2BTDA

Crystal structure of dhal from e. coli
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
209
structure length
209
Chain Sequence
SLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Nucleotide-Binding Subunit Dhal of the Escherichia Coli Dihydroxyacetone Kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PTS-DEPENDENT DIHYDROXYACETONE KINASE
total genus 84
structure length 209
sequence length 209
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2005-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02734 Dak2 DAK2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.340 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2btdA00
1UN8A 3PNLB 2BTDA 3CR3A 1UN9A 4LRZA
chains in the Genus database with same CATH superfamily
2LXMA 3APFA 1BLXB 3CVPA 2V4HC 1QYMA 1MX6A 3T5VA 2QFCA 2EQXA 4EHMA 2L9BA 1HO8A 4CT4A 3JQ0A 2P9NG 3DEPA 4K03A 2OVBA 3CKCA 3HDXA 3T5XA 3SY2A 4LNBA 2GROB 2J09A 3Q49B 1W3BA 4PS8A 4TXQA 3ML9A 4DRXE 4V3IA 3URZA 4F7AA 2PL2A 1O5MA 3AU4A 2F8YA 5AJLA 4RVBA 1QZ2A 3P2BA 4A1GA 3NQPA 3PREA 3FUNA 3ULEG 3UM3A 4ACKA 4XI9A 3QWPA 1SQMA 5FT9A 2WPVA 4GPMA 3TWWA 2NSZA 4FADA 4HB5A 2XPIA 2A5UA 3SNXA 1EYHA 1OUVA 5LFAA 3R9AB 3JUEA 2UY1A 3ZYMA 3FEXA 1KPSB 3UTMA 3Q78A 4UWGA 2NXPA 1H0AA 4HS2A 4XE0A 5EN5D 4CDRA 3ZYKA 3TWRA 1BPOA 4FC8A 1KZPA 4YDYA 4CRWA 3JCKC 3C3RA 4YDEA 5T4YA 2MHKA 1OWOA 1E8ZA 4WNEA 2KZTA 4HOUA 5T8IA 1FT1A 4JZYA 4GZ3A 3TG4A 3RJVA 4I1OB 4NQ0A 5D66A 4HOQA 5CMYA 3Q79A 3FEYA 3D9HA 3VTXA 3SZ7A 3SBSA 2V4LA 4I2ZA 3BG0B 5FZSA 1RW2A 3ZGQA 3MEKA 4BT9A 5CMWA 2WQ7A 3CHRA 3GW4A 4EPZA 4FA6A 3DPDA 3MYVA 1DCQA 3RK6A 4PUCA 1MJ0A 2XQ0A 1WY6A 4JA9A 2X38A 3AG3E 3CLJA 5T3RA 2ZXWE 1E96B 3LXUX 1AP7A 2CFZA 3N71A 4YNDA 3Q7AA 3HRAA 1H6PA 3FP3A 1E8YA 3WXXA 3CVLA 3IXEA 5HI7A 4KZ0A 4HFGA 3RRNB 2GRLA 4BX8A 1L5JA 5CCLA 5IY5E 2H6HA 4AJWA 4GA0A 2X3MA 3SQVA 4EZKA 1HX8A 3EJNA 3MV2B 3LJ3A 5AJDA 5ENNA 3MJWA 3FTWA 4HRMB 3EHRA 5KNGA 2LXLA 4U8VD 3PNLB 2J8SD 4TRQA 4AV7A 3W9FA 2WMOA 4J7WA 1JWGA 3B7TA 4HRLA 4APOA 4U04A 3FUIA 4LEUA 4WWPA 3X2QE 1UJJA 2WQHA 1H2TC 4OAVB 5C1DA 3OTNA 4JHRA 4UUCA 3AS8A 4GTSA 3T9KA 2GRRB 2OOEA 4XZ4A 2XEHA 4JHJA 1EPUA 5EIDA 3LVQE 4GMRA 4DPRA 2L0IA 1OY3D 3AAAC 4XKBA 2J9QA 4J8EA 2VGYA 4DK5A 1PAQA 5G2NA 3HXFA 3L22A 2IOLA 1JWFA 2CHWA 2FF4A 4GCOA 4J8FA 3ZPJA 3ZVVA 5JJ7A 1E7UA 2OVFA 2I2OA 3E4BA 3UIOC 3PZ3A 1GW6A 5ENTD 3FWVA 4MBGA 3CHMA 4XIFA 1H6KA 1N0RA 1ZBPA 4E85A 4O1OA 5A6CA 2Q7FA 4G8KA 4KVMA 4NIKA 4Z68A 3R7RA 3JXIA 4JXTA 1V54E 4GAAA 2H6GA 2C0LA 3HXCA 3ISMC 4K0RA 2CFUA 5E75A 1AWCB 3PZ2A 2R03A 4G11A 4CZ2D 3RSEG 2J4DA 3QWWA 4PH4B 5G04J 3CVUA 5BXOA 3OXFA 3HG0D 2IJGX 5D2MC 3FH8A 4NACA 4A63B 1MX2A 4M7CA 4A3TA 3ESLA 4DUIA 1D8EA 1E7VA 3UMVA 3APDA 3EHNA 3L08A 4JB8P 4FHKA 2XEEA 3VLDA 4U7EB 4ANWA 1Z6TA 1YMPA 3FH5A 5DIZA 3NZSA 4XI0A 2MYOA 3O4ZA 4GU5A 2ZGGA 4AP2A 2X6KA 5KNHD 4GCNA 2WB2A 1MX4A 3UPVA 1N9AA 1HS6A 4CEMA 2VGEA 1WDYA 3S7DA 1S64A 2PM6A 3BEEA 4YVOA 3CHOA 4GZ5A 5JJTA 1NI1A 5KBAA 2X6IA 3S7FA 3LJNA 4FU3A 3V30A 3PZDA 1QQEA 2XENA 2V0PA 1A17A 2WXQA 3U4TA 3FTSA 5CERB 1NA0A 2Y3AA 4BFRA 2P9LG 3FUDA 2FO1E 2R17C 4I1AA 2EINE 2KATA 3Q15A 4W9RA 1A5EA 3TWUA 1NFIE 1U2VG 5ARGA 4O6FA 3ML8A 1BU9A 1SW6A 4K5CA 2XPYA 3CK7A 4JEUA 3T8KA 3CQCB 3FY4A 2R59A 3ZFWA 3HVEA 4JC8A 3W9GA 5FTPA 3G2TA 4KVOA 4L23A 3NOCD 2EILE 2R05A 4UI9C 3FH7A 1V55E 3UT8A 1P5QA 4QFVA 4GMJA 5AQ7A 3BU8A 4Q96A 4H7YA 4ILHB 4OYSA 1LD7A 1IQUA 1TJCA 4UQXA 4OAUC 1MHQA 3QB2A 3MKRA 3B7RL 1DCEA 3CR3A 5FZQA 5HS0A 3Q7FA 4RG6A 4WAFA 3S7BA 1HE8A 4FULA 4KBQA 4FJYA 3ENEA 2VSOE 2H6IA 3D9MA 4GTRA 4MLPA 1EDUA 4IULA 3GZSA 4NURA 3UQ3A 4ILIA 5ANLA 5LCWC 1KLXA 4LSZE 3RO2A 3Q75A 2AJAA 3V79K 5G05C 4IN3B 2QY7A 3G2SA 3Q9UC 5EILA 1TYQG 2LAIA 4F53A 4FLBA 3ZN3A 5B1AE 2KCLA 4O1PA 3HVEB 1OWLA 1Q2ZA 5HKPA 2M63A 2VJ8A 4JW1A 2BKKB 2RG8A 3Q9NC 2WXPA 3OAWA 1U3CA 1K8KG 1N11A 2LSVA 3DSVA 3ONKA 1OCZE 5ENQD 1HU3A 1HG5A 2L6JA 2CG2A 1DVPA 1NL4A 3TJPA 3RAUA 4C9BB 3CGHA 4I9EA 1O1TA 1QBQA 5M72A 4KZCA 1S0PA 2YHEA 2JLBA 3CEQA 4I17A 4JVSA 4BEPA 3E32A 5HQ8A 1BD8A 3UXGA 5FJYA 2FO7A 4AVXA 4CT0A 1MQSA 4G1TA 3ASNE 2H6FA 1Z3XA 4J0UA 4FP7A 2PZIA 3QJZA 4I43A 4XKCA 4A55A 2RFMA 3RKVA 1LTXA 4H7XA 2WXGA 2XEVA 4UQYA 3UKUG 3EIJA 4HVBA 3ULYA 2KM4A 2GRNB 5AYWD 4GB9A 2XRZA 4UWLA 1Y8MA 3PRZA 5BV1A 4OVUA 3CVWA 3HYMB 2IONA 3QOUA 2OV8A 4C0EA 2DBAA 2RFAA 4JL0A 3CIAA 4PDXA 3PEVB 4AY6A 5G05J 2XGSA 4L7TA 2DYSE 4JD2G 1E8WA 2C2LA 3JXJA 5LCWJ 3D9IA 3NF1A 2VGXB 1JCRA 4GTPA 4FHJA 5EDSA 4CGWA 5G55A 1WG0A 4HRNA 4ATZD 1BI8B 2KCVA 4APFA 4K5AB 3CVVA 3ASGA 4BESA 1UW4B 2LO6A 4A3VA 2YQ8A 2P9UG 1UN9A 3L54A 5EX0A 3IBEA 2ETCA 3EUVA 4UWFA 3Q73A 4AEZC 5ANRA 2KXPC 4B89A 1FT2A 2JEKA 2BKGA 2P2CP 3FTZA 3ABKE 2XCCA 3PE4A 1HH8A 1LD8A 3DWLG 2BUGA 4GTTA 5AARA 1K1AA 4U0ZA 1Y6IA 5ENRD 5AN8A 3D9JA 1DC2A 2IFUA 2CHZA 2WXRA 5AQ9A 2EIKE 4GMLA 4GYYA 2FBNA 3CSTA 3B7BA 3UX4A 4IYPA 4M3OA 5KJLA 4WNDA 3Q5MA 2B0OE 4C48B 3LPZA 4G25A 5LX8A 3L16A 3C72A 4DJAA 1X5BA 4HXIA 1E8XA 2PQNA 3OXGA 3PS6A 3FUMA 2PQRA 4Q94A 3UT4A 2IO2C 4LERA 4UWKA 4LUNU 3FU0A 4Q69A 3D9PA 3KEAA 2OEWA 3C3OA 4B93B 4G26A 2WXIA 2BF0X 1MYOA 4WWOA 3WG7E 5ITZF 2Y0BG 3TG5A 2IO3C 4WWNA 1INZA 3D9KA 4U0SA 4LCTA 4DX5D 4ME2A 3BQOA 3D3MA 2XZDG 4NRHB 5A23A 4JA7A 3UIPC 3RO3A 3DXMG 3V2XA 3LEWA 4MRUA 1E90A 4U8HA 3FU6A 2B6CA 4JEHA 5FZRA 3RRMB 3JYSA 1FPPA 1SZ9A 4ILGA 5BNWA 3TXNA 2DCPA 4UWHA 1H19A 3ABME 2WQ6A 4K5BA 3NOGD 4BSXA 3MZLB 5ENPD 3ASFA 5A7DB 1PC2A 2I6HA 3TXMA 2LUHA 1UG3A 2GGFA 1N4RA 1TNZA 1S63A 4F3VA 2ETBA 2F0YA 4GTOA 3IHYA 3DSTA 4RSYA 5KJMA 3SF4A 3JQ1A 5JHAA 2F8XK 4B8CB 3SFXA 3UINC 1JPLA 2VTBA 1JCSA 3BG1B 2QYUA 5D0QD 1D8DA 3B95A 3AU5A 4ANXA 1N54A 1BI7B 4YDWA 1TNUA 4L9PA 1QNFA 1HF8A 3E33A 4UQZA 2GRPB 4LRZA 4RQIA 4UI9J 5ENOD 2IU1A 3E37A 4PS7A 4GPKA 1H6OA 3S7JA 3TWQA 4B94A 4DLQA 4HORA 4I1MA 5HRYA 4ABNA 5KWDA 3LKUA 1EF1C 3CHPA 3FDHA 2AWIA 2HYZA 3PZ1A 5JJ6A 4BY6A 5CHEE 5AQBA 3FTYA 3J5QB 3I4GA 4KYOB 3E30A 5FIOA 2XS1A 3VTYA 1NP7A 3IHVA 3P1UA 5B1BE 4TXRA 2DWZA 3DXKG 3ZW3A 5AIJA 2BTDA 1IQRA 3FTXA 2HM8A 4C0MA 1UOHA 2ZGDA 4P29A 1ZU2A 3I3NA 4AM9A 3O48A 4U63A 3C98A 4BT8A 1OWPA 2QYJA 4YVQC 3SGHA 3RRUA 1UN8A 4GA1A 3C3QA 3SO8A 2J07A 2KC7A 2BEDA 1NA3A 2YNQA 3CK9A 3V31A 2ILRA 2WXOA 3HXEA 1O1RA 2Y4TA 3FUKA 5EX3A 2AVPA 5JHBA 3QK0A 5FWQA 4HLEA 4L1BA 4CCAA 3EHQA 2HR2A 4CDNA 3KS2A 3U66A 1G3NB 2J4BA 3LCAA 4N2SA 4GTVA 1UJKA 1SZAA 4G8LA 3LS8A 4TUMA 2OEVA 3HXBA 4GTQA 3J5PA 3DSSA 4URKA 4QQIA 3UM1A 3IKOB 2EIME 4Y6CA 1JCQA 3NZUA 3FHEA 3ASDA 2V5QC 4RLYA 3FUFA 3IEGA 4AIFA 1IKND 4ANUA 3I5PA 3AS4A 3QKYA 3KSLA 1TN7A 2WXKA 2XCBA 3NBNB 5H7PA 4ZHBA 1TN6A 2P9KG 5J08A 3L9TA 4B0ZA 3ZRHA 2DZNA 2ONDA 3MCXA 3DSXA 3U9WA 2NC9A 3CV0A 1IHBA 3CVYA 1TNYA 4F1SA 2WM9A 4BWRA 3K9IA 4GYWA 2I1KA 2Y4UA 2VYIA 3Q4AB 4JHKA 3FUHA 2EIJE 3CK8A 5BW8C 3CVXA 4CGVA 3ULQA 2YINA 3UI2A 4I6JA 3GZ1A 3DSWA 3PEUB 4N5QA 5CEAA 3MX3A 4LNGA 3QNKA 4B8AA 4ZFHA 1H2VC 2WMNA 3G2WA 3MA5A 2P9IG 3ASOE 1NZNA 5CECB 3AG4E 1FCHA 4F1PA 2KBXA 3L82A 3ONLA 3QC1A 3ZHEA 2HE0A 4I9CA 4G23A 3B7UX 4HBDA 1VDYA 1H2UA 4AXHA 4WNGA 1TR4A 1TJFA 1D9SA 3DRAA 4DX7D 2XZTG 3UUXA 1K1BA 3EU9A 4HOTA 2V5FA 2AXZA 3EHMA 4HLLA 3PNTB 3SBTB 2WXMA 3QWVA 3E34A 4HOSA 1TNBA 3UT7A 1SA4A 3F6QA 3SD5A 3TAXA 1IYGA 2WXHA 3CHSA 3TWSA 2QC9A 3D9LA 3ZEFA 4HNAD 4N3AA 1KT1A 4BSZB 4GZDA 3QAQA 2AXUA 4KT6B 2IEJA 3DEOA 2HO1A 2MOWA 4RG9A 4R7LA 1IHGA 3G2UA 3SI5A 2CHXA 2A4ZA 5BT1A 2DZOA 4WUYA 4WNFA 4J8YA 1OWNA 3EU5A 1YA0A 1Z3YA 2Y1LE 3HHMA 3ZKJA 3G2VA 3PE3A 4GYOA 3MKQB 5EKQD 4CYMD 2XRYA 3LY9A 4DI3A 1O1SA 3S2AA 5FQ7A 2X6FA 4X8QA 1WAO1 2RD0A 2FEZA 4ATGA 3PZ4A 3UM2A 2XHEA 3RIBA 2GRMA 3SFZA 4YDOA 4BX9A 2X6JA 3CSFA 5BV0A 1N4SA 3ASHA 4E6HA 2ETAA 3TGOA 4N3CA 5BUZA 4I6EA 4HI9A 3L17A 1TNOA 3AG2E 2I1JA 5LP0A 2R5SA 3HIZA 3KAEA 4N5CA 3SFYA 5DBKA 1PY1A 3FUEA 3CHQA 2UY1B 3HXDA 2JABA 4UI9K 1SA5A 5FINA 1ZB1A 1ELRA 3FUJA 3TWXA 4U95D 1DNPA 2C0MA 1OCCE 5BXUA 2X6HA 2VSYA 4DI4A 2NYJA 3EIQC 4U96D 5EYLA 4N3BA 5J90A 1B89A 1HZ4A 2Y69E 3ZHEB 3CVNA 3FULA 3GYZA 4EZJA 3ZUVB 5CRVA 2V8SE 2E0IA 1RZ4A 4CDMA 2WXFA 5G04C 3CVQA 3DSUA 3PUKA 4TXPA 4EZLA 5KJKA 2DIWA 1KZOA 3R7QA 4DX1A 4BERA 3QDNA 3TWTA 2VGXA 3LY7A 4G2VA 3T8MA 1S70B 3NB2A 3OXLA 4BTBA 2ZISA 2YHCA 2R2LA 2AW6A 4XEIG 1WM5A 4O60A 1JUQA 3SHFA 3B7SA 3MKQA 4LNUD 3DBSA 3LDZA 3TWVA 4N39A 2MRIA 4I2WA 1K3ZD 3AJIA 3GZ2A 4BTAA 4DX2A 3D9OA 3ZXSA 3D9NA 2P9PG 5CBOA 2XGOA 2R02A 4G24A 3Q47B 1IXVA 1OXJA 3QARA 2XS8A 1HG2A 3R9MA 2IQCA 5CRUA 3LY8A 3ZXPA 2AXVA 2L6BA 2LAHA 4DLOA 3LVRE 4L2LA 2P58C 4KMOA 5CBNA 4TV3A 4JPSA 2KCKA 4EBAG 2IF4A 1OT8A 3CKBA 4FJZA 1KT0A 4OVVA 3UKRG 2LSUA 5FQ6A 4D10C 3V2OA 3IV0A 3FTVA 4TUUA 3FTUA 2A5EA 3LYAA 3ZNGA 5LOZA 2VSNA 1FVFA 3MGBA 2P9SG 2ZIRA 2PM7A 4J8DA 3APCA 2VTBB 2ZU6B 3VLFA 3JUIA 3NAWA 3DPYA 2J08A 4AY5A 2IY0C 3ZYQA 5E76A 1XGWA 2RKKA 1N52A 3C5RA 1YYHA 1MZCA 5CEDB 5AQAA 2WXNA 5KCMA 3I4RB 5D0OD 5CCMA 3ZIMA 4U07A 3PH0C 4GTMA 3KEZA 4Y6WA 5JMND 2WXJA 1OWMA 4U8YD 3FU5A 1N4QA 3CQGB 2I9CA 2VSXE 1TEZA 4KXKB 4GZ6A 1OCRE 3AS5A 3KSQA 4LG6A 3RU0A 4PS3A 2WVIA 3PUJA 4XX5A 2GW1A 4I6GA 1HXIA 1ELKA 1N0QA 2FI7A 3FFLA 4GZCA 2DVWA 2GRQB 3U3WA 4EQFA 4L2YA 1XNFA 4BETA 4HI8A 5B3SE 1TN8A 3MV3B 5FQ4A 4DX6D 3VLEA 2J49A 1N4PA 2E2EA 4IRUA 5AAOA 4J6IA 5AENA 3TL5A 5ENSD 5KJNA 3ABLE 2XGMA 2F37A 2DYRE 3L13A 3L6AA 1LF8A 4F6RD 5ARFA 4MKTA 1N95A 3EDTB 2KZTB 2OCCE 4MS6A 3BUAA 1U3DA 3ESKA 3ZU7B 4HQDA 2VQ2A 4FLHA 4J8SA 1OCOE 4ANVA 1FVHA 5EYPF 5BPPA 3B13A 3AG1E 4EBAA 3KD7A 3PVLA 1ELWA 1Z5SC 2FULA 3UM0A 1HFAA 2CG3A 2PNNA 2LNIA 2XPZA 3U64A 4ACLA 2WXLA 4AOFA 3PDNA 4EECA 5EIBE 2QZAA 1N94A 2UWJG 3FU3A 4GA2A 4N2QA 1YCSB 4U0UA 5JA4D 5FQ8A 2IOSA 3ZYLA 2L0TB 1X81A 5C2YA 4A1SA 1SVXA
chains in the Genus database with same CATH topology
3TG5A 3TGOA 3APFA 4DI3A 2X6IA 3S7FA 3CVPA 3S2AA 4WWNA 3T5VA 3D9KA 2QFCA 4FU3A 1INZA 4U0SA 2EQXA 3PZDA 4LCTA 2L9BA 5FQ7A 1HO8A 1QQEA 2X6FA 4ME2A 4CT4A 3D3MA 1WAO1 2RD0A 2FEZA 4NRHB 4JA7A 4ATGA 2V0PA 3RO3A 5A23A 3JQ0A 3LEWA 4MRUA 1E90A 1A17A 2XHEA 4K03A 2WXQA 3RIBA 2OVBA 2GRMA 3CKCA 3SFZA 3FTSA 3HDXA 3U4TA 4U8HA 3T5XA 3FU6A 1NA0A 4BX9A 2Y3AA 2X6JA 2J09A 3Q49B 4JEHA 5FZRA 4BFRA 3CSFA 3RRMB 5BV0A 1W3BA 3FUDA 3JYSA 3ASHA 4PS8A 4E6HA 2R17C 3ML9A 4V3IA 4I1AA 1SZ9A 3URZA 4F7AA 2PL2A 2KATA 4ILGA 4N3CA 5BNWA 3Q15A 2DCPA 4I6EA 4UWHA 4W9RA 3L17A 3TXNA 5BUZA 1H19A 2I1JA 3AU4A 5LP0A 2R5SA 3HIZA 3KAEA 4N5CA 2WQ6A 5AJLA 4BSXA 3MZLB 4RVBA 1QZ2A 3ASFA 3P2BA 5A7DB 4A1GA 5ARGA 3NQPA 1PC2A 2I6HA 3ML8A 4O6FA 1PY1A 3PREA 5DBKA 3FUNA 3CHQA 3FUEA 3TXMA 1UG3A 2GGFA 2UY1B 4UI9K 4F3VA 2XPYA 3CK7A 4JEUA 4ACKA 4XI9A 1ELRA 3CQCB 3FUJA 3QWPA 1DNPA 3FY4A 1SQMA 2R59A 3IHYA 3ZFWA 5FT9A 2WPVA 3HVEA 2C0MA 4RSYA 2NSZA 5KJMA 4JC8A 3SF4A 4FADA 2X6HA 2XPIA 2A5UA 3JQ1A 5FTPA 5JHAA 3G2TA 4KVOA 4L23A 3SNXA 4B8CB 1EYHA 1OUVA 2VSYA 4DI4A 5LFAA 3EIQC 3R9AB 4UI9C 1JPLA 3FH7A 2UY1A 3ZYMA 3FEXA 2VTBA 3UT8A 1P5QA 4N3BA 5J90A 3BG1B 4QFVA 4UWGA 4GMJA 2NXPA 1H0AA 4HS2A 4XE0A 4Q96A 4H7YA 5D0QD 4ILHB 4CDRA 4OYSA 3ZYKA 1B89A 1IQUA 1BPOA 1HZ4A 4FC8A 1TJCA 3AU5A 1N54A 4UQXA 4ANXA 4CRWA 3JCKC 5T4YA 2MHKA 1MHQA 3QB2A 3ZHEB 1OWOA 1E8ZA 3CVNA 3MKRA 3B7RL 3FULA 3GYZA 3CR3A 4WNEA 4EZJA 5FZQA 2KZTA 1QNFA 1HF8A 4RG6A 4WAFA 4HOUA 5T8IA 3S7BA 4UQZA 1HE8A 4FULA 4KBQA 4FJYA 2V8SE 2E0IA 4LRZA 4UI9J 4CDMA 2WXFA 2IU1A 4PS7A 5G04C 4GPKA 3CVQA 3PUKA 3ENEA 4EZLA 5KJKA 2VSOE 5JJTA 3D9MA 2DIWA 4JZYA 4GZ3A 3S7JA 3R7QA 3TG4A 3RJVA 4I1OB 4NQ0A 4B94A 4DLQA 4HOQA 3QDNA 4HORA 4I1MA 4MLPA 5CMYA 1EDUA 2VGXA 4ABNA 3LY7A 3LKUA 4IULA 1EF1C 3GZSA 3CHPA 4NURA 3UQ3A 3FEYA 4ILIA 4G2VA 3VTXA 3SZ7A 5ANLA 3T8MA 1KLXA 3FDHA 5LCWC 3SBSA 2AWIA 2HYZA 3RO2A 2V4LA 4I2ZA 3OXLA 3BG0B 5JJ6A 4BY6A 5FZSA 4IN3B 5CHEE 5G05C 4BTBA 2QY7A 3ZGQA 2YHCA 3G2SA 3FTYA 3MEKA 3I4GA 2LAIA 4KYOB 2AW6A 4BT9A 4F53A 5CMWA 2WQ7A 3CHRA 3GW4A 1WM5A 4FLBA 4EPZA 4FA6A 3DPDA 3ZN3A 3MYVA 3VTYA 2KCLA 1NP7A 1JUQA 3IHVA 3SHFA 3P1UA 3B7SA 3HVEB 1OWLA 3MKQA 2M63A 2VJ8A 3DBSA 3LDZA 4JW1A 4N39A 2MRIA 2RG8A 3ZW3A 3RK6A 4I2WA 5AIJA 4PUCA 2WXPA 3GZ2A 3OAWA 1U3CA 2BTDA 1IQRA 4BTAA 3D9OA 3ZXSA 3D9NA 3FTXA 2HM8A 1WY6A 2XQ0A 4JA9A 2X38A 4C0MA 2XGOA 4P29A 2LSVA 3CLJA 1ZU2A 4G24A 3I3NA 5T3RA 4AM9A 3Q47B 3ONKA 3O48A 1E96B 4U63A 3LXUX 3C98A 1HU3A 1HG5A 2L6JA 2CG2A 3QARA 1HG2A 4BT8A 2CFZA 1DVPA 1OWPA 3TJPA 2IQCA 4YVQC 3LY8A 3N71A 3SGHA 3RRUA 1UN8A 4GA1A 4YNDA 4C9BB 3CGHA 4I9EA 3FP3A 1E8YA 2AXVA 2J07A 2KC7A 2LAHA 5M72A 3WXXA 4DLOA 3CVLA 3LVRE 4L2LA 4KZCA 1NA3A 2YNQA 2P58C 1S0PA 3CK9A 4KMOA 4TV3A 4JPSA 2KCKA 4EBAG 2IF4A 2YHEA 2ILRA 2JLBA 2WXOA 3CEQA 4I17A 4JVSA 5HI7A 4KZ0A 4HFGA 3CKBA 3RRNB 5HQ8A 4FJZA 1KT0A 2GRLA 4OVVA 2Y4TA 4BX8A 2LSUA 3FUKA 5FJYA 1L5JA 5CCLA 5EX3A 5FQ6A 2AVPA 2FO7A 4AVXA 4D10C 5JHBA 3IV0A 3QK0A 5FWQA 3FTVA 4CT0A 1MQSA 4G1TA 4HLEA 4TUUA 4AJWA 4GA0A 2X3MA 4L1BA 4CCAA 1Z3XA 4J0UA 4EZKA 1HX8A 3EJNA 3FTUA 3LYAA 4FP7A 2PZIA 5LOZA 2VSNA 3MV2B 3QJZA 2HR2A 1FVFA 4I43A 4XKCA 3KS2A 4A55A 3LJ3A 5AJDA 5ENNA 4CDNA 3U66A 3MJWA 3FTWA 3MGBA 2J4BA 3LCAA 4N2SA 2PM7A 1UJKA 3PNLB 4J8DA 3APCA 1SZAA 3RKVA 4TRQA 4AV7A 2VTBB 2ZU6B 3LS8A 3VLFA 4H7XA 2WMOA 2WXGA 3JUIA 2XEVA 4UQYA 3EIJA 2J08A 4AY5A 1JWGA 3ZYQA 4HVBA 5E76A 1XGWA 3B7TA 1N52A 4URKA 2KM4A 3IKOB 4APOA 5AYWD 4U04A 4Y6CA 3FUIA 3NZUA 4GB9A 4LEUA 4WWPA 2XRZA 4UWLA 3FHEA 2WXNA 3ASDA 5KCMA 1Y8MA 1UJJA 3PRZA 3I4RB 5D0OD 5BV1A 3FUFA 5CCMA 2WQHA 3IEGA 4OVUA 4AIFA 4U07A 3ZIMA 3CVWA 4ANUA 3I5PA 1H2TC 3HYMB 3PH0C 3AS4A 5C1DA 3OTNA 4JHRA 2IONA 3QKYA 3AS8A 2WXKA 2XCBA 3QOUA 2OV8A 2OOEA 4XZ4A 4C0EA 2DBAA 3KEZA 4Y6WA 4JL0A 2WXJA 1OWMA 4JHJA 5J08A 3FU5A 3CIAA 1EPUA 3LVQE 3CQGB 4PDXA 3PEVB 4B0ZA 2I9CA 3ZRHA 4DPRA 5G05J 4AY6A 2VSXE 2XGSA 2L0IA 4L7TA 1TEZA 2ONDA 4XKBA 2J9QA 4GZ6A 4KXKB 1E8WA 2C2LA 3MCXA 4J8EA 5LCWJ 2VGYA 3AS5A 4DK5A 3D9IA 1PAQA 3RU0A 3U9WA 2NC9A 3CV0A 3NF1A 4PS3A 5G2NA 3L22A 2WVIA 2IOLA 3CVYA 1JWFA 2CHWA 2FF4A 2VGXB 4GCOA 3PUJA 4F1SA 4XX5A 4J8FA 3ZPJA 2GW1A 3ZVVA 4I6GA 2WM9A 4BWRA 1HXIA 5JJ7A 1ELKA 1E7UA 3K9IA 4GYWA 2FI7A 3FFLA 4FHJA 2OVFA 5EDSA 2I1KA 4CGWA 2Y4UA 2VYIA 5G55A 3Q4AB 4GZCA 4JHKA 2I2OA 3FUHA 5BW8C 3CK8A 3CVXA 4CGVA 3U3WA 4EQFA 3E4BA 3ULQA 2YINA 4L2YA 2KCVA 4I6JA 4APFA 1GW6A 3GZ1A 3PEUB 1XNFA 3FWVA 3CVVA 3CHMA 4XIFA 3MX3A 1H6KA 3ASGA 1UW4B 1ZBPA 3QNKA 4B8AA 5FQ4A 3MV3B 4E85A 1H2VC 3VLEA 2J49A 2LO6A 5A6CA 4A3VA 2Q7FA 2E2EA 2WMNA 4IRUA 3G2WA 2YQ8A 4KVMA 1UN9A 3R7RA 3L54A 4J6IA 4JXTA 5AENA 3MA5A 3TL5A 5EX0A 5KJNA 4GAAA 2XGMA 2C0LA 3IBEA 1NZNA 4UWFA 3L13A 4AEZC 1FCHA 5ANRA 4K0RA 2CFUA 5E75A 3L6AA 4B89A 1LF8A 3ONLA 3QC1A 3ZHEA 5ARFA 2JEKA 4MKTA 4I9CA 4G23A 3B7UX 3EDTB 4G11A 2KZTB 3FTZA 1VDYA 1H2UA 4AXHA 2XCCA 4WNGA 4MS6A 1TJFA 3PE4A 1HH8A 2J4DA 3QWWA 4PH4B 1U3DA 2BUGA 5G04J 3ESKA 3CVUA 4U0ZA 3UUXA 1Y6IA 4HOTA 2VQ2A 2V5FA 3D9JA 4FLHA 2IFUA 2AXZA 3OXFA 2CHZA 2IJGX 3EHMA 3PNTB 3FH8A 4NACA 4J8SA 2WXRA 3SBTB 4A3TA 4ANVA 3ESLA 2WXMA 3QWVA 1E7VA 1FVHA 3UMVA 3APDA 3EHNA 2FBNA 3L08A 4GMLA 4GYYA 4HOSA 4FHKA 3CSTA 3UT7A 5BPPA 3UX4A 3B13A 3SD5A 3VLDA 4IYPA 4M3OA 3TAXA 1IYGA 4EBAA 4ANWA 3KD7A 2WXHA 3PVLA 1ELWA 1Z6TA 2FULA 3FH5A 4WNDA 5DIZA 5KJLA 3CHSA 3Q5MA 1HFAA 3NZSA 4XI0A 2CG3A 3D9LA 3LPZA 3O4ZA 4G25A 4GU5A 5LX8A 3L16A 3ZEFA 2LNIA 4DJAA 1X5BA 2XPZA 3U64A 4ACLA 4N3AA 4AP2A 4HXIA 1E8XA 1KT1A 2PQNA 2WXLA 3OXGA 3QAQA 4GZDA 3PS6A 2AXUA 2PQRA 3FUMA 4AOFA 2X6KA 3PDNA 4KT6B 4Q94A 4LERA 4UWKA 3UT4A 4LUNU 3FU0A 4Q69A 3D9PA 2HO1A 4EECA 4GCNA 2MOWA 4RG9A 2UWJG 2WB2A 3FU3A 4R7LA 1IHGA 3G2UA 4GA2A 4N2QA 3SI5A 2CHXA 2A4ZA 5BT1A 4G26A 4U0UA 3UPVA 4WUYA 4WNFA 1OWNA 2WXIA 1HS6A 4CEMA 2BF0X 1YA0A 5FQ8A 3S7DA 2IOSA 1Z3YA 3HHMA 3ZYLA 4WWOA 2PM6A 3BEEA 4YVOA 2L0TB 3G2VA 3PE3A 3CHOA 4GYOA 5C2YA 3MKQB 4A1SA 5EKQD 4GZ5A 2XRYA 3LY9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN8 A;  3PNL B;  2BTD A;  3CR3 A;  1UN9 A;  4LRZ A; 
#chains in the Genus database with same CATH topology
 2LXM A;  3APF A;  1BLX B;  3CVP A;  2V4H C;  1QYM A;  1MX6 A;  3T5V A;  2QFC A;  2EQX A;  4EHM A;  2L9B A;  1HO8 A;  4CT4 A;  3JQ0 A;  2P9N G;  3DEP A;  4K03 A;  2OVB A;  3CKC A;  3HDX A;  3T5X A;  3SY2 A;  4LNB A;  2GRO B;  2J09 A;  3Q49 B;  1W3B A;  4PS8 A;  4TXQ A;  3ML9 A;  4DRX E;  4V3I A;  3URZ A;  4F7A A;  2PL2 A;  1O5M A;  3AU4 A;  2F8Y A;  5AJL A;  4RVB A;  1QZ2 A;  3P2B A;  4A1G A;  3NQP A;  3PRE A;  3FUN A;  3ULE G;  3UM3 A;  4ACK A;  4XI9 A;  3QWP A;  1SQM A;  5FT9 A;  2WPV A;  4GPM A;  3TWW A;  2NSZ A;  4FAD A;  4HB5 A;  2XPI A;  2A5U A;  3SNX A;  1EYH A;  1OUV A;  5LFA A;  3R9A B;  3JUE A;  2UY1 A;  3ZYM A;  3FEX A;  1KPS B;  3UTM A;  3Q78 A;  4UWG A;  2NXP A;  1H0A A;  4HS2 A;  4XE0 A;  5EN5 D;  4CDR A;  3ZYK A;  3TWR A;  1BPO A;  4FC8 A;  1KZP A;  4YDY A;  4CRW A;  3JCK C;  3C3R A;  4YDE A;  5T4Y A;  2MHK A;  1OWO A;  1E8Z A;  4WNE A;  2KZT A;  4HOU A;  5T8I A;  1FT1 A;  4JZY A;  4GZ3 A;  3TG4 A;  3RJV A;  4I1O B;  4NQ0 A;  5D66 A;  4HOQ A;  5CMY A;  3Q79 A;  3FEY A;  3D9H A;  3VTX A;  3SZ7 A;  3SBS A;  2V4L A;  4I2Z A;  3BG0 B;  5FZS A;  1RW2 A;  3ZGQ A;  3MEK A;  4BT9 A;  5CMW A;  2WQ7 A;  3CHR A;  3GW4 A;  4EPZ A;  4FA6 A;  3DPD A;  3MYV A;  1DCQ A;  3RK6 A;  4PUC A;  1MJ0 A;  2XQ0 A;  1WY6 A;  4JA9 A;  2X38 A;  3AG3 E;  3CLJ A;  5T3R A;  2ZXW E;  1E96 B;  3LXU X;  1AP7 A;  2CFZ A;  3N71 A;  4YND A;  3Q7A A;  3HRA A;  1H6P A;  3FP3 A;  1E8Y A;  3WXX A;  3CVL A;  3IXE A;  5HI7 A;  4KZ0 A;  4HFG A;  3RRN B;  2GRL A;  4BX8 A;  1L5J A;  5CCL A;  5IY5 E;  2H6H A;  4AJW A;  4GA0 A;  2X3M A;  3SQV A;  4EZK A;  1HX8 A;  3EJN A;  3MV2 B;  3LJ3 A;  5AJD A;  5ENN A;  3MJW A;  3FTW A;  4HRM B;  3EHR A;  5KNG A;  2LXL A;  4U8V D;  3PNL B;  2J8S D;  4TRQ A;  4AV7 A;  3W9F A;  2WMO A;  4J7W A;  1JWG A;  3B7T A;  4HRL A;  4APO A;  4U04 A;  3FUI A;  4LEU A;  4WWP A;  3X2Q E;  1UJJ A;  2WQH A;  1H2T C;  4OAV B;  5C1D A;  3OTN A;  4JHR A;  4UUC A;  3AS8 A;  4GTS A;  3T9K A;  2GRR B;  2OOE A;  4XZ4 A;  2XEH A;  4JHJ A;  1EPU A;  5EID A;  3LVQ E;  4GMR A;  4DPR A;  2L0I A;  1OY3 D;  3AAA C;  4XKB A;  2J9Q A;  4J8E A;  2VGY A;  4DK5 A;  1PAQ A;  5G2N A;  3HXF A;  3L22 A;  2IOL A;  1JWF A;  2CHW A;  2FF4 A;  4GCO A;  4J8F A;  3ZPJ A;  3ZVV A;  5JJ7 A;  1E7U A;  2OVF A;  2I2O A;  3E4B A;  3UIO C;  3PZ3 A;  1GW6 A;  5ENT D;  3FWV A;  4MBG A;  3CHM A;  4XIF A;  1H6K A;  1N0R A;  1ZBP A;  4E85 A;  4O1O A;  5A6C A;  2Q7F A;  4G8K A;  4KVM A;  4NIK A;  4Z68 A;  3R7R A;  3JXI A;  4JXT A;  1V54 E;  4GAA A;  2H6G A;  2C0L A;  3HXC A;  3ISM C;  4K0R A;  2CFU A;  5E75 A;  1AWC B;  3PZ2 A;  2R03 A;  4G11 A;  4CZ2 D;  3RSE G;  2J4D A;  3QWW A;  4PH4 B;  5G04 J;  3CVU A;  5BXO A;  3OXF A;  3HG0 D;  2IJG X;  5D2M C;  3FH8 A;  4NAC A;  4A63 B;  1MX2 A;  4M7C A;  4A3T A;  3ESL A;  4DUI A;  1D8E A;  1E7V A;  3UMV A;  3APD A;  3EHN A;  3L08 A;  4JB8 P;  4FHK A;  2XEE A;  3VLD A;  4U7E B;  4ANW A;  1Z6T A;  1YMP A;  3FH5 A;  5DIZ A;  3NZS A;  4XI0 A;  2MYO A;  3O4Z A;  4GU5 A;  2ZGG A;  4AP2 A;  2X6K A;  5KNH D;  4GCN A;  2WB2 A;  1MX4 A;  3UPV A;  1N9A A;  1HS6 A;  4CEM A;  2VGE A;  1WDY A;  3S7D A;  1S64 A;  2PM6 A;  3BEE A;  4YVO A;  3CHO A;  4GZ5 A;  5JJT A;  1NI1 A;  5KBA A;  2X6I A;  3S7F A;  3LJN A;  4FU3 A;  3V30 A;  3PZD A;  1QQE A;  2XEN A;  2V0P A;  1A17 A;  2WXQ A;  3U4T A;  3FTS A;  5CER B;  1NA0 A;  2Y3A A;  4BFR A;  2P9L G;  3FUD A;  2FO1 E;  2R17 C;  4I1A A;  2EIN E;  2KAT A;  3Q15 A;  4W9R A;  1A5E A;  3TWU A;  1NFI E;  1U2V G;  5ARG A;  4O6F A;  3ML8 A;  1BU9 A;  1SW6 A;  4K5C A;  2XPY A;  3CK7 A;  4JEU A;  3T8K A;  3CQC B;  3FY4 A;  2R59 A;  3ZFW A;  3HVE A;  4JC8 A;  3W9G A;  5FTP A;  3G2T A;  4KVO A;  4L23 A;  3NOC D;  2EIL E;  2R05 A;  4UI9 C;  3FH7 A;  1V55 E;  3UT8 A;  1P5Q A;  4QFV A;  4GMJ A;  5AQ7 A;  3BU8 A;  4Q96 A;  4H7Y A;  4ILH B;  4OYS A;  1LD7 A;  1IQU A;  1TJC A;  4UQX A;  4OAU C;  1MHQ A;  3QB2 A;  3MKR A;  3B7R L;  1DCE A;  3CR3 A;  5FZQ A;  5HS0 A;  3Q7F A;  4RG6 A;  4WAF A;  3S7B A;  1HE8 A;  4FUL A;  4KBQ A;  4FJY A;  3ENE A;  2VSO E;  2H6I A;  3D9M A;  4GTR A;  4MLP A;  1EDU A;  4IUL A;  3GZS A;  4NUR A;  3UQ3 A;  4ILI A;  5ANL A;  5LCW C;  1KLX A;  4LSZ E;  3RO2 A;  3Q75 A;  2AJA A;  3V79 K;  5G05 C;  4IN3 B;  2QY7 A;  3G2S A;  3Q9U C;  5EIL A;  1TYQ G;  2LAI A;  4F53 A;  4FLB A;  3ZN3 A;  5B1A E;  2KCL A;  4O1P A;  3HVE B;  1OWL A;  1Q2Z A;  5HKP A;  2M63 A;  2VJ8 A;  4JW1 A;  2BKK B;  2RG8 A;  3Q9N C;  2WXP A;  3OAW A;  1U3C A;  1K8K G;  1N11 A;  2LSV A;  3DSV A;  3ONK A;  1OCZ E;  5ENQ D;  1HU3 A;  1HG5 A;  2L6J A;  2CG2 A;  1DVP A;  1NL4 A;  3TJP A;  3RAU A;  4C9B B;  3CGH A;  4I9E A;  1O1T A;  1QBQ A;  5M72 A;  4KZC A;  1S0P A;  2YHE A;  2JLB A;  3CEQ A;  4I17 A;  4JVS A;  4BEP A;  3E32 A;  5HQ8 A;  1BD8 A;  3UXG A;  5FJY A;  2FO7 A;  4AVX A;  4CT0 A;  1MQS A;  4G1T A;  3ASN E;  2H6F A;  1Z3X A;  4J0U A;  4FP7 A;  2PZI A;  3QJZ A;  4I43 A;  4XKC A;  4A55 A;  2RFM A;  3RKV A;  1LTX A;  4H7X A;  2WXG A;  2XEV A;  4UQY A;  3UKU G;  3EIJ A;  4HVB A;  3ULY A;  2KM4 A;  2GRN B;  5AYW D;  4GB9 A;  2XRZ A;  4UWL A;  1Y8M A;  3PRZ A;  5BV1 A;  4OVU A;  3CVW A;  3HYM B;  2ION A;  3QOU A;  2OV8 A;  4C0E A;  2DBA A;  2RFA A;  4JL0 A;  3CIA A;  4PDX A;  3PEV B;  4AY6 A;  5G05 J;  2XGS A;  4L7T A;  2DYS E;  4JD2 G;  1E8W A;  2C2L A;  3JXJ A;  5LCW J;  3D9I A;  3NF1 A;  2VGX B;  1JCR A;  4GTP A;  4FHJ A;  5EDS A;  4CGW A;  5G55 A;  1WG0 A;  4HRN A;  4ATZ D;  1BI8 B;  2KCV A;  4APF A;  4K5A B;  3CVV A;  3ASG A;  4BES A;  1UW4 B;  2LO6 A;  4A3V A;  2YQ8 A;  2P9U G;  1UN9 A;  3L54 A;  5EX0 A;  3IBE A;  2ETC A;  3EUV A;  4UWF A;  3Q73 A;  4AEZ C;  5ANR A;  2KXP C;  4B89 A;  1FT2 A;  2JEK A;  2BKG A;  2P2C P;  3FTZ A;  3ABK E;  2XCC A;  3PE4 A;  1HH8 A;  1LD8 A;  3DWL G;  2BUG A;  4GTT A;  5AAR A;  1K1A A;  4U0Z A;  1Y6I A;  5ENR D;  5AN8 A;  3D9J A;  1DC2 A;  2IFU A;  2CHZ A;  2WXR A;  5AQ9 A;  2EIK E;  4GML A;  4GYY A;  2FBN A;  3CST A;  3B7B A;  3UX4 A;  4IYP A;  4M3O A;  5KJL A;  4WND A;  3Q5M A;  2B0O E;  4C48 B;  3LPZ A;  4G25 A;  5LX8 A;  3L16 A;  3C72 A;  4DJA A;  1X5B A;  4HXI A;  1E8X A;  2PQN A;  3OXG A;  3PS6 A;  3FUM A;  2PQR A;  4Q94 A;  3UT4 A;  2IO2 C;  4LER A;  4UWK A;  4LUN U;  3FU0 A;  4Q69 A;  3D9P A;  3KEA A;  2OEW A;  3C3O A;  4B93 B;  4G26 A;  2WXI A;  2BF0 X;  1MYO A;  4WWO A;  3WG7 E;  5ITZ F;  2Y0B G;  3TG5 A;  2IO3 C;  4WWN A;  1INZ A;  3D9K A;  4U0S A;  4LCT A;  4DX5 D;  4ME2 A;  3BQO A;  3D3M A;  2XZD G;  4NRH B;  5A23 A;  4JA7 A;  3UIP C;  3RO3 A;  3DXM G;  3V2X A;  3LEW A;  4MRU A;  1E90 A;  4U8H A;  3FU6 A;  2B6C A;  4JEH A;  5FZR A;  3RRM B;  3JYS A;  1FPP A;  1SZ9 A;  4ILG A;  5BNW A;  3TXN A;  2DCP A;  4UWH A;  1H19 A;  3ABM E;  2WQ6 A;  4K5B A;  3NOG D;  4BSX A;  3MZL B;  5ENP D;  3ASF A;  5A7D B;  1PC2 A;  2I6H A;  3TXM A;  2LUH A;  1UG3 A;  2GGF A;  1N4R A;  1TNZ A;  1S63 A;  4F3V A;  2ETB A;  2F0Y A;  4GTO A;  3IHY A;  3DST A;  4RSY A;  5KJM A;  3SF4 A;  3JQ1 A;  5JHA A;  2F8X K;  4B8C B;  3SFX A;  3UIN C;  1JPL A;  2VTB A;  1JCS A;  3BG1 B;  2QYU A;  5D0Q D;  1D8D A;  3B95 A;  3AU5 A;  4ANX A;  1N54 A;  1BI7 B;  4YDW A;  1TNU A;  4L9P A;  1QNF A;  1HF8 A;  3E33 A;  4UQZ A;  2GRP B;  4LRZ A;  4RQI A;  4UI9 J;  5ENO D;  2IU1 A;  3E37 A;  4PS7 A;  4GPK A;  1H6O A;  3S7J A;  3TWQ A;  4B94 A;  4DLQ A;  4HOR A;  4I1M A;  5HRY A;  4ABN A;  5KWD A;  3LKU A;  1EF1 C;  3CHP A;  3FDH A;  2AWI A;  2HYZ A;  3PZ1 A;  5JJ6 A;  4BY6 A;  5CHE E;  5AQB A;  3FTY A;  3J5Q B;  3I4G A;  4KYO B;  3E30 A;  5FIO A;  2XS1 A;  3VTY A;  1NP7 A;  3IHV A;  3P1U A;  5B1B E;  4TXR A;  2DWZ A;  3DXK G;  3ZW3 A;  5AIJ A;  2BTD A;  1IQR A;  3FTX A;  2HM8 A;  4C0M A;  1UOH A;  2ZGD A;  4P29 A;  1ZU2 A;  3I3N A;  4AM9 A;  3O48 A;  4U63 A;  3C98 A;  4BT8 A;  1OWP A;  2QYJ A;  4YVQ C;  3SGH A;  3RRU A;  1UN8 A;  4GA1 A;  3C3Q A;  3SO8 A;  2J07 A;  2KC7 A;  2BED A;  1NA3 A;  2YNQ A;  3CK9 A;  3V31 A;  2ILR A;  2WXO A;  3HXE A;  1O1R A;  2Y4T A;  3FUK A;  5EX3 A;  2AVP A;  5JHB A;  3QK0 A;  5FWQ A;  4HLE A;  4L1B A;  4CCA A;  3EHQ A;  2HR2 A;  4CDN A;  3KS2 A;  3U66 A;  1G3N B;  2J4B A;  3LCA A;  4N2S A;  4GTV A;  1UJK A;  1SZA A;  4G8L A;  3LS8 A;  4TUM A;  2OEV A;  3HXB A;  4GTQ A;  3J5P A;  3DSS A;  4URK A;  4QQI A;  3UM1 A;  3IKO B;  2EIM E;  4Y6C A;  1JCQ A;  3NZU A;  3FHE A;  3ASD A;  2V5Q C;  4RLY A;  3FUF A;  3IEG A;  4AIF A;  1IKN D;  4ANU A;  3I5P A;  3AS4 A;  3QKY A;  3KSL A;  1TN7 A;  2WXK A;  2XCB A;  3NBN B;  5H7P A;  4ZHB A;  1TN6 A;  2P9K G;  5J08 A;  3L9T A;  4B0Z A;  3ZRH A;  2DZN A;  2OND A;  3MCX A;  3DSX A;  3U9W A;  2NC9 A;  3CV0 A;  1IHB A;  3CVY A;  1TNY A;  4F1S A;  2WM9 A;  4BWR A;  3K9I A;  4GYW A;  2I1K A;  2Y4U A;  2VYI A;  3Q4A B;  4JHK A;  3FUH A;  2EIJ E;  3CK8 A;  5BW8 C;  3CVX A;  4CGV A;  3ULQ A;  2YIN A;  3UI2 A;  4I6J A;  3GZ1 A;  3DSW A;  3PEU B;  4N5Q A;  5CEA A;  3MX3 A;  4LNG A;  3QNK A;  4B8A A;  4ZFH A;  1H2V C;  2WMN A;  3G2W A;  3MA5 A;  2P9I G;  3ASO E;  1NZN A;  5CEC B;  3AG4 E;  1FCH A;  4F1P A;  2KBX A;  3L82 A;  3ONL A;  3QC1 A;  3ZHE A;  2HE0 A;  4I9C A;  4G23 A;  3B7U X;  4HBD A;  1VDY A;  1H2U A;  4AXH A;  4WNG A;  1TR4 A;  1TJF A;  1D9S A;  3DRA A;  4DX7 D;  2XZT G;  3UUX A;  1K1B A;  3EU9 A;  4HOT A;  2V5F A;  2AXZ A;  3EHM A;  4HLL A;  3PNT B;  3SBT B;  2WXM A;  3QWV A;  3E34 A;  4HOS A;  1TNB A;  3UT7 A;  1SA4 A;  3F6Q A;  3SD5 A;  3TAX A;  1IYG A;  2WXH A;  3CHS A;  3TWS A;  2QC9 A;  3D9L A;  3ZEF A;  4HNA D;  4N3A A;  1KT1 A;  4BSZ B;  4GZD A;  3QAQ A;  2AXU A;  4KT6 B;  2IEJ A;  3DEO A;  2HO1 A;  2MOW A;  4RG9 A;  4R7L A;  1IHG A;  3G2U A;  3SI5 A;  2CHX A;  2A4Z A;  5BT1 A;  2DZO A;  4WUY A;  4WNF A;  4J8Y A;  1OWN A;  3EU5 A;  1YA0 A;  1Z3Y A;  2Y1L E;  3HHM A;  3ZKJ A;  3G2V A;  3PE3 A;  4GYO A;  3MKQ B;  5EKQ D;  4CYM D;  2XRY A;  3LY9 A;  4DI3 A;  1O1S A;  3S2A A;  5FQ7 A;  2X6F A;  4X8Q A;  1WAO 1;  2RD0 A;  2FEZ A;  4ATG A;  3PZ4 A;  3UM2 A;  2XHE A;  3RIB A;  2GRM A;  3SFZ A;  4YDO A;  4BX9 A;  2X6J A;  3CSF A;  5BV0 A;  1N4S A;  3ASH A;  4E6H A;  2ETA A;  3TGO A;  4N3C A;  5BUZ A;  4I6E A;  4HI9 A;  3L17 A;  1TNO A;  3AG2 E;  2I1J A;  5LP0 A;  2R5S A;  3HIZ A;  3KAE A;  4N5C A;  3SFY A;  5DBK A;  1PY1 A;  3FUE A;  3CHQ A;  2UY1 B;  3HXD A;  2JAB A;  4UI9 K;  1SA5 A;  5FIN A;  1ZB1 A;  1ELR A;  3FUJ A;  3TWX A;  4U95 D;  1DNP A;  2C0M A;  1OCC E;  5BXU A;  2X6H A;  2VSY A;  4DI4 A;  2NYJ A;  3EIQ C;  4U96 D;  5EYL A;  4N3B A;  5J90 A;  1B89 A;  1HZ4 A;  2Y69 E;  3ZHE B;  3CVN A;  3FUL A;  3GYZ A;  4EZJ A;  3ZUV B;  5CRV A;  2V8S E;  2E0I A;  1RZ4 A;  4CDM A;  2WXF A;  5G04 C;  3CVQ A;  3DSU A;  3PUK A;  4TXP A;  4EZL A;  5KJK A;  2DIW A;  1KZO A;  3R7Q A;  4DX1 A;  4BER A;  3QDN A;  3TWT A;  2VGX A;  3LY7 A;  4G2V A;  3T8M A;  1S70 B;  3NB2 A;  3OXL A;  4BTB A;  2ZIS A;  2YHC A;  2R2L A;  2AW6 A;  4XEI G;  1WM5 A;  4O60 A;  1JUQ A;  3SHF A;  3B7S A;  3MKQ A;  4LNU D;  3DBS A;  3LDZ A;  3TWV A;  4N39 A;  2MRI A;  4I2W A;  1K3Z D;  3AJI A;  3GZ2 A;  4BTA A;  4DX2 A;  3D9O A;  3ZXS A;  3D9N A;  2P9P G;  5CBO A;  2XGO A;  2R02 A;  4G24 A;  3Q47 B;  1IXV A;  1OXJ A;  3QAR A;  2XS8 A;  1HG2 A;  3R9M A;  2IQC A;  5CRU A;  3LY8 A;  3ZXP A;  2AXV A;  2L6B A;  2LAH A;  4DLO A;  3LVR E;  4L2L A;  2P58 C;  4KMO A;  5CBN A;  4TV3 A;  4JPS A;  2KCK A;  4EBA G;  2IF4 A;  1OT8 A;  3CKB A;  4FJZ A;  1KT0 A;  4OVV A;  3UKR G;  2LSU A;  5FQ6 A;  4D10 C;  3V2O A;  3IV0 A;  3FTV A;  4TUU A;  3FTU A;  2A5E A;  3LYA A;  3ZNG A;  5LOZ A;  2VSN A;  1FVF A;  3MGB A;  2P9S G;  2ZIR A;  2PM7 A;  4J8D A;  3APC A;  2VTB B;  2ZU6 B;  3VLF A;  3JUI A;  3NAW A;  3DPY A;  2J08 A;  4AY5 A;  2IY0 C;  3ZYQ A;  5E76 A;  1XGW A;  2RKK A;  1N52 A;  3C5R A;  1YYH A;  1MZC A;  5CED B;  5AQA A;  2WXN A;  5KCM A;  3I4R B;  5D0O D;  5CCM A;  3ZIM A;  4U07 A;  3PH0 C;  4GTM A;  3KEZ A;  4Y6W A;  5JMN D;  2WXJ A;  1OWM A;  4U8Y D;  3FU5 A;  1N4Q A;  3CQG B;  2I9C A;  2VSX E;  1TEZ A;  4KXK B;  4GZ6 A;  1OCR E;  3AS5 A;  3KSQ A;  4LG6 A;  3RU0 A;  4PS3 A;  2WVI A;  3PUJ A;  4XX5 A;  2GW1 A;  4I6G A;  1HXI A;  1ELK A;  1N0Q A;  2FI7 A;  3FFL A;  4GZC A;  2DVW A;  2GRQ B;  3U3W A;  4EQF A;  4L2Y A;  1XNF A;  4BET A;  4HI8 A;  5B3S E;  1TN8 A;  3MV3 B;  5FQ4 A;  4DX6 D;  3VLE A;  2J49 A;  1N4P A;  2E2E A;  4IRU A;  5AAO A;  4J6I A;  5AEN A;  3TL5 A;  5ENS D;  5KJN A;  3ABL E;  2XGM A;  2F37 A;  2DYR E;  3L13 A;  3L6A A;  1LF8 A;  4F6R D;  5ARF A;  4MKT A;  1N95 A;  3EDT B;  2KZT B;  2OCC E;  4MS6 A;  3BUA A;  1U3D A;  3ESK A;  3ZU7 B;  4HQD A;  2VQ2 A;  4FLH A;  4J8S A;  1OCO E;  4ANV A;  1FVH A;  5EYP F;  5BPP A;  3B13 A;  3AG1 E;  4EBA A;  3KD7 A;  3PVL A;  1ELW A;  1Z5S C;  2FUL A;  3UM0 A;  1HFA A;  2CG3 A;  2PNN A;  2LNI A;  2XPZ A;  3U64 A;  4ACL A;  2WXL A;  4AOF A;  3PDN A;  4EEC A;  5EIB E;  2QZA A;  1N94 A;  2UWJ G;  3FU3 A;  4GA2 A;  4N2Q A;  1YCS B;  4U0U A;  5JA4 D;  5FQ8 A;  2IOS A;  3ZYL A;  2L0T B;  1X81 A;  5C2Y A;  4A1S A;  1SVX A; 
#chains in the Genus database with same CATH homology
 3TG5 A;  3TGO A;  3APF A;  4DI3 A;  2X6I A;  3S7F A;  3CVP A;  3S2A A;  4WWN A;  3T5V A;  3D9K A;  2QFC A;  4FU3 A;  1INZ A;  4U0S A;  2EQX A;  3PZD A;  4LCT A;  2L9B A;  5FQ7 A;  1HO8 A;  1QQE A;  2X6F A;  4ME2 A;  4CT4 A;  3D3M A;  1WAO 1;  2RD0 A;  2FEZ A;  4NRH B;  4JA7 A;  4ATG A;  2V0P A;  3RO3 A;  5A23 A;  3JQ0 A;  3LEW A;  4MRU A;  1E90 A;  1A17 A;  2XHE A;  4K03 A;  2WXQ A;  3RIB A;  2OVB A;  2GRM A;  3CKC A;  3SFZ A;  3FTS A;  3HDX A;  3U4T A;  4U8H A;  3T5X A;  3FU6 A;  1NA0 A;  4BX9 A;  2Y3A A;  2X6J A;  2J09 A;  3Q49 B;  4JEH A;  5FZR A;  4BFR A;  3CSF A;  3RRM B;  5BV0 A;  1W3B A;  3FUD A;  3JYS A;  3ASH A;  4PS8 A;  4E6H A;  2R17 C;  3ML9 A;  4V3I A;  4I1A A;  1SZ9 A;  3URZ A;  4F7A A;  2PL2 A;  2KAT A;  4ILG A;  4N3C A;  5BNW A;  3Q15 A;  2DCP A;  4I6E A;  4UWH A;  4W9R A;  3L17 A;  3TXN A;  5BUZ A;  1H19 A;  2I1J A;  3AU4 A;  5LP0 A;  2R5S A;  3HIZ A;  3KAE A;  4N5C A;  2WQ6 A;  5AJL A;  4BSX A;  3MZL B;  4RVB A;  1QZ2 A;  3ASF A;  3P2B A;  5A7D B;  4A1G A;  5ARG A;  3NQP A;  1PC2 A;  2I6H A;  3ML8 A;  4O6F A;  1PY1 A;  3PRE A;  5DBK A;  3FUN A;  3CHQ A;  3FUE A;  3TXM A;  1UG3 A;  2GGF A;  2UY1 B;  4UI9 K;  4F3V A;  2XPY A;  3CK7 A;  4JEU A;  4ACK A;  4XI9 A;  1ELR A;  3CQC B;  3FUJ A;  3QWP A;  1DNP A;  3FY4 A;  1SQM A;  2R59 A;  3IHY A;  3ZFW A;  5FT9 A;  2WPV A;  3HVE A;  2C0M A;  4RSY A;  2NSZ A;  5KJM A;  4JC8 A;  3SF4 A;  4FAD A;  2X6H A;  2XPI A;  2A5U A;  3JQ1 A;  5FTP A;  5JHA A;  3G2T A;  4KVO A;  4L23 A;  3SNX A;  4B8C B;  1EYH A;  1OUV A;  2VSY A;  4DI4 A;  5LFA A;  3EIQ C;  3R9A B;  4UI9 C;  1JPL A;  3FH7 A;  2UY1 A;  3ZYM A;  3FEX A;  2VTB A;  3UT8 A;  1P5Q A;  4N3B A;  5J90 A;  3BG1 B;  4QFV A;  4UWG A;  4GMJ A;  2NXP A;  1H0A A;  4HS2 A;  4XE0 A;  4Q96 A;  4H7Y A;  5D0Q D;  4ILH B;  4CDR A;  4OYS A;  3ZYK A;  1B89 A;  1IQU A;  1BPO A;  1HZ4 A;  4FC8 A;  1TJC A;  3AU5 A;  1N54 A;  4UQX A;  4ANX A;  4CRW A;  3JCK C;  5T4Y A;  2MHK A;  1MHQ A;  3QB2 A;  3ZHE B;  1OWO A;  1E8Z A;  3CVN A;  3MKR A;  3B7R L;  3FUL A;  3GYZ A;  3CR3 A;  4WNE A;  4EZJ A;  5FZQ A;  2KZT A;  1QNF A;  1HF8 A;  4RG6 A;  4WAF A;  4HOU A;  5T8I A;  3S7B A;  4UQZ A;  1HE8 A;  4FUL A;  4KBQ A;  4FJY A;  2V8S E;  2E0I A;  4LRZ A;  4UI9 J;  4CDM A;  2WXF A;  2IU1 A;  4PS7 A;  5G04 C;  4GPK A;  3CVQ A;  3PUK A;  3ENE A;  4EZL A;  5KJK A;  2VSO E;  5JJT A;  3D9M A;  2DIW A;  4JZY A;  4GZ3 A;  3S7J A;  3R7Q A;  3TG4 A;  3RJV A;  4I1O B;  4NQ0 A;  4B94 A;  4DLQ A;  4HOQ A;  3QDN A;  4HOR A;  4I1M A;  4MLP A;  5CMY A;  1EDU A;  2VGX A;  4ABN A;  3LY7 A;  3LKU A;  4IUL A;  1EF1 C;  3GZS A;  3CHP A;  4NUR A;  3UQ3 A;  3FEY A;  4ILI A;  4G2V A;  3VTX A;  3SZ7 A;  5ANL A;  3T8M A;  1KLX A;  3FDH A;  5LCW C;  3SBS A;  2AWI A;  2HYZ A;  3RO2 A;  2V4L A;  4I2Z A;  3OXL A;  3BG0 B;  5JJ6 A;  4BY6 A;  5FZS A;  4IN3 B;  5CHE E;  5G05 C;  4BTB A;  2QY7 A;  3ZGQ A;  2YHC A;  3G2S A;  3FTY A;  3MEK A;  3I4G A;  2LAI A;  4KYO B;  2AW6 A;  4BT9 A;  4F53 A;  5CMW A;  2WQ7 A;  3CHR A;  3GW4 A;  1WM5 A;  4FLB A;  4EPZ A;  4FA6 A;  3DPD A;  3ZN3 A;  3MYV A;  3VTY A;  2KCL A;  1NP7 A;  1JUQ A;  3IHV A;  3SHF A;  3P1U A;  3B7S A;  3HVE B;  1OWL A;  3MKQ A;  2M63 A;  2VJ8 A;  3DBS A;  3LDZ A;  4JW1 A;  4N39 A;  2MRI A;  2RG8 A;  3ZW3 A;  3RK6 A;  4I2W A;  5AIJ A;  4PUC A;  2WXP A;  3GZ2 A;  3OAW A;  1U3C A;  2BTD A;  1IQR A;  4BTA A;  3D9O A;  3ZXS A;  3D9N A;  3FTX A;  2HM8 A;  1WY6 A;  2XQ0 A;  4JA9 A;  2X38 A;  4C0M A;  2XGO A;  4P29 A;  2LSV A;  3CLJ A;  1ZU2 A;  4G24 A;  3I3N A;  5T3R A;  4AM9 A;  3Q47 B;  3ONK A;  3O48 A;  1E96 B;  4U63 A;  3LXU X;  3C98 A;  1HU3 A;  1HG5 A;  2L6J A;  2CG2 A;  3QAR A;  1HG2 A;  4BT8 A;  2CFZ A;  1DVP A;  1OWP A;  3TJP A;  2IQC A;  4YVQ C;  3LY8 A;  3N71 A;  3SGH A;  3RRU A;  1UN8 A;  4GA1 A;  4YND A;  4C9B B;  3CGH A;  4I9E A;  3FP3 A;  1E8Y A;  2AXV A;  2J07 A;  2KC7 A;  2LAH A;  5M72 A;  3WXX A;  4DLO A;  3CVL A;  3LVR E;  4L2L A;  4KZC A;  1NA3 A;  2YNQ A;  2P58 C;  1S0P A;  3CK9 A;  4KMO A;  4TV3 A;  4JPS A;  2KCK A;  4EBA G;  2IF4 A;  2YHE A;  2ILR A;  2JLB A;  2WXO A;  3CEQ A;  4I17 A;  4JVS A;  5HI7 A;  4KZ0 A;  4HFG A;  3CKB A;  3RRN B;  5HQ8 A;  4FJZ A;  1KT0 A;  2GRL A;  4OVV A;  2Y4T A;  4BX8 A;  2LSU A;  3FUK A;  5FJY A;  1L5J A;  5CCL A;  5EX3 A;  5FQ6 A;  2AVP A;  2FO7 A;  4AVX A;  4D10 C;  5JHB A;  3IV0 A;  3QK0 A;  5FWQ A;  3FTV A;  4CT0 A;  1MQS A;  4G1T A;  4HLE A;  4TUU A;  4AJW A;  4GA0 A;  2X3M A;  4L1B A;  4CCA A;  1Z3X A;  4J0U A;  4EZK A;  1HX8 A;  3EJN A;  3FTU A;  3LYA A;  4FP7 A;  2PZI A;  5LOZ A;  2VSN A;  3MV2 B;  3QJZ A;  2HR2 A;  1FVF A;  4I43 A;  4XKC A;  3KS2 A;  4A55 A;  3LJ3 A;  5AJD A;  5ENN A;  4CDN A;  3U66 A;  3MJW A;  3FTW A;  3MGB A;  2J4B A;  3LCA A;  4N2S A;  2PM7 A;  1UJK A;  3PNL B;  4J8D A;  3APC A;  1SZA A;  3RKV A;  4TRQ A;  4AV7 A;  2VTB B;  2ZU6 B;  3LS8 A;  3VLF A;  4H7X A;  2WMO A;  2WXG A;  3JUI A;  2XEV A;  4UQY A;  3EIJ A;  2J08 A;  4AY5 A;  1JWG A;  3ZYQ A;  4HVB A;  5E76 A;  1XGW A;  3B7T A;  1N52 A;  4URK A;  2KM4 A;  3IKO B;  4APO A;  5AYW D;  4U04 A;  4Y6C A;  3FUI A;  3NZU A;  4GB9 A;  4LEU A;  4WWP A;  2XRZ A;  4UWL A;  3FHE A;  2WXN A;  3ASD A;  5KCM A;  1Y8M A;  1UJJ A;  3PRZ A;  3I4R B;  5D0O D;  5BV1 A;  3FUF A;  5CCM A;  2WQH A;  3IEG A;  4OVU A;  4AIF A;  4U07 A;  3ZIM A;  3CVW A;  4ANU A;  3I5P A;  1H2T C;  3HYM B;  3PH0 C;  3AS4 A;  5C1D A;  3OTN A;  4JHR A;  2ION A;  3QKY A;  3AS8 A;  2WXK A;  2XCB A;  3QOU A;  2OV8 A;  2OOE A;  4XZ4 A;  4C0E A;  2DBA A;  3KEZ A;  4Y6W A;  4JL0 A;  2WXJ A;  1OWM A;  4JHJ A;  5J08 A;  3FU5 A;  3CIA A;  1EPU A;  3LVQ E;  3CQG B;  4PDX A;  3PEV B;  4B0Z A;  2I9C A;  3ZRH A;  4DPR A;  5G05 J;  4AY6 A;  2VSX E;  2XGS A;  2L0I A;  4L7T A;  1TEZ A;  2OND A;  4XKB A;  2J9Q A;  4GZ6 A;  4KXK B;  1E8W A;  2C2L A;  3MCX A;  4J8E A;  5LCW J;  2VGY A;  3AS5 A;  4DK5 A;  3D9I A;  1PAQ A;  3RU0 A;  3U9W A;  2NC9 A;  3CV0 A;  3NF1 A;  4PS3 A;  5G2N A;  3L22 A;  2WVI A;  2IOL A;  3CVY A;  1JWF A;  2CHW A;  2FF4 A;  2VGX B;  4GCO A;  3PUJ A;  4F1S A;  4XX5 A;  4J8F A;  3ZPJ A;  2GW1 A;  3ZVV A;  4I6G A;  2WM9 A;  4BWR A;  1HXI A;  5JJ7 A;  1ELK A;  1E7U A;  3K9I A;  4GYW A;  2FI7 A;  3FFL A;  4FHJ A;  2OVF A;  5EDS A;  2I1K A;  4CGW A;  2Y4U A;  2VYI A;  5G55 A;  3Q4A B;  4GZC A;  4JHK A;  2I2O A;  3FUH A;  5BW8 C;  3CK8 A;  3CVX A;  4CGV A;  3U3W A;  4EQF A;  3E4B A;  3ULQ A;  2YIN A;  4L2Y A;  2KCV A;  4I6J A;  4APF A;  1GW6 A;  3GZ1 A;  3PEU B;  1XNF A;  3FWV A;  3CVV A;  3CHM A;  4XIF A;  3MX3 A;  1H6K A;  3ASG A;  1UW4 B;  1ZBP A;  3QNK A;  4B8A A;  5FQ4 A;  3MV3 B;  4E85 A;  1H2V C;  3VLE A;  2J49 A;  2LO6 A;  5A6C A;  4A3V A;  2Q7F A;  2E2E A;  2WMN A;  4IRU A;  3G2W A;  2YQ8 A;  4KVM A;  1UN9 A;  3R7R A;  3L54 A;  4J6I A;  4JXT A;  5AEN A;  3MA5 A;  3TL5 A;  5EX0 A;  5KJN A;  4GAA A;  2XGM A;  2C0L A;  3IBE A;  1NZN A;  4UWF A;  3L13 A;  4AEZ C;  1FCH A;  5ANR A;  4K0R A;  2CFU A;  5E75 A;  3L6A A;  4B89 A;  1LF8 A;  3ONL A;  3QC1 A;  3ZHE A;  5ARF A;  2JEK A;  4MKT A;  4I9C A;  4G23 A;  3B7U X;  3EDT B;  4G11 A;  2KZT B;  3FTZ A;  1VDY A;  1H2U A;  4AXH A;  2XCC A;  4WNG A;  4MS6 A;  1TJF A;  3PE4 A;  1HH8 A;  2J4D A;  3QWW A;  4PH4 B;  1U3D A;  2BUG A;  5G04 J;  3ESK A;  3CVU A;  4U0Z A;  3UUX A;  1Y6I A;  4HOT A;  2VQ2 A;  2V5F A;  3D9J A;  4FLH A;  2IFU A;  2AXZ A;  3OXF A;  2CHZ A;  2IJG X;  3EHM A;  3PNT B;  3FH8 A;  4NAC A;  4J8S A;  2WXR A;  3SBT B;  4A3T A;  4ANV A;  3ESL A;  2WXM A;  3QWV A;  1E7V A;  1FVH A;  3UMV A;  3APD A;  3EHN A;  2FBN A;  3L08 A;  4GML A;  4GYY A;  4HOS A;  4FHK A;  3CST A;  3UT7 A;  5BPP A;  3UX4 A;  3B13 A;  3SD5 A;  3VLD A;  4IYP A;  4M3O A;  3TAX A;  1IYG A;  4EBA A;  4ANW A;  3KD7 A;  2WXH A;  3PVL A;  1ELW A;  1Z6T A;  2FUL A;  3FH5 A;  4WND A;  5DIZ A;  5KJL A;  3CHS A;  3Q5M A;  1HFA A;  3NZS A;  4XI0 A;  2CG3 A;  3D9L A;  3LPZ A;  3O4Z A;  4G25 A;  4GU5 A;  5LX8 A;  3L16 A;  3ZEF A;  2LNI A;  4DJA A;  1X5B A;  2XPZ A;  3U64 A;  4ACL A;  4N3A A;  4AP2 A;  4HXI A;  1E8X A;  1KT1 A;  2PQN A;  2WXL A;  3OXG A;  3QAQ A;  4GZD A;  3PS6 A;  2AXU A;  2PQR A;  3FUM A;  4AOF A;  2X6K A;  3PDN A;  4KT6 B;  4Q94 A;  4LER A;  4UWK A;  3UT4 A;  4LUN U;  3FU0 A;  4Q69 A;  3D9P A;  2HO1 A;  4EEC A;  4GCN A;  2MOW A;  4RG9 A;  2UWJ G;  2WB2 A;  3FU3 A;  4R7L A;  1IHG A;  3G2U A;  4GA2 A;  4N2Q A;  3SI5 A;  2CHX A;  2A4Z A;  5BT1 A;  4G26 A;  4U0U A;  3UPV A;  4WUY A;  4WNF A;  1OWN A;  2WXI A;  1HS6 A;  4CEM A;  2BF0 X;  1YA0 A;  5FQ8 A;  3S7D A;  2IOS A;  1Z3Y A;  3HHM A;  3ZYL A;  4WWO A;  2PM6 A;  3BEE A;  4YVO A;  2L0T B;  3G2V A;  3PE3 A;  3CHO A;  4GYO A;  5C2Y A;  3MKQ B;  4A1S A;  5EKQ D;  4GZ5 A;  2XRY A;  3LY9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...