4UI9K

Atomic structure of the human anaphase-promoting complex
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
493
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHKSCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 178
structure length 493
sequence length 526
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
K PF13176 TPR_7 Tetratricopeptide repeat
K PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9K00
5AYWD 3SF4A 2XGSA 3N71A 4G24A 5ARGA 3ASDA 3QWVA 5ARFA 4YVOA 1ZU2A 2FO7A 4J0UA 2AVPA 2VYIA 4J8FA 4H7XA 5G04J 2KCKA 4RG9A 3ASFA 1OUVA 4F3VA 3UPVA 3LY7A 5FZSA 4AY6A 5FT9A 4UQXA 3S7FA 4O6FA 3U3WA 2P58C 2UWJG 4JL0A 5HQ8A 3HYMB 3MV3B 5CHEE 3VTXA 4HORA 4YNDA 4J8DA 4G25A 3WXXA 3RO3A 2L6JA 5FZRA 2HYZA 3CKBA 5A7DB 3QOUA 4N5CA 4WUYA 4AM9A 1P5QA 3CVPA 4GZ3A 3QWPA 3S7BA 4BWRA 3TG4A 2PQNA 3CVQA 2XCBA 3NF1A 3Q4AB 4Y6WA 3S7JA 4WNDA 2BUGA 4BT9A 4GYOA 3CEQA 5C1DA 4JA9A 1QZ2A 2FI7A 5EX0A 5JJTA 1HZ4A 4GPKA 2UY1A 3FFLA 2WQHA 4GA0A 4U0ZA 2IF4A 4UI9C 4I17A 4W9RA 4XI9A 5FZQA 1NA0A 3OXLA 5DIZA 5G04C 2UY1B 3MV2B 3KD7A 4BT8A 4XIFA 4CGVA 4N3BA 1NA3A 4WNGA 5CCLA 3PE3A 5D0OD 5BT1A 4H7YA 4J8EA 2NC9A 4JA7A 3UQ3A 2LSUA 4GCOA 5JJ7A 4IN3B 4N3AA 4U04A 3OXFA 2Y4TA 3AS5A 5G05C 1WM5A 3ULQA 4BTBA 5BNWA 2LNIA 3AS8A 3UUXA 4GZ6A 3URZA 2MHKA 4G2VA 1E96B 3ZHEB 5EKQD 4B94A 2PQRA 2VGYA 3FWVA 2Y4UA 3GZ2A 3MEKA 3LY9A 3RJVA 1Y8MA 3KS2A 1ZBPA 1KLXA 4N39A 1QQEA 2XGMA 1IHGA 1WAO1 2VSYA 3ASHA 5D0QD 1IYGA 3QDNA 5BW8C 1HXIA 4ABNA 3CK7A 4GYWA 3R9AB 2GW1A 3GZ1A 2XEVA 3MKRA 4HOUA 2ONDA 3LCAA 3PDNA 3RO2A 2FEZA 2R5SA 4NRHB 4U0UA 3ZPJA 3E4BA 3FP3A 3TAXA 5G05J 4CDRA 4KXKB 2PZIA 5KJNA 4HOTA 5DBKA 2VGXB 3EDTB 3Q49B 4JHRA 4LEUA 2C0LA 3LKUA 1A17A 2YQ8A 3CK8A 1FCHA 3BEEA 2I6HA 3GW4A 3KAEA 3Q5MA 4GZ5A 4WNFA 4XI0A 4AY5A 2J9QA 2KCVA 3LY8A 4I9EA 5KJLA 4N3CA 3IEGA 3AS4A 4RG6A 4HOQA 3RKVA 2QFCA 5M72A 4I2WA 3ASGA 2FBNA 2KCLA 2HO1A 4G26A 4UQZA 5A6CA 1B89A 2WPVA 2E2EA 3LPZA 2PL2A 3CVNA 3Q47B 1KT1A 5EX3A 2IFUA 4UI9K 4GCNA 1HH8A 1NZNA 3CVLA 3ZFWA 4HOSA 2XPIA 2C0MA 3CV0A 4AIFA 4GA2A 5LCWJ 2LSVA 4KYOB 1PC2A 4WNEA 3RIBA 3LYAA 3K9IA 4U07A 3QKYA 3VTYA 5KJKA 2FF4A 4GYYA 3TG5A 1YA0A 1ELWA 2XCCA 4GA1A 3S7DA 5FJYA 1ELRA 2HR2A 4G23A 3ESKA 3ZHEA 4YVQC 4CGWA 2VSNA 3O48A 5FTPA 5HI7A 3RU0A 5KJMA 2YHCA 4I2ZA 4UI9J 1W3BA 3CK9A 2OOEA 2V5FA 3Q15A 1XNFA 2KATA 4G1TA 4ME2A 3ZN3A 2Q7FA 3SZ7A 4A1SA 5CCMA 4N2QA 3U4TA 3QWWA 1KT0A 3MA5A 4Y6CA 1TJCA 2XGOA 3GYZA 4U0SA 2DBAA 3OXGA 3CKCA 3PE4A 4NQ0A 4UQYA 5JJ6A 4BTAA 3TGOA 4I1AA 4I9CA 4APOA 5LCWC 2VQ2A 4N2SA 2C2LA 2KC7A 3ZGQA 3JYSA 4EQFA 4KBQA 2VGXA 2JLBA
chains in the Genus database with same CATH superfamily
1N4RA 3CGHA 3HXBA 2VGEA 5G04J 3DBSA 1FVHA 2LO6A 3TXNA 4ATGA 3RAUA 3FTWA 2WVIA 3T5VA 5A7DB 1MX6A 3SO8A 4WUYA 1H0AA 5KNHD 2BUGA 4C0MA 3UX4A 4U0ZA 1H6OA 2UY1B 3KD7A 2E0IA 4JPSA 4MBGA 4B93B 3LXUX 3HXEA 1D8EA 4DJAA 3OXFA 1WM5A 3E30A 2VTBB 3EU9A 3NOGD 4DX5D 3GZ2A 3MEKA 2Y4UA 1SZ9A 2A5UA 4GTVA 4GYWA 3R9AB 2R5SA 3MZLB 3ZW3A 4WWOA 4CDRA 3G2TA 3JQ1A 2XZDG 2ZU6B 1L5JA 3DXKG 3LY8A 2QFCA 2HO1A 1B89A 3PZ2A 1HO8A 2WMOA 3PS6A 4FHJA 4XEIG 1RZ4A 2HR2A 2VSNA 4PS8A 4EHMA 3UINC 3U4TA 2XGOA 3UXGA 3CKCA 5ENPD 4X8QA 5FIOA 4APOA 1JWFA 2KC7A 3B7UX 2JLBA 3ZUVB 2XGSA 1DC2A 3Q79A 1DVPA 1OUVA 3LY7A 2H6GA 3C3OA 2I2OA 1JCQA 5AQBA 2WXIA 2V0PA 3ZYLA 3G2SA 1MHQA 1O1SA 5EX0A 2I9CA 2ZISA 2XRYA 2V8SE 1OCCE 2P9IG 3DSVA 2F37A 5BV1A 3CHSA 1SW6A 2ZGGA 3FEXA 5EILA 4BX9A 5HS0A 3KEZA 2AXUA 5BW8C 3HDXA 4KVOA 2ZGDA 4XKBA 3GZ1A 2FEZA 3FU5A 4NRHB 1N4QA 4OAUC 4FC8A 4TXQA 3BQOA 5LX8A 4I2WA 4Q94A 1S63A 3APFA 2E2EA 3LPZA 1NZNA 3I3NA 4KYOB 3TWQA 2KM4A 4U95D 3QKYA 1H2TC 3PUKA 3PRZA 2IO2C 3RU0A 1OCRE 4UWHA 4I2ZA 3C5RA 5ENQD 4N2QA 2VJ8A 2WXMA 3B7SA 3D9LA 2HE0A 2GRPB 2BKGA 3OXGA 3TGOA 1N95A 5ANLA 2OEWA 3ABLE 4I1AA 3FUJA 2VQ2A 3ML9A 2GRMA 4LNGA 1JCRA 2BKKB 3DSUA 3GZSA 4RQIA 5CHEE 3R9MA 3CVYA 5EN5D 5KCMA 3CEQA 2FI7A 2XPZA 4HLEA 3FH5A 1K8KG 2WQ7A 1N11A 1V55E 3SFXA 4H7YA 1N0QA 3B13A 3ASNE 5JJ7A 1IQUA 3Q75A 1NP7A 3QJZA 4U8VD 3CIAA 4HLLA 1WAO1 4BERA 3LCAA 3L22A 2VGXB 3EDTB 1A17A 1HFAA 5CRVA 3UT8A 5BUZA 2KCVA 4B8CB 3C3RA 5M72A 2KCLA 5LOZA 2PL2A 3FU3A 3JXIA 4ANWA 2BF0X 2P9SG 1Z5SC 4HS2A 3PNTB 2FF4A 1YA0A 1OWMA 4GA1A 3R7QA 5AARA 2J09A 1ELRA 3ZHEA 4LRZA 1H2VC 1LTXA 4G1TA 4ME2A 2Q7FA 4OVVA 2DYRE 4BY6A 4I9CA 2P9KG 4DX2A 2IOLA 4GZCA 3IV0A 4J0UA 4FJZA 2X38A 4RG9A 3UKUG 4ANVA 4CCAA 4K5BA 5FZRA 2HYZA 2WXHA 2DZNA 3ISMC 2AWIA 2X6JA 5JHBA 3S7BA 3FTZA 4I1OB 3DSXA 4JXTA 5DIZA 4N3BA 4YDEA 4F7AA 2LSUA 3UQ3A 1QYMA 3PZ1A 4U04A 4BTBA 2ETCA 4O1OA 4HBDA 4HNAD 3FWVA 3CHRA 3TWRA 2WXOA 2J49A 4XX5A 2B6CA 5IY5E 4HOUA 2FULA 3PVLA 2PZIA 5H7PA 4LEUA 3Q5MA 1FCHA 2I6HA 2H6FA 4HVBA 4TXRA 3DPYA 1JUQA 4G26A 1O1RA 4K0RA 3ASOE 3LEWA 4AVXA 2LUHA 2IJGX 3Q78A 3TG5A 3B7TA 4G23A 4FU3A 3CSTA 5LP0A 4U8HA 3CLJA 1GW6A 3I4RB 3Q73A 2MYOA 4JVSA 3EIJA 2WXQA 1TJCA 2ETAA 1QBQA 1DCEA 5EYPF 3ZNGA 1N54A 3CQCB 3NAWA 3PZDA 1HX8A 4UWGA 4FADA 4KT6B 1Y6IA 3D9IA 4JZYA 4MRUA 3Q7FA 4YNDA 3CKBA 5FQ4A 4UUCA 3EHNA 2KZTA 4EECA 3CVQA 4WNDA 1PY1A 4IULA 1E90A 3KSQA 4BX8A 1D8DA 3L54A 2DWZA 3ZRHA 4HB5A 3C98A 4HRNA 2PM6A 3AS8A 3SI5A 1TYQG 3ZHEB 4JD2G 1HS6A 1RW2A 4L2YA 5EYLA 3ZYQA 2KBXA 3C72A 2RD0A 3DPDA 4PS3A 4AEZC 3ULYA 2XEVA 3MKRA 2ONDA 4CZ2D 3SY2A 4K03A 5DBKA 5KJNA 4L2LA 4JEUA 3BG1B 3ENEA 3PNLB 1UN9A 3E34A 5D2MC 3VTYA 3D3MA 3NBNB 2VSXE 1V54E 2L9BA 3DSTA 3FHEA 3Q9NC 4HI8A 4M7CA 1LF8A 3UTMA 4L9PA 1HU3A 4Q96A 4BTAA 4UQYA 4KMOA 2BEDA 4GTRA 5D66A 1K1BA 4HI9A 4A1GA 3PEVB 5ENNA 1JPLA 1OY3D 3TJPA 3QWPA 3ONLA 3S2AA 2PQNA 1SA5A 4BT9A 5CECB 4EBAA 1UW4B 1TN7A 4FP7A 4BT8A 4AOFA 5CMYA 4AXHA 2IO3C 1N4SA 3SBSA 2QY7A 1H2UA 3FU0A 1JCSA 2GRNB 1VDYA 2CFUA 4AJWA 3ZVVA 5KNGA 3LS8A 3AJIA 4FLBA 1TN8A 1WDYA 3D9PA 4N39A 4M3OA 2WXLA 3TWWA 3B95A 4ABNA 1O1TA 4FLHA 2AW6A 3D9OA 5G05J 4HOTA 3ZXPA 4ZFHA 2KZTB 1MZCA 3QNKA 1OWPA 1N4PA 4I9EA 4N3CA 4YDWA 2J08A 1Z3XA 3CHQA 4OAVB 2XPIA 2L0TB 2NYJA 3RIBA 4GMLA 4I6GA 2J8SD 3R7RA 5FTPA 2R03A 4GZDA 3CSFA 2CG3A 3QWWA 5BV0A 2V4HC 5JJ6A 3QC1A 4EQFA 3N71A 4G24A 4ILHB 3HHMA 5T8IA 4F3VA 3J5QB 4A63B 3DWLG 2P58C 3W9FA 1E7UA 3TWXA 3Q4AB 3T5XA 4GYOA 3KSLA 3FFLA 4UI9C 2WQHA 4XI9A 3CHMA 4I6JA 5CERB 3E37A 4GCOA 4IN3B 4HXIA 1Z6TA 1Y8MA 4GMJA 2XGMA 4MKTA 1TR4A 1A5EA 3FUKA 2GW1A 2AXZA 1TEZA 4DRXE 3ABKE 3L82A 3Q49B 5FZSA 2KXPC 3LJNA 3FUHA 4U7EB 3CVNA 3ZKJA 4HOSA 3V31A 3K9IA 5KJKA 5ITZF 4L23A 1ELWA 3EUVA 5FJYA 4UWLA 3HIZA 1XNFA 1O5MA 4TRQA 4OVUA 1IXVA 4RLYA 3SFZA 2RFMA 1FT1A 2VGXA 3VLEA 5ARGA 4HFGA 3TWVA 2KCKA 4QQIA 3RRNB 4HRLA 2XZTG 4U63A 3U3WA 2R17C 3MV3B 3SHFA 2R05A 2X6HA 3FTSA 4BWRA 4WWPA 3QK0A 5FQ8A 2WXNA 2R02A 2WMNA 2XEEA 1S64A 4DX1A 4W9RA 4LCTA 3SQVA 5G04C 4DLQA 3MV2B 2X3MA 3DSWA 2J07A 3FTYA 1NI1A 3U64A 3AS5A 1E8XA 2H6IA 4ANUA 4U8YD 4B94A 2VGYA 3ZU7B 3U9WA 3E33A 4LUNU 5D0QD 1HE8A 1E7VA 3HRAA 1N94A 2A5EA 4U0UA 3DXMG 3B7BA 3S7FA 4UQZA 2CHWA 4GZ5A 4GPMA 3DEOA 3EHRA 1E8WA 4A55A 3D9NA 4GB9A 4ANXA 1BLXB 4YDOA 3CV0A 1N52A 4WNEA 1D9SA 2F8XK 4N5QA 2VTBA 2WXGA 3O48A 3AG4E 4DX7D 3CK9A 4O1PA 4GTTA 2XS8A 4IYPA 4CDMA 5LFAA 2WXRA 2DCPA 2P2CP 2DVWA 5HI7A 2WXKA 1UG3A 2P9LG 1U3DA 3RK6A 3I4GA 2MRIA 3ZGQA 2EINE 1BPOA 2FO7A 5AIJA 4O6FA 3WG7E 3APCA 4MLPA 1P5QA 4AP2A 1LD8A 1MQSA 4CRWA 5EIBE 3HXFA 4DPRA 5BXOA 3RRUA 3L6AA 1X81A 2NC9A 3V30A 4WWNA 5CEAA 1OWOA 1ZBPA 3UIOC 5B1BE 5KBAA 3AG2E 1DNPA 3L13A 1AWCB 2BTDA 3LKUA 3BEEA 3GW4A 1SQMA 4WNFA 4IRUA 2J9QA 3LDZA 5KJLA 3IEGA 3LVRE 4JEHA 3D9JA 4EZKA 3FULA 2IU1A 4C9BB 2ZIRA 4EBAG 1OCOE 4GA2A 4U07A 2LAIA 4GYYA 5CRUA 2V5QC 3IKOB 4ILGA 4ATZD 4CGWA 4YVQC 4UI9J 2Y0BG 2OOEA 4GTPA 3QB2A 1INZA 5CCMA 2DBAA 4C48B 1TNOA 4J8YA 2C2LA 4KBQA 4Z68A 3MKQB 4NIKA 2VYIA 4UQXA 3RO3A 3SGHA 4AM9A 4GZ3A 3UIPC 3ZYMA 2WXJA 4LERA 4DI4A 4GPKA 4GA0A 3OTNA 5CBNA 4FJYA 4PS7A 5CCLA 4J7WA 3BU8A 2RFAA 4UWFA 3ZXSA 2EIKE 4ACKA 4TV3A 5BNWA 4GTQA 2ILRA 3HVEB 4GZ6A 3URZA 3LY9A 3KS2A 4BSXA 1IHGA 2DYSE 5EIDA 4F53A 3CK7A 1NFIE 2EIJE 5FQ7A 2Y1LE 3BG0B 3PUJA 3PDNA 3E4BA 3FUIA 2QC9A 3FUEA 4XI0A 4RG6A 2LAHA 2HM8A 4F6RD 2J4DA 1N0RA 1KT1A 4UI9K 3BUAA 1TNUA 5CMWA 2C0MA 4JW1A 4GAAA 3S7DA 3SD5A 3VLFA 2YHEA 1G3NB 4EPZA 3EU5A 2NSZA 3UI2A 3Q9UC 1W3BA 2V5FA 3Q15A 2I1JA 1OT8A 3Q7AA 2JABA 1FT2A 3D9MA 3PE4A 3TWSA 3PZ3A 1U2VG 2XRZA 3FH8A 2GRQB 4LSZE 4N2SA 4Q69A 3JYSA 4RSYA 4A3TA 3ASDA 1ZU2A 2AVPA 4PDXA 3UPVA 3ASFA 2GRLA 4G25A 4JB8P 2AJAA 2CHZA 5BPPA 4N5CA 2XPYA 2XEHA 3P1UA 3LVQE 1HZ4A 3NQPA 4LNBA 2LXLA 3UKRG 2IF4A 5FZQA 2QYJA 1HG2A 4PUCA 1IHBA 3EHMA 2QZAA 4BEPA 3IHVA 1OCZE 3W9GA 5HRYA 5AQ9A 3UUXA 3NOCD 4L1BA 4V3IA 1UJJA 3QARA 2Y3AA 1WG0A 1S0PA 3J5PA 2AXVA 2F0YA 3CHOA 3UM1A 3RO2A 3TWUA 2GROB 4GTMA 3FP3A 3IBEA 2WB2A 3T9KA 3ULEG 2NXPA 1BU9A 4JHJA 3KEAA 5ENSD 5A6CA 2WPVA 4GTOA 1HH8A 4AIFA 3LYAA 1TN6A 4PH4B 2DZOA 1U3CA 1E8YA 1FPPA 2YHCA 5ENTD 2A4ZA 3L9TA 4ACLA 3V2OA 3QAQA 3SBTB 4A1SA 2RG8A 1IQRA 3IXEA 4CT4A 1EF1C 4XZ4A 4U0SA 3NZUA 3MJWA 3JUIA 3MKQA 1BD8A 4ILIA 2XENA 3FY4A 5AYWD 4GU5A 4H7XA 2CHXA 3L16A 2L6JA 3U66A 3CVPA 4HRMB 4B0ZA 3TG4A 3NF1A 4Y6WA 5JJTA 3IHYA 1QNFA 3O4ZA 4G8LA 3FH7A 4CGVA 3MYVA 4APFA 4J8EA 3FUDA 1EYHA 2IONA 4N3AA 2PNNA 2Y4TA 2MHKA 4G2VA 4U96D 5ANRA 2CG2A 4A3VA 1TJFA 4AV7A 4L7TA 4J6IA 3F6QA 5C2YA 3ZPJA 4BFRA 2ZXWE 1YCSB 2WXPA 2YQ8A 2P9PG 5J08A 3HXCA 2OEVA 3SFYA 2QYUA 2IOSA 2L0IA 3LJ3A 1TNZA 1UJKA 3VLDA 3AU4A 3CVUA 1H6PA 3UT4A 3P2BA 3G2WA 5KJMA 1SA4A 3CQGB 3UM3A 4DUIA 4D10C 3MA5A 5JHAA 2XHEA 3JUEA 1KZOA 3SF4A 5ARFA 4NACA 3OAWA 2MOWA 3EJNA 2VSOE 3VTXA 3CVWA 3AG3E 4J8DA 1Q2ZA 5B1AE 5AAOA 3B7RL 3L17A 4QFVA 5LCWJ 3AG1E 1QZ2A 5AN8A 2UY1A 3FTXA 4DX6D 5FQ6A 3OXLA 4WNGA 4CDNA 1OXJA 3PE3A 1JWGA 3CVVA 3FUFA 2OCCE 1E96B 2Y69E 3JCKC 5EKQD 2XQ0A 2JEKA 1OWLA 3ASHA 3G2UA 4J8SA 2EQXA 2X6KA 1MYOA 4KXKB 4LNUD 1K1AA 1H6KA 3TXMA 3RKVA 5E75A 4E85A 2EIME 4I6EA 1ELKA 1HG5A 5EX3A 3FU6A 4GCNA 3ML8A 2LSVA 2CFZA 1PC2A 3UM0A 3ONKA 2XCCA 4G8KA 3ZEFA 3V2XA 1UN8A 2KATA 5AJLA 1N9AA 4NQ0A 3AAAC 2OVFA 5LCWC 2EILE 2R59A 3I5PA 3UM2A 1E8ZA 4C0EA 5B3SE 3QWVA 4YVOA 4TXPA 4E6HA 4DLOA 4XKCA 4EZLA 2UWJG 4JL0A 3WXXA 3JXJA 2DIWA 3S7JA 2J4BA 5FINA 4KVMA 4JC8A 4I17A 5T4YA 1H19A 2P9UG 2IEJA 3RRMB 3CHPA 1FVFA 3EIQC 1YYHA 4K5CA 3HVEA 1TNYA 4UWKA 5BXUA 3V79K 2I1KA 1AP7A 4CEMA 2PM7A 2PQRA 4NURA 4EZJA 1QQEA 2XS1A 2X6IA 1IYGA 3QDNA 4KZCA 3G2VA 1LD7A 4JHRA 4B8AA 2C0LA 3PREA 4WAFA 1SVXA 3ESLA 4BSZB 5CEDB 5KWDA 5AENA 1UOHA 3D9KA 1S70B 3C3QA 1Z3YA 2GRRB 1KZPA 1NL4A 5ENRD 2GGFA 4BESA 3FDHA 2OVBA 3SZ7A 3ZN3A 2IQCA 3TAXA 2ETBA 1ZB1A 5A23A 4G11A 5JMND 2OV8A 4P29A 3HXDA 4OYSA 4J8FA 4R7LA 2M63A 2B0OE 3APDA 5FT9A 5HQ8A 4HORA 4B89A 3NZSA 3FEYA 4I1MA 1DCQA 2L6BA 2R2LA 1NA0A 1PAQA 3FTVA 2IY0C 2V4LA 5CBOA 5G05C 3ULQA 2YNQA 2LNIA 1EDUA 3RSEG 4RVBA 4GMRA 3L08A 1YMPA 3JQ0A 4DK5A 4GTSA 1HF8A 3T8MA 3MX3A 1X5BA 4AY5A 4O60A 5FWQA 4K5AB 3CVXA 2WXFA 4HOQA 3MCXA 5JA4D 3ASGA 5HKPA 2WM9A 3Q47B 3CVLA 5ENOD 3ZYKA 3E32A 1BI8B 4YDYA 2FO1E 3EHQA 5AJDA 4F1PA 3AU5A 5E76A 3TWTA 1MX4A 4Y6CA 3GYZA 5EDSA 3DRAA 1IKND 4TUMA 5T3RA 3ABME 3UMVA 4I43A 2LXMA 4AY6A 1BI7B 1SZAA 2YINA 3HYMB 2X6FA 3HG0D 3NB2A 1WY6A 4FULA 3QOUA 2XCBA 5C1DA 1EPUA 4JA9A 2H6HA 3D9HA 4FHKA 4XIFA 1NA3A 1MX2A 1KPSB 5D0OD 4CYMD 5BT1A 4JA7A 3SNXA 4LG6A 5AQAA 3FUNA 4CT0A 3X2QE 2WQ6A 3FUMA 4ZHBA 2RKKA 4BETA 5J90A 3T8KA 3DEPA 3RJVA 1TNBA 1KLXA 5AQ7A 2VSYA 1MJ0A 5G55A 1HXIA 1XGWA 2P9NG 3PZ4A 3CK8A 3KAEA 3CR3A 4MS6A 3AS4A 2FBNA 4HQDA 4URKA 5G2NA 2IFUA 3FTUA 4DI3A 3ZFWA 3PEUB 4KZ0A 3ESKA 4TUUA 1K3ZD 4JHKA 4FA6A 3MGBA 1OWNA 3UT7A 1KT0A 4XE0A 3DSSA 3TL5A 4F1SA 3ZIMA 3PH0C 2F8YA
chains in the Genus database with same CATH topology
3CQCB 3SF4A 1BPOA 3CGHA 3PZDA 1HX8A 5ARFA 4UWGA 2FO7A 4FADA 4KT6B 5AIJA 5G04J 3DBSA 1FVHA 1Y6IA 2LO6A 4NACA 3TXNA 4ATGA 3OAWA 2MOWA 3D9IA 3EJNA 2VSOE 4JZYA 4MRUA 4O6FA 3VTXA 3CVWA 3FTWA 2WVIA 4J8DA 4YNDA 3APCA 3B7RL 3CKBA 3L17A 4MLPA 5FQ4A 5A7DB 3T5VA 4WUYA 3EHNA 1P5QA 1H0AA 2KZTA 4QFVA 4EECA 4AP2A 3CVQA 5LCWJ 4WNDA 2BUGA 1QZ2A 1MQSA 4CRWA 4C0MA 3UX4A 2UY1A 4U0ZA 4DPRA 1PY1A 3FTXA 4IULA 1E90A 5FQ6A 3OXLA 4BX8A 2UY1B 3KD7A 2E0IA 4JPSA 3RRUA 3L54A 4WNGA 3L6AA 3LXUX 4CDNA 3ZRHA 3PE3A 2NC9A 4DJAA 1JWGA 4WWNA 3OXFA 1WM5A 3C98A 3CVVA 2PM6A 2VTBB 3AS8A 3SI5A 3FUFA 3ZHEB 1E96B 3JCKC 5EKQD 2XQ0A 1OWOA 3GZ2A 1HS6A 2Y4UA 3MEKA 4L2YA 1SZ9A 3ZYQA 2JEKA 1ZBPA 1OWLA 3DPDA 2RD0A 4PS3A 2A5UA 3ASHA 3G2UA 4AEZC 4J8SA 4GYWA 3R9AB 2EQXA 2XEVA 3MKRA 1DNPA 2ONDA 2X6KA 3L13A 2R5SA 3MZLB 3ZW3A 4WWOA 4K03A 4CDRA 3G2TA 4KXKB 3JQ1A 2BTDA 5DBKA 3LKUA 5KJNA 3BEEA 3GW4A 2ZU6B 1L5JA 1SQMA 1H6KA 4L2LA 4JEUA 4WNFA 4IRUA 2J9QA 3LDZA 3LY8A 3TXMA 5KJLA 3IEGA 3LVRE 3BG1B 5E75A 3RKVA 4E85A 2QFCA 4JEHA 3D9JA 2HO1A 4EZKA 3FULA 1B89A 4I6EA 1ELKA 3ENEA 3PNLB 1HG5A 5EX3A 1UN9A 3FU6A 2IU1A 4C9BB 1HO8A 4GCNA 2WMOA 4EBAG 4GA2A 3ML8A 2LSVA 2CFZA 1PC2A 4U07A 3VTYA 3D3MA 3ONKA 3PS6A 2LAIA 4GYYA 2VSXE 2XCCA 3IKOB 4ILGA 4FHJA 2L9BA 3FHEA 2HR2A 4CGWA 4YVQC 2VSNA 4PS8A 4UI9J 3ZEFA 1LF8A 2OOEA 1UN8A 2KATA 5AJLA 1HU3A 3U4TA 3QB2A 1INZA 4Q96A 5CCMA 2XGOA 4BTAA 2DBAA 4NQ0A 3CKCA 4UQYA 4KMOA 4APOA 2OVFA 5LCWC 2C2LA 1JWFA 2KC7A 2R59A 3B7UX 4KBQA 3I5PA 2JLBA 3MKQB 1E8ZA 2XGSA 4C0EA 3QWVA 4YVOA 2VYIA 4A1GA 4E6HA 3PEVB 4DLOA 5ENNA 1JPLA 1DVPA 1OUVA 3LY7A 4XKCA 4EZLA 4UQXA 2UWJG 4JL0A 2I2OA 3TJPA 3WXXA 3RO3A 2WXIA 2V0PA 3SGHA 4AM9A 4GZ3A 3ZYLA 3QWPA 2DIWA 3G2SA 3ONLA 3S2AA 2PQNA 3ZYMA 3S7JA 4BT9A 2J4BA 2WXJA 4EBAA 4KVMA 4LERA 1MHQA 4DI4A 5EX0A 2I9CA 1UW4B 4GPKA 4GA0A 4JC8A 4I17A 5T4YA 4FP7A 4BT8A 1H19A 2XRYA 3OTNA 4AOFA 5CMYA 4AXHA 3RRMB 4FJYA 3CHPA 1FVFA 2V8SE 3SBSA 2QY7A 4PS7A 5CCLA 1H2UA 3EIQC 4UWFA 3ZXSA 3FU0A 4TV3A 4ACKA 3HVEA 4UWKA 1VDYA 2I1KA 5BV1A 5BNWA 2CFUA 4AJWA 3CHSA 2ILRA 3HVEB 4GZ6A 3ZVVA 3URZA 3LS8A 4CEMA 2PM7A 2PQRA 3FEXA 4NURA 4EZJA 3LY9A 4BX9A 4FLBA 3KS2A 4BSXA 3D9PA 4N39A 4M3OA 2WXLA 1QQEA 3KEZA 1IHGA 2X6IA 2AXUA 3QDNA 1IYGA 4F53A 5BW8C 3HDXA 4ABNA 3CK7A 4KZCA 4KVOA 4FLHA 4XKBA 3GZ1A 5FQ7A 2AW6A 3BG0B 3PUJA 3PDNA 3G2VA 2FEZA 3D9OA 3FU5A 4NRHB 3E4BA 5G05J 4HOTA 4FC8A 2KZTB 4JHRA 4B8AA 2C0LA 3FUIA 3PREA 3QNKA 4WAFA 1OWPA 3FUEA 4XI0A 4I9EA 4N3CA 5LX8A 4RG6A 3ESLA 2LAHA 2HM8A 4I2WA 2J08A 1Z3XA 4Q94A 3APFA 2J4DA 2E2EA 3LPZA 1KT1A 5AENA 4UI9K 3CHQA 1NZNA 2XPIA 2C0MA 3D9KA 4JW1A 2L0TB 3I3NA 4KYOB 5CMWA 3RIBA 2KM4A 3QKYA 4GMLA 4GAAA 4I6GA 1H2TC 3PUKA 1Z3YA 3PRZA 3S7DA 3SD5A 3VLFA 2YHEA 3R7RA 4EPZA 3RU0A 2NSZA 2GGFA 4UWHA 5FTPA 4I2ZA 1W3BA 2V5FA 3Q15A 3FDHA 2I1JA 2OVBA 4GZDA 3SZ7A 3ZN3A 3CSFA 4N2QA 2VJ8A 2IQCA 2WXMA 3B7SA 3D9LA 2CG3A 3QWWA 3TAXA 3OXGA 5ANLA 5BV0A 3D9MA 3PE4A 3TGOA 5JJ6A 2XRZA 3QC1A 3FH8A 4I1AA 3FUJA 2VQ2A 4N2SA 3ML9A 5A23A 2GRMA 3JYSA 4EQFA 4G11A 4Q69A 4RSYA 2OV8A 4A3TA 3N71A 4G24A 4ILHB 3ASDA 4P29A 4OYSA 1ZU2A 2AVPA 4J8FA 3HHMA 4R7LA 5T8IA 2M63A 4PDXA 4F3VA 3UPVA 3ASFA 3APDA 5FT9A 2P58C 3GZSA 5HQ8A 2GRLA 4B89A 5CHEE 4HORA 4G25A 3CVYA 2CHZA 5BPPA 4N5CA 1E7UA 2XPYA 3Q4AB 3T5XA 5KCMA 3NZSA 4GYOA 3CEQA 3FEYA 3P1UA 3LVQE 2FI7A 1HZ4A 3NQPA 2XPZA 3FFLA 2WQHA 4I1MA 4UI9C 2IF4A 4HLEA 4XI9A 5FZQA 3FH5A 1HG2A 1NA0A 4PUCA 3CHMA 3EHMA 2WQ7A 1PAQA 4I6JA 3FTVA 3IHVA 4H7YA 3B13A 4GCOA 5JJ7A 2V4LA 4IN3B 1IQUA 5G05C 1NP7A 4HXIA 3ULQA 2YNQA 2LNIA 3UUXA 1EDUA 1Z6TA 4L1BA 4V3IA 1UJJA 3QARA 2Y3AA 3QJZA 4RVBA 1S0PA 1Y8MA 4GMJA 2AXVA 2XGMA 4MKTA 3CIAA 1WAO1 3L08A 3FUKA 3JQ0A 2GW1A 4DK5A 3CHOA 1HF8A 2AXZA 3LCAA 3RO2A 3T8MA 1TEZA 3MX3A 3FP3A 3IBEA 3L22A 2WB2A 2VGXB 3EDTB 3Q49B 1X5BA 5FZSA 1A17A 4AY5A 5FWQA 1HFAA 2NXPA 3UT8A 5BUZA 3CVXA 2KCVA 4JHJA 2WXFA 4HOQA 4B8CB 5M72A 3MCXA 3ASGA 2KCLA 3FUHA 5A6CA 2WPVA 2WM9A 2PL2A 5LOZA 3CVNA 3Q47B 3FU3A 4ANWA 1HH8A 2BF0X 3CVLA 4HOSA 4AIFA 3LYAA 3K9IA 4HS2A 5KJKA 4PH4B 1U3CA 3ZYKA 3PNTB 4L23A 2FF4A 1YA0A 1OWMA 1ELWA 4GA1A 1E8YA 3R7QA 5FJYA 2J09A 4UWLA 5AJDA 1ELRA 3ZHEA 4LRZA 3AU5A 3HIZA 5E76A 1H2VC 2YHCA 2A4ZA 1XNFA 4ACLA 4G1TA 4ME2A 2Q7FA 3QAQA 3SBTB 4A1SA 2RG8A 1IQRA 1EF1C 4OVVA 4TRQA 4Y6CA 4XZ4A 4CT4A 3GYZA 3NZUA 3MJWA 4U0SA 4BY6A 5EDSA 4OVUA 5T3RA 3JUIA 4I9CA 3SFZA 3MKQA 3UMVA 2VGXA 2IOLA 4ILIA 3VLEA 3FY4A 4GZCA 5AYWD 4I43A 5ARGA 4HFGA 3IV0A 4J0UA 4FJZA 2X38A 4GU5A 4H7XA 2KCKA 4RG9A 3RRNB 4AY6A 3U3WA 4U63A 1SZAA 2R17C 2YINA 2CHXA 3HYMB 2X6FA 3L16A 3MV3B 3SHFA 4ANVA 1WY6A 4CCAA 2L6JA 5FZRA 2HYZA 2WXHA 4FULA 3QOUA 2X6HA 2AWIA 3U66A 2X6JA 3CVPA 3FTSA 5JHBA 3S7BA 4B0ZA 4BWRA 3TG4A 4WWPA 2XCBA 3NF1A 3QK0A 4Y6WA 5FQ8A 5C1DA 5JJTA 1EPUA 4JA9A 2WXNA 3FTZA 3IHYA 4I1OB 2WMNA 1QNFA 3O4ZA 4FHKA 4W9RA 4LCTA 3FH7A 4JXTA 5DIZA 5G04C 4DLQA 3MV2B 2X3MA 4XIFA 4CGVA 3MYVA 4N3BA 1NA3A 2J07A 3FTYA 5D0OD 5BT1A 4APFA 4J8EA 3FUDA 4JA7A 1EYHA 2LSUA 3SNXA 3UQ3A 2IONA 4F7AA 4N3AA 4U04A 3U64A 2Y4TA 3AS5A 1E8XA 4BTBA 3FUNA 4CT0A 2WQ6A 2MHKA 4G2VA 4A3VA 3FUMA 2CG2A 5ANRA 4ANUA 4B94A 2VGYA 3FWVA 5J90A 3RJVA 3CHRA 3U9WA 1KLXA 1TJFA 4AV7A 4L7TA 2VSYA 2J49A 2WXOA 4LUNU 4J6IA 1HE8A 5D0QD 4XX5A 1E7VA 1HXIA 5G55A 4HOUA 2FULA 5C2YA 3ZPJA 3PVLA 4U0UA 4BFRA 1XGWA 2PZIA 4LEUA 3S7FA 2WXPA 3CK8A 2CHWA 2YQ8A 1FCHA 3KAEA 2I6HA 3Q5MA 4GZ5A 3CR3A 4UQZA 5J08A 4HVBA 4MS6A 1E8WA 3AS4A 1JUQA 4A55A 2FBNA 4G26A 4K0RA 3D9NA 4GB9A 4URKA 5G2NA 4ANXA 2IOSA 2IFUA 3FTUA 3LEWA 4DI3A 3ZFWA 2L0IA 3CV0A 3LJ3A 4AVXA 1N52A 4WNEA 1UJKA 3PEUB 3AU4A 3VLDA 2IJGX 3CVUA 3TG5A 3UT4A 4KZ0A 2VTBA 3B7TA 3P2BA 4FU3A 4G23A 3CSTA 3ESKA 2WXGA 3G2WA 3O48A 4TUUA 5KJMA 5LP0A 4U8HA 3CK9A 3CQGB 4JHKA 3CLJA 1GW6A 3I4RB 4IYPA 4D10C 4CDMA 5LFAA 2WXRA 4FA6A 4JVSA 2DCPA 3MGBA 1OWNA 3EIJA 3UT7A 1KT0A 2WXQA 1UG3A 1TJCA 2WXKA 3MA5A 1U3DA 4XE0A 5HI7A 5JHAA 3RK6A 2XHEA 3TL5A 3I4GA 4F1SA 3ZIMA 2MRIA 3PH0C 3ZGQA 1N54A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AYW D;  3SF4 A;  2XGS A;  3N71 A;  4G24 A;  5ARG A;  3ASD A;  3QWV A;  5ARF A;  4YVO A;  1ZU2 A;  2FO7 A;  4J0U A;  2AVP A;  2VYI A;  4J8F A;  4H7X A;  5G04 J;  2KCK A;  4RG9 A;  3ASF A;  1OUV A;  4F3V A;  3UPV A;  3LY7 A;  5FZS A;  4AY6 A;  5FT9 A;  4UQX A;  3S7F A;  4O6F A;  3U3W A;  2P58 C;  2UWJ G;  4JL0 A;  5HQ8 A;  3HYM B;  3MV3 B;  5CHE E;  3VTX A;  4HOR A;  4YND A;  4J8D A;  4G25 A;  3WXX A;  3RO3 A;  2L6J A;  5FZR A;  2HYZ A;  3CKB A;  5A7D B;  3QOU A;  4N5C A;  4WUY A;  4AM9 A;  1P5Q A;  3CVP A;  4GZ3 A;  3QWP A;  3S7B A;  4BWR A;  3TG4 A;  2PQN A;  3CVQ A;  2XCB A;  3NF1 A;  3Q4A B;  4Y6W A;  3S7J A;  4WND A;  2BUG A;  4BT9 A;  4GYO A;  3CEQ A;  5C1D A;  4JA9 A;  1QZ2 A;  2FI7 A;  5EX0 A;  5JJT A;  1HZ4 A;  4GPK A;  2UY1 A;  3FFL A;  2WQH A;  4GA0 A;  4U0Z A;  2IF4 A;  4UI9 C;  4I17 A;  4W9R A;  4XI9 A;  5FZQ A;  1NA0 A;  3OXL A;  5DIZ A;  5G04 C;  2UY1 B;  3MV2 B;  3KD7 A;  4BT8 A;  4XIF A;  4CGV A;  4N3B A;  1NA3 A;  4WNG A;  5CCL A;  3PE3 A;  5D0O D;  5BT1 A;  4H7Y A;  4J8E A;  2NC9 A;  4JA7 A;  3UQ3 A;  2LSU A;  4GCO A;  5JJ7 A;  4IN3 B;  4N3A A;  4U04 A;  3OXF A;  2Y4T A;  3AS5 A;  5G05 C;  1WM5 A;  3ULQ A;  4BTB A;  5BNW A;  2LNI A;  3AS8 A;  3UUX A;  4GZ6 A;  3URZ A;  2MHK A;  4G2V A;  1E96 B;  3ZHE B;  5EKQ D;  4B94 A;  2PQR A;  2VGY A;  3FWV A;  2Y4U A;  3GZ2 A;  3MEK A;  3LY9 A;  3RJV A;  1Y8M A;  3KS2 A;  1ZBP A;  1KLX A;  4N39 A;  1QQE A;  2XGM A;  1IHG A;  1WAO 1;  2VSY A;  3ASH A;  5D0Q D;  1IYG A;  3QDN A;  5BW8 C;  1HXI A;  4ABN A;  3CK7 A;  4GYW A;  3R9A B;  2GW1 A;  3GZ1 A;  2XEV A;  3MKR A;  4HOU A;  2OND A;  3LCA A;  3PDN A;  3RO2 A;  2FEZ A;  2R5S A;  4NRH B;  4U0U A;  3ZPJ A;  3E4B A;  3FP3 A;  3TAX A;  5G05 J;  4CDR A;  4KXK B;  2PZI A;  5KJN A;  4HOT A;  5DBK A;  2VGX B;  3EDT B;  3Q49 B;  4JHR A;  4LEU A;  2C0L A;  3LKU A;  1A17 A;  2YQ8 A;  3CK8 A;  1FCH A;  3BEE A;  2I6H A;  3GW4 A;  3KAE A;  3Q5M A;  4GZ5 A;  4WNF A;  4XI0 A;  4AY5 A;  2J9Q A;  2KCV A;  3LY8 A;  4I9E A;  5KJL A;  4N3C A;  3IEG A;  3AS4 A;  4RG6 A;  4HOQ A;  3RKV A;  2QFC A;  5M72 A;  4I2W A;  3ASG A;  2FBN A;  2KCL A;  2HO1 A;  4G26 A;  4UQZ A;  5A6C A;  1B89 A;  2WPV A;  2E2E A;  3LPZ A;  2PL2 A;  3CVN A;  3Q47 B;  1KT1 A;  5EX3 A;  2IFU A;  4UI9 K;  4GCN A;  1HH8 A;  1NZN A;  3CVL A;  3ZFW A;  4HOS A;  2XPI A;  2C0M A;  3CV0 A;  4AIF A;  4GA2 A;  5LCW J;  2LSV A;  4KYO B;  1PC2 A;  4WNE A;  3RIB A;  3LYA A;  3K9I A;  4U07 A;  3QKY A;  3VTY A;  5KJK A;  2FF4 A;  4GYY A;  3TG5 A;  1YA0 A;  1ELW A;  2XCC A;  4GA1 A;  3S7D A;  5FJY A;  1ELR A;  2HR2 A;  4G23 A;  3ESK A;  3ZHE A;  4YVQ C;  4CGW A;  2VSN A;  3O48 A;  5FTP A;  5HI7 A;  3RU0 A;  5KJM A;  2YHC A;  4I2Z A;  4UI9 J;  1W3B A;  3CK9 A;  2OOE A;  2V5F A;  3Q15 A;  1XNF A;  2KAT A;  4G1T A;  4ME2 A;  3ZN3 A;  2Q7F A;  3SZ7 A;  4A1S A;  5CCM A;  4N2Q A;  3U4T A;  3QWW A;  1KT0 A;  3MA5 A;  4Y6C A;  1TJC A;  2XGO A;  3GYZ A;  4U0S A;  2DBA A;  3OXG A;  3CKC A;  3PE4 A;  4NQ0 A;  4UQY A;  5JJ6 A;  4BTA A;  3TGO A;  4I1A A;  4I9C A;  4APO A;  5LCW C;  2VQ2 A;  4N2S A;  2C2L A;  2KC7 A;  3ZGQ A;  3JYS A;  4EQF A;  4KBQ A;  2VGX A;  2JLB A; 
#chains in the Genus database with same CATH topology
 1N4R A;  3CGH A;  3HXB A;  2VGE A;  5G04 J;  3DBS A;  1FVH A;  2LO6 A;  3TXN A;  4ATG A;  3RAU A;  3FTW A;  2WVI A;  3T5V A;  5A7D B;  1MX6 A;  3SO8 A;  4WUY A;  1H0A A;  5KNH D;  2BUG A;  4C0M A;  3UX4 A;  4U0Z A;  1H6O A;  2UY1 B;  3KD7 A;  2E0I A;  4JPS A;  4MBG A;  4B93 B;  3LXU X;  3HXE A;  1D8E A;  4DJA A;  3OXF A;  1WM5 A;  3E30 A;  2VTB B;  3EU9 A;  3NOG D;  4DX5 D;  3GZ2 A;  3MEK A;  2Y4U A;  1SZ9 A;  2A5U A;  4GTV A;  4GYW A;  3R9A B;  2R5S A;  3MZL B;  3ZW3 A;  4WWO A;  4CDR A;  3G2T A;  3JQ1 A;  2XZD G;  2ZU6 B;  1L5J A;  3DXK G;  3LY8 A;  2QFC A;  2HO1 A;  1B89 A;  3PZ2 A;  1HO8 A;  2WMO A;  3PS6 A;  4FHJ A;  4XEI G;  1RZ4 A;  2HR2 A;  2VSN A;  4PS8 A;  4EHM A;  3UIN C;  3U4T A;  2XGO A;  3UXG A;  3CKC A;  5ENP D;  4X8Q A;  5FIO A;  4APO A;  1JWF A;  2KC7 A;  3B7U X;  2JLB A;  3ZUV B;  2XGS A;  1DC2 A;  3Q79 A;  1DVP A;  1OUV A;  3LY7 A;  2H6G A;  3C3O A;  2I2O A;  1JCQ A;  5AQB A;  2WXI A;  2V0P A;  3ZYL A;  3G2S A;  1MHQ A;  1O1S A;  5EX0 A;  2I9C A;  2ZIS A;  2XRY A;  2V8S E;  1OCC E;  2P9I G;  3DSV A;  2F37 A;  5BV1 A;  3CHS A;  1SW6 A;  2ZGG A;  3FEX A;  5EIL A;  4BX9 A;  5HS0 A;  3KEZ A;  2AXU A;  5BW8 C;  3HDX A;  4KVO A;  2ZGD A;  4XKB A;  3GZ1 A;  2FEZ A;  3FU5 A;  4NRH B;  1N4Q A;  4OAU C;  4FC8 A;  4TXQ A;  3BQO A;  5LX8 A;  4I2W A;  4Q94 A;  1S63 A;  3APF A;  2E2E A;  3LPZ A;  1NZN A;  3I3N A;  4KYO B;  3TWQ A;  2KM4 A;  4U95 D;  3QKY A;  1H2T C;  3PUK A;  3PRZ A;  2IO2 C;  3RU0 A;  1OCR E;  4UWH A;  4I2Z A;  3C5R A;  5ENQ D;  4N2Q A;  2VJ8 A;  2WXM A;  3B7S A;  3D9L A;  2HE0 A;  2GRP B;  2BKG A;  3OXG A;  3TGO A;  1N95 A;  5ANL A;  2OEW A;  3ABL E;  4I1A A;  3FUJ A;  2VQ2 A;  3ML9 A;  2GRM A;  4LNG A;  1JCR A;  2BKK B;  3DSU A;  3GZS A;  4RQI A;  5CHE E;  3R9M A;  3CVY A;  5EN5 D;  5KCM A;  3CEQ A;  2FI7 A;  2XPZ A;  4HLE A;  3FH5 A;  1K8K G;  2WQ7 A;  1N11 A;  1V55 E;  3SFX A;  4H7Y A;  1N0Q A;  3B13 A;  3ASN E;  5JJ7 A;  1IQU A;  3Q75 A;  1NP7 A;  3QJZ A;  4U8V D;  3CIA A;  4HLL A;  1WAO 1;  4BER A;  3LCA A;  3L22 A;  2VGX B;  3EDT B;  1A17 A;  1HFA A;  5CRV A;  3UT8 A;  5BUZ A;  2KCV A;  4B8C B;  3C3R A;  5M72 A;  2KCL A;  5LOZ A;  2PL2 A;  3FU3 A;  3JXI A;  4ANW A;  2BF0 X;  2P9S G;  1Z5S C;  4HS2 A;  3PNT B;  2FF4 A;  1YA0 A;  1OWM A;  4GA1 A;  3R7Q A;  5AAR A;  2J09 A;  1ELR A;  3ZHE A;  4LRZ A;  1H2V C;  1LTX A;  4G1T A;  4ME2 A;  2Q7F A;  4OVV A;  2DYR E;  4BY6 A;  4I9C A;  2P9K G;  4DX2 A;  2IOL A;  4GZC A;  3IV0 A;  4J0U A;  4FJZ A;  2X38 A;  4RG9 A;  3UKU G;  4ANV A;  4CCA A;  4K5B A;  5FZR A;  2HYZ A;  2WXH A;  2DZN A;  3ISM C;  2AWI A;  2X6J A;  5JHB A;  3S7B A;  3FTZ A;  4I1O B;  3DSX A;  4JXT A;  5DIZ A;  4N3B A;  4YDE A;  4F7A A;  2LSU A;  3UQ3 A;  1QYM A;  3PZ1 A;  4U04 A;  4BTB A;  2ETC A;  4O1O A;  4HBD A;  4HNA D;  3FWV A;  3CHR A;  3TWR A;  2WXO A;  2J49 A;  4XX5 A;  2B6C A;  5IY5 E;  4HOU A;  2FUL A;  3PVL A;  2PZI A;  5H7P A;  4LEU A;  3Q5M A;  1FCH A;  2I6H A;  2H6F A;  4HVB A;  4TXR A;  3DPY A;  1JUQ A;  4G26 A;  1O1R A;  4K0R A;  3ASO E;  3LEW A;  4AVX A;  2LUH A;  2IJG X;  3Q78 A;  3TG5 A;  3B7T A;  4G23 A;  4FU3 A;  3CST A;  5LP0 A;  4U8H A;  3CLJ A;  1GW6 A;  3I4R B;  3Q73 A;  2MYO A;  4JVS A;  3EIJ A;  2WXQ A;  1TJC A;  2ETA A;  1QBQ A;  1DCE A;  5EYP F;  3ZNG A;  1N54 A;  3CQC B;  3NAW A;  3PZD A;  1HX8 A;  4UWG A;  4FAD A;  4KT6 B;  1Y6I A;  3D9I A;  4JZY A;  4MRU A;  3Q7F A;  4YND A;  3CKB A;  5FQ4 A;  4UUC A;  3EHN A;  2KZT A;  4EEC A;  3CVQ A;  4WND A;  1PY1 A;  4IUL A;  1E90 A;  3KSQ A;  4BX8 A;  1D8D A;  3L54 A;  2DWZ A;  3ZRH A;  4HB5 A;  3C98 A;  4HRN A;  2PM6 A;  3AS8 A;  3SI5 A;  1TYQ G;  3ZHE B;  4JD2 G;  1HS6 A;  1RW2 A;  4L2Y A;  5EYL A;  3ZYQ A;  2KBX A;  3C72 A;  2RD0 A;  3DPD A;  4PS3 A;  4AEZ C;  3ULY A;  2XEV A;  3MKR A;  2OND A;  4CZ2 D;  3SY2 A;  4K03 A;  5DBK A;  5KJN A;  4L2L A;  4JEU A;  3BG1 B;  3ENE A;  3PNL B;  1UN9 A;  3E34 A;  5D2M C;  3VTY A;  3D3M A;  3NBN B;  2VSX E;  1V54 E;  2L9B A;  3DST A;  3FHE A;  3Q9N C;  4HI8 A;  4M7C A;  1LF8 A;  3UTM A;  4L9P A;  1HU3 A;  4Q96 A;  4BTA A;  4UQY A;  4KMO A;  2BED A;  4GTR A;  5D66 A;  1K1B A;  4HI9 A;  4A1G A;  3PEV B;  5ENN A;  1JPL A;  1OY3 D;  3TJP A;  3QWP A;  3ONL A;  3S2A A;  2PQN A;  1SA5 A;  4BT9 A;  5CEC B;  4EBA A;  1UW4 B;  1TN7 A;  4FP7 A;  4BT8 A;  4AOF A;  5CMY A;  4AXH A;  2IO3 C;  1N4S A;  3SBS A;  2QY7 A;  1H2U A;  3FU0 A;  1JCS A;  2GRN B;  1VDY A;  2CFU A;  4AJW A;  3ZVV A;  5KNG A;  3LS8 A;  3AJI A;  4FLB A;  1TN8 A;  1WDY A;  3D9P A;  4N39 A;  4M3O A;  2WXL A;  3TWW A;  3B95 A;  4ABN A;  1O1T A;  4FLH A;  2AW6 A;  3D9O A;  5G05 J;  4HOT A;  3ZXP A;  4ZFH A;  2KZT B;  1MZC A;  3QNK A;  1OWP A;  1N4P A;  4I9E A;  4N3C A;  4YDW A;  2J08 A;  1Z3X A;  3CHQ A;  4OAV B;  2XPI A;  2L0T B;  2NYJ A;  3RIB A;  4GML A;  4I6G A;  2J8S D;  3R7R A;  5FTP A;  2R03 A;  4GZD A;  3CSF A;  2CG3 A;  3QWW A;  5BV0 A;  2V4H C;  5JJ6 A;  3QC1 A;  4EQF A;  3N71 A;  4G24 A;  4ILH B;  3HHM A;  5T8I A;  4F3V A;  3J5Q B;  4A63 B;  3DWL G;  2P58 C;  3W9F A;  1E7U A;  3TWX A;  3Q4A B;  3T5X A;  4GYO A;  3KSL A;  3FFL A;  4UI9 C;  2WQH A;  4XI9 A;  3CHM A;  4I6J A;  5CER B;  3E37 A;  4GCO A;  4IN3 B;  4HXI A;  1Z6T A;  1Y8M A;  4GMJ A;  2XGM A;  4MKT A;  1TR4 A;  1A5E A;  3FUK A;  2GW1 A;  2AXZ A;  1TEZ A;  4DRX E;  3ABK E;  3L82 A;  3Q49 B;  5FZS A;  2KXP C;  3LJN A;  3FUH A;  4U7E B;  3CVN A;  3ZKJ A;  4HOS A;  3V31 A;  3K9I A;  5KJK A;  5ITZ F;  4L23 A;  1ELW A;  3EUV A;  5FJY A;  4UWL A;  3HIZ A;  1XNF A;  1O5M A;  4TRQ A;  4OVU A;  1IXV A;  4RLY A;  3SFZ A;  2RFM A;  1FT1 A;  2VGX A;  3VLE A;  5ARG A;  4HFG A;  3TWV A;  2KCK A;  4QQI A;  3RRN B;  4HRL A;  2XZT G;  4U63 A;  3U3W A;  2R17 C;  3MV3 B;  3SHF A;  2R05 A;  2X6H A;  3FTS A;  4BWR A;  4WWP A;  3QK0 A;  5FQ8 A;  2WXN A;  2R02 A;  2WMN A;  2XEE A;  1S64 A;  4DX1 A;  4W9R A;  4LCT A;  3SQV A;  5G04 C;  4DLQ A;  3MV2 B;  2X3M A;  3DSW A;  2J07 A;  3FTY A;  1NI1 A;  3U64 A;  3AS5 A;  1E8X A;  2H6I A;  4ANU A;  4U8Y D;  4B94 A;  2VGY A;  3ZU7 B;  3U9W A;  3E33 A;  4LUN U;  5D0Q D;  1HE8 A;  1E7V A;  3HRA A;  1N94 A;  2A5E A;  4U0U A;  3DXM G;  3B7B A;  3S7F A;  4UQZ A;  2CHW A;  4GZ5 A;  4GPM A;  3DEO A;  3EHR A;  1E8W A;  4A55 A;  3D9N A;  4GB9 A;  4ANX A;  1BLX B;  4YDO A;  3CV0 A;  1N52 A;  4WNE A;  1D9S A;  2F8X K;  4N5Q A;  2VTB A;  2WXG A;  3O48 A;  3AG4 E;  4DX7 D;  3CK9 A;  4O1P A;  4GTT A;  2XS8 A;  4IYP A;  4CDM A;  5LFA A;  2WXR A;  2DCP A;  2P2C P;  2DVW A;  5HI7 A;  2WXK A;  1UG3 A;  2P9L G;  1U3D A;  3RK6 A;  3I4G A;  2MRI A;  3ZGQ A;  2EIN E;  1BPO A;  2FO7 A;  5AIJ A;  4O6F A;  3WG7 E;  3APC A;  4MLP A;  1P5Q A;  4AP2 A;  1LD8 A;  1MQS A;  4CRW A;  5EIB E;  3HXF A;  4DPR A;  5BXO A;  3RRU A;  3L6A A;  1X81 A;  2NC9 A;  3V30 A;  4WWN A;  5CEA A;  1OWO A;  1ZBP A;  3UIO C;  5B1B E;  5KBA A;  3AG2 E;  1DNP A;  3L13 A;  1AWC B;  2BTD A;  3LKU A;  3BEE A;  3GW4 A;  1SQM A;  4WNF A;  4IRU A;  2J9Q A;  3LDZ A;  5KJL A;  3IEG A;  3LVR E;  4JEH A;  3D9J A;  4EZK A;  3FUL A;  2IU1 A;  4C9B B;  2ZIR A;  4EBA G;  1OCO E;  4GA2 A;  4U07 A;  2LAI A;  4GYY A;  5CRU A;  2V5Q C;  3IKO B;  4ILG A;  4ATZ D;  4CGW A;  4YVQ C;  4UI9 J;  2Y0B G;  2OOE A;  4GTP A;  3QB2 A;  1INZ A;  5CCM A;  2DBA A;  4C48 B;  1TNO A;  4J8Y A;  2C2L A;  4KBQ A;  4Z68 A;  3MKQ B;  4NIK A;  2VYI A;  4UQX A;  3RO3 A;  3SGH A;  4AM9 A;  4GZ3 A;  3UIP C;  3ZYM A;  2WXJ A;  4LER A;  4DI4 A;  4GPK A;  4GA0 A;  3OTN A;  5CBN A;  4FJY A;  4PS7 A;  5CCL A;  4J7W A;  3BU8 A;  2RFA A;  4UWF A;  3ZXS A;  2EIK E;  4ACK A;  4TV3 A;  5BNW A;  4GTQ A;  2ILR A;  3HVE B;  4GZ6 A;  3URZ A;  3LY9 A;  3KS2 A;  4BSX A;  1IHG A;  2DYS E;  5EID A;  4F53 A;  3CK7 A;  1NFI E;  2EIJ E;  5FQ7 A;  2Y1L E;  3BG0 B;  3PUJ A;  3PDN A;  3E4B A;  3FUI A;  2QC9 A;  3FUE A;  4XI0 A;  4RG6 A;  2LAH A;  2HM8 A;  4F6R D;  2J4D A;  1N0R A;  1KT1 A;  4UI9 K;  3BUA A;  1TNU A;  5CMW A;  2C0M A;  4JW1 A;  4GAA A;  3S7D A;  3SD5 A;  3VLF A;  2YHE A;  1G3N B;  4EPZ A;  3EU5 A;  2NSZ A;  3UI2 A;  3Q9U C;  1W3B A;  2V5F A;  3Q15 A;  2I1J A;  1OT8 A;  3Q7A A;  2JAB A;  1FT2 A;  3D9M A;  3PE4 A;  3TWS A;  3PZ3 A;  1U2V G;  2XRZ A;  3FH8 A;  2GRQ B;  4LSZ E;  4N2S A;  4Q69 A;  3JYS A;  4RSY A;  4A3T A;  3ASD A;  1ZU2 A;  2AVP A;  4PDX A;  3UPV A;  3ASF A;  2GRL A;  4G25 A;  4JB8 P;  2AJA A;  2CHZ A;  5BPP A;  4N5C A;  2XPY A;  2XEH A;  3P1U A;  3LVQ E;  1HZ4 A;  3NQP A;  4LNB A;  2LXL A;  3UKR G;  2IF4 A;  5FZQ A;  2QYJ A;  1HG2 A;  4PUC A;  1IHB A;  3EHM A;  2QZA A;  4BEP A;  3IHV A;  1OCZ E;  3W9G A;  5HRY A;  5AQ9 A;  3UUX A;  3NOC D;  4L1B A;  4V3I A;  1UJJ A;  3QAR A;  2Y3A A;  1WG0 A;  1S0P A;  3J5P A;  2AXV A;  2F0Y A;  3CHO A;  3UM1 A;  3RO2 A;  3TWU A;  2GRO B;  4GTM A;  3FP3 A;  3IBE A;  2WB2 A;  3T9K A;  3ULE G;  2NXP A;  1BU9 A;  4JHJ A;  3KEA A;  5ENS D;  5A6C A;  2WPV A;  4GTO A;  1HH8 A;  4AIF A;  3LYA A;  1TN6 A;  4PH4 B;  2DZO A;  1U3C A;  1E8Y A;  1FPP A;  2YHC A;  5ENT D;  2A4Z A;  3L9T A;  4ACL A;  3V2O A;  3QAQ A;  3SBT B;  4A1S A;  2RG8 A;  1IQR A;  3IXE A;  4CT4 A;  1EF1 C;  4XZ4 A;  4U0S A;  3NZU A;  3MJW A;  3JUI A;  3MKQ A;  1BD8 A;  4ILI A;  2XEN A;  3FY4 A;  5AYW D;  4GU5 A;  4H7X A;  2CHX A;  3L16 A;  2L6J A;  3U66 A;  3CVP A;  4HRM B;  4B0Z A;  3TG4 A;  3NF1 A;  4Y6W A;  5JJT A;  3IHY A;  1QNF A;  3O4Z A;  4G8L A;  3FH7 A;  4CGV A;  3MYV A;  4APF A;  4J8E A;  3FUD A;  1EYH A;  2ION A;  4N3A A;  2PNN A;  2Y4T A;  2MHK A;  4G2V A;  4U96 D;  5ANR A;  2CG2 A;  4A3V A;  1TJF A;  4AV7 A;  4L7T A;  4J6I A;  3F6Q A;  5C2Y A;  3ZPJ A;  4BFR A;  2ZXW E;  1YCS B;  2WXP A;  2YQ8 A;  2P9P G;  5J08 A;  3HXC A;  2OEV A;  3SFY A;  2QYU A;  2IOS A;  2L0I A;  3LJ3 A;  1TNZ A;  1UJK A;  3VLD A;  3AU4 A;  3CVU A;  1H6P A;  3UT4 A;  3P2B A;  3G2W A;  5KJM A;  1SA4 A;  3CQG B;  3UM3 A;  4DUI A;  4D10 C;  3MA5 A;  5JHA A;  2XHE A;  3JUE A;  1KZO A;  3SF4 A;  5ARF A;  4NAC A;  3OAW A;  2MOW A;  3EJN A;  2VSO E;  3VTX A;  3CVW A;  3AG3 E;  4J8D A;  1Q2Z A;  5B1A E;  5AAO A;  3B7R L;  3L17 A;  4QFV A;  5LCW J;  3AG1 E;  1QZ2 A;  5AN8 A;  2UY1 A;  3FTX A;  4DX6 D;  5FQ6 A;  3OXL A;  4WNG A;  4CDN A;  1OXJ A;  3PE3 A;  1JWG A;  3CVV A;  3FUF A;  2OCC E;  1E96 B;  2Y69 E;  3JCK C;  5EKQ D;  2XQ0 A;  2JEK A;  1OWL A;  3ASH A;  3G2U A;  4J8S A;  2EQX A;  2X6K A;  1MYO A;  4KXK B;  4LNU D;  1K1A A;  1H6K A;  3TXM A;  3RKV A;  5E75 A;  4E85 A;  2EIM E;  4I6E A;  1ELK A;  1HG5 A;  5EX3 A;  3FU6 A;  4GCN A;  3ML8 A;  2LSV A;  2CFZ A;  1PC2 A;  3UM0 A;  3ONK A;  2XCC A;  4G8K A;  3ZEF A;  3V2X A;  1UN8 A;  2KAT A;  5AJL A;  1N9A A;  4NQ0 A;  3AAA C;  2OVF A;  5LCW C;  2EIL E;  2R59 A;  3I5P A;  3UM2 A;  1E8Z A;  4C0E A;  5B3S E;  3QWV A;  4YVO A;  4TXP A;  4E6H A;  4DLO A;  4XKC A;  4EZL A;  2UWJ G;  4JL0 A;  3WXX A;  3JXJ A;  2DIW A;  3S7J A;  2J4B A;  5FIN A;  4KVM A;  4JC8 A;  4I17 A;  5T4Y A;  1H19 A;  2P9U G;  2IEJ A;  3RRM B;  3CHP A;  1FVF A;  3EIQ C;  1YYH A;  4K5C A;  3HVE A;  1TNY A;  4UWK A;  5BXU A;  3V79 K;  2I1K A;  1AP7 A;  4CEM A;  2PM7 A;  2PQR A;  4NUR A;  4EZJ A;  1QQE A;  2XS1 A;  2X6I A;  1IYG A;  3QDN A;  4KZC A;  3G2V A;  1LD7 A;  4JHR A;  4B8A A;  2C0L A;  3PRE A;  4WAF A;  1SVX A;  3ESL A;  4BSZ B;  5CED B;  5KWD A;  5AEN A;  1UOH A;  3D9K A;  1S70 B;  3C3Q A;  1Z3Y A;  2GRR B;  1KZP A;  1NL4 A;  5ENR D;  2GGF A;  4BES A;  3FDH A;  2OVB A;  3SZ7 A;  3ZN3 A;  2IQC A;  3TAX A;  2ETB A;  1ZB1 A;  5A23 A;  4G11 A;  5JMN D;  2OV8 A;  4P29 A;  3HXD A;  4OYS A;  4J8F A;  4R7L A;  2M63 A;  2B0O E;  3APD A;  5FT9 A;  5HQ8 A;  4HOR A;  4B89 A;  3NZS A;  3FEY A;  4I1M A;  1DCQ A;  2L6B A;  2R2L A;  1NA0 A;  1PAQ A;  3FTV A;  2IY0 C;  2V4L A;  5CBO A;  5G05 C;  3ULQ A;  2YNQ A;  2LNI A;  1EDU A;  3RSE G;  4RVB A;  4GMR A;  3L08 A;  1YMP A;  3JQ0 A;  4DK5 A;  4GTS A;  1HF8 A;  3T8M A;  3MX3 A;  1X5B A;  4AY5 A;  4O60 A;  5FWQ A;  4K5A B;  3CVX A;  2WXF A;  4HOQ A;  3MCX A;  5JA4 D;  3ASG A;  5HKP A;  2WM9 A;  3Q47 B;  3CVL A;  5ENO D;  3ZYK A;  3E32 A;  1BI8 B;  4YDY A;  2FO1 E;  3EHQ A;  5AJD A;  4F1P A;  3AU5 A;  5E76 A;  3TWT A;  1MX4 A;  4Y6C A;  3GYZ A;  5EDS A;  3DRA A;  1IKN D;  4TUM A;  5T3R A;  3ABM E;  3UMV A;  4I43 A;  2LXM A;  4AY6 A;  1BI7 B;  1SZA A;  2YIN A;  3HYM B;  2X6F A;  3HG0 D;  3NB2 A;  1WY6 A;  4FUL A;  3QOU A;  2XCB A;  5C1D A;  1EPU A;  4JA9 A;  2H6H A;  3D9H A;  4FHK A;  4XIF A;  1NA3 A;  1MX2 A;  1KPS B;  5D0O D;  4CYM D;  5BT1 A;  4JA7 A;  3SNX A;  4LG6 A;  5AQA A;  3FUN A;  4CT0 A;  3X2Q E;  2WQ6 A;  3FUM A;  4ZHB A;  2RKK A;  4BET A;  5J90 A;  3T8K A;  3DEP A;  3RJV A;  1TNB A;  1KLX A;  5AQ7 A;  2VSY A;  1MJ0 A;  5G55 A;  1HXI A;  1XGW A;  2P9N G;  3PZ4 A;  3CK8 A;  3KAE A;  3CR3 A;  4MS6 A;  3AS4 A;  2FBN A;  4HQD A;  4URK A;  5G2N A;  2IFU A;  3FTU A;  4DI3 A;  3ZFW A;  3PEU B;  4KZ0 A;  3ESK A;  4TUU A;  1K3Z D;  4JHK A;  4FA6 A;  3MGB A;  1OWN A;  3UT7 A;  1KT0 A;  4XE0 A;  3DSS A;  3TL5 A;  4F1S A;  3ZIM A;  3PH0 C;  2F8Y A; 
#chains in the Genus database with same CATH homology
 3CQC B;  3SF4 A;  1BPO A;  3CGH A;  3PZD A;  1HX8 A;  5ARF A;  4UWG A;  2FO7 A;  4FAD A;  4KT6 B;  5AIJ A;  5G04 J;  3DBS A;  1FVH A;  1Y6I A;  2LO6 A;  4NAC A;  3TXN A;  4ATG A;  3OAW A;  2MOW A;  3D9I A;  3EJN A;  2VSO E;  4JZY A;  4MRU A;  4O6F A;  3VTX A;  3CVW A;  3FTW A;  2WVI A;  4J8D A;  4YND A;  3APC A;  3B7R L;  3CKB A;  3L17 A;  4MLP A;  5FQ4 A;  5A7D B;  3T5V A;  4WUY A;  3EHN A;  1P5Q A;  1H0A A;  2KZT A;  4QFV A;  4EEC A;  4AP2 A;  3CVQ A;  5LCW J;  4WND A;  2BUG A;  1QZ2 A;  1MQS A;  4CRW A;  4C0M A;  3UX4 A;  2UY1 A;  4U0Z A;  4DPR A;  1PY1 A;  3FTX A;  4IUL A;  1E90 A;  5FQ6 A;  3OXL A;  4BX8 A;  2UY1 B;  3KD7 A;  2E0I A;  4JPS A;  3RRU A;  3L54 A;  4WNG A;  3L6A A;  3LXU X;  4CDN A;  3ZRH A;  3PE3 A;  2NC9 A;  4DJA A;  1JWG A;  4WWN A;  3OXF A;  1WM5 A;  3C98 A;  3CVV A;  2PM6 A;  2VTB B;  3AS8 A;  3SI5 A;  3FUF A;  3ZHE B;  1E96 B;  3JCK C;  5EKQ D;  2XQ0 A;  1OWO A;  3GZ2 A;  1HS6 A;  2Y4U A;  3MEK A;  4L2Y A;  1SZ9 A;  3ZYQ A;  2JEK A;  1ZBP A;  1OWL A;  3DPD A;  2RD0 A;  4PS3 A;  2A5U A;  3ASH A;  3G2U A;  4AEZ C;  4J8S A;  4GYW A;  3R9A B;  2EQX A;  2XEV A;  3MKR A;  1DNP A;  2OND A;  2X6K A;  3L13 A;  2R5S A;  3MZL B;  3ZW3 A;  4WWO A;  4K03 A;  4CDR A;  3G2T A;  4KXK B;  3JQ1 A;  2BTD A;  5DBK A;  3LKU A;  5KJN A;  3BEE A;  3GW4 A;  2ZU6 B;  1L5J A;  1SQM A;  1H6K A;  4L2L A;  4JEU A;  4WNF A;  4IRU A;  2J9Q A;  3LDZ A;  3LY8 A;  3TXM A;  5KJL A;  3IEG A;  3LVR E;  3BG1 B;  5E75 A;  3RKV A;  4E85 A;  2QFC A;  4JEH A;  3D9J A;  2HO1 A;  4EZK A;  3FUL A;  1B89 A;  4I6E A;  1ELK A;  3ENE A;  3PNL B;  1HG5 A;  5EX3 A;  1UN9 A;  3FU6 A;  2IU1 A;  4C9B B;  1HO8 A;  4GCN A;  2WMO A;  4EBA G;  4GA2 A;  3ML8 A;  2LSV A;  2CFZ A;  1PC2 A;  4U07 A;  3VTY A;  3D3M A;  3ONK A;  3PS6 A;  2LAI A;  4GYY A;  2VSX E;  2XCC A;  3IKO B;  4ILG A;  4FHJ A;  2L9B A;  3FHE A;  2HR2 A;  4CGW A;  4YVQ C;  2VSN A;  4PS8 A;  4UI9 J;  3ZEF A;  1LF8 A;  2OOE A;  1UN8 A;  2KAT A;  5AJL A;  1HU3 A;  3U4T A;  3QB2 A;  1INZ A;  4Q96 A;  5CCM A;  2XGO A;  4BTA A;  2DBA A;  4NQ0 A;  3CKC A;  4UQY A;  4KMO A;  4APO A;  2OVF A;  5LCW C;  2C2L A;  1JWF A;  2KC7 A;  2R59 A;  3B7U X;  4KBQ A;  3I5P A;  2JLB A;  3MKQ B;  1E8Z A;  2XGS A;  4C0E A;  3QWV A;  4YVO A;  2VYI A;  4A1G A;  4E6H A;  3PEV B;  4DLO A;  5ENN A;  1JPL A;  1DVP A;  1OUV A;  3LY7 A;  4XKC A;  4EZL A;  4UQX A;  2UWJ G;  4JL0 A;  2I2O A;  3TJP A;  3WXX A;  3RO3 A;  2WXI A;  2V0P A;  3SGH A;  4AM9 A;  4GZ3 A;  3ZYL A;  3QWP A;  2DIW A;  3G2S A;  3ONL A;  3S2A A;  2PQN A;  3ZYM A;  3S7J A;  4BT9 A;  2J4B A;  2WXJ A;  4EBA A;  4KVM A;  4LER A;  1MHQ A;  4DI4 A;  5EX0 A;  2I9C A;  1UW4 B;  4GPK A;  4GA0 A;  4JC8 A;  4I17 A;  5T4Y A;  4FP7 A;  4BT8 A;  1H19 A;  2XRY A;  3OTN A;  4AOF A;  5CMY A;  4AXH A;  3RRM B;  4FJY A;  3CHP A;  1FVF A;  2V8S E;  3SBS A;  2QY7 A;  4PS7 A;  5CCL A;  1H2U A;  3EIQ C;  4UWF A;  3ZXS A;  3FU0 A;  4TV3 A;  4ACK A;  3HVE A;  4UWK A;  1VDY A;  2I1K A;  5BV1 A;  5BNW A;  2CFU A;  4AJW A;  3CHS A;  2ILR A;  3HVE B;  4GZ6 A;  3ZVV A;  3URZ A;  3LS8 A;  4CEM A;  2PM7 A;  2PQR A;  3FEX A;  4NUR A;  4EZJ A;  3LY9 A;  4BX9 A;  4FLB A;  3KS2 A;  4BSX A;  3D9P A;  4N39 A;  4M3O A;  2WXL A;  1QQE A;  3KEZ A;  1IHG A;  2X6I A;  2AXU A;  3QDN A;  1IYG A;  4F53 A;  5BW8 C;  3HDX A;  4ABN A;  3CK7 A;  4KZC A;  4KVO A;  4FLH A;  4XKB A;  3GZ1 A;  5FQ7 A;  2AW6 A;  3BG0 B;  3PUJ A;  3PDN A;  3G2V A;  2FEZ A;  3D9O A;  3FU5 A;  4NRH B;  3E4B A;  5G05 J;  4HOT A;  4FC8 A;  2KZT B;  4JHR A;  4B8A A;  2C0L A;  3FUI A;  3PRE A;  3QNK A;  4WAF A;  1OWP A;  3FUE A;  4XI0 A;  4I9E A;  4N3C A;  5LX8 A;  4RG6 A;  3ESL A;  2LAH A;  2HM8 A;  4I2W A;  2J08 A;  1Z3X A;  4Q94 A;  3APF A;  2J4D A;  2E2E A;  3LPZ A;  1KT1 A;  5AEN A;  4UI9 K;  3CHQ A;  1NZN A;  2XPI A;  2C0M A;  3D9K A;  4JW1 A;  2L0T B;  3I3N A;  4KYO B;  5CMW A;  3RIB A;  2KM4 A;  3QKY A;  4GML A;  4GAA A;  4I6G A;  1H2T C;  3PUK A;  1Z3Y A;  3PRZ A;  3S7D A;  3SD5 A;  3VLF A;  2YHE A;  3R7R A;  4EPZ A;  3RU0 A;  2NSZ A;  2GGF A;  4UWH A;  5FTP A;  4I2Z A;  1W3B A;  2V5F A;  3Q15 A;  3FDH A;  2I1J A;  2OVB A;  4GZD A;  3SZ7 A;  3ZN3 A;  3CSF A;  4N2Q A;  2VJ8 A;  2IQC A;  2WXM A;  3B7S A;  3D9L A;  2CG3 A;  3QWW A;  3TAX A;  3OXG A;  5ANL A;  5BV0 A;  3D9M A;  3PE4 A;  3TGO A;  5JJ6 A;  2XRZ A;  3QC1 A;  3FH8 A;  4I1A A;  3FUJ A;  2VQ2 A;  4N2S A;  3ML9 A;  5A23 A;  2GRM A;  3JYS A;  4EQF A;  4G11 A;  4Q69 A;  4RSY A;  2OV8 A;  4A3T A;  3N71 A;  4G24 A;  4ILH B;  3ASD A;  4P29 A;  4OYS A;  1ZU2 A;  2AVP A;  4J8F A;  3HHM A;  4R7L A;  5T8I A;  2M63 A;  4PDX A;  4F3V A;  3UPV A;  3ASF A;  3APD A;  5FT9 A;  2P58 C;  3GZS A;  5HQ8 A;  2GRL A;  4B89 A;  5CHE E;  4HOR A;  4G25 A;  3CVY A;  2CHZ A;  5BPP A;  4N5C A;  1E7U A;  2XPY A;  3Q4A B;  3T5X A;  5KCM A;  3NZS A;  4GYO A;  3CEQ A;  3FEY A;  3P1U A;  3LVQ E;  2FI7 A;  1HZ4 A;  3NQP A;  2XPZ A;  3FFL A;  2WQH A;  4I1M A;  4UI9 C;  2IF4 A;  4HLE A;  4XI9 A;  5FZQ A;  3FH5 A;  1HG2 A;  1NA0 A;  4PUC A;  3CHM A;  3EHM A;  2WQ7 A;  1PAQ A;  4I6J A;  3FTV A;  3IHV A;  4H7Y A;  3B13 A;  4GCO A;  5JJ7 A;  2V4L A;  4IN3 B;  1IQU A;  5G05 C;  1NP7 A;  4HXI A;  3ULQ A;  2YNQ A;  2LNI A;  3UUX A;  1EDU A;  1Z6T A;  4L1B A;  4V3I A;  1UJJ A;  3QAR A;  2Y3A A;  3QJZ A;  4RVB A;  1S0P A;  1Y8M A;  4GMJ A;  2AXV A;  2XGM A;  4MKT A;  3CIA A;  1WAO 1;  3L08 A;  3FUK A;  3JQ0 A;  2GW1 A;  4DK5 A;  3CHO A;  1HF8 A;  2AXZ A;  3LCA A;  3RO2 A;  3T8M A;  1TEZ A;  3MX3 A;  3FP3 A;  3IBE A;  3L22 A;  2WB2 A;  2VGX B;  3EDT B;  3Q49 B;  1X5B A;  5FZS A;  1A17 A;  4AY5 A;  5FWQ A;  1HFA A;  2NXP A;  3UT8 A;  5BUZ A;  3CVX A;  2KCV A;  4JHJ A;  2WXF A;  4HOQ A;  4B8C B;  5M72 A;  3MCX A;  3ASG A;  2KCL A;  3FUH A;  5A6C A;  2WPV A;  2WM9 A;  2PL2 A;  5LOZ A;  3CVN A;  3Q47 B;  3FU3 A;  4ANW A;  1HH8 A;  2BF0 X;  3CVL A;  4HOS A;  4AIF A;  3LYA A;  3K9I A;  4HS2 A;  5KJK A;  4PH4 B;  1U3C A;  3ZYK A;  3PNT B;  4L23 A;  2FF4 A;  1YA0 A;  1OWM A;  1ELW A;  4GA1 A;  1E8Y A;  3R7Q A;  5FJY A;  2J09 A;  4UWL A;  5AJD A;  1ELR A;  3ZHE A;  4LRZ A;  3AU5 A;  3HIZ A;  5E76 A;  1H2V C;  2YHC A;  2A4Z A;  1XNF A;  4ACL A;  4G1T A;  4ME2 A;  2Q7F A;  3QAQ A;  3SBT B;  4A1S A;  2RG8 A;  1IQR A;  1EF1 C;  4OVV A;  4TRQ A;  4Y6C A;  4XZ4 A;  4CT4 A;  3GYZ A;  3NZU A;  3MJW A;  4U0S A;  4BY6 A;  5EDS A;  4OVU A;  5T3R A;  3JUI A;  4I9C A;  3SFZ A;  3MKQ A;  3UMV A;  2VGX A;  2IOL A;  4ILI A;  3VLE A;  3FY4 A;  4GZC A;  5AYW D;  4I43 A;  5ARG A;  4HFG A;  3IV0 A;  4J0U A;  4FJZ A;  2X38 A;  4GU5 A;  4H7X A;  2KCK A;  4RG9 A;  3RRN B;  4AY6 A;  3U3W A;  4U63 A;  1SZA A;  2R17 C;  2YIN A;  2CHX A;  3HYM B;  2X6F A;  3L16 A;  3MV3 B;  3SHF A;  4ANV A;  1WY6 A;  4CCA A;  2L6J A;  5FZR A;  2HYZ A;  2WXH A;  4FUL A;  3QOU A;  2X6H A;  2AWI A;  3U66 A;  2X6J A;  3CVP A;  3FTS A;  5JHB A;  3S7B A;  4B0Z A;  4BWR A;  3TG4 A;  4WWP A;  2XCB A;  3NF1 A;  3QK0 A;  4Y6W A;  5FQ8 A;  5C1D A;  5JJT A;  1EPU A;  4JA9 A;  2WXN A;  3FTZ A;  3IHY A;  4I1O B;  2WMN A;  1QNF A;  3O4Z A;  4FHK A;  4W9R A;  4LCT A;  3FH7 A;  4JXT A;  5DIZ A;  5G04 C;  4DLQ A;  3MV2 B;  2X3M A;  4XIF A;  4CGV A;  3MYV A;  4N3B A;  1NA3 A;  2J07 A;  3FTY A;  5D0O D;  5BT1 A;  4APF A;  4J8E A;  3FUD A;  4JA7 A;  1EYH A;  2LSU A;  3SNX A;  3UQ3 A;  2ION A;  4F7A A;  4N3A A;  4U04 A;  3U64 A;  2Y4T A;  3AS5 A;  1E8X A;  4BTB A;  3FUN A;  4CT0 A;  2WQ6 A;  2MHK A;  4G2V A;  4A3V A;  3FUM A;  2CG2 A;  5ANR A;  4ANU A;  4B94 A;  2VGY A;  3FWV A;  5J90 A;  3RJV A;  3CHR A;  3U9W A;  1KLX A;  1TJF A;  4AV7 A;  4L7T A;  2VSY A;  2J49 A;  2WXO A;  4LUN U;  4J6I A;  1HE8 A;  5D0Q D;  4XX5 A;  1E7V A;  1HXI A;  5G55 A;  4HOU A;  2FUL A;  5C2Y A;  3ZPJ A;  3PVL A;  4U0U A;  4BFR A;  1XGW A;  2PZI A;  4LEU A;  3S7F A;  2WXP A;  3CK8 A;  2CHW A;  2YQ8 A;  1FCH A;  3KAE A;  2I6H A;  3Q5M A;  4GZ5 A;  3CR3 A;  4UQZ A;  5J08 A;  4HVB A;  4MS6 A;  1E8W A;  3AS4 A;  1JUQ A;  4A55 A;  2FBN A;  4G26 A;  4K0R A;  3D9N A;  4GB9 A;  4URK A;  5G2N A;  4ANX A;  2IOS A;  2IFU A;  3FTU A;  3LEW A;  4DI3 A;  3ZFW A;  2L0I A;  3CV0 A;  3LJ3 A;  4AVX A;  1N52 A;  4WNE A;  1UJK A;  3PEU B;  3AU4 A;  3VLD A;  2IJG X;  3CVU A;  3TG5 A;  3UT4 A;  4KZ0 A;  2VTB A;  3B7T A;  3P2B A;  4FU3 A;  4G23 A;  3CST A;  3ESK A;  2WXG A;  3G2W A;  3O48 A;  4TUU A;  5KJM A;  5LP0 A;  4U8H A;  3CK9 A;  3CQG B;  4JHK A;  3CLJ A;  1GW6 A;  3I4R B;  4IYP A;  4D10 C;  4CDM A;  5LFA A;  2WXR A;  4FA6 A;  4JVS A;  2DCP A;  3MGB A;  1OWN A;  3EIJ A;  3UT7 A;  1KT0 A;  2WXQ A;  1UG3 A;  1TJC A;  2WXK A;  3MA5 A;  1U3D A;  4XE0 A;  5HI7 A;  5JHA A;  3RK6 A;  2XHE A;  3TL5 A;  3I4G A;  4F1S A;  3ZIM A;  2MRI A;  3PH0 C;  3ZGQ A;  1N54 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...