5LP0A

Crystal structure of the zebra fish enth domain from epsin1 in 1.41 angstrom resolution
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
140
structure length
140
Chain Sequence
GAMGSSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMVWKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVAQQCRENIYAVQTLKDFQYIDRDGKDQGVNVREKAKQLVTLLKDEERLREERIHALKTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Epsin 1
publication title A bacterial genetic selection system for ubiquitylation cascade discovery.
pubmed doi rcsb
source organism Danio rerio
total genus 59
structure length 140
sequence length 140
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-08-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 5lp0A00
3ZYQA 5CMYA 5LP0A 1INZA 1MHQA 1JWGA 1XGWA 3D9KA 3D9OA 4GZDA 3RRUA 3G2VA 4Q94A 3ZYKA 3D9LA 2BF0X 2L0TB 1ELKA 5LOZA 2KM4A 3ZYLA 1HFAA 3ONLA 2DIWA 2LO6A 3G2SA 1DVPA 4JXTA 1JPLA 3D9MA 4FLBA 1JUQA 2L0IA 1HF8A 1PY1A 1UJJA 3ZYMA 1VDYA 3D9PA 5CMWA 1HG5A 1EYHA 4NACA 1X5BA 4FU3A 1LF8A 1SZAA 4Q96A 4GZCA 3D9JA 5J08A 1SZ9A 3CLJA 4AVXA 1UJKA 4HFGA 2V8SE 3G2UA 3G2WA 3LDZA 3D9NA 1HX8A 1HG2A 2QY7A 2MOWA 3ONKA 1EDUA 1JWFA 3G2TA 3D9IA 1H0AA 2DCPA
chains in the Genus database with same CATH superfamily
2J4BA 3V31A 3SD5A 4IULA 1AP7A 2HYZA 4TXRA 1IYGA 1B89A 2GW1A 3ASDA 1SA5A 2QYUA 3HXBA 3L08A 3Q79A 4U0ZA 4FJZA 5BT1A 3CQCB 3HXCA 3ISMC 3LPZA 3PNTB 4UI9C 3FTWA 4W9RA 2XCCA 2V4HC 4G25A 3Q7AA 4YDWA 4WWPA 4U8VD 3AG3E 3CVNA 4LEUA 2VJ8A 2IOSA 3TJPA 4WNGA 5LP0A 4JA7A 4P29A 2XS1A 4HLEA 4CYMD 3CVVA 4G26A 3PDNA 3FTZA 5A7DB 1S63A 1XNFA 1YA0A 4XZ4A 3UKUG 1YYHA 4BT9A 3DSVA 2QY7A 4GMJA 3DSSA 3EU5A 5CHEE 3CK9A 5KJLA 4G8KA 1GW6A 4AY5A 1OCCE 3APFA 3SGHA 5G04C 2GRNB 2WMNA 3PE3A 3LEWA 2AWIA 1D9SA 1E8ZA 3CV0A 4DX1A 1D8DA 2L6BA 2WQ7A 3ZEFA 2P2CP 3X2QE 3ASOE 5ARFA 4NURA 2DWZA 5B1BE 3ENEA 3DEOA 1OUVA 1E7UA 5LOZA 3HXFA 2XCBA 2Y1LE 4EHMA 5G05C 5JJ6A 3ZYMA 3ASHA 2IO3C 2AW6A 1N11A 4Q96A 2WXLA 4FHKA 3C72A 5KNGA 4QQIA 4YDEA 2GRQB 3E33A 3Q75A 3LJNA 4GTPA 3TWTA 1YMPA 1Z6TA 3G2VA 4DPRA 3DXMG 4UI9J 2H6HA 3GZ1A 4YNDA 1K1AA 2XZTG 1TN8A 1H19A 3QK0A 5ARGA 5ENOD 1HE8A 2Y69E 4HRLA 1OWLA 3PZ4A 1NP7A 4J8EA 5KJMA 5EX0A 2KBXA 4BEPA 5AJDA 3PS6A 2PM6A 4JVSA 1ZU2A 3AG4E 3PZ3A 3CVYA 2P9NG 4PS3A 3BQOA 4WNFA 3ABLE 3TXNA 3L6AA 4OYSA 1Z3YA 3EDTB 4G2VA 3Q7FA 1MZCA 3RO2A 3ULYA 3DSXA 4LNBA 2BF0X 3S7FA 2A5UA 5AIJA 5G04J 3APDA 3PVLA 4LG6A 5EYPF 3JXIA 5HRYA 3FTXA 5AN8A 1HF8A 1EYHA 4E85A 2EQXA 5D2MC 3ABKE 4EPZA 2KXPC 3TGOA 4Z68A 3VLDA 3B13A 3ZRHA 3FP3A 2KATA 1E90A 4XEIG 3AG1E 4CT4A 4HRMB 5G05J 3NOGD 3UPVA 3O48A 1TNOA 3D9JA 3FH5A 1NA0A 4EECA 3DWLG 4HBDA 3G2WA 1INZA 2LNIA 4JA9A 4KT6B 3PNLB 1LTXA 1SA4A 4I1AA 4J8YA 1NL4A 5ENNA 2P58C 5BV0A 4U8HA 2RD0A 1X5BA 2L9BA 4GAAA 2ETCA 3NQPA 3FU3A 2WXHA 4HOTA 3FH8A 3ASFA 3JYSA 4ILGA 5ANLA 2XQ0A 2FF4A 4I1OB 4F7AA 4JC8A 3URZA 4J8FA 4HS2A 3W9FA 3MEKA 3E4BA 3U4TA 2YINA 4GMLA 4EBAA 1WAO1 4BTAA 3RAUA 1PAQA 3PEVB 4N3CA 3CR3A 1H6OA 1TJCA 1UW4B 3C3RA 2ETBA 3SO8A 4ANWA 2GRPB 3I5PA 4U04A 5EX3A 4N5CA 4A3TA 2WQ6A 4AXHA 5LX8A 1E96B 3PE4A 1DVPA 1S64A 2KCLA 4G8LA 5FTPA 1MX6A 2AXUA 3IBEA 3EUVA 2I9CA 2ONDA 1EPUA 4L9PA 2E2EA 1KPSB 5AQAA 4N39A 3RIBA 3TAXA 3T5XA 3R7RA 4U63A 4PS8A 4CEMA 4BSXA 4RLYA 3OXFA 1ELKA 3TWWA 3CHQA 1BD8A 1Z3XA 2OV8A 2YQ8A 3RK6A 3ULEG 3LY9A 4GTRA 1IXVA 2F37A 1OWNA 2ILRA 3L22A 3FTUA 2MHKA 5ANRA 4O1PA 3CVQA 4RG9A 1QBQA 2ETAA 3DPDA 5C1DA 3UTMA 2C0LA 2WXGA 4HQDA 4GPKA 5ITZF 1ZBPA 4O1OA 3EJNA 3Q15A 3SBTB 2XPZA 1XGWA 5J90A 3S7DA 4CT0A 2V5QC 4U0UA 1WY6A 3R7QA 2P9PG 2WB2A 5B3SE 3CSFA 4J8DA 4FHJA 2CFZA 3B7SA 5HQ8A 3EHQA 4APOA 1SQMA 2PZIA 2AVPA 2JEKA 1QQEA 3SZ7A 3ZGQA 3GZ2A 1TR4A 3ZYLA 2P9SG 4RQIA 3EHRA 1ELRA 2ZXWE 2NYJA 4GA0A 4U0SA 1O1RA 3ZYQA 1U3DA 3LXUX 1K1BA 1FCHA 4LUNU 1H2VC 1PC2A 4HI8A 5EYLA 3AAAC 3ZHEA 4ME2A 3UIOC 4GB9A 3GW4A 4DX2A 3FY4A 3AU5A 3QWWA 5CEAA 1JCSA 2X6HA 3ZUVB 1K8KG 4WWOA 3TWRA 3EIJA 4N2QA 3FTSA 1JUQA 5ENSD 3BG1B 2VGXA 1UJJA 5EIDA 5CECB 4HXIA 3TWSA 3CEQA 4LERA 2PQNA 2MYOA 4UWKA 3PRZA 4NACA 4NRHB 2FI7A 4YDOA 5AYWD 3Q78A 2VQ2A 2WXKA 2UWJG 2WPVA 2QC9A 3I4GA 4CCAA 4DLQA 4BESA 4PUCA 1N4QA 3D9IA 3UUXA 4IN3B 3JQ1A 4CDNA 3S2AA 4ACKA 4BWRA 3FUFA 4F53A 3NB2A 4L2LA 3EU9A 4GCOA 4H7XA 1AWCB 2OEVA 3U64A 5CEDB 3E30A 3DPYA 3NF1A 4XE0A 4A55A 5JJTA 2FO1E 2B6CA 2R17C 2R05A 4RSYA 2Y4UA 2C0MA 5T8IA 2L0IA 3ML9A 4K5AB 2CHXA 5BV1A 2XPYA 4JHRA 3ZN3A 4LRZA 4CGWA 1LD7A 4BY6A 4EZKA 2QZAA 4A3VA 1N4RA 4JHKA 3CVPA 3L13A 4NIKA 1TJFA 5CCLA 3CVXA 2XPIA 4GMRA 4X8QA 1MX4A 4FJYA 1BPOA 2BEDA 4DX7D 2EINE 1DC2A 3CGHA 3ZHEB 2E0IA 4Y6CA 4BSZB 5JHAA 3AU4A 1E8YA 4UQXA 1DCEA 4CDMA 5AAOA 1OWOA 2AXVA 4GTMA 1E8XA 2KZTA 3C5RA 4FU3A 2IOLA 3CK7A 3J5QB 1WDYA 4DI3A 1UOHA 5E75A 2X3MA 2VGXB 3VTYA 2RFAA 4YVOA 3PUKA 3NBNB 3ZYKA 1O5MA 3UIPC 4FLBA 4HOSA 4B94A 3T8KA 1V55E 3L82A 4UUCA 2J8SD 2JABA 3T9KA 4LNGA 3L16A 4XKBA 2C2LA 2NXPA 4JZYA 4MKTA 3FEYA 2VSYA 3HHMA 1S0PA 4KMOA 4A1SA 1KLXA 2WXQA 4C48B 3DBSA 4URKA 2R59A 4KXKB 4DX6D 3UM0A 4CRWA 3Q4AB 2XGSA 3E32A 3RRUA 4GTSA 2LXMA 5FT9A 2CG2A 2WXFA 3JUEA 3SFZA 3TG4A 1SZAA 2QYJA 3FUIA 3B95A 3ULQA 1N0QA 3OXGA 3BU8A 2VSOE 3NAWA 2I1JA 3IEGA 4QFVA 2CHWA 2L0TB 2XEEA 1HFAA 2IJGX 2LO6A 2DYRE 3MJWA 5AARA 3RRMB 1LF8A 2XS8A 4WWNA 4EZLA 3AS8A 3PUJA 3ZIMA 3UXGA 2J07A 3HDXA 3HIZA 5EN5D 1QNFA 5BUZA 5CBNA 1W3BA 2A4ZA 4XI9A 1KT0A 3OXLA 3DEPA 1TEZA 3EHMA 5G55A 4B8CB 3FUNA 3E37A 3RKVA 2KZTB 1OXJA 2J9QA 2I2OA 3JQ0A 3LVQE 3CKCA 4JEUA 1DNPA 4R7LA 4U7EB 1N9AA 2ZISA 1H6PA 4HLLA 3VLEA 5FZSA 4B93B 1O1SA 1RW2A 2YNQA 1A17A 2IU1A 3UQ3A 2BKKB 4I1MA 2F0YA 5T3RA 2NSZA 4GTQA 4JW1A 4OVVA 4I6EA 3RRNB 4LCTA 3FUHA 3MX3A 4DK5A 2OVBA 4AVXA 3D9NA 4TV3A 2CG3A 3TXMA 2YHCA 4KZCA 3C3OA 4K5BA 2VTBA 3J5PA 1TNBA 2OEWA 4O60A 5CERB 2XEVA 1N4PA 1FVHA 3SI5A 3B7UX 4TXPA 4F1PA 1EDUA 1JWFA 4C0MA 3OAWA 2F8YA 3EHNA 1H2TC 5KWDA 2KM4A 5EKQD 3E34A 2LXLA 1U3CA 4HRNA 3R9MA 5HI7A 2J09A 5FINA 5FWQA 1N94A 2DZOA 1N52A 2R03A 2P9LG 3G2TA 1TNYA 1P5QA 5CBOA 1UN9A 2Q7FA 2Y3AA 2WXPA 2AJAA 1IQUA 4FC8A 3MKQA 4OAUC 1WM5A 3LY8A 2IEJA 4U95D 3QC1A 2LAIA 3DSTA 3I3NA 4JL0A 2FEZA 3GYZA 2WXNA 5CMYA 4EZJA 4DI4A 1IHBA 3IXEA 4L7TA 3FUKA 5A23A 3ZNGA 5D0QD 3UI2A 4B8AA 5E76A 2DCPA 3FWVA 1MJ0A 1WG0A 2WXRA 3CK8A 2IO2C 4KZ0A 4GYYA 5EILA 2VSXE 1KZPA 4F3VA 2CFUA 3I4RB 4H7YA 4CZ2D 4I9CA 3ZXPA 3ESLA 4GTTA 4J7WA 4HOUA 3OTNA 4GZ5A 3DSWA 2DYSE 4UQYA 4FULA 3AG2E 2R5SA 5LCWC 1V54E 1EF1C 2H6IA 3CHMA 3Q9NC 5FQ4A 3U9WA 2PM7A 4I17A 3GZSA 2VTBB 4IYPA 4JB8P 4KBQA 3Q49B 4XKCA 4GTOA 3B7RL 2LUHA 2DBAA 2EIME 4O6FA 4HORA 5EIBE 1SZ9A 4GPMA 3W9GA 2IONA 2H6FA 3FULA 3D9HA 4JHJA 3D9KA 3PZDA 2IY0C 1U2VG 1JPLA 3FEXA 4BX9A 1HG5A 4HI9A 2BTDA 4I6GA 5ENTD 4AOFA 3UT7A 1FPPA 4YDYA 3F6QA 5BW8C 2P9IG 3ONKA 3MKQB 4ZHBA 2IQCA 3KAEA 1MHQA 3KSLA 4Q94A 1JCRA 1FT1A 3PZ2A 3DXKG 5AQ7A 3UM2A 5J08A 1MQSA 2A5EA 2GRMA 3S7BA 1N95A 4FA6A 1X81A 3R9AB 4K03A 4CGVA 5C2YA 5LCWJ 5FQ7A 4MS6A 5EDSA 2I1KA 3ASGA 4MBGA 3BUAA 2XHEA 3CHOA 2ZGGA 1O1TA 3MCXA 4GA2A 2JLBA 2J08A 4N2SA 2P9KG 5ENPD 4DJAA 3SFXA 3K9IA 1L5JA 1QYMA 4U96D 3PREA 3ONLA 4C9BB 3CKBA 1Z5SC 1LD8A 2KC7A 5BPPA 3U3WA 5CCMA 2XENA 3UKRG 3MV2B 2EIJE 3T8MA 5FZQA 2RG8A 4ANXA 2X6KA 3LDZA 2Y4TA 3D9OA 4AJWA 1UN8A 4OAVB 2WVIA 2P9UG 3DRAA 3HRAA 3C98A 4MLPA 4AIFA 3LYAA 3S7JA 5KBAA 3P2BA 3CLJA 3KD7A 4GZ3A 2VGEA 3QNKA 3FH7A 3JUIA 1HS6A 1Y6IA 3FFLA 1HZ4A 1TNUA 4V3IA 1HH8A 5H7PA 1VDYA 2HE0A 1MX2A 4BERA 4L1BA 4G23A 4C0EA 3QJZA 3SBSA 5BXUA 5JHBA 2GROB 2FULA 3Q9UC 5FZRA 1HX8A 4DLOA 2GGFA 2V5FA 3HYMB 3FU0A 3D9LA 3FUEA 4N3AA 4ANUA 3ZXSA 4JXTA 1N0RA 1FT2A 1H2UA 2WM9A 3V30A 1DCQA 2ZGDA 4GTVA 1SW6A 2V4LA 4J8SA 2LAHA 3IHVA 4PDXA 4DUIA 1HU3A 1HXIA 3U66A 3IKOB 4HNAD 1ELWA 1JWGA 3ZPJA 3QKYA 2EILE 2XGMA 1N54A 4G1TA 3D9PA 3P1UA 5ENRD 4AY6A 2VGYA 1FVFA 3V79K 3ZFWA 1HG2A 3T5VA 3APCA 2FO7A 3JCKC 3WG7E 3NOCD 5KNHD 3TG5A 1MYOA 3ASNE 4E6HA 4NQ0A 1Y8MA 3TWUA 2XGOA 4GZCA 5A6CA 2OCCE 4MRUA 2HR2A 1BLXB 3B7TA 4BFRA 2L6JA 3CHSA 2V0PA 2MRIA 4I2ZA 2VSNA 4BX8A 1RZ4A 3G2SA 3FTYA 3D9MA 5FQ8A 4GU5A 2LSUA 3KEZA 4GYWA 2V8SE 1TYQG 5G2NA 3MGBA 3CHPA 1H0AA 2WXJA 3B7BA 1ZB1A 4U8YD 4GA1A 3SHFA 2WXOA 3ML8A 2EIKE 2WXIA 3FUMA 3BG0B 4JD2G 1OY3D 4XI0A 3C3QA 5FJYA 4M3OA 1UJKA 4AM9A 2MOWA 1NZNA 3AJIA 3CIAA 4G24A 3ESKA 5KJNA 5CMWA 5D66A 4EQFA 2X6JA 4RVBA 3SY2A 3MYVA 3MA5A 2UY1A 1OWMA 2DIWA 4FLHA 3RO3A 3Q73A 1N4SA 3FDHA 2QFCA 2CHZA 5D0OD 3UX4A 2I6HA 3V2XA 4I43A 4I9EA 3LVRE 3SFYA 3CQGB 2WXMA 4UWGA 4Q69A 1IQRA 3ZKJA 5ENQD 4BT8A 1E7VA 3L17A 3FTVA 1H6KA 2WQHA 5JA4D 1D8EA 4YVQC 1TN6A 2F8XK 4ATZD 1SVXA 4LSZE 3UINC 2VYIA 3D3MA 4AEZC 2IFUA 1NI1A 3HG0D 3LJ3A 3TWVA 4OVUA 4TUUA 2AXZA 3PH0C 4N3BA 3LY7A 3LCAA 5CRUA 4EBAG 3KS2A 4GZDA 5DBKA 5LFAA 4PS7A 2B0OE 3AS5A 2PNNA 4BTBA 3Q5MA 2PL2A 5KCMA 3QDNA 4G11A 5FQ6A 3AS4A 3QWPA 3SF4A 1A5EA 4AP2A 4WAFA 3ZU7B 4J0UA 4APFA 3ZVVA 4IRUA 3TL5A 1UG3A 3MZLB 3L9TA 2WMOA 4TXQA 5KJKA 3MV3B 3V2OA 3HXDA 4A63B 4WNEA 3IV0A 4WNDA 5BXOA 3UT8A 1OWPA 3G2UA 4HVBA 4UI9K 3QWVA 4ANVA 1BI7B 2R2LA 2PQRA 3FUJA 4ACLA 1OCZE 1HO8A 1OT8A 3QARA 3PZ1A 2XEHA 3SQVA 4L23A 2HM8A 2DZNA 5FIOA 4HB5A 2UY1B 2RFMA 4HOQA 2GRRB 1OCOE 3RU0A 4XX5A 2X6IA 3CHRA 1S70B 4B89A 3UM3A 3O4ZA 2Y0BG 3PEUB 3LKUA 3ABME 1KZOA 3VTXA 2XRYA 4K0RA 3FHEA 4DX5D 4XIFA 1Q2ZA 4UWLA 5AQ9A 2XRZA 4BETA 4M7CA 2RKKA 3Q47B 4I6JA 2FBNA 2X6FA 5CRVA 3UMVA 3FU6A 3CVWA 3QAQA 2J4DA 4ILIA 1E8WA 5AJLA 3HVEA 1K3ZD 1NA3A 4LNUD 4F1SA 2XZDG 2BUGA 3RSEG 4KVMA 3BEEA 3FU5A 4JEHA 1BI8B 2YHEA 4ATGA 4PH4B 5AENA 3WXXA 1KT1A 2HO1A 3VLFA 2BKGA 5BNWA 2NC9A 2J49A 3FUDA 3QOUA 3NZUA 1BU9A 3N71A 5IY5E 1IKND 1NFIE 2ZIRA 4F6RD 2IF4A 5B1AE 4UQZA 4RG6A 4UWHA 3ZW3A 2KCKA 5JJ7A 3KSQA 3CVUA 4JPSA 1QZ2A 4KVOA 4KYOB 2LSVA 4FADA 4B0ZA 4A1GA 5DIZA 2H6GA 4ZFHA 3RJVA 4Y6WA 5AQBA 4L2YA 4FP7A 1TN7A 2R02A 3UT4A 4GCNA 1YCSB 2DVWA 3EIQC 3HXEA 3LS8A 2OVFA 3L54A 3DSUA 4HFGA 5T4YA 4DRXE 4U07A 4TUMA 2OOEA 5M72A 2KCVA 4N5QA 3TWXA 4K5CA 3NZSA 5JMND 3TWQA 4WUYA 4J6IA 5HS0A 4AV7A 4UWFA 1JCQA 3KEAA 2ZU6B 4GZ6A 1OCRE 3CVLA 1IHGA 3QB2A 3HVEB 3CSTA 4I2WA 4ABNA 1PY1A 2M63A 1TNZA 4TRQA 3SNXA 4CDRA 4D10C 4ILHB 2X38A 2GRLA 3UM1A 5HKPA 3IHYA 3MKRA 3JXJA 1G3NB 4GYOA
chains in the Genus database with same CATH topology
2WXJA 2J4BA 2PZIA 3OAWA 2AVPA 2JEKA 1QQEA 3EHNA 3SD5A 4GA1A 3SZ7A 3ZGQA 1H2TC 4IULA 3SHFA 3GZ2A 2WXOA 3ML8A 3ZYLA 2KM4A 2HYZA 1IYGA 2WXIA 3FUMA 5EKQD 3BG0B 1B89A 2GW1A 3ASDA 1U3CA 4XI0A 1ELRA 5HI7A 5FJYA 4M3OA 2J09A 3L08A 1UJKA 4GA0A 4AM9A 5FWQA 4U0ZA 4FJZA 1N52A 4U0SA 5BT1A 2MOWA 1NZNA 3G2TA 3CQCB 1P5QA 3ZYQA 1U3DA 1UN9A 3LXUX 2Q7FA 2Y3AA 3LPZA 3PNTB 4UI9C 2WXPA 1FCHA 3FTWA 4LUNU 4W9RA 2XCCA 1H2VC 4G25A 4FC8A 1IQUA 1PC2A 3CIAA 4G24A 3MKQA 3ZHEA 3ESKA 4ME2A 5KJNA 5CMWA 4WWPA 1WM5A 3LY8A 4EQFA 2X6JA 4GB9A 3CVNA 4RVBA 3QC1A 3GW4A 4LEUA 3FY4A 3AU5A 3QWWA 2LAIA 3MYVA 2VJ8A 2IOSA 3I3NA 3MA5A 4JL0A 3TJPA 2X6HA 2FEZA 4WNGA 3GYZA 4WWOA 2WXNA 5CMYA 4JA7A 4EZJA 4P29A 5LP0A 4HLEA 3EIJA 2UY1A 4DI4A 1OWMA 3CVVA 2DIWA 4G26A 4N2QA 3FTSA 1JUQA 3PDNA 4FLHA 3RO3A 3BG1B 2VGXA 3FTZA 1UJJA 5A7DB 1XNFA 3FDHA 1YA0A 2QFCA 4XZ4A 2CHZA 4HXIA 3CEQA 4L7TA 5D0OD 3FUKA 4LERA 3UX4A 2I6HA 5A23A 4BT9A 4I43A 2PQNA 4I9EA 2QY7A 4GMJA 4UWKA 5CHEE 3PRZA 5D0QD 3CK9A 5KJLA 4B8AA 3LVRE 5E76A 1GW6A 2DCPA 3CQGB 3FWVA 4NACA 4NRHB 2WXMA 4AY5A 2FI7A 3APFA 4UWGA 2WXRA 3SGHA 5G04C 1IQRA 5AYWD 3CK8A 4KZ0A 4Q69A 4GYYA 2WMNA 2VQ2A 2VSXE 2WXKA 3PE3A 3LEWA 4F3VA 2CFUA 2UWJG 2WPVA 4BT8A 3I4RB 4H7YA 2AWIA 1E7VA 1E8ZA 4I9CA 3I4GA 4CCAA 3CV0A 4DLQA 3ESLA 3L17A 3FTVA 4PUCA 2WQ7A 4HOUA 3OTNA 1H6KA 3ZEFA 4GZ5A 3D9IA 3UUXA 4IN3B 5ARFA 2WQHA 4NURA 4YVQC 3JQ1A 3ENEA 4CDNA 4UQYA 4FULA 3S2AA 4ACKA 4BWRA 3FUFA 4F53A 1OUVA 1E7UA 2VYIA 4L2LA 3D3MA 5LOZA 2R5SA 2XCBA 4GCOA 4AEZC 5LCWC 1EF1C 2IFUA 3CHMA 5G05C 5JJ6A 3ZYMA 3ASHA 2AW6A 4Q96A 4H7XA 2WXLA 3LJ3A 4FHKA 3U64A 4OVUA 5FQ4A 3U9WA 4TUUA 2AXZA 3NF1A 3PH0C 4N3BA 2PM7A 4I17A 3GZSA 4XE0A 2VTBB 3LY7A 3LCAA 4A55A 5JJTA 1Z6TA 4EBAG 3KS2A 4GZDA 3G2VA 4IYPA 4DPRA 4UI9J 5DBKA 4KBQA 2R17C 3Q49B 4XKCA 5LFAA 4PS7A 4RSYA 2Y4UA 3GZ1A 2C0MA 5T8IA 3B7RL 2L0IA 4YNDA 3ML9A 3AS5A 2DBAA 2CHXA 1H19A 4O6FA 4BTBA 3QK0A 2XPYA 5BV1A 4JHRA 4HORA 3ZN3A 3Q5MA 4LRZA 5ARGA 4CGWA 1SZ9A 2PL2A 1HE8A 5KCMA 2IONA 3QDNA 1OWLA 4G11A 5FQ6A 4BY6A 4EZKA 1NP7A 3AS4A 3QWPA 3SF4A 4J8EA 5KJMA 4AP2A 4WAFA 5EX0A 4A3VA 4J0UA 4JHKA 3FULA 4APFA 3ZVVA 4IRUA 4JHJA 5AJDA 3D9KA 3PS6A 2PM6A 3CVPA 3L13A 3PZDA 3TL5A 4JVSA 1UG3A 1ZU2A 3MZLB 1TJFA 5CCLA 3CVXA 3CVYA 1JPLA 2WMOA 4PS3A 3FEXA 4WNFA 2XPIA 4BX9A 5KJKA 3MV3B 1HG5A 2BTDA 4I6GA 4WNEA 3L6AA 3TXNA 3IV0A 4OYSA 4AOFA 4WNDA 1Z3YA 4FJYA 3UT8A 1BPOA 1OWPA 3EDTB 3UT7A 3G2UA 4HVBA 4UI9K 5BW8C 3ONKA 3CGHA 4G2VA 3MKQB 3ZHEB 2E0IA 3QWVA 2IQCA 3KAEA 4Y6CA 3RO2A 1MHQA 5JHAA 4ANVA 3AU4A 4Q94A 1E8YA 4UQXA 2BF0X 3S7FA 2A5UA 5AIJA 5G04J 4CDMA 3APDA 3PVLA 1OWOA 2PQRA 2AXVA 3FUJA 1E8XA 4ACLA 2KZTA 3FTXA 1HO8A 1HF8A 3QARA 1EYHA 4E85A 2EQXA 4FU3A 2IOLA 3CK7A 2HM8A 4L23A 5J08A 4DI3A 2UY1B 4EPZA 1MQSA 2GRMA 3S7BA 5E75A 2X3MA 2VGXB 4HOQA 3VTYA 3TGOA 4YVOA 4FA6A 3PUKA 3RU0A 4XX5A 3VLDA 3B13A 2X6IA 3ZYKA 3CHRA 4K03A 3R9AB 4B89A 4CGVA 4FLBA 3ZRHA 4B94A 4HOSA 3FP3A 2KATA 5C2YA 1E90A 5LCWJ 3O4ZA 4CT4A 5G05J 5FQ7A 3UPVA 3PEUB 4MS6A 3O48A 3LKUA 5EDSA 2I1KA 3D9JA 3ASGA 3FH5A 3VTXA 1NA0A 2XRYA 2XHEA 3CHOA 4EECA 4K0RA 3MCXA 3G2WA 4GA2A 2JLBA 2J08A 1INZA 3FHEA 4N2SA 3L16A 2LNIA 4XKBA 4DJAA 4XIFA 4JA9A 3K9IA 4KT6B 2C2LA 4UWLA 2NXPA 1L5JA 4JZYA 4MKTA 2XRZA 3FEYA 3PNLB 3PREA 3ONLA 4C9BB 4I1AA 3CKBA 5ENNA 5BV0A 2P58C 2VSYA 4U8HA 3Q47B 3HHMA 1S0PA 4KMOA 2KC7A 5BPPA 2RD0A 4I6JA 5CCMA 3U3WA 1X5BA 2FBNA 2X6FA 3MV2B 3UMVA 4A1SA 2L9BA 3FU6A 1KLXA 2WXQA 4GAAA 2RG8A 5FZQA 3DBSA 3QAQA 3T8MA 4ANXA 2J4DA 4URKA 3CVWA 4ILIA 1E8WA 2R59A 5AJLA 2X6KA 3HVEA 3LDZA 4KXKB 3NQPA 1NA3A 4CRWA 3Q4AB 2Y4TA 4F1SA 2XGSA 2BUGA 2WXHA 3FU3A 3D9OA 4HOTA 3RRUA 4AJWA 1UN8A 4KVMA 3BEEA 3FU5A 5FT9A 2WVIA 3FH8A 4JEHA 2CG2A 3C98A 4MLPA 3ASFA 2WXFA 3JYSA 4ILGA 3SFZA 3TG4A 5ANLA 2YHEA 4AIFA 4ATGA 2XQ0A 1SZAA 3FUIA 3LYAA 4PH4B 5AENA 3ULQA 3S7JA 2FF4A 3P2BA 4I1OB 3CLJA 3WXXA 1KT1A 4F7AA 3KD7A 2HO1A 3OXGA 4JC8A 3URZA 4GZ3A 4J8FA 3VLFA 5BNWA 2NC9A 4HS2A 3QNKA 2J49A 3FH7A 2VSOE 3FUDA 3QOUA 3JUIA 3MEKA 3E4BA 2I1JA 1HS6A 3IEGA 1Y6IA 3U4TA 4QFVA 3NZUA 2CHWA 2YINA 3N71A 3FFLA 2L0TB 1HZ4A 4V3IA 4GMLA 4EBAA 1HFAA 1WAO1 2IJGX 2LO6A 4BTAA 1HH8A 3MJWA 1PAQA 3PEVB 1VDYA 3RRMB 1LF8A 2IF4A 4N3CA 3CR3A 4WWNA 4C0EA 4L1BA 4G23A 4EZLA 3QJZA 3AS8A 3PUJA 3SBSA 3ZIMA 1TJCA 5JHBA 4UQZA 2FULA 1UW4B 5FZRA 4ANWA 1HX8A 4RG6A 2J07A 3HDXA 3HIZA 4UWHA 1QNFA 4DLOA 5BUZA 3I5PA 2GGFA 4U04A 3ZW3A 5EX3A 1W3BA 2A4ZA 2KCKA 4N5CA 2V5FA 4XI9A 1KT0A 3HYMB 4A3TA 5JJ7A 2WQ6A 3FU0A 3CVUA 4AXHA 3OXLA 3D9LA 4JPSA 3FUEA 4N3AA 5LX8A 1QZ2A 1E96B 4ANUA 3PE4A 4KVOA 4KYOB 4JXTA 3ZXSA 1DVPA 2LSVA 4FADA 2KCLA 5FTPA 1H2UA 2WM9A 1TEZA 2AXUA 3EHMA 4B0ZA 2V4LA 5G55A 4A1GA 4B8CB 5DIZA 3FUNA 2LAHA 3IBEA 4J8SA 2I9CA 2ONDA 3IHVA 4PDXA 1HU3A 1EPUA 3RKVA 2E2EA 1HXIA 2KZTB 4N39A 3RIBA 3RJVA 2J9QA 2I2OA 3JQ0A 3LVQE 3TAXA 3CKCA 3IKOB 3T5XA 3R7RA 3U66A 4U63A 4JEUA 1DNPA 4PS8A 1ELWA 1JWGA 4Y6WA 4BSXA 4R7LA 4CEMA 3OXFA 4L2YA 3ZPJA 1ELKA 3QKYA 4FP7A 3CHQA 2XGMA 3UT4A 1N54A 4G1TA 4GCNA 3EIQC 3D9PA 3LS8A 3P1UA 2OVFA 3L54A 1Z3XA 2OV8A 3VLEA 5FZSA 2YQ8A 4AY6A 2VGYA 2YNQA 4HFGA 3RK6A 5T4YA 1FVFA 4GYOA 3ZFWA 1A17A 1HG2A 4U07A 3LY9A 3T5VA 2IU1A 3APCA 3UQ3A 2FO7A 3JCKC 4I1MA 2OOEA 5T3RA 2NSZA 1OWNA 3TG5A 4APOA 2ILRA 5M72A 4JW1A 4OVVA 3L22A 3FTUA 4I6EA 2MHKA 2KCVA 3RRNB 4NQ0A 4E6HA 5ANRA 4LCTA 3FUHA 3CVQA 1Y8MA 4RG9A 2XGOA 3MX3A 4GZCA 5C1DA 3DPDA 4DK5A 2C0LA 2WXGA 5A6CA 4GPKA 2OVBA 4AVXA 3NZSA 1ZBPA 3D9NA 4MRUA 4WUYA 2HR2A 4J6IA 3EJNA 4AV7A 3Q15A 3B7TA 3SBTB 4BFRA 4TV3A 4UWFA 2L6JA 2XPZA 3CHSA 1XGWA 2V0PA 2MRIA 2CG3A 4I2ZA 2ZU6B 3S7DA 3TXMA 4CT0A 2YHCA 4GZ6A 5J90A 2VSNA 3CVLA 4KZCA 4U0UA 1IHGA 4BX8A 3QB2A 3G2SA 3FTYA 3D9MA 3HVEB 3CSTA 4I2WA 5FQ8A 4ABNA 1PY1A 2M63A 4TRQA 1WY6A 3R7QA 2VTBA 3SNXA 4GU5A 2WB2A 4CDRA 4D10C 3CSFA 4ILHB 4J8DA 2X38A 4FHJA 2CFZA 2LSUA 2XEVA 1FVHA 2GRLA 3KEZA 4GYWA 3SI5A 2V8SE 3B7UX 3B7SA 5HQ8A 5G2NA 3MGBA 3IHYA 3MKRA 1EDUA 1JWFA 1SQMA 3CHPA 1H0AA 4C0MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZYQ A;  5CMY A;  5LP0 A;  1INZ A;  1MHQ A;  1JWG A;  1XGW A;  3D9K A;  3D9O A;  4GZD A;  3RRU A;  3G2V A;  4Q94 A;  3ZYK A;  3D9L A;  2BF0 X;  2L0T B;  1ELK A;  5LOZ A;  2KM4 A;  3ZYL A;  1HFA A;  3ONL A;  2DIW A;  2LO6 A;  3G2S A;  1DVP A;  4JXT A;  1JPL A;  3D9M A;  4FLB A;  1JUQ A;  2L0I A;  1HF8 A;  1PY1 A;  1UJJ A;  3ZYM A;  1VDY A;  3D9P A;  5CMW A;  1HG5 A;  1EYH A;  4NAC A;  1X5B A;  4FU3 A;  1LF8 A;  1SZA A;  4Q96 A;  4GZC A;  3D9J A;  5J08 A;  1SZ9 A;  3CLJ A;  4AVX A;  1UJK A;  4HFG A;  2V8S E;  3G2U A;  3G2W A;  3LDZ A;  3D9N A;  1HX8 A;  1HG2 A;  2QY7 A;  2MOW A;  3ONK A;  1EDU A;  1JWF A;  3G2T A;  3D9I A;  1H0A A;  2DCP A; 
#chains in the Genus database with same CATH topology
 2J4B A;  3V31 A;  3SD5 A;  4IUL A;  1AP7 A;  2HYZ A;  4TXR A;  1IYG A;  1B89 A;  2GW1 A;  3ASD A;  1SA5 A;  2QYU A;  3HXB A;  3L08 A;  3Q79 A;  4U0Z A;  4FJZ A;  5BT1 A;  3CQC B;  3HXC A;  3ISM C;  3LPZ A;  3PNT B;  4UI9 C;  3FTW A;  4W9R A;  2XCC A;  2V4H C;  4G25 A;  3Q7A A;  4YDW A;  4WWP A;  4U8V D;  3AG3 E;  3CVN A;  4LEU A;  2VJ8 A;  2IOS A;  3TJP A;  4WNG A;  5LP0 A;  4JA7 A;  4P29 A;  2XS1 A;  4HLE A;  4CYM D;  3CVV A;  4G26 A;  3PDN A;  3FTZ A;  5A7D B;  1S63 A;  1XNF A;  1YA0 A;  4XZ4 A;  3UKU G;  1YYH A;  4BT9 A;  3DSV A;  2QY7 A;  4GMJ A;  3DSS A;  3EU5 A;  5CHE E;  3CK9 A;  5KJL A;  4G8K A;  1GW6 A;  4AY5 A;  1OCC E;  3APF A;  3SGH A;  5G04 C;  2GRN B;  2WMN A;  3PE3 A;  3LEW A;  2AWI A;  1D9S A;  1E8Z A;  3CV0 A;  4DX1 A;  1D8D A;  2L6B A;  2WQ7 A;  3ZEF A;  2P2C P;  3X2Q E;  3ASO E;  5ARF A;  4NUR A;  2DWZ A;  5B1B E;  3ENE A;  3DEO A;  1OUV A;  1E7U A;  5LOZ A;  3HXF A;  2XCB A;  2Y1L E;  4EHM A;  5G05 C;  5JJ6 A;  3ZYM A;  3ASH A;  2IO3 C;  2AW6 A;  1N11 A;  4Q96 A;  2WXL A;  4FHK A;  3C72 A;  5KNG A;  4QQI A;  4YDE A;  2GRQ B;  3E33 A;  3Q75 A;  3LJN A;  4GTP A;  3TWT A;  1YMP A;  1Z6T A;  3G2V A;  4DPR A;  3DXM G;  4UI9 J;  2H6H A;  3GZ1 A;  4YND A;  1K1A A;  2XZT G;  1TN8 A;  1H19 A;  3QK0 A;  5ARG A;  5ENO D;  1HE8 A;  2Y69 E;  4HRL A;  1OWL A;  3PZ4 A;  1NP7 A;  4J8E A;  5KJM A;  5EX0 A;  2KBX A;  4BEP A;  5AJD A;  3PS6 A;  2PM6 A;  4JVS A;  1ZU2 A;  3AG4 E;  3PZ3 A;  3CVY A;  2P9N G;  4PS3 A;  3BQO A;  4WNF A;  3ABL E;  3TXN A;  3L6A A;  4OYS A;  1Z3Y A;  3EDT B;  4G2V A;  3Q7F A;  1MZC A;  3RO2 A;  3ULY A;  3DSX A;  4LNB A;  2BF0 X;  3S7F A;  2A5U A;  5AIJ A;  5G04 J;  3APD A;  3PVL A;  4LG6 A;  5EYP F;  3JXI A;  5HRY A;  3FTX A;  5AN8 A;  1HF8 A;  1EYH A;  4E85 A;  2EQX A;  5D2M C;  3ABK E;  4EPZ A;  2KXP C;  3TGO A;  4Z68 A;  3VLD A;  3B13 A;  3ZRH A;  3FP3 A;  2KAT A;  1E90 A;  4XEI G;  3AG1 E;  4CT4 A;  4HRM B;  5G05 J;  3NOG D;  3UPV A;  3O48 A;  1TNO A;  3D9J A;  3FH5 A;  1NA0 A;  4EEC A;  3DWL G;  4HBD A;  3G2W A;  1INZ A;  2LNI A;  4JA9 A;  4KT6 B;  3PNL B;  1LTX A;  1SA4 A;  4I1A A;  4J8Y A;  1NL4 A;  5ENN A;  2P58 C;  5BV0 A;  4U8H A;  2RD0 A;  1X5B A;  2L9B A;  4GAA A;  2ETC A;  3NQP A;  3FU3 A;  2WXH A;  4HOT A;  3FH8 A;  3ASF A;  3JYS A;  4ILG A;  5ANL A;  2XQ0 A;  2FF4 A;  4I1O B;  4F7A A;  4JC8 A;  3URZ A;  4J8F A;  4HS2 A;  3W9F A;  3MEK A;  3E4B A;  3U4T A;  2YIN A;  4GML A;  4EBA A;  1WAO 1;  4BTA A;  3RAU A;  1PAQ A;  3PEV B;  4N3C A;  3CR3 A;  1H6O A;  1TJC A;  1UW4 B;  3C3R A;  2ETB A;  3SO8 A;  4ANW A;  2GRP B;  3I5P A;  4U04 A;  5EX3 A;  4N5C A;  4A3T A;  2WQ6 A;  4AXH A;  5LX8 A;  1E96 B;  3PE4 A;  1DVP A;  1S64 A;  2KCL A;  4G8L A;  5FTP A;  1MX6 A;  2AXU A;  3IBE A;  3EUV A;  2I9C A;  2OND A;  1EPU A;  4L9P A;  2E2E A;  1KPS B;  5AQA A;  4N39 A;  3RIB A;  3TAX A;  3T5X A;  3R7R A;  4U63 A;  4PS8 A;  4CEM A;  4BSX A;  4RLY A;  3OXF A;  1ELK A;  3TWW A;  3CHQ A;  1BD8 A;  1Z3X A;  2OV8 A;  2YQ8 A;  3RK6 A;  3ULE G;  3LY9 A;  4GTR A;  1IXV A;  2F37 A;  1OWN A;  2ILR A;  3L22 A;  3FTU A;  2MHK A;  5ANR A;  4O1P A;  3CVQ A;  4RG9 A;  1QBQ A;  2ETA A;  3DPD A;  5C1D A;  3UTM A;  2C0L A;  2WXG A;  4HQD A;  4GPK A;  5ITZ F;  1ZBP A;  4O1O A;  3EJN A;  3Q15 A;  3SBT B;  2XPZ A;  1XGW A;  5J90 A;  3S7D A;  4CT0 A;  2V5Q C;  4U0U A;  1WY6 A;  3R7Q A;  2P9P G;  2WB2 A;  5B3S E;  3CSF A;  4J8D A;  4FHJ A;  2CFZ A;  3B7S A;  5HQ8 A;  3EHQ A;  4APO A;  1SQM A;  2PZI A;  2AVP A;  2JEK A;  1QQE A;  3SZ7 A;  3ZGQ A;  3GZ2 A;  1TR4 A;  3ZYL A;  2P9S G;  4RQI A;  3EHR A;  1ELR A;  2ZXW E;  2NYJ A;  4GA0 A;  4U0S A;  1O1R A;  3ZYQ A;  1U3D A;  3LXU X;  1K1B A;  1FCH A;  4LUN U;  1H2V C;  1PC2 A;  4HI8 A;  5EYL A;  3AAA C;  3ZHE A;  4ME2 A;  3UIO C;  4GB9 A;  3GW4 A;  4DX2 A;  3FY4 A;  3AU5 A;  3QWW A;  5CEA A;  1JCS A;  2X6H A;  3ZUV B;  1K8K G;  4WWO A;  3TWR A;  3EIJ A;  4N2Q A;  3FTS A;  1JUQ A;  5ENS D;  3BG1 B;  2VGX A;  1UJJ A;  5EID A;  5CEC B;  4HXI A;  3TWS A;  3CEQ A;  4LER A;  2PQN A;  2MYO A;  4UWK A;  3PRZ A;  4NAC A;  4NRH B;  2FI7 A;  4YDO A;  5AYW D;  3Q78 A;  2VQ2 A;  2WXK A;  2UWJ G;  2WPV A;  2QC9 A;  3I4G A;  4CCA A;  4DLQ A;  4BES A;  4PUC A;  1N4Q A;  3D9I A;  3UUX A;  4IN3 B;  3JQ1 A;  4CDN A;  3S2A A;  4ACK A;  4BWR A;  3FUF A;  4F53 A;  3NB2 A;  4L2L A;  3EU9 A;  4GCO A;  4H7X A;  1AWC B;  2OEV A;  3U64 A;  5CED B;  3E30 A;  3DPY A;  3NF1 A;  4XE0 A;  4A55 A;  5JJT A;  2FO1 E;  2B6C A;  2R17 C;  2R05 A;  4RSY A;  2Y4U A;  2C0M A;  5T8I A;  2L0I A;  3ML9 A;  4K5A B;  2CHX A;  5BV1 A;  2XPY A;  4JHR A;  3ZN3 A;  4LRZ A;  4CGW A;  1LD7 A;  4BY6 A;  4EZK A;  2QZA A;  4A3V A;  1N4R A;  4JHK A;  3CVP A;  3L13 A;  4NIK A;  1TJF A;  5CCL A;  3CVX A;  2XPI A;  4GMR A;  4X8Q A;  1MX4 A;  4FJY A;  1BPO A;  2BED A;  4DX7 D;  2EIN E;  1DC2 A;  3CGH A;  3ZHE B;  2E0I A;  4Y6C A;  4BSZ B;  5JHA A;  3AU4 A;  1E8Y A;  4UQX A;  1DCE A;  4CDM A;  5AAO A;  1OWO A;  2AXV A;  4GTM A;  1E8X A;  2KZT A;  3C5R A;  4FU3 A;  2IOL A;  3CK7 A;  3J5Q B;  1WDY A;  4DI3 A;  1UOH A;  5E75 A;  2X3M A;  2VGX B;  3VTY A;  2RFA A;  4YVO A;  3PUK A;  3NBN B;  3ZYK A;  1O5M A;  3UIP C;  4FLB A;  4HOS A;  4B94 A;  3T8K A;  1V55 E;  3L82 A;  4UUC A;  2J8S D;  2JAB A;  3T9K A;  4LNG A;  3L16 A;  4XKB A;  2C2L A;  2NXP A;  4JZY A;  4MKT A;  3FEY A;  2VSY A;  3HHM A;  1S0P A;  4KMO A;  4A1S A;  1KLX A;  2WXQ A;  4C48 B;  3DBS A;  4URK A;  2R59 A;  4KXK B;  4DX6 D;  3UM0 A;  4CRW A;  3Q4A B;  2XGS A;  3E32 A;  3RRU A;  4GTS A;  2LXM A;  5FT9 A;  2CG2 A;  2WXF A;  3JUE A;  3SFZ A;  3TG4 A;  1SZA A;  2QYJ A;  3FUI A;  3B95 A;  3ULQ A;  1N0Q A;  3OXG A;  3BU8 A;  2VSO E;  3NAW A;  2I1J A;  3IEG A;  4QFV A;  2CHW A;  2L0T B;  2XEE A;  1HFA A;  2IJG X;  2LO6 A;  2DYR E;  3MJW A;  5AAR A;  3RRM B;  1LF8 A;  2XS8 A;  4WWN A;  4EZL A;  3AS8 A;  3PUJ A;  3ZIM A;  3UXG A;  2J07 A;  3HDX A;  3HIZ A;  5EN5 D;  1QNF A;  5BUZ A;  5CBN A;  1W3B A;  2A4Z A;  4XI9 A;  1KT0 A;  3OXL A;  3DEP A;  1TEZ A;  3EHM A;  5G55 A;  4B8C B;  3FUN A;  3E37 A;  3RKV A;  2KZT B;  1OXJ A;  2J9Q A;  2I2O A;  3JQ0 A;  3LVQ E;  3CKC A;  4JEU A;  1DNP A;  4R7L A;  4U7E B;  1N9A A;  2ZIS A;  1H6P A;  4HLL A;  3VLE A;  5FZS A;  4B93 B;  1O1S A;  1RW2 A;  2YNQ A;  1A17 A;  2IU1 A;  3UQ3 A;  2BKK B;  4I1M A;  2F0Y A;  5T3R A;  2NSZ A;  4GTQ A;  4JW1 A;  4OVV A;  4I6E A;  3RRN B;  4LCT A;  3FUH A;  3MX3 A;  4DK5 A;  2OVB A;  4AVX A;  3D9N A;  4TV3 A;  2CG3 A;  3TXM A;  2YHC A;  4KZC A;  3C3O A;  4K5B A;  2VTB A;  3J5P A;  1TNB A;  2OEW A;  4O60 A;  5CER B;  2XEV A;  1N4P A;  1FVH A;  3SI5 A;  3B7U X;  4TXP A;  4F1P A;  1EDU A;  1JWF A;  4C0M A;  3OAW A;  2F8Y A;  3EHN A;  1H2T C;  5KWD A;  2KM4 A;  5EKQ D;  3E34 A;  2LXL A;  1U3C A;  4HRN A;  3R9M A;  5HI7 A;  2J09 A;  5FIN A;  5FWQ A;  1N94 A;  2DZO A;  1N52 A;  2R03 A;  2P9L G;  3G2T A;  1TNY A;  1P5Q A;  5CBO A;  1UN9 A;  2Q7F A;  2Y3A A;  2WXP A;  2AJA A;  1IQU A;  4FC8 A;  3MKQ A;  4OAU C;  1WM5 A;  3LY8 A;  2IEJ A;  4U95 D;  3QC1 A;  2LAI A;  3DST A;  3I3N A;  4JL0 A;  2FEZ A;  3GYZ A;  2WXN A;  5CMY A;  4EZJ A;  4DI4 A;  1IHB A;  3IXE A;  4L7T A;  3FUK A;  5A23 A;  3ZNG A;  5D0Q D;  3UI2 A;  4B8A A;  5E76 A;  2DCP A;  3FWV A;  1MJ0 A;  1WG0 A;  2WXR A;  3CK8 A;  2IO2 C;  4KZ0 A;  4GYY A;  5EIL A;  2VSX E;  1KZP A;  4F3V A;  2CFU A;  3I4R B;  4H7Y A;  4CZ2 D;  4I9C A;  3ZXP A;  3ESL A;  4GTT A;  4J7W A;  4HOU A;  3OTN A;  4GZ5 A;  3DSW A;  2DYS E;  4UQY A;  4FUL A;  3AG2 E;  2R5S A;  5LCW C;  1V54 E;  1EF1 C;  2H6I A;  3CHM A;  3Q9N C;  5FQ4 A;  3U9W A;  2PM7 A;  4I17 A;  3GZS A;  2VTB B;  4IYP A;  4JB8 P;  4KBQ A;  3Q49 B;  4XKC A;  4GTO A;  3B7R L;  2LUH A;  2DBA A;  2EIM E;  4O6F A;  4HOR A;  5EIB E;  1SZ9 A;  4GPM A;  3W9G A;  2ION A;  2H6F A;  3FUL A;  3D9H A;  4JHJ A;  3D9K A;  3PZD A;  2IY0 C;  1U2V G;  1JPL A;  3FEX A;  4BX9 A;  1HG5 A;  4HI9 A;  2BTD A;  4I6G A;  5ENT D;  4AOF A;  3UT7 A;  1FPP A;  4YDY A;  3F6Q A;  5BW8 C;  2P9I G;  3ONK A;  3MKQ B;  4ZHB A;  2IQC A;  3KAE A;  1MHQ A;  3KSL A;  4Q94 A;  1JCR A;  1FT1 A;  3PZ2 A;  3DXK G;  5AQ7 A;  3UM2 A;  5J08 A;  1MQS A;  2A5E A;  2GRM A;  3S7B A;  1N95 A;  4FA6 A;  1X81 A;  3R9A B;  4K03 A;  4CGV A;  5C2Y A;  5LCW J;  5FQ7 A;  4MS6 A;  5EDS A;  2I1K A;  3ASG A;  4MBG A;  3BUA A;  2XHE A;  3CHO A;  2ZGG A;  1O1T A;  3MCX A;  4GA2 A;  2JLB A;  2J08 A;  4N2S A;  2P9K G;  5ENP D;  4DJA A;  3SFX A;  3K9I A;  1L5J A;  1QYM A;  4U96 D;  3PRE A;  3ONL A;  4C9B B;  3CKB A;  1Z5S C;  1LD8 A;  2KC7 A;  5BPP A;  3U3W A;  5CCM A;  2XEN A;  3UKR G;  3MV2 B;  2EIJ E;  3T8M A;  5FZQ A;  2RG8 A;  4ANX A;  2X6K A;  3LDZ A;  2Y4T A;  3D9O A;  4AJW A;  1UN8 A;  4OAV B;  2WVI A;  2P9U G;  3DRA A;  3HRA A;  3C98 A;  4MLP A;  4AIF A;  3LYA A;  3S7J A;  5KBA A;  3P2B A;  3CLJ A;  3KD7 A;  4GZ3 A;  2VGE A;  3QNK A;  3FH7 A;  3JUI A;  1HS6 A;  1Y6I A;  3FFL A;  1HZ4 A;  1TNU A;  4V3I A;  1HH8 A;  5H7P A;  1VDY A;  2HE0 A;  1MX2 A;  4BER A;  4L1B A;  4G23 A;  4C0E A;  3QJZ A;  3SBS A;  5BXU A;  5JHB A;  2GRO B;  2FUL A;  3Q9U C;  5FZR A;  1HX8 A;  4DLO A;  2GGF A;  2V5F A;  3HYM B;  3FU0 A;  3D9L A;  3FUE A;  4N3A A;  4ANU A;  3ZXS A;  4JXT A;  1N0R A;  1FT2 A;  1H2U A;  2WM9 A;  3V30 A;  1DCQ A;  2ZGD A;  4GTV A;  1SW6 A;  2V4L A;  4J8S A;  2LAH A;  3IHV A;  4PDX A;  4DUI A;  1HU3 A;  1HXI A;  3U66 A;  3IKO B;  4HNA D;  1ELW A;  1JWG A;  3ZPJ A;  3QKY A;  2EIL E;  2XGM A;  1N54 A;  4G1T A;  3D9P A;  3P1U A;  5ENR D;  4AY6 A;  2VGY A;  1FVF A;  3V79 K;  3ZFW A;  1HG2 A;  3T5V A;  3APC A;  2FO7 A;  3JCK C;  3WG7 E;  3NOC D;  5KNH D;  3TG5 A;  1MYO A;  3ASN E;  4E6H A;  4NQ0 A;  1Y8M A;  3TWU A;  2XGO A;  4GZC A;  5A6C A;  2OCC E;  4MRU A;  2HR2 A;  1BLX B;  3B7T A;  4BFR A;  2L6J A;  3CHS A;  2V0P A;  2MRI A;  4I2Z A;  2VSN A;  4BX8 A;  1RZ4 A;  3G2S A;  3FTY A;  3D9M A;  5FQ8 A;  4GU5 A;  2LSU A;  3KEZ A;  4GYW A;  2V8S E;  1TYQ G;  5G2N A;  3MGB A;  3CHP A;  1H0A A;  2WXJ A;  3B7B A;  1ZB1 A;  4U8Y D;  4GA1 A;  3SHF A;  2WXO A;  3ML8 A;  2EIK E;  2WXI A;  3FUM A;  3BG0 B;  4JD2 G;  1OY3 D;  4XI0 A;  3C3Q A;  5FJY A;  4M3O A;  1UJK A;  4AM9 A;  2MOW A;  1NZN A;  3AJI A;  3CIA A;  4G24 A;  3ESK A;  5KJN A;  5CMW A;  5D66 A;  4EQF A;  2X6J A;  4RVB A;  3SY2 A;  3MYV A;  3MA5 A;  2UY1 A;  1OWM A;  2DIW A;  4FLH A;  3RO3 A;  3Q73 A;  1N4S A;  3FDH A;  2QFC A;  2CHZ A;  5D0O D;  3UX4 A;  2I6H A;  3V2X A;  4I43 A;  4I9E A;  3LVR E;  3SFY A;  3CQG B;  2WXM A;  4UWG A;  4Q69 A;  1IQR A;  3ZKJ A;  5ENQ D;  4BT8 A;  1E7V A;  3L17 A;  3FTV A;  1H6K A;  2WQH A;  5JA4 D;  1D8E A;  4YVQ C;  1TN6 A;  2F8X K;  4ATZ D;  1SVX A;  4LSZ E;  3UIN C;  2VYI A;  3D3M A;  4AEZ C;  2IFU A;  1NI1 A;  3HG0 D;  3LJ3 A;  3TWV A;  4OVU A;  4TUU A;  2AXZ A;  3PH0 C;  4N3B A;  3LY7 A;  3LCA A;  5CRU A;  4EBA G;  3KS2 A;  4GZD A;  5DBK A;  5LFA A;  4PS7 A;  2B0O E;  3AS5 A;  2PNN A;  4BTB A;  3Q5M A;  2PL2 A;  5KCM A;  3QDN A;  4G11 A;  5FQ6 A;  3AS4 A;  3QWP A;  3SF4 A;  1A5E A;  4AP2 A;  4WAF A;  3ZU7 B;  4J0U A;  4APF A;  3ZVV A;  4IRU A;  3TL5 A;  1UG3 A;  3MZL B;  3L9T A;  2WMO A;  4TXQ A;  5KJK A;  3MV3 B;  3V2O A;  3HXD A;  4A63 B;  4WNE A;  3IV0 A;  4WND A;  5BXO A;  3UT8 A;  1OWP A;  3G2U A;  4HVB A;  4UI9 K;  3QWV A;  4ANV A;  1BI7 B;  2R2L A;  2PQR A;  3FUJ A;  4ACL A;  1OCZ E;  1HO8 A;  1OT8 A;  3QAR A;  3PZ1 A;  2XEH A;  3SQV A;  4L23 A;  2HM8 A;  2DZN A;  5FIO A;  4HB5 A;  2UY1 B;  2RFM A;  4HOQ A;  2GRR B;  1OCO E;  3RU0 A;  4XX5 A;  2X6I A;  3CHR A;  1S70 B;  4B89 A;  3UM3 A;  3O4Z A;  2Y0B G;  3PEU B;  3LKU A;  3ABM E;  1KZO A;  3VTX A;  2XRY A;  4K0R A;  3FHE A;  4DX5 D;  4XIF A;  1Q2Z A;  4UWL A;  5AQ9 A;  2XRZ A;  4BET A;  4M7C A;  2RKK A;  3Q47 B;  4I6J A;  2FBN A;  2X6F A;  5CRV A;  3UMV A;  3FU6 A;  3CVW A;  3QAQ A;  2J4D A;  4ILI A;  1E8W A;  5AJL A;  3HVE A;  1K3Z D;  1NA3 A;  4LNU D;  4F1S A;  2XZD G;  2BUG A;  3RSE G;  4KVM A;  3BEE A;  3FU5 A;  4JEH A;  1BI8 B;  2YHE A;  4ATG A;  4PH4 B;  5AEN A;  3WXX A;  1KT1 A;  2HO1 A;  3VLF A;  2BKG A;  5BNW A;  2NC9 A;  2J49 A;  3FUD A;  3QOU A;  3NZU A;  1BU9 A;  3N71 A;  5IY5 E;  1IKN D;  1NFI E;  2ZIR A;  4F6R D;  2IF4 A;  5B1A E;  4UQZ A;  4RG6 A;  4UWH A;  3ZW3 A;  2KCK A;  5JJ7 A;  3KSQ A;  3CVU A;  4JPS A;  1QZ2 A;  4KVO A;  4KYO B;  2LSV A;  4FAD A;  4B0Z A;  4A1G A;  5DIZ A;  2H6G A;  4ZFH A;  3RJV A;  4Y6W A;  5AQB A;  4L2Y A;  4FP7 A;  1TN7 A;  2R02 A;  3UT4 A;  4GCN A;  1YCS B;  2DVW A;  3EIQ C;  3HXE A;  3LS8 A;  2OVF A;  3L54 A;  3DSU A;  4HFG A;  5T4Y A;  4DRX E;  4U07 A;  4TUM A;  2OOE A;  5M72 A;  2KCV A;  4N5Q A;  3TWX A;  4K5C A;  3NZS A;  5JMN D;  3TWQ A;  4WUY A;  4J6I A;  5HS0 A;  4AV7 A;  4UWF A;  1JCQ A;  3KEA A;  2ZU6 B;  4GZ6 A;  1OCR E;  3CVL A;  1IHG A;  3QB2 A;  3HVE B;  3CST A;  4I2W A;  4ABN A;  1PY1 A;  2M63 A;  1TNZ A;  4TRQ A;  3SNX A;  4CDR A;  4D10 C;  4ILH B;  2X38 A;  2GRL A;  3UM1 A;  5HKP A;  3IHY A;  3MKR A;  3JXJ A;  1G3N B;  4GYO A; 
#chains in the Genus database with same CATH homology
 2WXJ A;  2J4B A;  2PZI A;  3OAW A;  2AVP A;  2JEK A;  1QQE A;  3EHN A;  3SD5 A;  4GA1 A;  3SZ7 A;  3ZGQ A;  1H2T C;  4IUL A;  3SHF A;  3GZ2 A;  2WXO A;  3ML8 A;  3ZYL A;  2KM4 A;  2HYZ A;  1IYG A;  2WXI A;  3FUM A;  5EKQ D;  3BG0 B;  1B89 A;  2GW1 A;  3ASD A;  1U3C A;  4XI0 A;  1ELR A;  5HI7 A;  5FJY A;  4M3O A;  2J09 A;  3L08 A;  1UJK A;  4GA0 A;  4AM9 A;  5FWQ A;  4U0Z A;  4FJZ A;  1N52 A;  4U0S A;  5BT1 A;  2MOW A;  1NZN A;  3G2T A;  3CQC B;  1P5Q A;  3ZYQ A;  1U3D A;  1UN9 A;  3LXU X;  2Q7F A;  2Y3A A;  3LPZ A;  3PNT B;  4UI9 C;  2WXP A;  1FCH A;  3FTW A;  4LUN U;  4W9R A;  2XCC A;  1H2V C;  4G25 A;  4FC8 A;  1IQU A;  1PC2 A;  3CIA A;  4G24 A;  3MKQ A;  3ZHE A;  3ESK A;  4ME2 A;  5KJN A;  5CMW A;  4WWP A;  1WM5 A;  3LY8 A;  4EQF A;  2X6J A;  4GB9 A;  3CVN A;  4RVB A;  3QC1 A;  3GW4 A;  4LEU A;  3FY4 A;  3AU5 A;  3QWW A;  2LAI A;  3MYV A;  2VJ8 A;  2IOS A;  3I3N A;  3MA5 A;  4JL0 A;  3TJP A;  2X6H A;  2FEZ A;  4WNG A;  3GYZ A;  4WWO A;  2WXN A;  5CMY A;  4JA7 A;  4EZJ A;  4P29 A;  5LP0 A;  4HLE A;  3EIJ A;  2UY1 A;  4DI4 A;  1OWM A;  3CVV A;  2DIW A;  4G26 A;  4N2Q A;  3FTS A;  1JUQ A;  3PDN A;  4FLH A;  3RO3 A;  3BG1 B;  2VGX A;  3FTZ A;  1UJJ A;  5A7D B;  1XNF A;  3FDH A;  1YA0 A;  2QFC A;  4XZ4 A;  2CHZ A;  4HXI A;  3CEQ A;  4L7T A;  5D0O D;  3FUK A;  4LER A;  3UX4 A;  2I6H A;  5A23 A;  4BT9 A;  4I43 A;  2PQN A;  4I9E A;  2QY7 A;  4GMJ A;  4UWK A;  5CHE E;  3PRZ A;  5D0Q D;  3CK9 A;  5KJL A;  4B8A A;  3LVR E;  5E76 A;  1GW6 A;  2DCP A;  3CQG B;  3FWV A;  4NAC A;  4NRH B;  2WXM A;  4AY5 A;  2FI7 A;  3APF A;  4UWG A;  2WXR A;  3SGH A;  5G04 C;  1IQR A;  5AYW D;  3CK8 A;  4KZ0 A;  4Q69 A;  4GYY A;  2WMN A;  2VQ2 A;  2VSX E;  2WXK A;  3PE3 A;  3LEW A;  4F3V A;  2CFU A;  2UWJ G;  2WPV A;  4BT8 A;  3I4R B;  4H7Y A;  2AWI A;  1E7V A;  1E8Z A;  4I9C A;  3I4G A;  4CCA A;  3CV0 A;  4DLQ A;  3ESL A;  3L17 A;  3FTV A;  4PUC A;  2WQ7 A;  4HOU A;  3OTN A;  1H6K A;  3ZEF A;  4GZ5 A;  3D9I A;  3UUX A;  4IN3 B;  5ARF A;  2WQH A;  4NUR A;  4YVQ C;  3JQ1 A;  3ENE A;  4CDN A;  4UQY A;  4FUL A;  3S2A A;  4ACK A;  4BWR A;  3FUF A;  4F53 A;  1OUV A;  1E7U A;  2VYI A;  4L2L A;  3D3M A;  5LOZ A;  2R5S A;  2XCB A;  4GCO A;  4AEZ C;  5LCW C;  1EF1 C;  2IFU A;  3CHM A;  5G05 C;  5JJ6 A;  3ZYM A;  3ASH A;  2AW6 A;  4Q96 A;  4H7X A;  2WXL A;  3LJ3 A;  4FHK A;  3U64 A;  4OVU A;  5FQ4 A;  3U9W A;  4TUU A;  2AXZ A;  3NF1 A;  3PH0 C;  4N3B A;  2PM7 A;  4I17 A;  3GZS A;  4XE0 A;  2VTB B;  3LY7 A;  3LCA A;  4A55 A;  5JJT A;  1Z6T A;  4EBA G;  3KS2 A;  4GZD A;  3G2V A;  4IYP A;  4DPR A;  4UI9 J;  5DBK A;  4KBQ A;  2R17 C;  3Q49 B;  4XKC A;  5LFA A;  4PS7 A;  4RSY A;  2Y4U A;  3GZ1 A;  2C0M A;  5T8I A;  3B7R L;  2L0I A;  4YND A;  3ML9 A;  3AS5 A;  2DBA A;  2CHX A;  1H19 A;  4O6F A;  4BTB A;  3QK0 A;  2XPY A;  5BV1 A;  4JHR A;  4HOR A;  3ZN3 A;  3Q5M A;  4LRZ A;  5ARG A;  4CGW A;  1SZ9 A;  2PL2 A;  1HE8 A;  5KCM A;  2ION A;  3QDN A;  1OWL A;  4G11 A;  5FQ6 A;  4BY6 A;  4EZK A;  1NP7 A;  3AS4 A;  3QWP A;  3SF4 A;  4J8E A;  5KJM A;  4AP2 A;  4WAF A;  5EX0 A;  4A3V A;  4J0U A;  4JHK A;  3FUL A;  4APF A;  3ZVV A;  4IRU A;  4JHJ A;  5AJD A;  3D9K A;  3PS6 A;  2PM6 A;  3CVP A;  3L13 A;  3PZD A;  3TL5 A;  4JVS A;  1UG3 A;  1ZU2 A;  3MZL B;  1TJF A;  5CCL A;  3CVX A;  3CVY A;  1JPL A;  2WMO A;  4PS3 A;  3FEX A;  4WNF A;  2XPI A;  4BX9 A;  5KJK A;  3MV3 B;  1HG5 A;  2BTD A;  4I6G A;  4WNE A;  3L6A A;  3TXN A;  3IV0 A;  4OYS A;  4AOF A;  4WND A;  1Z3Y A;  4FJY A;  3UT8 A;  1BPO A;  1OWP A;  3EDT B;  3UT7 A;  3G2U A;  4HVB A;  4UI9 K;  5BW8 C;  3ONK A;  3CGH A;  4G2V A;  3MKQ B;  3ZHE B;  2E0I A;  3QWV A;  2IQC A;  3KAE A;  4Y6C A;  3RO2 A;  1MHQ A;  5JHA A;  4ANV A;  3AU4 A;  4Q94 A;  1E8Y A;  4UQX A;  2BF0 X;  3S7F A;  2A5U A;  5AIJ A;  5G04 J;  4CDM A;  3APD A;  3PVL A;  1OWO A;  2PQR A;  2AXV A;  3FUJ A;  1E8X A;  4ACL A;  2KZT A;  3FTX A;  1HO8 A;  1HF8 A;  3QAR A;  1EYH A;  4E85 A;  2EQX A;  4FU3 A;  2IOL A;  3CK7 A;  2HM8 A;  4L23 A;  5J08 A;  4DI3 A;  2UY1 B;  4EPZ A;  1MQS A;  2GRM A;  3S7B A;  5E75 A;  2X3M A;  2VGX B;  4HOQ A;  3VTY A;  3TGO A;  4YVO A;  4FA6 A;  3PUK A;  3RU0 A;  4XX5 A;  3VLD A;  3B13 A;  2X6I A;  3ZYK A;  3CHR A;  4K03 A;  3R9A B;  4B89 A;  4CGV A;  4FLB A;  3ZRH A;  4B94 A;  4HOS A;  3FP3 A;  2KAT A;  5C2Y A;  1E90 A;  5LCW J;  3O4Z A;  4CT4 A;  5G05 J;  5FQ7 A;  3UPV A;  3PEU B;  4MS6 A;  3O48 A;  3LKU A;  5EDS A;  2I1K A;  3D9J A;  3ASG A;  3FH5 A;  3VTX A;  1NA0 A;  2XRY A;  2XHE A;  3CHO A;  4EEC A;  4K0R A;  3MCX A;  3G2W A;  4GA2 A;  2JLB A;  2J08 A;  1INZ A;  3FHE A;  4N2S A;  3L16 A;  2LNI A;  4XKB A;  4DJA A;  4XIF A;  4JA9 A;  3K9I A;  4KT6 B;  2C2L A;  4UWL A;  2NXP A;  1L5J A;  4JZY A;  4MKT A;  2XRZ A;  3FEY A;  3PNL B;  3PRE A;  3ONL A;  4C9B B;  4I1A A;  3CKB A;  5ENN A;  5BV0 A;  2P58 C;  2VSY A;  4U8H A;  3Q47 B;  3HHM A;  1S0P A;  4KMO A;  2KC7 A;  5BPP A;  2RD0 A;  4I6J A;  5CCM A;  3U3W A;  1X5B A;  2FBN A;  2X6F A;  3MV2 B;  3UMV A;  4A1S A;  2L9B A;  3FU6 A;  1KLX A;  2WXQ A;  4GAA A;  2RG8 A;  5FZQ A;  3DBS A;  3QAQ A;  3T8M A;  4ANX A;  2J4D A;  4URK A;  3CVW A;  4ILI A;  1E8W A;  2R59 A;  5AJL A;  2X6K A;  3HVE A;  3LDZ A;  4KXK B;  3NQP A;  1NA3 A;  4CRW A;  3Q4A B;  2Y4T A;  4F1S A;  2XGS A;  2BUG A;  2WXH A;  3FU3 A;  3D9O A;  4HOT A;  3RRU A;  4AJW A;  1UN8 A;  4KVM A;  3BEE A;  3FU5 A;  5FT9 A;  2WVI A;  3FH8 A;  4JEH A;  2CG2 A;  3C98 A;  4MLP A;  3ASF A;  2WXF A;  3JYS A;  4ILG A;  3SFZ A;  3TG4 A;  5ANL A;  2YHE A;  4AIF A;  4ATG A;  2XQ0 A;  1SZA A;  3FUI A;  3LYA A;  4PH4 B;  5AEN A;  3ULQ A;  3S7J A;  2FF4 A;  3P2B A;  4I1O B;  3CLJ A;  3WXX A;  1KT1 A;  4F7A A;  3KD7 A;  2HO1 A;  3OXG A;  4JC8 A;  3URZ A;  4GZ3 A;  4J8F A;  3VLF A;  5BNW A;  2NC9 A;  4HS2 A;  3QNK A;  2J49 A;  3FH7 A;  2VSO E;  3FUD A;  3QOU A;  3JUI A;  3MEK A;  3E4B A;  2I1J A;  1HS6 A;  3IEG A;  1Y6I A;  3U4T A;  4QFV A;  3NZU A;  2CHW A;  2YIN A;  3N71 A;  3FFL A;  2L0T B;  1HZ4 A;  4V3I A;  4GML A;  4EBA A;  1HFA A;  1WAO 1;  2IJG X;  2LO6 A;  4BTA A;  1HH8 A;  3MJW A;  1PAQ A;  3PEV B;  1VDY A;  3RRM B;  1LF8 A;  2IF4 A;  4N3C A;  3CR3 A;  4WWN A;  4C0E A;  4L1B A;  4G23 A;  4EZL A;  3QJZ A;  3AS8 A;  3PUJ A;  3SBS A;  3ZIM A;  1TJC A;  5JHB A;  4UQZ A;  2FUL A;  1UW4 B;  5FZR A;  4ANW A;  1HX8 A;  4RG6 A;  2J07 A;  3HDX A;  3HIZ A;  4UWH A;  1QNF A;  4DLO A;  5BUZ A;  3I5P A;  2GGF A;  4U04 A;  3ZW3 A;  5EX3 A;  1W3B A;  2A4Z A;  2KCK A;  4N5C A;  2V5F A;  4XI9 A;  1KT0 A;  3HYM B;  4A3T A;  5JJ7 A;  2WQ6 A;  3FU0 A;  3CVU A;  4AXH A;  3OXL A;  3D9L A;  4JPS A;  3FUE A;  4N3A A;  5LX8 A;  1QZ2 A;  1E96 B;  4ANU A;  3PE4 A;  4KVO A;  4KYO B;  4JXT A;  3ZXS A;  1DVP A;  2LSV A;  4FAD A;  2KCL A;  5FTP A;  1H2U A;  2WM9 A;  1TEZ A;  2AXU A;  3EHM A;  4B0Z A;  2V4L A;  5G55 A;  4A1G A;  4B8C B;  5DIZ A;  3FUN A;  2LAH A;  3IBE A;  4J8S A;  2I9C A;  2OND A;  3IHV A;  4PDX A;  1HU3 A;  1EPU A;  3RKV A;  2E2E A;  1HXI A;  2KZT B;  4N39 A;  3RIB A;  3RJV A;  2J9Q A;  2I2O A;  3JQ0 A;  3LVQ E;  3TAX A;  3CKC A;  3IKO B;  3T5X A;  3R7R A;  3U66 A;  4U63 A;  4JEU A;  1DNP A;  4PS8 A;  1ELW A;  1JWG A;  4Y6W A;  4BSX A;  4R7L A;  4CEM A;  3OXF A;  4L2Y A;  3ZPJ A;  1ELK A;  3QKY A;  4FP7 A;  3CHQ A;  2XGM A;  3UT4 A;  1N54 A;  4G1T A;  4GCN A;  3EIQ C;  3D9P A;  3LS8 A;  3P1U A;  2OVF A;  3L54 A;  1Z3X A;  2OV8 A;  3VLE A;  5FZS A;  2YQ8 A;  4AY6 A;  2VGY A;  2YNQ A;  4HFG A;  3RK6 A;  5T4Y A;  1FVF A;  4GYO A;  3ZFW A;  1A17 A;  1HG2 A;  4U07 A;  3LY9 A;  3T5V A;  2IU1 A;  3APC A;  3UQ3 A;  2FO7 A;  3JCK C;  4I1M A;  2OOE A;  5T3R A;  2NSZ A;  1OWN A;  3TG5 A;  4APO A;  2ILR A;  5M72 A;  4JW1 A;  4OVV A;  3L22 A;  3FTU A;  4I6E A;  2MHK A;  2KCV A;  3RRN B;  4NQ0 A;  4E6H A;  5ANR A;  4LCT A;  3FUH A;  3CVQ A;  1Y8M A;  4RG9 A;  2XGO A;  3MX3 A;  4GZC A;  5C1D A;  3DPD A;  4DK5 A;  2C0L A;  2WXG A;  5A6C A;  4GPK A;  2OVB A;  4AVX A;  3NZS A;  1ZBP A;  3D9N A;  4MRU A;  4WUY A;  2HR2 A;  4J6I A;  3EJN A;  4AV7 A;  3Q15 A;  3B7T A;  3SBT B;  4BFR A;  4TV3 A;  4UWF A;  2L6J A;  2XPZ A;  3CHS A;  1XGW A;  2V0P A;  2MRI A;  2CG3 A;  4I2Z A;  2ZU6 B;  3S7D A;  3TXM A;  4CT0 A;  2YHC A;  4GZ6 A;  5J90 A;  2VSN A;  3CVL A;  4KZC A;  4U0U A;  1IHG A;  4BX8 A;  3QB2 A;  3G2S A;  3FTY A;  3D9M A;  3HVE B;  3CST A;  4I2W A;  5FQ8 A;  4ABN A;  1PY1 A;  2M63 A;  4TRQ A;  1WY6 A;  3R7Q A;  2VTB A;  3SNX A;  4GU5 A;  2WB2 A;  4CDR A;  4D10 C;  3CSF A;  4ILH B;  4J8D A;  2X38 A;  4FHJ A;  2CFZ A;  2LSU A;  2XEV A;  1FVH A;  2GRL A;  3KEZ A;  4GYW A;  3SI5 A;  2V8S E;  3B7U X;  3B7S A;  5HQ8 A;  5G2N A;  3MGB A;  3IHY A;  3MKR A;  1EDU A;  1JWF A;  1SQM A;  3CHP A;  1H0A A;  4C0M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...