2GRQB

Crystal structure of human rangap1-ubc9-d127a
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
157
structure length
157
Chain Sequence
PADVSTFLAFPSPEKLLRLGPKSSVLIAQQTDTSDPEKVVSAFLKVSSVFKDEATVRMAVQDAVDALMQKAFNSSSFNSNTFLTRLLVHMGLLKSEDKVKAIANLYGPLMALNHMVQQDYFPKALAPLLLAFVTKPNSALESCSFARHSLLQTLYKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 I
publication title Lysine activation and functional analysis of E2-mediated conjugation in the SUMO pathway.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 57
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.200 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ran-GTPase activating protein 1, C-terminal domain 2grqB00
1Z5SC 2GRNB 2GROB 5D2MC 3UIPC 2GRQB 2IY0C 2GRRB 2IO3C 2IO2C 3UIOC 1KPSB 2GRPB 3UINC
chains in the Genus database with same CATH superfamily
1E8XA 3LJ3A 4U7EB 3SZ7A 4CDNA 3DPDA 3EU9A 1XNFA 2P9NG 3AS8A 3ZGQA 3ONKA 3JUIA 4OAVB 4U8YD 1UN9A 4EZKA 2ZISA 1E8WA 3Q47B 5LCWJ 4MBGA 4XIFA 4HOSA 2XPIA 4DLQA 2DBAA 2X6HA 4UWLA 4A3TA 3UMVA 5KJLA 4CEMA 3FUJA 4AY6A 3BQOA 3UIPC 3TJPA 4KYOB 4G11A 2EIME 2MHKA 4P29A 4U0SA 3JUEA 5ITZF 3W9GA 1H6OA 2UWJG 3ABME 2RG8A 4JEUA 4RG9A 4NACA 2PL2A 3S7FA 3UPVA 1FVHA 2X6KA 3QC1A 4RSYA 1H19A 2QY7A 1U3DA 3B7TA 3T5VA 1N95A 2XZTG 3DXKG 2VGXA 5D2MC 3CHMA 1UJKA 2DYSE 1K8KG 3QB2A 3NBNB 3FTZA 1B89A 3DSSA 2VGYA 3DBSA 1NA0A 1QNFA 3PRZA 3ENEA 1N0QA 1IHGA 4XE0A 3QOUA 1BLXB 5FZSA 3AS4A 5CBOA 1RZ4A 1S64A 4XI0A 3BG1B 3SHFA 4GA1A 2CG2A 3L54A 5KJMA 4U96D 4YDWA 3TWRA 3D9MA 2XEEA 4HORA 3R7RA 3JQ0A 3C3OA 2WMOA 3IHYA 1SW6A 3KAEA 2ZU6B 4EPZA 3UKUG 4HRLA 3ZYMA 2H6HA 1MX2A 3IBEA 4LSZE 2H6GA 4U07A 1HF8A 2PM6A 4HI9A 4LNBA 4A1GA 2WB2A 2IY0C 3G2SA 2DZOA 4ANVA 5BT1A 4BT8A 2ZGDA 2FEZA 3TXMA 4N2SA 2WXMA 5EYLA 3G2VA 2DYRE 4HB5A 4M7CA 1TNBA 1UOHA 2HM8A 4I9CA 3KEZA 4TV3A 2P9LG 3L9TA 4U8VD 1H2UA 1BU9A 4CCAA 3TWQA 2GRRB 2L0TB 3OXFA 4WUYA 5BXUA 3LCAA 5BV1A 4FJZA 3FTXA 3PREA 1SA5A 1PY1A 3TL5A 4ACLA 4N3CA 3QK0A 2F37A 3SY2A 1OCZE 1TNZA 3SFZA 4GTPA 5ENNA 4Q69A 4FJYA 4A55A 4E6HA 4GCOA 4WWNA 5EDSA 1X81A 3EHRA 5JMND 4BWRA 1IQUA 3SNXA 2VGEA 3HXBA 3AG3E 4EBAA 3T8KA 1IYGA 4O60A 2DIWA 2E0IA 4C0EA 2V5QC 2OV8A 2B0OE 4XX5A 3ML8A 3MKRA 3MV2B 4L1BA 3IV0A 3EIQC 3RSEG 4F7AA 1FPPA 3NB2A 3MGBA 1V54E 2A4ZA 3FWVA 2XS8A 5EX3A 3VTYA 4FLHA 4WNEA 3UT7A 4JPSA 4AXHA 4B8AA 3ABKE 3PZ3A 2VJ8A 1VDYA 3G2UA 3VTXA 4FADA 2UY1B 1K1AA 2DWZA 2MRIA 4DJAA 2ONDA 3UT4A 3FTWA 5FIOA 1HXIA 2KXPC 1WY6A 1KPSB 3ZYKA 1NZNA 3Q7FA 2FI7A 2J8SD 4B93B 2YHEA 4DX6D 2GW1A 1KLXA 3U9WA 5AYWD 4ME2A 4GTOA 3E32A 2F8YA 4HNAD 2LO6A 3B7RL 4D10C 3SGHA 5AJDA 1TN7A 3PZ4A 1IHBA 3F6QA 4PUCA 3SI5A 4DK5A 2R59A 1HZ4A 4ILHB 3RO3A 3D9IA 4G2VA 1UN8A 4OYSA 1DNPA 1JCRA 3PNLB 4K03A 2HYZA 5EN5D 4KT6B 4HLEA 3J5QB 4JA9A 3FFLA 4NIKA 2OOEA 4I1MA 4WNGA 5FTPA 3GZ2A 3RKVA 3CVNA 3CVLA 5EYPF 1HU3A 3GW4A 1OT8A 1WG0A 3LYAA 5AQAA 2GGFA 5CBNA 2VGXB 4YDYA 4GZCA 2BEDA 4CZ2D 4CDRA 1WDYA 2EINE 2AVPA 1RW2A 3FUKA 3CVWA 5FQ6A 5FQ7A 3ISMC 5IY5E 4UWKA 2QYJA 3SFXA 1HG2A 2ZIRA 2VYIA 3J5PA 4K0RA 3VLDA 4XKBA 4J7WA 1JWFA 4O1OA 1LF8A 3Q75A 1MJ0A 3CK9A 5DIZA 3CKBA 2I9CA 5C2YA 4MKTA 3U66A 3AS5A 4I17A 1NFIE 4C9BB 3D3MA 2M63A 1INZA 2XZDG 2WXIA 2XENA 3C72A 2Y1LE 4HQDA 3AU4A 3PVLA 2YINA 4TUUA 3CSTA 1WAO1 2WXLA 4YNDA 1MHQA 1D9SA 3N71A 2Y4UA 5HI7A 3C98A 3JYSA 5EKQD 3FEYA 4JL0A 3I5PA 2VSNA 5FQ4A 1OWOA 3LXUX 2J07A 4GZ6A 3IKOB 4N3AA 2CHZA 1ELKA 2RFMA 2X6JA 5LCWC 3VLFA 4WNDA 3FUEA 2ZGGA 4EHMA 2L6BA 1W3BA 3ZPJA 3NOCD 3O4ZA 3RIBA 5FQ8A 2JABA 3KEAA 2WQ7A 1BPOA 3FTVA 3R9AB 1YA0A 2QFCA 3DPYA 3Q49B 4GMLA 2VSXE 1IXVA 3P2BA 3I3NA 3CHQA 3APFA 3R9MA 1HX8A 4PS8A 2HE0A 5KBAA 4HOUA 4DLOA 3PS6A 3ZFWA 5B1AE 4C48B 4BY6A 3HVEB 4HBDA 3ZU7B 3OTNA 4G26A 4F53A 3Q78A 4JXTA 5G04C 3ONLA 2R05A 4U0UA 1TJCA 1N0RA 4GTSA 3EDTB 2HR2A 3HIZA 2OEWA 3CR3A 2FULA 2CG3A 4DX5D 3JQ1A 4UI9J 4KMOA 2LXMA 5EIBE 4G23A 4AY5A 2RKKA 2YHCA 2WXJA 5CCLA 2VSYA 4BESA 2WXHA 3QWPA 3SQVA 3EU5A 2ILRA 1X5BA 2OVFA 2J9QA 2VSOE 5G04J 4ZFHA 3ZNGA 1HFAA 3S7DA 3LVRE 5HKPA 1DCQA 1D8EA 1HO8A 4HRMB 4OVVA 4H7YA 5DBKA 2XCCA 1H0AA 2P2CP 3E33A 3D9OA 2XEHA 2AXUA 4KXKB 4Z68A 2LXLA 4WWOA 4I9EA 2HO1A 1N9AA 1TJFA 3T8MA 3RU0A 3NOGD 1OCOE 4JZYA 3DRAA 3FUIA 4KVOA 5ARFA 2XPZA 3UIOC 3KSLA 1JCSA 2JLBA 3FEXA 1N52A 1NA3A 5H7PA 3QDNA 4BSZB 3EJNA 2Y3AA 5CMWA 2XPYA 4J8DA 2IOLA 1N4PA 5KWDA 4I1AA 4B89A 5KCMA 1JWGA 2LUHA 4NURA 1FCHA 4LUNU 4AEZC 3DSTA 3CQCB 3TWXA 3MV3B 4H7XA 2GRQB 2L6JA 2I1JA 5D0QD 3UQ3A 4HI8A 4N3BA 1SQMA 4F1SA 4HXIA 3UM3A 3U4TA 2FO1E 5LOZA 4F3VA 2PNNA 3ZN3A 2IO2C 4MS6A 4GPMA 1MYOA 2R03A 3RK6A 1TN6A 5A23A 3FUDA 3TWVA 4HOTA 1S70B 5ENTD 4JD2G 3B7UX 1PAQA 3PEVB 4E85A 2QC9A 3FULA 1BI7B 5ENQD 1V55E 2XQ0A 4O1PA 3E34A 4BFRA 1DC2A 2WXOA 4U0ZA 4FHJA 3PE3A 3AG1E 4GZ5A 1S63A 2XRZA 4GYWA 1O1SA 3FU3A 2RD0A 4FHKA 5JA4D 3B95A 1SZ9A 3SFYA 4YVQC 3OXGA 4UWHA 4ANWA 3SO8A 3ZEFA 5B1BE 2V5FA 4I1OB 5J90A 3ULYA 2QYUA 3PZ1A 4B94A 1ZBPA 3CSFA 3RO2A 4N2QA 3HVEA 2V0PA 2L0IA 4GYYA 4ANUA 4K5AB 2XS1A 2Y4TA 4G25A 2PZIA 4MRUA 2J4DA 4GMJA 4GZ3A 5A6CA 4YDOA 4KZCA 1QQEA 4NRHB 4M3OA 3UX4A 3HXEA 2C2LA 4N5CA 3AG4E 3ASGA 4ILGA 5AN8A 2KCLA 5JHBA 3MZLB 5B3SE 4DI4A 3V31A 3B7SA 4DX7D 2WVIA 4Y6WA 3IEGA 3KSQA 5BUZA 2V4HC 1FVFA 2Y0BG 4Y6CA 1FT2A 3U3WA 3I4RB 3ASFA 1LTXA 2JEKA 4FULA 4JHKA 4Q94A 4UWFA 4CT0A 1N4SA 3UKRG 2ETBA 1K1BA 5AAOA 3CK7A 4F6RD 4IYPA 3TWTA 3L08A 4BX9A 3EHNA 3L17A 4BTBA 4ATGA 4DUIA 3BUAA 3CVXA 3GZ1A 4HFGA 2VTBA 4LERA 4PS3A 2BTDA 2A5UA 2XGOA 5AQ7A 3CVUA 5M72A 4CRWA 3DSXA 4QFVA 3VLEA 3FDHA 3ULQA 3KS2A 1IQRA 1EYHA 3NAWA 4X8QA 5EIDA 5G05J 3EIJA 3O48A 2XEVA 4LNGA 1HS6A 4B8CB 2EIKE 1WM5A 1L5JA 2WMNA 3ZRHA 2I1KA 3UINC 3UUXA 4IRUA 3AJIA 3ZYQA 5C1DA 5D66A 4A1SA 1YYHA 3KD7A 3P1UA 2LSVA 4JHRA 3CKCA 3CEQA 3G2WA 5EILA 4FP7A 4BETA 3LKUA 2GRPB 1TEZA 1ELWA 1Z6TA 4GAAA 4AOFA 3QARA 4GTTA 3IHVA 2WXKA 1H2TC 4L7TA 5JJ6A 3TWSA 4G8KA 2IFUA 4I43A 4NQ0A 1LD8A 3FUFA 5E76A 1OWLA 3RRMB 2ZXWE 3HG0D 3UTMA 4APOA 4U04A 3ZYLA 4I2ZA 3PE4A 2CHWA 3ASDA 4HRNA 4JHJA 1E90A 3PZDA 2PQRA 2Q7FA 4WNFA 3E4BA 3K9IA 1KT0A 5CRUA 3CLJA 2XGSA 4JW1A 4TRQA 1EPUA 4A63B 1Q2ZA 3RAUA 3SBSA 4L2LA 3ZIMA 3FP3A 3GYZA 1D8DA 1OWMA 2WXFA 4V3IA 3EHMA 3FTSA 2LSUA 2GRNB 1KZOA 1LD7A 3CHPA 4A3VA 2C0LA 2P9UG 1N94A 2I6HA 1P5QA 4IN3B 4L2YA 1U2VG 5AARA 5FINA 1SVXA 3EUVA 5AIJA 1E8ZA 3PNTB 1QYMA 1BD8A 4EQFA 3GZSA 1HE8A 1SZAA 4OVUA 4URKA 2AXVA 1H6KA 3ZW3A 2AW6A 1OWNA 4GCNA 5JHAA 5ANLA 3HHMA 2BF0X 3DSVA 3UXGA 5FZQA 5AENA 4UI9C 5A7DB 2CHXA 4GTVA 4J6IA 3DSUA 3LDZA 3ZXPA 3BU8A 5D0OD 3E37A 1TN8A 1YMPA 3FTUA 3TGOA 1N4QA 3Q9NC 2X3MA 1JUQA 2F8XK 1U3CA 2J49A 4L9PA 5BW8C 1OY3D 3ZHEA 5HQ8A 5HS0A 1JPLA 3URZA 4J8YA 5CRVA 2C0MA 2WQHA 3QJZA 3BEEA 3BG0B 5T3RA 4U8HA 4GTRA 3D9KA 4K5BA 1NL4A 2R02A 2YNQA 3HXDA 4J0UA 4RLYA 5CCMA 2KC7A 1UJJA 4GPKA 4AJWA 3FH7A 2CFUA 3MA5A 4AV7A 4HLLA 2R5SA 4IULA 2WXQA 4CGVA 3NQPA 1N54A 3UM2A 3S2AA 4EBAG 5J08A 2FBNA 2AJAA 3Q7AA 2IF4A 4LRZA 4RVBA 4KVMA 3LY9A 3C3RA 3DXMG 3RRNB 4ANXA 3V79K 2WXRA 2X6IA 2IJGX 1OWPA 2KM4A 2NXPA 2DCPA 2KATA 2OCCE 4JVSA 3ABLE 2IONA 2AWIA 1DCEA 5FWQA 3V2XA 1A5EA 1H2VC 3DEOA 3LJNA 1MX6A 3PZ2A 3MYVA 4FU3A 3APDA 5FZRA 4I6JA 2P9SG 4BX8A 3L6AA 1E7UA 2A5EA 5BXOA 3DSWA 4BERA 5CEDB 4ATZD 2VTBB 5KNHD 3FU5A 3ZUVB 1KT1A 3FUHA 5FJYA 3UM0A 3S7BA 4HOQA 2GROB 4G24A 1OUVA 2V8SE 3MKQB 2NC9A 4N39A 4JC8A 3HRAA 3X2QE 3L22A 3V30A 2P9IG 3CHRA 3UM1A 4G8LA 4KZ0A 2WXGA 3FH8A 4DPRA 4UWGA 3DEPA 3TG5A 2P9KG 3QWWA 3OAWA 4PDXA 5JJTA 3L82A 1TNYA 5T8IA 3NZUA 4APFA 5E75A 5BNWA 4BTAA 3TG4A 1UG3A 3CVYA 3SBTB 3MX3A 2H6FA 3JXJA 3C3QA 4LNUD 3EHQA 3L13A 4ABNA 2KZTB 1ZB1A 4FLBA 4HS2A 2OVBA 4EZLA 3CK8A 1OXJA 4WAFA 3NZSA 1Z5SC 3ASOE 2X38A 4ILIA 2IO3C 3SF4A 1TNOA 2BKKB 2DVWA 5HRYA 4HVBA 4BEPA 2J08A 4XI9A 4EECA 4PS7A 1N11A 3S7JA 2WM9A 3MEKA 4B0ZA 2L9BA 5CEAA 2QZAA 4UQYA 2AXZA 1NP7A 3CHSA 5KJNA 2XGMA 2LNIA 2ETAA 2RFAA 4UI9K 2VQ2A 3G2TA 4PH4B 3W9FA 4J8SA 4LCTA 5G2NA 2KCVA 3FU6A 3E30A 3ZXSA 2BUGA 3PUKA 4DX1A 4ACKA 1G3NB 2IU1A 4GTMA 4JB8P 4DRXE 3D9PA 3Q4AB 5KJKA 3U64A 2YQ8A 4CGWA 3L16A 5BV0A 4FC8A 5G55A 2FO7A 2EILE 3Q73A 1QZ2A 3B7BA 3CVPA 4K5CA 4YVOA 4DI3A 1KZPA 3APCA 5LP0A 3C5RA 1UW4B 4BSXA 3FH5A 1O1RA 1HH8A 1XGWA 1YCSB 2XCBA 5KNGA 2WQ6A 2FF4A 3WG7E 2ETCA 3HDXA 1TYQG 3CIAA 4FA6A 3QKYA 4AIFA 1Z3YA 2E2EA 3PEUB 3IXEA 3AG2E 5ENSD 1O1TA 2KBXA 3ML9A 4C0MA 2R2LA 5T4YA 1A17A 4XEIG 5AQBA 3LVQE 4UQZA 3T5XA 1SA4A 3HXFA 2MYOA 2GRMA 5ENRD 3ULEG 4J8EA 5G05C 1MX4A 2OEVA 2PQNA 1OCCE 1IKND 4JA7A 4LEUA 4Q96A 3R7QA 4AVXA 3DWLG 3PUJA 3FUMA 4W9RA 3NF1A 1QBQA 1S0PA 3LPZA 4AP2A 4RG6A 3PDNA 4CYMD 4ZHBA 3MKQA 3OXLA 1TNUA 2WXPA 1E7VA 1OCRE 3ASNE 5ENPD 3JXIA 4YDEA 3D9LA 4F1PA 5ARGA 2H6IA 3CHOA 3ZHEB 3V2OA 1EF1C 4OAUC 3QWVA 3Q9UC 4XZ4A 4UUCA 2Y69E 4CT4A 5AQ9A 5BPPA 2J09A 3JCKC 3UT8A 3B13A 1BI8B 2LAIA 1N4RA 3Q79A 2KZTA 1GW6A 4J8FA 5CMYA 5CECB 4RQIA 4GMRA 5LX8A 3PH0C 4GYOA 4GU5A 4GA2A 3QNKA 2IEJA 2P58C 3TXNA 3TWWA 1TR4A 1ELRA 3HXCA 1E8YA 5ANRA 3CV0A 3QAQA 4N5QA 5AJLA 1NI1A 3AU5A 3RJVA 2B6CA 1MQSA 3Q5MA 1JCQA 4DX2A 2EQXA 3FUNA 3UI2A 2WPVA 2I2OA 4TXQA 3ZVVA 4AM9A 3D9HA 3FU0A 3MJWA 3FTYA 1MZCA 3TWUA 1ZU2A 1HG5A 4TXRA 4UQXA 2P9PG 3SD5A 1FT1A 1Y8MA 3CVQA 2X6FA 2XRYA 5EX0A 5ENOD 2PM7A 4O6FA 1O5MA 2NSZA 3D9JA 3TAXA 3LEWA 4G1TA 4GZDA 4I6EA 3MCXA 2IOSA 2IQCA 2KCKA 2V4LA 4GA0A 2DZNA 4GTQA 4L23A 2R17C 3T9KA 4I6GA 3CVVA 5CHEE 3I4GA 1H6PA 4R7LA 2BKGA 4U95D 2F0YA 5JJ7A 3ASHA 5CERB 4I2WA 4LG6A 1K3ZD 4KBQA 3ESKA 4JEHA 1Y6IA 2XHEA 2CFZA 3WXXA 1PC2A 3FHEA 3FY4A 2GRLA 3HYMB 2J4BA 2WXNA 3D9NA 2NYJA 1AP7A 3RRUA 4TUMA 4MLPA 4U63A 2EIJE 3AAAC 1AWCB 4CDMA 1DVPA 4GB9A 3CGHA 2LAHA 1E96B 2MOWA 5FT9A 4EZJA 3ZKJA 3CQGB 4QQIA 3LY8A 1EDUA 4BT9A 3LS8A 4TXPA 3LY7A 4WWPA 5LFAA 1Z3XA 4XKCA 3Q15A 3ESLA 2UY1A
chains in the Genus database with same CATH topology
1Z5SC 2GRNB 2GROB 5D2MC 3UIPC 2GRQB 2IY0C 2GRRB 2IO3C 2IO2C 3UIOC 1KPSB 2GRPB 3UINC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z5S C;  2GRN B;  2GRO B;  5D2M C;  3UIP C;  2GRQ B;  2IY0 C;  2GRR B;  2IO3 C;  2IO2 C;  3UIO C;  1KPS B;  2GRP B;  3UIN C; 
#chains in the Genus database with same CATH topology
 1E8X A;  3LJ3 A;  4U7E B;  3SZ7 A;  4CDN A;  3DPD A;  3EU9 A;  1XNF A;  2P9N G;  3AS8 A;  3ZGQ A;  3ONK A;  3JUI A;  4OAV B;  4U8Y D;  1UN9 A;  4EZK A;  2ZIS A;  1E8W A;  3Q47 B;  5LCW J;  4MBG A;  4XIF A;  4HOS A;  2XPI A;  4DLQ A;  2DBA A;  2X6H A;  4UWL A;  4A3T A;  3UMV A;  5KJL A;  4CEM A;  3FUJ A;  4AY6 A;  3BQO A;  3UIP C;  3TJP A;  4KYO B;  4G11 A;  2EIM E;  2MHK A;  4P29 A;  4U0S A;  3JUE A;  5ITZ F;  3W9G A;  1H6O A;  2UWJ G;  3ABM E;  2RG8 A;  4JEU A;  4RG9 A;  4NAC A;  2PL2 A;  3S7F A;  3UPV A;  1FVH A;  2X6K A;  3QC1 A;  4RSY A;  1H19 A;  2QY7 A;  1U3D A;  3B7T A;  3T5V A;  1N95 A;  2XZT G;  3DXK G;  2VGX A;  5D2M C;  3CHM A;  1UJK A;  2DYS E;  1K8K G;  3QB2 A;  3NBN B;  3FTZ A;  1B89 A;  3DSS A;  2VGY A;  3DBS A;  1NA0 A;  1QNF A;  3PRZ A;  3ENE A;  1N0Q A;  1IHG A;  4XE0 A;  3QOU A;  1BLX B;  5FZS A;  3AS4 A;  5CBO A;  1RZ4 A;  1S64 A;  4XI0 A;  3BG1 B;  3SHF A;  4GA1 A;  2CG2 A;  3L54 A;  5KJM A;  4U96 D;  4YDW A;  3TWR A;  3D9M A;  2XEE A;  4HOR A;  3R7R A;  3JQ0 A;  3C3O A;  2WMO A;  3IHY A;  1SW6 A;  3KAE A;  2ZU6 B;  4EPZ A;  3UKU G;  4HRL A;  3ZYM A;  2H6H A;  1MX2 A;  3IBE A;  4LSZ E;  2H6G A;  4U07 A;  1HF8 A;  2PM6 A;  4HI9 A;  4LNB A;  4A1G A;  2WB2 A;  2IY0 C;  3G2S A;  2DZO A;  4ANV A;  5BT1 A;  4BT8 A;  2ZGD A;  2FEZ A;  3TXM A;  4N2S A;  2WXM A;  5EYL A;  3G2V A;  2DYR E;  4HB5 A;  4M7C A;  1TNB A;  1UOH A;  2HM8 A;  4I9C A;  3KEZ A;  4TV3 A;  2P9L G;  3L9T A;  4U8V D;  1H2U A;  1BU9 A;  4CCA A;  3TWQ A;  2GRR B;  2L0T B;  3OXF A;  4WUY A;  5BXU A;  3LCA A;  5BV1 A;  4FJZ A;  3FTX A;  3PRE A;  1SA5 A;  1PY1 A;  3TL5 A;  4ACL A;  4N3C A;  3QK0 A;  2F37 A;  3SY2 A;  1OCZ E;  1TNZ A;  3SFZ A;  4GTP A;  5ENN A;  4Q69 A;  4FJY A;  4A55 A;  4E6H A;  4GCO A;  4WWN A;  5EDS A;  1X81 A;  3EHR A;  5JMN D;  4BWR A;  1IQU A;  3SNX A;  2VGE A;  3HXB A;  3AG3 E;  4EBA A;  3T8K A;  1IYG A;  4O60 A;  2DIW A;  2E0I A;  4C0E A;  2V5Q C;  2OV8 A;  2B0O E;  4XX5 A;  3ML8 A;  3MKR A;  3MV2 B;  4L1B A;  3IV0 A;  3EIQ C;  3RSE G;  4F7A A;  1FPP A;  3NB2 A;  3MGB A;  1V54 E;  2A4Z A;  3FWV A;  2XS8 A;  5EX3 A;  3VTY A;  4FLH A;  4WNE A;  3UT7 A;  4JPS A;  4AXH A;  4B8A A;  3ABK E;  3PZ3 A;  2VJ8 A;  1VDY A;  3G2U A;  3VTX A;  4FAD A;  2UY1 B;  1K1A A;  2DWZ A;  2MRI A;  4DJA A;  2OND A;  3UT4 A;  3FTW A;  5FIO A;  1HXI A;  2KXP C;  1WY6 A;  1KPS B;  3ZYK A;  1NZN A;  3Q7F A;  2FI7 A;  2J8S D;  4B93 B;  2YHE A;  4DX6 D;  2GW1 A;  1KLX A;  3U9W A;  5AYW D;  4ME2 A;  4GTO A;  3E32 A;  2F8Y A;  4HNA D;  2LO6 A;  3B7R L;  4D10 C;  3SGH A;  5AJD A;  1TN7 A;  3PZ4 A;  1IHB A;  3F6Q A;  4PUC A;  3SI5 A;  4DK5 A;  2R59 A;  1HZ4 A;  4ILH B;  3RO3 A;  3D9I A;  4G2V A;  1UN8 A;  4OYS A;  1DNP A;  1JCR A;  3PNL B;  4K03 A;  2HYZ A;  5EN5 D;  4KT6 B;  4HLE A;  3J5Q B;  4JA9 A;  3FFL A;  4NIK A;  2OOE A;  4I1M A;  4WNG A;  5FTP A;  3GZ2 A;  3RKV A;  3CVN A;  3CVL A;  5EYP F;  1HU3 A;  3GW4 A;  1OT8 A;  1WG0 A;  3LYA A;  5AQA A;  2GGF A;  5CBN A;  2VGX B;  4YDY A;  4GZC A;  2BED A;  4CZ2 D;  4CDR A;  1WDY A;  2EIN E;  2AVP A;  1RW2 A;  3FUK A;  3CVW A;  5FQ6 A;  5FQ7 A;  3ISM C;  5IY5 E;  4UWK A;  2QYJ A;  3SFX A;  1HG2 A;  2ZIR A;  2VYI A;  3J5P A;  4K0R A;  3VLD A;  4XKB A;  4J7W A;  1JWF A;  4O1O A;  1LF8 A;  3Q75 A;  1MJ0 A;  3CK9 A;  5DIZ A;  3CKB A;  2I9C A;  5C2Y A;  4MKT A;  3U66 A;  3AS5 A;  4I17 A;  1NFI E;  4C9B B;  3D3M A;  2M63 A;  1INZ A;  2XZD G;  2WXI A;  2XEN A;  3C72 A;  2Y1L E;  4HQD A;  3AU4 A;  3PVL A;  2YIN A;  4TUU A;  3CST A;  1WAO 1;  2WXL A;  4YND A;  1MHQ A;  1D9S A;  3N71 A;  2Y4U A;  5HI7 A;  3C98 A;  3JYS A;  5EKQ D;  3FEY A;  4JL0 A;  3I5P A;  2VSN A;  5FQ4 A;  1OWO A;  3LXU X;  2J07 A;  4GZ6 A;  3IKO B;  4N3A A;  2CHZ A;  1ELK A;  2RFM A;  2X6J A;  5LCW C;  3VLF A;  4WND A;  3FUE A;  2ZGG A;  4EHM A;  2L6B A;  1W3B A;  3ZPJ A;  3NOC D;  3O4Z A;  3RIB A;  5FQ8 A;  2JAB A;  3KEA A;  2WQ7 A;  1BPO A;  3FTV A;  3R9A B;  1YA0 A;  2QFC A;  3DPY A;  3Q49 B;  4GML A;  2VSX E;  1IXV A;  3P2B A;  3I3N A;  3CHQ A;  3APF A;  3R9M A;  1HX8 A;  4PS8 A;  2HE0 A;  5KBA A;  4HOU A;  4DLO A;  3PS6 A;  3ZFW A;  5B1A E;  4C48 B;  4BY6 A;  3HVE B;  4HBD A;  3ZU7 B;  3OTN A;  4G26 A;  4F53 A;  3Q78 A;  4JXT A;  5G04 C;  3ONL A;  2R05 A;  4U0U A;  1TJC A;  1N0R A;  4GTS A;  3EDT B;  2HR2 A;  3HIZ A;  2OEW A;  3CR3 A;  2FUL A;  2CG3 A;  4DX5 D;  3JQ1 A;  4UI9 J;  4KMO A;  2LXM A;  5EIB E;  4G23 A;  4AY5 A;  2RKK A;  2YHC A;  2WXJ A;  5CCL A;  2VSY A;  4BES A;  2WXH A;  3QWP A;  3SQV A;  3EU5 A;  2ILR A;  1X5B A;  2OVF A;  2J9Q A;  2VSO E;  5G04 J;  4ZFH A;  3ZNG A;  1HFA A;  3S7D A;  3LVR E;  5HKP A;  1DCQ A;  1D8E A;  1HO8 A;  4HRM B;  4OVV A;  4H7Y A;  5DBK A;  2XCC A;  1H0A A;  2P2C P;  3E33 A;  3D9O A;  2XEH A;  2AXU A;  4KXK B;  4Z68 A;  2LXL A;  4WWO A;  4I9E A;  2HO1 A;  1N9A A;  1TJF A;  3T8M A;  3RU0 A;  3NOG D;  1OCO E;  4JZY A;  3DRA A;  3FUI A;  4KVO A;  5ARF A;  2XPZ A;  3UIO C;  3KSL A;  1JCS A;  2JLB A;  3FEX A;  1N52 A;  1NA3 A;  5H7P A;  3QDN A;  4BSZ B;  3EJN A;  2Y3A A;  5CMW A;  2XPY A;  4J8D A;  2IOL A;  1N4P A;  5KWD A;  4I1A A;  4B89 A;  5KCM A;  1JWG A;  2LUH A;  4NUR A;  1FCH A;  4LUN U;  4AEZ C;  3DST A;  3CQC B;  3TWX A;  3MV3 B;  4H7X A;  2GRQ B;  2L6J A;  2I1J A;  5D0Q D;  3UQ3 A;  4HI8 A;  4N3B A;  1SQM A;  4F1S A;  4HXI A;  3UM3 A;  3U4T A;  2FO1 E;  5LOZ A;  4F3V A;  2PNN A;  3ZN3 A;  2IO2 C;  4MS6 A;  4GPM A;  1MYO A;  2R03 A;  3RK6 A;  1TN6 A;  5A23 A;  3FUD A;  3TWV A;  4HOT A;  1S70 B;  5ENT D;  4JD2 G;  3B7U X;  1PAQ A;  3PEV B;  4E85 A;  2QC9 A;  3FUL A;  1BI7 B;  5ENQ D;  1V55 E;  2XQ0 A;  4O1P A;  3E34 A;  4BFR A;  1DC2 A;  2WXO A;  4U0Z A;  4FHJ A;  3PE3 A;  3AG1 E;  4GZ5 A;  1S63 A;  2XRZ A;  4GYW A;  1O1S A;  3FU3 A;  2RD0 A;  4FHK A;  5JA4 D;  3B95 A;  1SZ9 A;  3SFY A;  4YVQ C;  3OXG A;  4UWH A;  4ANW A;  3SO8 A;  3ZEF A;  5B1B E;  2V5F A;  4I1O B;  5J90 A;  3ULY A;  2QYU A;  3PZ1 A;  4B94 A;  1ZBP A;  3CSF A;  3RO2 A;  4N2Q A;  3HVE A;  2V0P A;  2L0I A;  4GYY A;  4ANU A;  4K5A B;  2XS1 A;  2Y4T A;  4G25 A;  2PZI A;  4MRU A;  2J4D A;  4GMJ A;  4GZ3 A;  5A6C A;  4YDO A;  4KZC A;  1QQE A;  4NRH B;  4M3O A;  3UX4 A;  3HXE A;  2C2L A;  4N5C A;  3AG4 E;  3ASG A;  4ILG A;  5AN8 A;  2KCL A;  5JHB A;  3MZL B;  5B3S E;  4DI4 A;  3V31 A;  3B7S A;  4DX7 D;  2WVI A;  4Y6W A;  3IEG A;  3KSQ A;  5BUZ A;  2V4H C;  1FVF A;  2Y0B G;  4Y6C A;  1FT2 A;  3U3W A;  3I4R B;  3ASF A;  1LTX A;  2JEK A;  4FUL A;  4JHK A;  4Q94 A;  4UWF A;  4CT0 A;  1N4S A;  3UKR G;  2ETB A;  1K1B A;  5AAO A;  3CK7 A;  4F6R D;  4IYP A;  3TWT A;  3L08 A;  4BX9 A;  3EHN A;  3L17 A;  4BTB A;  4ATG A;  4DUI A;  3BUA A;  3CVX A;  3GZ1 A;  4HFG A;  2VTB A;  4LER A;  4PS3 A;  2BTD A;  2A5U A;  2XGO A;  5AQ7 A;  3CVU A;  5M72 A;  4CRW A;  3DSX A;  4QFV A;  3VLE A;  3FDH A;  3ULQ A;  3KS2 A;  1IQR A;  1EYH A;  3NAW A;  4X8Q A;  5EID A;  5G05 J;  3EIJ A;  3O48 A;  2XEV A;  4LNG A;  1HS6 A;  4B8C B;  2EIK E;  1WM5 A;  1L5J A;  2WMN A;  3ZRH A;  2I1K A;  3UIN C;  3UUX A;  4IRU A;  3AJI A;  3ZYQ A;  5C1D A;  5D66 A;  4A1S A;  1YYH A;  3KD7 A;  3P1U A;  2LSV A;  4JHR A;  3CKC A;  3CEQ A;  3G2W A;  5EIL A;  4FP7 A;  4BET A;  3LKU A;  2GRP B;  1TEZ A;  1ELW A;  1Z6T A;  4GAA A;  4AOF A;  3QAR A;  4GTT A;  3IHV A;  2WXK A;  1H2T C;  4L7T A;  5JJ6 A;  3TWS A;  4G8K A;  2IFU A;  4I43 A;  4NQ0 A;  1LD8 A;  3FUF A;  5E76 A;  1OWL A;  3RRM B;  2ZXW E;  3HG0 D;  3UTM A;  4APO A;  4U04 A;  3ZYL A;  4I2Z A;  3PE4 A;  2CHW A;  3ASD A;  4HRN A;  4JHJ A;  1E90 A;  3PZD A;  2PQR A;  2Q7F A;  4WNF A;  3E4B A;  3K9I A;  1KT0 A;  5CRU A;  3CLJ A;  2XGS A;  4JW1 A;  4TRQ A;  1EPU A;  4A63 B;  1Q2Z A;  3RAU A;  3SBS A;  4L2L A;  3ZIM A;  3FP3 A;  3GYZ A;  1D8D A;  1OWM A;  2WXF A;  4V3I A;  3EHM A;  3FTS A;  2LSU A;  2GRN B;  1KZO A;  1LD7 A;  3CHP A;  4A3V A;  2C0L A;  2P9U G;  1N94 A;  2I6H A;  1P5Q A;  4IN3 B;  4L2Y A;  1U2V G;  5AAR A;  5FIN A;  1SVX A;  3EUV A;  5AIJ A;  1E8Z A;  3PNT B;  1QYM A;  1BD8 A;  4EQF A;  3GZS A;  1HE8 A;  1SZA A;  4OVU A;  4URK A;  2AXV A;  1H6K A;  3ZW3 A;  2AW6 A;  1OWN A;  4GCN A;  5JHA A;  5ANL A;  3HHM A;  2BF0 X;  3DSV A;  3UXG A;  5FZQ A;  5AEN A;  4UI9 C;  5A7D B;  2CHX A;  4GTV A;  4J6I A;  3DSU A;  3LDZ A;  3ZXP A;  3BU8 A;  5D0O D;  3E37 A;  1TN8 A;  1YMP A;  3FTU A;  3TGO A;  1N4Q A;  3Q9N C;  2X3M A;  1JUQ A;  2F8X K;  1U3C A;  2J49 A;  4L9P A;  5BW8 C;  1OY3 D;  3ZHE A;  5HQ8 A;  5HS0 A;  1JPL A;  3URZ A;  4J8Y A;  5CRV A;  2C0M A;  2WQH A;  3QJZ A;  3BEE A;  3BG0 B;  5T3R A;  4U8H A;  4GTR A;  3D9K A;  4K5B A;  1NL4 A;  2R02 A;  2YNQ A;  3HXD A;  4J0U A;  4RLY A;  5CCM A;  2KC7 A;  1UJJ A;  4GPK A;  4AJW A;  3FH7 A;  2CFU A;  3MA5 A;  4AV7 A;  4HLL A;  2R5S A;  4IUL A;  2WXQ A;  4CGV A;  3NQP A;  1N54 A;  3UM2 A;  3S2A A;  4EBA G;  5J08 A;  2FBN A;  2AJA A;  3Q7A A;  2IF4 A;  4LRZ A;  4RVB A;  4KVM A;  3LY9 A;  3C3R A;  3DXM G;  3RRN B;  4ANX A;  3V79 K;  2WXR A;  2X6I A;  2IJG X;  1OWP A;  2KM4 A;  2NXP A;  2DCP A;  2KAT A;  2OCC E;  4JVS A;  3ABL E;  2ION A;  2AWI A;  1DCE A;  5FWQ A;  3V2X A;  1A5E A;  1H2V C;  3DEO A;  3LJN A;  1MX6 A;  3PZ2 A;  3MYV A;  4FU3 A;  3APD A;  5FZR A;  4I6J A;  2P9S G;  4BX8 A;  3L6A A;  1E7U A;  2A5E A;  5BXO A;  3DSW A;  4BER A;  5CED B;  4ATZ D;  2VTB B;  5KNH D;  3FU5 A;  3ZUV B;  1KT1 A;  3FUH A;  5FJY A;  3UM0 A;  3S7B A;  4HOQ A;  2GRO B;  4G24 A;  1OUV A;  2V8S E;  3MKQ B;  2NC9 A;  4N39 A;  4JC8 A;  3HRA A;  3X2Q E;  3L22 A;  3V30 A;  2P9I G;  3CHR A;  3UM1 A;  4G8L A;  4KZ0 A;  2WXG A;  3FH8 A;  4DPR A;  4UWG A;  3DEP A;  3TG5 A;  2P9K G;  3QWW A;  3OAW A;  4PDX A;  5JJT A;  3L82 A;  1TNY A;  5T8I A;  3NZU A;  4APF A;  5E75 A;  5BNW A;  4BTA A;  3TG4 A;  1UG3 A;  3CVY A;  3SBT B;  3MX3 A;  2H6F A;  3JXJ A;  3C3Q A;  4LNU D;  3EHQ A;  3L13 A;  4ABN A;  2KZT B;  1ZB1 A;  4FLB A;  4HS2 A;  2OVB A;  4EZL A;  3CK8 A;  1OXJ A;  4WAF A;  3NZS A;  1Z5S C;  3ASO E;  2X38 A;  4ILI A;  2IO3 C;  3SF4 A;  1TNO A;  2BKK B;  2DVW A;  5HRY A;  4HVB A;  4BEP A;  2J08 A;  4XI9 A;  4EEC A;  4PS7 A;  1N11 A;  3S7J A;  2WM9 A;  3MEK A;  4B0Z A;  2L9B A;  5CEA A;  2QZA A;  4UQY A;  2AXZ A;  1NP7 A;  3CHS A;  5KJN A;  2XGM A;  2LNI A;  2ETA A;  2RFA A;  4UI9 K;  2VQ2 A;  3G2T A;  4PH4 B;  3W9F A;  4J8S A;  4LCT A;  5G2N A;  2KCV A;  3FU6 A;  3E30 A;  3ZXS A;  2BUG A;  3PUK A;  4DX1 A;  4ACK A;  1G3N B;  2IU1 A;  4GTM A;  4JB8 P;  4DRX E;  3D9P A;  3Q4A B;  5KJK A;  3U64 A;  2YQ8 A;  4CGW A;  3L16 A;  5BV0 A;  4FC8 A;  5G55 A;  2FO7 A;  2EIL E;  3Q73 A;  1QZ2 A;  3B7B A;  3CVP A;  4K5C A;  4YVO A;  4DI3 A;  1KZP A;  3APC A;  5LP0 A;  3C5R A;  1UW4 B;  4BSX A;  3FH5 A;  1O1R A;  1HH8 A;  1XGW A;  1YCS B;  2XCB A;  5KNG A;  2WQ6 A;  2FF4 A;  3WG7 E;  2ETC A;  3HDX A;  1TYQ G;  3CIA A;  4FA6 A;  3QKY A;  4AIF A;  1Z3Y A;  2E2E A;  3PEU B;  3IXE A;  3AG2 E;  5ENS D;  1O1T A;  2KBX A;  3ML9 A;  4C0M A;  2R2L A;  5T4Y A;  1A17 A;  4XEI G;  5AQB A;  3LVQ E;  4UQZ A;  3T5X A;  1SA4 A;  3HXF A;  2MYO A;  2GRM A;  5ENR D;  3ULE G;  4J8E A;  5G05 C;  1MX4 A;  2OEV A;  2PQN A;  1OCC E;  1IKN D;  4JA7 A;  4LEU A;  4Q96 A;  3R7Q A;  4AVX A;  3DWL G;  3PUJ A;  3FUM A;  4W9R A;  3NF1 A;  1QBQ A;  1S0P A;  3LPZ A;  4AP2 A;  4RG6 A;  3PDN A;  4CYM D;  4ZHB A;  3MKQ A;  3OXL A;  1TNU A;  2WXP A;  1E7V A;  1OCR E;  3ASN E;  5ENP D;  3JXI A;  4YDE A;  3D9L A;  4F1P A;  5ARG A;  2H6I A;  3CHO A;  3ZHE B;  3V2O A;  1EF1 C;  4OAU C;  3QWV A;  3Q9U C;  4XZ4 A;  4UUC A;  2Y69 E;  4CT4 A;  5AQ9 A;  5BPP A;  2J09 A;  3JCK C;  3UT8 A;  3B13 A;  1BI8 B;  2LAI A;  1N4R A;  3Q79 A;  2KZT A;  1GW6 A;  4J8F A;  5CMY A;  5CEC B;  4RQI A;  4GMR A;  5LX8 A;  3PH0 C;  4GYO A;  4GU5 A;  4GA2 A;  3QNK A;  2IEJ A;  2P58 C;  3TXN A;  3TWW A;  1TR4 A;  1ELR A;  3HXC A;  1E8Y A;  5ANR A;  3CV0 A;  3QAQ A;  4N5Q A;  5AJL A;  1NI1 A;  3AU5 A;  3RJV A;  2B6C A;  1MQS A;  3Q5M A;  1JCQ A;  4DX2 A;  2EQX A;  3FUN A;  3UI2 A;  2WPV A;  2I2O A;  4TXQ A;  3ZVV A;  4AM9 A;  3D9H A;  3FU0 A;  3MJW A;  3FTY A;  1MZC A;  3TWU A;  1ZU2 A;  1HG5 A;  4TXR A;  4UQX A;  2P9P G;  3SD5 A;  1FT1 A;  1Y8M A;  3CVQ A;  2X6F A;  2XRY A;  5EX0 A;  5ENO D;  2PM7 A;  4O6F A;  1O5M A;  2NSZ A;  3D9J A;  3TAX A;  3LEW A;  4G1T A;  4GZD A;  4I6E A;  3MCX A;  2IOS A;  2IQC A;  2KCK A;  2V4L A;  4GA0 A;  2DZN A;  4GTQ A;  4L23 A;  2R17 C;  3T9K A;  4I6G A;  3CVV A;  5CHE E;  3I4G A;  1H6P A;  4R7L A;  2BKG A;  4U95 D;  2F0Y A;  5JJ7 A;  3ASH A;  5CER B;  4I2W A;  4LG6 A;  1K3Z D;  4KBQ A;  3ESK A;  4JEH A;  1Y6I A;  2XHE A;  2CFZ A;  3WXX A;  1PC2 A;  3FHE A;  3FY4 A;  2GRL A;  3HYM B;  2J4B A;  2WXN A;  3D9N A;  2NYJ A;  1AP7 A;  3RRU A;  4TUM A;  4MLP A;  4U63 A;  2EIJ E;  3AAA C;  1AWC B;  4CDM A;  1DVP A;  4GB9 A;  3CGH A;  2LAH A;  1E96 B;  2MOW A;  5FT9 A;  4EZJ A;  3ZKJ A;  3CQG B;  4QQI A;  3LY8 A;  1EDU A;  4BT9 A;  3LS8 A;  4TXP A;  3LY7 A;  4WWP A;  5LFA A;  1Z3X A;  4XKC A;  3Q15 A;  3ESL A;  2UY1 A; 
#chains in the Genus database with same CATH homology
 1Z5S C;  2GRN B;  2GRO B;  5D2M C;  3UIP C;  2GRQ B;  2IY0 C;  2GRR B;  2IO3 C;  2IO2 C;  3UIO C;  1KPS B;  2GRP B;  3UIN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...