q96 A;  3PZD A;  4M3O A;  3S7F A;  3MGB A;  5AIJ A;  2WXO A;  3VLD A;  4UWK A;  4FLB A;  4ILH B;  3CVL A;  2WMN A;  2IU1 A;  3AS8 A;  4MS6 A;  2WXK A;  2AXZ A;  3L22 A;  4HXI A;  5JHB A;  4W9R A;  3FUJ A;  3HVE B;  4IUL A;  1KT0 A;  3PNL B;  5LFA A;  3GYZ A;  2JEK A;  4G1T A;  4LUN U;  4XIF A;  5LCW J;  4GAA A;  4JZY A;  4NUR A;  2RG8 A;  3BG1 B;  3D9N A;  4GYW A;  4G26 A;  1Y8M A;  3UT8 A;  3PEV B;  5KCM A;  4ILI A;  3RJV A;  2UY1 A;  2ION A;  2LNI A;  2XHE A;  2VGX A;  4D10 C;  3CEQ A;  5DIZ A;  4J8S A;  3NF1 A;  4GCO A;  3AU5 A;  4B8A A;  3CQC B;  3FHE A;  5FT9 A;  2KZT A;  5BNW A;  1TJC A;  1UG3 A;  4A55 A;  1H2T C;  3U9W A;  4N2S A;  2WXQ A;  2XPI A;  2X3M A;  3ZGQ A;  1HXI A;  1Y6I A;  4ILG A;  2L0T B;  2IOS A;  3IHY A;  3KD7 A;  5FJY A;  3UT7 A;  4EBA G;  3GZ2 A;  5JJT A;  2X6K A;  5ARF A;  3CVW A;  3APC A;  3P1U A;  4CEM A;  4J6I A;  2J09 A;  3ULQ A;  2Y4U A;  4YVO A;  4GYY A;  1JPL A;  4KXK B;  4GZ5 A;  4KT6 B;  3ZFW A;  5KJN A;  4P29 A;  4YND A;  1N52 A;  4HOR A;  1NA0 A;  3CQG B;  3ASD A;  4U63 A;  3I4R B;  4PS3 A;  2XPZ A;  1FCH A;  1QNF A;  2XGM A;  4NAC A;  3ZYM A;  1H2V C;  3S7B A;  4ANU A;  3RU0 A;  3G2T A;  3T5V A;  1OUV A;  4C9B B;  3R9A B;  2PM7 A;  3LXU X;  2R17 C;  2V5F A;  3NQP A;  3ZEF A;  4C0M A;  1HS6 A;  1KLX A;  3FUH A;  4TUU A;  4WWP A;  4BX8 A;  2VJ8 A;  4N2Q A;  4EPZ A;  4U8H A;  1U3D A;  1H0A A;  3QAR A;  5EX3 A;  2V8S E;  3L16 A;  1HH8 A;  3O4Z A;  3C98 A;  4HOT A;  3RRN B;  2WQ7 A;  4N39 A;  3LY7 A;  3IV0 A;  1MHQ A;  4PUC A;  4ANX A;  4A3V A;  4DPR A;  3FU6 A;  3EDT B;  3FH5 A;  2VYI A;  4A1S A;  2UWJ G;  3UQ3 A;  3FUL A;  4L1B A;  3FTS A;  4I17 A;  4EZL A;  3RRU A;  3N71 A;  3B7T A;  4N3A A;  4AXH A;  4WNF A;  5CMW A;  5CCL A;  3CK8 A;  3L6A A;  4KVM A;  2XRZ A;  2KCL A;  2AXV A;  3UT4 A;  1OWP A;  2BTD A;  2FO7 A;  1Z3X A;  1QZ2 A;  2XCC A;  2QY7 A;  1H19 A;  3CK9 A;  4EZK A;  2JLB A;  3CVY A;  1SQM A;  4Q69 A;  1Z3Y A;  3AU4 A;  1PAQ A;  4JXT A;  4ANW A;  4GPK A;  3QDN A;  5J90 A;  2LSU A;  3PUK A;  2X6I A;  2YIN A;  3SZ7 A;  4ANV A;  2UY1 B;  4FJY A;  4OYS A;  2CFU A;  3ENE A;  2NXP A;  2CHW A;  2WXP A;  3FTY A;  2EQX A;  2WM9 A;  5EKQ D;  4G25 A;  3ONK A;  5KJL A;  4LCT A;  4EQF A;  3SHF A;  3CLJ A;  4N3B A;  1OWL A;  4CDM A;  5G05 J;  2WVI A;  4KBQ A;  1OWO A;  3TJP A;  2L0I A;  4GA2 A;  3CKC A;  3JCK C;  3L08 A;  3D9P A;  5D0Q D;  4CT4 A;  4AV7 A;  2WXH A;  3D3M A;  1H2U A;  2FI7 A;  3MEK A;  4JVS A;  2I6H A;  4CT0 A;  5EDS A;  3QWW A;  2WQ6 A;  3EHN A;  4JHR A;  4AY6 A;  1FVH A;  4B0Z A;  2KM4 A;  3RIB A;  3IKO B;  4ATG A;  2LAH A;  4UWG A;  4WAF A;  3U4T A;  4BFR A;  4LEU A;  4E85 A;  5BT1 A;  1TJF A;  3FU5 A;  2I9C A;  4LRZ A;  3TG4 A;  3APF A;  4CGV A;  4EEC A;  4JEH A;  5KJM A;  4ME2 A;  3ASG A;  3S2A A;  2XCB A;  4GMJ A;  2OVF A;  2Q7F A;  4GA1 A;  5G05 C;  4N5C A;  2J08 A;  3LJ3 A;  4AP2 A;  3OTN A;  1E8X A;  4UQX A;  1HX8 A;  1IQU A;  4DK5 A;  4HLE A;  4JL0 A;  3UPV A;  3CVV A;  3D9K A;  1HG2 A;  3CGH A;  2NC9 A;  4GU5 A;  4RVB A;  2PQR A;  3HVE A;  3MX3 A;  3HYM B;  5BUZ A;  4APF A;  1MQS A;  4H7X A;  3MCX A;  3PDN A;  5D0O D;  1IQR A;  4I6G A;  5CMY A;  2XRY A;  3ESK A;  4A1G A;  5LOZ A;  2HYZ A;  2OVB A;  3PE3 A;  3FU3 A;  2WXG A;  2WXF A;  4FC8 A;  4KYO B;  4XX5 A;  3T5X A;  4B94 A;  2X38 A;  4J8F A;  3ZVV A;  2C2L A;  2CG2 A;  5AJL A;  1W3B A;  4HVB A;  4I1M A;  5JJ7 A;  2Y4T A;  2X6J A;  4HS2 A;  4APO A;  4B8C B;  3UUX A;  2VSX E;  3CHQ A;  5E76 A;  2YQ8 A;  4KVO A;  5T8I A;  1E8Y A;  3ZPJ A;  2J9Q A;  2L9B A;  1LF8 A;  4TV3 A;  4AY5 A;  3PRE A;  2FBN A;  2XEV A;  2YNQ A;  2I1J A;  5E75 A;  3SF4 A;  3K9I A;  1X5B A;  3FEY A;  4DLQ A;  2R5S A;  4EZJ A;  1E8Z A;  5G55 A;  2OOE A;  3CSF A;  4JEU A;  4R7L A;  2ZU6 B;  2NSZ A;  2PM6 A;  4UWF A;  5BV1 A;  2VTB B;  4I43 A;  3FUD A;  4HOS A;  2AXU A;  2C0M A;  2FEZ A;  4UWL A;  4BSX A;  5LP0 A;  3KS2 A;  5FQ8 A;  2GRM A;  4FHJ A;  5HI7 A;  4G24 A;  4AIF A;  2Y3A A;  1E7U A;  5CCM A;  2WXJ A;  3LCA A;  3VTX A;  3FUI A;  4MKT A;  3NZU A;  3PNT B;  3DBS A;  3URZ A;  3QB2 A;  4GZD A;  4WNE A;  1E8W A;  2XPY A;  5FTP A;  3QWP A;  3R7R A;  2IF4 A;  5T4Y A;  2BUG A;  3MA5 A;  4F53 A;  2V0P A;  1E7V A;  2GGF A;  3CIA A;  4FHK A;  2J4B A;  3FTZ A;  5AJD A;  5T3R A;  3S7J A;  2HR2 A;  3ZXS A;  2WXL A;  4RG6 A;  3U66 A;  4BY6 A;  2VSO E;  3P2B A;  2OND A;  2VQ2 A;  3FUK A;  3FUF A;  3ZHE B;  1SZ9 A;  4PS7 A;  2M63 A;  4AEZ C;  3ZYL A;  2V4L A;  3CHM A;  5BW8 C;  1NA3 A;  4L2Y A;  4GYO A;  4J0U A;  4I9C A;  4G2V A;  2IOL A;  3G2W A;  3PS6 A;  3Q15 A;  4UQY A;  4MRU A;  4AM9 A;  2VGX B;  3PH0 C;  1INZ A;  4GCN A;  3EIQ C;  5ENN A;  2GW1 A;  3R7Q A;  2WB2 A;  4XI9 A;  4DI4 A;  1XNF A;  3FWV A;  3CK7 A;  4Q94 A;  4FAD A;  5C2Y A;  3MKR A;  1EPU A;  3U64 A;  4I6J A;  3FH8 A;  5ARG A;  1JWF A;  2FF4 A;  3FY4 A;  3SI5 A;  4LER A;  3CST A;  3ML8 A;  3PE4 A;  3SFZ A;  1JUQ A;  2AWI A;  2XGS A;  3CVN A;  3EHM A;  4JC8 A;  4O6F A;  4U0U A;  5A7D B;  4I1O B;  4WND A;  3EJN A;  1ELW A;  1HF8 A;  3PVL A;  4XI0 A;  4IN3 B;  5CHE E;  2KCV A;  2CG3 A;  3MJW A;  2DIW A;  4FLH A;  1EDU A;  2DBA A;  3CVQ A;  3ASH A;  3IHV A;  2KC7 A;  3ZN3 A;  3GW4 A;  3QNK A;  1S0P A;  4WWO A;  2J49 A;  5HQ8 A;  4IYP A;  4V3I A;  3T8M A;  4GB9 A;  4UI9 C;  2LAI A;  4BTA A;  1H6K A;  3JQ0 A;  2IFU A;  3G2S A;  1YA0 A;  5G04 C;  1DVP A;  3RRM B;  3HIZ A;  3FU0 A;  2QFC A;  2WXR A;  3MKQ A;  4Y6W A;  2GRL A;  2I1K A;  3G2V A;  5FZS A;  2KZT B;  4KZC A;  3RKV A;  2P58 C;  1UN9 A;  3NZS A;  2LO6 A;  4GZ6 A;  3B13 A;  3I3N A;  3D9M A;  2HO1 A;  4KZ0 A;  2E0I A;  4AOF A;  5LCW C;  1HO8 A;  3JYS A;  3RO2 A;  3TXN A;  3B7S A;  3O48 A;  3Q4A B;  3ZW3 A;  4CCA A;  3QC1 A;  4C0E A;  3OXG A;  3Q49 B;  1UW4 B;  4JHJ A;  2PZI A;  4L23 A;  5BPP A;  5FZQ A;  5LX8 A;  3LPZ A;  2WXI A;  4XKC A;  5FZR A;  5M72 A;  3Q47 B;  3PEU B;  2HM8 A;  2VSY A;  3MZL B;  4PDX A;  4AJW A;  5C1D A;  3OAW A;  1NP7 A;  1TEZ A;  1ZBP A;  4UI9 J;  5G04 J;  3CVX A;  4I2Z A;  4JPS A;  1VDY A;  3FTU A;  3FUN A;  4URK A;  4CDN A;  5AYW D;  4I2W A;  4MLP A;  4NRH B;  3MKQ B;  2J4D A;  3ML9 A;  2VGY A;  4BT8 A;  1WM5 A;  4FUL A;  4I1A A;  2E2E A;  3DPD A;  3FH7 A;  4U0Z A;  3D9O A;  4HFG A;  4YVQ C;  2AVP A;  4F1S A;  3SBS A;  3ZIM A;  5JJ6 A;  5FQ4 A;  4BTB A;  1KT1 A;  2MOW A;  2VSN A;  3QAQ A;  1FVF A;  1SZA A;  4DJA A;  3ONL A;  4QFV A;  3B7U X;  3HHM A;  4BX9 A;  5BV0 A;  3LDZ A;  3GZ1 A;  2PL2 A;  4U0S A;  4JA9 A;  4EBA A;  4CGW A;  3QKY A;  4XE0 A;  3CVU A;  3BG0 B;  2WXN A;  3FDH A;  1UN8 A;  2OV8 A;  4E6H A;  2C0L A;  4N3C A;  2RD0 A;  2XGO A;  2MHK A;  1WY6 A;  2J07 A;  4UI9 K;  1NZN A;  3CKB A;  4FU3 A;  1GW6 A;  3TG5 A;  3FP3 A;  3JUI A;  1ZU2 A;  2WMO A;  1JWG A;  4JW1 A;  4U07 A;  3CR3 A;  4RG9 A;  3QK0 A;  3TAX A;  4G23 A;  1BPO A;  1N54 A;  3HDX A;  5G2N A;  1DNP A;  3LYA A;  2A5U A;  3LS8 A;  4WWN A;  5ANL A;  4GZC A;  3CV0 A;  3FUE A;  3SD5 A;  4ACK A;  4CDR A;  5AEN A;  1PC2 A;  1E90 A;  1B89 A;  4L2L A;  5FQ6 A;  4A3T A;  2L6J A;  3PUJ A;  5FQ7 A;  2BF0 X;  3VLE A;  2YHE A;  3SGH A;  4OVV A;  4BWR A;  2IJG X;  2KAT A;  4WNG A;  4NQ0 A;  4AVX A;  4BT9 A;  1HFA A;  4DLO A;  3TGO A;  5KJK A;  3LKU A;  2PQN A;  3FTV A;  4HOQ A;  4G11 A;  3ZYK A;  3ZHE A;  3GZS A;  3VTY A;  3I4G A;  3FTW A;  2LSV A;  3CHP A;  4PH4 B;  2R59 A;  4DI3 A;  4GML A;  4Y6C A;  2DCP A;  1P5Q A;  3BEE A;  3D9L A;  3QWV A;  3FTX A;  3JQ1 A;  4F3V A;  4K03 A;  1QQE A;  5JHA A;  4UQZ A;  2X6H A;  3L17 A;  3QOU A;  3APD A;  5A6C A;  4GA0 A;  3LY9 A;  2WQH A;  1HU3 A;  3Q5M A;  4FP7 A;  4FA6 A;  3KEZ A;  3IBE A;  1OWM A;  1UJJ A;  3VLF A;  3IEG A;  4KMO A;  4I9E A;  4F7A A;  3TL5 A;  1Z6T A;  2VTB A;  1OWN A;  3D9I A;  5DBK A;  2CHZ A;  3AS4 A;  5EX0 A;  3LVQ E;  3CVP A;  4XZ4 A;  4CRW A;  3B7R L;  3SBT B;  3MV3 B;  3L54 A;  3E4B A;  3UMV A;  2YHC A;  1XGW A;  3MV2 B;  2MRI A;  3ZRH A;  1HZ4 A;  4FJZ A;  2FUL A;  3LEW A;  4H7Y A;  5FWQ A;  2I2O A;  2CFZ A;  1ELR A;  3ESL A;  3QJZ A;  3WXX A;  4XKB A;  4OVU A;  5ANR A;  3KAE A;  1E96 B;  4JA7 A;  3LY8 A;  1EF1 C;  5J08 A;  4B89 A;  1L5J A;  2A4Z A;  1HE8 A;  3AS5 A;  3CHR A;  3RO3 A;  3U3W A;  1UJK A;  3FUM A;  4IRU A;  1HG5 A;  2IQC A;  4TRQ A;  3UX4 A;  3G2U A;  3D9J A;  4UWH A;  2CHX A;  1U3C A;  3OXF A;  1WAO 1;  4I6E A;  1PY1 A;  3FEX A;  5A23 A;  3I5P A;  4K0R A;  3S7D A;  2AW6 A;  4RSY A;  4J8E A;  4PS8 A;  4U04 A;  1EYH A;  1A17 A;  2WPV A;  4ACL A;  1IYG A;  1IHG A;  3ASF A;  3TXM A;  4L7T A;  3LVR E;  3PRZ A;  4ABN A;  4HOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...