2GRQB

Crystal structure of human rangap1-ubc9-d127a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
b'PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 57
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grqB00
2IO2C 3UIOC 2IO3C 3UINC 2GROB 1KPSB 3UIPC 1Z5SC 2GRPB 2GRRB 2GRNB 2IY0C 2GRQB 5D2MC
chains in the Genus database with same CATH superfamily
4IN3B 4O6FA 3MA5A 4K5AB 3MKQA 1TN8A 3DBSA 3TJPA 3BU8A 4O1PA 3L22A 3GZ1A 2J8SD 1E90A 4CYMD 5CMWA 2LAHA 4UQXA 3EHNA 4DI4A 5ENRD 5ENNA 3T8KA 4G25A 4GMLA 3RSEG 3S2AA 4UI9K 5CMYA 3UXGA 4OYSA 3TWSA 5CCMA 2PM7A 2X6FA 3IBEA 3L6AA 5CRVA 3AG3E 1NI1A 1SA4A 1HE8A 4CGVA 2Y4UA 3LCAA 4JHKA 3NZUA 2OOEA 2YINA 4YDOA 4PDXA 3PE4A 1LTXA 3APCA 4G8LA 3FWVA 4HBDA 4FJZA 1H0AA 5KJKA 2XGOA 3HDXA 1HS6A 5CRUA 4DX6D 3R9AB 3D9MA 3HG0D 4J8DA 2R17C 4KMOA 3PZDA 5CBNA 2XEHA 3VTYA 1Y6IA 2MOWA 4TUMA 3UIPC 5DBKA 1IHBA 3KAEA 4GMJA 1TJFA 3ZXSA 4ZHBA 2VSOE 4O60A 2P58C 2AXVA 4ABNA 3FTVA 2IEJA 5JJ7A 4BTAA 5LP0A 5CEDB 2Y3AA 3CVLA 3RO3A 4EZJA 4IRUA 2GRNB 1MQSA 2XPYA 4J0UA 1INZA 1QZ2A 3IEGA 4URKA 2V5FA 1ELKA 3SBSA 1E7VA 4BSXA 2R05A 4U0SA 3EJNA 2PZIA 4APOA 4OAUC 4BERA 1LD8A 2NYJA 3OXFA 3CLJA 4N5QA 4JXTA 3B7RL 3HXFA 4J8YA 1NL4A 4XI9A 5A7DB 2YHCA 1K1BA 1N4QA 3DWLG 5KJMA 1W3BA 4EZLA 4EPZA 3Q15A 3FP3A 1H2UA 1S63A 5JHAA 3ZW3A 3ASDA 5T8IA 3V2OA 4GMRA 4NURA 3Q47B 4N3AA 2QFCA 4PS7A 3PREA 5EIBE 1FCHA 3CK7A 1QBQA 2WM9A 3SGHA 2A5UA 2DCPA 3NF1A 2PNNA 4CCAA 1BD8A 3O4ZA 4J8SA 3VTXA 1SZAA 3APFA 4TXRA 2UY1A 3C72A 2OEVA 3I4RB 3RRNB 3AU4A 2NXPA 4F6RD 3DSXA 5AAOA 3PZ3A 4I9CA 4F3VA 3TG4A 2YHEA 2Y0BG 4HLLA 4C48B 4I1AA 2JLBA 3ASFA 1KLXA 3MV3B 4BTBA 3MZLB 4Y6WA 2AXZA 4DX5D 3RRMB 2VYIA 4HOUA 5KNGA 1TYQG 2GROB 3FY4A 2WXOA 4UI9C 3HXCA 3MKQB 1JPLA 3FU5A 4XZ4A 4CDNA 2MYOA 4ATZD 1N0QA 2FBNA 4HOQA 3QAQA 5D2MC 4ACLA 4KZCA 1N4SA 2EIKE 4ME2A 1XNFA 3DPDA 3FU6A 4GTOA 4JC8A 3MGBA 2VGXA 3ZXPA 5EDSA 3UKRG 3LY8A 4UI9J 4BT8A 3HIZA 4UUCA 4KVMA 1N4RA 1WM5A 3B95A 2LNIA 2H6FA 2WVIA 2PQNA 4GTRA 4KBQA 2H6GA 4HNAD 1FVHA 4CZ2D 4XE0A 4RG6A 5AJDA 3LYAA 1N0RA 1SZ9A 1ZU2A 2RFMA 1IQRA 5AIJA 2L6JA 4CT0A 1HU3A 3ZRHA 4B8CB 4N2SA 4A1GA 5B1BE 4DLOA 4Q94A 4HORA 1L5JA 1GW6A 5BV0A 5LOZA 3I4GA 2FF4A 1FVFA 3QKYA 4EHMA 4XKBA 3D9HA 5FZSA 4A1SA 4HI8A 3D9LA 1DNPA 3ASGA 3CVUA 5HRYA 3FUFA 3C5RA 4GPMA 4P29A 4F53A 4UWLA 3KSQA 4F1PA 4YDEA 4Q69A 4JW1A 4UWHA 4FU3A 2GRQB 3AG2E 3UKUG 1E96B 5A6CA 4D10C 4HRMB 3TXNA 3C3RA 4I9EA 5BPPA 5FZRA 2XCCA 2XRYA 5JJTA 3S7JA 3P2BA 1SVXA 3L13A 4K5CA 2P9NG 2J09A 3DXMG 1HF8A 3BUAA 3FUKA 3ZYQA 3GW4A 1NZNA 1N4PA 2LSUA 4RQIA 3IV0A 3SQVA 4BX8A 2AW6A 2CFZA 4O1OA 5KJNA 3FTXA 5FJYA 2ZXWE 1WDYA 3D9PA 3SZ7A 4N3BA 3B7UX 3SBTB 1QQEA 1KT1A 3KS2A 2H6HA 3QNKA 1ELRA 3DSUA 5FINA 2Y4TA 1OCOE 2CHXA 5J90A 4LRZA 3LEWA 1TNOA 3U4TA 3ABLE 4GYYA 2X6IA 3LJ3A 3B7BA 5EYPF 2WXLA 1QYMA 4V3IA 1BI8B 4I2WA 4A3VA 1Q2ZA 2UY1B 3PRZA 3QJZA 2IU1A 3D9OA 4I43A 4BSZB 3URZA 5B1AE 5G55A 5CERB 4WWNA 2C0LA 3ONLA 5JA4D 3ML9A 3SD5A 4AY5A 2DYSE 3MX3A 1MJ0A 2CFUA 1FPPA 3D9NA 3ULYA 3FUDA 5ENSD 1A17A 2FEZA 5C1DA 3WXXA 4HOSA 3RJVA 5CBOA 4E85A 2LSVA 4ZFHA 4TXPA 5EX0A 1IQUA 2VTBA 5HKPA 3IHVA 4TV3A 4G24A 3UT7A 5FZQA 4EECA 5AQBA 5ARGA 5ENQD 3CKCA 2V4LA 3CQCB 2WQ7A 5BW8C 4I6JA 4FLHA 4U8VD 1S64A 4G8KA 2AXUA 2GRMA 2VQ2A 1UOHA 4L7TA 3CHQA 3CVYA 4PS8A 2DVWA 3QDNA 3NOCD 2R02A 1X5BA 2BUGA 3V31A 3Q9NC 4MS6A 4ILGA 1AWCB 3VLDA 3CK8A 1YMPA 3LVQE 2FI7A 5KWDA 2KXPC 1TNYA 1OT8A 3V2XA 5AJLA 1OCCE 4WNFA 2FO1E 4I17A 1H6PA 3GYZA 2HR2A 3Q7AA 3QWWA 3J5PA 4JL0A 3OAWA 1A5EA 1NFIE 4GCOA 4GTTA 1PC2A 5D0QD 5G05C 3ASHA 4N5CA 2WXJA 4L2YA 3RK6A 3UQ3A 4N39A 2FULA 4HLEA 3B7TA 3U66A 4G23A 4G1TA 3RO2A 3AG4E 1RW2A 4LUNU 4JEUA 5HI7A 1HO8A 4NIKA 1YA0A 2WXMA 4BY6A 4NACA 2WXHA 3DEOA 3UM1A 5G05J 4AV7A 4OVVA 4QQIA 3PE3A 4IYPA 2ONDA 3DXKG 3R7QA 2BEDA 4C9BB 2EQXA 3UPVA 2VSYA 5BXOA 1DCQA 2JEKA 3ZUVB 5LX8A 1MX4A 3CGHA 3CV0A 5EKQD 3Q78A 3FUMA 2BKGA 3MKRA 5KCMA 3PZ1A 4AP2A 3U64A 3E32A 2IF4A 4LEUA 5CEAA 1E8WA 4JPSA 3OTNA 5ITZF 3L54A 4MLPA 3FUNA 3ZEFA 3PS6A 4Q96A 1K3ZD 2XPIA 4KXKB 1BU9A 4LCTA 3CVXA 5HS0A 3LY9A 4JHJA 4DX2A 3SNXA 3EIQC 3FTSA 4JZYA 3ZGQA 4J8FA 2H6IA 4U63A 1S70B 2F0YA 1QNFA 2CG2A 1JWGA 3HXDA 3FUIA 3G2VA 3JUIA 4WWOA 4UWGA 4ANWA 1OUVA 4RVBA 4ILIA 4E6HA 1H2VC 1ZB1A 3L17A 1TNZA 3CVPA 4RSYA 2F8XK 3D3MA 4H7XA 3L16A 2P9IG 2AVPA 2V5QC 2WMNA 5AARA 3ASOE 1N94A 4NQ0A 5T4YA 4GZ3A 4AM9A 1IXVA 4GA1A 4K03A 2AJAA 4MKTA 2J4BA 1UG3A 4GZ6A 1TR4A 5G04C 2VTBB 1OWPA 1OWNA 2R03A 4U0UA 3QOUA 5FIOA 4AEZC 2R2LA 4AOFA 4I2ZA 4HQDA 2DZOA 2LXLA 3U9WA 2E2EA 2AWIA 4BESA 3TWQA 5H7PA 4K0RA 4PH4B 1TN6A 3TAXA 3HXBA 3D9IA 1Z3YA 3KEAA 1E7UA 1LD7A 4GAAA 2L0IA 3ZHEA 3QWPA 1IHGA 3CQGB 3TGOA 3FU0A 3UT8A 3UM3A 4B94A 4A63B 3ZYKA 3IXEA 3NZSA 2X3MA 4CDRA 2ILRA 2OCCE 3JCKC 3PH0C 3R9MA 4JB8P 2Y1LE 4DPRA 1N9AA 2GGFA 2WXGA 2DWZA 2ETAA 4EQFA 4WUYA 2KM4A 1HZ4A 1UJKA 2L9BA 3AG1E 3RKVA 3AS8A 1MX2A 3K9IA 4Z68A 5AN8A 5KBAA 3AU5A 4UQYA 3G2WA 2OVFA 3ZYMA 4YDWA 1IYGA 3JUEA 2M63A 3UTMA 5CECB 4FHKA 4F1SA 3EIJA 3LJNA 3AS4A 3LDZA 4GZ5A 4AY6A 2ETBA 1SW6A 4GCNA 5CHEE 1K8KG 3DSTA 5ENTD 4GTSA 4M7CA 3L08A 4G26A 2C0MA 5BUZA 2LAIA 3CKBA 3EDTB 1TNBA 3D9KA 4BT9A 3Q49B 5E75A 3IHYA 3MJWA 1IKND 1OCZE 3JQ0A 4AJWA 2KATA 3LPZA 2VSXE 4DK5A 4H7YA 1U3DA 3L82A 3CVVA 3VLFA 3RIBA 3BQOA 5FQ8A 4LSZE 3NBNB 1KZPA 2DBAA 2J08A 3R7RA 4C0MA 2YQ8A 3FTYA 5A23A 4B93B 3CHSA 4ANXA 3Q73A 3UINC 2XCBA 5D66A 2EIJE 2GRPB 1RZ4A 4J6IA 4JA9A 3CIAA 1SA5A 2ZISA 3SFXA 3G2UA 4K5BA 1OXJA 2OV8A 3W9GA 4LG6A 3QK0A 4WWPA 4AXHA 4WAFA 2J4DA 2LUHA 4GPKA 5LCWC 1FT1A 3PZ2A 2IOSA 1HXIA 3SY2A 2P9KG 4U8HA 1TN7A 4FADA 2WXNA 1HFAA 3KD7A 1P5QA 2XEEA 4FC8A 3UX4A 3RU0A 2B6CA 3MV2B 3UI2A 1KZOA 4GU5A 4EZKA 4HVBA 5LCWJ 4FHJA 3JYSA 2CG3A 3FH8A 4B0ZA 2VJ8A 3CR3A 5B3SE 5FQ6A 1ZBPA 3PNLB 2IO2C 2C2LA 4PUCA 4YNDA 4U96D 3ABKE 3U3WA 2QYUA 3CHRA 2RKKA 5IY5E 3E37A 2DIWA 1MX6A 3ZPJA 5E76A 3HXEA 1BI7B 1D8DA 2XZDG 4PS3A 4ATGA 2CHWA 3T9KA 5M72A 2IY0C 2L0TB 4MRUA 5BXUA 3ZHEB 1OCRE 2MHKA 2XENA 2PM6A 4QFVA 2NC9A 3GZ2A 4A3TA 2JABA 2X6JA 4DX7D 2WXFA 3PZ4A 4GYOA 1V55E 3TWXA 1JCQA 4UWFA 3G2SA 2WXIA 4AVXA 4OVUA 2Q7FA 4BFRA 5FQ4A 4N3CA 2VGXB 5C2YA 2WQ6A 3FFLA 3Q7FA 2KZTA 5JHBA 1LF8A 2VGEA 5EILA 2RG8A 4U7EB 2QZAA 1H6OA 3AAAC 2VGYA 1B89A 3Q75A 2X6KA 3IKOB 3KSLA 4FJYA 4UWKA 3RAUA 3E34A 5EX3A 4EBAA 3FTWA 2V8SE 3PDNA 3G2TA 3ABME 5JMND 4G11A 3KEZA 2DZNA 4Y6CA 4ANUA 3SFZA 4U04A 2RD0A 3FTUA 4X8QA 4JEHA 4XX5A 2P2CP 4DRXE 3JXIA 5AQ7A 3ONKA 5ANRA 3EU9A 1UW4B 3AJIA 3SFYA 5DIZA 2XRZA 3NOGD 2IONA 2WMOA 5AQAA 3OXGA 3NQPA 1D9SA 1BLXB 4CEMA 4KT6B 3TWRA 2WQHA 2XQ0A 4LERA 2LO6A 1O5MA 2EILE 1E8XA 2RFAA 3FUHA 4RG9A 3QB2A 3Q79A 4FA6A 5EYLA 1HG5A 4WNGA 3ASNE 3P1UA 3SHFA 3ULEG 2P9SG 1DC2A 4GTPA 1JUQA 4TXQA 1UJJA 2HYZA 3UM2A 3O48A 2OVBA 2IFUA 4XI0A 4HRNA 2BKKB 4BX9A 4ACKA 5BNWA 2P9PG 3X2QE 3FU3A 2E0IA 4LNBA 2QC9A 1G3NB 4FP7A 3CSTA 3FUJA 3GZSA 3APDA 1MYOA 3DPYA 1MHQA 4UQZA 3TL5A 3TWWA 3ULQA 3LS8A 1U2VG 3EHMA 1U3CA 1X81A 2CHZA 4U95D 4L23A 4I6GA 3V30A 4BEPA 4GA0A 2XS1A 4AIFA 4GTQA 4CGWA 1E8ZA 1N95A 3HVEA 2IQCA 5EN5D 3PNTB 2B0OE 4FULA 4I1OB 4B89A 4IULA 4R7LA 5ENPD 3DRAA 3PEVB 4HB5A 1K1AA 4GZDA 3DSVA 3WG7E 2ETCA 3FDHA 2HE0A 4N2QA 4WNEA 3E4BA 1JWFA 2QY7A 4GTVA 3CSFA 4CRWA 2BF0X 4DLQA 1WAO1 3OXLA 1MZCA 3LXUX 4NRHB 1Z6TA 2P9LG 5BT1A 1EF1C 3N71A 3ZN3A 4HXIA 2DYRE 4ILHB 3ISMC 5FTPA 1Y8MA 4XEIG 1V54E 3S7BA 4A55A 3HRAA 4KYOB 2KZTB 3C98A 4FLBA 5LFAA 2Y69E 2IOLA 4L2LA 3LKUA 2HM8A 4F7AA 1VDYA 2F8YA 2NSZA 4W9RA 2BTDA 3L9TA 3FHEA 2EIME 3FH7A 3PEUB 3PUJA 3Q9UC 2GRRB 5G04J 3MEKA 3CHPA 2PQRA 4HFGA 4YDYA 5T3RA 2VSNA 3UM0A 2KBXA 3UIOC 2A5EA 1BPOA 4MBGA 2XZTG 4GZCA 5FT9A 3VLEA 2I6HA 1EPUA 2IJGX 1Z5SC 1NA3A 1YCSB 2I1JA 3PUKA 1N52A 4JD2G 3TWVA 1OWOA 2EINE 3EHQA 1OWLA 2UWJG 3FULA 3BG1B 4CDMA 4GYWA 3I5PA 2ZGDA 1H6KA 4U0ZA 3FUEA 2X6HA 4WNDA 2PL2A 5ANLA 4OAVB 3QARA 3F6QA 3UT4A 1TJCA 1JCSA 5FWQA 3EHRA 4BWRA 3FH5A 3SO8A 3CEQA 3CVNA 2YNQA 3QC1A 4HI9A 2WXPA 2WXQA 3AS5A 3B13A 1N54A 3C3OA 5HQ8A 3CHMA 1YYHA 3ZIMA 5BV1A 1D8EA 4U07A 5CCLA 3V79K 1N11A 4HOTA 3SF4A 5ENOD 1E8YA 4DUIA 4EBAG 2L6BA 5KNHD 2V0PA 4J8EA 2XEVA 3C3QA 1NP7A 3FTZA 5FQ7A 5AQ9A 3TWUA 1HG2A 4JA7A 2MRIA 1DVPA 3E30A 1WG0A 3ZKJA 1S0PA 3CK9A 4YVQC 2P9UG 3HHMA 3D9JA 4DI3A 1FT2A 2F37A 4RLYA 5J08A 2FO7A 4BETA 4XKCA 3ZNGA 5ARFA 3ZYLA 1H2TC 3ZVVA 1UN8A 3BG0B 1DCEA 1ELWA 1EDUA 3LVRE 1HX8A 3PVLA 1Z3XA 3Q5MA 3CVQA 4YVOA 5JJ6A 2XHEA 3TXMA 2J07A 3DEPA 1O1SA 3BEEA 4DJAA 2OEWA 3NAWA 2XGSA 1O1RA 1TNUA 4JHRA 2ZGGA 1NA0A 3CVWA 3HVEB 2ZIRA 2A4ZA 4HS2A 2X38A 1PAQA 3SI5A 3JXJA 3DSWA 3RRUA 2WXKA 4G2VA 2KCKA 3MCXA 3J5QB 4J7WA 3B7SA 4XIFA 3Q4AB 2R5SA 5D0OD 1JCRA 3TWTA 4GTMA 3FEYA 1KPSB 1HH8A 1TEZA 4C0EA 3ENEA 2HO1A 2QYJA 2J9QA 3TG5A 1PY1A 4DX1A 2GW1A 3DSSA 2R59A 4I1MA 3EU5A 4GB9A 2ZU6B 2I1KA 4JVSA 3QWVA 2LXMA 3ZU7B 3ESKA 3ZFWA 4GA2A 2J49A 3E33A 5EIDA 4TRQA 4ANVA 4KZ0A 2XS8A 4L1BA 3FEXA 1SQMA 4I6EA 3ESLA 4LNGA 3UMVA 4KVOA 3S7DA 3MYVA 3HYMB 5AYWD 3UUXA 1OY3D 3LY7A 4APFA 3EUVA 2XPZA 1UN9A 3T5VA 2I2OA 2GRLA 3ML8A 1OWMA 3W9FA 2KCVA 2KCLA 1WY6A 3T8MA 1O1TA 1EYHA 2WB2A 4M3OA 4B8AA 1AP7A 2KC7A 3NB2A 1XGWA 5KJLA 2XGMA 1H19A 4L9PA 4U8YD 4LNUD 2WXRA 2I9CA 2WPVA 1KT0A 3CHOA 3S7FA 4TUUA 4HRLA 2V4HC 2IO3C 5AENA 3JQ1A 5G2NA 4CT4A 3T5XA 3I3NA
chains in the Genus database with same CATH topology
2IO2C 3UIOC 2IO3C 3UINC 2GROB 1KPSB 3UIPC 1Z5SC 2GRPB 2GRRB 2GRNB 2IY0C 2GRQB 5D2MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO2 C;  3UIO C;  2IO3 C;  3UIN C;  2GRO B;  1KPS B;  3UIP C;  1Z5S C;  2GRP B;  2GRR B;  2GRN B;  2IY0 C;  2GRQ B;  5D2M C; 
#chains in the Genus database with same CATH topology
 4IN3 B;  4O6F A;  3MA5 A;  4K5A B;  3MKQ A;  1TN8 A;  3DBS A;  3TJP A;  3BU8 A;  4O1P A;  3L22 A;  3GZ1 A;  2J8S D;  1E90 A;  4CYM D;  5CMW A;  2LAH A;  4UQX A;  3EHN A;  4DI4 A;  5ENR D;  5ENN A;  3T8K A;  4G25 A;  4GML A;  3RSE G;  3S2A A;  4UI9 K;  5CMY A;  3UXG A;  4OYS A;  3TWS A;  5CCM A;  2PM7 A;  2X6F A;  3IBE A;  3L6A A;  5CRV A;  3AG3 E;  1NI1 A;  1SA4 A;  1HE8 A;  4CGV A;  2Y4U A;  3LCA A;  4JHK A;  3NZU A;  2OOE A;  2YIN A;  4YDO A;  4PDX A;  3PE4 A;  1LTX A;  3APC A;  4G8L A;  3FWV A;  4HBD A;  4FJZ A;  1H0A A;  5KJK A;  2XGO A;  3HDX A;  1HS6 A;  5CRU A;  4DX6 D;  3R9A B;  3D9M A;  3HG0 D;  4J8D A;  2R17 C;  4KMO A;  3PZD A;  5CBN A;  2XEH A;  3VTY A;  1Y6I A;  2MOW A;  4TUM A;  3UIP C;  5DBK A;  1IHB A;  3KAE A;  4GMJ A;  1TJF A;  3ZXS A;  4ZHB A;  2VSO E;  4O60 A;  2P58 C;  2AXV A;  4ABN A;  3FTV A;  2IEJ A;  5JJ7 A;  4BTA A;  5LP0 A;  5CED B;  2Y3A A;  3CVL A;  3RO3 A;  4EZJ A;  4IRU A;  2GRN B;  1MQS A;  2XPY A;  4J0U A;  1INZ A;  1QZ2 A;  3IEG A;  4URK A;  2V5F A;  1ELK A;  3SBS A;  1E7V A;  4BSX A;  2R05 A;  4U0S A;  3EJN A;  2PZI A;  4APO A;  4OAU C;  4BER A;  1LD8 A;  2NYJ A;  3OXF A;  3CLJ A;  4N5Q A;  4JXT A;  3B7R L;  3HXF A;  4J8Y A;  1NL4 A;  4XI9 A;  5A7D B;  2YHC A;  1K1B A;  1N4Q A;  3DWL G;  5KJM A;  1W3B A;  4EZL A;  4EPZ A;  3Q15 A;  3FP3 A;  1H2U A;  1S63 A;  5JHA A;  3ZW3 A;  3ASD A;  5T8I A;  3V2O A;  4GMR A;  4NUR A;  3Q47 B;  4N3A A;  2QFC A;  4PS7 A;  3PRE A;  5EIB E;  1FCH A;  3CK7 A;  1QBQ A;  2WM9 A;  3SGH A;  2A5U A;  2DCP A;  3NF1 A;  2PNN A;  4CCA A;  1BD8 A;  3O4Z A;  4J8S A;  3VTX A;  1SZA A;  3APF A;  4TXR A;  2UY1 A;  3C72 A;  2OEV A;  3I4R B;  3RRN B;  3AU4 A;  2NXP A;  4F6R D;  3DSX A;  5AAO A;  3PZ3 A;  4I9C A;  4F3V A;  3TG4 A;  2YHE A;  2Y0B G;  4HLL A;  4C48 B;  4I1A A;  2JLB A;  3ASF A;  1KLX A;  3MV3 B;  4BTB A;  3MZL B;  4Y6W A;  2AXZ A;  4DX5 D;  3RRM B;  2VYI A;  4HOU A;  5KNG A;  1TYQ G;  2GRO B;  3FY4 A;  2WXO A;  4UI9 C;  3HXC A;  3MKQ B;  1JPL A;  3FU5 A;  4XZ4 A;  4CDN A;  2MYO A;  4ATZ D;  1N0Q A;  2FBN A;  4HOQ A;  3QAQ A;  5D2M C;  4ACL A;  4KZC A;  1N4S A;  2EIK E;  4ME2 A;  1XNF A;  3DPD A;  3FU6 A;  4GTO A;  4JC8 A;  3MGB A;  2VGX A;  3ZXP A;  5EDS A;  3UKR G;  3LY8 A;  4UI9 J;  4BT8 A;  3HIZ A;  4UUC A;  4KVM A;  1N4R A;  1WM5 A;  3B95 A;  2LNI A;  2H6F A;  2WVI A;  2PQN A;  4GTR A;  4KBQ A;  2H6G A;  4HNA D;  1FVH A;  4CZ2 D;  4XE0 A;  4RG6 A;  5AJD A;  3LYA A;  1N0R A;  1SZ9 A;  1ZU2 A;  2RFM A;  1IQR A;  5AIJ A;  2L6J A;  4CT0 A;  1HU3 A;  3ZRH A;  4B8C B;  4N2S A;  4A1G A;  5B1B E;  4DLO A;  4Q94 A;  4HOR A;  1L5J A;  1GW6 A;  5BV0 A;  5LOZ A;  3I4G A;  2FF4 A;  1FVF A;  3QKY A;  4EHM A;  4XKB A;  3D9H A;  5FZS A;  4A1S A;  4HI8 A;  3D9L A;  1DNP A;  3ASG A;  3CVU A;  5HRY A;  3FUF A;  3C5R A;  4GPM A;  4P29 A;  4F53 A;  4UWL A;  3KSQ A;  4F1P A;  4YDE A;  4Q69 A;  4JW1 A;  4UWH A;  4FU3 A;  2GRQ B;  3AG2 E;  3UKU G;  1E96 B;  5A6C A;  4D10 C;  4HRM B;  3TXN A;  3C3R A;  4I9E A;  5BPP A;  5FZR A;  2XCC A;  2XRY A;  5JJT A;  3S7J A;  3P2B A;  1SVX A;  3L13 A;  4K5C A;  2P9N G;  2J09 A;  3DXM G;  1HF8 A;  3BUA A;  3FUK A;  3ZYQ A;  3GW4 A;  1NZN A;  1N4P A;  2LSU A;  4RQI A;  3IV0 A;  3SQV A;  4BX8 A;  2AW6 A;  2CFZ A;  4O1O A;  5KJN A;  3FTX A;  5FJY A;  2ZXW E;  1WDY A;  3D9P A;  3SZ7 A;  4N3B A;  3B7U X;  3SBT B;  1QQE A;  1KT1 A;  3KS2 A;  2H6H A;  3QNK A;  1ELR A;  3DSU A;  5FIN A;  2Y4T A;  1OCO E;  2CHX A;  5J90 A;  4LRZ A;  3LEW A;  1TNO A;  3U4T A;  3ABL E;  4GYY A;  2X6I A;  3LJ3 A;  3B7B A;  5EYP F;  2WXL A;  1QYM A;  4V3I A;  1BI8 B;  4I2W A;  4A3V A;  1Q2Z A;  2UY1 B;  3PRZ A;  3QJZ A;  2IU1 A;  3D9O A;  4I43 A;  4BSZ B;  3URZ A;  5B1A E;  5G55 A;  5CER B;  4WWN A;  2C0L A;  3ONL A;  5JA4 D;  3ML9 A;  3SD5 A;  4AY5 A;  2DYS E;  3MX3 A;  1MJ0 A;  2CFU A;  1FPP A;  3D9N A;  3ULY A;  3FUD A;  5ENS D;  1A17 A;  2FEZ A;  5C1D A;  3WXX A;  4HOS A;  3RJV A;  5CBO A;  4E85 A;  2LSV A;  4ZFH A;  4TXP A;  5EX0 A;  1IQU A;  2VTB A;  5HKP A;  3IHV A;  4TV3 A;  4G24 A;  3UT7 A;  5FZQ A;  4EEC A;  5AQB A;  5ARG A;  5ENQ D;  3CKC A;  2V4L A;  3CQC B;  2WQ7 A;  5BW8 C;  4I6J A;  4FLH A;  4U8V D;  1S64 A;  4G8K A;  2AXU A;  2GRM A;  2VQ2 A;  1UOH A;  4L7T A;  3CHQ A;  3CVY A;  4PS8 A;  2DVW A;  3QDN A;  3NOC D;  2R02 A;  1X5B A;  2BUG A;  3V31 A;  3Q9N C;  4MS6 A;  4ILG A;  1AWC B;  3VLD A;  3CK8 A;  1YMP A;  3LVQ E;  2FI7 A;  5KWD A;  2KXP C;  1TNY A;  1OT8 A;  3V2X A;  5AJL A;  1OCC E;  4WNF A;  2FO1 E;  4I17 A;  1H6P A;  3GYZ A;  2HR2 A;  3Q7A A;  3QWW A;  3J5P A;  4JL0 A;  3OAW A;  1A5E A;  1NFI E;  4GCO A;  4GTT A;  1PC2 A;  5D0Q D;  5G05 C;  3ASH A;  4N5C A;  2WXJ A;  4L2Y A;  3RK6 A;  3UQ3 A;  4N39 A;  2FUL A;  4HLE A;  3B7T A;  3U66 A;  4G23 A;  4G1T A;  3RO2 A;  3AG4 E;  1RW2 A;  4LUN U;  4JEU A;  5HI7 A;  1HO8 A;  4NIK A;  1YA0 A;  2WXM A;  4BY6 A;  4NAC A;  2WXH A;  3DEO A;  3UM1 A;  5G05 J;  4AV7 A;  4OVV A;  4QQI A;  3PE3 A;  4IYP A;  2OND A;  3DXK G;  3R7Q A;  2BED A;  4C9B B;  2EQX A;  3UPV A;  2VSY A;  5BXO A;  1DCQ A;  2JEK A;  3ZUV B;  5LX8 A;  1MX4 A;  3CGH A;  3CV0 A;  5EKQ D;  3Q78 A;  3FUM A;  2BKG A;  3MKR A;  5KCM A;  3PZ1 A;  4AP2 A;  3U64 A;  3E32 A;  2IF4 A;  4LEU A;  5CEA A;  1E8W A;  4JPS A;  3OTN A;  5ITZ F;  3L54 A;  4MLP A;  3FUN A;  3ZEF A;  3PS6 A;  4Q96 A;  1K3Z D;  2XPI A;  4KXK B;  1BU9 A;  4LCT A;  3CVX A;  5HS0 A;  3LY9 A;  4JHJ A;  4DX2 A;  3SNX A;  3EIQ C;  3FTS A;  4JZY A;  3ZGQ A;  4J8F A;  2H6I A;  4U63 A;  1S70 B;  2F0Y A;  1QNF A;  2CG2 A;  1JWG A;  3HXD A;  3FUI A;  3G2V A;  3JUI A;  4WWO A;  4UWG A;  4ANW A;  1OUV A;  4RVB A;  4ILI A;  4E6H A;  1H2V C;  1ZB1 A;  3L17 A;  1TNZ A;  3CVP A;  4RSY A;  2F8X K;  3D3M A;  4H7X A;  3L16 A;  2P9I G;  2AVP A;  2V5Q C;  2WMN A;  5AAR A;  3ASO E;  1N94 A;  4NQ0 A;  5T4Y A;  4GZ3 A;  4AM9 A;  1IXV A;  4GA1 A;  4K03 A;  2AJA A;  4MKT A;  2J4B A;  1UG3 A;  4GZ6 A;  1TR4 A;  5G04 C;  2VTB B;  1OWP A;  1OWN A;  2R03 A;  4U0U A;  3QOU A;  5FIO A;  4AEZ C;  2R2L A;  4AOF A;  4I2Z A;  4HQD A;  2DZO A;  2LXL A;  3U9W A;  2E2E A;  2AWI A;  4BES A;  3TWQ A;  5H7P A;  4K0R A;  4PH4 B;  1TN6 A;  3TAX A;  3HXB A;  3D9I A;  1Z3Y A;  3KEA A;  1E7U A;  1LD7 A;  4GAA A;  2L0I A;  3ZHE A;  3QWP A;  1IHG A;  3CQG B;  3TGO A;  3FU0 A;  3UT8 A;  3UM3 A;  4B94 A;  4A63 B;  3ZYK A;  3IXE A;  3NZS A;  2X3M A;  4CDR A;  2ILR A;  2OCC E;  3JCK C;  3PH0 C;  3R9M A;  4JB8 P;  2Y1L E;  4DPR A;  1N9A A;  2GGF A;  2WXG A;  2DWZ A;  2ETA A;  4EQF A;  4WUY A;  2KM4 A;  1HZ4 A;  1UJK A;  2L9B A;  3AG1 E;  3RKV A;  3AS8 A;  1MX2 A;  3K9I A;  4Z68 A;  5AN8 A;  5KBA A;  3AU5 A;  4UQY A;  3G2W A;  2OVF A;  3ZYM A;  4YDW A;  1IYG A;  3JUE A;  2M63 A;  3UTM A;  5CEC B;  4FHK A;  4F1S A;  3EIJ A;  3LJN A;  3AS4 A;  3LDZ A;  4GZ5 A;  4AY6 A;  2ETB A;  1SW6 A;  4GCN A;  5CHE E;  1K8K G;  3DST A;  5ENT D;  4GTS A;  4M7C A;  3L08 A;  4G26 A;  2C0M A;  5BUZ A;  2LAI A;  3CKB A;  3EDT B;  1TNB A;  3D9K A;  4BT9 A;  3Q49 B;  5E75 A;  3IHY A;  3MJW A;  1IKN D;  1OCZ E;  3JQ0 A;  4AJW A;  2KAT A;  3LPZ A;  2VSX E;  4DK5 A;  4H7Y A;  1U3D A;  3L82 A;  3CVV A;  3VLF A;  3RIB A;  3BQO A;  5FQ8 A;  4LSZ E;  3NBN B;  1KZP A;  2DBA A;  2J08 A;  3R7R A;  4C0M A;  2YQ8 A;  3FTY A;  5A23 A;  4B93 B;  3CHS A;  4ANX A;  3Q73 A;  3UIN C;  2XCB A;  5D66 A;  2EIJ E;  2GRP B;  1RZ4 A;  4J6I A;  4JA9 A;  3CIA A;  1SA5 A;  2ZIS A;  3SFX A;  3G2U A;  4K5B A;  1OXJ A;  2OV8 A;  3W9G A;  4LG6 A;  3QK0 A;  4WWP A;  4AXH A;  4WAF A;  2J4D A;  2LUH A;  4GPK A;  5LCW C;  1FT1 A;  3PZ2 A;  2IOS A;  1HXI A;  3SY2 A;  2P9K G;  4U8H A;  1TN7 A;  4FAD A;  2WXN A;  1HFA A;  3KD7 A;  1P5Q A;  2XEE A;  4FC8 A;  3UX4 A;  3RU0 A;  2B6C A;  3MV2 B;  3UI2 A;  1KZO A;  4GU5 A;  4EZK A;  4HVB A;  5LCW J;  4FHJ A;  3JYS A;  2CG3 A;  3FH8 A;  4B0Z A;  2VJ8 A;  3CR3 A;  5B3S E;  5FQ6 A;  1ZBP A;  3PNL B;  2IO2 C;  2C2L A;  4PUC A;  4YND A;  4U96 D;  3ABK E;  3U3W A;  2QYU A;  3CHR A;  2RKK A;  5IY5 E;  3E37 A;  2DIW A;  1MX6 A;  3ZPJ A;  5E76 A;  3HXE A;  1BI7 B;  1D8D A;  2XZD G;  4PS3 A;  4ATG A;  2CHW A;  3T9K A;  5M72 A;  2IY0 C;  2L0T B;  4MRU A;  5BXU A;  3ZHE B;  1OCR E;  2MHK A;  2XEN A;  2PM6 A;  4QFV A;  2NC9 A;  3GZ2 A;  4A3T A;  2JAB A;  2X6J A;  4DX7 D;  2WXF A;  3PZ4 A;  4GYO A;  1V55 E;  3TWX A;  1JCQ A;  4UWF A;  3G2S A;  2WXI A;  4AVX A;  4OVU A;  2Q7F A;  4BFR A;  5FQ4 A;  4N3C A;  2VGX B;  5C2Y A;  2WQ6 A;  3FFL A;  3Q7F A;  2KZT A;  5JHB A;  1LF8 A;  2VGE A;  5EIL A;  2RG8 A;  4U7E B;  2QZA A;  1H6O A;  3AAA C;  2VGY A;  1B89 A;  3Q75 A;  2X6K A;  3IKO B;  3KSL A;  4FJY A;  4UWK A;  3RAU A;  3E34 A;  5EX3 A;  4EBA A;  3FTW A;  2V8S E;  3PDN A;  3G2T A;  3ABM E;  5JMN D;  4G11 A;  3KEZ A;  2DZN A;  4Y6C A;  4ANU A;  3SFZ A;  4U04 A;  2RD0 A;  3FTU A;  4X8Q A;  4JEH A;  4XX5 A;  2P2C P;  4DRX E;  3JXI A;  5AQ7 A;  3ONK A;  5ANR A;  3EU9 A;  1UW4 B;  3AJI A;  3SFY A;  5DIZ A;  2XRZ A;  3NOG D;  2ION A;  2WMO A;  5AQA A;  3OXG A;  3NQP A;  1D9S A;  1BLX B;  4CEM A;  4KT6 B;  3TWR A;  2WQH A;  2XQ0 A;  4LER A;  2LO6 A;  1O5M A;  2EIL E;  1E8X A;  2RFA A;  3FUH A;  4RG9 A;  3QB2 A;  3Q79 A;  4FA6 A;  5EYL A;  1HG5 A;  4WNG A;  3ASN E;  3P1U A;  3SHF A;  3ULE G;  2P9S G;  1DC2 A;  4GTP A;  1JUQ A;  4TXQ A;  1UJJ A;  2HYZ A;  3UM2 A;  3O48 A;  2OVB A;  2IFU A;  4XI0 A;  4HRN A;  2BKK B;  4BX9 A;  4ACK A;  5BNW A;  2P9P G;  3X2Q E;  3FU3 A;  2E0I A;  4LNB A;  2QC9 A;  1G3N B;  4FP7 A;  3CST A;  3FUJ A;  3GZS A;  3APD A;  1MYO A;  3DPY A;  1MHQ A;  4UQZ A;  3TL5 A;  3TWW A;  3ULQ A;  3LS8 A;  1U2V G;  3EHM A;  1U3C A;  1X81 A;  2CHZ A;  4U95 D;  4L23 A;  4I6G A;  3V30 A;  4BEP A;  4GA0 A;  2XS1 A;  4AIF A;  4GTQ A;  4CGW A;  1E8Z A;  1N95 A;  3HVE A;  2IQC A;  5EN5 D;  3PNT B;  2B0O E;  4FUL A;  4I1O B;  4B89 A;  4IUL A;  4R7L A;  5ENP D;  3DRA A;  3PEV B;  4HB5 A;  1K1A A;  4GZD A;  3DSV A;  3WG7 E;  2ETC A;  3FDH A;  2HE0 A;  4N2Q A;  4WNE A;  3E4B A;  1JWF A;  2QY7 A;  4GTV A;  3CSF A;  4CRW A;  2BF0 X;  4DLQ A;  1WAO 1;  3OXL A;  1MZC A;  3LXU X;  4NRH B;  1Z6T A;  2P9L G;  5BT1 A;  1EF1 C;  3N71 A;  3ZN3 A;  4HXI A;  2DYR E;  4ILH B;  3ISM C;  5FTP A;  1Y8M A;  4XEI G;  1V54 E;  3S7B A;  4A55 A;  3HRA A;  4KYO B;  2KZT B;  3C98 A;  4FLB A;  5LFA A;  2Y69 E;  2IOL A;  4L2L A;  3LKU A;  2HM8 A;  4F7A A;  1VDY A;  2F8Y A;  2NSZ A;  4W9R A;  2BTD A;  3L9T A;  3FHE A;  2EIM E;  3FH7 A;  3PEU B;  3PUJ A;  3Q9U C;  2GRR B;  5G04 J;  3MEK A;  3CHP A;  2PQR A;  4HFG A;  4YDY A;  5T3R A;  2VSN A;  3UM0 A;  2KBX A;  3UIO C;  2A5E A;  1BPO A;  4MBG A;  2XZT G;  4GZC A;  5FT9 A;  3VLE A;  2I6H A;  1EPU A;  2IJG X;  1Z5S C;  1NA3 A;  1YCS B;  2I1J A;  3PUK A;  1N52 A;  4JD2 G;  3TWV A;  1OWO A;  2EIN E;  3EHQ A;  1OWL A;  2UWJ G;  3FUL A;  3BG1 B;  4CDM A;  4GYW A;  3I5P A;  2ZGD A;  1H6K A;  4U0Z A;  3FUE A;  2X6H A;  4WND A;  2PL2 A;  5ANL A;  4OAV B;  3QAR A;  3F6Q A;  3UT4 A;  1TJC A;  1JCS A;  5FWQ A;  3EHR A;  4BWR A;  3FH5 A;  3SO8 A;  3CEQ A;  3CVN A;  2YNQ A;  3QC1 A;  4HI9 A;  2WXP A;  2WXQ A;  3AS5 A;  3B13 A;  1N54 A;  3C3O A;  5HQ8 A;  3CHM A;  1YYH A;  3ZIM A;  5BV1 A;  1D8E A;  4U07 A;  5CCL A;  3V79 K;  1N11 A;  4HOT A;  3SF4 A;  5ENO D;  1E8Y A;  4DUI A;  4EBA G;  2L6B A;  5KNH D;  2V0P A;  4J8E A;  2XEV A;  3C3Q A;  1NP7 A;  3FTZ A;  5FQ7 A;  5AQ9 A;  3TWU A;  1HG2 A;  4JA7 A;  2MRI A;  1DVP A;  3E30 A;  1WG0 A;  3ZKJ A;  1S0P A;  3CK9 A;  4YVQ C;  2P9U G;  3HHM A;  3D9J A;  4DI3 A;  1FT2 A;  2F37 A;  4RLY A;  5J08 A;  2FO7 A;  4BET A;  4XKC A;  3ZNG A;  5ARF A;  3ZYL A;  1H2T C;  3ZVV A;  1UN8 A;  3BG0 B;  1DCE A;  1ELW A;  1EDU A;  3LVR E;  1HX8 A;  3PVL A;  1Z3X A;  3Q5M A;  3CVQ A;  4YVO A;  5JJ6 A;  2XHE A;  3TXM A;  2J07 A;  3DEP A;  1O1S A;  3BEE A;  4DJA A;  2OEW A;  3NAW A;  2XGS A;  1O1R A;  1TNU A;  4JHR A;  2ZGG A;  1NA0 A;  3CVW A;  3HVE B;  2ZIR A;  2A4Z A;  4HS2 A;  2X38 A;  1PAQ A;  3SI5 A;  3JXJ A;  3DSW A;  3RRU A;  2WXK A;  4G2V A;  2KCK A;  3MCX A;  3J5Q B;  4J7W A;  3B7S A;  4XIF A;  3Q4A B;  2R5S A;  5D0O D;  1JCR A;  3TWT A;  4GTM A;  3FEY A;  1KPS B;  1HH8 A;  1TEZ A;  4C0E A;  3ENE A;  2HO1 A;  2QYJ A;  2J9Q A;  3TG5 A;  1PY1 A;  4DX1 A;  2GW1 A;  3DSS A;  2R59 A;  4I1M A;  3EU5 A;  4GB9 A;  2ZU6 B;  2I1K A;  4JVS A;  3QWV A;  2LXM A;  3ZU7 B;  3ESK A;  3ZFW A;  4GA2 A;  2J49 A;  3E33 A;  5EID A;  4TRQ A;  4ANV A;  4KZ0 A;  2XS8 A;  4L1B A;  3FEX A;  1SQM A;  4I6E A;  3ESL A;  4LNG A;  3UMV A;  4KVO A;  3S7D A;  3MYV A;  3HYM B;  5AYW D;  3UUX A;  1OY3 D;  3LY7 A;  4APF A;  3EUV A;  2XPZ A;  1UN9 A;  3T5V A;  2I2O A;  2GRL A;  3ML8 A;  1OWM A;  3W9F A;  2KCV A;  2KCL A;  1WY6 A;  3T8M A;  1O1T A;  1EYH A;  2WB2 A;  4M3O A;  4B8A A;  1AP7 A;  2KC7 A;  3NB2 A;  1XGW A;  5KJL A;  2XGM A;  1H19 A;  4L9P A;  4U8Y D;  4LNU D;  2WXR A;  2I9C A;  2WPV A;  1KT0 A;  3CHO A;  3S7F A;  4TUU A;  4HRL A;  2V4H C;  2IO3 C;  5AEN A;  3JQ1 A;  5G2N A;  4CT4 A;  3T5X A;  3I3N A; 
#chains in the Genus database with same CATH homology
 2IO2 C;  3UIO C;  2IO3 C;  3UIN C;  2GRO B;  1KPS B;  3UIP C;  1Z5S C;  2GRP B;  2GRR B;  2GRN B;  2IY0 C;  2GRQ B;  5D2M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...