2BTDA

Crystal structure of dhal from e. coli
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
209
structure length
209
Chain Sequence
SLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PTS-DEPENDENT DIHYDROXYACETONE KINASE
publication title Crystal Structure of the Nucleotide-Binding Subunit Dhal of the Escherichia Coli Dihydroxyacetone Kinase.
pubmed doi rcsb
source organism Escherichia coli
total genus 84
structure length 209
sequence length 209
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2005-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02734 Dak2 DAK2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.340 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2btdA00
1UN8A 3PNLB 4LRZA 3CR3A 1UN9A 2BTDA
chains in the Genus database with same CATH superfamily
1NFIE 2IOLA 3EU9A 2R05A 1SZ9A 2AVPA 2JABA 4JXTA 3MYVA 1SQMA 3EUVA 4GZ3A 3JYSA 5H7PA 2PM7A 3TWXA 2NC9A 5HQ8A 4GA1A 4MS6A 4BTBA 3U4TA 2LXMA 4FA6A 5JHBA 2V0PA 4AV7A 3S7BA 4G23A 4E6HA 1ZU2A 2ZU6B 3FUFA 3EHQA 2KZTB 1N4PA 4AVXA 4GAAA 2UY1B 2VJ8A 2VGXA 2EIJE 3U3WA 4J8EA 4OVVA 3JUEA 4UI9J 4CDMA 3FTVA 1E90A 4JZYA 4NACA 5G05J 4PS7A 1HO8A 1PY1A 5EILA 2ZISA 5AQBA 3AS4A 3CVVA 2NYJA 1Q2ZA 3KSLA 4GPKA 3HXBA 4FHKA 1U3CA 1Z6TA 3DPDA 3DSTA 2IEJA 5D0OD 2YHEA 1K1BA 3FUIA 3ASNE 4FU3A 2WQ7A 3ZVVA 2FI7A 1YMPA 3MX3A 3CVLA 2WXMA 5FQ7A 1ELWA 3OXLA 2J49A 4U63A 3GZ2A 1TN6A 4UWHA 5D66A 3MV2B 2WXHA 2WVIA 2J09A 4HNAD 4CDRA 1Z3XA 4DLOA 1UJJA 1WY6A 2MYOA 1OWPA 3PEUB 3I4GA 2H6IA 4O1OA 3FY4A 5FJYA 3RIBA 4GZ5A 4K0RA 3BG0B 2XZDG 4XI9A 1JPLA 3FU0A 1NA3A 1N95A 3E32A 3S2AA 1HG2A 1NP7A 2X6IA 1OWLA 3G2VA 5KNHD 2VTBB 2XGOA 3CKBA 4RVBA 1A17A 4ILGA 4OYSA 3Q7AA 4GPMA 5EKQD 2J4BA 2LO6A 1JCSA 3UIPC 4N39A 4CEMA 3Q9NC 3TXMA 4UWGA 2XEEA 3QWWA 5KCMA 5AAOA 3MEKA 3W9FA 2C0MA 4F53A 4G2VA 5ENNA 4U95D 2AXZA 3FTSA 2VYIA 4X8QA 4BESA 3JXIA 3G2TA 3UI2A 2GRRB 3GW4A 3NZSA 2QC9A 4BY6A 4GYYA 5AQ7A 5KWDA 2DVWA 3CHPA 3IKOB 4J0UA 5ENSD 2ETCA 4LNUD 3KEZA 3SO8A 4I2WA 4HXIA 1E96B 4A55A 1A5EA 1GW6A 4KMOA 1X5BA 1V55E 4CGVA 3GYZA 3LJ3A 3K9IA 3UPVA 1N4RA 4W9RA 4KXKB 3UM3A 1SVXA 5G05C 5BV1A 5BXOA 3Q15A 2Y0BG 3QWVA 2Y4TA 3OXGA 2VSNA 1O1TA 1K8KG 1TN8A 3HXFA 4Z68A 3FTYA 2H6HA 2X6HA 3FEYA 4I9EA 4FC8A 2R17C 4YDEA 5ARFA 1OWNA 4Y6CA 1X81A 4JPSA 4APFA 4DX1A 3Q9UC 3RRNB 3LDZA 1D9SA 2P9LG 2YHCA 3ZRHA 4LG6A 2C0LA 1WAO1 4L23A 2CHWA 5A23A 1H0AA 3HHMA 1QBQA 4HQDA 5FZQA 4U8YD 4BT8A 3UTMA 4I17A 3ZIMA 3CV0A 4OVUA 2HM8A 5KJLA 1EPUA 2R5SA 3C5RA 3ASGA 3ZHEA 1S64A 3IV0A 1KPSB 4J8SA 2QFCA 3SGHA 3T9KA 4GYWA 1E8XA 3SF4A 4RSYA 4B8AA 3Q75A 4I1OB 1QZ2A 2LUHA 4WAFA 1IHGA 4G25A 3NOCD 5LCWC 2GRLA 3KD7A 3ML9A 2I1JA 1FPPA 5BT1A 4ANXA 3ESKA 4GZCA 3GZ1A 3CVQA 3Q49B 3R7QA 2BKGA 2H6FA 4UQXA 2L0IA 4HORA 4H7YA 4UWKA 5ENQD 4O1PA 1WG0A 3U9WA 5BPPA 3UKUG 3Q78A 5LX8A 4ANWA 1E7VA 2WXLA 5CEAA 4WWOA 4JC8A 1MZCA 4YVQC 3Q79A 4Q94A 3L17A 1HU3A 4WWPA 1FT2A 4BX8A 1YCSB 3ZXSA 4JEHA 4P29A 4L2YA 2WXGA 1UN9A 4H7XA 4FLHA 2WB2A 4HFGA 4LSZE 1EDUA 1HFAA 2VSOE 2VGXB 5ENTD 4PS8A 5AYWD 2IOSA 1D8DA 3C3QA 5CRVA 3FTUA 2AW6A 1NL4A 4AY6A 4MKTA 4XX5A 4TXQA 2Y3AA 2P9UG 5EYPF 1FVFA 3EU5A 1HS6A 3LY7A 4GZDA 4HOQA 2WPVA 4U8VD 3RRUA 2HO1A 3Q7FA 3TWSA 1MX4A 1OCOE 2QZAA 3FWVA 3HRAA 4G11A 3ZXPA 5CMYA 3MZLB 4TXPA 1H6OA 3WXXA 1E8ZA 4U0SA 1Z5SC 4KZCA 1EF1C 5JA4D 1ELRA 1SA4A 3EIQC 3PNLB 3QAQA 3MKQA 3JXJA 4QFVA 4UI9K 4BSZB 1Z3YA 1HZ4A 3LS8A 2F8YA 3ONKA 3S7DA 1IQRA 4GTVA 4UQZA 3NF1A 2OVFA 2OOEA 4ZFHA 2EILE 1TNOA 4N2SA 2R03A 1OUVA 2P2CP 4ABNA 4UUCA 3MJWA 4HI8A 2LAHA 4DPRA 3MCXA 5KBAA 5HRYA 3DWLG 4QQIA 2KM4A 4FULA 4IULA 2AJAA 2E2EA 4Y6WA 5ANLA 4KT6B 4TV3A 5T4YA 2GRNB 3J5QB 3AS8A 4FHJA 3HVEA 2MRIA 4JVSA 1INZA 1OCRE 4ME2A 1TN7A 2HE0A 3PZ4A 4B0ZA 3UT8A 2ZIRA 4N2QA 4EZLA 1N4SA 2DYSE 4JEUA 5FZRA 3TWRA 1JCRA 3EIJA 3ZKJA 4BETA 3FFLA 2Q7FA 3CEQA 2PZIA 3FUDA 3R7RA 3NOGD 4A3TA 4B94A 2L6JA 3VLEA 4BSXA 1N54A 3RO2A 2DYRE 3ZUVB 3S7JA 4GB9A 5C1DA 5AQAA 3T5XA 4ANVA 3KSQA 1QYMA 1LD8A 1LTXA 3APCA 2EIKE 3CVYA 1TEZA 4BT9A 3T8KA 1IYGA 3FU5A 3UM1A 3LPZA 3UMVA 1K3ZD 2LNIA 3JQ1A 2ZGDA 1H6KA 4HRMB 4G26A 3S7FA 3FULA 2CFUA 3PZDA 2XPZA 4DLQA 5LFAA 5E76A 3B7UX 4AJWA 1SA5A 4WWNA 1MX2A 2WMNA 4A1SA 4JB8P 2DIWA 5ENOD 4GA0A 4RG6A 5EX0A 4I9CA 1DCEA 3SBSA 1UW4B 4YDWA 4U8HA 3L9TA 4PH4B 3T5VA 1BI7B 3CGHA 3DRAA 3B95A 1UJKA 4UWFA 4CT0A 1W3BA 2FO7A 5G04C 3CR3A 3ZYQA 2R2LA 3G2WA 2XCBA 4XKCA 3X2QE 3FU3A 3ULYA 1OXJA 4KYOB 1TJFA 2YQ8A 4UQYA 3V79K 4KZ0A 3TG4A 2IU1A 5FQ8A 2ZGGA 2AXUA 1JUQA 2IQCA 1DNPA 1WDYA 1OY3D 4XI0A 3V30A 3UM0A 4MBGA 3ENEA 1UG3A 1ELKA 2WXNA 4AM9A 4EBAA 3FU6A 5FQ4A 2IONA 3RRMB 3NZUA 1IXVA 3C3OA 4GTMA 1OCZE 3B13A 1N9AA 2VSYA 2B0OE 1ZBPA 4R7LA 3PEVB 4DUIA 4I6JA 3E33A 4F1PA 2P58C 3PUKA 4KVOA 4F1SA 2XPYA 2VQ2A 4U04A 4EHMA 3T8MA 3Q47B 1L5JA 4L9PA 2ILRA 2QY7A 5CHEE 3I5PA 2ETAA 3FH7A 4NIKA 2J8SD 2ZXWE 2KC7A 2J4DA 3HIZA 2KCVA 1KZPA 2XEHA 4DRXE 1EYHA 3LJNA 1HF8A 2WXRA 5KJNA 3ML8A 3FUEA 4UI9C 3QOUA 4OAVB 2WQHA 4F7AA 3JCKC 2RG8A 1TNUA 1N4QA 4DX7D 3W9GA 2BEDA 4CRWA 3ABKE 2DWZA 1BU9A 3FH8A 2JLBA 2M63A 4TUMA 4ANUA 3HXCA 4EZKA 1IHBA 1U2VG 2P9PG 3E37A 3AG4E 1K1AA 5HKPA 1O1SA 1TNBA 2MHKA 4BWRA 4OAUC 5BW8C 3QDNA 4O60A 2CHXA 5HS0A 5CBOA 2FO1E 1OT8A 1AWCB 2VSXE 3CQCB 4I6EA 4EBAG 5CERB 1PAQA 5JJ6A 4XZ4A 2WQ6A 4LCTA 4GTOA 2IFUA 3RJVA 3ZW3A 1FVHA 4NURA 2DCPA 2L0TB 1U3DA 5BXUA 2A5EA 2DZOA 3MKRA 1BPOA 2UWJG 4Q96A 3PZ1A 4K5AB 4LERA 4N3BA 1HX8A 5DIZA 3PVLA 3EJNA 1TNZA 3APDA 5ENPD 3J5PA 4PDXA 1UN8A 2WXKA 5DBKA 1DVPA 3IHVA 2H6GA 4J8DA 4HRNA 4BTAA 3SBTB 3BG1B 3NBNB 2EIME 4IN3B 4JHRA 3DSVA 3TWVA 4YNDA 2IY0C 5EX3A 5IY5E 1TR4A 4AY5A 5B3SE 1KZOA 1RZ4A 3ABLE 4LUNU 2FEZA 3APFA 3TXNA 4E85A 4C48B 3Q4AB 1SZAA 4GTRA 3ZYMA 4G24A 5AIJA 2OVBA 2Y4UA 4GTTA 4AEZC 4GTQA 1H19A 2F37A 3AG3E 4BERA 1H6PA 3D9LA 3KS2A 4FLBA 3ZN3A 4AP2A 3ULEG 5CECB 2VTBA 5CCMA 3PRZA 4J7WA 4DK5A 5EIDA 2PNNA 2XRYA 3D3MA 3TWUA 2P9NG 3UXGA 3EHRA 3LCAA 1B89A 2XS1A 3CLJA 3ASHA 3L16A 4K5CA 3FDHA 3CVPA 1IKND 3VTYA 3VLFA 4GU5A 3PZ3A 4DI3A 3L22A 2QYUA 1S0PA 5FT9A 2FULA 3RK6A 2X6KA 5J90A 4O6FA 2IO3C 3TWTA 2PM6A 4Q69A 2CHZA 1KLXA 4JHKA 4FADA 4GYOA 4L2LA 2EINE 5BNWA 5ARGA 4F6RD 2WXQA 1HE8A 4BX9A 2J08A 4LNGA 3PE3A 1MJ0A 3AS5A 5D0QD 2X6FA 3O4ZA 1BLXB 2XEVA 5LP0A 1N94A 1E8YA 3PNTB 3FHEA 1DCQA 4GMJA 4FP7A 3TG5A 3UT4A 2WXPA 4G8LA 3LXUX 1JWFA 5E75A 5KJMA 3OAWA 4WNFA 1KT1A 3FUMA 3V2OA 2JEKA 3LYAA 2YINA 3B7BA 4ATZD 4JW1A 3L13A 5FWQA 5HI7A 4U7EB 4HI9A 3D9MA 2X3MA 3D9IA 4WNEA 3QC1A 2WM9A 3TL5A 3VTXA 4FJYA 3CHQA 1MQSA 3DBSA 2XGSA 4F3VA 1S70B 3HYMB 2V4HC 4ATGA 4WUYA 4CGWA 3CVXA 1HXIA 4ILHB 4B89A 4LEUA 2P9IG 4YDYA 1AP7A 2B6CA 2WXFA 2OV8A 2PQNA 1QQEA 3UINC 4DX2A 2BUGA 1OWOA 3U66A 1FT1A 4HLEA 2OEWA 1SW6A 4N5CA 4IRUA 1D8EA 1XGWA 1MHQA 3SY2A 3NB2A 3QB2A 1Y6IA 2AWIA 1NI1A 3D9OA 5FZSA 3ASDA 3ZNGA 4HVBA 2YNQA 2CFZA 3RU0A 3BU8A 1E7UA 4CCAA 4HS2A 3OXFA 2V4LA 3E30A 4AXHA 3I3NA 2XRZA 5JHAA 4RG9A 3GZSA 2GGFA 3D9PA 3PREA 4ILIA 2HR2A 3Q73A 3CIAA 3D9NA 2FBNA 4KBQA 3SFXA 3HXEA 2NXPA 4C0EA 2BF0X 4HLLA 4M7CA 3WG7E 2KCLA 2WXOA 5JJ7A 4HOTA 3ZHEB 3R9MA 3CK8A 5ITZF 4I6GA 3BEEA 5EIBE 4MRUA 5C2YA 4CT4A 5AJLA 1PC2A 2I2OA 3C72A 4DX5D 3PDNA 3V2XA 3ZYLA 4PS3A 4TRQA 3FH5A 2DBAA 3FEXA 3LKUA 3KAEA 4B93B 2LSUA 2A5UA 2X38A 1HH8A 3CSFA 2LSVA 3ONLA 4CDNA 5JMND 3OTNA 2RFMA 4IYPA 4GMRA 1UOHA 3L6AA 3TWWA 2OCCE 5ANRA 1H2VC 4U96D 1NA0A 3CKCA 3U64A 1O1RA 2L6BA 3JQ0A 3SFZA 4CZ2D 3CVUA 3CHSA 4GCNA 3IHYA 4JA9A 2IJGX 2RKKA 4DX6D 3DEPA 3RO3A 4N5QA 2MOWA 3PZ2A 1O5MA 4LRZA 4ACLA 4B8CB 3EHNA 3IXEA 4A3VA 3UKRG 5LCWJ 3SNXA 4FJZA 1N0QA 3EDTB 3Q5MA 3F6QA 3IEGA 1N0RA 1H2UA 4XE0A 2I1KA 1JWGA 3SQVA 5FQ6A 2ONDA 5A7DB 4HOUA 4GCOA 3CHOA 3O48A 4NQ0A 3QKYA 4C0MA 3P1UA 2XCCA 3PH0C 3ZYKA 4XKBA 1TJCA 3QJZA 2XGMA 3UIOC 2J9QA 5T3RA 3G2UA 5CMWA 3CQGB 3FUHA 4A1GA 5G55A 1MYOA 1NZNA 3DSWA 2PL2A 2Y69E 3DXKG 3DSXA 2DZNA 2RD0A 3MKQB 5AARA 2PQRA 3B7SA 5FINA 4UWLA 2V8SE 3PS6A 4I1AA 4URKA 1Y8MA 3MGBA 5CEDB 1IQUA 4AIFA 3AJIA 3IBEA 1YA0A 2XQ0A 3G2SA 2KBXA 3CHMA 3E4BA 3E34A 3AU4A 1YYHA 3ASOE 3UQ3A 3RSEG 4RLYA 3PE4A 2BTDA 4J6IA 1KT0A 3AAAC 4EZJA 3FP3A 4TUUA 3ZFWA 2XPIA 3QARA 4XIFA 1RW2A 1HG5A 3URZA 2HYZA 2KZTA 2XS8A 3L08A 2UY1A 5ENRD 4V3IA 3C98A 1TYQG 5G2NA 3R9AB 3HVEB 5AENA 4L1BA 3DXMG 5B1AE 3RAUA 3LVQE 3C3RA 3DSSA 3SHFA 4U07A 3UT7A 3V31A 2P9SG 5B1BE 2GRQB 3HG0D 3BQOA 4JD2G 3SD5A 2ETBA 3FTWA 5FIOA 2F0YA 2X6JA 4BFRA 2AXVA 1XNFA 2BKKB 2NSZA 1OCCE 1V54E 4BEPA 4GA2A 3ZU7B 5BV0A 3L54A 1H2TC 2Y1LE 4EPZA 1N52A 4JL0A 3TJPA 3FUJA 4U0UA 5CRUA 4C9BB 3SI5A 5AJDA 3ESLA 3D9JA 1WM5A 2VGEA 3HDXA 4APOA 3PUJA 3QNKA 2RFAA 5BUZA 4HBDA 4GMLA 3D9KA 3CSTA 3DSUA 3FTXA 2LAIA 4ZHBA 4D10C 2R02A 2P9KG 4HOSA 3NQPA 4NRHB 4N3AA 3ZEFA 3LVRE 2XZTG 4WNGA 2KCKA 2IF4A 3N71A 5CCLA 1E8WA 4K03A 3TAXA 1QNFA 4CYMD 1G3NB 4MLPA 3KEAA 2LXLA 4L7TA 2F8XK 2OEVA 1ZB1A 3CK9A 3P2BA 4TXRA 2VGYA 3FUNA 3B7TA 3CK7A 4JHJA 1DC2A 3DPYA 5M72A 5KJKA 3DEOA 1LD7A 3ASFA 3ISMC 2E0IA 5EN5D 4N3CA 5CBNA 5D2MC 5T8IA 3AG1E 2A4ZA 2CG2A 4I43A 3B7RL 2QYJA 4XEIG 1N11A 1S63A 1VDYA 3TGOA 1FCHA 4PUCA 2GW1A 2GRPB 5AN8A 3I4RB 5JJTA 3UX4A 3ZGQA 2KXPC 2XENA 4J8YA 4KVMA 3CVNA 5KNGA 4DJAA 3ABME 3AG2E 2KATA 1MX6A 3BUAA 4J8FA 3UM2A 5EDSA 4ACKA 4GTPA 4I2ZA 4YDOA 2FF4A 3FUKA 2I6HA 3NAWA 4G8KA 4A63B 4HRLA 4K5BA 5A6CA 2V5QC 3FTZA 4RQIA 1BD8A 3JUIA 3L82A 2L9BA 1BI8B 3LY9A 4DI4A 3RKVA 1TNYA 2V5FA 2WMOA 5FTPA 2WXJA 4HB5A 5G04J 3LEWA 3CVWA 2IO2C 3SFYA 2XHEA 4EQFA 3VLDA 2CG3A 2GRMA 3AU5A 3MA5A 3CHRA 4GTSA 4U0ZA 5EYLA 3EHMA 3MV3B 4I1MA 4G1TA 2C2LA 2J07A 2WXIA 3QK0A 4GZ6A 3HXDA 3TWQA 3ULQA 3SZ7A 2EQXA 3UUXA 5LOZA 5AQ9A 4AOFA 4WNDA 2I9CA 3D9HA 5J08A 3ZPJA 1P5QA 4YVOA 4JA7A 4LNBA 4M3OA 2R59A 2GROB 1LF8A 4EECA 3LY8A 3QWPA 1JCQA 1OWMA
chains in the Genus database with same CATH topology
1PAQA 2IOLA 5JJ6A 4XZ4A 2WQ6A 3FWVA 4LCTA 3RO3A 1SZ9A 2AVPA 2IFUA 3RJVA 4G11A 3ZW3A 1FVHA 4JXTA 2MOWA 4NURA 4LRZA 2DCPA 2L0TB 5CMYA 4ACLA 4B8CB 3MYVA 1U3DA 1SQMA 3MZLB 3EHNA 4A3VA 4GZ3A 3WXXA 3JYSA 2PM7A 3MKRA 1E8ZA 4U0SA 1BPOA 5LCWJ 2NC9A 3SNXA 4FJZA 4KZCA 1EF1C 2UWJG 1ELRA 3EDTB 3Q5MA 4Q96A 5HQ8A 3EIQC 3PNLB 3QAQA 4GA1A 4MS6A 4BTBA 3U4TA 3IEGA 3MKQA 1H2UA 4XE0A 2I1KA 4QFVA 4FA6A 5JHBA 4LERA 2V0PA 1JWGA 4N3BA 1HX8A 5DIZA 2ONDA 5FQ6A 4AV7A 5A7DB 4HOUA 3PVLA 4UI9K 3EJNA 3S7BA 4G23A 4E6HA 4GCOA 1Z3YA 1ZU2A 1HZ4A 3CHOA 3LS8A 3APDA 3O48A 2ZU6B 4NQ0A 3FUFA 3QKYA 4C0MA 2KZTB 3P1UA 4PDXA 1UN8A 3ONKA 4AVXA 4GAAA 2UY1B 2VJ8A 2WXKA 2XCCA 2VGXA 3PH0C 5DBKA 3U3WA 4J8EA 4OVVA 1DVPA 3IHVA 3S7DA 4J8DA 1IQRA 3ZYKA 4BTAA 4UQZA 3SBTB 3BG1B 4XKBA 4IN3B 4JHRA 1TJCA 4UI9J 3NF1A 2OVFA 4CDMA 3QJZA 2XGMA 3FTVA 4YNDA 1E90A 5EX3A 4AY5A 4JZYA 4NACA 2OOEA 2J9QA 5G05J 4PS7A 5T3RA 3G2UA 5CMWA 4N2SA 3CQGB 1OUVA 4LUNU 3FUHA 2FEZA 1HO8A 5G55A 4A1GA 4ABNA 3APFA 3TXNA 1PY1A 4E85A 1NZNA 2PL2A 3MJWA 3Q4AB 1SZAA 2LAHA 2RD0A 3AS4A 3MKQB 4DPRA 3CVVA 3ZYMA 3MCXA 2PQRA 4G24A 5AIJA 3B7SA 2OVBA 2Y4UA 4AEZC 2KM4A 1H19A 4FULA 4GPKA 4IULA 4FHKA 4UWLA 1U3CA 2E2EA 2V8SE 3PS6A 4Y6WA 1Z6TA 3DPDA 5D0OD 2YHEA 3FUIA 4I1AA 4KT6B 4TV3A 5ANLA 5T4YA 3D9LA 3KS2A 4URKA 4FLBA 4FU3A 2WQ7A 1Y8MA 3ZVVA 3MGBA 3ZN3A 2FI7A 4AP2A 3MX3A 3CVLA 1IQUA 3AS8A 4FHJA 4AIFA 3HVEA 2VTBA 3IBEA 5CCMA 1YA0A 2MRIA 4JVSA 1INZA 3PRZA 2XQ0A 3G2SA 4ME2A 4DK5A 2WXMA 3CHMA 5FQ7A 1ELWA 3E4BA 3AU4A 3OXLA 4B0ZA 2J49A 4U63A 3GZ2A 2XRYA 3UT8A 4UWHA 3UQ3A 3MV2B 2WXHA 2WVIA 4N2QA 4EZLA 3PE4A 2J09A 4CDRA 2BTDA 3D3MA 1Z3XA 4DLOA 4J6IA 1KT0A 1UJJA 3LCAA 1WY6A 4JEUA 1B89A 3CLJA 5FZRA 3ASHA 4EZJA 3EIJA 1OWPA 3FP3A 3I4GA 3PEUB 4TUUA 3ZFWA 3L16A 2XPIA 3FFLA 3QARA 4XIFA 1HG5A 3FY4A 2Q7FA 3URZA 2HYZA 3FDHA 5FJYA 3RIBA 3CEQA 2KZTA 2PZIA 3L08A 3CVPA 3FUDA 4GZ5A 3R7RA 2UY1A 4K0RA 3BG0B 3VTYA 3VLFA 4XI9A 1JPLA 4V3IA 4A3TA 4GU5A 3C98A 3FU0A 4B94A 2L6JA 1NA3A 3L22A 3VLEA 4DI3A 5G2NA 4BSXA 3R9AB 3S2AA 1HG2A 1S0PA 1NP7A 1N54A 2X6IA 5FT9A 3RO2A 2FULA 3RK6A 2X6KA 1OWLA 3G2VA 4O6FA 5J90A 3HVEB 3S7JA 4GB9A 2VTBB 2XGOA 3CKBA 4RVBA 5C1DA 5AENA 4L1BA 3T5XA 4ANVA 1A17A 2PM6A 4ILGA 4OYSA 4Q69A 3LVQE 2CHZA 1KLXA 3SHFA 4JHKA 4FADA 5EKQD 3APCA 3CVYA 2J4BA 4U07A 3UT7A 1TEZA 2LO6A 4BT9A 4N39A 4GYOA 4L2LA 4CEMA 5BNWA 3TXMA 4UWGA 5ARGA 2WXQA 1HE8A 4BX9A 2J08A 3QWWA 3PE3A 3AS5A 5D0QD 1IYGA 5KCMA 2X6FA 3FU5A 3O4ZA 5LP0A 2XEVA 3LPZA 3MEKA 3SD5A 1E8YA 3PNTB 3UMVA 2C0MA 3FHEA 4GMJA 3FTWA 4F53A 4G2VA 5ENNA 4FP7A 3TG5A 2AXZA 3FTSA 2VYIA 2X6JA 3UT4A 2LNIA 4BFRA 2WXPA 3JQ1A 2AXVA 3LXUX 1JWFA 1XNFA 5E75A 2NSZA 3G2TA 5KJMA 3OAWA 1H6KA 4WNFA 4GA2A 4G26A 1KT1A 3FULA 3GW4A 3FUMA 2CFUA 1H2TC 3L54A 3S7FA 5BV0A 3NZSA 4EPZA 1N52A 4JL0A 3TJPA 3PZDA 2JEKA 3FUJA 4U0UA 2XPZA 4DLQA 5LFAA 4C9BB 5E76A 3SI5A 4BY6A 4GYYA 3B7UX 4AJWA 5AJDA 3LYAA 3CHPA 2YINA 3IKOB 3ESLA 3D9JA 4WWNA 4J0UA 2WMNA 1WM5A 4A1SA 3HDXA 4JW1A 3KEZA 4APOA 3L13A 3PUJA 2DIWA 3QNKA 5FWQA 5BUZA 4GMLA 3D9KA 4GA0A 4HXIA 1E96B 3CSTA 3D9MA 2X3MA 4I2WA 4RG6A 4A55A 1GW6A 4KMOA 3D9IA 1X5BA 3FTXA 4I9CA 2LAIA 3QC1A 4WNEA 5EX0A 2WM9A 4D10C 3GYZA 4CGVA 3TL5A 3SBSA 3LJ3A 1UW4B 3VTXA 4FJYA 3CHQA 4HOSA 3NQPA 4NRHB 1MQSA 4U8HA 4PH4B 3DBSA 3T5VA 2XGSA 3K9IA 4F3VA 3UPVA 4N3AA 5HI7A 3HYMB 4W9RA 3LVRE 4KXKB 3ZEFA 3CGHA 4WNGA 4ATGA 4WUYA 2KCKA 5G05C 2IF4A 3N71A 5CCLA 1E8WA 4K03A 3TAXA 5BV1A 4CGWA 3CVXA 1HXIA 4ILHB 4B89A 3Q15A 4LEUA 1QNFA 1UJKA 3QWVA 4UWFA 2Y4TA 3OXGA 2VSNA 4MLPA 2WXFA 3FTYA 2OV8A 2X6HA 3FEYA 1W3BA 2FO7A 2PQNA 4CT0A 4I9EA 4FC8A 2R17C 1QQEA 5G04C 3CR3A 3ZYQA 3G2WA 2XCBA 4L7TA 4XKCA 5ARFA 3FU3A 1OWNA 4Y6CA 4KYOB 1TJFA 2YQ8A 4UQYA 3CK9A 2BUGA 3P2BA 1OWOA 4KZ0A 4JPSA 3TG4A 2VGYA 3U66A 2IU1A 3FUNA 5FQ8A 4APFA 3RRNB 2AXUA 3B7TA 3LDZA 4HLEA 3CK7A 4JHJA 1JUQA 2IQCA 2YHCA 3ZRHA 5M72A 5KJKA 2C0LA 4N5CA 1WAO1 1DNPA 4IRUA 1XGWA 3ASFA 4XI0A 1MHQA 4L23A 2CHWA 5A23A 1H0AA 3HHMA 2E0IA 3ENEA 1UG3A 3QB2A 1Y6IA 5FZQA 2AWIA 1ELKA 3D9OA 4N3CA 2WXNA 5FZSA 4AM9A 4EBAA 3ASDA 4BT8A 4I17A 5T8IA 3ZIMA 3FU6A 5FQ4A 3CV0A 2IONA 2HM8A 2A4ZA 4OVUA 3RRMB 2CG2A 4I43A 3B7RL 5KJLA 1EPUA 3NZUA 2R5SA 4HVBA 2YNQA 2CFZA 3ASGA 3RU0A 3ZHEA 1E7UA 4CCAA 3B13A 4HS2A 3IV0A 1VDYA 2VSYA 3OXFA 1ZBPA 3TGOA 1FCHA 4J8SA 4R7LA 3PEVB 4PUCA 2V4LA 2QFCA 3SGHA 4I6JA 4GYWA 2GW1A 4AXHA 3I3NA 2XRZA 2P58C 3PUKA 3I4RB 5JHAA 1E8XA 3SF4A 5JJTA 3UX4A 3ZGQA 4RSYA 4B8AA 4KVOA 4RG9A 3GZSA 4F1SA 2XPYA 4KVMA 2GGFA 3D9PA 3PREA 3CVNA 4ILIA 2VQ2A 4U04A 4DJAA 4I1OB 2HR2A 2KATA 1QZ2A 4WAFA 3CIAA 3D9NA 3T8MA 1IHGA 3Q47B 2FBNA 1L5JA 4KBQA 4G25A 2NXPA 4C0EA 5LCWC 2GRLA 3KD7A 3ML9A 4J8FA 2BF0X 2ILRA 2I1JA 5BT1A 4ANXA 2QY7A 3ESKA 4GZCA 5EDSA 3GZ1A 5CHEE 4ACKA 2KCLA 2WXOA 3I5PA 3CVQA 4I2ZA 5JJ7A 2FF4A 3FH7A 3FUKA 2I6HA 3Q49B 4HOTA 3R7QA 3ZHEB 3CK8A 2L0IA 4UQXA 2KC7A 4I6GA 4H7YA 2J4DA 4UWKA 4HORA 3BEEA 3HIZA 2KCVA 3U9WA 5BPPA 5A6CA 4MRUA 5C2YA 1EYHA 5LX8A 4CT4A 4ANWA 1HF8A 2WXRA 3FTZA 1E7VA 5AJLA 2WXLA 5KJNA 1PC2A 2I2OA 3ML8A 3FUEA 4WWOA 3JUIA 4JC8A 2L9BA 3PDNA 3LY9A 3ZYLA 4UI9C 4DI4A 4YVQC 4PS3A 3QOUA 4Q94A 4TRQA 2WQHA 3FH5A 1HU3A 2DBAA 3FEXA 3L17A 4WWPA 4F7AA 3LKUA 3KAEA 3RKVA 3JCKC 4BX8A 2V5FA 3ZXSA 2RG8A 2WMOA 5FTPA 2WXJA 4JEHA 4P29A 2LSUA 2A5UA 4L2YA 5G04J 3LEWA 2X38A 1HH8A 3CVWA 2WXGA 1UN9A 4H7XA 4FLHA 3CSFA 4CRWA 2LSVA 2XHEA 4EQFA 3VLDA 4HFGA 2WB2A 2CG3A 2GRMA 3FH8A 1EDUA 3AU5A 3ONLA 1HFAA 2JLBA 2M63A 2VSOE 3MA5A 4CDNA 2VGXB 4ANUA 3CHRA 4EZKA 4U0ZA 4PS8A 5AYWD 2IOSA 3OTNA 3EHMA 3MV3B 4I1MA 4IYPA 4G1TA 2C2LA 2J07A 3FTUA 2WXIA 3L6AA 2AW6A 3QK0A 4GZ6A 4AY6A 3ULQA 3SZ7A 2EQXA 3UUXA 5LOZA 4AOFA 4WNDA 2I9CA 4MKTA 4XX5A 5J08A 2MHKA 4BWRA 3ZPJA 1P5QA 5ANRA 5BW8C 1H2VC 3QDNA 2Y3AA 1NA0A 3CKCA 1FVFA 2CHXA 4JA7A 4YVOA 4M3OA 3U64A 2R59A 1HS6A 3JQ0A 3SFZA 3CVUA 3CHSA 4GCNA 3LY7A 4GZDA 3IHYA 4HOQA 2WPVA 1LF8A 4EECA 3RRUA 4JA9A 2IJGX 3LY8A 2HO1A 2VSXE 3QWPA 3CQCB 4I6EA 1OWMA 4EBAG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN8 A;  3PNL B;  4LRZ A;  3CR3 A;  1UN9 A;  2BTD A; 
#chains in the Genus database with same CATH topology
 1NFI E;  2IOL A;  3EU9 A;  2R05 A;  1SZ9 A;  2AVP A;  2JAB A;  4JXT A;  3MYV A;  1SQM A;  3EUV A;  4GZ3 A;  3JYS A;  5H7P A;  2PM7 A;  3TWX A;  2NC9 A;  5HQ8 A;  4GA1 A;  4MS6 A;  4BTB A;  3U4T A;  2LXM A;  4FA6 A;  5JHB A;  2V0P A;  4AV7 A;  3S7B A;  4G23 A;  4E6H A;  1ZU2 A;  2ZU6 B;  3FUF A;  3EHQ A;  2KZT B;  1N4P A;  4AVX A;  4GAA A;  2UY1 B;  2VJ8 A;  2VGX A;  2EIJ E;  3U3W A;  4J8E A;  4OVV A;  3JUE A;  4UI9 J;  4CDM A;  3FTV A;  1E90 A;  4JZY A;  4NAC A;  5G05 J;  4PS7 A;  1HO8 A;  1PY1 A;  5EIL A;  2ZIS A;  5AQB A;  3AS4 A;  3CVV A;  2NYJ A;  1Q2Z A;  3KSL A;  4GPK A;  3HXB A;  4FHK A;  1U3C A;  1Z6T A;  3DPD A;  3DST A;  2IEJ A;  5D0O D;  2YHE A;  1K1B A;  3FUI A;  3ASN E;  4FU3 A;  2WQ7 A;  3ZVV A;  2FI7 A;  1YMP A;  3MX3 A;  3CVL A;  2WXM A;  5FQ7 A;  1ELW A;  3OXL A;  2J49 A;  4U63 A;  3GZ2 A;  1TN6 A;  4UWH A;  5D66 A;  3MV2 B;  2WXH A;  2WVI A;  2J09 A;  4HNA D;  4CDR A;  1Z3X A;  4DLO A;  1UJJ A;  1WY6 A;  2MYO A;  1OWP A;  3PEU B;  3I4G A;  2H6I A;  4O1O A;  3FY4 A;  5FJY A;  3RIB A;  4GZ5 A;  4K0R A;  3BG0 B;  2XZD G;  4XI9 A;  1JPL A;  3FU0 A;  1NA3 A;  1N95 A;  3E32 A;  3S2A A;  1HG2 A;  1NP7 A;  2X6I A;  1OWL A;  3G2V A;  5KNH D;  2VTB B;  2XGO A;  3CKB A;  4RVB A;  1A17 A;  4ILG A;  4OYS A;  3Q7A A;  4GPM A;  5EKQ D;  2J4B A;  2LO6 A;  1JCS A;  3UIP C;  4N39 A;  4CEM A;  3Q9N C;  3TXM A;  4UWG A;  2XEE A;  3QWW A;  5KCM A;  5AAO A;  3MEK A;  3W9F A;  2C0M A;  4F53 A;  4G2V A;  5ENN A;  4U95 D;  2AXZ A;  3FTS A;  2VYI A;  4X8Q A;  4BES A;  3JXI A;  3G2T A;  3UI2 A;  2GRR B;  3GW4 A;  3NZS A;  2QC9 A;  4BY6 A;  4GYY A;  5AQ7 A;  5KWD A;  2DVW A;  3CHP A;  3IKO B;  4J0U A;  5ENS D;  2ETC A;  4LNU D;  3KEZ A;  3SO8 A;  4I2W A;  4HXI A;  1E96 B;  4A55 A;  1A5E A;  1GW6 A;  4KMO A;  1X5B A;  1V55 E;  4CGV A;  3GYZ A;  3LJ3 A;  3K9I A;  3UPV A;  1N4R A;  4W9R A;  4KXK B;  3UM3 A;  1SVX A;  5G05 C;  5BV1 A;  5BXO A;  3Q15 A;  2Y0B G;  3QWV A;  2Y4T A;  3OXG A;  2VSN A;  1O1T A;  1K8K G;  1TN8 A;  3HXF A;  4Z68 A;  3FTY A;  2H6H A;  2X6H A;  3FEY A;  4I9E A;  4FC8 A;  2R17 C;  4YDE A;  5ARF A;  1OWN A;  4Y6C A;  1X81 A;  4JPS A;  4APF A;  4DX1 A;  3Q9U C;  3RRN B;  3LDZ A;  1D9S A;  2P9L G;  2YHC A;  3ZRH A;  4LG6 A;  2C0L A;  1WAO 1;  4L23 A;  2CHW A;  5A23 A;  1H0A A;  3HHM A;  1QBQ A;  4HQD A;  5FZQ A;  4U8Y D;  4BT8 A;  3UTM A;  4I17 A;  3ZIM A;  3CV0 A;  4OVU A;  2HM8 A;  5KJL A;  1EPU A;  2R5S A;  3C5R A;  3ASG A;  3ZHE A;  1S64 A;  3IV0 A;  1KPS B;  4J8S A;  2QFC A;  3SGH A;  3T9K A;  4GYW A;  1E8X A;  3SF4 A;  4RSY A;  4B8A A;  3Q75 A;  4I1O B;  1QZ2 A;  2LUH A;  4WAF A;  1IHG A;  4G25 A;  3NOC D;  5LCW C;  2GRL A;  3KD7 A;  3ML9 A;  2I1J A;  1FPP A;  5BT1 A;  4ANX A;  3ESK A;  4GZC A;  3GZ1 A;  3CVQ A;  3Q49 B;  3R7Q A;  2BKG A;  2H6F A;  4UQX A;  2L0I A;  4HOR A;  4H7Y A;  4UWK A;  5ENQ D;  4O1P A;  1WG0 A;  3U9W A;  5BPP A;  3UKU G;  3Q78 A;  5LX8 A;  4ANW A;  1E7V A;  2WXL A;  5CEA A;  4WWO A;  4JC8 A;  1MZC A;  4YVQ C;  3Q79 A;  4Q94 A;  3L17 A;  1HU3 A;  4WWP A;  1FT2 A;  4BX8 A;  1YCS B;  3ZXS A;  4JEH A;  4P29 A;  4L2Y A;  2WXG A;  1UN9 A;  4H7X A;  4FLH A;  2WB2 A;  4HFG A;  4LSZ E;  1EDU A;  1HFA A;  2VSO E;  2VGX B;  5ENT D;  4PS8 A;  5AYW D;  2IOS A;  1D8D A;  3C3Q A;  5CRV A;  3FTU A;  2AW6 A;  1NL4 A;  4AY6 A;  4MKT A;  4XX5 A;  4TXQ A;  2Y3A A;  2P9U G;  5EYP F;  1FVF A;  3EU5 A;  1HS6 A;  3LY7 A;  4GZD A;  4HOQ A;  2WPV A;  4U8V D;  3RRU A;  2HO1 A;  3Q7F A;  3TWS A;  1MX4 A;  1OCO E;  2QZA A;  3FWV A;  3HRA A;  4G11 A;  3ZXP A;  5CMY A;  3MZL B;  4TXP A;  1H6O A;  3WXX A;  1E8Z A;  4U0S A;  1Z5S C;  4KZC A;  1EF1 C;  5JA4 D;  1ELR A;  1SA4 A;  3EIQ C;  3PNL B;  3QAQ A;  3MKQ A;  3JXJ A;  4QFV A;  4UI9 K;  4BSZ B;  1Z3Y A;  1HZ4 A;  3LS8 A;  2F8Y A;  3ONK A;  3S7D A;  1IQR A;  4GTV A;  4UQZ A;  3NF1 A;  2OVF A;  2OOE A;  4ZFH A;  2EIL E;  1TNO A;  4N2S A;  2R03 A;  1OUV A;  2P2C P;  4ABN A;  4UUC A;  3MJW A;  4HI8 A;  2LAH A;  4DPR A;  3MCX A;  5KBA A;  5HRY A;  3DWL G;  4QQI A;  2KM4 A;  4FUL A;  4IUL A;  2AJA A;  2E2E A;  4Y6W A;  5ANL A;  4KT6 B;  4TV3 A;  5T4Y A;  2GRN B;  3J5Q B;  3AS8 A;  4FHJ A;  3HVE A;  2MRI A;  4JVS A;  1INZ A;  1OCR E;  4ME2 A;  1TN7 A;  2HE0 A;  3PZ4 A;  4B0Z A;  3UT8 A;  2ZIR A;  4N2Q A;  4EZL A;  1N4S A;  2DYS E;  4JEU A;  5FZR A;  3TWR A;  1JCR A;  3EIJ A;  3ZKJ A;  4BET A;  3FFL A;  2Q7F A;  3CEQ A;  2PZI A;  3FUD A;  3R7R A;  3NOG D;  4A3T A;  4B94 A;  2L6J A;  3VLE A;  4BSX A;  1N54 A;  3RO2 A;  2DYR E;  3ZUV B;  3S7J A;  4GB9 A;  5C1D A;  5AQA A;  3T5X A;  4ANV A;  3KSQ A;  1QYM A;  1LD8 A;  1LTX A;  3APC A;  2EIK E;  3CVY A;  1TEZ A;  4BT9 A;  3T8K A;  1IYG A;  3FU5 A;  3UM1 A;  3LPZ A;  3UMV A;  1K3Z D;  2LNI A;  3JQ1 A;  2ZGD A;  1H6K A;  4HRM B;  4G26 A;  3S7F A;  3FUL A;  2CFU A;  3PZD A;  2XPZ A;  4DLQ A;  5LFA A;  5E76 A;  3B7U X;  4AJW A;  1SA5 A;  4WWN A;  1MX2 A;  2WMN A;  4A1S A;  4JB8 P;  2DIW A;  5ENO D;  4GA0 A;  4RG6 A;  5EX0 A;  4I9C A;  1DCE A;  3SBS A;  1UW4 B;  4YDW A;  4U8H A;  3L9T A;  4PH4 B;  3T5V A;  1BI7 B;  3CGH A;  3DRA A;  3B95 A;  1UJK A;  4UWF A;  4CT0 A;  1W3B A;  2FO7 A;  5G04 C;  3CR3 A;  3ZYQ A;  2R2L A;  3G2W A;  2XCB A;  4XKC A;  3X2Q E;  3FU3 A;  3ULY A;  1OXJ A;  4KYO B;  1TJF A;  2YQ8 A;  4UQY A;  3V79 K;  4KZ0 A;  3TG4 A;  2IU1 A;  5FQ8 A;  2ZGG A;  2AXU A;  1JUQ A;  2IQC A;  1DNP A;  1WDY A;  1OY3 D;  4XI0 A;  3V30 A;  3UM0 A;  4MBG A;  3ENE A;  1UG3 A;  1ELK A;  2WXN A;  4AM9 A;  4EBA A;  3FU6 A;  5FQ4 A;  2ION A;  3RRM B;  3NZU A;  1IXV A;  3C3O A;  4GTM A;  1OCZ E;  3B13 A;  1N9A A;  2VSY A;  2B0O E;  1ZBP A;  4R7L A;  3PEV B;  4DUI A;  4I6J A;  3E33 A;  4F1P A;  2P58 C;  3PUK A;  4KVO A;  4F1S A;  2XPY A;  2VQ2 A;  4U04 A;  4EHM A;  3T8M A;  3Q47 B;  1L5J A;  4L9P A;  2ILR A;  2QY7 A;  5CHE E;  3I5P A;  2ETA A;  3FH7 A;  4NIK A;  2J8S D;  2ZXW E;  2KC7 A;  2J4D A;  3HIZ A;  2KCV A;  1KZP A;  2XEH A;  4DRX E;  1EYH A;  3LJN A;  1HF8 A;  2WXR A;  5KJN A;  3ML8 A;  3FUE A;  4UI9 C;  3QOU A;  4OAV B;  2WQH A;  4F7A A;  3JCK C;  2RG8 A;  1TNU A;  1N4Q A;  4DX7 D;  3W9G A;  2BED A;  4CRW A;  3ABK E;  2DWZ A;  1BU9 A;  3FH8 A;  2JLB A;  2M63 A;  4TUM A;  4ANU A;  3HXC A;  4EZK A;  1IHB A;  1U2V G;  2P9P G;  3E37 A;  3AG4 E;  1K1A A;  5HKP A;  1O1S A;  1TNB A;  2MHK A;  4BWR A;  4OAU C;  5BW8 C;  3QDN A;  4O60 A;  2CHX A;  5HS0 A;  5CBO A;  2FO1 E;  1OT8 A;  1AWC B;  2VSX E;  3CQC B;  4I6E A;  4EBA G;  5CER B;  1PAQ A;  5JJ6 A;  4XZ4 A;  2WQ6 A;  4LCT A;  4GTO A;  2IFU A;  3RJV A;  3ZW3 A;  1FVH A;  4NUR A;  2DCP A;  2L0T B;  1U3D A;  5BXU A;  2A5E A;  2DZO A;  3MKR A;  1BPO A;  2UWJ G;  4Q96 A;  3PZ1 A;  4K5A B;  4LER A;  4N3B A;  1HX8 A;  5DIZ A;  3PVL A;  3EJN A;  1TNZ A;  3APD A;  5ENP D;  3J5P A;  4PDX A;  1UN8 A;  2WXK A;  5DBK A;  1DVP A;  3IHV A;  2H6G A;  4J8D A;  4HRN A;  4BTA A;  3SBT B;  3BG1 B;  3NBN B;  2EIM E;  4IN3 B;  4JHR A;  3DSV A;  3TWV A;  4YND A;  2IY0 C;  5EX3 A;  5IY5 E;  1TR4 A;  4AY5 A;  5B3S E;  1KZO A;  1RZ4 A;  3ABL E;  4LUN U;  2FEZ A;  3APF A;  3TXN A;  4E85 A;  4C48 B;  3Q4A B;  1SZA A;  4GTR A;  3ZYM A;  4G24 A;  5AIJ A;  2OVB A;  2Y4U A;  4GTT A;  4AEZ C;  4GTQ A;  1H19 A;  2F37 A;  3AG3 E;  4BER A;  1H6P A;  3D9L A;  3KS2 A;  4FLB A;  3ZN3 A;  4AP2 A;  3ULE G;  5CEC B;  2VTB A;  5CCM A;  3PRZ A;  4J7W A;  4DK5 A;  5EID A;  2PNN A;  2XRY A;  3D3M A;  3TWU A;  2P9N G;  3UXG A;  3EHR A;  3LCA A;  1B89 A;  2XS1 A;  3CLJ A;  3ASH A;  3L16 A;  4K5C A;  3FDH A;  3CVP A;  1IKN D;  3VTY A;  3VLF A;  4GU5 A;  3PZ3 A;  4DI3 A;  3L22 A;  2QYU A;  1S0P A;  5FT9 A;  2FUL A;  3RK6 A;  2X6K A;  5J90 A;  4O6F A;  2IO3 C;  3TWT A;  2PM6 A;  4Q69 A;  2CHZ A;  1KLX A;  4JHK A;  4FAD A;  4GYO A;  4L2L A;  2EIN E;  5BNW A;  5ARG A;  4F6R D;  2WXQ A;  1HE8 A;  4BX9 A;  2J08 A;  4LNG A;  3PE3 A;  1MJ0 A;  3AS5 A;  5D0Q D;  2X6F A;  3O4Z A;  1BLX B;  2XEV A;  5LP0 A;  1N94 A;  1E8Y A;  3PNT B;  3FHE A;  1DCQ A;  4GMJ A;  4FP7 A;  3TG5 A;  3UT4 A;  2WXP A;  4G8L A;  3LXU X;  1JWF A;  5E75 A;  5KJM A;  3OAW A;  4WNF A;  1KT1 A;  3FUM A;  3V2O A;  2JEK A;  3LYA A;  2YIN A;  3B7B A;  4ATZ D;  4JW1 A;  3L13 A;  5FWQ A;  5HI7 A;  4U7E B;  4HI9 A;  3D9M A;  2X3M A;  3D9I A;  4WNE A;  3QC1 A;  2WM9 A;  3TL5 A;  3VTX A;  4FJY A;  3CHQ A;  1MQS A;  3DBS A;  2XGS A;  4F3V A;  1S70 B;  3HYM B;  2V4H C;  4ATG A;  4WUY A;  4CGW A;  3CVX A;  1HXI A;  4ILH B;  4B89 A;  4LEU A;  2P9I G;  4YDY A;  1AP7 A;  2B6C A;  2WXF A;  2OV8 A;  2PQN A;  1QQE A;  3UIN C;  4DX2 A;  2BUG A;  1OWO A;  3U66 A;  1FT1 A;  4HLE A;  2OEW A;  1SW6 A;  4N5C A;  4IRU A;  1D8E A;  1XGW A;  1MHQ A;  3SY2 A;  3NB2 A;  3QB2 A;  1Y6I A;  2AWI A;  1NI1 A;  3D9O A;  5FZS A;  3ASD A;  3ZNG A;  4HVB A;  2YNQ A;  2CFZ A;  3RU0 A;  3BU8 A;  1E7U A;  4CCA A;  4HS2 A;  3OXF A;  2V4L A;  3E30 A;  4AXH A;  3I3N A;  2XRZ A;  5JHA A;  4RG9 A;  3GZS A;  2GGF A;  3D9P A;  3PRE A;  4ILI A;  2HR2 A;  3Q73 A;  3CIA A;  3D9N A;  2FBN A;  4KBQ A;  3SFX A;  3HXE A;  2NXP A;  4C0E A;  2BF0 X;  4HLL A;  4M7C A;  3WG7 E;  2KCL A;  2WXO A;  5JJ7 A;  4HOT A;  3ZHE B;  3R9M A;  3CK8 A;  5ITZ F;  4I6G A;  3BEE A;  5EIB E;  4MRU A;  5C2Y A;  4CT4 A;  5AJL A;  1PC2 A;  2I2O A;  3C72 A;  4DX5 D;  3PDN A;  3V2X A;  3ZYL A;  4PS3 A;  4TRQ A;  3FH5 A;  2DBA A;  3FEX A;  3LKU A;  3KAE A;  4B93 B;  2LSU A;  2A5U A;  2X38 A;  1HH8 A;  3CSF A;  2LSV A;  3ONL A;  4CDN A;  5JMN D;  3OTN A;  2RFM A;  4IYP A;  4GMR A;  1UOH A;  3L6A A;  3TWW A;  2OCC E;  5ANR A;  1H2V C;  4U96 D;  1NA0 A;  3CKC A;  3U64 A;  1O1R A;  2L6B A;  3JQ0 A;  3SFZ A;  4CZ2 D;  3CVU A;  3CHS A;  4GCN A;  3IHY A;  4JA9 A;  2IJG X;  2RKK A;  4DX6 D;  3DEP A;  3RO3 A;  4N5Q A;  2MOW A;  3PZ2 A;  1O5M A;  4LRZ A;  4ACL A;  4B8C B;  3EHN A;  3IXE A;  4A3V A;  3UKR G;  5LCW J;  3SNX A;  4FJZ A;  1N0Q A;  3EDT B;  3Q5M A;  3F6Q A;  3IEG A;  1N0R A;  1H2U A;  4XE0 A;  2I1K A;  1JWG A;  3SQV A;  5FQ6 A;  2OND A;  5A7D B;  4HOU A;  4GCO A;  3CHO A;  3O48 A;  4NQ0 A;  3QKY A;  4C0M A;  3P1U A;  2XCC A;  3PH0 C;  3ZYK A;  4XKB A;  1TJC A;  3QJZ A;  2XGM A;  3UIO C;  2J9Q A;  5T3R A;  3G2U A;  5CMW A;  3CQG B;  3FUH A;  4A1G A;  5G55 A;  1MYO A;  1NZN A;  3DSW A;  2PL2 A;  2Y69 E;  3DXK G;  3DSX A;  2DZN A;  2RD0 A;  3MKQ B;  5AAR A;  2PQR A;  3B7S A;  5FIN A;  4UWL A;  2V8S E;  3PS6 A;  4I1A A;  4URK A;  1Y8M A;  3MGB A;  5CED B;  1IQU A;  4AIF A;  3AJI A;  3IBE A;  1YA0 A;  2XQ0 A;  3G2S A;  2KBX A;  3CHM A;  3E4B A;  3E34 A;  3AU4 A;  1YYH A;  3ASO E;  3UQ3 A;  3RSE G;  4RLY A;  3PE4 A;  2BTD A;  4J6I A;  1KT0 A;  3AAA C;  4EZJ A;  3FP3 A;  4TUU A;  3ZFW A;  2XPI A;  3QAR A;  4XIF A;  1RW2 A;  1HG5 A;  3URZ A;  2HYZ A;  2KZT A;  2XS8 A;  3L08 A;  2UY1 A;  5ENR D;  4V3I A;  3C98 A;  1TYQ G;  5G2N A;  3R9A B;  3HVE B;  5AEN A;  4L1B A;  3DXM G;  5B1A E;  3RAU A;  3LVQ E;  3C3R A;  3DSS A;  3SHF A;  4U07 A;  3UT7 A;  3V31 A;  2P9S G;  5B1B E;  2GRQ B;  3HG0 D;  3BQO A;  4JD2 G;  3SD5 A;  2ETB A;  3FTW A;  5FIO A;  2F0Y A;  2X6J A;  4BFR A;  2AXV A;  1XNF A;  2BKK B;  2NSZ A;  1OCC E;  1V54 E;  4BEP A;  4GA2 A;  3ZU7 B;  5BV0 A;  3L54 A;  1H2T C;  2Y1L E;  4EPZ A;  1N52 A;  4JL0 A;  3TJP A;  3FUJ A;  4U0U A;  5CRU A;  4C9B B;  3SI5 A;  5AJD A;  3ESL A;  3D9J A;  1WM5 A;  2VGE A;  3HDX A;  4APO A;  3PUJ A;  3QNK A;  2RFA A;  5BUZ A;  4HBD A;  4GML A;  3D9K A;  3CST A;  3DSU A;  3FTX A;  2LAI A;  4ZHB A;  4D10 C;  2R02 A;  2P9K G;  4HOS A;  3NQP A;  4NRH B;  4N3A A;  3ZEF A;  3LVR E;  2XZT G;  4WNG A;  2KCK A;  2IF4 A;  3N71 A;  5CCL A;  1E8W A;  4K03 A;  3TAX A;  1QNF A;  4CYM D;  1G3N B;  4MLP A;  3KEA A;  2LXL A;  4L7T A;  2F8X K;  2OEV A;  1ZB1 A;  3CK9 A;  3P2B A;  4TXR A;  2VGY A;  3FUN A;  3B7T A;  3CK7 A;  4JHJ A;  1DC2 A;  3DPY A;  5M72 A;  5KJK A;  3DEO A;  1LD7 A;  3ASF A;  3ISM C;  2E0I A;  5EN5 D;  4N3C A;  5CBN A;  5D2M C;  5T8I A;  3AG1 E;  2A4Z A;  2CG2 A;  4I43 A;  3B7R L;  2QYJ A;  4XEI G;  1N11 A;  1S63 A;  1VDY A;  3TGO A;  1FCH A;  4PUC A;  2GW1 A;  2GRP B;  5AN8 A;  3I4R B;  5JJT A;  3UX4 A;  3ZGQ A;  2KXP C;  2XEN A;  4J8Y A;  4KVM A;  3CVN A;  5KNG A;  4DJA A;  3ABM E;  3AG2 E;  2KAT A;  1MX6 A;  3BUA A;  4J8F A;  3UM2 A;  5EDS A;  4ACK A;  4GTP A;  4I2Z A;  4YDO A;  2FF4 A;  3FUK A;  2I6H A;  3NAW A;  4G8K A;  4A63 B;  4HRL A;  4K5B A;  5A6C A;  2V5Q C;  3FTZ A;  4RQI A;  1BD8 A;  3JUI A;  3L82 A;  2L9B A;  1BI8 B;  3LY9 A;  4DI4 A;  3RKV A;  1TNY A;  2V5F A;  2WMO A;  5FTP A;  2WXJ A;  4HB5 A;  5G04 J;  3LEW A;  3CVW A;  2IO2 C;  3SFY A;  2XHE A;  4EQF A;  3VLD A;  2CG3 A;  2GRM A;  3AU5 A;  3MA5 A;  3CHR A;  4GTS A;  4U0Z A;  5EYL A;  3EHM A;  3MV3 B;  4I1M A;  4G1T A;  2C2L A;  2J07 A;  2WXI A;  3QK0 A;  4GZ6 A;  3HXD A;  3TWQ A;  3ULQ A;  3SZ7 A;  2EQX A;  3UUX A;  5LOZ A;  5AQ9 A;  4AOF A;  4WND A;  2I9C A;  3D9H A;  5J08 A;  3ZPJ A;  1P5Q A;  4YVO A;  4JA7 A;  4LNB A;  4M3O A;  2R59 A;  2GRO B;  1LF8 A;  4EEC A;  3LY8 A;  3QWP A;  1JCQ A;  1OWM A; 
#chains in the Genus database with same CATH homology
 1PAQ A;  2IOL A;  5JJ6 A;  4XZ4 A;  2WQ6 A;  3FWV A;  4LCT A;  3RO3 A;  1SZ9 A;  2AVP A;  2IFU A;  3RJV A;  4G11 A;  3ZW3 A;  1FVH A;  4JXT A;  2MOW A;  4NUR A;  4LRZ A;  2DCP A;  2L0T B;  5CMY A;  4ACL A;  4B8C B;  3MYV A;  1U3D A;  1SQM A;  3MZL B;  3EHN A;  4A3V A;  4GZ3 A;  3WXX A;  3JYS A;  2PM7 A;  3MKR A;  1E8Z A;  4U0S A;  1BPO A;  5LCW J;  2NC9 A;  3SNX A;  4FJZ A;  4KZC A;  1EF1 C;  2UWJ G;  1ELR A;  3EDT B;  3Q5M A;  4Q96 A;  5HQ8 A;  3EIQ C;  3PNL B;  3QAQ A;  4GA1 A;  4MS6 A;  4BTB A;  3U4T A;  3IEG A;  3MKQ A;  1H2U A;  4XE0 A;  2I1K A;  4QFV A;  4FA6 A;  5JHB A;  4LER A;  2V0P A;  1JWG A;  4N3B A;  1HX8 A;  5DIZ A;  2OND A;  5FQ6 A;  4AV7 A;  5A7D B;  4HOU A;  3PVL A;  4UI9 K;  3EJN A;  3S7B A;  4G23 A;  4E6H A;  4GCO A;  1Z3Y A;  1ZU2 A;  1HZ4 A;  3CHO A;  3LS8 A;  3APD A;  3O48 A;  2ZU6 B;  4NQ0 A;  3FUF A;  3QKY A;  4C0M A;  2KZT B;  3P1U A;  4PDX A;  1UN8 A;  3ONK A;  4AVX A;  4GAA A;  2UY1 B;  2VJ8 A;  2WXK A;  2XCC A;  2VGX A;  3PH0 C;  5DBK A;  3U3W A;  4J8E A;  4OVV A;  1DVP A;  3IHV A;  3S7D A;  4J8D A;  1IQR A;  3ZYK A;  4BTA A;  4UQZ A;  3SBT B;  3BG1 B;  4XKB A;  4IN3 B;  4JHR A;  1TJC A;  4UI9 J;  3NF1 A;  2OVF A;  4CDM A;  3QJZ A;  2XGM A;  3FTV A;  4YND A;  1E90 A;  5EX3 A;  4AY5 A;  4JZY A;  4NAC A;  2OOE A;  2J9Q A;  5G05 J;  4PS7 A;  5T3R A;  3G2U A;  5CMW A;  4N2S A;  3CQG B;  1OUV A;  4LUN U;  3FUH A;  2FEZ A;  1HO8 A;  5G55 A;  4A1G A;  4ABN A;  3APF A;  3TXN A;  1PY1 A;  4E85 A;  1NZN A;  2PL2 A;  3MJW A;  3Q4A B;  1SZA A;  2LAH A;  2RD0 A;  3AS4 A;  3MKQ B;  4DPR A;  3CVV A;  3ZYM A;  3MCX A;  2PQR A;  4G24 A;  5AIJ A;  3B7S A;  2OVB A;  2Y4U A;  4AEZ C;  2KM4 A;  1H19 A;  4FUL A;  4GPK A;  4IUL A;  4FHK A;  4UWL A;  1U3C A;  2E2E A;  2V8S E;  3PS6 A;  4Y6W A;  1Z6T A;  3DPD A;  5D0O D;  2YHE A;  3FUI A;  4I1A A;  4KT6 B;  4TV3 A;  5ANL A;  5T4Y A;  3D9L A;  3KS2 A;  4URK A;  4FLB A;  4FU3 A;  2WQ7 A;  1Y8M A;  3ZVV A;  3MGB A;  3ZN3 A;  2FI7 A;  4AP2 A;  3MX3 A;  3CVL A;  1IQU A;  3AS8 A;  4FHJ A;  4AIF A;  3HVE A;  2VTB A;  3IBE A;  5CCM A;  1YA0 A;  2MRI A;  4JVS A;  1INZ A;  3PRZ A;  2XQ0 A;  3G2S A;  4ME2 A;  4DK5 A;  2WXM A;  3CHM A;  5FQ7 A;  1ELW A;  3E4B A;  3AU4 A;  3OXL A;  4B0Z A;  2J49 A;  4U63 A;  3GZ2 A;  2XRY A;  3UT8 A;  4UWH A;  3UQ3 A;  3MV2 B;  2WXH A;  2WVI A;  4N2Q A;  4EZL A;  3PE4 A;  2J09 A;  4CDR A;  2BTD A;  3D3M A;  1Z3X A;  4DLO A;  4J6I A;  1KT0 A;  1UJJ A;  3LCA A;  1WY6 A;  4JEU A;  1B89 A;  3CLJ A;  5FZR A;  3ASH A;  4EZJ A;  3EIJ A;  1OWP A;  3FP3 A;  3I4G A;  3PEU B;  4TUU A;  3ZFW A;  3L16 A;  2XPI A;  3FFL A;  3QAR A;  4XIF A;  1HG5 A;  3FY4 A;  2Q7F A;  3URZ A;  2HYZ A;  3FDH A;  5FJY A;  3RIB A;  3CEQ A;  2KZT A;  2PZI A;  3L08 A;  3CVP A;  3FUD A;  4GZ5 A;  3R7R A;  2UY1 A;  4K0R A;  3BG0 B;  3VTY A;  3VLF A;  4XI9 A;  1JPL A;  4V3I A;  4A3T A;  4GU5 A;  3C98 A;  3FU0 A;  4B94 A;  2L6J A;  1NA3 A;  3L22 A;  3VLE A;  4DI3 A;  5G2N A;  4BSX A;  3R9A B;  3S2A A;  1HG2 A;  1S0P A;  1NP7 A;  1N54 A;  2X6I A;  5FT9 A;  3RO2 A;  2FUL A;  3RK6 A;  2X6K A;  1OWL A;  3G2V A;  4O6F A;  5J90 A;  3HVE B;  3S7J A;  4GB9 A;  2VTB B;  2XGO A;  3CKB A;  4RVB A;  5C1D A;  5AEN A;  4L1B A;  3T5X A;  4ANV A;  1A17 A;  2PM6 A;  4ILG A;  4OYS A;  4Q69 A;  3LVQ E;  2CHZ A;  1KLX A;  3SHF A;  4JHK A;  4FAD A;  5EKQ D;  3APC A;  3CVY A;  2J4B A;  4U07 A;  3UT7 A;  1TEZ A;  2LO6 A;  4BT9 A;  4N39 A;  4GYO A;  4L2L A;  4CEM A;  5BNW A;  3TXM A;  4UWG A;  5ARG A;  2WXQ A;  1HE8 A;  4BX9 A;  2J08 A;  3QWW A;  3PE3 A;  3AS5 A;  5D0Q D;  1IYG A;  5KCM A;  2X6F A;  3FU5 A;  3O4Z A;  5LP0 A;  2XEV A;  3LPZ A;  3MEK A;  3SD5 A;  1E8Y A;  3PNT B;  3UMV A;  2C0M A;  3FHE A;  4GMJ A;  3FTW A;  4F53 A;  4G2V A;  5ENN A;  4FP7 A;  3TG5 A;  2AXZ A;  3FTS A;  2VYI A;  2X6J A;  3UT4 A;  2LNI A;  4BFR A;  2WXP A;  3JQ1 A;  2AXV A;  3LXU X;  1JWF A;  1XNF A;  5E75 A;  2NSZ A;  3G2T A;  5KJM A;  3OAW A;  1H6K A;  4WNF A;  4GA2 A;  4G26 A;  1KT1 A;  3FUL A;  3GW4 A;  3FUM A;  2CFU A;  1H2T C;  3L54 A;  3S7F A;  5BV0 A;  3NZS A;  4EPZ A;  1N52 A;  4JL0 A;  3TJP A;  3PZD A;  2JEK A;  3FUJ A;  4U0U A;  2XPZ A;  4DLQ A;  5LFA A;  4C9B B;  5E76 A;  3SI5 A;  4BY6 A;  4GYY A;  3B7U X;  4AJW A;  5AJD A;  3LYA A;  3CHP A;  2YIN A;  3IKO B;  3ESL A;  3D9J A;  4WWN A;  4J0U A;  2WMN A;  1WM5 A;  4A1S A;  3HDX A;  4JW1 A;  3KEZ A;  4APO A;  3L13 A;  3PUJ A;  2DIW A;  3QNK A;  5FWQ A;  5BUZ A;  4GML A;  3D9K A;  4GA0 A;  4HXI A;  1E96 B;  3CST A;  3D9M A;  2X3M A;  4I2W A;  4RG6 A;  4A55 A;  1GW6 A;  4KMO A;  3D9I A;  1X5B A;  3FTX A;  4I9C A;  2LAI A;  3QC1 A;  4WNE A;  5EX0 A;  2WM9 A;  4D10 C;  3GYZ A;  4CGV A;  3TL5 A;  3SBS A;  3LJ3 A;  1UW4 B;  3VTX A;  4FJY A;  3CHQ A;  4HOS A;  3NQP A;  4NRH B;  1MQS A;  4U8H A;  4PH4 B;  3DBS A;  3T5V A;  2XGS A;  3K9I A;  4F3V A;  3UPV A;  4N3A A;  5HI7 A;  3HYM B;  4W9R A;  3LVR E;  4KXK B;  3ZEF A;  3CGH A;  4WNG A;  4ATG A;  4WUY A;  2KCK A;  5G05 C;  2IF4 A;  3N71 A;  5CCL A;  1E8W A;  4K03 A;  3TAX A;  5BV1 A;  4CGW A;  3CVX A;  1HXI A;  4ILH B;  4B89 A;  3Q15 A;  4LEU A;  1QNF A;  1UJK A;  3QWV A;  4UWF A;  2Y4T A;  3OXG A;  2VSN A;  4MLP A;  2WXF A;  3FTY A;  2OV8 A;  2X6H A;  3FEY A;  1W3B A;  2FO7 A;  2PQN A;  4CT0 A;  4I9E A;  4FC8 A;  2R17 C;  1QQE A;  5G04 C;  3CR3 A;  3ZYQ A;  3G2W A;  2XCB A;  4L7T A;  4XKC A;  5ARF A;  3FU3 A;  1OWN A;  4Y6C A;  4KYO B;  1TJF A;  2YQ8 A;  4UQY A;  3CK9 A;  2BUG A;  3P2B A;  1OWO A;  4KZ0 A;  4JPS A;  3TG4 A;  2VGY A;  3U66 A;  2IU1 A;  3FUN A;  5FQ8 A;  4APF A;  3RRN B;  2AXU A;  3B7T A;  3LDZ A;  4HLE A;  3CK7 A;  4JHJ A;  1JUQ A;  2IQC A;  2YHC A;  3ZRH A;  5M72 A;  5KJK A;  2C0L A;  4N5C A;  1WAO 1;  1DNP A;  4IRU A;  1XGW A;  3ASF A;  4XI0 A;  1MHQ A;  4L23 A;  2CHW A;  5A23 A;  1H0A A;  3HHM A;  2E0I A;  3ENE A;  1UG3 A;  3QB2 A;  1Y6I A;  5FZQ A;  2AWI A;  1ELK A;  3D9O A;  4N3C A;  2WXN A;  5FZS A;  4AM9 A;  4EBA A;  3ASD A;  4BT8 A;  4I17 A;  5T8I A;  3ZIM A;  3FU6 A;  5FQ4 A;  3CV0 A;  2ION A;  2HM8 A;  2A4Z A;  4OVU A;  3RRM B;  2CG2 A;  4I43 A;  3B7R L;  5KJL A;  1EPU A;  3NZU A;  2R5S A;  4HVB A;  2YNQ A;  2CFZ A;  3ASG A;  3RU0 A;  3ZHE A;  1E7U A;  4CCA A;  3B13 A;  4HS2 A;  3IV0 A;  1VDY A;  2VSY A;  3OXF A;  1ZBP A;  3TGO A;  1FCH A;  4J8S A;  4R7L A;  3PEV B;  4PUC A;  2V4L A;  2QFC A;  3SGH A;  4I6J A;  4GYW A;  2GW1 A;  4AXH A;  3I3N A;  2XRZ A;  2P58 C;  3PUK A;  3I4R B;  5JHA A;  1E8X A;  3SF4 A;  5JJT A;  3UX4 A;  3ZGQ A;  4RSY A;  4B8A A;  4KVO A;  4RG9 A;  3GZS A;  4F1S A;  2XPY A;  4KVM A;  2GGF A;  3D9P A;  3PRE A;  3CVN A;  4ILI A;  2VQ2 A;  4U04 A;  4DJA A;  4I1O B;  2HR2 A;  2KAT A;  1QZ2 A;  4WAF A;  3CIA A;  3D9N A;  3T8M A;  1IHG A;  3Q47 B;  2FBN A;  1L5J A;  4KBQ A;  4G25 A;  2NXP A;  4C0E A;  5LCW C;  2GRL A;  3KD7 A;  3ML9 A;  4J8F A;  2BF0 X;  2ILR A;  2I1J A;  5BT1 A;  4ANX A;  2QY7 A;  3ESK A;  4GZC A;  5EDS A;  3GZ1 A;  5CHE E;  4ACK A;  2KCL A;  2WXO A;  3I5P A;  3CVQ A;  4I2Z A;  5JJ7 A;  2FF4 A;  3FH7 A;  3FUK A;  2I6H A;  3Q49 B;  4HOT A;  3R7Q A;  3ZHE B;  3CK8 A;  2L0I A;  4UQX A;  2KC7 A;  4I6G A;  4H7Y A;  2J4D A;  4UWK A;  4HOR A;  3BEE A;  3HIZ A;  2KCV A;  3U9W A;  5BPP A;  5A6C A;  4MRU A;  5C2Y A;  1EYH A;  5LX8 A;  4CT4 A;  4ANW A;  1HF8 A;  2WXR A;  3FTZ A;  1E7V A;  5AJL A;  2WXL A;  5KJN A;  1PC2 A;  2I2O A;  3ML8 A;  3FUE A;  4WWO A;  3JUI A;  4JC8 A;  2L9B A;  3PDN A;  3LY9 A;  3ZYL A;  4UI9 C;  4DI4 A;  4YVQ C;  4PS3 A;  3QOU A;  4Q94 A;  4TRQ A;  2WQH A;  3FH5 A;  1HU3 A;  2DBA A;  3FEX A;  3L17 A;  4WWP A;  4F7A A;  3LKU A;  3KAE A;  3RKV A;  3JCK C;  4BX8 A;  2V5F A;  3ZXS A;  2RG8 A;  2WMO A;  5FTP A;  2WXJ A;  4JEH A;  4P29 A;  2LSU A;  2A5U A;  4L2Y A;  5G04 J;  3LEW A;  2X38 A;  1HH8 A;  3CVW A;  2WXG A;  1UN9 A;  4H7X A;  4FLH A;  3CSF A;  4CRW A;  2LSV A;  2XHE A;  4EQF A;  3VLD A;  4HFG A;  2WB2 A;  2CG3 A;  2GRM A;  3FH8 A;  1EDU A;  3AU5 A;  3ONL A;  1HFA A;  2JLB A;  2M63 A;  2VSO E;  3MA5 A;  4CDN A;  2VGX B;  4ANU A;  3CHR A;  4EZK A;  4U0Z A;  4PS8 A;  5AYW D;  2IOS A;  3OTN A;  3EHM A;  3MV3 B;  4I1M A;  4IYP A;  4G1T A;  2C2L A;  2J07 A;  3FTU A;  2WXI A;  3L6A A;  2AW6 A;  3QK0 A;  4GZ6 A;  4AY6 A;  3ULQ A;  3SZ7 A;  2EQX A;  3UUX A;  5LOZ A;  4AOF A;  4WND A;  2I9C A;  4MKT A;  4XX5 A;  5J08 A;  2MHK A;  4BWR A;  3ZPJ A;  1P5Q A;  5ANR A;  5BW8 C;  1H2V C;  3QDN A;  2Y3A A;  1NA0 A;  3CKC A;  1FVF A;  2CHX A;  4JA7 A;  4YVO A;  4M3O A;  3U64 A;  2R59 A;  1HS6 A;  3JQ0 A;  3SFZ A;  3CVU A;  3CHS A;  4GCN A;  3LY7 A;  4GZD A;  3IHY A;  4HOQ A;  2WPV A;  1LF8 A;  4EEC A;  3RRU A;  4JA9 A;  2IJG X;  3LY8 A;  2HO1 A;  2VSX E;  3QWP A;  3CQC B;  4I6E A;  1OWM A;  4EBA G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...