2BTDA

Crystal structure of dhal from e. coli
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
209
structure length
209
Chain Sequence
SLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKDIGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISRGKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRASYLGERSIGHQDPGATSVMFMMQMLALAAKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS-DEPENDENT DIHYDROXYACETONE KINASE
publication title Crystal Structure of the Nucleotide-Binding Subunit Dhal of the Escherichia Coli Dihydroxyacetone Kinase.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 84
structure length 209
sequence length 209
ec nomenclature ec 2.7.1.121: Phosphoenolpyruvate--glycerone phosphotransferase.
pdb deposition date 2005-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02734 Dak2 DAK2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.340 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2btdA00
1UN9A 2BTDA 3CR3A 1UN8A 4LRZA 3PNLB
chains in the Genus database with same CATH superfamily
5EYLA 3FH8A 3TWQA 4N3AA 3U4TA 5J90A 2ZU6B 4GTQA 3GZ1A 4U96D 5ARFA 3MV2B 2GGFA 1U3CA 2J4DA 4KT6B 3S7FA 5ENQD 4DX6D 1KPSB 2R05A 4WWPA 4BEPA 4LG6A 4IYPA 3ZRHA 2IFUA 2X6KA 4CDNA 3MYVA 4Y6WA 4JD2G 4BSZB 3E30A 2A5EA 4F6RD 3ABKE 1E8XA 1BU9A 1NA3A 1QBQA 2Y4TA 3X2QE 4PS8A 2X38A 1QNFA 5D66A 2FBNA 2P9KG 5LCWC 3EJNA 1IHBA 3SHFA 1DC2A 3PE4A 5G04J 4BX8A 3PE3A 1JUQA 2LSVA 3T5VA 4MBGA 3ZW3A 5BXUA 3KEAA 3TG5A 5BPPA 4G11A 3JXIA 5ENRD 5AQ7A 2NYJA 4K03A 3LJ3A 4A1GA 3OXGA 3PNTB 5ARGA 4J8DA 3LY7A 1BLXB 1TYQG 4LRZA 5FWQA 3IHYA 3PZ2A 3ASHA 3R7RA 1UOHA 4DJAA 5FQ4A 4DLOA 3D9KA 3R9MA 3LYAA 2WQHA 4H7XA 4GTVA 2IJGX 1BD8A 4NRHB 3DSXA 4WNEA 4GA1A 4APFA 4MS6A 5D2MC 2XS8A 3VLDA 2J08A 1U3DA 3RRNB 4UWFA 4DLQA 5CMYA 3Q78A 1JWFA 2HO1A 1U2VG 1QYMA 3PZ4A 3SBSA 4GZDA 2IEJA 4N5CA 3CKBA 5ENPD 3L82A 2QC9A 1WM5A 4DI4A 3JYSA 5J08A 3UUXA 5AAOA 4BT8A 2RG8A 2KZTA 4O1PA 2C0MA 2PQNA 3LEWA 3QNKA 2NC9A 5A7DB 5BNWA 2WXNA 3FUKA 3V2OA 3I4RB 3FTZA 2I2OA 3C3QA 4FULA 3CK7A 1WDYA 2GRRB 3RO3A 2VSYA 5JJ6A 1N11A 4ILHB 2ZXWE 3FY4A 4XI0A 2AXVA 3RJVA 4K5AB 2XEVA 2H6FA 3AS4A 5LX8A 2JLBA 2UY1B 4FC8A 2YHCA 2X6IA 1OY3D 1S63A 5AQAA 3S2AA 5BW8C 3E33A 4CEMA 2CHXA 2WXJA 3PS6A 5CBOA 1KZPA 2CG3A 5BV0A 2CHWA 4UWLA 4B89A 4HB5A 1NZNA 4F1PA 3ESLA 4KMOA 3FWVA 2WXFA 2ZISA 4EZLA 2GRMA 3FP3A 1RZ4A 2BUGA 4TUMA 3PH0C 4ANWA 3NBNB 1E7VA 5LP0A 4B0ZA 1TJCA 2ZIRA 3E37A 4RG9A 1PC2A 3NZSA 3O48A 5FIOA 3ZHEB 3GZSA 3CGHA 3HXBA 4GA0A 4EPZA 1EDUA 3CK8A 3Q9NC 2XQ0A 1UG3A 3APCA 1UN8A 5KNHD 4GPKA 1D9SA 3QOUA 2J09A 2ETAA 5C1DA 3TG4A 4JW1A 2LXLA 3SFXA 3NOCD 3IHVA 4UWGA 3C3OA 1ELRA 3DPDA 3AU4A 2P58C 1SQMA 1NP7A 4AY6A 3TAXA 2XHEA 3IKOB 3PUKA 2ZGDA 4DX5D 5JA4D 3C72A 3FUJA 1ZB1A 4HRLA 2AXZA 2Y3AA 4PS3A 4PH4B 4JHJA 4O1OA 3N71A 3SNXA 3P1UA 2XCBA 5ITZF 2IO2C 4WNDA 2H6HA 5CMWA 4EZJA 4XI9A 2X3MA 1N9AA 2DYRE 4WNGA 4HOUA 3VLFA 4U07A 4W9RA 2IO3C 4A1SA 3MKQA 3UINC 3TWSA 2IONA 3RRUA 4HVBA 4WNFA 3UM0A 2RFAA 4EQFA 4ACKA 4A63B 3U9WA 3D9JA 3HVEA 3CVUA 4G25A 5EX3A 2IQCA 5KJMA 4AY5A 4EECA 5FZSA 4RVBA 3UKRG 3PZDA 3KEZA 3L13A 4I2ZA 1H2UA 2XGSA 2V5FA 3IV0A 3FH5A 3LJNA 2L0TB 3MZLB 2XPIA 2OVBA 3SFZA 3DEPA 5KJNA 1FPPA 3ZFWA 3CVQA 2R03A 4I9EA 1D8EA 2AWIA 5EIBE 1TNBA 4XIFA 2VSOE 1YCSB 3LDZA 2L9BA 2YINA 3KS2A 3TWWA 3Q15A 2X6FA 3FEXA 4GZ3A 5HQ8A 4I1AA 3B7TA 5T4YA 3D9HA 5CEDB 1XGWA 1E8YA 2WXLA 1OT8A 3CVXA 3UT4A 2WXIA 2XS1A 2J49A 4YDYA 2LUHA 4TUUA 3ONKA 3ZPJA 2L6BA 1QZ2A 4F3VA 4K0RA 4LNUD 3PREA 3HDXA 2WXHA 4EBAG 2HE0A 2DCPA 2WQ7A 2EIKE 3GZ2A 3Q49B 1E7UA 4OVUA 5FZQA 5A6CA 3B7SA 4HI8A 1OWLA 3FDHA 2PL2A 3MV3B 5FQ6A 3ZYKA 2L6JA 3PNLB 2M63A 1JCQA 1X81A 3FUDA 4MRUA 2CFZA 4LUNU 2WXQA 5AENA 4HI9A 2VTBB 1O1TA 1LD8A 3T9KA 3TXMA 2V4LA 3SBTB 4GZCA 4UI9J 2NSZA 3HXCA 1YA0A 3MEKA 3U3WA 4EZKA 3EHRA 4GZ5A 4YDEA 4XEIG 3CQGB 3CHSA 2P2CP 3CSFA 4C0EA 3Q7AA 4DK5A 3EHMA 4GYWA 3AG1E 2FEZA 2QZAA 1DCQA 1HXIA 4N2SA 3T5XA 5FINA 4NQ0A 5HKPA 4NURA 4HOQA 2WXOA 4JEUA 4YNDA 3QAQA 3SFYA 2BF0X 4FHJA 3PUJA 1Z5SC 3VTXA 4JPSA 5EILA 3SD5A 4J8FA 3QARA 3U64A 2GROB 1A5EA 4YVQC 4UQXA 2A4ZA 3FUHA 3AU5A 2WB2A 2OCCE 3MKRA 4AIFA 5EKQD 1DNPA 3BQOA 1UW4B 1IYGA 3DSTA 3FUFA 3J5PA 3ZGQA 2WXGA 3KSLA 4BETA 2LXMA 5KNGA 4A55A 3BU8A 3DRAA 2WXRA 1X5BA 5AQBA 2WPVA 2QYJA 3UM3A 3B7RL 3EIQC 3LS8A 4GB9A 1PY1A 2I9CA 3KAEA 3CKCA 5E75A 4BSXA 2QY7A 3Q7FA 3V30A 2F37A 5FT9A 2CG2A 2XZTG 2R02A 2GRNB 3WXXA 4WAFA 4YDOA 4I6JA 4G8LA 3FUNA 3NZUA 3FUEA 2L0IA 4HNAD 3CHOA 4LERA 2ZGGA 3C5RA 4J7WA 1S70B 4GU5A 2XPZA 3UX4A 2GRQB 3ASOE 3UM2A 2VGYA 1NL4A 1YYHA 2ETBA 1BI8B 3BG0B 3SF4A 4U8VD 3FU0A 1QQEA 3WG7E 3LXUX 3D9OA 1Y8MA 2LSUA 1A17A 4B8AA 1TNZA 2C2LA 4J8SA 3HYMB 4LNBA 2R5SA 2P9UG 4KVOA 3UI2A 2J4BA 4FJYA 4KXKB 2RFMA 2DYSE 3OXFA 2Y1LE 3S7JA 3EU5A 3FH7A 4GTOA 3APFA 4LNGA 3ZKJA 3ZYMA 1EF1C 4MKTA 4UQYA 5EYPF 1AWCB 1P5QA 3SI5A 2F8YA 3ZYQA 3QWWA 4I43A 3ASFA 4KVMA 5CERB 1TNOA 4CT0A 2RKKA 2EIME 3Q9UC 4KBQA 4V3IA 4JB8P 4I6EA 4ANUA 1N4PA 3L16A 4B8CB 4J6IA 4BWRA 3ULQA 3G2UA 2ONDA 2Y4UA 4RSYA 3NAWA 4L2LA 1EPUA 5ENSD 4JHRA 3QKYA 3TWRA 2OOEA 5BT1A 3O4ZA 1TNYA 4UI9C 1N0QA 3NQPA 1PAQA 3E34A 4NIKA 1Z6TA 3VLEA 4L2YA 5CCMA 5H7PA 5AQ9A 4FLHA 4HLLA 4ME2A 2BTDA 2HR2A 2VJ8A 5EIDA 1TN7A 1LF8A 4BTBA 4CDMA 1N4QA 2Y69E 2WXKA 3HXEA 4BY6A 2P9SG 3UXGA 4IULA 1Z3XA 2FULA 2WM9A 3G2SA 5EX0A 4E6HA 3AAAC 2VSXE 4LSZE 4CZ2D 4GPMA 5FJYA 3TWTA 2PM7A 5CRUA 4F1SA 4JL0A 2C0LA 1E8ZA 3ML8A 4GAAA 2LNIA 4HORA 3PZ3A 4G2VA 3OXLA 3DXKG 3FTYA 1MJ0A 3ZXSA 4U0ZA 2FF4A 3CVVA 3JQ1A 3EHNA 1N4RA 2CFUA 4QQIA 1INZA 3JXJA 1SZ9A 3ZEFA 3NOGD 4UWHA 4HRMB 3Q73A 4O60A 1OCOE 2XPYA 1OWOA 3CQCB 3I5PA 4DX7D 1OXJA 2P9LG 3G2TA 5D0OD 3DXMG 2YHEA 4K5CA 3JQ0A 4GTSA 2DBAA 2MRIA 2WVIA 4BERA 3TXNA 5ENTD 3MKQB 5JJTA 1KT1A 4L1BA 1XNFA 2VQ2A 3PEUB 4KZCA 4JC8A 2XGMA 3ABME 3W9FA 2WQ6A 5EN5D 1HS6A 3HVEB 1H0AA 4TV3A 4U04A 5C2YA 4GMJA 3UMVA 3PRZA 3EIJA 5KCMA 2X6HA 4HXIA 3B7UX 3HRAA 5KJKA 3ZHEA 1HO8A 3MCXA 3RK6A 3DBSA 5EDSA 5AN8A 1KLXA 1UJJA 3L08A 2EILE 3CIAA 2PZIA 3JUIA 1SZAA 2A5UA 3L9TA 2KCVA 3DSUA 4FHKA 1B89A 1MX2A 5DBKA 3AG4E 4GYYA 2AJAA 1HU3A 3UPVA 5G55A 4IRUA 4OYSA 2DWZA 4G1TA 3CEQA 3L17A 5FTPA 1WY6A 1N52A 4ABNA 2F0YA 4BX9A 5JJ7A 1DCEA 1K1AA 2FI7A 4OAVB 4GTPA 4N2QA 2PM6A 3ENEA 1OWNA 4BFRA 4K5BA 2V8SE 5BXOA 3U66A 2DZNA 2P9PG 1IXVA 2KXPC 5CHEE 5KJLA 3FTUA 1IQUA 3JCKC 1ZU2A 5KWDA 3ZXPA 2P9IG 3J5QB 1Q2ZA 1NI1A 2FO1E 1MHQA 3SQVA 4R7LA 4DX1A 2Q7FA 3G2VA 3PEVB 2GRPB 2V4HC 4A3TA 4I1OB 4N3BA 2XEHA 2IF4A 4X8QA 2WMOA 2IOLA 1L5JA 4AJWA 3QK0A 3FTSA 3AJIA 3FU5A 4GTTA 3LVRE 3LVQE 4G26A 1SA5A 2ILRA 4JHKA 3UQ3A 2J8SD 1H2VC 5ENNA 3FTVA 3K9IA 4OAUC 2MHKA 4BESA 3IEGA 4D10C 3I4GA 4GMLA 1ELKA 4MLPA 4Q69A 2LAIA 2VYIA 4RLYA 3CR3A 4LCTA 1JCRA 2Y0BG 4KYOB 1HE8A 4OVVA 3RO2A 4AV7A 3CVNA 5BUZA 4M7CA 1HF8A 1TNUA 3ULEG 1K8KG 4EHMA 3RAUA 5E76A 4HOSA 2KBXA 5FZRA 1FCHA 3Q4AB 3B13A 4M3OA 3S7BA 5CBNA 5B1BE 1IKND 1UN9A 3D9PA 3P2BA 3UM1A 3LPZA 4I17A 5AJLA 1EYHA 2E0IA 2PNNA 1KZOA 5FQ8A 4B93B 5AARA 4FU3A 1Y6IA 3CK9A 3UIPC 4HOTA 1HH8A 4IN3B 4GA2A 3ESKA 1SW6A 3B95A 2BKGA 3GW4A 3UKUG 4ANXA 2KC7A 1O5MA 3V79K 5JHBA 2XZDG 2KM4A 2GW1A 1LTXA 4B94A 4AXHA 5CCLA 3BEEA 1N4SA 2HM8A 1OCCE 4GYOA 4TRQA 2QYUA 4JVSA 3ASDA 3DSWA 2P9NG 3RKVA 1Z3YA 1H2TC 3HXFA 4GZ6A 3ZYLA 4LEUA 1W3BA 3LCAA 3T8KA 3ZN3A 1WG0A 4HLEA 1E96B 4CDRA 2JEKA 3JUEA 4AP2A 3V31A 4I1MA 4TXRA 5G05J 4U0UA 2VGXA 4CT4A 4Q96A 4PS7A 1HG5A 4FADA 2VTBA 1N94A 2B0OE 3AS8A 5AYWD 1WAO1 2XRYA 4ZFHA 4FJZA 1AP7A 5HI7A 1TJFA 4WWNA 4BTAA 1JPLA 1K3ZD 1JCSA 3C98A 3ONLA 2E2EA 3KD7A 4Y6CA 2JABA 2ETCA 5JMND 1S64A 1BPOA 1FT1A 3CSTA 1V55E 4PDXA 4F7AA 2NXPA 1K1BA 5BV1A 2R59A 3TJPA 2KZTB 3CVWA 2J07A 3EHQA 4UQZA 1MX6A 4ATZD 2H6IA 2J9QA 5CEAA 3FULA 4DUIA 4YVOA 3Q75A 4GTMA 3FFLA 3T8MA 4JEHA 3FUIA 3NB2A 4J0UA 5ENOD 3B7BA 4DPRA 2DIWA 3TL5A 3RSEG 1V54E 4L9PA 1HX8A 2PQRA 4H7YA 5T8IA 3TGOA 2LAHA 3L6AA 4APOA 1H19A 3LKUA 3R9AB 2LO6A 1S0PA 2R2LA 3LY8A 3W9GA 1D8DA 3URZA 2YNQA 3DSVA 5CECB 2WXPA 4ILGA 3SGHA 2GRLA 1BI7B 3CLJA 1LD7A 3FUMA 4UWKA 3V2XA 3QB2A 4URKA 4C48B 3Q79A 4UUCA 1OCRE 3C3RA 3QWVA 4Z68A 4G23A 1TR4A 3VTYA 2IU1A 2DZOA 2DVWA 1JWGA 4FA6A 4XE0A 4WWOA 5D0QD 4U8YD 2XRZA 1RW2A 3QJZA 3ASNE 5AJDA 4ACLA 2XCCA 1OUVA 3QC1A 3QDNA 3Q47B 3UIOC 1MQSA 3ML9A 5M72A 4J8EA 2YQ8A 3AS5A 3SY2A 2XGOA 5HRYA 2FO7A 1H6PA 2QFCA 4TXPA 3FU6A 3I3NA 5LFAA 2AXUA 2KCKA 2I6HA 3D3MA 2X6JA 4JZYA 2KCLA 4GTRA 1ELWA 1YMPA 4C0MA 3FEYA 5KBAA 1MZCA 1N0RA 1MX4A 3AG2E 3ZIMA 4NACA 4XKCA 5LOZA 3D9IA 3L22A 2H6GA 3Q5MA 4I6GA 4CGWA 2B6CA 4F53A 1OCZE 4XX5A 1HZ4A 4YDWA 5G05C 3PDNA 2UY1A 2BEDA 1GW6A 3OAWA 1FT2A 3NF1A 4U95D 4AVXA 3DPYA 4N3CA 4U63A 3FTWA 4C9BB 4FP7A 5G04C 4ATGA 4HFGA 3HIZA 3ZNGA 3CHQA 5AIJA 1IHGA 4CGVA 5ANRA 3CHMA 3E4BA 3AG3E 3QWPA 2V0PA 4U0SA 4Q94A 5IY5E 4AM9A 2OEWA 4N39A 3IXEA 3RIBA 4DX2A 4EBAA 3ZVVA 4U7EB 3RU0A 1MYOA 1TN8A 5B3SE 4E85A 3PVLA 2KATA 4HS2A 3D9NA 2EINE 1HG2A 3ULYA 4ANVA 4KZ0A 4N5QA 1FVHA 3SO8A 1H6KA 3HHMA 3D9LA 4I9CA 3R7QA 2BKKB 5A23A 5G2NA 3FHEA 3HG0D 3EUVA 2CHZA 4JA7A 5FQ7A 3F6QA 1ZBPA 5JHAA 3TWXA 3ZUVB 3MJWA 2UWJG 4G8KA 4GCOA 1SVXA 1KT0A 3DEOA 4GCNA 4XZ4A 5B1AE 3OTNA 2V5QC 4HBDA 3FTXA 5LCWJ 3BUAA 4L7TA 4CCAA 3RRMB 2MYOA 2HYZA 3L54A 4AEZC 2OVFA 2IOSA 3ABLE 1N95A 3E32A 3TWVA 1UJKA 3PZ1A 1O1RA 4QFVA 3CVYA 4AOFA 3UT7A 3CHPA 2AVPA 3EU9A 4G24A 1HFAA 4P29A 2XENA 3GYZA 3APDA 3S7DA 1NA0A 3IBEA 2F8XK 3CVLA 3CV0A 1TN6A 4FLBA 4TXQA 2AW6A 3ZU7B 3TWUA 2OV8A 2VSNA 1OWPA 1IQRA 3UTMA 4I2WA 4GMRA 2VGEA 4JA9A 5T3RA 4RQIA 1G3NB 4DRXE 3MA5A 4ILIA 1VDYA 4HQDA 3D9MA 3ASGA 1H6OA 2WMNA 3DSSA 2OEVA 5DIZA 4XKBA 3UT8A 5ANLA 3G2WA 4L23A 3LY9A 2I1JA 1E90A 4HRNA 4WUYA 1NFIE 1N54A 2EIJE 1O1SA 1SA4A 4CYMD 3EDTB 3MGBA 3FU3A 5HS0A 4U8HA 4CRWA 1OWMA 1FVFA 4J8YA 2RD0A 4DI3A 3ISMC 4RG6A 3KSQA 3DWLG 3HXDA 3CVPA 2MOWA 4O6FA 4JXTA 2EQXA 1E8WA 1DVPA 3BG1B 2R17C 2VGXB 3SZ7A 2I1KA 4PUCA 2WXMA 3CHRA 4ZHBA 2IY0C 5CRVA 3MX3A 1TEZA 4BT9A 2XEEA 4A3VA 4UI9K
chains in the Genus database with same CATH topology
3LKUA 3MZLB 3R9AB 3FH8A 2XPIA 4N3AA 2OVBA 2LO6A 1S0PA 3SFZA 3U4TA 2XPYA 5KJNA 1OWOA 5J90A 3CQCB 3I5PA 2ZU6B 3LY8A 3ZFWA 3CVQA 3URZA 2YNQA 3G2TA 3GZ1A 2WXPA 4I9EA 4ILGA 5D0OD 5ARFA 3MV2B 2AWIA 2YHEA 3SGHA 2GGFA 2GRLA 1U3CA 2J4DA 4KT6B 3JQ0A 3S7FA 3CLJA 4XIFA 2DBAA 2MRIA 2VSOE 2WVIA 3TXNA 3LDZA 3FUMA 2L9BA 4UWKA 2YINA 3MKQB 3KS2A 5JJTA 1KT1A 4L1BA 4WWPA 3QB2A 4IYPA 3ZRHA 1XNFA 4URKA 2IFUA 2VQ2A 2X6KA 4CDNA 3MYVA 3QWVA 4Y6WA 3PEUB 3Q15A 4KZCA 2X6FA 3FEXA 4G23A 4JC8A 4GZ3A 2XGMA 5HQ8A 3VTYA 2IU1A 2WQ6A 1HS6A 3HVEB 1H0AA 4I1AA 4TV3A 1JWGA 3B7TA 5T4YA 4FA6A 4XE0A 1E8XA 4U04A 1XGWA 4WWOA 5C2YA 5D0QD 2XRZA 1NA3A 2Y4TA 1E8YA 2WXLA 3QJZA 4GMJA 3UMVA 3PRZA 4PS8A 2X38A 5AJDA 3EIJA 5KCMA 4ACLA 1QNFA 2FBNA 2XCCA 3CVXA 5LCWC 1OUVA 2X6HA 3EJNA 3QC1A 3UT4A 4HXIA 3QDNA 2WXIA 3Q47B 3B7UX 3SHFA 2J49A 3PE4A 5KJKA 1MQSA 3ML9A 5G04J 3ZHEA 4BX8A 3PE3A 1HO8A 5M72A 3MCXA 4J8EA 3RK6A 1JUQA 2LSVA 4TUUA 3ONKA 3T5VA 3DBSA 3ZPJA 2YQ8A 5EDSA 3AS5A 3ZW3A 1QZ2A 2XGOA 1KLXA 1UJJA 3L08A 2FO7A 3TG5A 4F3VA 2QFCA 4K0RA 5BPPA 3FU6A 3CIAA 3I3NA 4G11A 3PREA 2PZIA 3JUIA 1SZAA 2A5UA 5LFAA 3HDXA 2KCVA 2AXUA 2WXHA 4FHKA 4K03A 4EBAG 2KCKA 3LJ3A 4A1GA 2DCPA 1B89A 2I6HA 3OXGA 3PNTB 5ARGA 5DBKA 2WQ7A 3D3MA 2X6JA 4GYYA 3GZ2A 4J8DA 4JZYA 3Q49B 1E7UA 2KCLA 1HU3A 1ELWA 3UPVA 4OVUA 3LY7A 5FZQA 5G55A 4IRUA 5A6CA 3B7SA 4C0MA 1OWLA 3FEYA 4LRZA 3FDHA 4OYSA 5FWQA 4G1TA 3IHYA 2PL2A 3MV3B 3CEQA 3ASHA 5FQ6A 3L17A 3ZYKA 2L6JA 3R7RA 5FTPA 1WY6A 3ZIMA 4DJAA 3PNLB 1N52A 4NACA 2M63A 5FQ4A 4DLOA 4ABNA 3D9KA 4XKCA 4BX9A 5JJ7A 5LOZA 3LYAA 2WQHA 4H7XA 3D9IA 2FI7A 3FUDA 3L22A 4MRUA 2CFZA 3Q5MA 4I6GA 2IJGX 4NRHB 4LUNU 4WNEA 4GA1A 4N2QA 2PM6A 2WXQA 4APFA 4CGWA 4MS6A 4F53A 5AENA 3ENEA 2VTBB 3VLDA 2J08A 1OWNA 1U3DA 4BFRA 4XX5A 1HZ4A 5G05C 2V8SE 3PDNA 4UWFA 3RRNB 3TXMA 2V4LA 3U66A 3SBTB 4GZCA 4DLQA 5CMYA 2UY1A 3OAWA 1GW6A 4UI9J 1JWFA 2HO1A 2NSZA 3MEKA 1YA0A 3NF1A 3U3WA 4EZKA 4GZ5A 5KJLA 5CHEE 3SBSA 4GZDA 3FTUA 3CQGB 1IQUA 3CHSA 3JCKC 3CSFA 1ZU2A 4C0EA 4AVXA 4N5CA 3CKBA 4DK5A 4N3CA 1WM5A 3EHMA 4GYWA 3JYSA 4U63A 4DI4A 5J08A 2FEZA 3FTWA 4C9BB 1HXIA 4N2SA 3T5XA 4FP7A 4NQ0A 5G04C 4ATGA 4NURA 3UUXA 4HOQA 4HFGA 1MHQA 2WXOA 4JEUA 4R7LA 3HIZA 4YNDA 3QAQA 4BT8A 2RG8A 2KZTA 2Q7FA 3CHQA 2C0MA 2BF0X 3G2VA 3PEVB 4FHJA 5AIJA 2PQNA 3PUJA 1IHGA 4CGVA 3VTXA 4JPSA 3LEWA 5ANRA 4A3TA 3QNKA 3SD5A 4J8FA 4I1OB 3QARA 2NC9A 5A7DB 3U64A 4N3BA 2IF4A 3CHMA 5BNWA 4YVQC 2WXNA 3E4BA 4UQXA 2WMOA 3FUKA 2IOLA 1L5JA 4AJWA 3QK0A 3FTSA 2A4ZA 3QWPA 3I4RB 3FUHA 2V0PA 3FU5A 3AU5A 4Q94A 4U0SA 2WB2A 4AM9A 3LVRE 3MKRA 4N39A 3FTZA 4AIFA 2I2OA 4FULA 3CK7A 5EKQD 3LVQE 4G26A 3RIBA 1DNPA 4EBAA 1UW4B 3RO3A 2VSYA 3ZVVA 5JJ6A 1IYGA 2ILRA 3FUFA 4ILHB 4JHKA 3UQ3A 3RU0A 1H2VC 5ENNA 3FTVA 3K9IA 3ZGQA 2WXGA 3FY4A 4XI0A 2AXVA 3RJVA 4E85A 4A55A 2MHKA 3PVLA 2KATA 2XEVA 4HS2A 2WXRA 3AS4A 3D9NA 5LX8A 2JLBA 3IEGA 1HG2A 1X5BA 3I4GA 4ANVA 4D10C 2UY1B 4KZ0A 2WPVA 1FVHA 4FC8A 1H6KA 4GMLA 1ELKA 4MLPA 4Q69A 2YHCA 2VYIA 3B7RL 2LAIA 3EIQC 3HHMA 1PY1A 3LS8A 3D9LA 2I9CA 4GB9A 4I9CA 3KAEA 3CR3A 3CKCA 4LCTA 5E75A 3R7QA 4BSXA 2QY7A 2X6IA 4KYOB 1HE8A 4OVVA 2CG2A 5FT9A 5BW8C 5G2NA 3RO2A 3S2AA 4AV7A 5A23A 4CEMA 2CHXA 3CVNA 2WXJA 5BUZA 3FHEA 3WXXA 3PS6A 4WAFA 1HF8A 4I6JA 2CHZA 2CG3A 5BV0A 5E76A 3FUNA 4HOSA 3NZUA 3FUEA 4JA7A 2CHWA 5FQ7A 4UWLA 5FZRA 2L0IA 4B89A 1FCHA 3Q4AB 1ZBPA 3CHOA 5JHAA 3B13A 4M3OA 4LERA 3S7BA 3MJWA 1NZNA 1UN9A 3ESLA 3D9PA 3P2BA 4KMOA 3FWVA 4GU5A 2XPZA 2WXFA 3UX4A 2UWJG 4EZLA 4GCOA 2GRMA 1KT0A 2VGYA 3FP3A 4GCNA 4XZ4A 2BUGA 3LPZA 3OTNA 4I17A 5AJLA 3BG0B 1EYHA 3FTXA 2E0IA 5LCWJ 3SF4A 3FU0A 5FQ8A 3PH0C 1QQEA 4ANWA 4L7TA 1E7VA 4FU3A 1Y6IA 3LXUX 4CCAA 3CK9A 4B0ZA 3RRMB 3D9OA 5LP0A 4HOTA 1HH8A 1TJCA 1Y8MA 4IN3B 2HYZA 4GA2A 2LSUA 3ESKA 1A17A 3L54A 4RG9A 1PC2A 3GW4A 4AEZC 3NZSA 2OVFA 2IOSA 4B8AA 3O48A 3ZHEB 2C2LA 3CGHA 3GZSA 4GA0A 4EPZA 4ANXA 1EDUA 2KC7A 3CK8A 5JHBA 1UJKA 2KM4A 2GW1A 4J8SA 2XQ0A 3HYMB 1UG3A 4B94A 4AXHA 5CCLA 2R5SA 3BEEA 4KVOA 4QFVA 3APCA 3CVYA 1UN8A 4AOFA 3UT7A 2J4BA 3CHPA 2AVPA 2HM8A 4G24A 4GPKA 4FJYA 1HFAA 4KXKB 4GYOA 4TRQA 4P29A 3QOUA 3GYZA 2J09A 4JVSA 3OXFA 3ASDA 3APDA 3RKVA 1Z3YA 5C1DA 3TG4A 4JW1A 3S7JA 1H2TC 3S7DA 3FH7A 1NA0A 3APFA 4GZ6A 3ZYLA 4LEUA 1W3BA 3IBEA 3LCAA 3CVLA 3ZN3A 3IHVA 4UWGA 3ZYMA 3CV0A 4HLEA 1EF1C 1ELRA 3DPDA 4MKTA 4UQYA 3AU4A 1E96B 2P58C 1P5QA 4FLBA 3SI5A 4CDRA 1SQMA 2JEKA 1NP7A 2AW6A 3ZYQA 3QWWA 4I43A 4AP2A 3ASFA 4KVMA 4I1MA 2OV8A 4CT0A 4AY6A 2VSNA 3TAXA 4KBQA 2XHEA 1OWPA 3IKOB 4V3IA 5G05J 1IQRA 4U0UA 3PUKA 4I6EA 2VGXA 4I2WA 4CT4A 4Q96A 4JA9A 4PS7A 3FUJA 1HG5A 4FADA 2VTBA 5T3RA 2AXZA 2Y3AA 3AS8A 5AYWD 3L16A 1WAO1 2XRYA 4PS3A 4ANUA 4PH4B 4B8CB 4FJZA 4JHJA 4J6IA 5HI7A 3MA5A 4ILIA 4BWRA 3ULQA 1TJFA 1VDYA 3G2UA 3N71A 2ONDA 3D9MA 4WWNA 3ASGA 1JPLA 2Y4UA 4RSYA 4BTAA 3SNXA 3P1UA 4L2LA 1EPUA 2XCBA 2WMNA 3C98A 4JHRA 3ONLA 2E2EA 3KD7A 3QKYA 4WNDA 5DIZA 2OOEA 4Y6CA 5BT1A 1BPOA 4XKBA 3O4ZA 4UI9C 3UT8A 5CMWA 4EZJA 5ANLA 3NQPA 1PAQA 4XI9A 3CSTA 2X3MA 3G2WA 4PDXA 1Z6TA 3VLEA 4F7AA 2NXPA 3LY9A 4L2YA 2I1JA 4L23A 5BV1A 1E90A 2R59A 5CCMA 4WNGA 4FLHA 4HOUA 3TJPA 4ME2A 2BTDA 2HR2A 2VJ8A 4WUYA 3VLFA 4U07A 2KZTB 1N54A 4W9RA 4A1SA 3MKQA 3CVWA 1LF8A 2IONA 3EDTB 4BTBA 4CDMA 3MGBA 2J07A 2WXKA 3FU3A 3RRUA 4UQZA 4BY6A 4U8HA 4HVBA 4WNFA 4CRWA 4EQFA 4IULA 2J9QA 1OWMA 4ACKA 1Z3XA 3U9WA 3D9JA 1FVFA 3HVEA 2FULA 2RD0A 2WM9A 3G2SA 5EX0A 4DI3A 3CVUA 4RG6A 3FULA 4E6HA 4YVOA 3CVPA 4G25A 5EX3A 2IQCA 2MOWA 2VSXE 5KJMA 4AY5A 3FFLA 4EECA 5FJYA 5FZSA 4O6FA 4RVBA 3T8MA 4JXTA 2PM7A 2EQXA 1E8WA 1DVPA 3PZDA 3FUIA 3BG1B 3KEZA 3L13A 4JEHA 4F1SA 4JL0A 2R17C 2VGXB 2C0LA 1E8ZA 4I2ZA 3ML8A 4GAAA 4J0UA 2LNIA 3SZ7A 4DPRA 1H2UA 2I1KA 2DIWA 4PUCA 4G2VA 2WXMA 4HORA 3OXLA 3ZXSA 3FTYA 3TL5A 4U0ZA 2FF4A 3CHRA 3CVVA 1TEZA 3JQ1A 1HX8A 3MX3A 3EHNA 4BT9A 2XGSA 2PQRA 4H7YA 2CFUA 2V5FA 3IV0A 4A3VA 5T8IA 3TGOA 3FH5A 2LAHA 3L6AA 1INZA 2L0TB 1SZ9A 4UI9K 4APOA 1H19A 3ZEFA 4UWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UN9 A;  2BTD A;  3CR3 A;  1UN8 A;  4LRZ A;  3PNL B; 
#chains in the Genus database with same CATH topology
 5EYL A;  3FH8 A;  3TWQ A;  4N3A A;  3U4T A;  5J90 A;  2ZU6 B;  4GTQ A;  3GZ1 A;  4U96 D;  5ARF A;  3MV2 B;  2GGF A;  1U3C A;  2J4D A;  4KT6 B;  3S7F A;  5ENQ D;  4DX6 D;  1KPS B;  2R05 A;  4WWP A;  4BEP A;  4LG6 A;  4IYP A;  3ZRH A;  2IFU A;  2X6K A;  4CDN A;  3MYV A;  4Y6W A;  4JD2 G;  4BSZ B;  3E30 A;  2A5E A;  4F6R D;  3ABK E;  1E8X A;  1BU9 A;  1NA3 A;  1QBQ A;  2Y4T A;  3X2Q E;  4PS8 A;  2X38 A;  1QNF A;  5D66 A;  2FBN A;  2P9K G;  5LCW C;  3EJN A;  1IHB A;  3SHF A;  1DC2 A;  3PE4 A;  5G04 J;  4BX8 A;  3PE3 A;  1JUQ A;  2LSV A;  3T5V A;  4MBG A;  3ZW3 A;  5BXU A;  3KEA A;  3TG5 A;  5BPP A;  4G11 A;  3JXI A;  5ENR D;  5AQ7 A;  2NYJ A;  4K03 A;  3LJ3 A;  4A1G A;  3OXG A;  3PNT B;  5ARG A;  4J8D A;  3LY7 A;  1BLX B;  1TYQ G;  4LRZ A;  5FWQ A;  3IHY A;  3PZ2 A;  3ASH A;  3R7R A;  1UOH A;  4DJA A;  5FQ4 A;  4DLO A;  3D9K A;  3R9M A;  3LYA A;  2WQH A;  4H7X A;  4GTV A;  2IJG X;  1BD8 A;  4NRH B;  3DSX A;  4WNE A;  4GA1 A;  4APF A;  4MS6 A;  5D2M C;  2XS8 A;  3VLD A;  2J08 A;  1U3D A;  3RRN B;  4UWF A;  4DLQ A;  5CMY A;  3Q78 A;  1JWF A;  2HO1 A;  1U2V G;  1QYM A;  3PZ4 A;  3SBS A;  4GZD A;  2IEJ A;  4N5C A;  3CKB A;  5ENP D;  3L82 A;  2QC9 A;  1WM5 A;  4DI4 A;  3JYS A;  5J08 A;  3UUX A;  5AAO A;  4BT8 A;  2RG8 A;  2KZT A;  4O1P A;  2C0M A;  2PQN A;  3LEW A;  3QNK A;  2NC9 A;  5A7D B;  5BNW A;  2WXN A;  3FUK A;  3V2O A;  3I4R B;  3FTZ A;  2I2O A;  3C3Q A;  4FUL A;  3CK7 A;  1WDY A;  2GRR B;  3RO3 A;  2VSY A;  5JJ6 A;  1N11 A;  4ILH B;  2ZXW E;  3FY4 A;  4XI0 A;  2AXV A;  3RJV A;  4K5A B;  2XEV A;  2H6F A;  3AS4 A;  5LX8 A;  2JLB A;  2UY1 B;  4FC8 A;  2YHC A;  2X6I A;  1OY3 D;  1S63 A;  5AQA A;  3S2A A;  5BW8 C;  3E33 A;  4CEM A;  2CHX A;  2WXJ A;  3PS6 A;  5CBO A;  1KZP A;  2CG3 A;  5BV0 A;  2CHW A;  4UWL A;  4B89 A;  4HB5 A;  1NZN A;  4F1P A;  3ESL A;  4KMO A;  3FWV A;  2WXF A;  2ZIS A;  4EZL A;  2GRM A;  3FP3 A;  1RZ4 A;  2BUG A;  4TUM A;  3PH0 C;  4ANW A;  3NBN B;  1E7V A;  5LP0 A;  4B0Z A;  1TJC A;  2ZIR A;  3E37 A;  4RG9 A;  1PC2 A;  3NZS A;  3O48 A;  5FIO A;  3ZHE B;  3GZS A;  3CGH A;  3HXB A;  4GA0 A;  4EPZ A;  1EDU A;  3CK8 A;  3Q9N C;  2XQ0 A;  1UG3 A;  3APC A;  1UN8 A;  5KNH D;  4GPK A;  1D9S A;  3QOU A;  2J09 A;  2ETA A;  5C1D A;  3TG4 A;  4JW1 A;  2LXL A;  3SFX A;  3NOC D;  3IHV A;  4UWG A;  3C3O A;  1ELR A;  3DPD A;  3AU4 A;  2P58 C;  1SQM A;  1NP7 A;  4AY6 A;  3TAX A;  2XHE A;  3IKO B;  3PUK A;  2ZGD A;  4DX5 D;  5JA4 D;  3C72 A;  3FUJ A;  1ZB1 A;  4HRL A;  2AXZ A;  2Y3A A;  4PS3 A;  4PH4 B;  4JHJ A;  4O1O A;  3N71 A;  3SNX A;  3P1U A;  2XCB A;  5ITZ F;  2IO2 C;  4WND A;  2H6H A;  5CMW A;  4EZJ A;  4XI9 A;  2X3M A;  1N9A A;  2DYR E;  4WNG A;  4HOU A;  3VLF A;  4U07 A;  4W9R A;  2IO3 C;  4A1S A;  3MKQ A;  3UIN C;  3TWS A;  2ION A;  3RRU A;  4HVB A;  4WNF A;  3UM0 A;  2RFA A;  4EQF A;  4ACK A;  4A63 B;  3U9W A;  3D9J A;  3HVE A;  3CVU A;  4G25 A;  5EX3 A;  2IQC A;  5KJM A;  4AY5 A;  4EEC A;  5FZS A;  4RVB A;  3UKR G;  3PZD A;  3KEZ A;  3L13 A;  4I2Z A;  1H2U A;  2XGS A;  2V5F A;  3IV0 A;  3FH5 A;  3LJN A;  2L0T B;  3MZL B;  2XPI A;  2OVB A;  3SFZ A;  3DEP A;  5KJN A;  1FPP A;  3ZFW A;  3CVQ A;  2R03 A;  4I9E A;  1D8E A;  2AWI A;  5EIB E;  1TNB A;  4XIF A;  2VSO E;  1YCS B;  3LDZ A;  2L9B A;  2YIN A;  3KS2 A;  3TWW A;  3Q15 A;  2X6F A;  3FEX A;  4GZ3 A;  5HQ8 A;  4I1A A;  3B7T A;  5T4Y A;  3D9H A;  5CED B;  1XGW A;  1E8Y A;  2WXL A;  1OT8 A;  3CVX A;  3UT4 A;  2WXI A;  2XS1 A;  2J49 A;  4YDY A;  2LUH A;  4TUU A;  3ONK A;  3ZPJ A;  2L6B A;  1QZ2 A;  4F3V A;  4K0R A;  4LNU D;  3PRE A;  3HDX A;  2WXH A;  4EBA G;  2HE0 A;  2DCP A;  2WQ7 A;  2EIK E;  3GZ2 A;  3Q49 B;  1E7U A;  4OVU A;  5FZQ A;  5A6C A;  3B7S A;  4HI8 A;  1OWL A;  3FDH A;  2PL2 A;  3MV3 B;  5FQ6 A;  3ZYK A;  2L6J A;  3PNL B;  2M63 A;  1JCQ A;  1X81 A;  3FUD A;  4MRU A;  2CFZ A;  4LUN U;  2WXQ A;  5AEN A;  4HI9 A;  2VTB B;  1O1T A;  1LD8 A;  3T9K A;  3TXM A;  2V4L A;  3SBT B;  4GZC A;  4UI9 J;  2NSZ A;  3HXC A;  1YA0 A;  3MEK A;  3U3W A;  4EZK A;  3EHR A;  4GZ5 A;  4YDE A;  4XEI G;  3CQG B;  3CHS A;  2P2C P;  3CSF A;  4C0E A;  3Q7A A;  4DK5 A;  3EHM A;  4GYW A;  3AG1 E;  2FEZ A;  2QZA A;  1DCQ A;  1HXI A;  4N2S A;  3T5X A;  5FIN A;  4NQ0 A;  5HKP A;  4NUR A;  4HOQ A;  2WXO A;  4JEU A;  4YND A;  3QAQ A;  3SFY A;  2BF0 X;  4FHJ A;  3PUJ A;  1Z5S C;  3VTX A;  4JPS A;  5EIL A;  3SD5 A;  4J8F A;  3QAR A;  3U64 A;  2GRO B;  1A5E A;  4YVQ C;  4UQX A;  2A4Z A;  3FUH A;  3AU5 A;  2WB2 A;  2OCC E;  3MKR A;  4AIF A;  5EKQ D;  1DNP A;  3BQO A;  1UW4 B;  1IYG A;  3DST A;  3FUF A;  3J5P A;  3ZGQ A;  2WXG A;  3KSL A;  4BET A;  2LXM A;  5KNG A;  4A55 A;  3BU8 A;  3DRA A;  2WXR A;  1X5B A;  5AQB A;  2WPV A;  2QYJ A;  3UM3 A;  3B7R L;  3EIQ C;  3LS8 A;  4GB9 A;  1PY1 A;  2I9C A;  3KAE A;  3CKC A;  5E75 A;  4BSX A;  2QY7 A;  3Q7F A;  3V30 A;  2F37 A;  5FT9 A;  2CG2 A;  2XZT G;  2R02 A;  2GRN B;  3WXX A;  4WAF A;  4YDO A;  4I6J A;  4G8L A;  3FUN A;  3NZU A;  3FUE A;  2L0I A;  4HNA D;  3CHO A;  4LER A;  2ZGG A;  3C5R A;  4J7W A;  1S70 B;  4GU5 A;  2XPZ A;  3UX4 A;  2GRQ B;  3ASO E;  3UM2 A;  2VGY A;  1NL4 A;  1YYH A;  2ETB A;  1BI8 B;  3BG0 B;  3SF4 A;  4U8V D;  3FU0 A;  1QQE A;  3WG7 E;  3LXU X;  3D9O A;  1Y8M A;  2LSU A;  1A17 A;  4B8A A;  1TNZ A;  2C2L A;  4J8S A;  3HYM B;  4LNB A;  2R5S A;  2P9U G;  4KVO A;  3UI2 A;  2J4B A;  4FJY A;  4KXK B;  2RFM A;  2DYS E;  3OXF A;  2Y1L E;  3S7J A;  3EU5 A;  3FH7 A;  4GTO A;  3APF A;  4LNG A;  3ZKJ A;  3ZYM A;  1EF1 C;  4MKT A;  4UQY A;  5EYP F;  1AWC B;  1P5Q A;  3SI5 A;  2F8Y A;  3ZYQ A;  3QWW A;  4I43 A;  3ASF A;  4KVM A;  5CER B;  1TNO A;  4CT0 A;  2RKK A;  2EIM E;  3Q9U C;  4KBQ A;  4V3I A;  4JB8 P;  4I6E A;  4ANU A;  1N4P A;  3L16 A;  4B8C B;  4J6I A;  4BWR A;  3ULQ A;  3G2U A;  2OND A;  2Y4U A;  4RSY A;  3NAW A;  4L2L A;  1EPU A;  5ENS D;  4JHR A;  3QKY A;  3TWR A;  2OOE A;  5BT1 A;  3O4Z A;  1TNY A;  4UI9 C;  1N0Q A;  3NQP A;  1PAQ A;  3E34 A;  4NIK A;  1Z6T A;  3VLE A;  4L2Y A;  5CCM A;  5H7P A;  5AQ9 A;  4FLH A;  4HLL A;  4ME2 A;  2BTD A;  2HR2 A;  2VJ8 A;  5EID A;  1TN7 A;  1LF8 A;  4BTB A;  4CDM A;  1N4Q A;  2Y69 E;  2WXK A;  3HXE A;  4BY6 A;  2P9S G;  3UXG A;  4IUL A;  1Z3X A;  2FUL A;  2WM9 A;  3G2S A;  5EX0 A;  4E6H A;  3AAA C;  2VSX E;  4LSZ E;  4CZ2 D;  4GPM A;  5FJY A;  3TWT A;  2PM7 A;  5CRU A;  4F1S A;  4JL0 A;  2C0L A;  1E8Z A;  3ML8 A;  4GAA A;  2LNI A;  4HOR A;  3PZ3 A;  4G2V A;  3OXL A;  3DXK G;  3FTY A;  1MJ0 A;  3ZXS A;  4U0Z A;  2FF4 A;  3CVV A;  3JQ1 A;  3EHN A;  1N4R A;  2CFU A;  4QQI A;  1INZ A;  3JXJ A;  1SZ9 A;  3ZEF A;  3NOG D;  4UWH A;  4HRM B;  3Q73 A;  4O60 A;  1OCO E;  2XPY A;  1OWO A;  3CQC B;  3I5P A;  4DX7 D;  1OXJ A;  2P9L G;  3G2T A;  5D0O D;  3DXM G;  2YHE A;  4K5C A;  3JQ0 A;  4GTS A;  2DBA A;  2MRI A;  2WVI A;  4BER A;  3TXN A;  5ENT D;  3MKQ B;  5JJT A;  1KT1 A;  4L1B A;  1XNF A;  2VQ2 A;  3PEU B;  4KZC A;  4JC8 A;  2XGM A;  3ABM E;  3W9F A;  2WQ6 A;  5EN5 D;  1HS6 A;  3HVE B;  1H0A A;  4TV3 A;  4U04 A;  5C2Y A;  4GMJ A;  3UMV A;  3PRZ A;  3EIJ A;  5KCM A;  2X6H A;  4HXI A;  3B7U X;  3HRA A;  5KJK A;  3ZHE A;  1HO8 A;  3MCX A;  3RK6 A;  3DBS A;  5EDS A;  5AN8 A;  1KLX A;  1UJJ A;  3L08 A;  2EIL E;  3CIA A;  2PZI A;  3JUI A;  1SZA A;  2A5U A;  3L9T A;  2KCV A;  3DSU A;  4FHK A;  1B89 A;  1MX2 A;  5DBK A;  3AG4 E;  4GYY A;  2AJA A;  1HU3 A;  3UPV A;  5G55 A;  4IRU A;  4OYS A;  2DWZ A;  4G1T A;  3CEQ A;  3L17 A;  5FTP A;  1WY6 A;  1N52 A;  4ABN A;  2F0Y A;  4BX9 A;  5JJ7 A;  1DCE A;  1K1A A;  2FI7 A;  4OAV B;  4GTP A;  4N2Q A;  2PM6 A;  3ENE A;  1OWN A;  4BFR A;  4K5B A;  2V8S E;  5BXO A;  3U66 A;  2DZN A;  2P9P G;  1IXV A;  2KXP C;  5CHE E;  5KJL A;  3FTU A;  1IQU A;  3JCK C;  1ZU2 A;  5KWD A;  3ZXP A;  2P9I G;  3J5Q B;  1Q2Z A;  1NI1 A;  2FO1 E;  1MHQ A;  3SQV A;  4R7L A;  4DX1 A;  2Q7F A;  3G2V A;  3PEV B;  2GRP B;  2V4H C;  4A3T A;  4I1O B;  4N3B A;  2XEH A;  2IF4 A;  4X8Q A;  2WMO A;  2IOL A;  1L5J A;  4AJW A;  3QK0 A;  3FTS A;  3AJI A;  3FU5 A;  4GTT A;  3LVR E;  3LVQ E;  4G26 A;  1SA5 A;  2ILR A;  4JHK A;  3UQ3 A;  2J8S D;  1H2V C;  5ENN A;  3FTV A;  3K9I A;  4OAU C;  2MHK A;  4BES A;  3IEG A;  4D10 C;  3I4G A;  4GML A;  1ELK A;  4MLP A;  4Q69 A;  2LAI A;  2VYI A;  4RLY A;  3CR3 A;  4LCT A;  1JCR A;  2Y0B G;  4KYO B;  1HE8 A;  4OVV A;  3RO2 A;  4AV7 A;  3CVN A;  5BUZ A;  4M7C A;  1HF8 A;  1TNU A;  3ULE G;  1K8K G;  4EHM A;  3RAU A;  5E76 A;  4HOS A;  2KBX A;  5FZR A;  1FCH A;  3Q4A B;  3B13 A;  4M3O A;  3S7B A;  5CBN A;  5B1B E;  1IKN D;  1UN9 A;  3D9P A;  3P2B A;  3UM1 A;  3LPZ A;  4I17 A;  5AJL A;  1EYH A;  2E0I A;  2PNN A;  1KZO A;  5FQ8 A;  4B93 B;  5AAR A;  4FU3 A;  1Y6I A;  3CK9 A;  3UIP C;  4HOT A;  1HH8 A;  4IN3 B;  4GA2 A;  3ESK A;  1SW6 A;  3B95 A;  2BKG A;  3GW4 A;  3UKU G;  4ANX A;  2KC7 A;  1O5M A;  3V79 K;  5JHB A;  2XZD G;  2KM4 A;  2GW1 A;  1LTX A;  4B94 A;  4AXH A;  5CCL A;  3BEE A;  1N4S A;  2HM8 A;  1OCC E;  4GYO A;  4TRQ A;  2QYU A;  4JVS A;  3ASD A;  3DSW A;  2P9N G;  3RKV A;  1Z3Y A;  1H2T C;  3HXF A;  4GZ6 A;  3ZYL A;  4LEU A;  1W3B A;  3LCA A;  3T8K A;  3ZN3 A;  1WG0 A;  4HLE A;  1E96 B;  4CDR A;  2JEK A;  3JUE A;  4AP2 A;  3V31 A;  4I1M A;  4TXR A;  5G05 J;  4U0U A;  2VGX A;  4CT4 A;  4Q96 A;  4PS7 A;  1HG5 A;  4FAD A;  2VTB A;  1N94 A;  2B0O E;  3AS8 A;  5AYW D;  1WAO 1;  2XRY A;  4ZFH A;  4FJZ A;  1AP7 A;  5HI7 A;  1TJF A;  4WWN A;  4BTA A;  1JPL A;  1K3Z D;  1JCS A;  3C98 A;  3ONL A;  2E2E A;  3KD7 A;  4Y6C A;  2JAB A;  2ETC A;  5JMN D;  1S64 A;  1BPO A;  1FT1 A;  3CST A;  1V55 E;  4PDX A;  4F7A A;  2NXP A;  1K1B A;  5BV1 A;  2R59 A;  3TJP A;  2KZT B;  3CVW A;  2J07 A;  3EHQ A;  4UQZ A;  1MX6 A;  4ATZ D;  2H6I A;  2J9Q A;  5CEA A;  3FUL A;  4DUI A;  4YVO A;  3Q75 A;  4GTM A;  3FFL A;  3T8M A;  4JEH A;  3FUI A;  3NB2 A;  4J0U A;  5ENO D;  3B7B A;  4DPR A;  2DIW A;  3TL5 A;  3RSE G;  1V54 E;  4L9P A;  1HX8 A;  2PQR A;  4H7Y A;  5T8I A;  3TGO A;  2LAH A;  3L6A A;  4APO A;  1H19 A;  3LKU A;  3R9A B;  2LO6 A;  1S0P A;  2R2L A;  3LY8 A;  3W9G A;  1D8D A;  3URZ A;  2YNQ A;  3DSV A;  5CEC B;  2WXP A;  4ILG A;  3SGH A;  2GRL A;  1BI7 B;  3CLJ A;  1LD7 A;  3FUM A;  4UWK A;  3V2X A;  3QB2 A;  4URK A;  4C48 B;  3Q79 A;  4UUC A;  1OCR E;  3C3R A;  3QWV A;  4Z68 A;  4G23 A;  1TR4 A;  3VTY A;  2IU1 A;  2DZO A;  2DVW A;  1JWG A;  4FA6 A;  4XE0 A;  4WWO A;  5D0Q D;  4U8Y D;  2XRZ A;  1RW2 A;  3QJZ A;  3ASN E;  5AJD A;  4ACL A;  2XCC A;  1OUV A;  3QC1 A;  3QDN A;  3Q47 B;  3UIO C;  1MQS A;  3ML9 A;  5M72 A;  4J8E A;  2YQ8 A;  3AS5 A;  3SY2 A;  2XGO A;  5HRY A;  2FO7 A;  1H6P A;  2QFC A;  4TXP A;  3FU6 A;  3I3N A;  5LFA A;  2AXU A;  2KCK A;  2I6H A;  3D3M A;  2X6J A;  4JZY A;  2KCL A;  4GTR A;  1ELW A;  1YMP A;  4C0M A;  3FEY A;  5KBA A;  1MZC A;  1N0R A;  1MX4 A;  3AG2 E;  3ZIM A;  4NAC A;  4XKC A;  5LOZ A;  3D9I A;  3L22 A;  2H6G A;  3Q5M A;  4I6G A;  4CGW A;  2B6C A;  4F53 A;  1OCZ E;  4XX5 A;  1HZ4 A;  4YDW A;  5G05 C;  3PDN A;  2UY1 A;  2BED A;  1GW6 A;  3OAW A;  1FT2 A;  3NF1 A;  4U95 D;  4AVX A;  3DPY A;  4N3C A;  4U63 A;  3FTW A;  4C9B B;  4FP7 A;  5G04 C;  4ATG A;  4HFG A;  3HIZ A;  3ZNG A;  3CHQ A;  5AIJ A;  1IHG A;  4CGV A;  5ANR A;  3CHM A;  3E4B A;  3AG3 E;  3QWP A;  2V0P A;  4U0S A;  4Q94 A;  5IY5 E;  4AM9 A;  2OEW A;  4N39 A;  3IXE A;  3RIB A;  4DX2 A;  4EBA A;  3ZVV A;  4U7E B;  3RU0 A;  1MYO A;  1TN8 A;  5B3S E;  4E85 A;  3PVL A;  2KAT A;  4HS2 A;  3D9N A;  2EIN E;  1HG2 A;  3ULY A;  4ANV A;  4KZ0 A;  4N5Q A;  1FVH A;  3SO8 A;  1H6K A;  3HHM A;  3D9L A;  4I9C A;  3R7Q A;  2BKK B;  5A23 A;  5G2N A;  3FHE A;  3HG0 D;  3EUV A;  2CHZ A;  4JA7 A;  5FQ7 A;  3F6Q A;  1ZBP A;  5JHA A;  3TWX A;  3ZUV B;  3MJW A;  2UWJ G;  4G8K A;  4GCO A;  1SVX A;  1KT0 A;  3DEO A;  4GCN A;  4XZ4 A;  5B1A E;  3OTN A;  2V5Q C;  4HBD A;  3FTX A;  5LCW J;  3BUA A;  4L7T A;  4CCA A;  3RRM B;  2MYO A;  2HYZ A;  3L54 A;  4AEZ C;  2OVF A;  2IOS A;  3ABL E;  1N95 A;  3E32 A;  3TWV A;  1UJK A;  3PZ1 A;  1O1R A;  4QFV A;  3CVY A;  4AOF A;  3UT7 A;  3CHP A;  2AVP A;  3EU9 A;  4G24 A;  1HFA A;  4P29 A;  2XEN A;  3GYZ A;  3APD A;  3S7D A;  1NA0 A;  3IBE A;  2F8X K;  3CVL A;  3CV0 A;  1TN6 A;  4FLB A;  4TXQ A;  2AW6 A;  3ZU7 B;  3TWU A;  2OV8 A;  2VSN A;  1OWP A;  1IQR A;  3UTM A;  4I2W A;  4GMR A;  2VGE A;  4JA9 A;  5T3R A;  4RQI A;  1G3N B;  4DRX E;  3MA5 A;  4ILI A;  1VDY A;  4HQD A;  3D9M A;  3ASG A;  1H6O A;  2WMN A;  3DSS A;  2OEV A;  5DIZ A;  4XKB A;  3UT8 A;  5ANL A;  3G2W A;  4L23 A;  3LY9 A;  2I1J A;  1E90 A;  4HRN A;  4WUY A;  1NFI E;  1N54 A;  2EIJ E;  1O1S A;  1SA4 A;  4CYM D;  3EDT B;  3MGB A;  3FU3 A;  5HS0 A;  4U8H A;  4CRW A;  1OWM A;  1FVF A;  4J8Y A;  2RD0 A;  4DI3 A;  3ISM C;  4RG6 A;  3KSQ A;  3DWL G;  3HXD A;  3CVP A;  2MOW A;  4O6F A;  4JXT A;  2EQX A;  1E8W A;  1DVP A;  3BG1 B;  2R17 C;  2VGX B;  3SZ7 A;  2I1K A;  4PUC A;  2WXM A;  3CHR A;  4ZHB A;  2IY0 C;  5CRV A;  3MX3 A;  1TEZ A;  4BT9 A;  2XEE A;  4A3V A;  4UI9 K; 
#chains in the Genus database with same CATH homology
 3LKU A;  3MZL B;  3R9A B;  3FH8 A;  2XPI A;  4N3A A;  2OVB A;  2LO6 A;  1S0P A;  3SFZ A;  3U4T A;  2XPY A;  5KJN A;  1OWO A;  5J90 A;  3CQC B;  3I5P A;  2ZU6 B;  3LY8 A;  3ZFW A;  3CVQ A;  3URZ A;  2YNQ A;  3G2T A;  3GZ1 A;  2WXP A;  4I9E A;  4ILG A;  5D0O D;  5ARF A;  3MV2 B;  2AWI A;  2YHE A;  3SGH A;  2GGF A;  2GRL A;  1U3C A;  2J4D A;  4KT6 B;  3JQ0 A;  3S7F A;  3CLJ A;  4XIF A;  2DBA A;  2MRI A;  2VSO E;  2WVI A;  3TXN A;  3LDZ A;  3FUM A;  2L9B A;  4UWK A;  2YIN A;  3MKQ B;  3KS2 A;  5JJT A;  1KT1 A;  4L1B A;  4WWP A;  3QB2 A;  4IYP A;  3ZRH A;  1XNF A;  4URK A;  2IFU A;  2VQ2 A;  2X6K A;  4CDN A;  3MYV A;  3QWV A;  4Y6W A;  3PEU B;  3Q15 A;  4KZC A;  2X6F A;  3FEX A;  4G23 A;  4JC8 A;  4GZ3 A;  2XGM A;  5HQ8 A;  3VTY A;  2IU1 A;  2WQ6 A;  1HS6 A;  3HVE B;  1H0A A;  4I1A A;  4TV3 A;  1JWG A;  3B7T A;  5T4Y A;  4FA6 A;  4XE0 A;  1E8X A;  4U04 A;  1XGW A;  4WWO A;  5C2Y A;  5D0Q D;  2XRZ A;  1NA3 A;  2Y4T A;  1E8Y A;  2WXL A;  3QJZ A;  4GMJ A;  3UMV A;  3PRZ A;  4PS8 A;  2X38 A;  5AJD A;  3EIJ A;  5KCM A;  4ACL A;  1QNF A;  2FBN A;  2XCC A;  3CVX A;  5LCW C;  1OUV A;  2X6H A;  3EJN A;  3QC1 A;  3UT4 A;  4HXI A;  3QDN A;  2WXI A;  3Q47 B;  3B7U X;  3SHF A;  2J49 A;  3PE4 A;  5KJK A;  1MQS A;  3ML9 A;  5G04 J;  3ZHE A;  4BX8 A;  3PE3 A;  1HO8 A;  5M72 A;  3MCX A;  4J8E A;  3RK6 A;  1JUQ A;  2LSV A;  4TUU A;  3ONK A;  3T5V A;  3DBS A;  3ZPJ A;  2YQ8 A;  5EDS A;  3AS5 A;  3ZW3 A;  1QZ2 A;  2XGO A;  1KLX A;  1UJJ A;  3L08 A;  2FO7 A;  3TG5 A;  4F3V A;  2QFC A;  4K0R A;  5BPP A;  3FU6 A;  3CIA A;  3I3N A;  4G11 A;  3PRE A;  2PZI A;  3JUI A;  1SZA A;  2A5U A;  5LFA A;  3HDX A;  2KCV A;  2AXU A;  2WXH A;  4FHK A;  4K03 A;  4EBA G;  2KCK A;  3LJ3 A;  4A1G A;  2DCP A;  1B89 A;  2I6H A;  3OXG A;  3PNT B;  5ARG A;  5DBK A;  2WQ7 A;  3D3M A;  2X6J A;  4GYY A;  3GZ2 A;  4J8D A;  4JZY A;  3Q49 B;  1E7U A;  2KCL A;  1HU3 A;  1ELW A;  3UPV A;  4OVU A;  3LY7 A;  5FZQ A;  5G55 A;  4IRU A;  5A6C A;  3B7S A;  4C0M A;  1OWL A;  3FEY A;  4LRZ A;  3FDH A;  4OYS A;  5FWQ A;  4G1T A;  3IHY A;  2PL2 A;  3MV3 B;  3CEQ A;  3ASH A;  5FQ6 A;  3L17 A;  3ZYK A;  2L6J A;  3R7R A;  5FTP A;  1WY6 A;  3ZIM A;  4DJA A;  3PNL B;  1N52 A;  4NAC A;  2M63 A;  5FQ4 A;  4DLO A;  4ABN A;  3D9K A;  4XKC A;  4BX9 A;  5JJ7 A;  5LOZ A;  3LYA A;  2WQH A;  4H7X A;  3D9I A;  2FI7 A;  3FUD A;  3L22 A;  4MRU A;  2CFZ A;  3Q5M A;  4I6G A;  2IJG X;  4NRH B;  4LUN U;  4WNE A;  4GA1 A;  4N2Q A;  2PM6 A;  2WXQ A;  4APF A;  4CGW A;  4MS6 A;  4F53 A;  5AEN A;  3ENE A;  2VTB B;  3VLD A;  2J08 A;  1OWN A;  1U3D A;  4BFR A;  4XX5 A;  1HZ4 A;  5G05 C;  2V8S E;  3PDN A;  4UWF A;  3RRN B;  3TXM A;  2V4L A;  3U66 A;  3SBT B;  4GZC A;  4DLQ A;  5CMY A;  2UY1 A;  3OAW A;  1GW6 A;  4UI9 J;  1JWF A;  2HO1 A;  2NSZ A;  3MEK A;  1YA0 A;  3NF1 A;  3U3W A;  4EZK A;  4GZ5 A;  5KJL A;  5CHE E;  3SBS A;  4GZD A;  3FTU A;  3CQG B;  1IQU A;  3CHS A;  3JCK C;  3CSF A;  1ZU2 A;  4C0E A;  4AVX A;  4N5C A;  3CKB A;  4DK5 A;  4N3C A;  1WM5 A;  3EHM A;  4GYW A;  3JYS A;  4U63 A;  4DI4 A;  5J08 A;  2FEZ A;  3FTW A;  4C9B B;  1HXI A;  4N2S A;  3T5X A;  4FP7 A;  4NQ0 A;  5G04 C;  4ATG A;  4NUR A;  3UUX A;  4HOQ A;  4HFG A;  1MHQ A;  2WXO A;  4JEU A;  4R7L A;  3HIZ A;  4YND A;  3QAQ A;  4BT8 A;  2RG8 A;  2KZT A;  2Q7F A;  3CHQ A;  2C0M A;  2BF0 X;  3G2V A;  3PEV B;  4FHJ A;  5AIJ A;  2PQN A;  3PUJ A;  1IHG A;  4CGV A;  3VTX A;  4JPS A;  3LEW A;  5ANR A;  4A3T A;  3QNK A;  3SD5 A;  4J8F A;  4I1O B;  3QAR A;  2NC9 A;  5A7D B;  3U64 A;  4N3B A;  2IF4 A;  3CHM A;  5BNW A;  4YVQ C;  2WXN A;  3E4B A;  4UQX A;  2WMO A;  3FUK A;  2IOL A;  1L5J A;  4AJW A;  3QK0 A;  3FTS A;  2A4Z A;  3QWP A;  3I4R B;  3FUH A;  2V0P A;  3FU5 A;  3AU5 A;  4Q94 A;  4U0S A;  2WB2 A;  4AM9 A;  3LVR E;  3MKR A;  4N39 A;  3FTZ A;  4AIF A;  2I2O A;  4FUL A;  3CK7 A;  5EKQ D;  3LVQ E;  4G26 A;  3RIB A;  1DNP A;  4EBA A;  1UW4 B;  3RO3 A;  2VSY A;  3ZVV A;  5JJ6 A;  1IYG A;  2ILR A;  3FUF A;  4ILH B;  4JHK A;  3UQ3 A;  3RU0 A;  1H2V C;  5ENN A;  3FTV A;  3K9I A;  3ZGQ A;  2WXG A;  3FY4 A;  4XI0 A;  2AXV A;  3RJV A;  4E85 A;  4A55 A;  2MHK A;  3PVL A;  2KAT A;  2XEV A;  4HS2 A;  2WXR A;  3AS4 A;  3D9N A;  5LX8 A;  2JLB A;  3IEG A;  1HG2 A;  1X5B A;  3I4G A;  4ANV A;  4D10 C;  2UY1 B;  4KZ0 A;  2WPV A;  1FVH A;  4FC8 A;  1H6K A;  4GML A;  1ELK A;  4MLP A;  4Q69 A;  2YHC A;  2VYI A;  3B7R L;  2LAI A;  3EIQ C;  3HHM A;  1PY1 A;  3LS8 A;  3D9L A;  2I9C A;  4GB9 A;  4I9C A;  3KAE A;  3CR3 A;  3CKC A;  4LCT A;  5E75 A;  3R7Q A;  4BSX A;  2QY7 A;  2X6I A;  4KYO B;  1HE8 A;  4OVV A;  2CG2 A;  5FT9 A;  5BW8 C;  5G2N A;  3RO2 A;  3S2A A;  4AV7 A;  5A23 A;  4CEM A;  2CHX A;  3CVN A;  2WXJ A;  5BUZ A;  3FHE A;  3WXX A;  3PS6 A;  4WAF A;  1HF8 A;  4I6J A;  2CHZ A;  2CG3 A;  5BV0 A;  5E76 A;  3FUN A;  4HOS A;  3NZU A;  3FUE A;  4JA7 A;  2CHW A;  5FQ7 A;  4UWL A;  5FZR A;  2L0I A;  4B89 A;  1FCH A;  3Q4A B;  1ZBP A;  3CHO A;  5JHA A;  3B13 A;  4M3O A;  4LER A;  3S7B A;  3MJW A;  1NZN A;  1UN9 A;  3ESL A;  3D9P A;  3P2B A;  4KMO A;  3FWV A;  4GU5 A;  2XPZ A;  2WXF A;  3UX4 A;  2UWJ G;  4EZL A;  4GCO A;  2GRM A;  1KT0 A;  2VGY A;  3FP3 A;  4GCN A;  4XZ4 A;  2BUG A;  3LPZ A;  3OTN A;  4I17 A;  5AJL A;  3BG0 B;  1EYH A;  3FTX A;  2E0I A;  5LCW J;  3SF4 A;  3FU0 A;  5FQ8 A;  3PH0 C;  1QQE A;  4ANW A;  4L7T A;  1E7V A;  4FU3 A;  1Y6I A;  3LXU X;  4CCA A;  3CK9 A;  4B0Z A;  3RRM B;  3D9O A;  5LP0 A;  4HOT A;  1HH8 A;  1TJC A;  1Y8M A;  4IN3 B;  2HYZ A;  4GA2 A;  2LSU A;  3ESK A;  1A17 A;  3L54 A;  4RG9 A;  1PC2 A;  3GW4 A;  4AEZ C;  3NZS A;  2OVF A;  2IOS A;  4B8A A;  3O48 A;  3ZHE B;  2C2L A;  3CGH A;  3GZS A;  4GA0 A;  4EPZ A;  4ANX A;  1EDU A;  2KC7 A;  3CK8 A;  5JHB A;  1UJK A;  2KM4 A;  2GW1 A;  4J8S A;  2XQ0 A;  3HYM B;  1UG3 A;  4B94 A;  4AXH A;  5CCL A;  2R5S A;  3BEE A;  4KVO A;  4QFV A;  3APC A;  3CVY A;  1UN8 A;  4AOF A;  3UT7 A;  2J4B A;  3CHP A;  2AVP A;  2HM8 A;  4G24 A;  4GPK A;  4FJY A;  1HFA A;  4KXK B;  4GYO A;  4TRQ A;  4P29 A;  3QOU A;  3GYZ A;  2J09 A;  4JVS A;  3OXF A;  3ASD A;  3APD A;  3RKV A;  1Z3Y A;  5C1D A;  3TG4 A;  4JW1 A;  3S7J A;  1H2T C;  3S7D A;  3FH7 A;  1NA0 A;  3APF A;  4GZ6 A;  3ZYL A;  4LEU A;  1W3B A;  3IBE A;  3LCA A;  3CVL A;  3ZN3 A;  3IHV A;  4UWG A;  3ZYM A;  3CV0 A;  4HLE A;  1EF1 C;  1ELR A;  3DPD A;  4MKT A;  4UQY A;  3AU4 A;  1E96 B;  2P58 C;  1P5Q A;  4FLB A;  3SI5 A;  4CDR A;  1SQM A;  2JEK A;  1NP7 A;  2AW6 A;  3ZYQ A;  3QWW A;  4I43 A;  4AP2 A;  3ASF A;  4KVM A;  4I1M A;  2OV8 A;  4CT0 A;  4AY6 A;  2VSN A;  3TAX A;  4KBQ A;  2XHE A;  1OWP A;  3IKO B;  4V3I A;  5G05 J;  1IQR A;  4U0U A;  3PUK A;  4I6E A;  2VGX A;  4I2W A;  4CT4 A;  4Q96 A;  4JA9 A;  4PS7 A;  3FUJ A;  1HG5 A;  4FAD A;  2VTB A;  5T3R A;  2AXZ A;  2Y3A A;  3AS8 A;  5AYW D;  3L16 A;  1WAO 1;  2XRY A;  4PS3 A;  4ANU A;  4PH4 B;  4B8C B;  4FJZ A;  4JHJ A;  4J6I A;  5HI7 A;  3MA5 A;  4ILI A;  4BWR A;  3ULQ A;  1TJF A;  1VDY A;  3G2U A;  3N71 A;  2OND A;  3D9M A;  4WWN A;  3ASG A;  1JPL A;  2Y4U A;  4RSY A;  4BTA A;  3SNX A;  3P1U A;  4L2L A;  1EPU A;  2XCB A;  2WMN A;  3C98 A;  4JHR A;  3ONL A;  2E2E A;  3KD7 A;  3QKY A;  4WND A;  5DIZ A;  2OOE A;  4Y6C A;  5BT1 A;  1BPO A;  4XKB A;  3O4Z A;  4UI9 C;  3UT8 A;  5CMW A;  4EZJ A;  5ANL A;  3NQP A;  1PAQ A;  4XI9 A;  3CST A;  2X3M A;  3G2W A;  4PDX A;  1Z6T A;  3VLE A;  4F7A A;  2NXP A;  3LY9 A;  4L2Y A;  2I1J A;  4L23 A;  5BV1 A;  1E90 A;  2R59 A;  5CCM A;  4WNG A;  4FLH A;  4HOU A;  3TJP A;  4ME2 A;  2BTD A;  2HR2 A;  2VJ8 A;  4WUY A;  3VLF A;  4U07 A;  2KZT B;  1N54 A;  4W9R A;  4A1S A;  3MKQ A;  3CVW A;  1LF8 A;  2ION A;  3EDT B;  4BTB A;  4CDM A;  3MGB A;  2J07 A;  2WXK A;  3FU3 A;  3RRU A;  4UQZ A;  4BY6 A;  4U8H A;  4HVB A;  4WNF A;  4CRW A;  4EQF A;  4IUL A;  2J9Q A;  1OWM A;  4ACK A;  1Z3X A;  3U9W A;  3D9J A;  1FVF A;  3HVE A;  2FUL A;  2RD0 A;  2WM9 A;  3G2S A;  5EX0 A;  4DI3 A;  3CVU A;  4RG6 A;  3FUL A;  4E6H A;  4YVO A;  3CVP A;  4G25 A;  5EX3 A;  2IQC A;  2MOW A;  2VSX E;  5KJM A;  4AY5 A;  3FFL A;  4EEC A;  5FJY A;  5FZS A;  4O6F A;  4RVB A;  3T8M A;  4JXT A;  2PM7 A;  2EQX A;  1E8W A;  1DVP A;  3PZD A;  3FUI A;  3BG1 B;  3KEZ A;  3L13 A;  4JEH A;  4F1S A;  4JL0 A;  2R17 C;  2VGX B;  2C0L A;  1E8Z A;  4I2Z A;  3ML8 A;  4GAA A;  4J0U A;  2LNI A;  3SZ7 A;  4DPR A;  1H2U A;  2I1K A;  2DIW A;  4PUC A;  4G2V A;  2WXM A;  4HOR A;  3OXL A;  3ZXS A;  3FTY A;  3TL5 A;  4U0Z A;  2FF4 A;  3CHR A;  3CVV A;  1TEZ A;  3JQ1 A;  1HX8 A;  3MX3 A;  3EHN A;  4BT9 A;  2XGS A;  2PQR A;  4H7Y A;  2CFU A;  2V5F A;  3IV0 A;  4A3V A;  5T8I A;  3TGO A;  3FH5 A;  2LAH A;  3L6A A;  1INZ A;  2L0T B;  1SZ9 A;  4UI9 K;  4APO A;  1H19 A;  3ZEF A;  4UWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...