5LP0A

Crystal structure of the zebra fish enth domain from epsin1 in 1.41 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
140
structure length
140
Chain Sequence
GAMGSSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHALKTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A bacterial genetic selection system for ubiquitylation cascade discovery.
pubmed doi rcsb
source organism Danio rerio
molecule tags Signaling protein
molecule keywords Epsin 1
total genus 59
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lp0A00
3D9MA 1ELKA 1HG5A 4GZCA 1UJKA 1H0AA 1LF8A 4Q94A 5LOZA 1MHQA 5LP0A 1JPLA 3ZYMA 1INZA 4HFGA 3D9IA 2BF0X 4FU3A 3ZYLA 1HG2A 5CMWA 1EYHA 3D9OA 2KM4A 5CMYA 1JUQA 2DCPA 3ZYKA 1UJJA 4FLBA 1HF8A 1HX8A 3D9PA 1SZAA 3D9NA 4GZDA 3RRUA 2DIWA 3ZYQA 2QY7A 2V8SE 3LDZA 1PY1A 2L0TB 1VDYA 4AVXA 2MOWA 3G2SA 3ONLA 4Q96A 3G2TA 3D9KA 3CLJA 3G2UA 2L0IA 3D9LA 1DVPA 3G2WA 4NACA 1X5BA 3G2VA 5J08A 2LO6A 1XGWA 3ONKA 1SZ9A 3D9JA 4JXTA 1JWFA 1JWGA 1HFAA 1EDUA
chains in the Genus database with same CATH superfamily
4GTTA 3J5QB 3HXDA 3V2OA 3CVYA 2GROB 2I6HA 5ENQD 3SBTB 2BUGA 2WXIA 5A23A 5CCMA 3CHOA 3FH5A 5AN8A 3R9AB 4GA1A 3JCKC 2HM8A 3AG1E 2RD0A 4UQXA 2WXQA 3SFZA 1WY6A 4APFA 4H7YA 5AAOA 2QFCA 4FLBA 3FUHA 2AXVA 1PY1A 2IF4A 3ZW3A 4F7AA 3TWRA 4LEUA 4BETA 2EIKE 4JEUA 2RFAA 5E76A 4I6JA 2I2OA 3HXBA 4GCOA 4FLHA 3CR3A 3RJVA 5J90A 3FTYA 3QKYA 3B7BA 3LXUX 3SBSA 3Q79A 4C0EA 3B95A 3Q9UC 4JPSA 4F3VA 1JWGA 1HFAA 4X8QA 3SZ7A 2DVWA 3LDZA 2JLBA 5BXOA 5D2MC 3KD7A 5FZSA 3HDXA 2F8YA 5AQAA 2H6FA 4E85A 1SZ9A 2FF4A 5AQBA 5BUZA 4BSXA 4ILGA 4HQDA 1K1BA 3E32A 4I43A 1L5JA 4GMLA 4J6IA 4DX2A 2DCPA 4G2VA 3D9NA 2KBXA 3TJPA 5JA4D 5FZQA 3TGOA 4L9PA 5ENSD 2OEWA 4DX6D 4HRNA 5B1BE 1BI8B 3P2BA 4XKCA 1TEZA 2WXNA 2VSOE 1D9SA 2IO3C 4PS8A 3IHVA 3N71A 3RRUA 5KJLA 1MYOA 1G3NB 4OVVA 3VTYA 3FTZA 4BSZB 4J7WA 4C9BB 1SZAA 2IOLA 5A7DB 5M72A 5JJTA 4N3AA 2OCCE 4FC8A 2H6GA 3TWQA 3UIOC 1TNZA 4RQIA 2VGEA 4GTMA 3APCA 3Q7AA 1HO8A 3BQOA 3HRAA 4U8VD 1KLXA 3MX3A 4MRUA 4P29A 4A55A 4U0ZA 2Y3AA 3PDNA 4BEPA 3KEAA 5LFAA 4TUMA 1YCSB 3FEXA 4N5QA 2PM7A 5AENA 1E7UA 4HNAD 3Q75A 3BUAA 1DCEA 4WNDA 2XENA 3C98A 3FUIA 2DYRE 2ZIRA 5EKQD 2IEJA 5C2YA 3ZYLA 1TNYA 4YDEA 4B89A 3DPYA 2P9SG 4WWOA 4O1OA 3T8MA 5B1AE 4AJWA 2FO7A 4RG6A 4CDNA 1IXVA 4N2SA 2NYJA 4I6GA 4JZYA 4EZJA 4KXKB 4AY6A 5D0OD 4F6RD 4LG6A 3ESKA 4IULA 3I4RB 1TYQG 2DYSE 3ZNGA 3AU5A 2R05A 4WUYA 1NA0A 3NOGD 4TXPA 3PRZA 4NURA 5LCWC 2WXJA 5FQ4A 3ZKJA 3SFYA 1D8DA 3LY7A 3JQ1A 4G1TA 2PZIA 1N4SA 5ENPD 4M7CA 4LCTA 1JCQA 3FWVA 2WXGA 3C72A 3UT4A 2DWZA 2L9BA 3E33A 3ZRHA 5KJMA 2L0IA 2LXMA 3B7SA 4CCAA 3ESLA 3FP3A 3LVRE 3FTUA 3DBSA 3PUKA 5FTPA 3S7DA 4EHMA 4NQ0A 5EYPF 4DUIA 3LVQE 4DK5A 3TWXA 2L0TB 3RO2A 4HI8A 3RAUA 3SI5A 5CERB 1N94A 3UPVA 4D10C 1DNPA 3CHRA 4CZ2D 5LOZA 3UM1A 4ACKA 1OWPA 2YHEA 2Q7FA 3MKQA 2PL2A 4GPMA 4APOA 4L2YA 4UWLA 4G24A 1TN6A 1DVPA 3G2VA 1N4RA 5EX3A 1FVHA 3CHPA 4XX5A 2KZTB 3FUEA 1UOHA 2J8SD 2KATA 3FU6A 1E90A 3CIAA 1Z5SC 2DBAA 1SA5A 3LS8A 1OWNA 4R7LA 3D9KA 1H2UA 2ILRA 4WNFA 1FT1A 3V79K 5HI7A 3ZU7B 2VYIA 2J4BA 3C5RA 2IQCA 2GRRB 2KZTA 1JCSA 4JL0A 2VSXE 4I9CA 4DJAA 4HB5A 3NZUA 1A17A 4Q94A 5ENTD 1V54E 2LNIA 3FTXA 1HG2A 5G05C 2XS8A 3NZSA 3QC1A 4G8KA 3DPDA 2V5FA 3QAQA 1OCZE 2CG2A 2P9PG 3FU3A 3ABME 4U0UA 3T8KA 3KS2A 3RO3A 4JA7A 4FULA 5CMYA 1H19A 5AJLA 4BERA 3UMVA 4DX1A 3F6QA 2LAIA 3CLJA 4KVMA 4CGVA 5CECB 5T8IA 4L1BA 2OVFA 1HX8A 2VGXA 3RU0A 3TWUA 5EIBE 1OCCE 5FZRA 3D9JA 4U8YD 1H2VC 4J8FA 3RIBA 2GRPB 3ZN3A 5CHEE 3PZ2A 4GYYA 3GZ1A 1O1SA 4XKBA 2AWIA 3CK7A 1W3BA 3MV2B 1OWLA 3OXFA 3AS5A 2IY0C 5BPPA 1NP7A 5KCMA 4DPRA 5KWDA 4HLEA 2R17C 4MLPA 5ANLA 2CHWA 3DSUA 1NZNA 3Q5MA 1EF1C 5G2NA 2X6IA 3MKQB 2AJAA 4EBAG 3S2AA 4BTAA 3ENEA 2KC7A 4U63A 4XZ4A 3FFLA 3FTSA 1BD8A 3DEOA 3B13A 2WM9A 3PZ4A 2VGYA 4GZ3A 3TXNA 3JXIA 2QYUA 2LO6A 1WAO1 4GTSA 3I5PA 5C1DA 4JVSA 1HG5A 2RKKA 1IYGA 4J8SA 3OXLA 4G26A 1N9AA 3BG0B 3L16A 3IKOB 5FQ6A 4DI4A 4ANUA 1X81A 2XQ0A 3ZIMA 1XGWA 2XGOA 4RVBA 3SNXA 4K03A 2UY1A 1OT8A 3FUDA 4WNEA 3Q4AB 3O4ZA 1P5QA 5JHAA 4OVUA 4HOUA 4EQFA 1IQUA 2V5QC 4L7TA 4KZCA 1SQMA 3ONLA 1TJCA 2VJ8A 2XHEA 3AG4E 3E30A 1B89A 4C48B 3KEZA 4B8AA 3ZFWA 1OUVA 4U8HA 3T9KA 4QFVA 4J8DA 3Q15A 1DCQA 3EU5A 3UIPC 4UQYA 3LY8A 5BV0A 4XEIG 2RFMA 3CVUA 2HYZA 4HFGA 5CRVA 4PS3A 1S0PA 3D9HA 4BT9A 4UWGA 3VTXA 3ASFA 4TV3A 3RSEG 4WAFA 4DI3A 5BXUA 2VGXB 3T5XA 4JB8P 4FJYA 4UWFA 3FULA 3SGHA 3D9IA 2BF0X 3E4BA 3LEWA 4XI9A 3TWTA 3U9WA 4N5CA 4HS2A 2BKKB 3QOUA 3UX4A 1E96B 2XS1A 4I17A 1LD7A 4B93B 3CQCB 3G2SA 4CGWA 2P9UG 4U07A 3ZEFA 4PH4B 4FADA 1GW6A 3UM0A 1H0AA 3FH7A 1NL4A 3FUKA 2CFUA 2X6JA 4OAVB 4A1SA 3T5VA 3NOCD 1BI7B 3NB2A 4TXQA 1YYHA 4U96D 4GYWA 4OAUC 2Y4TA 4BWRA 3R7RA 2GW1A 2F0YA 1NFIE 3D9OA 2WQ6A 4GTRA 2M63A 1N0RA 3JQ0A 3CHMA 3NF1A 4LRZA 2WMNA 1MJ0A 3UKUG 3UI2A 3E34A 1IKND 3B7TA 3IBEA 4HRMB 3PZDA 3QDNA 3Q9NC 1Z3YA 2ETAA 3ASDA 1PAQA 2CG3A 1JCRA 4KYOB 3UM3A 3LJ3A 2WXFA 3FUJA 2WXLA 3TG5A 2F8XK 1TN8A 3I4GA 4ZFHA 4BESA 5FWQA 5AQ9A 2OVBA 2UY1B 1HF8A 3CVLA 2DZNA 4JA9A 3CVXA 3L82A 4YDYA 3OTNA 3SHFA 1N11A 3G2WA 4WNGA 1Z3XA 3Q7FA 3ISMC 1JWFA 5HQ8A 3EHQA 1Y6IA 3DSVA 3PS6A 3GW4A 3ZYMA 2J08A 3ZXSA 2LSVA 4UUCA 1H6PA 1OWOA 3LJNA 2AXZA 3D9LA 4CT0A 5HRYA 5EYLA 1S63A 4AV7A 3GZ2A 4K0RA 4HOQA 1JUQA 2KXPC 3MJWA 3CSFA 3IV0A 3UTMA 2I1JA 3CVPA 3JXJA 5FQ7A 1HXIA 2P2CP 4AIFA 2H6HA 5FQ8A 3UUXA 4ANXA 1FT2A 2HE0A 1KT1A 2IONA 2IOSA 2EIJE 5BV1A 3WXXA 3ABKE 3KAEA 2JABA 4K5BA 2J07A 1K8KG 1N4QA 2LXLA 4BY6A 2P9NG 4CYMD 4JD2G 4MS6A 2DIWA 2VTBB 4AOFA 4OYSA 4I2ZA 3QNKA 2ETCA 2ZGDA 5DBKA 3ONKA 4EPZA 5D0QD 3ASOE 3DRAA 2XPIA 2J4DA 1OXJA 4YDOA 3PVLA 4GYOA 4QQIA 4EECA 2P9LG 3AS4A 2QY7A 3PE4A 1MX6A 2YINA 2L6BA 1SVXA 5ITZF 2VQ2A 1HS6A 3HVEB 4K5AB 2XEEA 3E37A 3RKVA 2UWJG 2PM6A 4BTBA 3G2TA 4L23A 3NBNB 4ILIA 2MYOA 5B3SE 4AP2A 3QJZA 4HBDA 4AY5A 3CVVA 1JPLA 5EIDA 2ETBA 2KM4A 2MHKA 1HZ4A 4ATGA 1QBQA 2I1KA 3APDA 3HXFA 5JHBA 3OXGA 4EZLA 2ZXWE 3V2XA 1SA4A 1TN7A 2NSZA 1O1TA 2IO2C 1MX2A 2B0OE 2GRLA 3AU4A 3B7UX 1TNOA 1FCHA 2XEVA 4NRHB 1IHBA 4N3BA 1QYMA 3U3WA 3D9MA 3KSLA 2ZGGA 3ASGA 1EYHA 4YVQC 2EILE 2V0PA 2L6JA 2XEHA 5H7PA 3EIJA 3VLEA 3PZ3A 3HYMB 4RLYA 3CHSA 4V3IA 2EIME 5FINA 3L08A 2J49A 4EZKA 3JUEA 2XCCA 1IHGA 3EU9A 5CMWA 1TR4A 1BU9A 3CVNA 3TL5A 3J5PA 2LAHA 3LPZA 2E0IA 3D3MA 4GA2A 2RG8A 2VSNA 1TNBA 3ZGQA 3QK0A 5KBAA 3HHMA 5G55A 1KZOA 2X6HA 5AJDA 1HE8A 2WMOA 2KCKA 3ZHEB 4HVBA 5KNGA 2AW6A 4URKA 3Q73A 5IY5E 3AG3E 1Q2ZA 3DXKG 2HO1A 3FUNA 4KMOA 2GRMA 3FUMA 4O1PA 3L6AA 4UI9J 2KCVA 2QYJA 2R02A 1NA3A 1ZU2A 3ZVVA 3FU0A 4L2LA 4GPKA 3C3RA 4CDRA 5HKPA 4F53A 1KT0A 4RSYA 3ZYQA 3DWLG 1VDYA 2BTDA 5LX8A 2A4ZA 3PEUB 1D8EA 2DZOA 2YHCA 2IU1A 3IXEA 3FHEA 3MKRA 3S7FA 2XGSA 4FHJA 3GYZA 2FBNA 3FU5A 3CSTA 1HH8A 4GU5A 4N3CA 4A1GA 3HVEA 4GMRA 3UQ3A 2WPVA 3RK6A 4TUUA 5KNHD 4HXIA 3MGBA 2J09A 2PNNA 1MX4A 3HG0D 1INZA 2IJGX 2R03A 4FU3A 4M3OA 3HXEA 2CHXA 1UN8A 4GZDA 5CRUA 2BEDA 3CQGB 4K5CA 4GZ6A 4XIFA 3MEKA 4G8LA 3ML9A 3ZUVB 4XI0A 3CK9A 3TWSA 4WWNA 4JHKA 5T4YA 5ENNA 4Y6CA 2WXMA 4ANVA 2XZTG 3BEEA 1N0QA 1RW2A 2EINE 1DC2A 5CEDB 2CHZA 5ENOD 4Z68A 4IN3B 2EQXA 3CVQA 3JYSA 4U7EB 4DLOA 4YDWA 1K3ZD 3CVWA 3UKRG 4PS7A 4ZHBA 1NI1A 1FVFA 4DLQA 4U95D 3BG1B 4IRUA 4JHRA 4G25A 3U66A 5ARFA 3U64A 2WVIA 4N39A 3PREA 1E8XA 3TAXA 1LTXA 4ABNA 5AIJA 2WXOA 2R5SA 1LD8A 1BPOA 4BFRA 2KCLA 4NACA 4JHJA 3W9GA 2R59A 3CHQA 1UJKA 3LYAA 4O6FA 4U0SA 5G04C 3IHYA 4DX5D 2PQNA 2JEKA 3SFXA 1U3CA 3JUIA 1K1AA 2WXKA 2B6CA 4JEHA 2P58C 4I1OB 3DSSA 2C0MA 2X6KA 5LP0A 2XCBA 2V4LA 1IQRA 2R2LA 4I6EA 3O48A 3SY2A 2C2LA 3ZXPA 4AVXA 4I1AA 4GTPA 4YVOA 3QWVA 4MBGA 4IYPA 1U3DA 4CDMA 2ZISA 4ILHB 3TG4A 2FEZA 4HORA 4HRLA 1E8YA 5E75A 2Y69E 3DSTA 5LCWJ 4GA0A 2X38A 3P1UA 1ZB1A 2LUHA 3PZ1A 2YNQA 4XE0A 1FPPA 5JMND 4AM9A 2Y4UA 2QC9A 3L9TA 3V31A 4ATZD 3WG7E 4B0ZA 4BX9A 1UG3A 1N52A 3AG2E 4ACLA 5FT9A 4A3TA 4KBQA 2V4HC 2Y1LE 1ELWA 4U04A 3CEQA 3FY4A 3TWWA 1X5BA 4AEZC 3ASHA 3C3OA 2PQRA 4A3VA 5AARA 3EIQC 4KT6B 2CFZA 4Q69A 4UWHA 3FDHA 1EPUA 4I9EA 3RRMB 2MOWA 2XPYA 5D66A 2XRYA 5CBNA 3SO8A 4AXHA 1H2TC 3AS8A 3CV0A 2WQHA 5ARGA 4JC8A 1PC2A 4KZ0A 5A6CA 3UM2A 4GB9A 3Q47B 3HXCA 3PNLB 3I3NA 3MCXA 2NC9A 4PUCA 5CBOA 3S7BA 2NXPA 2XPZA 4LERA 1LF8A 4ME2A 4NIKA 1Y8MA 3LKUA 4LNGA 2P9IG 3C3QA 2X3MA 5BT1A 4GCNA 2FI7A 5ANRA 5AYWD 2VSYA 4BX8A 1OY3D 1A5EA 3TXMA 3Q78A 1WG0A 4TRQA 4G11A 3RRNB 2J9QA 4G23A 5EILA 4UI9K 4FA6A 1TNUA 4HI9A 4WWPA 1E7VA 4GAAA 3CKBA 2A5UA 3ULYA 2GRNB 3BU8A 5DIZA 3UT7A 3R9MA 5FJYA 1SW6A 2Y0BG 3CGHA 3Q49B 1OWMA 2AXUA 1OCOE 5EN5D 1XNFA 3MV3B 4A63B 1MHQA 3LCAA 5JJ7A 4LNUD 4LUNU 4I2WA 2GRQB 3FEYA 4FP7A 3ZYKA 4J8EA 1KZPA 4GTQA 3ML8A 4DRXE 3GZSA 3S7JA 2H6IA 1YA0A 1OCRE 3EDTB 5BNWA 4RG9A 2WQ7A 4N2QA 3U4TA 3EJNA 3VLFA 2IFUA 2F37A 4EBAA 3PEVB 3ULQA 3NAWA 3URZA 3ABLE 1QZ2A 4GTVA 2HR2A 5KJKA 3R7QA 1H6KA 1YMPA 2MRIA 3MYVA 4DX7D 5HS0A 3QWWA 1S70B 1N4PA 3UXGA 1E8WA 4BT8A 1UJJA 1ZBPA 4PDXA 3CKCA 3HIZA 3OAWA 3SQVA 4JW1A 2YQ8A 2I9CA 2OEVA 5J08A 1U2VG 1ELKA 1RZ4A 3FUFA 3V30A 4B94A 2ZU6B 3EHMA 3IEGA 2A5EA 2LSUA 1V55E 2WB2A 1WM5A 1MZCA 3VLDA 3DXMG 3CK8A 2BKGA 3FTVA 2E2EA 3TWVA 5G05J 5KJNA 2WXHA 4H7XA 3ULEG 2XGMA 4CEMA 1TJFA 3L13A 5EX0A 4F1PA 4CT4A 3SD5A 3ZHEA 3MA5A 2VTBA 4F1SA 3KSQA 4J0UA 4FJZA 3LY9A 5JJ6A 5BW8C 4GZ5A 5CEAA 5CCLA 3SF4A 1H6OA 4KVOA 1AWCB 3B7RL 4J8YA 1O5MA 3EUVA 2QZAA 3PE3A 3L54A 4W9RA 2GGFA 4I1MA 1WDYA 3K9IA 4ANWA 2XRZA 2P9KG 4HLLA 5T3RA 3QB2A 3NQPA 2FO1E 3UINC 3DEPA 3ZPJA 2AVPA 1N95A 1N54A 3AJIA 4UI9C 3AAAC 5FIOA 3PUJA 1QNFA 4B8CB 1AP7A 2OOEA 4UWKA 3PNTB 1O1RA 4UQZA 3EHNA 2XZDG 1ELRA 3L17A 4Y6WA 2WXRA 5EDSA 4GZCA 2C0LA 3FH8A 4YNDA 1E8ZA 1KPSB 3FTWA 5AQ7A 3X2QE 2ONDA 2FULA 2V8SE 3QWPA 1MQSA 2OV8A 3G2UA 4GTOA 4CRWA 4E6HA 3DSWA 3APFA 3DSXA 5ENRD 1QQEA 4C0MA 4HOSA 4Q96A 4GMJA 1EDUA 3ASNE 4O60A 1UN9A 4FHKA 4HOTA 4TXRA 3D9PA 1S64A 4LNBA 3PH0C 3UT8A 2X6FA 3MZLB 3QARA 1UW4B 3L22A 1BLXB 1HU3A 3EHRA 1Z6TA 2WXPA 4LSZE 3W9FA 4JXTA 4MKTA 5G04J
chains in the Genus database with same CATH topology
1KT1A 2C0MA 2X6KA 5LP0A 2IONA 4FULA 3CVYA 2IOSA 2XCBA 5CMYA 2I6HA 1H19A 5AJLA 5BV1A 2V4LA 3UMVA 1IQRA 3SBTB 2BUGA 2WXIA 3O48A 4I6EA 3WXXA 2C2LA 4AVXA 5A23A 5CCMA 4I1AA 4YVOA 3KAEA 2LAIA 3CLJA 3QWVA 3CHOA 4KVMA 4CGVA 4IYPA 1U3DA 4CDMA 3FH5A 3R9AB 4GA1A 4ILHB 3JCKC 2HM8A 3TG4A 2FEZA 2J07A 2RD0A 4HORA 4UQXA 2WXQA 1E8YA 5T8IA 4L1BA 5E75A 1WY6A 3SFZA 2OVFA 4APFA 4BY6A 4H7YA 5LCWJ 2QFCA 4FLBA 3FUHA 1HX8A 4MS6A 2VGXA 2DIWA 4GA0A 3RU0A 2VTBB 2X38A 2AXVA 3P1UA 1PY1A 2IF4A 3ZW3A 4F7AA 4AOFA 4OYSA 4I2ZA 5FZRA 3QNKA 4LEUA 2YNQA 4JEUA 5DBKA 3ONKA 4XE0A 5E76A 3D9JA 4I6JA 2I2OA 4AM9A 2Y4UA 1H2VC 5D0QD 4EPZA 4J8FA 3RIBA 2XPIA 2J4DA 3ZN3A 4GCOA 3PVLA 4FLHA 5CHEE 4B0ZA 4GYOA 3CR3A 3RJVA 4BX9A 4GYYA 1UG3A 3FTYA 1N52A 3QKYA 5J90A 4EECA 4ACLA 3AS4A 2QY7A 3GZ1A 5FT9A 3PE4A 3LXUX 3SBSA 4A3TA 2YINA 4KBQA 4XKBA 2AWIA 3CK7A 1ELWA 4U04A 3CEQA 4C0EA 1W3BA 3FY4A 1X5BA 3MV2B 1OWLA 3OXFA 3AS5A 4AEZC 3ASHA 4JPSA 2PQRA 2VQ2A 1NP7A 4A3VA 3EIQC 4F3VA 5BPPA 1JWGA 5KCMA 4DPRA 1HFAA 4KT6B 2CFZA 1HS6A 3HVEB 4Q69A 3SZ7A 4HLEA 2R17C 4MLPA 4UWHA 3FDHA 3RKVA 5ANLA 1EPUA 2UWJG 3LDZA 2CHWA 4I9EA 2JLBA 2PM6A 3RRMB 2MOWA 1NZNA 2XPYA 3G2TA 4L23A 3KD7A 4BTBA 5FZSA 3Q5MA 2XRYA 1EF1C 3HDXA 5G2NA 2X6IA 3MKQB 4ILIA 4E85A 4AXHA 1H2TC 1SZ9A 2FF4A 3AS8A 4AP2A 4EBAG 5BUZA 3S2AA 4BSXA 4BTAA 3ENEA 3QJZA 2KC7A 4ILGA 4AY5A 3CVVA 3CV0A 4I43A 1L5JA 1JPLA 4GMLA 4J6IA 2WQHA 5ARGA 4U63A 4JC8A 2KM4A 2MHKA 2DCPA 4XZ4A 3FFLA 4G2VA 3FTSA 3D9NA 1HZ4A 1PC2A 4ATGA 2I1KA 4KZ0A 5A6CA 3APDA 3B13A 5JHBA 2WM9A 3OXGA 4GB9A 4EZLA 3TJPA 3Q47B 2VGYA 3PNLB 4GZ3A 3I3NA 5FZQA 3MCXA 2NC9A 4PUCA 3TXNA 3TGOA 3S7BA 2LO6A 2NSZA 1WAO1 3I5PA 5C1DA 4JVSA 2NXPA 4XKCA 2XPZA 3P2BA 4LERA 1TEZA 1HG5A 1LF8A 2WXNA 4ME2A 2GRLA 3AU4A 2VSOE 1Y8MA 3LKUA 1IYGA 4J8SA 3OXLA 4PS8A 2X3MA 4G26A 3IHVA 3N71A 3RRUA 3B7UX 5BT1A 5KJLA 4GCNA 2FI7A 3BG0B 5ANRA 2VSYA 5AYWD 3L16A 3IKOB 5FQ6A 4BX8A 4DI4A 1FCHA 4ANUA 2XQ0A 3TXMA 4OVVA 4TRQA 4G11A 2XEVA 3RRNB 2J9QA 4NRHB 3VTYA 3ZIMA 4G23A 1XGWA 2XGOA 4N3BA 4RVBA 4UI9K 4FA6A 3SNXA 4K03A 3U3WA 2UY1A 4WWPA 1E7VA 3D9MA 3FUDA 3FTZA 4GAAA 4WNEA 3CKBA 3Q4AB 3O4ZA 1P5QA 3ASGA 1EYHA 2A5UA 4C9BB 4OVUA 5JHAA 4HOUA 4EQFA 4YVQC 1IQUA 1SZAA 3UT7A 2V0PA 5DIZA 2IOLA 4L7TA 2L6JA 4KZCA 5A7DB 1SQMA 5FJYA 3EIJA 3VLEA 3ONLA 5M72A 3HYMB 5JJTA 3CHSA 4N3AA 1TJCA 2VJ8A 2XHEA 4FC8A 3CGHA 3Q49B 4V3IA 1OWMA 3L08A 2J49A 4EZKA 3APCA 1HO8A 2AXUA 1B89A 1IHGA 1XNFA 2XCCA 5CMWA 3MV3B 3KEZA 1KLXA 3CVNA 4B8AA 3TL5A 1MHQA 3LCAA 3MX3A 5JJ7A 3ZFWA 4MRUA 4LUNU 1OUVA 4I2WA 4P29A 2LAHA 4U8HA 4U0ZA 4A55A 4FP7A 3FEYA 3LPZA 2Y3AA 3ZYKA 2E0IA 3D3MA 4GA2A 3PDNA 2RG8A 2VSNA 4J8DA 4J8EA 3ML8A 4QFVA 3Q15A 5LFAA 3ZGQA 3FEXA 3QK0A 2PM7A 3GZSA 5AENA 1E7UA 3S7JA 3HHMA 4WNDA 4UQYA 5G55A 3LY8A 2X6HA 3C98A 5AJDA 3FUIA 5BV0A 1HE8A 1YA0A 2WMOA 3EDTB 5BNWA 3U66A 5EKQD 4RG9A 3CVUA 2WQ7A 5C2YA 4N2QA 2HYZA 2KCKA 4HFGA 3ZHEB 3U4TA 3ZYLA 4B89A 3EJNA 4PS3A 3VLFA 1S0PA 2IFUA 4BT9A 4UWGA 4HVBA 4EBAA 3PEVB 4WWOA 3T8MA 3ULQA 3VTXA 4AJWA 2FO7A 3URZA 4RG6A 2AW6A 4URKA 3ASFA 1QZ2A 4CDNA 4TV3A 3FUNA 4KMOA 2HO1A 4WAFA 4N2SA 4DI3A 2GRMA 2HR2A 3FUMA 4UI9J 3L6AA 5KJKA 2VGXB 2KCVA 3T5XA 4I6GA 3R7QA 1NA3A 1ZU2A 1H6KA 3ZVVA 2MRIA 4FJYA 4JZYA 3MYVA 3FU0A 4UWFA 4EZJA 4KXKB 4L2LA 3FULA 4AY6A 3QWWA 5D0OD 4GPKA 1E8WA 3SGHA 3D9IA 2BF0X 3E4BA 3LEWA 4BT8A 4XI9A 3U9WA 4CDRA 3ESKA 1UJJA 4N5CA 4IULA 4HS2A 1KT0A 3I4RB 4F53A 4RSYA 3QOUA 3ZYQA 3UX4A 1ZBPA 1E96B 4I17A 4PDXA 3AU5A 1VDYA 3CKCA 3CQCB 2BTDA 3G2SA 4WUYA 3HIZA 5LX8A 3OAWA 1NA0A 4CGWA 2A4ZA 4JW1A 4U07A 3PRZA 4NURA 2YQ8A 3PEUB 2I9CA 3ZEFA 5LCWC 2WXJA 4PH4B 2YHCA 5FQ4A 4FADA 2IU1A 3LY7A 1GW6A 3JQ1A 5J08A 1ELKA 1H0AA 3FHEA 3FH7A 2XGSA 3MKRA 3S7FA 4G1TA 4FHJA 3FUKA 3FUFA 2CFUA 2PZIA 3GYZA 2FBNA 2X6JA 4B94A 3FU5A 4LCTA 3CSTA 1HH8A 2ZU6B 3EHMA 3FWVA 4GU5A 4A1SA 4N3CA 2WXGA 4A1GA 3T5VA 3IEGA 2LSUA 3HVEA 3UT4A 2WB2A 2L9BA 1WM5A 3VLDA 3UQ3A 3ZRHA 2WPVA 3RK6A 2L0IA 4TUUA 5KJMA 3B7SA 4HXIA 4CCAA 3ESLA 3FP3A 3LVRE 4GYWA 3MGBA 2J09A 3CK8A 3FTUA 2Y4TA 3FTVA 4BWRA 2E2EA 3DBSA 3PUKA 5G05J 2GW1A 3R7RA 5KJNA 2WXHA 4H7XA 5FTPA 1INZA 2IJGX 2XGMA 4FU3A 4M3OA 4NQ0A 3S7DA 4CEMA 1TJFA 3L13A 2CHXA 5EX0A 3D9OA 4CT4A 2WQ6A 3LVQE 4DK5A 1UN8A 4GZDA 3SD5A 3ZHEA 2M63A 3JQ0A 3MA5A 2L0TB 3RO2A 3CQGB 2VTBA 3CHMA 4F1SA 3NF1A 4LRZA 4GZ6A 4XIFA 2WMNA 3MEKA 3SI5A 3UPVA 4J0UA 4FJZA 4D10C 3LY9A 3ML9A 5JJ6A 1DNPA 3CHRA 5BW8C 4XI0A 5LOZA 3CK9A 3B7TA 4GZ5A 5CCLA 3SF4A 3IBEA 4ACKA 1OWPA 4WWNA 3PZDA 3QDNA 4JHKA 4KVOA 5ENNA 5T4YA 3B7RL 4Y6CA 1Z3YA 2YHEA 3ASDA 2Q7FA 2WXMA 2PL2A 3MKQA 1PAQA 3PE3A 4ANVA 2CG3A 4APOA 3BEEA 3L54A 4L2YA 4UWLA 4G24A 4KYOB 4W9RA 2CHZA 1DVPA 2WXFA 3FUJA 2GGFA 3LJ3A 4I1MA 3G2VA 4IN3B 2WXLA 3TG5A 2EQXA 1FVHA 3K9IA 5EX3A 4ANWA 3CVQA 2XRZA 3CHPA 3I4GA 3JYSA 4XX5A 4DLOA 5T3RA 3QB2A 3NQPA 3CVWA 2KZTB 4PS7A 5FWQA 3FUEA 3ZPJA 2AVPA 1FVFA 4DLQA 2OVBA 2UY1B 1HF8A 3CVLA 1N54A 2KATA 3FU6A 1E90A 3CIAA 2DBAA 4UI9C 4JA9A 3PUJA 1QNFA 4B8CB 3CVXA 3LS8A 3BG1B 2OOEA 1OWNA 3OTNA 4R7LA 4UWKA 3SHFA 3D9KA 1H2UA 2ILRA 4WNFA 3G2WA 4WNGA 3PNTB 1Z3XA 4IRUA 4JHRA 3EHNA 4UQZA 1ELRA 1JWFA 5HI7A 3L17A 4G25A 4Y6WA 5HQ8A 2WXRA 5EDSA 1Y6IA 3PS6A 4GZCA 2C0LA 3FH8A 4YNDA 3GW4A 1E8ZA 2J08A 2VYIA 2J4BA 5ARFA 3FTWA 3U64A 3ZYMA 2WVIA 3ZXSA 4N39A 2ONDA 3PREA 2FULA 2IQCA 1E8XA 2LSVA 2V8SE 3QWPA 3TAXA 4ABNA 5AIJA 1OWOA 2KZTA 1MQSA 2WXOA 2OV8A 4JL0A 3G2UA 4CRWA 2R5SA 2AXZA 3D9LA 4E6HA 1BPOA 2VSXE 4BFRA 2KCLA 4NACA 4JHJA 4CT0A 3APFA 4I9CA 4DJAA 1QQEA 4C0MA 3NZUA 4Q96A 4HOSA 4GMJA 4AV7A 2R59A 1EDUA 1A17A 3CHQA 4Q94A 1UJKA 3GZ2A 3LYAA 4O6FA 4U0SA 2LNIA 3FTXA 1UN9A 4FHKA 4HOTA 1HG2A 5G04C 3IHYA 4K0RA 5G05C 4HOQA 1JUQA 3MJWA 3D9PA 2PQNA 3CSFA 2JEKA 3IV0A 3NZSA 3PH0C 3UT8A 3QC1A 1U3CA 2X6FA 3JUIA 2I1JA 3CVPA 3MZLB 3DPDA 3QARA 2V5FA 3QAQA 1UW4B 2CG2A 1HXIA 3L22A 5FQ7A 1HU3A 3FU3A 1Z6TA 2WXKA 4U0UA 4AIFA 4JEHA 3KS2A 2WXPA 5FQ8A 4JA7A 3RO3A 3UUXA 4ANXA 2P58C 4JXTA 4I1OB 4MKTA 5G04J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D9M A;  1ELK A;  1HG5 A;  4GZC A;  1UJK A;  1H0A A;  1LF8 A;  4Q94 A;  5LOZ A;  1MHQ A;  5LP0 A;  1JPL A;  3ZYM A;  1INZ A;  4HFG A;  3D9I A;  2BF0 X;  4FU3 A;  3ZYL A;  1HG2 A;  5CMW A;  1EYH A;  3D9O A;  2KM4 A;  5CMY A;  1JUQ A;  2DCP A;  3ZYK A;  1UJJ A;  4FLB A;  1HF8 A;  1HX8 A;  3D9P A;  1SZA A;  3D9N A;  4GZD A;  3RRU A;  2DIW A;  3ZYQ A;  2QY7 A;  2V8S E;  3LDZ A;  1PY1 A;  2L0T B;  1VDY A;  4AVX A;  2MOW A;  3G2S A;  3ONL A;  4Q96 A;  3G2T A;  3D9K A;  3CLJ A;  3G2U A;  2L0I A;  3D9L A;  1DVP A;  3G2W A;  4NAC A;  1X5B A;  3G2V A;  5J08 A;  2LO6 A;  1XGW A;  3ONK A;  1SZ9 A;  3D9J A;  4JXT A;  1JWF A;  1JWG A;  1HFA A;  1EDU A; 
#chains in the Genus database with same CATH topology
 4GTT A;  3J5Q B;  3HXD A;  3V2O A;  3CVY A;  2GRO B;  2I6H A;  5ENQ D;  3SBT B;  2BUG A;  2WXI A;  5A23 A;  5CCM A;  3CHO A;  3FH5 A;  5AN8 A;  3R9A B;  4GA1 A;  3JCK C;  2HM8 A;  3AG1 E;  2RD0 A;  4UQX A;  2WXQ A;  3SFZ A;  1WY6 A;  4APF A;  4H7Y A;  5AAO A;  2QFC A;  4FLB A;  3FUH A;  2AXV A;  1PY1 A;  2IF4 A;  3ZW3 A;  4F7A A;  3TWR A;  4LEU A;  4BET A;  2EIK E;  4JEU A;  2RFA A;  5E76 A;  4I6J A;  2I2O A;  3HXB A;  4GCO A;  4FLH A;  3CR3 A;  3RJV A;  5J90 A;  3FTY A;  3QKY A;  3B7B A;  3LXU X;  3SBS A;  3Q79 A;  4C0E A;  3B95 A;  3Q9U C;  4JPS A;  4F3V A;  1JWG A;  1HFA A;  4X8Q A;  3SZ7 A;  2DVW A;  3LDZ A;  2JLB A;  5BXO A;  5D2M C;  3KD7 A;  5FZS A;  3HDX A;  2F8Y A;  5AQA A;  2H6F A;  4E85 A;  1SZ9 A;  2FF4 A;  5AQB A;  5BUZ A;  4BSX A;  4ILG A;  4HQD A;  1K1B A;  3E32 A;  4I43 A;  1L5J A;  4GML A;  4J6I A;  4DX2 A;  2DCP A;  4G2V A;  3D9N A;  2KBX A;  3TJP A;  5JA4 D;  5FZQ A;  3TGO A;  4L9P A;  5ENS D;  2OEW A;  4DX6 D;  4HRN A;  5B1B E;  1BI8 B;  3P2B A;  4XKC A;  1TEZ A;  2WXN A;  2VSO E;  1D9S A;  2IO3 C;  4PS8 A;  3IHV A;  3N71 A;  3RRU A;  5KJL A;  1MYO A;  1G3N B;  4OVV A;  3VTY A;  3FTZ A;  4BSZ B;  4J7W A;  4C9B B;  1SZA A;  2IOL A;  5A7D B;  5M72 A;  5JJT A;  4N3A A;  2OCC E;  4FC8 A;  2H6G A;  3TWQ A;  3UIO C;  1TNZ A;  4RQI A;  2VGE A;  4GTM A;  3APC A;  3Q7A A;  1HO8 A;  3BQO A;  3HRA A;  4U8V D;  1KLX A;  3MX3 A;  4MRU A;  4P29 A;  4A55 A;  4U0Z A;  2Y3A A;  3PDN A;  4BEP A;  3KEA A;  5LFA A;  4TUM A;  1YCS B;  3FEX A;  4N5Q A;  2PM7 A;  5AEN A;  1E7U A;  4HNA D;  3Q75 A;  3BUA A;  1DCE A;  4WND A;  2XEN A;  3C98 A;  3FUI A;  2DYR E;  2ZIR A;  5EKQ D;  2IEJ A;  5C2Y A;  3ZYL A;  1TNY A;  4YDE A;  4B89 A;  3DPY A;  2P9S G;  4WWO A;  4O1O A;  3T8M A;  5B1A E;  4AJW A;  2FO7 A;  4RG6 A;  4CDN A;  1IXV A;  4N2S A;  2NYJ A;  4I6G A;  4JZY A;  4EZJ A;  4KXK B;  4AY6 A;  5D0O D;  4F6R D;  4LG6 A;  3ESK A;  4IUL A;  3I4R B;  1TYQ G;  2DYS E;  3ZNG A;  3AU5 A;  2R05 A;  4WUY A;  1NA0 A;  3NOG D;  4TXP A;  3PRZ A;  4NUR A;  5LCW C;  2WXJ A;  5FQ4 A;  3ZKJ A;  3SFY A;  1D8D A;  3LY7 A;  3JQ1 A;  4G1T A;  2PZI A;  1N4S A;  5ENP D;  4M7C A;  4LCT A;  1JCQ A;  3FWV A;  2WXG A;  3C72 A;  3UT4 A;  2DWZ A;  2L9B A;  3E33 A;  3ZRH A;  5KJM A;  2L0I A;  2LXM A;  3B7S A;  4CCA A;  3ESL A;  3FP3 A;  3LVR E;  3FTU A;  3DBS A;  3PUK A;  5FTP A;  3S7D A;  4EHM A;  4NQ0 A;  5EYP F;  4DUI A;  3LVQ E;  4DK5 A;  3TWX A;  2L0T B;  3RO2 A;  4HI8 A;  3RAU A;  3SI5 A;  5CER B;  1N94 A;  3UPV A;  4D10 C;  1DNP A;  3CHR A;  4CZ2 D;  5LOZ A;  3UM1 A;  4ACK A;  1OWP A;  2YHE A;  2Q7F A;  3MKQ A;  2PL2 A;  4GPM A;  4APO A;  4L2Y A;  4UWL A;  4G24 A;  1TN6 A;  1DVP A;  3G2V A;  1N4R A;  5EX3 A;  1FVH A;  3CHP A;  4XX5 A;  2KZT B;  3FUE A;  1UOH A;  2J8S D;  2KAT A;  3FU6 A;  1E90 A;  3CIA A;  1Z5S C;  2DBA A;  1SA5 A;  3LS8 A;  1OWN A;  4R7L A;  3D9K A;  1H2U A;  2ILR A;  4WNF A;  1FT1 A;  3V79 K;  5HI7 A;  3ZU7 B;  2VYI A;  2J4B A;  3C5R A;  2IQC A;  2GRR B;  2KZT A;  1JCS A;  4JL0 A;  2VSX E;  4I9C A;  4DJA A;  4HB5 A;  3NZU A;  1A17 A;  4Q94 A;  5ENT D;  1V54 E;  2LNI A;  3FTX A;  1HG2 A;  5G05 C;  2XS8 A;  3NZS A;  3QC1 A;  4G8K A;  3DPD A;  2V5F A;  3QAQ A;  1OCZ E;  2CG2 A;  2P9P G;  3FU3 A;  3ABM E;  4U0U A;  3T8K A;  3KS2 A;  3RO3 A;  4JA7 A;  4FUL A;  5CMY A;  1H19 A;  5AJL A;  4BER A;  3UMV A;  4DX1 A;  3F6Q A;  2LAI A;  3CLJ A;  4KVM A;  4CGV A;  5CEC B;  5T8I A;  4L1B A;  2OVF A;  1HX8 A;  2VGX A;  3RU0 A;  3TWU A;  5EIB E;  1OCC E;  5FZR A;  3D9J A;  4U8Y D;  1H2V C;  4J8F A;  3RIB A;  2GRP B;  3ZN3 A;  5CHE E;  3PZ2 A;  4GYY A;  3GZ1 A;  1O1S A;  4XKB A;  2AWI A;  3CK7 A;  1W3B A;  3MV2 B;  1OWL A;  3OXF A;  3AS5 A;  2IY0 C;  5BPP A;  1NP7 A;  5KCM A;  4DPR A;  5KWD A;  4HLE A;  2R17 C;  4MLP A;  5ANL A;  2CHW A;  3DSU A;  1NZN A;  3Q5M A;  1EF1 C;  5G2N A;  2X6I A;  3MKQ B;  2AJA A;  4EBA G;  3S2A A;  4BTA A;  3ENE A;  2KC7 A;  4U63 A;  4XZ4 A;  3FFL A;  3FTS A;  1BD8 A;  3DEO A;  3B13 A;  2WM9 A;  3PZ4 A;  2VGY A;  4GZ3 A;  3TXN A;  3JXI A;  2QYU A;  2LO6 A;  1WAO 1;  4GTS A;  3I5P A;  5C1D A;  4JVS A;  1HG5 A;  2RKK A;  1IYG A;  4J8S A;  3OXL A;  4G26 A;  1N9A A;  3BG0 B;  3L16 A;  3IKO B;  5FQ6 A;  4DI4 A;  4ANU A;  1X81 A;  2XQ0 A;  3ZIM A;  1XGW A;  2XGO A;  4RVB A;  3SNX A;  4K03 A;  2UY1 A;  1OT8 A;  3FUD A;  4WNE A;  3Q4A B;  3O4Z A;  1P5Q A;  5JHA A;  4OVU A;  4HOU A;  4EQF A;  1IQU A;  2V5Q C;  4L7T A;  4KZC A;  1SQM A;  3ONL A;  1TJC A;  2VJ8 A;  2XHE A;  3AG4 E;  3E30 A;  1B89 A;  4C48 B;  3KEZ A;  4B8A A;  3ZFW A;  1OUV A;  4U8H A;  3T9K A;  4QFV A;  4J8D A;  3Q15 A;  1DCQ A;  3EU5 A;  3UIP C;  4UQY A;  3LY8 A;  5BV0 A;  4XEI G;  2RFM A;  3CVU A;  2HYZ A;  4HFG A;  5CRV A;  4PS3 A;  1S0P A;  3D9H A;  4BT9 A;  4UWG A;  3VTX A;  3ASF A;  4TV3 A;  3RSE G;  4WAF A;  4DI3 A;  5BXU A;  2VGX B;  3T5X A;  4JB8 P;  4FJY A;  4UWF A;  3FUL A;  3SGH A;  3D9I A;  2BF0 X;  3E4B A;  3LEW A;  4XI9 A;  3TWT A;  3U9W A;  4N5C A;  4HS2 A;  2BKK B;  3QOU A;  3UX4 A;  1E96 B;  2XS1 A;  4I17 A;  1LD7 A;  4B93 B;  3CQC B;  3G2S A;  4CGW A;  2P9U G;  4U07 A;  3ZEF A;  4PH4 B;  4FAD A;  1GW6 A;  3UM0 A;  1H0A A;  3FH7 A;  1NL4 A;  3FUK A;  2CFU A;  2X6J A;  4OAV B;  4A1S A;  3T5V A;  3NOC D;  1BI7 B;  3NB2 A;  4TXQ A;  1YYH A;  4U96 D;  4GYW A;  4OAU C;  2Y4T A;  4BWR A;  3R7R A;  2GW1 A;  2F0Y A;  1NFI E;  3D9O A;  2WQ6 A;  4GTR A;  2M63 A;  1N0R A;  3JQ0 A;  3CHM A;  3NF1 A;  4LRZ A;  2WMN A;  1MJ0 A;  3UKU G;  3UI2 A;  3E34 A;  1IKN D;  3B7T A;  3IBE A;  4HRM B;  3PZD A;  3QDN A;  3Q9N C;  1Z3Y A;  2ETA A;  3ASD A;  1PAQ A;  2CG3 A;  1JCR A;  4KYO B;  3UM3 A;  3LJ3 A;  2WXF A;  3FUJ A;  2WXL A;  3TG5 A;  2F8X K;  1TN8 A;  3I4G A;  4ZFH A;  4BES A;  5FWQ A;  5AQ9 A;  2OVB A;  2UY1 B;  1HF8 A;  3CVL A;  2DZN A;  4JA9 A;  3CVX A;  3L82 A;  4YDY A;  3OTN A;  3SHF A;  1N11 A;  3G2W A;  4WNG A;  1Z3X A;  3Q7F A;  3ISM C;  1JWF A;  5HQ8 A;  3EHQ A;  1Y6I A;  3DSV A;  3PS6 A;  3GW4 A;  3ZYM A;  2J08 A;  3ZXS A;  2LSV A;  4UUC A;  1H6P A;  1OWO A;  3LJN A;  2AXZ A;  3D9L A;  4CT0 A;  5HRY A;  5EYL A;  1S63 A;  4AV7 A;  3GZ2 A;  4K0R A;  4HOQ A;  1JUQ A;  2KXP C;  3MJW A;  3CSF A;  3IV0 A;  3UTM A;  2I1J A;  3CVP A;  3JXJ A;  5FQ7 A;  1HXI A;  2P2C P;  4AIF A;  2H6H A;  5FQ8 A;  3UUX A;  4ANX A;  1FT2 A;  2HE0 A;  1KT1 A;  2ION A;  2IOS A;  2EIJ E;  5BV1 A;  3WXX A;  3ABK E;  3KAE A;  2JAB A;  4K5B A;  2J07 A;  1K8K G;  1N4Q A;  2LXL A;  4BY6 A;  2P9N G;  4CYM D;  4JD2 G;  4MS6 A;  2DIW A;  2VTB B;  4AOF A;  4OYS A;  4I2Z A;  3QNK A;  2ETC A;  2ZGD A;  5DBK A;  3ONK A;  4EPZ A;  5D0Q D;  3ASO E;  3DRA A;  2XPI A;  2J4D A;  1OXJ A;  4YDO A;  3PVL A;  4GYO A;  4QQI A;  4EEC A;  2P9L G;  3AS4 A;  2QY7 A;  3PE4 A;  1MX6 A;  2YIN A;  2L6B A;  1SVX A;  5ITZ F;  2VQ2 A;  1HS6 A;  3HVE B;  4K5A B;  2XEE A;  3E37 A;  3RKV A;  2UWJ G;  2PM6 A;  4BTB A;  3G2T A;  4L23 A;  3NBN B;  4ILI A;  2MYO A;  5B3S E;  4AP2 A;  3QJZ A;  4HBD A;  4AY5 A;  3CVV A;  1JPL A;  5EID A;  2ETB A;  2KM4 A;  2MHK A;  1HZ4 A;  4ATG A;  1QBQ A;  2I1K A;  3APD A;  3HXF A;  5JHB A;  3OXG A;  4EZL A;  2ZXW E;  3V2X A;  1SA4 A;  1TN7 A;  2NSZ A;  1O1T A;  2IO2 C;  1MX2 A;  2B0O E;  2GRL A;  3AU4 A;  3B7U X;  1TNO A;  1FCH A;  2XEV A;  4NRH B;  1IHB A;  4N3B A;  1QYM A;  3U3W A;  3D9M A;  3KSL A;  2ZGG A;  3ASG A;  1EYH A;  4YVQ C;  2EIL E;  2V0P A;  2L6J A;  2XEH A;  5H7P A;  3EIJ A;  3VLE A;  3PZ3 A;  3HYM B;  4RLY A;  3CHS A;  4V3I A;  2EIM E;  5FIN A;  3L08 A;  2J49 A;  4EZK A;  3JUE A;  2XCC A;  1IHG A;  3EU9 A;  5CMW A;  1TR4 A;  1BU9 A;  3CVN A;  3TL5 A;  3J5P A;  2LAH A;  3LPZ A;  2E0I A;  3D3M A;  4GA2 A;  2RG8 A;  2VSN A;  1TNB A;  3ZGQ A;  3QK0 A;  5KBA A;  3HHM A;  5G55 A;  1KZO A;  2X6H A;  5AJD A;  1HE8 A;  2WMO A;  2KCK A;  3ZHE B;  4HVB A;  5KNG A;  2AW6 A;  4URK A;  3Q73 A;  5IY5 E;  3AG3 E;  1Q2Z A;  3DXK G;  2HO1 A;  3FUN A;  4KMO A;  2GRM A;  3FUM A;  4O1P A;  3L6A A;  4UI9 J;  2KCV A;  2QYJ A;  2R02 A;  1NA3 A;  1ZU2 A;  3ZVV A;  3FU0 A;  4L2L A;  4GPK A;  3C3R A;  4CDR A;  5HKP A;  4F53 A;  1KT0 A;  4RSY A;  3ZYQ A;  3DWL G;  1VDY A;  2BTD A;  5LX8 A;  2A4Z A;  3PEU B;  1D8E A;  2DZO A;  2YHC A;  2IU1 A;  3IXE A;  3FHE A;  3MKR A;  3S7F A;  2XGS A;  4FHJ A;  3GYZ A;  2FBN A;  3FU5 A;  3CST A;  1HH8 A;  4GU5 A;  4N3C A;  4A1G A;  3HVE A;  4GMR A;  3UQ3 A;  2WPV A;  3RK6 A;  4TUU A;  5KNH D;  4HXI A;  3MGB A;  2J09 A;  2PNN A;  1MX4 A;  3HG0 D;  1INZ A;  2IJG X;  2R03 A;  4FU3 A;  4M3O A;  3HXE A;  2CHX A;  1UN8 A;  4GZD A;  5CRU A;  2BED A;  3CQG B;  4K5C A;  4GZ6 A;  4XIF A;  3MEK A;  4G8L A;  3ML9 A;  3ZUV B;  4XI0 A;  3CK9 A;  3TWS A;  4WWN A;  4JHK A;  5T4Y A;  5ENN A;  4Y6C A;  2WXM A;  4ANV A;  2XZT G;  3BEE A;  1N0Q A;  1RW2 A;  2EIN E;  1DC2 A;  5CED B;  2CHZ A;  5ENO D;  4Z68 A;  4IN3 B;  2EQX A;  3CVQ A;  3JYS A;  4U7E B;  4DLO A;  4YDW A;  1K3Z D;  3CVW A;  3UKR G;  4PS7 A;  4ZHB A;  1NI1 A;  1FVF A;  4DLQ A;  4U95 D;  3BG1 B;  4IRU A;  4JHR A;  4G25 A;  3U66 A;  5ARF A;  3U64 A;  2WVI A;  4N39 A;  3PRE A;  1E8X A;  3TAX A;  1LTX A;  4ABN A;  5AIJ A;  2WXO A;  2R5S A;  1LD8 A;  1BPO A;  4BFR A;  2KCL A;  4NAC A;  4JHJ A;  3W9G A;  2R59 A;  3CHQ A;  1UJK A;  3LYA A;  4O6F A;  4U0S A;  5G04 C;  3IHY A;  4DX5 D;  2PQN A;  2JEK A;  3SFX A;  1U3C A;  3JUI A;  1K1A A;  2WXK A;  2B6C A;  4JEH A;  2P58 C;  4I1O B;  3DSS A;  2C0M A;  2X6K A;  5LP0 A;  2XCB A;  2V4L A;  1IQR A;  2R2L A;  4I6E A;  3O48 A;  3SY2 A;  2C2L A;  3ZXP A;  4AVX A;  4I1A A;  4GTP A;  4YVO A;  3QWV A;  4MBG A;  4IYP A;  1U3D A;  4CDM A;  2ZIS A;  4ILH B;  3TG4 A;  2FEZ A;  4HOR A;  4HRL A;  1E8Y A;  5E75 A;  2Y69 E;  3DST A;  5LCW J;  4GA0 A;  2X38 A;  3P1U A;  1ZB1 A;  2LUH A;  3PZ1 A;  2YNQ A;  4XE0 A;  1FPP A;  5JMN D;  4AM9 A;  2Y4U A;  2QC9 A;  3L9T A;  3V31 A;  4ATZ D;  3WG7 E;  4B0Z A;  4BX9 A;  1UG3 A;  1N52 A;  3AG2 E;  4ACL A;  5FT9 A;  4A3T A;  4KBQ A;  2V4H C;  2Y1L E;  1ELW A;  4U04 A;  3CEQ A;  3FY4 A;  3TWW A;  1X5B A;  4AEZ C;  3ASH A;  3C3O A;  2PQR A;  4A3V A;  5AAR A;  3EIQ C;  4KT6 B;  2CFZ A;  4Q69 A;  4UWH A;  3FDH A;  1EPU A;  4I9E A;  3RRM B;  2MOW A;  2XPY A;  5D66 A;  2XRY A;  5CBN A;  3SO8 A;  4AXH A;  1H2T C;  3AS8 A;  3CV0 A;  2WQH A;  5ARG A;  4JC8 A;  1PC2 A;  4KZ0 A;  5A6C A;  3UM2 A;  4GB9 A;  3Q47 B;  3HXC A;  3PNL B;  3I3N A;  3MCX A;  2NC9 A;  4PUC A;  5CBO A;  3S7B A;  2NXP A;  2XPZ A;  4LER A;  1LF8 A;  4ME2 A;  4NIK A;  1Y8M A;  3LKU A;  4LNG A;  2P9I G;  3C3Q A;  2X3M A;  5BT1 A;  4GCN A;  2FI7 A;  5ANR A;  5AYW D;  2VSY A;  4BX8 A;  1OY3 D;  1A5E A;  3TXM A;  3Q78 A;  1WG0 A;  4TRQ A;  4G11 A;  3RRN B;  2J9Q A;  4G23 A;  5EIL A;  4UI9 K;  4FA6 A;  1TNU A;  4HI9 A;  4WWP A;  1E7V A;  4GAA A;  3CKB A;  2A5U A;  3ULY A;  2GRN B;  3BU8 A;  5DIZ A;  3UT7 A;  3R9M A;  5FJY A;  1SW6 A;  2Y0B G;  3CGH A;  3Q49 B;  1OWM A;  2AXU A;  1OCO E;  5EN5 D;  1XNF A;  3MV3 B;  4A63 B;  1MHQ A;  3LCA A;  5JJ7 A;  4LNU D;  4LUN U;  4I2W A;  2GRQ B;  3FEY A;  4FP7 A;  3ZYK A;  4J8E A;  1KZP A;  4GTQ A;  3ML8 A;  4DRX E;  3GZS A;  3S7J A;  2H6I A;  1YA0 A;  1OCR E;  3EDT B;  5BNW A;  4RG9 A;  2WQ7 A;  4N2Q A;  3U4T A;  3EJN A;  3VLF A;  2IFU A;  2F37 A;  4EBA A;  3PEV B;  3ULQ A;  3NAW A;  3URZ A;  3ABL E;  1QZ2 A;  4GTV A;  2HR2 A;  5KJK A;  3R7Q A;  1H6K A;  1YMP A;  2MRI A;  3MYV A;  4DX7 D;  5HS0 A;  3QWW A;  1S70 B;  1N4P A;  3UXG A;  1E8W A;  4BT8 A;  1UJJ A;  1ZBP A;  4PDX A;  3CKC A;  3HIZ A;  3OAW A;  3SQV A;  4JW1 A;  2YQ8 A;  2I9C A;  2OEV A;  5J08 A;  1U2V G;  1ELK A;  1RZ4 A;  3FUF A;  3V30 A;  4B94 A;  2ZU6 B;  3EHM A;  3IEG A;  2A5E A;  2LSU A;  1V55 E;  2WB2 A;  1WM5 A;  1MZC A;  3VLD A;  3DXM G;  3CK8 A;  2BKG A;  3FTV A;  2E2E A;  3TWV A;  5G05 J;  5KJN A;  2WXH A;  4H7X A;  3ULE G;  2XGM A;  4CEM A;  1TJF A;  3L13 A;  5EX0 A;  4F1P A;  4CT4 A;  3SD5 A;  3ZHE A;  3MA5 A;  2VTB A;  4F1S A;  3KSQ A;  4J0U A;  4FJZ A;  3LY9 A;  5JJ6 A;  5BW8 C;  4GZ5 A;  5CEA A;  5CCL A;  3SF4 A;  1H6O A;  4KVO A;  1AWC B;  3B7R L;  4J8Y A;  1O5M A;  3EUV A;  2QZA A;  3PE3 A;  3L54 A;  4W9R A;  2GGF A;  4I1M A;  1WDY A;  3K9I A;  4ANW A;  2XRZ A;  2P9K G;  4HLL A;  5T3R A;  3QB2 A;  3NQP A;  2FO1 E;  3UIN C;  3DEP A;  3ZPJ A;  2AVP A;  1N95 A;  1N54 A;  3AJI A;  4UI9 C;  3AAA C;  5FIO A;  3PUJ A;  1QNF A;  4B8C B;  1AP7 A;  2OOE A;  4UWK A;  3PNT B;  1O1R A;  4UQZ A;  3EHN A;  2XZD G;  1ELR A;  3L17 A;  4Y6W A;  2WXR A;  5EDS A;  4GZC A;  2C0L A;  3FH8 A;  4YND A;  1E8Z A;  1KPS B;  3FTW A;  5AQ7 A;  3X2Q E;  2OND A;  2FUL A;  2V8S E;  3QWP A;  1MQS A;  2OV8 A;  3G2U A;  4GTO A;  4CRW A;  4E6H A;  3DSW A;  3APF A;  3DSX A;  5ENR D;  1QQE A;  4C0M A;  4HOS A;  4Q96 A;  4GMJ A;  1EDU A;  3ASN E;  4O60 A;  1UN9 A;  4FHK A;  4HOT A;  4TXR A;  3D9P A;  1S64 A;  4LNB A;  3PH0 C;  3UT8 A;  2X6F A;  3MZL B;  3QAR A;  1UW4 B;  3L22 A;  1BLX B;  1HU3 A;  3EHR A;  1Z6T A;  2WXP A;  4LSZ E;  3W9F A;  4JXT A;  4MKT A;  5G04 J; 
#chains in the Genus database with same CATH homology
 1KT1 A;  2C0M A;  2X6K A;  5LP0 A;  2ION A;  4FUL A;  3CVY A;  2IOS A;  2XCB A;  5CMY A;  2I6H A;  1H19 A;  5AJL A;  5BV1 A;  2V4L A;  3UMV A;  1IQR A;  3SBT B;  2BUG A;  2WXI A;  3O48 A;  4I6E A;  3WXX A;  2C2L A;  4AVX A;  5A23 A;  5CCM A;  4I1A A;  4YVO A;  3KAE A;  2LAI A;  3CLJ A;  3QWV A;  3CHO A;  4KVM A;  4CGV A;  4IYP A;  1U3D A;  4CDM A;  3FH5 A;  3R9A B;  4GA1 A;  4ILH B;  3JCK C;  2HM8 A;  3TG4 A;  2FEZ A;  2J07 A;  2RD0 A;  4HOR A;  4UQX A;  2WXQ A;  1E8Y A;  5T8I A;  4L1B A;  5E75 A;  1WY6 A;  3SFZ A;  2OVF A;  4APF A;  4BY6 A;  4H7Y A;  5LCW J;  2QFC A;  4FLB A;  3FUH A;  1HX8 A;  4MS6 A;  2VGX A;  2DIW A;  4GA0 A;  3RU0 A;  2VTB B;  2X38 A;  2AXV A;  3P1U A;  1PY1 A;  2IF4 A;  3ZW3 A;  4F7A A;  4AOF A;  4OYS A;  4I2Z A;  5FZR A;  3QNK A;  4LEU A;  2YNQ A;  4JEU A;  5DBK A;  3ONK A;  4XE0 A;  5E76 A;  3D9J A;  4I6J A;  2I2O A;  4AM9 A;  2Y4U A;  1H2V C;  5D0Q D;  4EPZ A;  4J8F A;  3RIB A;  2XPI A;  2J4D A;  3ZN3 A;  4GCO A;  3PVL A;  4FLH A;  5CHE E;  4B0Z A;  4GYO A;  3CR3 A;  3RJV A;  4BX9 A;  4GYY A;  1UG3 A;  3FTY A;  1N52 A;  3QKY A;  5J90 A;  4EEC A;  4ACL A;  3AS4 A;  2QY7 A;  3GZ1 A;  5FT9 A;  3PE4 A;  3LXU X;  3SBS A;  4A3T A;  2YIN A;  4KBQ A;  4XKB A;  2AWI A;  3CK7 A;  1ELW A;  4U04 A;  3CEQ A;  4C0E A;  1W3B A;  3FY4 A;  1X5B A;  3MV2 B;  1OWL A;  3OXF A;  3AS5 A;  4AEZ C;  3ASH A;  4JPS A;  2PQR A;  2VQ2 A;  1NP7 A;  4A3V A;  3EIQ C;  4F3V A;  5BPP A;  1JWG A;  5KCM A;  4DPR A;  1HFA A;  4KT6 B;  2CFZ A;  1HS6 A;  3HVE B;  4Q69 A;  3SZ7 A;  4HLE A;  2R17 C;  4MLP A;  4UWH A;  3FDH A;  3RKV A;  5ANL A;  1EPU A;  2UWJ G;  3LDZ A;  2CHW A;  4I9E A;  2JLB A;  2PM6 A;  3RRM B;  2MOW A;  1NZN A;  2XPY A;  3G2T A;  4L23 A;  3KD7 A;  4BTB A;  5FZS A;  3Q5M A;  2XRY A;  1EF1 C;  3HDX A;  5G2N A;  2X6I A;  3MKQ B;  4ILI A;  4E85 A;  4AXH A;  1H2T C;  1SZ9 A;  2FF4 A;  3AS8 A;  4AP2 A;  4EBA G;  5BUZ A;  3S2A A;  4BSX A;  4BTA A;  3ENE A;  3QJZ A;  2KC7 A;  4ILG A;  4AY5 A;  3CVV A;  3CV0 A;  4I43 A;  1L5J A;  1JPL A;  4GML A;  4J6I A;  2WQH A;  5ARG A;  4U63 A;  4JC8 A;  2KM4 A;  2MHK A;  2DCP A;  4XZ4 A;  3FFL A;  4G2V A;  3FTS A;  3D9N A;  1HZ4 A;  1PC2 A;  4ATG A;  2I1K A;  4KZ0 A;  5A6C A;  3APD A;  3B13 A;  5JHB A;  2WM9 A;  3OXG A;  4GB9 A;  4EZL A;  3TJP A;  3Q47 B;  2VGY A;  3PNL B;  4GZ3 A;  3I3N A;  5FZQ A;  3MCX A;  2NC9 A;  4PUC A;  3TXN A;  3TGO A;  3S7B A;  2LO6 A;  2NSZ A;  1WAO 1;  3I5P A;  5C1D A;  4JVS A;  2NXP A;  4XKC A;  2XPZ A;  3P2B A;  4LER A;  1TEZ A;  1HG5 A;  1LF8 A;  2WXN A;  4ME2 A;  2GRL A;  3AU4 A;  2VSO E;  1Y8M A;  3LKU A;  1IYG A;  4J8S A;  3OXL A;  4PS8 A;  2X3M A;  4G26 A;  3IHV A;  3N71 A;  3RRU A;  3B7U X;  5BT1 A;  5KJL A;  4GCN A;  2FI7 A;  3BG0 B;  5ANR A;  2VSY A;  5AYW D;  3L16 A;  3IKO B;  5FQ6 A;  4BX8 A;  4DI4 A;  1FCH A;  4ANU A;  2XQ0 A;  3TXM A;  4OVV A;  4TRQ A;  4G11 A;  2XEV A;  3RRN B;  2J9Q A;  4NRH B;  3VTY A;  3ZIM A;  4G23 A;  1XGW A;  2XGO A;  4N3B A;  4RVB A;  4UI9 K;  4FA6 A;  3SNX A;  4K03 A;  3U3W A;  2UY1 A;  4WWP A;  1E7V A;  3D9M A;  3FUD A;  3FTZ A;  4GAA A;  4WNE A;  3CKB A;  3Q4A B;  3O4Z A;  1P5Q A;  3ASG A;  1EYH A;  2A5U A;  4C9B B;  4OVU A;  5JHA A;  4HOU A;  4EQF A;  4YVQ C;  1IQU A;  1SZA A;  3UT7 A;  2V0P A;  5DIZ A;  2IOL A;  4L7T A;  2L6J A;  4KZC A;  5A7D B;  1SQM A;  5FJY A;  3EIJ A;  3VLE A;  3ONL A;  5M72 A;  3HYM B;  5JJT A;  3CHS A;  4N3A A;  1TJC A;  2VJ8 A;  2XHE A;  4FC8 A;  3CGH A;  3Q49 B;  4V3I A;  1OWM A;  3L08 A;  2J49 A;  4EZK A;  3APC A;  1HO8 A;  2AXU A;  1B89 A;  1IHG A;  1XNF A;  2XCC A;  5CMW A;  3MV3 B;  3KEZ A;  1KLX A;  3CVN A;  4B8A A;  3TL5 A;  1MHQ A;  3LCA A;  3MX3 A;  5JJ7 A;  3ZFW A;  4MRU A;  4LUN U;  1OUV A;  4I2W A;  4P29 A;  2LAH A;  4U8H A;  4U0Z A;  4A55 A;  4FP7 A;  3FEY A;  3LPZ A;  2Y3A A;  3ZYK A;  2E0I A;  3D3M A;  4GA2 A;  3PDN A;  2RG8 A;  2VSN A;  4J8D A;  4J8E A;  3ML8 A;  4QFV A;  3Q15 A;  5LFA A;  3ZGQ A;  3FEX A;  3QK0 A;  2PM7 A;  3GZS A;  5AEN A;  1E7U A;  3S7J A;  3HHM A;  4WND A;  4UQY A;  5G55 A;  3LY8 A;  2X6H A;  3C98 A;  5AJD A;  3FUI A;  5BV0 A;  1HE8 A;  1YA0 A;  2WMO A;  3EDT B;  5BNW A;  3U66 A;  5EKQ D;  4RG9 A;  3CVU A;  2WQ7 A;  5C2Y A;  4N2Q A;  2HYZ A;  2KCK A;  4HFG A;  3ZHE B;  3U4T A;  3ZYL A;  4B89 A;  3EJN A;  4PS3 A;  3VLF A;  1S0P A;  2IFU A;  4BT9 A;  4UWG A;  4HVB A;  4EBA A;  3PEV B;  4WWO A;  3T8M A;  3ULQ A;  3VTX A;  4AJW A;  2FO7 A;  3URZ A;  4RG6 A;  2AW6 A;  4URK A;  3ASF A;  1QZ2 A;  4CDN A;  4TV3 A;  3FUN A;  4KMO A;  2HO1 A;  4WAF A;  4N2S A;  4DI3 A;  2GRM A;  2HR2 A;  3FUM A;  4UI9 J;  3L6A A;  5KJK A;  2VGX B;  2KCV A;  3T5X A;  4I6G A;  3R7Q A;  1NA3 A;  1ZU2 A;  1H6K A;  3ZVV A;  2MRI A;  4FJY A;  4JZY A;  3MYV A;  3FU0 A;  4UWF A;  4EZJ A;  4KXK B;  4L2L A;  3FUL A;  4AY6 A;  3QWW A;  5D0O D;  4GPK A;  1E8W A;  3SGH A;  3D9I A;  2BF0 X;  3E4B A;  3LEW A;  4BT8 A;  4XI9 A;  3U9W A;  4CDR A;  3ESK A;  1UJJ A;  4N5C A;  4IUL A;  4HS2 A;  1KT0 A;  3I4R B;  4F53 A;  4RSY A;  3QOU A;  3ZYQ A;  3UX4 A;  1ZBP A;  1E96 B;  4I17 A;  4PDX A;  3AU5 A;  1VDY A;  3CKC A;  3CQC B;  2BTD A;  3G2S A;  4WUY A;  3HIZ A;  5LX8 A;  3OAW A;  1NA0 A;  4CGW A;  2A4Z A;  4JW1 A;  4U07 A;  3PRZ A;  4NUR A;  2YQ8 A;  3PEU B;  2I9C A;  3ZEF A;  5LCW C;  2WXJ A;  4PH4 B;  2YHC A;  5FQ4 A;  4FAD A;  2IU1 A;  3LY7 A;  1GW6 A;  3JQ1 A;  5J08 A;  1ELK A;  1H0A A;  3FHE A;  3FH7 A;  2XGS A;  3MKR A;  3S7F A;  4G1T A;  4FHJ A;  3FUK A;  3FUF A;  2CFU A;  2PZI A;  3GYZ A;  2FBN A;  2X6J A;  4B94 A;  3FU5 A;  4LCT A;  3CST A;  1HH8 A;  2ZU6 B;  3EHM A;  3FWV A;  4GU5 A;  4A1S A;  4N3C A;  2WXG A;  4A1G A;  3T5V A;  3IEG A;  2LSU A;  3HVE A;  3UT4 A;  2WB2 A;  2L9B A;  1WM5 A;  3VLD A;  3UQ3 A;  3ZRH A;  2WPV A;  3RK6 A;  2L0I A;  4TUU A;  5KJM A;  3B7S A;  4HXI A;  4CCA A;  3ESL A;  3FP3 A;  3LVR E;  4GYW A;  3MGB A;  2J09 A;  3CK8 A;  3FTU A;  2Y4T A;  3FTV A;  4BWR A;  2E2E A;  3DBS A;  3PUK A;  5G05 J;  2GW1 A;  3R7R A;  5KJN A;  2WXH A;  4H7X A;  5FTP A;  1INZ A;  2IJG X;  2XGM A;  4FU3 A;  4M3O A;  4NQ0 A;  3S7D A;  4CEM A;  1TJF A;  3L13 A;  2CHX A;  5EX0 A;  3D9O A;  4CT4 A;  2WQ6 A;  3LVQ E;  4DK5 A;  1UN8 A;  4GZD A;  3SD5 A;  3ZHE A;  2M63 A;  3JQ0 A;  3MA5 A;  2L0T B;  3RO2 A;  3CQG B;  2VTB A;  3CHM A;  4F1S A;  3NF1 A;  4LRZ A;  4GZ6 A;  4XIF A;  2WMN A;  3MEK A;  3SI5 A;  3UPV A;  4J0U A;  4FJZ A;  4D10 C;  3LY9 A;  3ML9 A;  5JJ6 A;  1DNP A;  3CHR A;  5BW8 C;  4XI0 A;  5LOZ A;  3CK9 A;  3B7T A;  4GZ5 A;  5CCL A;  3SF4 A;  3IBE A;  4ACK A;  1OWP A;  4WWN A;  3PZD A;  3QDN A;  4JHK A;  4KVO A;  5ENN A;  5T4Y A;  3B7R L;  4Y6C A;  1Z3Y A;  2YHE A;  3ASD A;  2Q7F A;  2WXM A;  2PL2 A;  3MKQ A;  1PAQ A;  3PE3 A;  4ANV A;  2CG3 A;  4APO A;  3BEE A;  3L54 A;  4L2Y A;  4UWL A;  4G24 A;  4KYO B;  4W9R A;  2CHZ A;  1DVP A;  2WXF A;  3FUJ A;  2GGF A;  3LJ3 A;  4I1M A;  3G2V A;  4IN3 B;  2WXL A;  3TG5 A;  2EQX A;  1FVH A;  3K9I A;  5EX3 A;  4ANW A;  3CVQ A;  2XRZ A;  3CHP A;  3I4G A;  3JYS A;  4XX5 A;  4DLO A;  5T3R A;  3QB2 A;  3NQP A;  3CVW A;  2KZT B;  4PS7 A;  5FWQ A;  3FUE A;  3ZPJ A;  2AVP A;  1FVF A;  4DLQ A;  2OVB A;  2UY1 B;  1HF8 A;  3CVL A;  1N54 A;  2KAT A;  3FU6 A;  1E90 A;  3CIA A;  2DBA A;  4UI9 C;  4JA9 A;  3PUJ A;  1QNF A;  4B8C B;  3CVX A;  3LS8 A;  3BG1 B;  2OOE A;  1OWN A;  3OTN A;  4R7L A;  4UWK A;  3SHF A;  3D9K A;  1H2U A;  2ILR A;  4WNF A;  3G2W A;  4WNG A;  3PNT B;  1Z3X A;  4IRU A;  4JHR A;  3EHN A;  4UQZ A;  1ELR A;  1JWF A;  5HI7 A;  3L17 A;  4G25 A;  4Y6W A;  5HQ8 A;  2WXR A;  5EDS A;  1Y6I A;  3PS6 A;  4GZC A;  2C0L A;  3FH8 A;  4YND A;  3GW4 A;  1E8Z A;  2J08 A;  2VYI A;  2J4B A;  5ARF A;  3FTW A;  3U64 A;  3ZYM A;  2WVI A;  3ZXS A;  4N39 A;  2OND A;  3PRE A;  2FUL A;  2IQC A;  1E8X A;  2LSV A;  2V8S E;  3QWP A;  3TAX A;  4ABN A;  5AIJ A;  1OWO A;  2KZT A;  1MQS A;  2WXO A;  2OV8 A;  4JL0 A;  3G2U A;  4CRW A;  2R5S A;  2AXZ A;  3D9L A;  4E6H A;  1BPO A;  2VSX E;  4BFR A;  2KCL A;  4NAC A;  4JHJ A;  4CT0 A;  3APF A;  4I9C A;  4DJA A;  1QQE A;  4C0M A;  3NZU A;  4Q96 A;  4HOS A;  4GMJ A;  4AV7 A;  2R59 A;  1EDU A;  1A17 A;  3CHQ A;  4Q94 A;  1UJK A;  3GZ2 A;  3LYA A;  4O6F A;  4U0S A;  2LNI A;  3FTX A;  1UN9 A;  4FHK A;  4HOT A;  1HG2 A;  5G04 C;  3IHY A;  4K0R A;  5G05 C;  4HOQ A;  1JUQ A;  3MJW A;  3D9P A;  2PQN A;  3CSF A;  2JEK A;  3IV0 A;  3NZS A;  3PH0 C;  3UT8 A;  3QC1 A;  1U3C A;  2X6F A;  3JUI A;  2I1J A;  3CVP A;  3MZL B;  3DPD A;  3QAR A;  2V5F A;  3QAQ A;  1UW4 B;  2CG2 A;  1HXI A;  3L22 A;  5FQ7 A;  1HU3 A;  3FU3 A;  1Z6T A;  2WXK A;  4U0U A;  4AIF A;  4JEH A;  3KS2 A;  2WXP A;  5FQ8 A;  4JA7 A;  3RO3 A;  3UUX A;  4ANX A;  2P58 C;  4JXT A;  4I1O B;  4MKT A;  5G04 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...