2GRQB

Crystal structure of human rangap1-ubc9-d127a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
total genus 57
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grqB00
2GRRB 2GRQB 2IO2C 1Z5SC 2GRPB 1KPSB 2IO3C 5D2MC 3UIPC 2IY0C 3UIOC 2GROB 3UINC 2GRNB
chains in the Genus database with same CATH superfamily
3MX3A 2E0IA 2A5EA 4GYYA 3D9OA 4HI9A 2MHKA 5T8IA 4LNBA 5EDSA 4ZHBA 2WXHA 2Y4TA 5H7PA 4RQIA 5AIJA 5BXOA 3ENEA 4J8FA 3ZEFA 3TL5A 3MKQA 2WMNA 2DWZA 4I1OB 5JMND 3PZ3A 3D9NA 4GTPA 2OOEA 2CFZA 5CRVA 3MZLB 5KJLA 5EIDA 1NFIE 1X81A 4JHKA 2AW6A 4U63A 3FH5A 4UWGA 3Q49B 3CIAA 2AXUA 3HIZA 3DSSA 4TXPA 3CHRA 2AWIA 4DX7D 1SQMA 3TJPA 5IY5E 5ANRA 3HXFA 4XX5A 2DBAA 4WWOA 5ITZF 3LDZA 4ANVA 1NL4A 3L9TA 3QWPA 2XENA 1DC2A 1KZPA 5JJ6A 2EIME 2J9QA 1JWFA 1Z5SC 2XGMA 2LSVA 3MA5A 3UI2A 2VTBB 2QFCA 4DX1A 4M7CA 1OUVA 3CK7A 1SZ9A 1DVPA 5G2NA 3FULA 3I3NA 3BUAA 3RK6A 2XZTG 3ZYKA 5DIZA 5BV0A 3FUNA 1K8KG 2A5UA 3OAWA 4RG9A 3K9IA 1WY6A 4I9CA 4A3TA 4ATGA 4BTAA 2RG8A 3FU3A 2DIWA 1IXVA 4N5CA 4L9PA 4G1TA 4CDMA 5G05J 2L9BA 3MCXA 3FTSA 3NZUA 1MHQA 4K5CA 3JUIA 4AM9A 4UWLA 3LVQE 3D9JA 5D66A 3MGBA 3PS6A 2NC9A 4JEHA 4I6GA 3E32A 1HS6A 3ULQA 5DBKA 4JHJA 1N52A 4G8KA 4BFRA 1BI7B 1KPSB 2UWJG 4JA9A 4APOA 4GTMA 4P29A 2X6KA 4HNAD 3T5VA 1PC2A 1P5QA 3VTXA 1OWMA 3SI5A 4A1GA 4EHMA 5LP0A 3AG1E 1HX8A 2Y69E 4OAVB 4BSZB 2WQ7A 5HI7A 3RJVA 3IXEA 2NSZA 4JW1A 4GZ6A 2RKKA 1NA0A 4QQIA 3FUMA 3DXKG 1PY1A 3C3QA 1H19A 4KMOA 5BT1A 1GW6A 5CRUA 2LUHA 1MQSA 2WXNA 4GPKA 4WWNA 4J8SA 1G3NB 5AQ9A 3Q9NC 4CT0A 3T9KA 4U95D 3CVQA 1HO8A 2YQ8A 3RIBA 2P9NG 4BX8A 1ZBPA 1OWOA 3FTZA 1LTXA 3UX4A 4BT9A 4CEMA 3OXLA 3QWVA 4XKCA 3SHFA 3CVUA 3HXBA 2IJGX 4BETA 3PZ1A 1OCOE 1TNUA 2FO7A 5FQ8A 3EDTB 1DCQA 4A3VA 3PEUB 1NP7A 2ZIRA 3FTUA 5T3RA 4HLLA 3FUKA 4GA0A 1TJCA 4I9EA 4WAFA 3PUJA 4YDYA 4CGWA 4GMJA 4I6JA 2X38A 4I6EA 1QYMA 1N4QA 2IEJA 5ENNA 4FP7A 4YDEA 1KLXA 4N39A 3RRUA 4GCNA 1HFAA 2H6IA 3CVPA 4WNGA 3TWXA 3ZPJA 3CVNA 5HRYA 1YYHA 4URKA 2VSYA 3BEEA 5AJLA 1N4RA 4U8YD 3TWWA 1W3BA 3CHOA 2DZNA 4U07A 1U3DA 3G2WA 2J4BA 2KCKA 3ONLA 4HI8A 3PZ2A 5HS0A 2J07A 4A1SA 1OCCE 2ZGGA 1E8XA 3FTWA 3Q47B 3OXGA 2YNQA 4ANUA 2R59A 5CCMA 4UWFA 1UN9A 4U8VD 5D0OD 3CLJA 4OAUC 4J0UA 2VGYA 4ACLA 3TAXA 3G2SA 2XPYA 3CEQA 3QOUA 2CG2A 3LJNA 2IY0C 2L6JA 4FHKA 1DNPA 3UT7A 2OV8A 4WNFA 2EILE 3JXJA 1JUQA 4N5QA 3FUIA 3TG4A 3FEXA 3Q75A 5CHEE 5BXUA 2LXLA 2IU1A 3SO8A 3CQCB 4LERA 3P2BA 3FTVA 1U3CA 3LCAA 2X6FA 1N0QA 2J49A 3ASFA 4TRQA 3V30A 3LJ3A 3ZRHA 5ARFA 4GZCA 4GZDA 3LY7A 5JHAA 2BF0X 2RFMA 4BSXA 3UTMA 2QYJA 4B8CB 1QBQA 5FIOA 3AU4A 3SBTB 5B3SE 2KC7A 1H6OA 2KM4A 3C3RA 3ZYLA 5FZQA 3SY2A 2B0OE 3O4ZA 2XEHA 3AS5A 5CBOA 3NQPA 4XIFA 1JWGA 4G25A 4YVQC 4CZ2D 2PQRA 1N95A 1BI8B 4GAAA 2AXVA 3AJIA 2BEDA 1UJKA 2IFUA 3Q15A 4KZ0A 3PNLB 3CKCA 3ZHEA 3IBEA 2HR2A 4HVBA 1YMPA 2ZU6B 1ZU2A 5AAOA 2H6HA 3IV0A 3CHPA 5ENSD 1H0AA 2Y0BG 3PREA 3CK9A 3JQ0A 4AY5A 1OWLA 5EN5D 4NRHB 1U2VG 1Y8MA 3I5PA 1JCSA 4U8HA 3TGOA 5KNGA 4TV3A 2PL2A 1N94A 3AG2E 3UQ3A 3QAQA 1ZB1A 5FINA 3CSFA 2IQCA 5CMYA 2HE0A 3B7RL 3ISMC 4C9BB 4GTOA 3R9AB 3PE4A 4YDWA 5CCLA 3QB2A 4G23A 4MKTA 4L1BA 3D9KA 2GROB 3FUJA 1S70B 3LYAA 4ZFHA 3E33A 2NYJA 5BUZA 3SF4A 4E85A 2IOSA 3SZ7A 3G2UA 3ZNGA 4O6FA 3U9WA 4N2SA 1KT1A 4H7XA 3C98A 4G2VA 2ONDA 5E75A 1Z3XA 4BX9A 1ELRA 3RO2A 4I1MA 4L2LA 2C0MA 4JVSA 3EU5A 4OYSA 3RU0A 2VSXE 3HYMB 4BY6A 3R9MA 3B7SA 3ASHA 4QFVA 2WXOA 3ZU7B 4GYWA 2OVFA 4C0EA 2R5SA 4DUIA 1A5EA 3BQOA 1FVFA 4GCOA 4I17A 4G8LA 2XHEA 1OCRE 2PQNA 3EHMA 2A4ZA 2E2EA 3JQ1A 3CV0A 3LKUA 4UWKA 4ANWA 4F3VA 3B7TA 1TYQG 1Q2ZA 4ILIA 1TN8A 1OWPA 4EECA 2QC9A 4PS7A 4KVOA 4OVUA 4U96D 1E8YA 3DSXA 1QZ2A 4HXIA 1VDYA 3AG4E 3G2TA 3E30A 3BG0B 4MBGA 5HQ8A 1D9SA 2QZAA 3V31A 2IO2C 4J7WA 3DSWA 4M3OA 4J6IA 3L17A 1EYHA 2J4DA 2L0IA 3HXDA 1AWCB 4J8YA 4YDOA 3J5QB 3DPYA 4GTRA 2GRRB 4EQFA 4FLBA 5ENPD 3FFLA 4MLPA 4XEIG 2WMOA 3ZXSA 2FF4A 1BLXB 3FU5A 3CHMA 4Q69A 5EILA 4NIKA 3PRZA 4F6RD 1MX4A 3NBNB 4FC8A 5JJTA 2I6HA 2J08A 3IHYA 3U3WA 2VGXA 4B0ZA 2DCPA 4F1SA 2P9LG 4UUCA 5ANLA 3FH8A 1TN6A 5EX0A 3UM1A 1JCRA 2VJ8A 1SZAA 4GTSA 4C48B 4X8QA 4DPRA 3SGHA 3FDHA 4ILHB 4FA6A 1HE8A 1O1RA 4NACA 2YHCA 2B6CA 1Z3YA 2WXRA 4JXTA 3UINC 2GRNB 4G24A 3E37A 4O60A 3WG7E 3UKUG 4I43A 3HVEA 3TWRA 1N11A 4BTBA 1SW6A 4XZ4A 3BG1B 5AJDA 3FU0A 3DSVA 1H6PA 5KCMA 4AJWA 3UT4A 4U0ZA 1FT2A 3APFA 2WXJA 3T8KA 3X2QE 5KBAA 4PUCA 2AJAA 4EZJA 2I1JA 4U7EB 3KSLA 3S7DA 3ASOE 3FP3A 1FVHA 1N9AA 1O5MA 5AQ7A 2BTDA 2WXKA 2VQ2A 3PH0C 4W9RA 3LS8A 5D0QD 3EJNA 3KEZA 3TWQA 4DLQA 2V5FA 2ETCA 2ILRA 3PZDA 1FCHA 1WG0A 1BPOA 4V3IA 2H6FA 3ESLA 4K0RA 3JYSA 4EBAA 3FH7A 3NOGD 4ABNA 3NZSA 2R03A 2Q7FA 2NXPA 1FPPA 1ELKA 3ZUVB 3LY8A 1EPUA 3TWUA 1HH8A 1EF1C 3MKQB 4L7TA 1TJFA 4LNGA 2X3MA 3T8MA 2KCLA 5ENTD 2P58C 2Y3AA 4RSYA 5KWDA 3HG0D 4TXQA 4J8DA 2X6JA 3FHEA 1JCQA 3B13A 3J5PA 1OXJA 4AIFA 4IN3B 3GZ1A 1UG3A 3L82A 4DRXE 2GRMA 3UIOC 4HOQA 2ETAA 2RFAA 3S7JA 4ATZD 3GZ2A 3QC1A 1UOHA 4JZYA 4YNDA 4HB5A 4HRLA 1IYGA 2J09A 3NOCD 3G2VA 5BPPA 1YCSB 4KVMA 4FJYA 3ESKA 1IHBA 1D8DA 5FZRA 5CBNA 1UN8A 2WXGA 4HQDA 3ZW3A 3FTXA 1JPLA 4KZCA 3DSUA 3QK0A 1QQEA 2V4HC 5CECB 1L5JA 2FULA 4Q94A 1E8ZA 3VLDA 1IQUA 4D10C 3AS4A 2PNNA 5KJKA 4Y6WA 2VSNA 3FUFA 5BNWA 1Z6TA 5FWQA 3KEAA 4H7YA 4IULA 3V2OA 5A6CA 1H2VC 2XQ0A 3UMVA 3TXNA 3JUEA 3V2XA 5EKQD 4U0SA 3SFZA 3UUXA 2AXZA 4UQZA 5FTPA 3DRAA 4LG6A 4PH4B 3TWTA 3D9IA 2VGXB 4K5BA 1TNZA 2VTBA 1B89A 2KZTA 4AY6A 2CFUA 3KD7A 3QNKA 3Q7FA 1LD7A 2HM8A 1SA5A 2WQHA 2OEVA 3PNTB 3CHQA 4DLOA 4Y6CA 2KBXA 2LNIA 4DX5D 4J8EA 5ENOD 5AQAA 1TNBA 4GZ5A 1D8EA 3ASDA 4F53A 3S7FA 2ZGDA 3CKBA 1BU9A 2V4LA 4APFA 3CVLA 1TNOA 2M63A 1HG2A 1OY3D 4HRNA 3LEWA 3R7RA 3ZYQA 3DEPA 3HVEB 1K1BA 2EQXA 2QY7A 4DI4A 4ME2A 4AEZC 3C72A 4O1OA 1ELWA 2MRIA 2KXPC 4EPZA 4FJZA 4KYOB 2ETBA 2ZXWE 2XS8A 3PE3A 2FI7A 4NURA 3EHNA 3O48A 4TXRA 4I2WA 3SBSA 4EBAG 4G11A 3EIQC 2V0PA 4RVBA 4N3AA 3UT8A 4JPSA 1SVXA 2KATA 4MRUA 2P9PG 3Q4AB 3DSTA 3QWWA 3C3OA 2V8SE 3DXMG 4BERA 3W9FA 1RW2A 3ULEG 2BKGA 3CVVA 2ZISA 2C2LA 4AOFA 4LRZA 1LF8A 1H2UA 4A55A 4PS8A 5FQ7A 2QYUA 4UWHA 4ANXA 3AU5A 3TWSA 3SQVA 3ONKA 2GRQB 1PAQA 4NQ0A 3SFXA 5D2MC 2VSOE 3UPVA 4HBDA 2CHXA 1MJ0A 1HF8A 5CERB 2H6GA 2WB2A 3L6AA 2WVIA 5EYLA 2EINE 3B7BA 3L13A 4CDNA 4EZLA 2MYOA 4N2QA 1S64A 5HKPA 4TUUA 3SD5A 3HXEA 3ZGQA 2Y1LE 2I1KA 4RLYA 4CRWA 5FQ4A 3SFYA 1MX2A 4FU3A 5AENA 1K3ZD 1NI1A 1K1AA 1OWNA 2FO1E 4OVVA 1LD8A 4FLHA 4IRUA 2P9UG 2DYSE 4GB9A 5C1DA 2V5QC 2WXMA 2XGSA 2HO1A 2IF4A 2JLBA 1WDYA 3KS2A 3CVYA 2RD0A 5B1BE 4WNDA 3D9HA 2PM6A 2WPVA 4HRMB 5G55A 3S2AA 4JEUA 5ENQD 2PM7A 3UM3A 3MV3B 5LOZA 2P9KG 2CHZA 3TXMA 4JA7A 1V54E 3S7BA 4AP2A 3E34A 4L23A 4GZ3A 5FJYA 3QJZA 3NAWA 2KCVA 4LEUA 2EIJE 1S0PA 3ML9A 3ZFWA 3EUVA 3Q9UC 3DEOA 3VLEA 1DCEA 2L0TB 3CQGB 3OTNA 1KZOA 1Y6IA 2LAHA 4GA1A 4AXHA 3ZKJA 2JABA 1E96B 3UXGA 2UY1A 4YVOA 4ILGA 4BEPA 3FU6A 5A7DB 4DX2A 4CYMD 3CVWA 3CGHA 3NF1A 3V79K 1FT1A 1N0RA 5KJNA 2OVBA 3L08A 1WM5A 4N3BA 2IOLA 2IO3C 2EIKE 2KZTB 3CR3A 3ABKE 5EYPF 5JA4D 4R7LA 1INZA 2XRZA 3KSQA 2WXLA 3AAAC 3VTYA 1KT0A 2P9SG 2R02A 3FUDA 1MYOA 3I4GA 1E90A 3D9LA 3DBSA 4LNUD 2CHWA 1RZ4A 3DPDA 5LX8A 2OCCE 4FULA 4PDXA 3Q79A 4IYPA 3I4RB 3EIJA 4C0MA 3D3MA 3RO3A 3ZHEB 1TR4A 1MX6A 3IEGA 3UM0A 5J90A 5AQBA 4G26A 3LXUX 2F37A 2WQ6A 3GW4A 5C2YA 4GMRA 1HZ4A 4RG6A 3L22A 2R2LA 4L2YA 4WUYA 4CGVA 3FY4A 2J8SD 4UI9C 2XS1A 3UIPC 3CHSA 3HRAA 4UI9K 2XEEA 2GGFA 1NZNA 4JB8P 1E7VA 3HHMA 3IKOB 5FQ6A 2YINA 1TNYA 3L54A 3Q5MA 3LVRE 3U4TA 3BU8A 2DYRE 4O1PA 4DJAA 2F8XK 5EIBE 5FZSA 4TUMA 3PVLA 4WNEA 4HOTA 4JD2G 2LO6A 5M72A 2CG3A 3ZYMA 5G04C 3ZN3A 3Q73A 2I2OA 5A23A 4B94A 1QNFA 5BW8C 3B95A 4U0UA 3RAUA 1IQRA 2GRLA 5E76A 2WM9A 5JJ7A 4DX6D 2I9CA 5FT9A 5T4YA 1E8WA 3EHRA 4JL0A 4XE0A 3ABLE 4B8AA 1XGWA 3WXXA 5LCWC 3FEYA 3RRNB 4GA2A 3W9GA 1HU3A 4XI0A 1H2TC 3U64A 1UJJA 5KNHD 4GU5A 3LPZA 4CT4A 2WXPA 4BESA 2Y4UA 1V55E 3ZVVA 2C0LA 4GMLA 3FUEA 3APDA 5B1AE 3RSEG 2PZIA 4KT6B 3FWVA 3CVXA 3PEVB 3APCA 2XGOA 4FADA 3ZIMA 2P2CP 2F8YA 4AVXA 2XCCA 5CMWA 4F1PA 3FTYA 3MJWA 4E6HA 2LAIA 5EX3A 4HOSA 4KBQA 3MEKA 3ASGA 3VLFA 2L6BA 4GYOA 2MOWA 1AP7A 1WAO1 1OT8A 5ENRD 1IHGA 4DK5A 5LFAA 2IONA 5AYWD 3N71A 2XCBA 5KJMA 3PDNA 2UY1B 1N4SA 1MZCA 1N4PA 3EU9A 2XEVA 2X6IA 5AARA 3FUHA 2BKKB 1H6KA 3CK8A 4BWRA 3UKRG 5AN8A 3OXFA 4UQYA 4GTVA 3T5XA 1O1SA 2WXFA 4FHJA 2DZOA 1TN7A 2X6HA 4KXKB 2XZDG 1A17A 3HXCA 4MS6A 2GRPB 4K5AB 3QARA 4UI9J 4B89A 3KAEA 2OEWA 4GTQA 4JHRA 3AG3E 4LUNU 4N3CA 3SNXA 4B93B 2P9IG 3E4BA 5CEDB 4HOUA 2VGEA 5J08A 4UQXA 4CCAA 3DWLG 3ZXPA 1TEZA 3UM2A 1OCZE 1IKND 3QKYA 2LSUA 1BD8A 4XKBA 4LSZE 2GW1A 1N54A 5BV1A 5G04J 2XPZA 3B7UX 4Q96A 1XNFA 4JC8A 4HFGA 3GYZA 3Q7AA 3PZ4A 3JXIA 2HYZA 3MKRA 1YA0A 3HDXA 3TG5A 1HG5A 4PS3A 2BUGA 1S63A 1X5BA 3PUKA 3C5RA 4I1AA 5LCWJ 4U04A 4HORA 2F0YA 4LCTA 4DI3A 3RKVA 2FEZA 3D9PA 3L16A 4A63B 2XRYA 2WXQA 4GTTA 2LXMA 5G05C 4HLEA 3RRMB 3CSTA 2R17C 3URZA 3ASNE 4EZKA 3JCKC 2FBNA 3Q78A 3MV2B 1HXIA 1E7UA 1UW4B 3EHQA 3D9MA 2R05A 4AV7A 3F6QA 4I2ZA 3AS8A 3ML8A 3MYVA 1NA3A 1EDUA 3GZSA 3U66A 2VYIA 4WWPA 2YHEA 4XI9A 1SA4A 2AVPA 3P1UA 4BT8A 2WXIA 3ULYA 4K03A 3LY9A 4HS2A 1O1TA 4Z68A 3IHVA 4ACKA 4F7AA 3ABME 4GPMA 4CDRA 5ARGA 2DVWA 3QDNA 2XPIA 5CEAA 5JHBA 3R7QA 2JEKA 3TWVA 3NB2A
chains in the Genus database with same CATH topology
2GRRB 2GRQB 2IO2C 1Z5SC 2GRPB 1KPSB 2IO3C 5D2MC 3UIPC 2IY0C 3UIOC 2GROB 3UINC 2GRNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GRR B;  2GRQ B;  2IO2 C;  1Z5S C;  2GRP B;  1KPS B;  2IO3 C;  5D2M C;  3UIP C;  2IY0 C;  3UIO C;  2GRO B;  3UIN C;  2GRN B; 
#chains in the Genus database with same CATH topology
 3MX3 A;  2E0I A;  2A5E A;  4GYY A;  3D9O A;  4HI9 A;  2MHK A;  5T8I A;  4LNB A;  5EDS A;  4ZHB A;  2WXH A;  2Y4T A;  5H7P A;  4RQI A;  5AIJ A;  5BXO A;  3ENE A;  4J8F A;  3ZEF A;  3TL5 A;  3MKQ A;  2WMN A;  2DWZ A;  4I1O B;  5JMN D;  3PZ3 A;  3D9N A;  4GTP A;  2OOE A;  2CFZ A;  5CRV A;  3MZL B;  5KJL A;  5EID A;  1NFI E;  1X81 A;  4JHK A;  2AW6 A;  4U63 A;  3FH5 A;  4UWG A;  3Q49 B;  3CIA A;  2AXU A;  3HIZ A;  3DSS A;  4TXP A;  3CHR A;  2AWI A;  4DX7 D;  1SQM A;  3TJP A;  5IY5 E;  5ANR A;  3HXF A;  4XX5 A;  2DBA A;  4WWO A;  5ITZ F;  3LDZ A;  4ANV A;  1NL4 A;  3L9T A;  3QWP A;  2XEN A;  1DC2 A;  1KZP A;  5JJ6 A;  2EIM E;  2J9Q A;  1JWF A;  1Z5S C;  2XGM A;  2LSV A;  3MA5 A;  3UI2 A;  2VTB B;  2QFC A;  4DX1 A;  4M7C A;  1OUV A;  3CK7 A;  1SZ9 A;  1DVP A;  5G2N A;  3FUL A;  3I3N A;  3BUA A;  3RK6 A;  2XZT G;  3ZYK A;  5DIZ A;  5BV0 A;  3FUN A;  1K8K G;  2A5U A;  3OAW A;  4RG9 A;  3K9I A;  1WY6 A;  4I9C A;  4A3T A;  4ATG A;  4BTA A;  2RG8 A;  3FU3 A;  2DIW A;  1IXV A;  4N5C A;  4L9P A;  4G1T A;  4CDM A;  5G05 J;  2L9B A;  3MCX A;  3FTS A;  3NZU A;  1MHQ A;  4K5C A;  3JUI A;  4AM9 A;  4UWL A;  3LVQ E;  3D9J A;  5D66 A;  3MGB A;  3PS6 A;  2NC9 A;  4JEH A;  4I6G A;  3E32 A;  1HS6 A;  3ULQ A;  5DBK A;  4JHJ A;  1N52 A;  4G8K A;  4BFR A;  1BI7 B;  1KPS B;  2UWJ G;  4JA9 A;  4APO A;  4GTM A;  4P29 A;  2X6K A;  4HNA D;  3T5V A;  1PC2 A;  1P5Q A;  3VTX A;  1OWM A;  3SI5 A;  4A1G A;  4EHM A;  5LP0 A;  3AG1 E;  1HX8 A;  2Y69 E;  4OAV B;  4BSZ B;  2WQ7 A;  5HI7 A;  3RJV A;  3IXE A;  2NSZ A;  4JW1 A;  4GZ6 A;  2RKK A;  1NA0 A;  4QQI A;  3FUM A;  3DXK G;  1PY1 A;  3C3Q A;  1H19 A;  4KMO A;  5BT1 A;  1GW6 A;  5CRU A;  2LUH A;  1MQS A;  2WXN A;  4GPK A;  4WWN A;  4J8S A;  1G3N B;  5AQ9 A;  3Q9N C;  4CT0 A;  3T9K A;  4U95 D;  3CVQ A;  1HO8 A;  2YQ8 A;  3RIB A;  2P9N G;  4BX8 A;  1ZBP A;  1OWO A;  3FTZ A;  1LTX A;  3UX4 A;  4BT9 A;  4CEM A;  3OXL A;  3QWV A;  4XKC A;  3SHF A;  3CVU A;  3HXB A;  2IJG X;  4BET A;  3PZ1 A;  1OCO E;  1TNU A;  2FO7 A;  5FQ8 A;  3EDT B;  1DCQ A;  4A3V A;  3PEU B;  1NP7 A;  2ZIR A;  3FTU A;  5T3R A;  4HLL A;  3FUK A;  4GA0 A;  1TJC A;  4I9E A;  4WAF A;  3PUJ A;  4YDY A;  4CGW A;  4GMJ A;  4I6J A;  2X38 A;  4I6E A;  1QYM A;  1N4Q A;  2IEJ A;  5ENN A;  4FP7 A;  4YDE A;  1KLX A;  4N39 A;  3RRU A;  4GCN A;  1HFA A;  2H6I A;  3CVP A;  4WNG A;  3TWX A;  3ZPJ A;  3CVN A;  5HRY A;  1YYH A;  4URK A;  2VSY A;  3BEE A;  5AJL A;  1N4R A;  4U8Y D;  3TWW A;  1W3B A;  3CHO A;  2DZN A;  4U07 A;  1U3D A;  3G2W A;  2J4B A;  2KCK A;  3ONL A;  4HI8 A;  3PZ2 A;  5HS0 A;  2J07 A;  4A1S A;  1OCC E;  2ZGG A;  1E8X A;  3FTW A;  3Q47 B;  3OXG A;  2YNQ A;  4ANU A;  2R59 A;  5CCM A;  4UWF A;  1UN9 A;  4U8V D;  5D0O D;  3CLJ A;  4OAU C;  4J0U A;  2VGY A;  4ACL A;  3TAX A;  3G2S A;  2XPY A;  3CEQ A;  3QOU A;  2CG2 A;  3LJN A;  2IY0 C;  2L6J A;  4FHK A;  1DNP A;  3UT7 A;  2OV8 A;  4WNF A;  2EIL E;  3JXJ A;  1JUQ A;  4N5Q A;  3FUI A;  3TG4 A;  3FEX A;  3Q75 A;  5CHE E;  5BXU A;  2LXL A;  2IU1 A;  3SO8 A;  3CQC B;  4LER A;  3P2B A;  3FTV A;  1U3C A;  3LCA A;  2X6F A;  1N0Q A;  2J49 A;  3ASF A;  4TRQ A;  3V30 A;  3LJ3 A;  3ZRH A;  5ARF A;  4GZC A;  4GZD A;  3LY7 A;  5JHA A;  2BF0 X;  2RFM A;  4BSX A;  3UTM A;  2QYJ A;  4B8C B;  1QBQ A;  5FIO A;  3AU4 A;  3SBT B;  5B3S E;  2KC7 A;  1H6O A;  2KM4 A;  3C3R A;  3ZYL A;  5FZQ A;  3SY2 A;  2B0O E;  3O4Z A;  2XEH A;  3AS5 A;  5CBO A;  3NQP A;  4XIF A;  1JWG A;  4G25 A;  4YVQ C;  4CZ2 D;  2PQR A;  1N95 A;  1BI8 B;  4GAA A;  2AXV A;  3AJI A;  2BED A;  1UJK A;  2IFU A;  3Q15 A;  4KZ0 A;  3PNL B;  3CKC A;  3ZHE A;  3IBE A;  2HR2 A;  4HVB A;  1YMP A;  2ZU6 B;  1ZU2 A;  5AAO A;  2H6H A;  3IV0 A;  3CHP A;  5ENS D;  1H0A A;  2Y0B G;  3PRE A;  3CK9 A;  3JQ0 A;  4AY5 A;  1OWL A;  5EN5 D;  4NRH B;  1U2V G;  1Y8M A;  3I5P A;  1JCS A;  4U8H A;  3TGO A;  5KNG A;  4TV3 A;  2PL2 A;  1N94 A;  3AG2 E;  3UQ3 A;  3QAQ A;  1ZB1 A;  5FIN A;  3CSF A;  2IQC A;  5CMY A;  2HE0 A;  3B7R L;  3ISM C;  4C9B B;  4GTO A;  3R9A B;  3PE4 A;  4YDW A;  5CCL A;  3QB2 A;  4G23 A;  4MKT A;  4L1B A;  3D9K A;  2GRO B;  3FUJ A;  1S70 B;  3LYA A;  4ZFH A;  3E33 A;  2NYJ A;  5BUZ A;  3SF4 A;  4E85 A;  2IOS A;  3SZ7 A;  3G2U A;  3ZNG A;  4O6F A;  3U9W A;  4N2S A;  1KT1 A;  4H7X A;  3C98 A;  4G2V A;  2OND A;  5E75 A;  1Z3X A;  4BX9 A;  1ELR A;  3RO2 A;  4I1M A;  4L2L A;  2C0M A;  4JVS A;  3EU5 A;  4OYS A;  3RU0 A;  2VSX E;  3HYM B;  4BY6 A;  3R9M A;  3B7S A;  3ASH A;  4QFV A;  2WXO A;  3ZU7 B;  4GYW A;  2OVF A;  4C0E A;  2R5S A;  4DUI A;  1A5E A;  3BQO A;  1FVF A;  4GCO A;  4I17 A;  4G8L A;  2XHE A;  1OCR E;  2PQN A;  3EHM A;  2A4Z A;  2E2E A;  3JQ1 A;  3CV0 A;  3LKU A;  4UWK A;  4ANW A;  4F3V A;  3B7T A;  1TYQ G;  1Q2Z A;  4ILI A;  1TN8 A;  1OWP A;  4EEC A;  2QC9 A;  4PS7 A;  4KVO A;  4OVU A;  4U96 D;  1E8Y A;  3DSX A;  1QZ2 A;  4HXI A;  1VDY A;  3AG4 E;  3G2T A;  3E30 A;  3BG0 B;  4MBG A;  5HQ8 A;  1D9S A;  2QZA A;  3V31 A;  2IO2 C;  4J7W A;  3DSW A;  4M3O A;  4J6I A;  3L17 A;  1EYH A;  2J4D A;  2L0I A;  3HXD A;  1AWC B;  4J8Y A;  4YDO A;  3J5Q B;  3DPY A;  4GTR A;  2GRR B;  4EQF A;  4FLB A;  5ENP D;  3FFL A;  4MLP A;  4XEI G;  2WMO A;  3ZXS A;  2FF4 A;  1BLX B;  3FU5 A;  3CHM A;  4Q69 A;  5EIL A;  4NIK A;  3PRZ A;  4F6R D;  1MX4 A;  3NBN B;  4FC8 A;  5JJT A;  2I6H A;  2J08 A;  3IHY A;  3U3W A;  2VGX A;  4B0Z A;  2DCP A;  4F1S A;  2P9L G;  4UUC A;  5ANL A;  3FH8 A;  1TN6 A;  5EX0 A;  3UM1 A;  1JCR A;  2VJ8 A;  1SZA A;  4GTS A;  4C48 B;  4X8Q A;  4DPR A;  3SGH A;  3FDH A;  4ILH B;  4FA6 A;  1HE8 A;  1O1R A;  4NAC A;  2YHC A;  2B6C A;  1Z3Y A;  2WXR A;  4JXT A;  3UIN C;  2GRN B;  4G24 A;  3E37 A;  4O60 A;  3WG7 E;  3UKU G;  4I43 A;  3HVE A;  3TWR A;  1N11 A;  4BTB A;  1SW6 A;  4XZ4 A;  3BG1 B;  5AJD A;  3FU0 A;  3DSV A;  1H6P A;  5KCM A;  4AJW A;  3UT4 A;  4U0Z A;  1FT2 A;  3APF A;  2WXJ A;  3T8K A;  3X2Q E;  5KBA A;  4PUC A;  2AJA A;  4EZJ A;  2I1J A;  4U7E B;  3KSL A;  3S7D A;  3ASO E;  3FP3 A;  1FVH A;  1N9A A;  1O5M A;  5AQ7 A;  2BTD A;  2WXK A;  2VQ2 A;  3PH0 C;  4W9R A;  3LS8 A;  5D0Q D;  3EJN A;  3KEZ A;  3TWQ A;  4DLQ A;  2V5F A;  2ETC A;  2ILR A;  3PZD A;  1FCH A;  1WG0 A;  1BPO A;  4V3I A;  2H6F A;  3ESL A;  4K0R A;  3JYS A;  4EBA A;  3FH7 A;  3NOG D;  4ABN A;  3NZS A;  2R03 A;  2Q7F A;  2NXP A;  1FPP A;  1ELK A;  3ZUV B;  3LY8 A;  1EPU A;  3TWU A;  1HH8 A;  1EF1 C;  3MKQ B;  4L7T A;  1TJF A;  4LNG A;  2X3M A;  3T8M A;  2KCL A;  5ENT D;  2P58 C;  2Y3A A;  4RSY A;  5KWD A;  3HG0 D;  4TXQ A;  4J8D A;  2X6J A;  3FHE A;  1JCQ A;  3B13 A;  3J5P A;  1OXJ A;  4AIF A;  4IN3 B;  3GZ1 A;  1UG3 A;  3L82 A;  4DRX E;  2GRM A;  3UIO C;  4HOQ A;  2ETA A;  2RFA A;  3S7J A;  4ATZ D;  3GZ2 A;  3QC1 A;  1UOH A;  4JZY A;  4YND A;  4HB5 A;  4HRL A;  1IYG A;  2J09 A;  3NOC D;  3G2V A;  5BPP A;  1YCS B;  4KVM A;  4FJY A;  3ESK A;  1IHB A;  1D8D A;  5FZR A;  5CBN A;  1UN8 A;  2WXG A;  4HQD A;  3ZW3 A;  3FTX A;  1JPL A;  4KZC A;  3DSU A;  3QK0 A;  1QQE A;  2V4H C;  5CEC B;  1L5J A;  2FUL A;  4Q94 A;  1E8Z A;  3VLD A;  1IQU A;  4D10 C;  3AS4 A;  2PNN A;  5KJK A;  4Y6W A;  2VSN A;  3FUF A;  5BNW A;  1Z6T A;  5FWQ A;  3KEA A;  4H7Y A;  4IUL A;  3V2O A;  5A6C A;  1H2V C;  2XQ0 A;  3UMV A;  3TXN A;  3JUE A;  3V2X A;  5EKQ D;  4U0S A;  3SFZ A;  3UUX A;  2AXZ A;  4UQZ A;  5FTP A;  3DRA A;  4LG6 A;  4PH4 B;  3TWT A;  3D9I A;  2VGX B;  4K5B A;  1TNZ A;  2VTB A;  1B89 A;  2KZT A;  4AY6 A;  2CFU A;  3KD7 A;  3QNK A;  3Q7F A;  1LD7 A;  2HM8 A;  1SA5 A;  2WQH A;  2OEV A;  3PNT B;  3CHQ A;  4DLO A;  4Y6C A;  2KBX A;  2LNI A;  4DX5 D;  4J8E A;  5ENO D;  5AQA A;  1TNB A;  4GZ5 A;  1D8E A;  3ASD A;  4F53 A;  3S7F A;  2ZGD A;  3CKB A;  1BU9 A;  2V4L A;  4APF A;  3CVL A;  1TNO A;  2M63 A;  1HG2 A;  1OY3 D;  4HRN A;  3LEW A;  3R7R A;  3ZYQ A;  3DEP A;  3HVE B;  1K1B A;  2EQX A;  2QY7 A;  4DI4 A;  4ME2 A;  4AEZ C;  3C72 A;  4O1O A;  1ELW A;  2MRI A;  2KXP C;  4EPZ A;  4FJZ A;  4KYO B;  2ETB A;  2ZXW E;  2XS8 A;  3PE3 A;  2FI7 A;  4NUR A;  3EHN A;  3O48 A;  4TXR A;  4I2W A;  3SBS A;  4EBA G;  4G11 A;  3EIQ C;  2V0P A;  4RVB A;  4N3A A;  3UT8 A;  4JPS A;  1SVX A;  2KAT A;  4MRU A;  2P9P G;  3Q4A B;  3DST A;  3QWW A;  3C3O A;  2V8S E;  3DXM G;  4BER A;  3W9F A;  1RW2 A;  3ULE G;  2BKG A;  3CVV A;  2ZIS A;  2C2L A;  4AOF A;  4LRZ A;  1LF8 A;  1H2U A;  4A55 A;  4PS8 A;  5FQ7 A;  2QYU A;  4UWH A;  4ANX A;  3AU5 A;  3TWS A;  3SQV A;  3ONK A;  2GRQ B;  1PAQ A;  4NQ0 A;  3SFX A;  5D2M C;  2VSO E;  3UPV A;  4HBD A;  2CHX A;  1MJ0 A;  1HF8 A;  5CER B;  2H6G A;  2WB2 A;  3L6A A;  2WVI A;  5EYL A;  2EIN E;  3B7B A;  3L13 A;  4CDN A;  4EZL A;  2MYO A;  4N2Q A;  1S64 A;  5HKP A;  4TUU A;  3SD5 A;  3HXE A;  3ZGQ A;  2Y1L E;  2I1K A;  4RLY A;  4CRW A;  5FQ4 A;  3SFY A;  1MX2 A;  4FU3 A;  5AEN A;  1K3Z D;  1NI1 A;  1K1A A;  1OWN A;  2FO1 E;  4OVV A;  1LD8 A;  4FLH A;  4IRU A;  2P9U G;  2DYS E;  4GB9 A;  5C1D A;  2V5Q C;  2WXM A;  2XGS A;  2HO1 A;  2IF4 A;  2JLB A;  1WDY A;  3KS2 A;  3CVY A;  2RD0 A;  5B1B E;  4WND A;  3D9H A;  2PM6 A;  2WPV A;  4HRM B;  5G55 A;  3S2A A;  4JEU A;  5ENQ D;  2PM7 A;  3UM3 A;  3MV3 B;  5LOZ A;  2P9K G;  2CHZ A;  3TXM A;  4JA7 A;  1V54 E;  3S7B A;  4AP2 A;  3E34 A;  4L23 A;  4GZ3 A;  5FJY A;  3QJZ A;  3NAW A;  2KCV A;  4LEU A;  2EIJ E;  1S0P A;  3ML9 A;  3ZFW A;  3EUV A;  3Q9U C;  3DEO A;  3VLE A;  1DCE A;  2L0T B;  3CQG B;  3OTN A;  1KZO A;  1Y6I A;  2LAH A;  4GA1 A;  4AXH A;  3ZKJ A;  2JAB A;  1E96 B;  3UXG A;  2UY1 A;  4YVO A;  4ILG A;  4BEP A;  3FU6 A;  5A7D B;  4DX2 A;  4CYM D;  3CVW A;  3CGH A;  3NF1 A;  3V79 K;  1FT1 A;  1N0R A;  5KJN A;  2OVB A;  3L08 A;  1WM5 A;  4N3B A;  2IOL A;  2IO3 C;  2EIK E;  2KZT B;  3CR3 A;  3ABK E;  5EYP F;  5JA4 D;  4R7L A;  1INZ A;  2XRZ A;  3KSQ A;  2WXL A;  3AAA C;  3VTY A;  1KT0 A;  2P9S G;  2R02 A;  3FUD A;  1MYO A;  3I4G A;  1E90 A;  3D9L A;  3DBS A;  4LNU D;  2CHW A;  1RZ4 A;  3DPD A;  5LX8 A;  2OCC E;  4FUL A;  4PDX A;  3Q79 A;  4IYP A;  3I4R B;  3EIJ A;  4C0M A;  3D3M A;  3RO3 A;  3ZHE B;  1TR4 A;  1MX6 A;  3IEG A;  3UM0 A;  5J90 A;  5AQB A;  4G26 A;  3LXU X;  2F37 A;  2WQ6 A;  3GW4 A;  5C2Y A;  4GMR A;  1HZ4 A;  4RG6 A;  3L22 A;  2R2L A;  4L2Y A;  4WUY A;  4CGV A;  3FY4 A;  2J8S D;  4UI9 C;  2XS1 A;  3UIP C;  3CHS A;  3HRA A;  4UI9 K;  2XEE A;  2GGF A;  1NZN A;  4JB8 P;  1E7V A;  3HHM A;  3IKO B;  5FQ6 A;  2YIN A;  1TNY A;  3L54 A;  3Q5M A;  3LVR E;  3U4T A;  3BU8 A;  2DYR E;  4O1P A;  4DJA A;  2F8X K;  5EIB E;  5FZS A;  4TUM A;  3PVL A;  4WNE A;  4HOT A;  4JD2 G;  2LO6 A;  5M72 A;  2CG3 A;  3ZYM A;  5G04 C;  3ZN3 A;  3Q73 A;  2I2O A;  5A23 A;  4B94 A;  1QNF A;  5BW8 C;  3B95 A;  4U0U A;  3RAU A;  1IQR A;  2GRL A;  5E76 A;  2WM9 A;  5JJ7 A;  4DX6 D;  2I9C A;  5FT9 A;  5T4Y A;  1E8W A;  3EHR A;  4JL0 A;  4XE0 A;  3ABL E;  4B8A A;  1XGW A;  3WXX A;  5LCW C;  3FEY A;  3RRN B;  4GA2 A;  3W9G A;  1HU3 A;  4XI0 A;  1H2T C;  3U64 A;  1UJJ A;  5KNH D;  4GU5 A;  3LPZ A;  4CT4 A;  2WXP A;  4BES A;  2Y4U A;  1V55 E;  3ZVV A;  2C0L A;  4GML A;  3FUE A;  3APD A;  5B1A E;  3RSE G;  2PZI A;  4KT6 B;  3FWV A;  3CVX A;  3PEV B;  3APC A;  2XGO A;  4FAD A;  3ZIM A;  2P2C P;  2F8Y A;  4AVX A;  2XCC A;  5CMW A;  4F1P A;  3FTY A;  3MJW A;  4E6H A;  2LAI A;  5EX3 A;  4HOS A;  4KBQ A;  3MEK A;  3ASG A;  3VLF A;  2L6B A;  4GYO A;  2MOW A;  1AP7 A;  1WAO 1;  1OT8 A;  5ENR D;  1IHG A;  4DK5 A;  5LFA A;  2ION A;  5AYW D;  3N71 A;  2XCB A;  5KJM A;  3PDN A;  2UY1 B;  1N4S A;  1MZC A;  1N4P A;  3EU9 A;  2XEV A;  2X6I A;  5AAR A;  3FUH A;  2BKK B;  1H6K A;  3CK8 A;  4BWR A;  3UKR G;  5AN8 A;  3OXF A;  4UQY A;  4GTV A;  3T5X A;  1O1S A;  2WXF A;  4FHJ A;  2DZO A;  1TN7 A;  2X6H A;  4KXK B;  2XZD G;  1A17 A;  3HXC A;  4MS6 A;  2GRP B;  4K5A B;  3QAR A;  4UI9 J;  4B89 A;  3KAE A;  2OEW A;  4GTQ A;  4JHR A;  3AG3 E;  4LUN U;  4N3C A;  3SNX A;  4B93 B;  2P9I G;  3E4B A;  5CED B;  4HOU A;  2VGE A;  5J08 A;  4UQX A;  4CCA A;  3DWL G;  3ZXP A;  1TEZ A;  3UM2 A;  1OCZ E;  1IKN D;  3QKY A;  2LSU A;  1BD8 A;  4XKB A;  4LSZ E;  2GW1 A;  1N54 A;  5BV1 A;  5G04 J;  2XPZ A;  3B7U X;  4Q96 A;  1XNF A;  4JC8 A;  4HFG A;  3GYZ A;  3Q7A A;  3PZ4 A;  3JXI A;  2HYZ A;  3MKR A;  1YA0 A;  3HDX A;  3TG5 A;  1HG5 A;  4PS3 A;  2BUG A;  1S63 A;  1X5B A;  3PUK A;  3C5R A;  4I1A A;  5LCW J;  4U04 A;  4HOR A;  2F0Y A;  4LCT A;  4DI3 A;  3RKV A;  2FEZ A;  3D9P A;  3L16 A;  4A63 B;  2XRY A;  2WXQ A;  4GTT A;  2LXM A;  5G05 C;  4HLE A;  3RRM B;  3CST A;  2R17 C;  3URZ A;  3ASN E;  4EZK A;  3JCK C;  2FBN A;  3Q78 A;  3MV2 B;  1HXI A;  1E7U A;  1UW4 B;  3EHQ A;  3D9M A;  2R05 A;  4AV7 A;  3F6Q A;  4I2Z A;  3AS8 A;  3ML8 A;  3MYV A;  1NA3 A;  1EDU A;  3GZS A;  3U66 A;  2VYI A;  4WWP A;  2YHE A;  4XI9 A;  1SA4 A;  2AVP A;  3P1U A;  4BT8 A;  2WXI A;  3ULY A;  4K03 A;  3LY9 A;  4HS2 A;  1O1T A;  4Z68 A;  3IHV A;  4ACK A;  4F7A A;  3ABM E;  4GPM A;  4CDR A;  5ARG A;  2DVW A;  3QDN A;  2XPI A;  5CEA A;  5JHB A;  3R7Q A;  2JEK A;  3TWV A;  3NB2 A; 
#chains in the Genus database with same CATH homology
 2GRR B;  2GRQ B;  2IO2 C;  1Z5S C;  2GRP B;  1KPS B;  2IO3 C;  5D2M C;  3UIP C;  2IY0 C;  3UIO C;  2GRO B;  3UIN C;  2GRN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...