4UI9K

Atomic structure of the human anaphase-promoting complex
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
493
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHKSCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 178
structure length 493
sequence length 526
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
K PF13176 TPR_7 Tetratricopeptide repeat
K PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9K00
4JHRA 4GYYA 2XCCA 3KS2A 2VGXA 2Q7FA 2FBNA 3Q5MA 4HOQA 5FZRA 3KAEA 2V5FA 4O6FA 3ZGQA 3QKYA 2XGMA 4I9EA 2UY1A 4NRHB 4GCNA 4HOUA 5AYWD 1B89A 2AVPA 5CCMA 4I2WA 2L6JA 3SZ7A 5M72A 4WUYA 4GZ6A 4AY6A 3NF1A 5G05C 3WXXA 1IHGA 1OUVA 2BUGA 5C1DA 5ARFA 3ZHEA 5KJMA 3QWVA 2KCVA 1QQEA 4I1AA 1E96B 4A1SA 3LKUA 4J8DA 3RO3A 5FT9A 4APOA 3URZA 3PE3A 4N2SA 3BEEA 3MKRA 5JJTA 2QFCA 3S7FA 3MV3B 5LCWJ 3PE4A 4G2VA 3ASFA 4JA7A 3RJVA 3VTXA 2KCLA 5ARGA 1FCHA 4CDRA 3MEKA 1Y8MA 3PDNA 5KJKA 4WNEA 1WM5A 4XI0A 3CEQA 5FZQA 2J9QA 1ELWA 2WPVA 4J8EA 2C0LA 1HXIA 4GA0A 2C2LA 4BTBA 4KBQA 1NA0A 3GYZA 3RIBA 3QDNA 4N5CA 5FJYA 2HO1A 1A17A 2XPIA 4JL0A 3QOUA 4GZ3A 4XIFA 4J0UA 3K9IA 4IN3B 4HOSA 2IF4A 3Q47B 3ASHA 5D0OD 5A6CA 4CGWA 4ME2A 1NA3A 3Q49B 3CVQA 3JYSA 3QWWA 3E4BA 5EKQD 3Q4AB 3O48A 4HOTA 2VYIA 5G04J 2JLBA 2UY1B 1KT0A 3LYAA 3TGOA 4W9RA 4WNFA 2I6HA 2OOEA 4UI9C 3TG5A 4CGVA 3CKCA 1W3BA 3CVPA 3HYMB 2WQHA 4N3CA 4GZ5A 5EX3A 3ZPJA 3SF4A 4I17A 4H7YA 5HQ8A 1IYGA 1ELRA 3U3WA 1XNFA 2VQ2A 3GZ2A 5JJ6A 4KYOB 2HYZA 3LPZA 4WNGA 3S7JA 3LCAA 5G05J 3MA5A 3VTYA 4RG6A 3OXGA 2E2EA 2UWJG 5DBKA 4N2QA 4UI9K 3CK7A 2PQRA 5A7DB 4KXKB 4NQ0A 3RO2A 2R5SA 3ASDA 3AS4A 5HI7A 2Y4TA 4YVOA 2VSNA 4N3BA 5KJLA 3KD7A 4G1TA 4N3AA 4RG9A 3EDTB 5FZSA 5LCWC 1ZU2A 5CCLA 4JA9A 4B94A 1YA0A 3GZ1A 4WNDA 3ULQA 5BW8C 2PQNA 2FI7A 5CHEE 4Y6WA 2LSUA 2YQ8A 4BT9A 4EQFA 5EX0A 4GPKA 2HR2A 2KCKA 4G26A 3S7BA 1ZBPA 4ABNA 4BT8A 2VGXB 3UQ3A 2GW1A 3CK8A 2XEVA 4BTAA 1NZNA 1TJCA 4XI9A 4GCOA 5D0QD 2DBAA 4LEUA 5DIZA 4UI9J 5G04C 4I2ZA 2P58C 4G24A 4G23A 3ZHEB 4F3VA 5FTPA 3TG4A 2KATA 2XGOA 3LY9A 3CV0A 3GW4A 3RU0A 4Y6CA 4U0SA 3LY7A 4UQXA 3OXLA 2Y4UA 4U0UA 1WAO1 5BNWA 4GYOA 3ZN3A 4YVQC 2MHKA 4YNDA 2FF4A 3AS5A 3MV2B 3ZFWA 1HH8A 3S7DA 4AM9A 2IFUA 2XCBA 4U04A 2XGSA 3ASGA 4UQYA 3FFLA 3TAXA 2PL2A 5JJ7A 2C0MA 3RKVA 3AS8A 4U0ZA 4BWRA 4HORA 1KT1A 4AIFA 1PC2A 3IEGA 1HZ4A 3Q15A 3FP3A 3UPVA 3R9AB 1P5QA 4GYWA 2KC7A 2NC9A 2ONDA 4G25A 3U4TA 2YHCA 3N71A 4GA1A 2FEZA 4J8FA 2FO7A 4N39A 4I9CA 3FWVA 5BT1A 2PZIA 2VSYA 3UUXA 2LNIA 4GA2A 4UQZA 4U07A 4AY5A 5KJNA 3ESKA 2VGYA 3CVNA 1QZ2A 4H7XA 2LSVA 3OXFA 3CK9A 3CVLA 3QWPA 1KLXA 3CKBA 3LY8A
chains in the Genus database with same CATH superfamily
4FHKA 1OCRE 5CECB 2GRLA 4GYYA 1V55E 2XPZA 4JVSA 4U8VD 2OVBA 4PS8A 1OY3D 3T8KA 1OCOE 3Q5MA 4UWLA 1QYMA 5FZRA 1TNBA 2V5FA 4O6FA 2ETCA 5BUZA 4PS7A 2XGMA 3CHOA 2CG3A 4HOUA 5AYWD 2R17C 5ENQD 3AJIA 2L6JA 5EILA 3E30A 3SZ7A 2GRMA 3Q79A 3JQ1A 4HFGA 4GZ6A 3WG7E 3Q78A 1EF1C 2BUGA 5C1DA 5ARFA 3FEYA 3PS6A 4L1BA 2WM9A 4HXIA 3CR3A 3DRAA 1E96B 3L17A 3RRNB 4APOA 3TWXA 1KZPA 3URZA 3PE3A 3EIJA 4N2SA 1V54E 2YHEA 5JJTA 3TWTA 3J5PA 3PNLB 2QFCA 3PE4A 2BKKB 5ENPD 3LVRE 2DZOA 5ARGA 3UT8A 1FCHA 4CDRA 3UM1A 1DCQA 1Y8MA 3PDNA 5KJKA 4WNEA 4XI0A 3CEQA 5T8IA 1ELWA 1OWLA 1D8EA 4EPZA 2Y3AA 3EHRA 2X3MA 1HXIA 1SA5A 1IQRA 3UT4A 5G55A 2Y0BG 4N5CA 2HO1A 3CIAA 3R9MA 3APCA 4L7TA 4IRUA 4P29A 1OXJA 4GZ3A 4J0UA 3K9IA 1OCZE 2IF4A 3ASHA 3ZEFA 5A6CA 4U7EB 2EIKE 3S2AA 3TXMA 3KSLA 3QWWA 1N95A 3ULEG 5EKQD 1TN8A 4DI4A 1SA4A 3IV0A 4CRWA 4HOTA 5G04J 2IY0C 3NOGD 5A23A 2OOEA 1ELKA 4L2YA 2AWIA 4HI8A 4R7LA 5JA4D 2WQHA 4N3CA 4OVVA 5HQ8A 3E34A 2VSXE 3BU8A 2VQ2A 4K5BA 1U3CA 2LXLA 3NQPA 3B13A 5B3SE 3SQVA 4BERA 3S7JA 5G05J 3HVEB 3MA5A 3NB2A 4FLHA 4RG6A 3OXGA 3LJNA 1INZA 3B7RL 3JUEA 4Q96A 2F37A 2PQRA 4DI3A 5A7DB 5LOZA 3FUNA 2VTBA 3G2VA 1HU3A 1H2TC 4GPMA 3ONLA 3MYVA 5IY5E 1TR4A 2RG8A 2WXIA 4GTPA 4OAVB 3ASNE 3CLJA 4YVOA 3ULYA 3DPDA 3IXEA 3C3QA 3KD7A 5LCWC 3EDTB 4G8KA 2WXNA 4GMJA 3HXFA 1H19A 3T5XA 4JA9A 1UJJA 4M7CA 2X6IA 3FEXA 3TWWA 2AW6A 5BW8C 2CFUA 4FJZA 2QYUA 2FI7A 4QFVA 5CHEE 1IHBA 1FPPA 2LSUA 2YQ8A 2IU1A 1BI8B 5KCMA 1VDYA 3FUHA 3UMVA 1LTXA 4ABNA 2QC9A 2VGXB 3ZIMA 4GTOA 3UQ3A 1RZ4A 4BY6A 3ZYKA 4UWKA 1FT2A 3JXIA 2BF0X 4CEMA 2DWZA 2IQCA 4AEZC 5D0QD 4DX1A 2YINA 4CT0A 3AU4A 2RFAA 4I2ZA 4G24A 3DEOA 4U95D 4EZLA 5EYLA 2R59A 3LEWA 3SGHA 3EJNA 4BFRA 3L9TA 2NSZA 3KEZA 3CV0A 3GW4A 3LY7A 4UQXA 4KZCA 4LUNU 2V5QC 3L08A 4OAUC 1Z5SC 2H6IA 1OWOA 2R05A 5CEAA 4YVQC 3ISMC 4O1PA 3ABME 4U8YD 4HRNA 2CHWA 2AXZA 5G2NA 5FQ7A 3EU5A 5T4YA 4YDWA 1U2VG 3CVXA 4TXQA 2XEHA 4AM9A 4ANUA 4ZHBA 4B93B 4U8HA 3UM2A 2WXQA 4UQYA 1MZCA 2J08A 2IONA 3ZNGA 1AP7A 1MHQA 1HZ4A 5ENOD 4HVBA 3Q15A 3E37A 3UPVA 3R9AB 1P5QA 4JPSA 2NC9A 2ONDA 2XRYA 3HXDA 3Q9UC 4LERA 3W9GA 3N71A 1FVHA 4XEIG 4B8AA 2IJGX 1Y6IA 4I1OB 2OEVA 4I9CA 5ENSD 3TWSA 3APDA 4G8LA 4MKTA 4AY5A 4U07A 4RQIA 2ZU6B 4J7WA 2QZAA 5BPPA 3CHPA 2WXJA 3CK9A 2XS8A 2R03A 3SBTB 2WB2A 3D9OA 3CKBA 3T9KA 3FTWA 2LXMA 4EECA 4TXPA 2XCCA 4K5CA 3JCKC 2DIWA 2XRZA 2WXGA 2VGXA 3MZLB 3L22A 3KAEA 4A55A 4B89A 3ZGQA 3I5PA 2P9PG 5FWQA 4GTRA 1K1AA 1TYQG 4WWNA 4CCAA 3QARA 4I9EA 2UY1A 4NRHB 1B89A 2AVPA 3FTUA 3JXJA 3UI2A 3O4ZA 3CGHA 4WUYA 3SO8A 3G2SA 4GU5A 1HFAA 3J5QB 4DX7D 3QAQA 3AG4E 1HS6A 1OUVA 4MBGA 1N0RA 2X6HA 3L13A 4LNGA 1N54A 4I1AA 4NURA 3FTSA 1O1RA 3RO3A 2VGEA 3BEEA 2WQ7A 4FC8A 1K3ZD 1H6OA 4JHJA 1H2UA 4G2VA 3HG0D 3VTXA 1N9AA 4CT4A 1O5MA 3UM3A 5AQ7A 2FO1E 2XPYA 1UJKA 3QK0A 3RRMB 2IOLA 2WXKA 5KNHD 3MGBA 5AJDA 2WPVA 2L0TB 2C2LA 2GRNB 2EINE 1NA0A 2KXPC 3GYZA 3QDNA 2P9SG 4BESA 4JL0A 3T8MA 1PAQA 3QOUA 3IKOB 3T5VA 3ABLE 2HM8A 2WXOA 5EIDA 4HOSA 3ZKJA 4A3TA 4ANVA 3JQ0A 5ITZF 4FA6A 4CGWA 4ME2A 3KSQA 3U66A 4F6RD 3JYSA 3E4BA 1S63A 4DJAA 2WMOA 4UWGA 1MQSA 3MX3A 1E8ZA 1N52A 2JLBA 2DZNA 4WNFA 3TG5A 4UI9C 2HE0A 2ZGGA 1W3BA 4I6JA 1X5BA 3ZPJA 4I17A 4H7YA 5FQ6A 3ZRHA 5AQBA 1XNFA 4KYOB 2HYZA 4WNGA 1UOHA 3LCAA 1H0AA 1EPUA 2WMNA 4N2QA 4L9PA 4F1PA 4PH4B 2EIME 4E85A 4GMRA 3D3MA 4PDXA 5CERB 2VSOE 3ASDA 4TUMA 3HXBA 2LAIA 3RSEG 1OWNA 4JZYA 1TNUA 2Y4TA 3BQOA 2VSNA 3QJZA 4FADA 5FZSA 2WXFA 3VLEA 2R02A 3PZ2A 4JXTA 4FHJA 4CYMD 5CCLA 3FU5A 4EBAA 2CHZA 1A5EA 3UKUG 3CVVA 3GZ1A 4AVXA 1JCRA 3EHQA 1OCCE 2PQNA 3Q7AA 5H7PA 3PUJA 2WXRA 2J4BA 2P9KG 3EHMA 1H2VC 4EQFA 5EX0A 4TRQA 4GPKA 2RKKA 4G26A 3S7BA 1ZBPA 4HRLA 3ZXSA 2I1KA 2WQ6A 3FH8A 1TN6A 4A3VA 2GW1A 3OAWA 3CHSA 4KVOA 5CRUA 1BLXB 5FQ8A 1TJCA 4GCOA 5BV1A 5CBOA 3IBEA 3OTNA 3FU0A 2DBAA 4B0ZA 5AJLA 4LEUA 4QQIA 4AXHA 4Q69A 3FUKA 3PEVB 5G04C 1S0PA 4C0EA 2P58C 4J6IA 4LSZE 4G23A 5ANRA 4F3VA 1DC2A 2X6FA 3FU3A 2KATA 1MX2A 2BTDA 2JEKA 4U0SA 3OXLA 2CFZA 2H6GA 5BNWA 2LUHA 4GYOA 5AQAA 2QY7A 3FHEA 4F53A 4GTTA 3C98A 2MHKA 2LAHA 3SI5A 2DYSE 3D9MA 3SD5A 3PH0C 4LNUD 2AXVA 1OWMA 1HH8A 4EZKA 2A5UA 3VLFA 4BX8A 4XX5A 1D9SA 3DSTA 4U04A 3ASGA 1KZOA 2EQXA 3FFLA 4F1SA 1YCSB 3CHQA 2XQ0A 3CVUA 5JJ7A 3I4GA 3HIZA 3RKVA 4U0ZA 4BWRA 4HORA 1KT1A 5T3RA 3IEGA 3HRAA 4HI9A 2EILE 3GZSA 3FDHA 2B0OE 3JUIA 3AG1E 3FUMA 4B8CB 1SVXA 4ZFHA 1NP7A 2ZIRA 1QBQA 3NOCD 1WDYA 4LRZA 4Z68A 2YHCA 1JPLA 1MX6A 4DX6D 2XENA 3L6AA 3RRUA 4J8FA 5BV0A 2AJAA 3ABKE 3ASOE 4D10C 3D9LA 5BT1A 3MKQB 2VSYA 3CSTA 3UUXA 3SBSA 5AN8A 5KJNA 3B7TA 1E90A 2KZTB 3CVNA 3CVLA 3UX4A 5D66A 5ENRD 3ONKA 3LY8A 4JHRA 2IO2C 4X8QA 5AARA 3UM0A 1YYHA 2WXLA 2YNQA 4HOQA 1EDUA 1O1SA 3BG0B 4F7AA 1UW4B 4DK5A 5EIBE 3DXKG 2I2OA 2BKGA 3QKYA 4GCNA 4FP7A 5CCMA 1E7UA 5KWDA 4DPRA 1BD8A 2JABA 3D9HA 1RW2A 1IHGA 4AV7A 5KJMA 3QWVA 5CMYA 3E32A 1BI7B 3UINC 4CDNA 4A1SA 4XZ4A 2P2CP 1SQMA 5FT9A 5EYPF 3HVEA 3G2WA 4I6EA 3MV3B 3PREA 4BSXA 3ASFA 2J07A 4JA7A 1Z3XA 3RJVA 4HLLA 1Q2ZA 4HBDA 3FUJA 3TJPA 3MEKA 4IYPA 3I4RB 3C5RA 4GZCA 1WM5A 1JCQA 5FZQA 4PUCA 3V31A 2XZTG 4J8EA 3CHRA 2RD0A 4GA0A 4RVBA 4J8YA 4YDEA 3APFA 1DNPA 3RK6A 4GTQA 1XGWA 2Y1LE 3FUDA 3MCXA 4TXRA 1A17A 2ZISA 3DXMG 3QNKA 4J8SA 3PZDA 3P1UA 3SFYA 2J09A 5AQ9A 4IULA 2H6FA 3HXEA 3Q47B 3IHVA 1E8XA 4I1MA 4HQDA 4N5QA 1NA3A 4ACLA 3CVQA 3Q4AB 1X81A 4WWPA 3I3NA 3MKQA 1HF8A 4W9RA 4JB8P 2I6HA 4CGVA 3EU9A 3CKCA 2A4ZA 2KZTA 2NXPA 4GZ5A 3ENEA 2IEJA 4JW1A 3FUEA 2WXPA 3DWLG 3FTXA 3GZ2A 3FTZA 2MRIA 3QC1A 5FIOA 3UTMA 3F6QA 3VTYA 3ZVVA 2UWJG 5DBKA 4OYSA 4UI9K 3TL5A 1L5JA 1UG3A 3V2OA 4HB5A 5AENA 4G11A 3ESLA 4RLYA 4DRXE 3FH7A 4FJYA 4E6HA 3DSXA 1LF8A 2PNNA 2R2LA 4N3AA 3B7UX 2H6HA 2XEEA 3Q73A 1HO8A 4JEHA 5ENNA 4L23A 3ULQA 1WG0A 5JHAA 5CEDB 2VJ8A 4Y6WA 2V4HC 4Q94A 4BT9A 5HKPA 2V8SE 3X2QE 4CDMA 5E75A 2KCKA 3ZYMA 3PZ4A 2IO3C 2F8YA 4ANXA 1JUQA 1TNOA 1MX4A 3CQGB 4BTAA 5HS0A 5LX8A 4C0MA 4XKBA 3QB2A 4XI9A 1LD7A 4MLPA 2F8XK 1DCEA 3AG3E 3PUKA 3G2UA 5FQ4A 1OT8A 4UI9J 3AAAC 3L16A 1H6PA 3ZHEB 1LD8A 5FTPA 5C2YA 3L82A 3TG4A 4GB9A 4JHKA 3U64A 4YDOA 3LY9A 2P9NG 3ZYLA 2X6JA 4Y6CA 4U0UA 1SZ9A 2VTBB 3VLDA 4JEUA 3DSSA 5KNGA 4WWOA 2PM7A 4ILHB 3RAUA 3UIPC 2L9BA 2X6KA 4ATZD 5CBNA 2Y69E 4GMLA 2FF4A 2A5EA 5LFAA 1IKND 5JHBA 3AS5A 1S70B 3MV2B 4BEPA 3S7DA 2OCCE 2IFUA 4EZJA 2XCBA 4ILIA 3R7QA 2XGSA 2CHXA 3TAXA 3EIQC 1SW6A 1AWCB 2PL2A 3MJWA 3DBSA 4GTMA 2L6BA 1N4SA 4I43A 2IOSA 1PC2A 5AAOA 2BEDA 5B1AE 3HHMA 2KBXA 2XS1A 3LXUX 3DSWA 5J08A 3FP3A 4ILGA 2J8SD 3L54A 3TWRA 4K5AB 1QNFA 4G25A 4TV3A 1HX8A 3DEPA 4GA1A 4A1GA 3SFXA 2FEZA 2FO7A 3NBNB 1N0QA 3FWVA 3NAWA 2PZIA 3FTVA 3DPYA 2B6CA 3ESKA 2DCPA 2VGYA 3SY2A 3D9PA 4H7XA 3FUIA 3LS8A 2GRPB 1N94A 5JMND 3NZSA 3QWPA 3ZYQA 1YMPA 1G3NB 3KS2A 2Q7FA 2FBNA 2WXHA 3IHYA 3E33A 4C48B 1E7VA 2ETAA 2OV8A 3V79K 1WY6A 1TJFA 3ZW3A 3FY4A 2V4LA 1N4RA 1HG5A 4FLBA 4KMOA 4I2WA 5AIJA 3CVYA 3ML9A 5M72A 5ENTD 4DUIA 3HXCA 3NF1A 4AY6A 5G05C 3WXXA 3FTYA 3ZHEA 4MS6A 3V30A 2KCVA 1QQEA 1H6KA 1D8DA 2J49A 4URKA 2XHEA 3LKUA 4J8DA 5B1BE 3CHMA 2QYJA 4KT6B 1Z6TA 3MKRA 3SNXA 3U9WA 1E8YA 3S7FA 3LJ3A 5LCWJ 3PEUB 4K0RA 2KCLA 2V0PA 4ATGA 4DLQA 1ZB1A 3DSVA 3R7RA 2J9QA 2C0LA 3PVLA 2E0IA 5CMWA 3PZ1A 4C9BB 2CG2A 3FULA 3W9FA 4BTBA 4KBQA 4KVMA 4M3OA 3RIBA 5FJYA 3UIOC 2XPIA 3BG1B 1PY1A 3ZUVB 3C3OA 2L0IA 1FT1A 4XIFA 3Q9NC 3AG2E 1SZAA 5KBAA 5CRVA 3CVWA 4AP2A 4IN3B 3ZXPA 2P9LG 4DX2A 1EYHA 5D0OD 3Q49B 4LG6A 4YDYA 3O48A 2VYIA 1UN8A 4GTVA 3TWQA 3D9KA 2UY1B 1KT0A 5BXOA 3LYAA 3TGOA 2I1JA 4XE0A 4HLEA 1O1TA 5D2MC 3G2TA 1JCSA 3CVPA 3HYMB 3D9JA 4U96D 4HNAD 4XKCA 5EX3A 3PZ3A 5ANLA 3LDZA 3SF4A 1MJ0A 2WVIA 1IYGA 1ELRA 1DVPA 4BX9A 3U3WA 4RSYA 3Q7FA 5JJ6A 4AOFA 1E8WA 1N11A 3LPZA 4HRMB 3NZUA 3AU5A 1NI1A 1U3DA 2E2EA 3B95A 3CK7A 3EHNA 4UWFA 4KXKB 2FULA 5J90A 4NQ0A 1TNZA 1TNYA 1IQUA 1UN9A 2F0YA 3TWVA 4KZ0A 4BSZB 3RO2A 2R5SA 4WAFA 1JWGA 1HG2A 3SFZA 4HS2A 3AS4A 1NFIE 5HI7A 3D9IA 4UUCA 4N3BA 5KJLA 4G1TA 4RG9A 3D9NA 1ZU2A 4ANWA 3SHFA 3ZU7B 1Z3YA 4B94A 5LP0A 1YA0A 4WNDA 3UT7A 4BETA 1KPSB 5BXUA 1N4PA 3Q75A 3P2BA 1TN7A 4O1OA 1IXVA 2HR2A 1OWPA 5HRYA 3HDXA 1GW6A 2KM4A 4BT8A 2GRRB 3B7BA 3DSUA 2EIJE 3CK8A 2XEVA 3BUAA 1K8KG 3LVQE 3ML8A 1MYOA 2M63A 5EDSA 4DLOA 1NZNA 2DVWA 2ETBA 4JD2G 4K03A 5DIZA 2LO6A 3TXNA 3FH5A 4AJWA 4EBAG 3KEAA 4A63B 3EUVA 4DX5D 2XGOA 1JWFA 3RU0A 4TUUA 4V3IA 2ZXWE 4U63A 2PM6A 2Y4UA 3FUFA 1NL4A 1WAO1 2XZDG 4APFA 2I9CA 3PRZA 4FULA 3ZN3A 3C72A 4JC8A 2ZGDA 2OEWA 2GRQB 1K1BA 4YNDA 2AXUA 5FINA 2DYRE 3ZFWA 2OVFA 4L2LA 4MRUA 2J4DA 4ACKA 4NIKA 4LNBA 4GAAA 1HE8A 1BU9A 2C0MA 4UWHA 2ILRA 3AS8A 3CSFA 3UXGA 2P9IG 4FU3A 3PNTB 1S64A 3UKRG 4I6GA 2GGFA 4AIFA 2MOWA 3FU6A 4OVUA 4GZDA 3CQCB 4EHMA 4CZ2D 4GYWA 2KC7A 3C3RA 5EN5D 2P9UG 4NACA 3U4TA 3V2XA 2RFMA 4N39A 2GROB 1BPOA 4O60A 1FVFA 4PS3A 2LNIA 4GA2A 4UQZA 1TEZA 5E76A 2WXMA 2NYJA 4GTSA 1QZ2A 4LCTA 2LSVA 3B7SA 3OXFA 2MYOA 3TWUA 1N4QA 1KLXA 2X38A
chains in the Genus database with same CATH topology
3ZYQA 4JHRA 4FHKA 3FTWA 2GRLA 4EECA 4GYYA 2XCCA 3D9OA 3JCKC 2DIWA 3KS2A 2XPZA 2XRZA 4JVSA 2WXGA 2OVBA 2Q7FA 2VGXA 4PS8A 2FBNA 3MZLB 3Q5MA 4UWLA 2WXHA 2WXLA 2YNQA 3IHYA 3L22A 4HOQA 1EDUA 3KAEA 5FZRA 4A55A 1E7VA 2V5FA 4O6FA 3BG0B 4B89A 3ZGQA 3I5PA 4F7AA 2OV8A 5FWQA 1UW4B 4DK5A 5BUZA 2I2OA 4PS7A 3QKYA 1WY6A 2XGMA 3CHOA 2CG3A 1TJFA 4WWNA 3ZW3A 3FY4A 2V4LA 3QARA 4CCAA 4I9EA 2UY1A 4NRHB 4GCNA 4HOUA 4FP7A 1B89A 2AVPA 5AYWD 2R17C 3FTUA 5CCMA 1E7UA 1HG5A 4FLBA 4KMOA 4DPRA 4I2WA 2L6JA 3SZ7A 5AIJA 2GRMA 3JQ1A 3CVYA 3ML9A 5M72A 3O4ZA 4HFGA 3CGHA 4WUYA 4GZ6A 3G2SA 4GU5A 4AY6A 1HFAA 3NF1A 3QAQA 5G05C 3WXXA 1IHGA 4AV7A 1EF1C 1HS6A 1OUVA 2BUGA 3FTYA 5C1DA 5ARFA 3ZHEA 4MS6A 3FEYA 5KJMA 2X6HA 3QWVA 5CMYA 2KCVA 1QQEA 1H6KA 3L13A 3PS6A 4L1BA 1N54A 4I1AA 2J49A 4URKA 2WM9A 4HXIA 4NURA 3CR3A 3FTSA 2XHEA 1E96B 4CDNA 4A1SA 3L17A 3LKUA 4XZ4A 4J8DA 3RRNB 1SQMA 3RO3A 5FT9A 4APOA 3HVEA 3CHMA 3G2WA 3URZA 3PE3A 3EIJA 4KT6B 4N2SA 1Z6TA 3BEEA 2YHEA 3MKRA 3SNXA 3U9WA 1E8YA 5JJTA 4I6EA 2WQ7A 4FC8A 3PNLB 2QFCA 3S7FA 3LJ3A 4JHJA 3MV3B 3PREA 5LCWJ 3PE4A 1H2UA 4G2VA 4BSXA 3ASFA 2J07A 4JA7A 3PEUB 1Z3XA 3RJVA 3VTXA 4K0RA 3LVRE 2KCLA 5ARGA 3UT8A 2V0PA 4ATGA 1FCHA 4CDRA 4CT4A 3FUJA 3TJPA 3MEKA 4IYPA 1Y8MA 3I4RB 4DLQA 4GZCA 3PDNA 5KJKA 4WNEA 1WM5A 4XI0A 3CEQA 5T8IA 5FZQA 2XPYA 1UJKA 3QK0A 3RRMB 4PUCA 3R7RA 2IOLA 2J9QA 2WXKA 1ELWA 1OWLA 3MGBA 5AJDA 2WPVA 4J8EA 2C0LA 2L0TB 2Y3AA 4EPZA 3CHRA 2X3MA 1HXIA 3PVLA 2RD0A 2E0IA 4GA0A 5CMWA 4RVBA 1IQRA 3UT4A 4C9BB 3APFA 1DNPA 2CG2A 3FULA 2C2LA 3RK6A 4BTBA 4KBQA 1NA0A 4KVMA 1XGWA 4M3OA 3GYZA 5G55A 3RIBA 3FUDA 3MCXA 3QDNA 4N5CA 5FJYA 2HO1A 1A17A 3CIAA 2XPIA 4JL0A 3BG1B 3T8MA 1PY1A 3QNKA 4J8SA 3PZDA 3P1UA 3APCA 1PAQA 3QOUA 4IRUA 4L7TA 3IKOB 2L0IA 3T5VA 4P29A 2HM8A 2J09A 4GZ3A 4XIFA 4J0UA 1SZAA 4IULA 3K9IA 3CVWA 4AP2A 4IN3B 2WXOA 4HOSA 2IF4A 3Q47B 3IHVA 3ASHA 4A3TA 1E8XA 4ANVA 3ZEFA 1EYHA 3JQ0A 4I1MA 5D0OD 4FA6A 5A6CA 3S2AA 4CGWA 4ME2A 3TXMA 1NA3A 3Q49B 3U66A 4ACLA 3CVQA 3JYSA 3QWWA 3E4BA 4DJAA 5EKQD 4DI4A 3IV0A 3Q4AB 2WMOA 3O48A 4CRWA 4UWGA 1MQSA 2VYIA 3MX3A 4HOTA 1E8ZA 1N52A 5G04J 1UN8A 2JLBA 4WWPA 3D9KA 2UY1B 1KT0A 3I3NA 3LYAA 3TGOA 2I1JA 3MKQA 1HF8A 4W9RA 4XE0A 5A23A 4WNFA 2I6HA 2OOEA 1ELKA 4UI9C 3TG5A 4HLEA 4CGVA 4L2YA 2AWIA 3CKCA 4R7LA 2A4ZA 2KZTA 1W3BA 4I6JA 3G2TA 3CVPA 3HYMB 3D9JA 2WQHA 2NXPA 4N3CA 1X5BA 4GZ5A 4XKCA 5EX3A 3ZPJA 5ANLA 3LDZA 4I17A 3ENEA 4H7YA 3SF4A 4OVVA 5HQ8A 2WVIA 1IYGA 5FQ6A 1ELRA 1DVPA 4JW1A 4BX9A 3FUEA 3ZRHA 3U3WA 2WXPA 2VSXE 3FTXA 1XNFA 2VQ2A 3GZ2A 1U3CA 3NQPA 4RSYA 3FTZA 5JJ6A 3B13A 2MRIA 4KYOB 2HYZA 4AOFA 1E8WA 3QC1A 3LPZA 4WNGA 3S7JA 3LCAA 3NZUA 5G05J 3HVEB 3MA5A 4FLHA 4RG6A 3VTYA 3OXGA 1H0AA 3AU5A 3ZVVA 1EPUA 1U3DA 2WMNA 1INZA 3B7RL 2E2EA 2UWJG 5DBKA 4N2QA 4OYSA 4UI9K 3TL5A 3CK7A 4Q96A 2PQRA 4DI3A 3EHNA 5A7DB 4UWFA 4PH4B 1L5JA 1UG3A 2FULA 4KXKB 5J90A 5LOZA 4E85A 4NQ0A 3FUNA 2VTBA 3G2VA 3D3MA 1IQUA 1UN9A 4PDXA 5AENA 4G11A 4KZ0A 3RO2A 1HU3A 3ESLA 2R5SA 4WAFA 1JWGA 3ASDA 2VSOE 1HG2A 3FH7A 1H2TC 4FJYA 4E6HA 3ONLA 3MYVA 2LAIA 3SFZA 4HS2A 3AS4A 5HI7A 2RG8A 1OWNA 2WXIA 4JZYA 3D9IA 3CLJA 1LF8A 2Y4TA 4YVOA 2VSNA 3QJZA 3DPDA 4FADA 4N3BA 5KJLA 3KD7A 4G1TA 4N3AA 4RG9A 3EDTB 3B7UX 3D9NA 5FZSA 2WXFA 5LCWC 2WXNA 4GMJA 3VLEA 1ZU2A 4ANWA 4JXTA 1H19A 3SHFA 3T5XA 4FHJA 1HO8A 4JEHA 5ENNA 5CCLA 4JA9A 1UJJA 1Z3YA 3FU5A 4B94A 2CHZA 4EBAA 5LP0A 1YA0A 2X6IA 3CVVA 3FEXA 3GZ1A 4AVXA 4WNDA 2AW6A 4L23A 3ULQA 3UT7A 5BW8C 2CFUA 4FJZA 5JHAA 2PQNA 2FI7A 3P2BA 4QFVA 2VJ8A 5CHEE 3PUJA 2WXRA 4Y6WA 2J4BA 4Q94A 2LSUA 2YQ8A 2IU1A 4BT9A 3EHMA 1H2VC 4EQFA 5EX0A 4TRQA 2V8SE 4GPKA 5KCMA 1VDYA 2HR2A 4CDMA 1OWPA 3FUHA 5E75A 2KCKA 4G26A 3S7BA 3ZYMA 1ZBPA 3HDXA 3UMVA 3ZXSA 2I1KA 4ABNA 2WQ6A 1GW6A 2KM4A 4BT8A 4ANXA 3FH8A 1JUQA 2VGXB 3ZIMA 4A3VA 3UQ3A 2GW1A 3CQGB 3CK8A 2XEVA 4BTAA 3OAWA 3CHSA 4KVOA 4BY6A 3LVQE 3ML8A 2M63A 5EDSA 3ZYKA 4UWKA 4DLOA 5LX8A 4C0MA 1NZNA 4XKBA 2BF0X 3QB2A 1TJCA 4XI9A 5FQ8A 4GCOA 4CEMA 5BV1A 2IQCA 4AEZC 3IBEA 3OTNA 3FU0A 2DBAA 5D0QD 4B0ZA 4MLPA 2YINA 5AJLA 4CT0A 3AU4A 3PUKA 4LEUA 4K03A 4AXHA 4Q69A 3G2UA 5FQ4A 3FUKA 5DIZA 3PEVB 2LO6A 4UI9J 5G04C 1S0PA 4I2ZA 3TXNA 3FH5A 4C0EA 2P58C 4AJWA 3L16A 4G24A 4J6IA 4G23A 5ANRA 4EBAG 3ZHEB 4F3VA 5FTPA 2X6FA 5C2YA 3TG4A 4EZLA 4GB9A 4JHKA 3U64A 2R59A 3FU3A 3LEWA 3SGHA 2KATA 2XGOA 3EJNA 4BFRA 2NSZA 3KEZA 3LY9A 3CV0A 3ZYLA 1JWFA 2BTDA 3GW4A 3RU0A 2X6JA 4TUUA 4V3IA 2JEKA 4Y6CA 4U0SA 3LY7A 4U63A 4UQXA 3OXLA 2PM6A 2Y4UA 4U0UA 1SZ9A 3FUFA 2VTBB 4KZCA 4LUNU 2CFZA 3L08A 3VLDA 4JEUA 1WAO1 5BNWA 4APFA 2I9CA 4GYOA 2QY7A 1OWOA 3PRZA 4FULA 4WWOA 2PM7A 3FHEA 4ILHB 3ZN3A 4F53A 3C98A 4YVQC 2MHKA 2L9BA 2X6KA 4JC8A 2LAHA 3SI5A 4GMLA 3D9MA 4YNDA 2AXUA 2CHWA 3SD5A 2AXZA 2FF4A 3PH0C 5G2NA 5FQ7A 5LFAA 5T4YA 5JHBA 3AS5A 2AXVA 1OWMA 3MV2B 3ZFWA 1HH8A 3S7DA 4EZKA 3CVXA 2OVFA 2A5UA 3VLFA 4L2LA 4AM9A 4BX8A 2IFUA 4MRUA 4ANUA 4XX5A 4EZJA 2J4DA 2XCBA 4U8HA 4ILIA 3R7QA 2WXQA 4U04A 2XGSA 3ASGA 2EQXA 4UQYA 2CHXA 3FFLA 4F1SA 4ACKA 3TAXA 3EIQC 3CHQA 2XQ0A 2PL2A 3MJWA 4GAAA 3DBSA 1HE8A 3CVUA 5JJ7A 2C0MA 3I4GA 3HIZA 4UWHA 3RKVA 2ILRA 3AS8A 2J08A 3CSFA 4U0ZA 4FU3A 4I43A 4BWRA 2IONA 3PNTB 4HORA 1KT1A 4I6GA 2GGFA 2IOSA 4AIFA 1PC2A 5T3RA 2MOWA 3IEGA 3FU6A 1MHQA 4OVUA 1HZ4A 3HHMA 4GZDA 3CQCB 4HVBA 3LXUX 3Q15A 5J08A 3GZSA 3FDHA 3FP3A 4ILGA 3JUIA 3UPVA 3R9AB 1P5QA 4GYWA 3FUMA 3L54A 2KC7A 4B8CB 1NP7A 1QNFA 4NACA 4JPSA 2NC9A 2ONDA 2XRYA 4G25A 4LRZA 4LERA 3U4TA 4TV3A 2YHCA 3N71A 1FVHA 1JPLA 1HX8A 4B8AA 2IJGX 4GA1A 4A1GA 1Y6IA 4I1OB 3L6AA 3RRUA 2FEZA 4J8FA 5BV0A 2FO7A 4N39A 1BPOA 4I9CA 4D10C 3FWVA 3D9LA 5BT1A 1FVFA 3MKQB 2PZIA 4PS3A 3FTVA 3APDA 2VSYA 3CSTA 4MKTA 3UUXA 3SBSA 2LNIA 4GA2A 4UQZA 4U07A 4AY5A 5KJNA 1TEZA 5E76A 2WXMA 3ESKA 2DCPA 3B7TA 2ZU6B 1E90A 2KZTB 2VGYA 3CVNA 5BPPA 1QZ2A 3CHPA 3D9PA 3FUIA 3LS8A 4H7XA 4LCTA 2LSVA 2WXJA 3B7SA 3OXFA 3CK9A 3CVLA 3NZSA 3UX4A 3QWPA 1KLXA 3SBTB 2WB2A 2X38A 3CKBA 3ONKA 3LY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHR A;  4GYY A;  2XCC A;  3KS2 A;  2VGX A;  2Q7F A;  2FBN A;  3Q5M A;  4HOQ A;  5FZR A;  3KAE A;  2V5F A;  4O6F A;  3ZGQ A;  3QKY A;  2XGM A;  4I9E A;  2UY1 A;  4NRH B;  4GCN A;  4HOU A;  5AYW D;  1B89 A;  2AVP A;  5CCM A;  4I2W A;  2L6J A;  3SZ7 A;  5M72 A;  4WUY A;  4GZ6 A;  4AY6 A;  3NF1 A;  5G05 C;  3WXX A;  1IHG A;  1OUV A;  2BUG A;  5C1D A;  5ARF A;  3ZHE A;  5KJM A;  3QWV A;  2KCV A;  1QQE A;  4I1A A;  1E96 B;  4A1S A;  3LKU A;  4J8D A;  3RO3 A;  5FT9 A;  4APO A;  3URZ A;  3PE3 A;  4N2S A;  3BEE A;  3MKR A;  5JJT A;  2QFC A;  3S7F A;  3MV3 B;  5LCW J;  3PE4 A;  4G2V A;  3ASF A;  4JA7 A;  3RJV A;  3VTX A;  2KCL A;  5ARG A;  1FCH A;  4CDR A;  3MEK A;  1Y8M A;  3PDN A;  5KJK A;  4WNE A;  1WM5 A;  4XI0 A;  3CEQ A;  5FZQ A;  2J9Q A;  1ELW A;  2WPV A;  4J8E A;  2C0L A;  1HXI A;  4GA0 A;  2C2L A;  4BTB A;  4KBQ A;  1NA0 A;  3GYZ A;  3RIB A;  3QDN A;  4N5C A;  5FJY A;  2HO1 A;  1A17 A;  2XPI A;  4JL0 A;  3QOU A;  4GZ3 A;  4XIF A;  4J0U A;  3K9I A;  4IN3 B;  4HOS A;  2IF4 A;  3Q47 B;  3ASH A;  5D0O D;  5A6C A;  4CGW A;  4ME2 A;  1NA3 A;  3Q49 B;  3CVQ A;  3JYS A;  3QWW A;  3E4B A;  5EKQ D;  3Q4A B;  3O48 A;  4HOT A;  2VYI A;  5G04 J;  2JLB A;  2UY1 B;  1KT0 A;  3LYA A;  3TGO A;  4W9R A;  4WNF A;  2I6H A;  2OOE A;  4UI9 C;  3TG5 A;  4CGV A;  3CKC A;  1W3B A;  3CVP A;  3HYM B;  2WQH A;  4N3C A;  4GZ5 A;  5EX3 A;  3ZPJ A;  3SF4 A;  4I17 A;  4H7Y A;  5HQ8 A;  1IYG A;  1ELR A;  3U3W A;  1XNF A;  2VQ2 A;  3GZ2 A;  5JJ6 A;  4KYO B;  2HYZ A;  3LPZ A;  4WNG A;  3S7J A;  3LCA A;  5G05 J;  3MA5 A;  3VTY A;  4RG6 A;  3OXG A;  2E2E A;  2UWJ G;  5DBK A;  4N2Q A;  4UI9 K;  3CK7 A;  2PQR A;  5A7D B;  4KXK B;  4NQ0 A;  3RO2 A;  2R5S A;  3ASD A;  3AS4 A;  5HI7 A;  2Y4T A;  4YVO A;  2VSN A;  4N3B A;  5KJL A;  3KD7 A;  4G1T A;  4N3A A;  4RG9 A;  3EDT B;  5FZS A;  5LCW C;  1ZU2 A;  5CCL A;  4JA9 A;  4B94 A;  1YA0 A;  3GZ1 A;  4WND A;  3ULQ A;  5BW8 C;  2PQN A;  2FI7 A;  5CHE E;  4Y6W A;  2LSU A;  2YQ8 A;  4BT9 A;  4EQF A;  5EX0 A;  4GPK A;  2HR2 A;  2KCK A;  4G26 A;  3S7B A;  1ZBP A;  4ABN A;  4BT8 A;  2VGX B;  3UQ3 A;  2GW1 A;  3CK8 A;  2XEV A;  4BTA A;  1NZN A;  1TJC A;  4XI9 A;  4GCO A;  5D0Q D;  2DBA A;  4LEU A;  5DIZ A;  4UI9 J;  5G04 C;  4I2Z A;  2P58 C;  4G24 A;  4G23 A;  3ZHE B;  4F3V A;  5FTP A;  3TG4 A;  2KAT A;  2XGO A;  3LY9 A;  3CV0 A;  3GW4 A;  3RU0 A;  4Y6C A;  4U0S A;  3LY7 A;  4UQX A;  3OXL A;  2Y4U A;  4U0U A;  1WAO 1;  5BNW A;  4GYO A;  3ZN3 A;  4YVQ C;  2MHK A;  4YND A;  2FF4 A;  3AS5 A;  3MV2 B;  3ZFW A;  1HH8 A;  3S7D A;  4AM9 A;  2IFU A;  2XCB A;  4U04 A;  2XGS A;  3ASG A;  4UQY A;  3FFL A;  3TAX A;  2PL2 A;  5JJ7 A;  2C0M A;  3RKV A;  3AS8 A;  4U0Z A;  4BWR A;  4HOR A;  1KT1 A;  4AIF A;  1PC2 A;  3IEG A;  1HZ4 A;  3Q15 A;  3FP3 A;  3UPV A;  3R9A B;  1P5Q A;  4GYW A;  2KC7 A;  2NC9 A;  2OND A;  4G25 A;  3U4T A;  2YHC A;  3N71 A;  4GA1 A;  2FEZ A;  4J8F A;  2FO7 A;  4N39 A;  4I9C A;  3FWV A;  5BT1 A;  2PZI A;  2VSY A;  3UUX A;  2LNI A;  4GA2 A;  4UQZ A;  4U07 A;  4AY5 A;  5KJN A;  3ESK A;  2VGY A;  3CVN A;  1QZ2 A;  4H7X A;  2LSV A;  3OXF A;  3CK9 A;  3CVL A;  3QWP A;  1KLX A;  3CKB A;  3LY8 A; 
#chains in the Genus database with same CATH topology
 4FHK A;  1OCR E;  5CEC B;  2GRL A;  4GYY A;  1V55 E;  2XPZ A;  4JVS A;  4U8V D;  2OVB A;  4PS8 A;  1OY3 D;  3T8K A;  1OCO E;  3Q5M A;  4UWL A;  1QYM A;  5FZR A;  1TNB A;  2V5F A;  4O6F A;  2ETC A;  5BUZ A;  4PS7 A;  2XGM A;  3CHO A;  2CG3 A;  4HOU A;  5AYW D;  2R17 C;  5ENQ D;  3AJI A;  2L6J A;  5EIL A;  3E30 A;  3SZ7 A;  2GRM A;  3Q79 A;  3JQ1 A;  4HFG A;  4GZ6 A;  3WG7 E;  3Q78 A;  1EF1 C;  2BUG A;  5C1D A;  5ARF A;  3FEY A;  3PS6 A;  4L1B A;  2WM9 A;  4HXI A;  3CR3 A;  3DRA A;  1E96 B;  3L17 A;  3RRN B;  4APO A;  3TWX A;  1KZP A;  3URZ A;  3PE3 A;  3EIJ A;  4N2S A;  1V54 E;  2YHE A;  5JJT A;  3TWT A;  3J5P A;  3PNL B;  2QFC A;  3PE4 A;  2BKK B;  5ENP D;  3LVR E;  2DZO A;  5ARG A;  3UT8 A;  1FCH A;  4CDR A;  3UM1 A;  1DCQ A;  1Y8M A;  3PDN A;  5KJK A;  4WNE A;  4XI0 A;  3CEQ A;  5T8I A;  1ELW A;  1OWL A;  1D8E A;  4EPZ A;  2Y3A A;  3EHR A;  2X3M A;  1HXI A;  1SA5 A;  1IQR A;  3UT4 A;  5G55 A;  2Y0B G;  4N5C A;  2HO1 A;  3CIA A;  3R9M A;  3APC A;  4L7T A;  4IRU A;  4P29 A;  1OXJ A;  4GZ3 A;  4J0U A;  3K9I A;  1OCZ E;  2IF4 A;  3ASH A;  3ZEF A;  5A6C A;  4U7E B;  2EIK E;  3S2A A;  3TXM A;  3KSL A;  3QWW A;  1N95 A;  3ULE G;  5EKQ D;  1TN8 A;  4DI4 A;  1SA4 A;  3IV0 A;  4CRW A;  4HOT A;  5G04 J;  2IY0 C;  3NOG D;  5A23 A;  2OOE A;  1ELK A;  4L2Y A;  2AWI A;  4HI8 A;  4R7L A;  5JA4 D;  2WQH A;  4N3C A;  4OVV A;  5HQ8 A;  3E34 A;  2VSX E;  3BU8 A;  2VQ2 A;  4K5B A;  1U3C A;  2LXL A;  3NQP A;  3B13 A;  5B3S E;  3SQV A;  4BER A;  3S7J A;  5G05 J;  3HVE B;  3MA5 A;  3NB2 A;  4FLH A;  4RG6 A;  3OXG A;  3LJN A;  1INZ A;  3B7R L;  3JUE A;  4Q96 A;  2F37 A;  2PQR A;  4DI3 A;  5A7D B;  5LOZ A;  3FUN A;  2VTB A;  3G2V A;  1HU3 A;  1H2T C;  4GPM A;  3ONL A;  3MYV A;  5IY5 E;  1TR4 A;  2RG8 A;  2WXI A;  4GTP A;  4OAV B;  3ASN E;  3CLJ A;  4YVO A;  3ULY A;  3DPD A;  3IXE A;  3C3Q A;  3KD7 A;  5LCW C;  3EDT B;  4G8K A;  2WXN A;  4GMJ A;  3HXF A;  1H19 A;  3T5X A;  4JA9 A;  1UJJ A;  4M7C A;  2X6I A;  3FEX A;  3TWW A;  2AW6 A;  5BW8 C;  2CFU A;  4FJZ A;  2QYU A;  2FI7 A;  4QFV A;  5CHE E;  1IHB A;  1FPP A;  2LSU A;  2YQ8 A;  2IU1 A;  1BI8 B;  5KCM A;  1VDY A;  3FUH A;  3UMV A;  1LTX A;  4ABN A;  2QC9 A;  2VGX B;  3ZIM A;  4GTO A;  3UQ3 A;  1RZ4 A;  4BY6 A;  3ZYK A;  4UWK A;  1FT2 A;  3JXI A;  2BF0 X;  4CEM A;  2DWZ A;  2IQC A;  4AEZ C;  5D0Q D;  4DX1 A;  2YIN A;  4CT0 A;  3AU4 A;  2RFA A;  4I2Z A;  4G24 A;  3DEO A;  4U95 D;  4EZL A;  5EYL A;  2R59 A;  3LEW A;  3SGH A;  3EJN A;  4BFR A;  3L9T A;  2NSZ A;  3KEZ A;  3CV0 A;  3GW4 A;  3LY7 A;  4UQX A;  4KZC A;  4LUN U;  2V5Q C;  3L08 A;  4OAU C;  1Z5S C;  2H6I A;  1OWO A;  2R05 A;  5CEA A;  4YVQ C;  3ISM C;  4O1P A;  3ABM E;  4U8Y D;  4HRN A;  2CHW A;  2AXZ A;  5G2N A;  5FQ7 A;  3EU5 A;  5T4Y A;  4YDW A;  1U2V G;  3CVX A;  4TXQ A;  2XEH A;  4AM9 A;  4ANU A;  4ZHB A;  4B93 B;  4U8H A;  3UM2 A;  2WXQ A;  4UQY A;  1MZC A;  2J08 A;  2ION A;  3ZNG A;  1AP7 A;  1MHQ A;  1HZ4 A;  5ENO D;  4HVB A;  3Q15 A;  3E37 A;  3UPV A;  3R9A B;  1P5Q A;  4JPS A;  2NC9 A;  2OND A;  2XRY A;  3HXD A;  3Q9U C;  4LER A;  3W9G A;  3N71 A;  1FVH A;  4XEI G;  4B8A A;  2IJG X;  1Y6I A;  4I1O B;  2OEV A;  4I9C A;  5ENS D;  3TWS A;  3APD A;  4G8L A;  4MKT A;  4AY5 A;  4U07 A;  4RQI A;  2ZU6 B;  4J7W A;  2QZA A;  5BPP A;  3CHP A;  2WXJ A;  3CK9 A;  2XS8 A;  2R03 A;  3SBT B;  2WB2 A;  3D9O A;  3CKB A;  3T9K A;  3FTW A;  2LXM A;  4EEC A;  4TXP A;  2XCC A;  4K5C A;  3JCK C;  2DIW A;  2XRZ A;  2WXG A;  2VGX A;  3MZL B;  3L22 A;  3KAE A;  4A55 A;  4B89 A;  3ZGQ A;  3I5P A;  2P9P G;  5FWQ A;  4GTR A;  1K1A A;  1TYQ G;  4WWN A;  4CCA A;  3QAR A;  4I9E A;  2UY1 A;  4NRH B;  1B89 A;  2AVP A;  3FTU A;  3JXJ A;  3UI2 A;  3O4Z A;  3CGH A;  4WUY A;  3SO8 A;  3G2S A;  4GU5 A;  1HFA A;  3J5Q B;  4DX7 D;  3QAQ A;  3AG4 E;  1HS6 A;  1OUV A;  4MBG A;  1N0R A;  2X6H A;  3L13 A;  4LNG A;  1N54 A;  4I1A A;  4NUR A;  3FTS A;  1O1R A;  3RO3 A;  2VGE A;  3BEE A;  2WQ7 A;  4FC8 A;  1K3Z D;  1H6O A;  4JHJ A;  1H2U A;  4G2V A;  3HG0 D;  3VTX A;  1N9A A;  4CT4 A;  1O5M A;  3UM3 A;  5AQ7 A;  2FO1 E;  2XPY A;  1UJK A;  3QK0 A;  3RRM B;  2IOL A;  2WXK A;  5KNH D;  3MGB A;  5AJD A;  2WPV A;  2L0T B;  2C2L A;  2GRN B;  2EIN E;  1NA0 A;  2KXP C;  3GYZ A;  3QDN A;  2P9S G;  4BES A;  4JL0 A;  3T8M A;  1PAQ A;  3QOU A;  3IKO B;  3T5V A;  3ABL E;  2HM8 A;  2WXO A;  5EID A;  4HOS A;  3ZKJ A;  4A3T A;  4ANV A;  3JQ0 A;  5ITZ F;  4FA6 A;  4CGW A;  4ME2 A;  3KSQ A;  3U66 A;  4F6R D;  3JYS A;  3E4B A;  1S63 A;  4DJA A;  2WMO A;  4UWG A;  1MQS A;  3MX3 A;  1E8Z A;  1N52 A;  2JLB A;  2DZN A;  4WNF A;  3TG5 A;  4UI9 C;  2HE0 A;  2ZGG A;  1W3B A;  4I6J A;  1X5B A;  3ZPJ A;  4I17 A;  4H7Y A;  5FQ6 A;  3ZRH A;  5AQB A;  1XNF A;  4KYO B;  2HYZ A;  4WNG A;  1UOH A;  3LCA A;  1H0A A;  1EPU A;  2WMN A;  4N2Q A;  4L9P A;  4F1P A;  4PH4 B;  2EIM E;  4E85 A;  4GMR A;  3D3M A;  4PDX A;  5CER B;  2VSO E;  3ASD A;  4TUM A;  3HXB A;  2LAI A;  3RSE G;  1OWN A;  4JZY A;  1TNU A;  2Y4T A;  3BQO A;  2VSN A;  3QJZ A;  4FAD A;  5FZS A;  2WXF A;  3VLE A;  2R02 A;  3PZ2 A;  4JXT A;  4FHJ A;  4CYM D;  5CCL A;  3FU5 A;  4EBA A;  2CHZ A;  1A5E A;  3UKU G;  3CVV A;  3GZ1 A;  4AVX A;  1JCR A;  3EHQ A;  1OCC E;  2PQN A;  3Q7A A;  5H7P A;  3PUJ A;  2WXR A;  2J4B A;  2P9K G;  3EHM A;  1H2V C;  4EQF A;  5EX0 A;  4TRQ A;  4GPK A;  2RKK A;  4G26 A;  3S7B A;  1ZBP A;  4HRL A;  3ZXS A;  2I1K A;  2WQ6 A;  3FH8 A;  1TN6 A;  4A3V A;  2GW1 A;  3OAW A;  3CHS A;  4KVO A;  5CRU A;  1BLX B;  5FQ8 A;  1TJC A;  4GCO A;  5BV1 A;  5CBO A;  3IBE A;  3OTN A;  3FU0 A;  2DBA A;  4B0Z A;  5AJL A;  4LEU A;  4QQI A;  4AXH A;  4Q69 A;  3FUK A;  3PEV B;  5G04 C;  1S0P A;  4C0E A;  2P58 C;  4J6I A;  4LSZ E;  4G23 A;  5ANR A;  4F3V A;  1DC2 A;  2X6F A;  3FU3 A;  2KAT A;  1MX2 A;  2BTD A;  2JEK A;  4U0S A;  3OXL A;  2CFZ A;  2H6G A;  5BNW A;  2LUH A;  4GYO A;  5AQA A;  2QY7 A;  3FHE A;  4F53 A;  4GTT A;  3C98 A;  2MHK A;  2LAH A;  3SI5 A;  2DYS E;  3D9M A;  3SD5 A;  3PH0 C;  4LNU D;  2AXV A;  1OWM A;  1HH8 A;  4EZK A;  2A5U A;  3VLF A;  4BX8 A;  4XX5 A;  1D9S A;  3DST A;  4U04 A;  3ASG A;  1KZO A;  2EQX A;  3FFL A;  4F1S A;  1YCS B;  3CHQ A;  2XQ0 A;  3CVU A;  5JJ7 A;  3I4G A;  3HIZ A;  3RKV A;  4U0Z A;  4BWR A;  4HOR A;  1KT1 A;  5T3R A;  3IEG A;  3HRA A;  4HI9 A;  2EIL E;  3GZS A;  3FDH A;  2B0O E;  3JUI A;  3AG1 E;  3FUM A;  4B8C B;  1SVX A;  4ZFH A;  1NP7 A;  2ZIR A;  1QBQ A;  3NOC D;  1WDY A;  4LRZ A;  4Z68 A;  2YHC A;  1JPL A;  1MX6 A;  4DX6 D;  2XEN A;  3L6A A;  3RRU A;  4J8F A;  5BV0 A;  2AJA A;  3ABK E;  3ASO E;  4D10 C;  3D9L A;  5BT1 A;  3MKQ B;  2VSY A;  3CST A;  3UUX A;  3SBS A;  5AN8 A;  5KJN A;  3B7T A;  1E90 A;  2KZT B;  3CVN A;  3CVL A;  3UX4 A;  5D66 A;  5ENR D;  3ONK A;  3LY8 A;  4JHR A;  2IO2 C;  4X8Q A;  5AAR A;  3UM0 A;  1YYH A;  2WXL A;  2YNQ A;  4HOQ A;  1EDU A;  1O1S A;  3BG0 B;  4F7A A;  1UW4 B;  4DK5 A;  5EIB E;  3DXK G;  2I2O A;  2BKG A;  3QKY A;  4GCN A;  4FP7 A;  5CCM A;  1E7U A;  5KWD A;  4DPR A;  1BD8 A;  2JAB A;  3D9H A;  1RW2 A;  1IHG A;  4AV7 A;  5KJM A;  3QWV A;  5CMY A;  3E32 A;  1BI7 B;  3UIN C;  4CDN A;  4A1S A;  4XZ4 A;  2P2C P;  1SQM A;  5FT9 A;  5EYP F;  3HVE A;  3G2W A;  4I6E A;  3MV3 B;  3PRE A;  4BSX A;  3ASF A;  2J07 A;  4JA7 A;  1Z3X A;  3RJV A;  4HLL A;  1Q2Z A;  4HBD A;  3FUJ A;  3TJP A;  3MEK A;  4IYP A;  3I4R B;  3C5R A;  4GZC A;  1WM5 A;  1JCQ A;  5FZQ A;  4PUC A;  3V31 A;  2XZT G;  4J8E A;  3CHR A;  2RD0 A;  4GA0 A;  4RVB A;  4J8Y A;  4YDE A;  3APF A;  1DNP A;  3RK6 A;  4GTQ A;  1XGW A;  2Y1L E;  3FUD A;  3MCX A;  4TXR A;  1A17 A;  2ZIS A;  3DXM G;  3QNK A;  4J8S A;  3PZD A;  3P1U A;  3SFY A;  2J09 A;  5AQ9 A;  4IUL A;  2H6F A;  3HXE A;  3Q47 B;  3IHV A;  1E8X A;  4I1M A;  4HQD A;  4N5Q A;  1NA3 A;  4ACL A;  3CVQ A;  3Q4A B;  1X81 A;  4WWP A;  3I3N A;  3MKQ A;  1HF8 A;  4W9R A;  4JB8 P;  2I6H A;  4CGV A;  3EU9 A;  3CKC A;  2A4Z A;  2KZT A;  2NXP A;  4GZ5 A;  3ENE A;  2IEJ A;  4JW1 A;  3FUE A;  2WXP A;  3DWL G;  3FTX A;  3GZ2 A;  3FTZ A;  2MRI A;  3QC1 A;  5FIO A;  3UTM A;  3F6Q A;  3VTY A;  3ZVV A;  2UWJ G;  5DBK A;  4OYS A;  4UI9 K;  3TL5 A;  1L5J A;  1UG3 A;  3V2O A;  4HB5 A;  5AEN A;  4G11 A;  3ESL A;  4RLY A;  4DRX E;  3FH7 A;  4FJY A;  4E6H A;  3DSX A;  1LF8 A;  2PNN A;  2R2L A;  4N3A A;  3B7U X;  2H6H A;  2XEE A;  3Q73 A;  1HO8 A;  4JEH A;  5ENN A;  4L23 A;  3ULQ A;  1WG0 A;  5JHA A;  5CED B;  2VJ8 A;  4Y6W A;  2V4H C;  4Q94 A;  4BT9 A;  5HKP A;  2V8S E;  3X2Q E;  4CDM A;  5E75 A;  2KCK A;  3ZYM A;  3PZ4 A;  2IO3 C;  2F8Y A;  4ANX A;  1JUQ A;  1TNO A;  1MX4 A;  3CQG B;  4BTA A;  5HS0 A;  5LX8 A;  4C0M A;  4XKB A;  3QB2 A;  4XI9 A;  1LD7 A;  4MLP A;  2F8X K;  1DCE A;  3AG3 E;  3PUK A;  3G2U A;  5FQ4 A;  1OT8 A;  4UI9 J;  3AAA C;  3L16 A;  1H6P A;  3ZHE B;  1LD8 A;  5FTP A;  5C2Y A;  3L82 A;  3TG4 A;  4GB9 A;  4JHK A;  3U64 A;  4YDO A;  3LY9 A;  2P9N G;  3ZYL A;  2X6J A;  4Y6C A;  4U0U A;  1SZ9 A;  2VTB B;  3VLD A;  4JEU A;  3DSS A;  5KNG A;  4WWO A;  2PM7 A;  4ILH B;  3RAU A;  3UIP C;  2L9B A;  2X6K A;  4ATZ D;  5CBN A;  2Y69 E;  4GML A;  2FF4 A;  2A5E A;  5LFA A;  1IKN D;  5JHB A;  3AS5 A;  1S70 B;  3MV2 B;  4BEP A;  3S7D A;  2OCC E;  2IFU A;  4EZJ A;  2XCB A;  4ILI A;  3R7Q A;  2XGS A;  2CHX A;  3TAX A;  3EIQ C;  1SW6 A;  1AWC B;  2PL2 A;  3MJW A;  3DBS A;  4GTM A;  2L6B A;  1N4S A;  4I43 A;  2IOS A;  1PC2 A;  5AAO A;  2BED A;  5B1A E;  3HHM A;  2KBX A;  2XS1 A;  3LXU X;  3DSW A;  5J08 A;  3FP3 A;  4ILG A;  2J8S D;  3L54 A;  3TWR A;  4K5A B;  1QNF A;  4G25 A;  4TV3 A;  1HX8 A;  3DEP A;  4GA1 A;  4A1G A;  3SFX A;  2FEZ A;  2FO7 A;  3NBN B;  1N0Q A;  3FWV A;  3NAW A;  2PZI A;  3FTV A;  3DPY A;  2B6C A;  3ESK A;  2DCP A;  2VGY A;  3SY2 A;  3D9P A;  4H7X A;  3FUI A;  3LS8 A;  2GRP B;  1N94 A;  5JMN D;  3NZS A;  3QWP A;  3ZYQ A;  1YMP A;  1G3N B;  3KS2 A;  2Q7F A;  2FBN A;  2WXH A;  3IHY A;  3E33 A;  4C48 B;  1E7V A;  2ETA A;  2OV8 A;  3V79 K;  1WY6 A;  1TJF A;  3ZW3 A;  3FY4 A;  2V4L A;  1N4R A;  1HG5 A;  4FLB A;  4KMO A;  4I2W A;  5AIJ A;  3CVY A;  3ML9 A;  5M72 A;  5ENT D;  4DUI A;  3HXC A;  3NF1 A;  4AY6 A;  5G05 C;  3WXX A;  3FTY A;  3ZHE A;  4MS6 A;  3V30 A;  2KCV A;  1QQE A;  1H6K A;  1D8D A;  2J49 A;  4URK A;  2XHE A;  3LKU A;  4J8D A;  5B1B E;  3CHM A;  2QYJ A;  4KT6 B;  1Z6T A;  3MKR A;  3SNX A;  3U9W A;  1E8Y A;  3S7F A;  3LJ3 A;  5LCW J;  3PEU B;  4K0R A;  2KCL A;  2V0P A;  4ATG A;  4DLQ A;  1ZB1 A;  3DSV A;  3R7R A;  2J9Q A;  2C0L A;  3PVL A;  2E0I A;  5CMW A;  3PZ1 A;  4C9B B;  2CG2 A;  3FUL A;  3W9F A;  4BTB A;  4KBQ A;  4KVM A;  4M3O A;  3RIB A;  5FJY A;  3UIO C;  2XPI A;  3BG1 B;  1PY1 A;  3ZUV B;  3C3O A;  2L0I A;  1FT1 A;  4XIF A;  3Q9N C;  3AG2 E;  1SZA A;  5KBA A;  5CRV A;  3CVW A;  4AP2 A;  4IN3 B;  3ZXP A;  2P9L G;  4DX2 A;  1EYH A;  5D0O D;  3Q49 B;  4LG6 A;  4YDY A;  3O48 A;  2VYI A;  1UN8 A;  4GTV A;  3TWQ A;  3D9K A;  2UY1 B;  1KT0 A;  5BXO A;  3LYA A;  3TGO A;  2I1J A;  4XE0 A;  4HLE A;  1O1T A;  5D2M C;  3G2T A;  1JCS A;  3CVP A;  3HYM B;  3D9J A;  4U96 D;  4HNA D;  4XKC A;  5EX3 A;  3PZ3 A;  5ANL A;  3LDZ A;  3SF4 A;  1MJ0 A;  2WVI A;  1IYG A;  1ELR A;  1DVP A;  4BX9 A;  3U3W A;  4RSY A;  3Q7F A;  5JJ6 A;  4AOF A;  1E8W A;  1N11 A;  3LPZ A;  4HRM B;  3NZU A;  3AU5 A;  1NI1 A;  1U3D A;  2E2E A;  3B95 A;  3CK7 A;  3EHN A;  4UWF A;  4KXK B;  2FUL A;  5J90 A;  4NQ0 A;  1TNZ A;  1TNY A;  1IQU A;  1UN9 A;  2F0Y A;  3TWV A;  4KZ0 A;  4BSZ B;  3RO2 A;  2R5S A;  4WAF A;  1JWG A;  1HG2 A;  3SFZ A;  4HS2 A;  3AS4 A;  1NFI E;  5HI7 A;  3D9I A;  4UUC A;  4N3B A;  5KJL A;  4G1T A;  4RG9 A;  3D9N A;  1ZU2 A;  4ANW A;  3SHF A;  3ZU7 B;  1Z3Y A;  4B94 A;  5LP0 A;  1YA0 A;  4WND A;  3UT7 A;  4BET A;  1KPS B;  5BXU A;  1N4P A;  3Q75 A;  3P2B A;  1TN7 A;  4O1O A;  1IXV A;  2HR2 A;  1OWP A;  5HRY A;  3HDX A;  1GW6 A;  2KM4 A;  4BT8 A;  2GRR B;  3B7B A;  3DSU A;  2EIJ E;  3CK8 A;  2XEV A;  3BUA A;  1K8K G;  3LVQ E;  3ML8 A;  1MYO A;  2M63 A;  5EDS A;  4DLO A;  1NZN A;  2DVW A;  2ETB A;  4JD2 G;  4K03 A;  5DIZ A;  2LO6 A;  3TXN A;  3FH5 A;  4AJW A;  4EBA G;  3KEA A;  4A63 B;  3EUV A;  4DX5 D;  2XGO A;  1JWF A;  3RU0 A;  4TUU A;  4V3I A;  2ZXW E;  4U63 A;  2PM6 A;  2Y4U A;  3FUF A;  1NL4 A;  1WAO 1;  2XZD G;  4APF A;  2I9C A;  3PRZ A;  4FUL A;  3ZN3 A;  3C72 A;  4JC8 A;  2ZGD A;  2OEW A;  2GRQ B;  1K1B A;  4YND A;  2AXU A;  5FIN A;  2DYR E;  3ZFW A;  2OVF A;  4L2L A;  4MRU A;  2J4D A;  4ACK A;  4NIK A;  4LNB A;  4GAA A;  1HE8 A;  1BU9 A;  2C0M A;  4UWH A;  2ILR A;  3AS8 A;  3CSF A;  3UXG A;  2P9I G;  4FU3 A;  3PNT B;  1S64 A;  3UKR G;  4I6G A;  2GGF A;  4AIF A;  2MOW A;  3FU6 A;  4OVU A;  4GZD A;  3CQC B;  4EHM A;  4CZ2 D;  4GYW A;  2KC7 A;  3C3R A;  5EN5 D;  2P9U G;  4NAC A;  3U4T A;  3V2X A;  2RFM A;  4N39 A;  2GRO B;  1BPO A;  4O60 A;  1FVF A;  4PS3 A;  2LNI A;  4GA2 A;  4UQZ A;  1TEZ A;  5E76 A;  2WXM A;  2NYJ A;  4GTS A;  1QZ2 A;  4LCT A;  2LSV A;  3B7S A;  3OXF A;  2MYO A;  3TWU A;  1N4Q A;  1KLX A;  2X38 A; 
#chains in the Genus database with same CATH homology
 3ZYQ A;  4JHR A;  4FHK A;  3FTW A;  2GRL A;  4EEC A;  4GYY A;  2XCC A;  3D9O A;  3JCK C;  2DIW A;  3KS2 A;  2XPZ A;  2XRZ A;  4JVS A;  2WXG A;  2OVB A;  2Q7F A;  2VGX A;  4PS8 A;  2FBN A;  3MZL B;  3Q5M A;  4UWL A;  2WXH A;  2WXL A;  2YNQ A;  3IHY A;  3L22 A;  4HOQ A;  1EDU A;  3KAE A;  5FZR A;  4A55 A;  1E7V A;  2V5F A;  4O6F A;  3BG0 B;  4B89 A;  3ZGQ A;  3I5P A;  4F7A A;  2OV8 A;  5FWQ A;  1UW4 B;  4DK5 A;  5BUZ A;  2I2O A;  4PS7 A;  3QKY A;  1WY6 A;  2XGM A;  3CHO A;  2CG3 A;  1TJF A;  4WWN A;  3ZW3 A;  3FY4 A;  2V4L A;  3QAR A;  4CCA A;  4I9E A;  2UY1 A;  4NRH B;  4GCN A;  4HOU A;  4FP7 A;  1B89 A;  2AVP A;  5AYW D;  2R17 C;  3FTU A;  5CCM A;  1E7U A;  1HG5 A;  4FLB A;  4KMO A;  4DPR A;  4I2W A;  2L6J A;  3SZ7 A;  5AIJ A;  2GRM A;  3JQ1 A;  3CVY A;  3ML9 A;  5M72 A;  3O4Z A;  4HFG A;  3CGH A;  4WUY A;  4GZ6 A;  3G2S A;  4GU5 A;  4AY6 A;  1HFA A;  3NF1 A;  3QAQ A;  5G05 C;  3WXX A;  1IHG A;  4AV7 A;  1EF1 C;  1HS6 A;  1OUV A;  2BUG A;  3FTY A;  5C1D A;  5ARF A;  3ZHE A;  4MS6 A;  3FEY A;  5KJM A;  2X6H A;  3QWV A;  5CMY A;  2KCV A;  1QQE A;  1H6K A;  3L13 A;  3PS6 A;  4L1B A;  1N54 A;  4I1A A;  2J49 A;  4URK A;  2WM9 A;  4HXI A;  4NUR A;  3CR3 A;  3FTS A;  2XHE A;  1E96 B;  4CDN A;  4A1S A;  3L17 A;  3LKU A;  4XZ4 A;  4J8D A;  3RRN B;  1SQM A;  3RO3 A;  5FT9 A;  4APO A;  3HVE A;  3CHM A;  3G2W A;  3URZ A;  3PE3 A;  3EIJ A;  4KT6 B;  4N2S A;  1Z6T A;  3BEE A;  2YHE A;  3MKR A;  3SNX A;  3U9W A;  1E8Y A;  5JJT A;  4I6E A;  2WQ7 A;  4FC8 A;  3PNL B;  2QFC A;  3S7F A;  3LJ3 A;  4JHJ A;  3MV3 B;  3PRE A;  5LCW J;  3PE4 A;  1H2U A;  4G2V A;  4BSX A;  3ASF A;  2J07 A;  4JA7 A;  3PEU B;  1Z3X A;  3RJV A;  3VTX A;  4K0R A;  3LVR E;  2KCL A;  5ARG A;  3UT8 A;  2V0P A;  4ATG A;  1FCH A;  4CDR A;  4CT4 A;  3FUJ A;  3TJP A;  3MEK A;  4IYP A;  1Y8M A;  3I4R B;  4DLQ A;  4GZC A;  3PDN A;  5KJK A;  4WNE A;  1WM5 A;  4XI0 A;  3CEQ A;  5T8I A;  5FZQ A;  2XPY A;  1UJK A;  3QK0 A;  3RRM B;  4PUC A;  3R7R A;  2IOL A;  2J9Q A;  2WXK A;  1ELW A;  1OWL A;  3MGB A;  5AJD A;  2WPV A;  4J8E A;  2C0L A;  2L0T B;  2Y3A A;  4EPZ A;  3CHR A;  2X3M A;  1HXI A;  3PVL A;  2RD0 A;  2E0I A;  4GA0 A;  5CMW A;  4RVB A;  1IQR A;  3UT4 A;  4C9B B;  3APF A;  1DNP A;  2CG2 A;  3FUL A;  2C2L A;  3RK6 A;  4BTB A;  4KBQ A;  1NA0 A;  4KVM A;  1XGW A;  4M3O A;  3GYZ A;  5G55 A;  3RIB A;  3FUD A;  3MCX A;  3QDN A;  4N5C A;  5FJY A;  2HO1 A;  1A17 A;  3CIA A;  2XPI A;  4JL0 A;  3BG1 B;  3T8M A;  1PY1 A;  3QNK A;  4J8S A;  3PZD A;  3P1U A;  3APC A;  1PAQ A;  3QOU A;  4IRU A;  4L7T A;  3IKO B;  2L0I A;  3T5V A;  4P29 A;  2HM8 A;  2J09 A;  4GZ3 A;  4XIF A;  4J0U A;  1SZA A;  4IUL A;  3K9I A;  3CVW A;  4AP2 A;  4IN3 B;  2WXO A;  4HOS A;  2IF4 A;  3Q47 B;  3IHV A;  3ASH A;  4A3T A;  1E8X A;  4ANV A;  3ZEF A;  1EYH A;  3JQ0 A;  4I1M A;  5D0O D;  4FA6 A;  5A6C A;  3S2A A;  4CGW A;  4ME2 A;  3TXM A;  1NA3 A;  3Q49 B;  3U66 A;  4ACL A;  3CVQ A;  3JYS A;  3QWW A;  3E4B A;  4DJA A;  5EKQ D;  4DI4 A;  3IV0 A;  3Q4A B;  2WMO A;  3O48 A;  4CRW A;  4UWG A;  1MQS A;  2VYI A;  3MX3 A;  4HOT A;  1E8Z A;  1N52 A;  5G04 J;  1UN8 A;  2JLB A;  4WWP A;  3D9K A;  2UY1 B;  1KT0 A;  3I3N A;  3LYA A;  3TGO A;  2I1J A;  3MKQ A;  1HF8 A;  4W9R A;  4XE0 A;  5A23 A;  4WNF A;  2I6H A;  2OOE A;  1ELK A;  4UI9 C;  3TG5 A;  4HLE A;  4CGV A;  4L2Y A;  2AWI A;  3CKC A;  4R7L A;  2A4Z A;  2KZT A;  1W3B A;  4I6J A;  3G2T A;  3CVP A;  3HYM B;  3D9J A;  2WQH A;  2NXP A;  4N3C A;  1X5B A;  4GZ5 A;  4XKC A;  5EX3 A;  3ZPJ A;  5ANL A;  3LDZ A;  4I17 A;  3ENE A;  4H7Y A;  3SF4 A;  4OVV A;  5HQ8 A;  2WVI A;  1IYG A;  5FQ6 A;  1ELR A;  1DVP A;  4JW1 A;  4BX9 A;  3FUE A;  3ZRH A;  3U3W A;  2WXP A;  2VSX E;  3FTX A;  1XNF A;  2VQ2 A;  3GZ2 A;  1U3C A;  3NQP A;  4RSY A;  3FTZ A;  5JJ6 A;  3B13 A;  2MRI A;  4KYO B;  2HYZ A;  4AOF A;  1E8W A;  3QC1 A;  3LPZ A;  4WNG A;  3S7J A;  3LCA A;  3NZU A;  5G05 J;  3HVE B;  3MA5 A;  4FLH A;  4RG6 A;  3VTY A;  3OXG A;  1H0A A;  3AU5 A;  3ZVV A;  1EPU A;  1U3D A;  2WMN A;  1INZ A;  3B7R L;  2E2E A;  2UWJ G;  5DBK A;  4N2Q A;  4OYS A;  4UI9 K;  3TL5 A;  3CK7 A;  4Q96 A;  2PQR A;  4DI3 A;  3EHN A;  5A7D B;  4UWF A;  4PH4 B;  1L5J A;  1UG3 A;  2FUL A;  4KXK B;  5J90 A;  5LOZ A;  4E85 A;  4NQ0 A;  3FUN A;  2VTB A;  3G2V A;  3D3M A;  1IQU A;  1UN9 A;  4PDX A;  5AEN A;  4G11 A;  4KZ0 A;  3RO2 A;  1HU3 A;  3ESL A;  2R5S A;  4WAF A;  1JWG A;  3ASD A;  2VSO E;  1HG2 A;  3FH7 A;  1H2T C;  4FJY A;  4E6H A;  3ONL A;  3MYV A;  2LAI A;  3SFZ A;  4HS2 A;  3AS4 A;  5HI7 A;  2RG8 A;  1OWN A;  2WXI A;  4JZY A;  3D9I A;  3CLJ A;  1LF8 A;  2Y4T A;  4YVO A;  2VSN A;  3QJZ A;  3DPD A;  4FAD A;  4N3B A;  5KJL A;  3KD7 A;  4G1T A;  4N3A A;  4RG9 A;  3EDT B;  3B7U X;  3D9N A;  5FZS A;  2WXF A;  5LCW C;  2WXN A;  4GMJ A;  3VLE A;  1ZU2 A;  4ANW A;  4JXT A;  1H19 A;  3SHF A;  3T5X A;  4FHJ A;  1HO8 A;  4JEH A;  5ENN A;  5CCL A;  4JA9 A;  1UJJ A;  1Z3Y A;  3FU5 A;  4B94 A;  2CHZ A;  4EBA A;  5LP0 A;  1YA0 A;  2X6I A;  3CVV A;  3FEX A;  3GZ1 A;  4AVX A;  4WND A;  2AW6 A;  4L23 A;  3ULQ A;  3UT7 A;  5BW8 C;  2CFU A;  4FJZ A;  5JHA A;  2PQN A;  2FI7 A;  3P2B A;  4QFV A;  2VJ8 A;  5CHE E;  3PUJ A;  2WXR A;  4Y6W A;  2J4B A;  4Q94 A;  2LSU A;  2YQ8 A;  2IU1 A;  4BT9 A;  3EHM A;  1H2V C;  4EQF A;  5EX0 A;  4TRQ A;  2V8S E;  4GPK A;  5KCM A;  1VDY A;  2HR2 A;  4CDM A;  1OWP A;  3FUH A;  5E75 A;  2KCK A;  4G26 A;  3S7B A;  3ZYM A;  1ZBP A;  3HDX A;  3UMV A;  3ZXS A;  2I1K A;  4ABN A;  2WQ6 A;  1GW6 A;  2KM4 A;  4BT8 A;  4ANX A;  3FH8 A;  1JUQ A;  2VGX B;  3ZIM A;  4A3V A;  3UQ3 A;  2GW1 A;  3CQG B;  3CK8 A;  2XEV A;  4BTA A;  3OAW A;  3CHS A;  4KVO A;  4BY6 A;  3LVQ E;  3ML8 A;  2M63 A;  5EDS A;  3ZYK A;  4UWK A;  4DLO A;  5LX8 A;  4C0M A;  1NZN A;  4XKB A;  2BF0 X;  3QB2 A;  1TJC A;  4XI9 A;  5FQ8 A;  4GCO A;  4CEM A;  5BV1 A;  2IQC A;  4AEZ C;  3IBE A;  3OTN A;  3FU0 A;  2DBA A;  5D0Q D;  4B0Z A;  4MLP A;  2YIN A;  5AJL A;  4CT0 A;  3AU4 A;  3PUK A;  4LEU A;  4K03 A;  4AXH A;  4Q69 A;  3G2U A;  5FQ4 A;  3FUK A;  5DIZ A;  3PEV B;  2LO6 A;  4UI9 J;  5G04 C;  1S0P A;  4I2Z A;  3TXN A;  3FH5 A;  4C0E A;  2P58 C;  4AJW A;  3L16 A;  4G24 A;  4J6I A;  4G23 A;  5ANR A;  4EBA G;  3ZHE B;  4F3V A;  5FTP A;  2X6F A;  5C2Y A;  3TG4 A;  4EZL A;  4GB9 A;  4JHK A;  3U64 A;  2R59 A;  3FU3 A;  3LEW A;  3SGH A;  2KAT A;  2XGO A;  3EJN A;  4BFR A;  2NSZ A;  3KEZ A;  3LY9 A;  3CV0 A;  3ZYL A;  1JWF A;  2BTD A;  3GW4 A;  3RU0 A;  2X6J A;  4TUU A;  4V3I A;  2JEK A;  4Y6C A;  4U0S A;  3LY7 A;  4U63 A;  4UQX A;  3OXL A;  2PM6 A;  2Y4U A;  4U0U A;  1SZ9 A;  3FUF A;  2VTB B;  4KZC A;  4LUN U;  2CFZ A;  3L08 A;  3VLD A;  4JEU A;  1WAO 1;  5BNW A;  4APF A;  2I9C A;  4GYO A;  2QY7 A;  1OWO A;  3PRZ A;  4FUL A;  4WWO A;  2PM7 A;  3FHE A;  4ILH B;  3ZN3 A;  4F53 A;  3C98 A;  4YVQ C;  2MHK A;  2L9B A;  2X6K A;  4JC8 A;  2LAH A;  3SI5 A;  4GML A;  3D9M A;  4YND A;  2AXU A;  2CHW A;  3SD5 A;  2AXZ A;  2FF4 A;  3PH0 C;  5G2N A;  5FQ7 A;  5LFA A;  5T4Y A;  5JHB A;  3AS5 A;  2AXV A;  1OWM A;  3MV2 B;  3ZFW A;  1HH8 A;  3S7D A;  4EZK A;  3CVX A;  2OVF A;  2A5U A;  3VLF A;  4L2L A;  4AM9 A;  4BX8 A;  2IFU A;  4MRU A;  4ANU A;  4XX5 A;  4EZJ A;  2J4D A;  2XCB A;  4U8H A;  4ILI A;  3R7Q A;  2WXQ A;  4U04 A;  2XGS A;  3ASG A;  2EQX A;  4UQY A;  2CHX A;  3FFL A;  4F1S A;  4ACK A;  3TAX A;  3EIQ C;  3CHQ A;  2XQ0 A;  2PL2 A;  3MJW A;  4GAA A;  3DBS A;  1HE8 A;  3CVU A;  5JJ7 A;  2C0M A;  3I4G A;  3HIZ A;  4UWH A;  3RKV A;  2ILR A;  3AS8 A;  2J08 A;  3CSF A;  4U0Z A;  4FU3 A;  4I43 A;  4BWR A;  2ION A;  3PNT B;  4HOR A;  1KT1 A;  4I6G A;  2GGF A;  2IOS A;  4AIF A;  1PC2 A;  5T3R A;  2MOW A;  3IEG A;  3FU6 A;  1MHQ A;  4OVU A;  1HZ4 A;  3HHM A;  4GZD A;  3CQC B;  4HVB A;  3LXU X;  3Q15 A;  5J08 A;  3GZS A;  3FDH A;  3FP3 A;  4ILG A;  3JUI A;  3UPV A;  3R9A B;  1P5Q A;  4GYW A;  3FUM A;  3L54 A;  2KC7 A;  4B8C B;  1NP7 A;  1QNF A;  4NAC A;  4JPS A;  2NC9 A;  2OND A;  2XRY A;  4G25 A;  4LRZ A;  4LER A;  3U4T A;  4TV3 A;  2YHC A;  3N71 A;  1FVH A;  1JPL A;  1HX8 A;  4B8A A;  2IJG X;  4GA1 A;  4A1G A;  1Y6I A;  4I1O B;  3L6A A;  3RRU A;  2FEZ A;  4J8F A;  5BV0 A;  2FO7 A;  4N39 A;  1BPO A;  4I9C A;  4D10 C;  3FWV A;  3D9L A;  5BT1 A;  1FVF A;  3MKQ B;  2PZI A;  4PS3 A;  3FTV A;  3APD A;  2VSY A;  3CST A;  4MKT A;  3UUX A;  3SBS A;  2LNI A;  4GA2 A;  4UQZ A;  4U07 A;  4AY5 A;  5KJN A;  1TEZ A;  5E76 A;  2WXM A;  3ESK A;  2DCP A;  3B7T A;  2ZU6 B;  1E90 A;  2KZT B;  2VGY A;  3CVN A;  5BPP A;  1QZ2 A;  3CHP A;  3D9P A;  3FUI A;  3LS8 A;  4H7X A;  4LCT A;  2LSV A;  2WXJ A;  3B7S A;  3OXF A;  3CK9 A;  3CVL A;  3NZS A;  3UX4 A;  3QWP A;  1KLX A;  3SBT B;  2WB2 A;  2X38 A;  3CKB A;  3ONK A;  3LY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...