4UI9K

Atomic structure of the human anaphase-promoting complex
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
493
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHKSCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
total genus 178
structure length 493
sequence length 526
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
K PF13176 TPR_7 Tetratricopeptide repeat
K PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9K00
2C2LA 5DIZA 3BEEA 4BT9A 3CEQA 2XGMA 4G26A 2UY1B 4H7XA 1QZ2A 2L6JA 3CVNA 1TJCA 4U0UA 3ASHA 2UWJG 4UI9C 3URZA 2GW1A 4ME2A 2LSVA 4UQYA 2HR2A 2LNIA 2FF4A 2VGXA 4I2WA 5G04C 4I2ZA 3ESKA 2VSYA 3CV0A 5LCWJ 2JLBA 2HYZA 3QDNA 2KC7A 5HI7A 4U04A 4GYWA 1IHGA 1OUVA 5EKQD 5BT1A 3TAXA 4B94A 1E96B 1KT0A 3TGOA 4RG9A 4BWRA 5DBKA 4LEUA 2PQNA 4BTAA 4HOQA 2MHKA 5M72A 3TG4A 2Q7FA 4N2QA 4G24A 4W9RA 4J8DA 4GZ5A 1NZNA 3CVQA 2VYIA 3OXLA 4F3VA 2LSUA 5G05C 3S7DA 4HOUA 2Y4UA 4N39A 5JJ6A 3RJVA 5FZQA 2XPIA 2FBNA 4GYOA 4XIFA 4GYYA 4Y6WA 4YNDA 3SZ7A 5A6CA 2FI7A 3ASDA 2R5SA 1HH8A 3S7FA 4HOSA 4CDRA 1IYGA 4U0SA 3ZN3A 3CK8A 2J9QA 3AS8A 1KT1A 5AYWD 3GZ1A 4YVOA 2C0MA 2XCBA 2XEVA 2PL2A 3E4BA 4CGVA 2I6HA 1WAO1 2PZIA 4WNFA 4UI9K 5BW8C 3LCAA 3IEGA 4AIFA 2UY1A 3PE3A 4BT8A 1ZU2A 3R9AB 2VQ2A 2FEZA 4I9EA 3QWWA 4NRHB 3OXFA 3CK9A 3RIBA 3CKCA 1PC2A 1NA3A 1FCHA 5JJ7A 4YVQC 2AVPA 4O6FA 5BNWA 3RO3A 2VSNA 3QKYA 4UI9J 1HZ4A 3Q4AB 3ASFA 3GW4A 3EDTB 1ELRA 3LY9A 2KATA 3GYZA 1B89A 5ARFA 5G04J 4N3BA 4BTBA 3NF1A 3ZGQA 4UQXA 5KJNA 5CCMA 5CCLA 2PQRA 4KYOB 3UQ3A 3QWPA 3JYSA 4AM9A 3ZPJA 3Q49B 1HXIA 3FWVA 2YQ8A 4GPKA 4AY5A 4WUYA 4J0UA 3ULQA 2E2EA 3AS4A 2DBAA 3SF4A 4GZ6A 3QWVA 1KLXA 3GZ2A 4J8FA 4JL0A 4G2VA 1XNFA 4GCOA 2WQHA 1QQEA 4I9CA 3Q15A 3LPZA 2BUGA 3MEKA 3CK7A 3FP3A 4HOTA 4HORA 5D0OD 5CHEE 3CVPA 2Y4TA 5EX3A 5G05J 3RO2A 5LCWC 2FO7A 3O48A 1W3BA 4IN3B 3WXXA 5C1DA 3PE4A 5HQ8A 4A1SA 4GA2A 2VGYA 2IF4A 2KCVA 4N2SA 4KBQA 4NQ0A 1P5QA 5FJYA 2P58C 3KAEA 5JJTA 4U0ZA 5KJLA 1WM5A 3VTYA 4JA9A 2VGXB 4WNDA 3N71A 3Q5MA 2NC9A 2XGOA 4CGWA 2XGSA 3OXGA 4G25A 4I17A 4I1AA 5FTPA 3LY7A 5D0QD 4N5CA 3VTXA 3KS2A 5KJKA 3CVLA 3MA5A 5FZSA 1ZBPA 4GA1A 3ZFWA 3AS5A 3PDNA 2ONDA 3FFLA 2OOEA 2KCKA 1YA0A 4JA7A 4UQZA 4JHRA 1NA0A 4XI9A 1A17A 4WNGA 4ABNA 3U4TA 5ARGA 5FT9A 3QOUA 2KCLA 5KJMA 2C0LA 4GA0A 3KD7A 2XCCA 5EX0A 2V5FA 4WNEA 4AY6A 3TG5A 3HYMB 2QFCA 1Y8MA 5A7DB 3RU0A 3LY8A 3MV3B 2IFUA 5FZRA 4APOA 3S7JA 1ELWA 4GCNA 4N3AA 3LYAA 4G1TA 4U07A 3U3WA 3S7BA 4J8EA 3CKBA 3MV2B 4H7YA 3Q47B 4RG6A 3UUXA 3RKVA 4G23A 3UPVA 3LKUA 4XI0A 3MKRA 4N3CA 4GZ3A 3ASGA 2YHCA 4EQFA 2WPVA 3ZHEB 2HO1A 4KXKB 3K9IA 3ZHEA 4Y6CA
chains in the Genus database with same CATH superfamily
2DWZA 3BEEA 4BT9A 2F0YA 5HKPA 3TJPA 5IY5E 2JEKA 4I43A 2XGMA 3ZW3A 3NAWA 4E85A 4U0UA 3EHMA 4KT6B 3UT7A 1TNYA 2LNIA 5G04C 1DNPA 4FHJA 4I2ZA 5EN5D 3ZUVB 3ESKA 1PY1A 3QNKA 5B3SE 1HS6A 2JLBA 3CVXA 3AG1E 2J07A 4M7CA 2R59A 1EYHA 4GTMA 2DIWA 1QNFA 3CHMA 3L22A 4F7AA 3D9HA 4LEUA 2PQNA 4HXIA 4JHJA 5AIJA 1NP7A 4HOQA 2MHKA 3C98A 4XX5A 3SD5A 2CHZA 2XHEA 1Q2ZA 2IY0C 3CSFA 3MX3A 1K8KG 5FQ8A 2OEWA 3RRMB 3FUFA 3HDXA 3OXLA 1MJ0A 4K5AB 4FLBA 4HFGA 5KNGA 4BFRA 1LTXA 4EZKA 3APCA 4ATGA 3E34A 2KBXA 3S7DA 2KXPC 4HOUA 4BERA 1KZPA 4KVOA 2IO2C 1L5JA 2FO1E 1S63A 5FZQA 4XKBA 4GYYA 4XIFA 4JPSA 2GRQB 4WWNA 5A6CA 4GB9A 3ASDA 3E37A 1OXJA 1HH8A 4LSZE 3NOCD 5EYLA 4HLEA 4BSXA 4CDRA 4U0SA 3ZN3A 2J9QA 1E8YA 2IO3C 3GZ1A 4YVOA 2XCBA 1U2VG 4O1OA 1HO8A 4DJAA 4ANVA 4PH4B 2I6HA 1TNZA 4WNFA 2CHXA 4GTOA 4UWGA 4ZHBA 3CVVA 3UT8A 5ENNA 4U63A 1O1TA 4XZ4A 2KM4A 4HQDA 2LXMA 1BD8A 2HM8A 4Z68A 1NL4A 2AJAA 3DEOA 3ZRHA 2B6CA 3W9FA 1NFIE 1ZU2A 4GU5A 1DCQA 4GAAA 5AAOA 1G3NB 3CQGB 3TWXA 3G2SA 2VQ2A 2E0IA 1YYHA 3CSTA 3F6QA 2WXHA 5JHAA 2LXLA 4APFA 3OXFA 3CK9A 3T5XA 5E76A 4ANXA 3TWUA 4MKTA 1FCHA 5JJ7A 3D9PA 2AVPA 3EHRA 3FY4A 3FU0A 1X5BA 1Z6TA 2IJGX 4FU3A 1OY3D 2XENA 4L1BA 4TRQA 3QKYA 5ENQD 4DX5D 3T8KA 3TWTA 3SFZA 4P29A 1ELRA 2KATA 3TXMA 1U3DA 4WWPA 2P9IG 5G04J 1K1AA 4PDXA 2QZAA 2P9LG 1JUQA 3I3NA 3UQ3A 4BSZB 5BXOA 2GRMA 5CBOA 3JYSA 3PZ1A 4EBAA 2LAIA 3MJWA 3MZLB 4TXPA 5EIBE 5FQ6A 3HVEB 3SF4A 2V5QC 1KLXA 3GZ2A 4J8FA 4JL0A 4G2VA 3DPYA 2VSOE 2BUGA 2WXQA 3MEKA 2X6IA 5CMWA 2GRPB 3CVPA 2Y4TA 4A55A 4BY6A 4GTQA 2EIKE 4L23A 3HIZA 3UT4A 2Y1LE 1E8WA 1N11A 4CYMD 3FEXA 3PE4A 1E90A 2Y69E 4U8HA 1TNOA 4GZCA 1N4RA 4TV3A 3FTXA 1H6PA 1JPLA 4GMRA 2BF0X 3T5VA 4YDYA 1P5QA 4DI4A 5JJTA 1D9SA 5KJLA 3B7TA 3FTYA 1N52A 4JA9A 3U9WA 3C3OA 4B8CB 4Q69A 4F6RD 4I1AA 3ZIMA 4N5CA 3KS2A 5KJKA 4GZDA 4I1OB 3MA5A 1ZBPA 3UKRG 4K03A 5T3RA 3D9JA 3LVRE 2X6JA 4JHRA 1K1BA 2R17C 1NI1A 1NA0A 3FH8A 3UMVA 5J08A 2RFAA 4TXRA 2WXPA 3X2QE 2KCLA 2LO6A 4YDWA 3JXJA 3O4ZA 3KD7A 3PVLA 3G2VA 4WNEA 3HXDA 3QB2A 4U95D 2BEDA 3MGBA 3UINC 1UJKA 2QFCA 1Y8MA 2PM6A 3RU0A 2IFUA 3FH5A 3IKOB 3BG0B 5T4YA 3FTVA 4GCNA 4G1TA 4PUCA 4LNBA 3ONLA 3CKBA 5CBNA 3ENEA 3HVEA 4HLLA 1SQMA 4X8QA 3FUKA 3PZ4A 3UUXA 1V54E 2ZGDA 1H0AA 4XI0A 2OV8A 3ZYQA 4KZ0A 4GTVA 3OAWA 3PZDA 1UG3A 1TEZA 3DRAA 3ASGA 4PS3A 4GTTA 5CEAA 3ZEFA 4XE0A 2GRRB 2HO1A 4KXKB 2CFZA 3HRAA 4HBDA 4J8YA 3I4RB 4DX1A 5FWQA 3SI5A 2J08A 2P9PG 5ITZF 3CEQA 1QZ2A 3CVNA 3Q78A 4GTSA 3URZA 3OTNA 4ME2A 2LSVA 4UQYA 2HR2A 5CECB 2RG8A 2VSYA 1O1SA 1IXVA 4ACLA 3DWLG 1N54A 3KEZA 4GYWA 1Z3YA 1OUVA 2I2OA 5EKQD 4B94A 1E96B 3TGOA 4BWRA 4O60A 3IHYA 5H7PA 3SFXA 3G2WA 1Y6IA 1FVHA 2IOLA 2P9KG 5BV1A 2XS8A 3D3MA 4UWFA 5M72A 2Q7FA 5ENRD 1N4PA 3AU5A 3UIPC 1FPPA 4J8SA 3FDHA 5JJ6A 5ENOD 4CT0A 3CHQA 1IQUA 2FBNA 3QK0A 4GYOA 3CGHA 3R7RA 3SZ7A 2QYJA 2R5SA 4QFVA 2I9CA 1IYGA 3MYVA 3HG0D 2XQ0A 2XPYA 2R02A 5AYWD 2XRZA 3TWWA 1H6KA 2DYRE 3L16A 2H6HA 2C0MA 1H2TC 2XEVA 2PL2A 4GTPA 4CGVA 1E8XA 1WAO1 2PZIA 4CZ2D 4HI9A 5BW8C 3DSSA 3UM1A 3IEGA 2IQCA 4DK5A 1OWPA 3PE3A 1FT1A 4IRUA 5AENA 1MX2A 4DX7D 3L6AA 1SW6A 3RAUA 5AJDA 1BI8B 1JCQA 3TWRA 3JQ1A 4DLOA 3R9MA 3P2BA 2PM7A 3RIBA 3UI2A 4YDOA 2WMNA 3D9IA 4ANUA 4KMOA 4CRWA 1U3CA 4O6FA 5BNWA 1KZOA 3QC1A 3TWVA 1HZ4A 3TL5A 2EILE 3ASFA 3GW4A 3EDTB 2J09A 3LY9A 4BTBA 1ZB1A 4URKA 3AAAC 1E7UA 3CHSA 3DSVA 3UX4A 3ABKE 5KBAA 4ZFHA 4LERA 2OEVA 5ENSD 5AN8A 4GPKA 1LF8A 2E2EA 3G2UA 2L6BA 1E8ZA 4GZ6A 3ISMC 1MYOA 2R03A 2WXOA 3L54A 3DSXA 4GMJA 4OVUA 3CK7A 5FIOA 3FP3A 5D0OD 3P1UA 2A4ZA 2V4HC 3UM0A 4XKCA 4KVMA 4IULA 5LCWC 3PNLB 1W3BA 1EF1C 5A23A 2M63A 1S0PA 3ML9A 5FQ7A 4AP2A 4AJWA 4N2SA 4NQ0A 2QC9A 3FHEA 2ZISA 3CVUA 3KAEA 4U0ZA 2H6IA 3Q9NC 3ESLA 3EHNA 2WB2A 3CQCB 3N71A 3Q5MA 3C3RA 3VLFA 3PUKA 4CGWA 3OXGA 3W9GA 4FJYA 4I17A 3UXGA 2GGFA 4WWOA 2X6KA 3ONKA 3UTMA 4OVVA 4FP7A 2MOWA 4AXHA 2RKKA 5FZSA 5T8IA 1BPOA 2L0TB 3LEWA 2V0PA 2KCKA 1YA0A 4UQZA 3D9LA 4XI9A 1A17A 1MX4A 3U4TA 5ARGA 4LCTA 4JEHA 2C0LA 4GA0A 3Q73A 3HXEA 5EX0A 2KZTB 4XEIG 4D10C 4TUUA 3I4GA 3HYMB 5JHBA 5FQ4A 3SBSA 3C5RA 3LY8A 2AWIA 3NOGD 3B7UX 4G11A 4CDNA 2WVIA 2NXPA 3LYAA 3VLEA 4ANWA 3ASNE 1TR4A 3ULYA 2WXIA 1JCSA 3GZSA 3JUIA 5J90A 5BV0A 3LKUA 1N9AA 3MKRA 1OWOA 4GPMA 4UWHA 4GZ3A 4F1SA 4ILGA 1QBQA 2WPVA 3IXEA 1JCRA 2R05A 3D9MA 4Y6CA 1BU9A 2C2LA 5DIZA 4Q96A 5BXUA 3EU9A 4EHMA 2NYJA 2UY1B 4H7XA 4AVXA 2L6JA 2AXUA 2EIME 1TJCA 3ASHA 3IV0A 3CIAA 2UWJG 3L08A 1DVPA 3ABLE 4UI9C 2B0OE 2GW1A 1UOHA 3BU8A 3UKUG 5E75A 2VJ8A 1N0RA 2FF4A 2ETAA 2CHWA 2ZXWE 4HVBA 3NB2A 3CV0A 5LCWJ 3RSEG 4ILHB 3JUEA 3QDNA 2XEHA 4FJZA 1RW2A 4DX6D 2V8SE 4RG9A 3FUMA 3FTSA 4FLHA 4U96D 4BTAA 1HG2A 1DC2A 5BUZA 3TG4A 3Q7FA 4N2QA 1N94A 2H6GA 3J5QB 1N4SA 4L2YA 4J8DA 1WY6A 3EU5A 1SZ9A 2KZTA 1NZNA 3CVQA 1DCEA 3Q9UC 2LSUA 3CHOA 2A5EA 3SGHA 3V31A 4BX9A 2BKGA 3BQOA 3EUVA 4R7LA 4B89A 3ZKJA 1GW6A 4N39A 4U7EB 1TN6A 3FU5A 4WAFA 3UM3A 1YCSB 1UW4B 3SO8A 2FI7A 4E6HA 1WDYA 2WXFA 4DUIA 2MYOA 4RVBA 4HOSA 4YDEA 3V2OA 4A63B 1UN8A 2IOSA 2XZTG 1N0QA 4DX2A 1LD7A 3FTUA 2Y3AA 4IYPA 1OCZE 2IONA 3DSUA 2XEEA 4UI9K 1SA5A 4I6EA 3LCAA 1S64A 3LXUX 3ZXPA 3SBTB 2UY1A 4CCAA 4BESA 4BT8A 2DCPA 2WXRA 4L7TA 4K0RA 4LNUD 5FINA 1OWLA 2J4BA 1ELKA 3UIOC 2FEZA 3CVWA 3QWWA 4I6JA 2CFUA 1FVFA 1OCOE 1PC2A 3R7QA 3EJNA 2WXJA 4ATZD 1OWNA 3CHPA 3RO3A 4K5CA 2VSNA 3AJIA 4QQIA 3ZXSA 4RLYA 4UI9J 3AG3E 4J7WA 3GYZA 5ARFA 4KZCA 4DRXE 3LJ3A 4N3BA 3KEAA 3NF1A 4A1GA 3ZGQA 3PS6A 4UQXA 2IU1A 5KJNA 3L82A 1QYMA 3PH0C 5CCLA 3QWPA 4AM9A 1HXIA 4DPRA 1HU3A 3MCXA 4FA6A 4AY5A 2PNNA 1UN9A 2EQXA 3PZ2A 2DBAA 1TNBA 4EPZA 3E30A 2ETBA 2I1KA 3QWVA 3ZYLA 1TYQG 1XNFA 2AXZA 2WMOA 2ILRA 3B7BA 4GCOA 1HX8A 2WQHA 2BKKB 4I9CA 3ABME 3D9NA 3Q15A 4BEPA 2NSZA 3FU6A 3SQVA 4JD2G 2YHEA 3U64A 4LRZA 3Q79A 3L17A 3RO2A 3BG1B 3KSLA 4IN3B 4G8KA 5CMYA 3WXXA 3DSWA 1D8EA 5C1DA 4UUCA 2AXVA 4Q94A 3S2AA 3L13A 4O1PA 3B7RL 5G55A 1WM5A 3LDZA 2VGXB 2P9UG 5ENPD 4FHKA 3J5PA 1OCCE 3DXMG 4G25A 5FTPA 3LY7A 1H2VC 2OVBA 3VTXA 5LX8A 2X6HA 2WXLA 3MKQB 4GA1A 3ZFWA 4NIKA 1EDUA 3AS5A 2ONDA 3PZ3A 3FFLA 2H6FA 3QAQA 2OOEA 4JA7A 3NBNB 4WNGA 4AV7A 1JWFA 3B13A 3QOUA 5KJMA 4I1MA 4LUNU 3TXNA 4HRNA 4LG6A 4AY6A 5AQ7A 3TG5A 4EZLA 3T9KA 3LS8A 5A7DB 4JHKA 3ZYMA 1UJJA 2A5UA 3S7JA 1HF8A 3Q75A 1ELWA 3FUJA 2QYUA 4N3AA 4U07A 3U3WA 3IBEA 1PAQA 4OAUC 2Y0BG 4J8EA 3MV2B 5KWDA 1JWGA 3FUEA 4H7YA 3Q47B 1OCRE 3DEPA 4RG6A 3SY2A 1BLXB 1INZA 4K5BA 2ETCA 3DSTA 4N3CA 4F53A 2CG2A 3U66A 3V30A 3E32A 3RRUA 3CVYA 4B93B 4EQFA 2F37A 2X38A 3EHQA 3PNTB 3BUAA 4G8LA 3B7SA 3ZNGA 2DZOA 3HXBA 3NQPA 3PEVB 3ZHEA 4PS8A 5D66A 4U8VD 2RD0A 3FU3A 4G26A 4ILIA 1IHBA 1N4QA 2XS1A 4EBAG 1BI7B 4CEMA 1YMPA 2WM9A 1S70B 1HFAA 2VGXA 1FT2A 4I2WA 5ANLA 2CG3A 5KCMA 1AWCB 2JABA 3FUNA 3FEYA 5JA4D 2HYZA 4JVSA 2WXNA 2KC7A 2BTDA 5HI7A 4U04A 4OYSA 3PUJA 1IHGA 5EIDA 5BT1A 3FTZA 5LOZA 3TAXA 3MKQA 1KT0A 4JZYA 2FULA 3D9OA 5DBKA 1KPSB 1AP7A 2WXGA 5AJLA 2GRLA 3TWQA 4I6GA 3ML8A 1SVXA 3WG7E 2XPZA 2ZIRA 4G24A 4W9RA 5AQ9A 4FADA 2RFMA 2DYSE 4GZ5A 2F8YA 4F1PA 2V4LA 2VYIA 3HXCA 2WXKA 4F3VA 5G05C 1SA4A 5ENTD 4MBGA 2Y4UA 3ZYKA 3ZU7B 2YNQA 5B1BE 1TNUA 1Z5SC 3RRNB 3RJVA 5JMND 3TWSA 2XPIA 4NURA 5CRUA 4Y6WA 3D9KA 4YNDA 5EYPF 4AEZC 3S7FA 1H19A 3T8MA 3APFA 3CK8A 3AS8A 4RSYA 3AG2E 3FUDA 3PEUB 1KT1A 4FULA 4HRLA 2J8SD 2LAHA 4NACA 3E4BA 1X81A 3ZVVA 4B0ZA 4J6IA 3RK6A 3CLJA 3NZUA 4TUMA 5AQAA 4AIFA 2DVWA 2AW6A 2GRNB 2ZGGA 4LNGA 4DI3A 4UWKA 1MQSA 3R9AB 4JB8P 2WXMA 1XGWA 5ANRA 4ACKA 1SZAA 3Q7AA 4JW1A 1TJFA 4C0MA 4I9EA 5BPPA 4UWLA 3FULA 3V79K 3FUIA 4HS2A 4NRHB 4OAVB 4CT4A 3CKCA 3ULEG 1RZ4A 1NA3A 4YVQC 4C48B 2XRYA 4N5QA 3E33A 2WQ6A 2J4DA 4BX8A 3DXKG 1D8DA 3FH7A 3Q4AB 1B89A 1Z3XA 3SFYA 3FTWA 4HNAD 5HS0A 2OVFA 1IKND 5D2MC 2EINE 4U8YD 5CCMA 1N95A 3EIQC 2P9SG 2PQRA 4KYOB 3PREA 4B8AA 3ZPJA 3Q49B 3JXIA 3FWVA 3CR3A 2YQ8A 4C9BB 4WUYA 2YINA 4J0UA 3ULQA 3AG4E 2XZDG 3AS4A 2GROB 3HHMA 2F8XK 3QJZA 2DZNA 5CRVA 4A3TA 2VTBB 1TN7A 1QQEA 1EPUA 3LPZA 2QY7A 3IHVA 1O5MA 3B95A 4MS6A 4HOTA 4MLPA 4HORA 2IEJA 5CHEE 5EX3A 1OWMA 5G05J 2WQ7A 4EECA 2L9BA 1TN8A 2VGEA 1VDYA 3EIJA 4AOFA 5CEDB 2FO7A 3O48A 3HXFA 5B1AE 4JEUA 2R2LA 4EZJA 3SNXA 1WG0A 5HQ8A 4A1SA 4GA2A 2X3MA 2VGYA 5LFAA 2IF4A 4RQIA 4TXQA 2KCVA 4KBQA 4HRMB 3QARA 5FJYA 2P58C 3FUHA 3G2TA 2VSXE 3VTYA 2EIJE 3JQ0A 4WNDA 4CDMA 1A5EA 2NC9A 4C0EA 3AU4A 1E7VA 2XGOA 2P2CP 2XGSA 3I5PA 4DLQA 1MZCA 5EDSA 4HI8A 4HB5A 2L0IA 4JXTA 1IQRA 5D0QD 5HRYA 4BETA 1HG5A 3CVLA 4V3IA 4A3VA 5LP0A 1LD8A 3PDNA 1K3ZD 4FC8A 3KSQA 5KNHD 2ZU6B 5G2NA 1O1RA 4ABNA 1MX6A 5AARA 5FT9A 1MHQA 2XCCA 2OCCE 2MRIA 1V55E 4L2LA 2V5FA 4M3OA 3SHFA 4GMLA 3JCKC 3APDA 2J49A 3L9TA 4L9PA 2HE0A 3MV3B 5FZRA 4APOA 2I1JA 5C2YA 1H2UA 3V2XA 3VLDA 5CERB 3S7BA 4PS7A 3UM2A 4GTRA 5AQBA 3RKVA 3C3QA 3LVQE 2VTBA 3DBSA 1HE8A 3DPDA 4G23A 2LUHA 3UPVA 2X6FA 3LJNA 1OT8A 2YHCA 3CHRA 5EILA 3PRZA 3ZHEB 2P9NG 3C72A 1H6OA 3K9IA 3ASOE 3NZSA 4MRUA 4JC8A
chains in the Genus database with same CATH topology
2C2LA 5DIZA 5FWQA 3SI5A 2RD0A 3BEEA 4BT9A 2J08A 4Q96A 3FU3A 3TJPA 2JEKA 3CEQA 4I43A 2XGMA 4G26A 3ZW3A 2UY1B 4AVXA 4H7XA 1QZ2A 4ILIA 2L6JA 2AXUA 3CVNA 1TJCA 4E85A 4U0UA 3ASHA 3EHMA 3IV0A 3CIAA 2UWJG 4KT6B 3L08A 4EBAG 3UT7A 1DVPA 4UI9C 4CEMA 3URZA 2GW1A 3OTNA 4ME2A 2LSVA 4UQYA 5E75A 2WM9A 2HR2A 2VJ8A 2LNIA 2FF4A 1HFAA 2VGXA 2CHWA 4I2WA 5ANLA 2CG3A 5KCMA 5G04C 4HVBA 1DNPA 2RG8A 4FHJA 4I2ZA 3ESKA 1PY1A 3FUNA 3QNKA 3FEYA 2VSYA 3CV0A 1HS6A 2JLBA 2HYZA 4ILHB 5LCWJ 3CVXA 3QDNA 2J07A 4JVSA 4ACLA 2WXNA 2KC7A 1N54A 2BTDA 4FJZA 5HI7A 2R59A 3KEZA 1EYHA 4OYSA 4U04A 4GYWA 2DIWA 1Z3YA 3PUJA 1IHGA 1OUVA 2I2OA 5EKQD 2V8SE 5BT1A 3FTZA 1QNFA 5LOZA 3TAXA 3MKQA 4B94A 1E96B 1KT0A 3TGOA 4RG9A 3CHMA 4JZYA 4BWRA 3IHYA 2FULA 3D9OA 3L22A 5DBKA 4F7AA 3FUMA 3G2WA 3FTSA 4FLHA 2WXGA 4LEUA 1Y6IA 5AJLA 2PQNA 4HXIA 2GRLA 1FVHA 4JHJA 5AIJA 4BTAA 1HG2A 1NP7A 4HOQA 2MHKA 2IOLA 3C98A 4I6GA 5BV1A 3ML8A 4XX5A 3D3MA 4UWFA 5BUZA 3SD5A 5M72A 2XPZA 2CHZA 3TG4A 2Q7FA 2XHEA 4N2QA 3CSFA 4G24A 4W9RA 3MX3A 4L2YA 4J8DA 5FQ8A 1WY6A 4FADA 1SZ9A 2KZTA 4GZ5A 1NZNA 3FUFA 2V4LA 3CVQA 2VYIA 3HDXA 3OXLA 3RRMB 3AU5A 4FLBA 4HFGA 2WXKA 4F3VA 2LSUA 4BFRA 3CHOA 5G05C 4EZKA 3APCA 4ATGA 3SGHA 4BX9A 3S7DA 4HOUA 2Y4UA 3ZYKA 4R7LA 4B89A 4J8SA 2YNQA 1GW6A 4KVOA 4N39A 3FDHA 5JJ6A 1L5JA 3RRNB 3RJVA 5FZQA 4CT0A 3FU5A 3CHQA 4XKBA 1IQUA 2FBNA 2XPIA 3QK0A 4GYOA 4NURA 4WAFA 3CGHA 4GYYA 4XIFA 4JPSA 4Y6WA 3D9KA 4YNDA 3R7RA 4WWNA 3SZ7A 1UW4B 5A6CA 2FI7A 4GB9A 4E6HA 3ASDA 2R5SA 4AEZC 1HH8A 4ANWA 4QFVA 3S7FA 4HLEA 2WXFA 1H19A 3T8MA 4BSXA 4RVBA 2I9CA 4CDRA 4HOSA 1IYGA 3APFA 4U0SA 3ZN3A 3MYVA 3CK8A 2J9QA 1E8YA 3AS8A 1UN8A 4RSYA 2XQ0A 2IOSA 2XPYA 3FUDA 3PEUB 1KT1A 5AYWD 2XRZA 3GZ1A 1H6KA 4FULA 3L16A 4YVOA 2C0MA 2XCBA 2LAHA 1HO8A 4NACA 1H2TC 2XEVA 2PL2A 4DJAA 4ANVA 4PH4B 3E4BA 4CGVA 2I6HA 3FTUA 2Y3AA 4IYPA 1E8XA 1WAO1 2PZIA 4WNFA 3ZVVA 2IONA 2CHXA 4UWGA 4B0ZA 3CVVA 3UT8A 4UI9K 5BW8C 4J6IA 5ENNA 3RK6A 4I6EA 3CLJA 4U63A 3LCAA 3IEGA 3NZUA 2IQCA 3LXUX 4XZ4A 2KM4A 4AIFA 4DK5A 1OWPA 3SBTB 2UY1A 2HM8A 3PE3A 4CCAA 4IRUA 4BT8A 2DCPA 2WXRA 4L7TA 4K0RA 5AENA 3ZRHA 2AW6A 3L6AA 1ZU2A 4GU5A 4GAAA 4DI3A 1OWLA 4UWKA 1MQSA 3CQGB 3R9AB 2J4BA 3G2SA 2WXMA 1XGWA 1ELKA 2E0IA 2VQ2A 5AJDA 5ANRA 4ACKA 1SZAA 2FEZA 1TJFA 4JW1A 3CSTA 3CVWA 4C0MA 2WXHA 5JHAA 4I9EA 5BPPA 4UWLA 4APFA 3FULA 3QWWA 4I6JA 3FUIA 4HS2A 4NRHB 3JQ1A 3OXFA 4DLOA 3P2BA 2PM7A 3CK9A 3RIBA 2CFUA 3T5XA 5E76A 1FVFA 4CT4A 4ANXA 3CKCA 4MKTA 1PC2A 3R7QA 2WMNA 3D9IA 3EJNA 4ANUA 1NA3A 4KMOA 2WXJA 4CRWA 1OWNA 1FCHA 1U3CA 5JJ7A 4YVQC 3D9PA 2AVPA 3FY4A 4O6FA 2XRYA 3FU0A 1X5BA 5BNWA 1Z6TA 2IJGX 3CHPA 4FU3A 3RO3A 3QC1A 2WQ6A 2J4DA 2VSNA 4L1BA 4TRQA 3QKYA 4BX8A 3ZXSA 4UI9J 1HZ4A 3TL5A 3Q4AB 3FH7A 3ASFA 3GW4A 3EDTB 3SFZA 2J09A 1ELRA 4P29A 3LY9A 2KATA 3GYZA 1B89A 5ARFA 3TXMA 1U3DA 4KZCA 4WWPA 1Z3XA 5G04J 3LJ3A 3FTWA 4N3BA 4BTBA 2OVFA 4URKA 3NF1A 1E7UA 4PDXA 4A1GA 3ZGQA 3PS6A 3CHSA 4UQXA 2IU1A 5KJNA 5CCMA 3EIQC 3UX4A 1JUQA 3I3NA 3PH0C 5CCLA 2PQRA 4KYOB 3UQ3A 3PREA 2GRMA 3QWPA 4B8AA 3JYSA 4AM9A 3ZPJA 3Q49B 1HXIA 4DPRA 4LERA 1HU3A 3FWVA 3MCXA 3CR3A 4EBAA 2YQ8A 4C9BB 4FA6A 4GPKA 4AY5A 4WUYA 1LF8A 2YINA 2LAIA 3MJWA 3MZLB 4J0UA 3ULQA 1UN9A 5FQ6A 2E2EA 2EQXA 3AS4A 2DBAA 3G2UA 3HVEB 3SF4A 3HHMA 4EPZA 2I1KA 1E8ZA 4GZ6A 3QWVA 3ZYLA 1KLXA 3GZ2A 3QJZA 4JL0A 4J8FA 4G2VA 1XNFA 2AXZA 2WMOA 2ILRA 2WXOA 3L54A 4GCOA 1HX8A 4A3TA 2VTBB 2WQHA 1QQEA 4I9CA 3D9NA 3Q15A 2VSOE 1EPUA 2NSZA 3LPZA 2BUGA 2WXQA 2QY7A 3MEKA 3IHVA 4GMJA 4OVUA 3CK7A 3FU6A 4MS6A 2X6IA 3FP3A 4HOTA 5CMWA 4MLPA 4HORA 5D0OD 2YHEA 3U64A 3P1UA 2A4ZA 4LRZA 5CHEE 3CVPA 4XKCA 2Y4TA 4A55A 4BY6A 4KVMA 5EX3A 1OWMA 5G05J 2WQ7A 4EECA 2L9BA 3L17A 3RO2A 3BG1B 4IULA 5LCWC 4L23A 1VDYA 3EIJA 4AOFA 3HIZA 3PNLB 3UT4A 2FO7A 3O48A 1W3BA 1E8WA 4IN3B 1EF1C 3FEXA 5CMYA 3WXXA 5C1DA 3PE4A 4JEUA 1E90A 4EZJA 5A23A 4U8HA 2M63A 3SNXA 1S0PA 4GZCA 5HQ8A 3ML9A 5FQ7A 4A1SA 4GA2A 4AP2A 4AJWA 2X3MA 2VGYA 4TV3A 5LFAA 2IF4A 3FTXA 2KCVA 4N2SA 1JPLA 2AXVA 4Q94A 4KBQA 3S2AA 2BF0X 3T5VA 3QARA 4NQ0A 1P5QA 3FHEA 3L13A 5FJYA 2P58C 3FUHA 4DI4A 3CVUA 3B7RL 3KAEA 3G2TA 5G55A 2VSXE 5JJTA 4U0ZA 5KJLA 3B7TA 3FTYA 1WM5A 3LDZA 3VTYA 1N52A 4JA9A 3JQ0A 3ESLA 2VGXB 3U9WA 4WNDA 4B8CB 4FHKA 3EHNA 2WB2A 4CDMA 3CQCB 3N71A 3Q5MA 2NC9A 4C0EA 3VLFA 3AU4A 1E7VA 3PUKA 2XGOA 4Q69A 4CGWA 2XGSA 3OXGA 3I5PA 4G25A 4DLQA 4FJYA 4I17A 2GGFA 4WWOA 2X6KA 3ONKA 4OVVA 5EDSA 4FP7A 2L0IA 4JXTA 4I1AA 5FTPA 1IQRA 3LY7A 5D0QD 2MOWA 1H2VC 3ZIMA 4N5CA 2OVBA 1HG5A 3VTXA 4AXHA 3KS2A 5KJKA 2X6HA 4GZDA 5LX8A 2WXLA 3MKQB 4I1OB 3CVLA 3MA5A 5FZSA 1ZBPA 4GA1A 4V3IA 3ZFWA 5T8IA 4K03A 4A3VA 5LP0A 1EDUA 3AS5A 1BPOA 3PDNA 2L0TB 5T3RA 3D9JA 2ONDA 3FFLA 3LVRE 3LEWA 2V0PA 4FC8A 3QAQA 2OOEA 2ZU6B 2KCKA 1YA0A 2X6JA 4JA7A 4UQZA 4JHRA 5G2NA 2R17C 3D9LA 1NA0A 3FH8A 3UMVA 5J08A 4XI9A 1A17A 4WNGA 4ABNA 4AV7A 3U4TA 2WXPA 5ARGA 1JWFA 3B13A 4LCTA 5FT9A 3QOUA 4JEHA 2KCLA 2LO6A 2C0LA 4GA0A 5KJMA 1MHQA 3O4ZA 3KD7A 2XCCA 3PVLA 4I1MA 4LUNU 5EX0A 2MRIA 4L2LA 2V5FA 4M3OA 2KZTB 3G2VA 3SHFA 4WNEA 3QB2A 3TXNA 4GMLA 3MGBA 4D10C 4AY6A 3JCKC 1UJKA 4TUUA 3I4GA 3HYMB 2QFCA 3TG5A 3APDA 4EZLA 2J49A 5JHBA 1Y8MA 2PM6A 3LS8A 5A7DB 5FQ4A 4JHKA 3RU0A 3SBSA 3LY8A 3ZYMA 3MV3B 1UJJA 2IFUA 5FZRA 3FH5A 2A5UA 3IKOB 3S7JA 3BG0B 4APOA 2AWIA 2I1JA 5C2YA 5T4YA 3B7UX 1HF8A 1H2UA 3FTVA 4G11A 1ELWA 3FUJA 4GCNA 4CDNA 2WVIA 2NXPA 3LYAA 4G1TA 4N3AA 4PUCA 4U07A 3VLEA 3IBEA 1PAQA 3VLDA 3U3WA 3S7BA 3ONLA 4J8EA 3CKBA 4PS7A 3MV2B 1JWGA 3ENEA 3HVEA 3FUEA 4H7YA 1SQMA 3Q47B 2WXIA 3FUKA 4RG6A 3GZSA 3JUIA 3UUXA 3RKVA 3LVQE 2VTBA 5J90A 3DBSA 1HE8A 3DPDA 4G23A 5BV0A 1H0AA 3UPVA 2X6FA 3LKUA 4XI0A 1INZA 2OV8A 3ZYQA 3MKRA 1OWOA 4KZ0A 3OAWA 3PZDA 1UG3A 4N3CA 1TEZA 4F53A 2CG2A 4UWHA 3U66A 4GZ3A 3ASGA 2YHCA 4F1SA 4PS3A 3CHRA 4ILGA 3RRUA 3CVYA 4EQFA 2X38A 3PNTB 3PRZA 2WPVA 3ZEFA 3ZHEB 4XE0A 2HO1A 4KXKB 2CFZA 3B7SA 3K9IA 3NZSA 4MRUA 3D9MA 3NQPA 3I4RB 3PEVB 3ZHEA 4PS8A 4Y6CA 4JC8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2L A;  5DIZ A;  3BEE A;  4BT9 A;  3CEQ A;  2XGM A;  4G26 A;  2UY1 B;  4H7X A;  1QZ2 A;  2L6J A;  3CVN A;  1TJC A;  4U0U A;  3ASH A;  2UWJ G;  4UI9 C;  3URZ A;  2GW1 A;  4ME2 A;  2LSV A;  4UQY A;  2HR2 A;  2LNI A;  2FF4 A;  2VGX A;  4I2W A;  5G04 C;  4I2Z A;  3ESK A;  2VSY A;  3CV0 A;  5LCW J;  2JLB A;  2HYZ A;  3QDN A;  2KC7 A;  5HI7 A;  4U04 A;  4GYW A;  1IHG A;  1OUV A;  5EKQ D;  5BT1 A;  3TAX A;  4B94 A;  1E96 B;  1KT0 A;  3TGO A;  4RG9 A;  4BWR A;  5DBK A;  4LEU A;  2PQN A;  4BTA A;  4HOQ A;  2MHK A;  5M72 A;  3TG4 A;  2Q7F A;  4N2Q A;  4G24 A;  4W9R A;  4J8D A;  4GZ5 A;  1NZN A;  3CVQ A;  2VYI A;  3OXL A;  4F3V A;  2LSU A;  5G05 C;  3S7D A;  4HOU A;  2Y4U A;  4N39 A;  5JJ6 A;  3RJV A;  5FZQ A;  2XPI A;  2FBN A;  4GYO A;  4XIF A;  4GYY A;  4Y6W A;  4YND A;  3SZ7 A;  5A6C A;  2FI7 A;  3ASD A;  2R5S A;  1HH8 A;  3S7F A;  4HOS A;  4CDR A;  1IYG A;  4U0S A;  3ZN3 A;  3CK8 A;  2J9Q A;  3AS8 A;  1KT1 A;  5AYW D;  3GZ1 A;  4YVO A;  2C0M A;  2XCB A;  2XEV A;  2PL2 A;  3E4B A;  4CGV A;  2I6H A;  1WAO 1;  2PZI A;  4WNF A;  4UI9 K;  5BW8 C;  3LCA A;  3IEG A;  4AIF A;  2UY1 A;  3PE3 A;  4BT8 A;  1ZU2 A;  3R9A B;  2VQ2 A;  2FEZ A;  4I9E A;  3QWW A;  4NRH B;  3OXF A;  3CK9 A;  3RIB A;  3CKC A;  1PC2 A;  1NA3 A;  1FCH A;  5JJ7 A;  4YVQ C;  2AVP A;  4O6F A;  5BNW A;  3RO3 A;  2VSN A;  3QKY A;  4UI9 J;  1HZ4 A;  3Q4A B;  3ASF A;  3GW4 A;  3EDT B;  1ELR A;  3LY9 A;  2KAT A;  3GYZ A;  1B89 A;  5ARF A;  5G04 J;  4N3B A;  4BTB A;  3NF1 A;  3ZGQ A;  4UQX A;  5KJN A;  5CCM A;  5CCL A;  2PQR A;  4KYO B;  3UQ3 A;  3QWP A;  3JYS A;  4AM9 A;  3ZPJ A;  3Q49 B;  1HXI A;  3FWV A;  2YQ8 A;  4GPK A;  4AY5 A;  4WUY A;  4J0U A;  3ULQ A;  2E2E A;  3AS4 A;  2DBA A;  3SF4 A;  4GZ6 A;  3QWV A;  1KLX A;  3GZ2 A;  4J8F A;  4JL0 A;  4G2V A;  1XNF A;  4GCO A;  2WQH A;  1QQE A;  4I9C A;  3Q15 A;  3LPZ A;  2BUG A;  3MEK A;  3CK7 A;  3FP3 A;  4HOT A;  4HOR A;  5D0O D;  5CHE E;  3CVP A;  2Y4T A;  5EX3 A;  5G05 J;  3RO2 A;  5LCW C;  2FO7 A;  3O48 A;  1W3B A;  4IN3 B;  3WXX A;  5C1D A;  3PE4 A;  5HQ8 A;  4A1S A;  4GA2 A;  2VGY A;  2IF4 A;  2KCV A;  4N2S A;  4KBQ A;  4NQ0 A;  1P5Q A;  5FJY A;  2P58 C;  3KAE A;  5JJT A;  4U0Z A;  5KJL A;  1WM5 A;  3VTY A;  4JA9 A;  2VGX B;  4WND A;  3N71 A;  3Q5M A;  2NC9 A;  2XGO A;  4CGW A;  2XGS A;  3OXG A;  4G25 A;  4I17 A;  4I1A A;  5FTP A;  3LY7 A;  5D0Q D;  4N5C A;  3VTX A;  3KS2 A;  5KJK A;  3CVL A;  3MA5 A;  5FZS A;  1ZBP A;  4GA1 A;  3ZFW A;  3AS5 A;  3PDN A;  2OND A;  3FFL A;  2OOE A;  2KCK A;  1YA0 A;  4JA7 A;  4UQZ A;  4JHR A;  1NA0 A;  4XI9 A;  1A17 A;  4WNG A;  4ABN A;  3U4T A;  5ARG A;  5FT9 A;  3QOU A;  2KCL A;  5KJM A;  2C0L A;  4GA0 A;  3KD7 A;  2XCC A;  5EX0 A;  2V5F A;  4WNE A;  4AY6 A;  3TG5 A;  3HYM B;  2QFC A;  1Y8M A;  5A7D B;  3RU0 A;  3LY8 A;  3MV3 B;  2IFU A;  5FZR A;  4APO A;  3S7J A;  1ELW A;  4GCN A;  4N3A A;  3LYA A;  4G1T A;  4U07 A;  3U3W A;  3S7B A;  4J8E A;  3CKB A;  3MV2 B;  4H7Y A;  3Q47 B;  4RG6 A;  3UUX A;  3RKV A;  4G23 A;  3UPV A;  3LKU A;  4XI0 A;  3MKR A;  4N3C A;  4GZ3 A;  3ASG A;  2YHC A;  4EQF A;  2WPV A;  3ZHE B;  2HO1 A;  4KXK B;  3K9I A;  3ZHE A;  4Y6C A; 
#chains in the Genus database with same CATH topology
 2DWZ A;  3BEE A;  4BT9 A;  2F0Y A;  5HKP A;  3TJP A;  5IY5 E;  2JEK A;  4I43 A;  2XGM A;  3ZW3 A;  3NAW A;  4E85 A;  4U0U A;  3EHM A;  4KT6 B;  3UT7 A;  1TNY A;  2LNI A;  5G04 C;  1DNP A;  4FHJ A;  4I2Z A;  5EN5 D;  3ZUV B;  3ESK A;  1PY1 A;  3QNK A;  5B3S E;  1HS6 A;  2JLB A;  3CVX A;  3AG1 E;  2J07 A;  4M7C A;  2R59 A;  1EYH A;  4GTM A;  2DIW A;  1QNF A;  3CHM A;  3L22 A;  4F7A A;  3D9H A;  4LEU A;  2PQN A;  4HXI A;  4JHJ A;  5AIJ A;  1NP7 A;  4HOQ A;  2MHK A;  3C98 A;  4XX5 A;  3SD5 A;  2CHZ A;  2XHE A;  1Q2Z A;  2IY0 C;  3CSF A;  3MX3 A;  1K8K G;  5FQ8 A;  2OEW A;  3RRM B;  3FUF A;  3HDX A;  3OXL A;  1MJ0 A;  4K5A B;  4FLB A;  4HFG A;  5KNG A;  4BFR A;  1LTX A;  4EZK A;  3APC A;  4ATG A;  3E34 A;  2KBX A;  3S7D A;  2KXP C;  4HOU A;  4BER A;  1KZP A;  4KVO A;  2IO2 C;  1L5J A;  2FO1 E;  1S63 A;  5FZQ A;  4XKB A;  4GYY A;  4XIF A;  4JPS A;  2GRQ B;  4WWN A;  5A6C A;  4GB9 A;  3ASD A;  3E37 A;  1OXJ A;  1HH8 A;  4LSZ E;  3NOC D;  5EYL A;  4HLE A;  4BSX A;  4CDR A;  4U0S A;  3ZN3 A;  2J9Q A;  1E8Y A;  2IO3 C;  3GZ1 A;  4YVO A;  2XCB A;  1U2V G;  4O1O A;  1HO8 A;  4DJA A;  4ANV A;  4PH4 B;  2I6H A;  1TNZ A;  4WNF A;  2CHX A;  4GTO A;  4UWG A;  4ZHB A;  3CVV A;  3UT8 A;  5ENN A;  4U63 A;  1O1T A;  4XZ4 A;  2KM4 A;  4HQD A;  2LXM A;  1BD8 A;  2HM8 A;  4Z68 A;  1NL4 A;  2AJA A;  3DEO A;  3ZRH A;  2B6C A;  3W9F A;  1NFI E;  1ZU2 A;  4GU5 A;  1DCQ A;  4GAA A;  5AAO A;  1G3N B;  3CQG B;  3TWX A;  3G2S A;  2VQ2 A;  2E0I A;  1YYH A;  3CST A;  3F6Q A;  2WXH A;  5JHA A;  2LXL A;  4APF A;  3OXF A;  3CK9 A;  3T5X A;  5E76 A;  4ANX A;  3TWU A;  4MKT A;  1FCH A;  5JJ7 A;  3D9P A;  2AVP A;  3EHR A;  3FY4 A;  3FU0 A;  1X5B A;  1Z6T A;  2IJG X;  4FU3 A;  1OY3 D;  2XEN A;  4L1B A;  4TRQ A;  3QKY A;  5ENQ D;  4DX5 D;  3T8K A;  3TWT A;  3SFZ A;  4P29 A;  1ELR A;  2KAT A;  3TXM A;  1U3D A;  4WWP A;  2P9I G;  5G04 J;  1K1A A;  4PDX A;  2QZA A;  2P9L G;  1JUQ A;  3I3N A;  3UQ3 A;  4BSZ B;  5BXO A;  2GRM A;  5CBO A;  3JYS A;  3PZ1 A;  4EBA A;  2LAI A;  3MJW A;  3MZL B;  4TXP A;  5EIB E;  5FQ6 A;  3HVE B;  3SF4 A;  2V5Q C;  1KLX A;  3GZ2 A;  4J8F A;  4JL0 A;  4G2V A;  3DPY A;  2VSO E;  2BUG A;  2WXQ A;  3MEK A;  2X6I A;  5CMW A;  2GRP B;  3CVP A;  2Y4T A;  4A55 A;  4BY6 A;  4GTQ A;  2EIK E;  4L23 A;  3HIZ A;  3UT4 A;  2Y1L E;  1E8W A;  1N11 A;  4CYM D;  3FEX A;  3PE4 A;  1E90 A;  2Y69 E;  4U8H A;  1TNO A;  4GZC A;  1N4R A;  4TV3 A;  3FTX A;  1H6P A;  1JPL A;  4GMR A;  2BF0 X;  3T5V A;  4YDY A;  1P5Q A;  4DI4 A;  5JJT A;  1D9S A;  5KJL A;  3B7T A;  3FTY A;  1N52 A;  4JA9 A;  3U9W A;  3C3O A;  4B8C B;  4Q69 A;  4F6R D;  4I1A A;  3ZIM A;  4N5C A;  3KS2 A;  5KJK A;  4GZD A;  4I1O B;  3MA5 A;  1ZBP A;  3UKR G;  4K03 A;  5T3R A;  3D9J A;  3LVR E;  2X6J A;  4JHR A;  1K1B A;  2R17 C;  1NI1 A;  1NA0 A;  3FH8 A;  3UMV A;  5J08 A;  2RFA A;  4TXR A;  2WXP A;  3X2Q E;  2KCL A;  2LO6 A;  4YDW A;  3JXJ A;  3O4Z A;  3KD7 A;  3PVL A;  3G2V A;  4WNE A;  3HXD A;  3QB2 A;  4U95 D;  2BED A;  3MGB A;  3UIN C;  1UJK A;  2QFC A;  1Y8M A;  2PM6 A;  3RU0 A;  2IFU A;  3FH5 A;  3IKO B;  3BG0 B;  5T4Y A;  3FTV A;  4GCN A;  4G1T A;  4PUC A;  4LNB A;  3ONL A;  3CKB A;  5CBN A;  3ENE A;  3HVE A;  4HLL A;  1SQM A;  4X8Q A;  3FUK A;  3PZ4 A;  3UUX A;  1V54 E;  2ZGD A;  1H0A A;  4XI0 A;  2OV8 A;  3ZYQ A;  4KZ0 A;  4GTV A;  3OAW A;  3PZD A;  1UG3 A;  1TEZ A;  3DRA A;  3ASG A;  4PS3 A;  4GTT A;  5CEA A;  3ZEF A;  4XE0 A;  2GRR B;  2HO1 A;  4KXK B;  2CFZ A;  3HRA A;  4HBD A;  4J8Y A;  3I4R B;  4DX1 A;  5FWQ A;  3SI5 A;  2J08 A;  2P9P G;  5ITZ F;  3CEQ A;  1QZ2 A;  3CVN A;  3Q78 A;  4GTS A;  3URZ A;  3OTN A;  4ME2 A;  2LSV A;  4UQY A;  2HR2 A;  5CEC B;  2RG8 A;  2VSY A;  1O1S A;  1IXV A;  4ACL A;  3DWL G;  1N54 A;  3KEZ A;  4GYW A;  1Z3Y A;  1OUV A;  2I2O A;  5EKQ D;  4B94 A;  1E96 B;  3TGO A;  4BWR A;  4O60 A;  3IHY A;  5H7P A;  3SFX A;  3G2W A;  1Y6I A;  1FVH A;  2IOL A;  2P9K G;  5BV1 A;  2XS8 A;  3D3M A;  4UWF A;  5M72 A;  2Q7F A;  5ENR D;  1N4P A;  3AU5 A;  3UIP C;  1FPP A;  4J8S A;  3FDH A;  5JJ6 A;  5ENO D;  4CT0 A;  3CHQ A;  1IQU A;  2FBN A;  3QK0 A;  4GYO A;  3CGH A;  3R7R A;  3SZ7 A;  2QYJ A;  2R5S A;  4QFV A;  2I9C A;  1IYG A;  3MYV A;  3HG0 D;  2XQ0 A;  2XPY A;  2R02 A;  5AYW D;  2XRZ A;  3TWW A;  1H6K A;  2DYR E;  3L16 A;  2H6H A;  2C0M A;  1H2T C;  2XEV A;  2PL2 A;  4GTP A;  4CGV A;  1E8X A;  1WAO 1;  2PZI A;  4CZ2 D;  4HI9 A;  5BW8 C;  3DSS A;  3UM1 A;  3IEG A;  2IQC A;  4DK5 A;  1OWP A;  3PE3 A;  1FT1 A;  4IRU A;  5AEN A;  1MX2 A;  4DX7 D;  3L6A A;  1SW6 A;  3RAU A;  5AJD A;  1BI8 B;  1JCQ A;  3TWR A;  3JQ1 A;  4DLO A;  3R9M A;  3P2B A;  2PM7 A;  3RIB A;  3UI2 A;  4YDO A;  2WMN A;  3D9I A;  4ANU A;  4KMO A;  4CRW A;  1U3C A;  4O6F A;  5BNW A;  1KZO A;  3QC1 A;  3TWV A;  1HZ4 A;  3TL5 A;  2EIL E;  3ASF A;  3GW4 A;  3EDT B;  2J09 A;  3LY9 A;  4BTB A;  1ZB1 A;  4URK A;  3AAA C;  1E7U A;  3CHS A;  3DSV A;  3UX4 A;  3ABK E;  5KBA A;  4ZFH A;  4LER A;  2OEV A;  5ENS D;  5AN8 A;  4GPK A;  1LF8 A;  2E2E A;  3G2U A;  2L6B A;  1E8Z A;  4GZ6 A;  3ISM C;  1MYO A;  2R03 A;  2WXO A;  3L54 A;  3DSX A;  4GMJ A;  4OVU A;  3CK7 A;  5FIO A;  3FP3 A;  5D0O D;  3P1U A;  2A4Z A;  2V4H C;  3UM0 A;  4XKC A;  4KVM A;  4IUL A;  5LCW C;  3PNL B;  1W3B A;  1EF1 C;  5A23 A;  2M63 A;  1S0P A;  3ML9 A;  5FQ7 A;  4AP2 A;  4AJW A;  4N2S A;  4NQ0 A;  2QC9 A;  3FHE A;  2ZIS A;  3CVU A;  3KAE A;  4U0Z A;  2H6I A;  3Q9N C;  3ESL A;  3EHN A;  2WB2 A;  3CQC B;  3N71 A;  3Q5M A;  3C3R A;  3VLF A;  3PUK A;  4CGW A;  3OXG A;  3W9G A;  4FJY A;  4I17 A;  3UXG A;  2GGF A;  4WWO A;  2X6K A;  3ONK A;  3UTM A;  4OVV A;  4FP7 A;  2MOW A;  4AXH A;  2RKK A;  5FZS A;  5T8I A;  1BPO A;  2L0T B;  3LEW A;  2V0P A;  2KCK A;  1YA0 A;  4UQZ A;  3D9L A;  4XI9 A;  1A17 A;  1MX4 A;  3U4T A;  5ARG A;  4LCT A;  4JEH A;  2C0L A;  4GA0 A;  3Q73 A;  3HXE A;  5EX0 A;  2KZT B;  4XEI G;  4D10 C;  4TUU A;  3I4G A;  3HYM B;  5JHB A;  5FQ4 A;  3SBS A;  3C5R A;  3LY8 A;  2AWI A;  3NOG D;  3B7U X;  4G11 A;  4CDN A;  2WVI A;  2NXP A;  3LYA A;  3VLE A;  4ANW A;  3ASN E;  1TR4 A;  3ULY A;  2WXI A;  1JCS A;  3GZS A;  3JUI A;  5J90 A;  5BV0 A;  3LKU A;  1N9A A;  3MKR A;  1OWO A;  4GPM A;  4UWH A;  4GZ3 A;  4F1S A;  4ILG A;  1QBQ A;  2WPV A;  3IXE A;  1JCR A;  2R05 A;  3D9M A;  4Y6C A;  1BU9 A;  2C2L A;  5DIZ A;  4Q96 A;  5BXU A;  3EU9 A;  4EHM A;  2NYJ A;  2UY1 B;  4H7X A;  4AVX A;  2L6J A;  2AXU A;  2EIM E;  1TJC A;  3ASH A;  3IV0 A;  3CIA A;  2UWJ G;  3L08 A;  1DVP A;  3ABL E;  4UI9 C;  2B0O E;  2GW1 A;  1UOH A;  3BU8 A;  3UKU G;  5E75 A;  2VJ8 A;  1N0R A;  2FF4 A;  2ETA A;  2CHW A;  2ZXW E;  4HVB A;  3NB2 A;  3CV0 A;  5LCW J;  3RSE G;  4ILH B;  3JUE A;  3QDN A;  2XEH A;  4FJZ A;  1RW2 A;  4DX6 D;  2V8S E;  4RG9 A;  3FUM A;  3FTS A;  4FLH A;  4U96 D;  4BTA A;  1HG2 A;  1DC2 A;  5BUZ A;  3TG4 A;  3Q7F A;  4N2Q A;  1N94 A;  2H6G A;  3J5Q B;  1N4S A;  4L2Y A;  4J8D A;  1WY6 A;  3EU5 A;  1SZ9 A;  2KZT A;  1NZN A;  3CVQ A;  1DCE A;  3Q9U C;  2LSU A;  3CHO A;  2A5E A;  3SGH A;  3V31 A;  4BX9 A;  2BKG A;  3BQO A;  3EUV A;  4R7L A;  4B89 A;  3ZKJ A;  1GW6 A;  4N39 A;  4U7E B;  1TN6 A;  3FU5 A;  4WAF A;  3UM3 A;  1YCS B;  1UW4 B;  3SO8 A;  2FI7 A;  4E6H A;  1WDY A;  2WXF A;  4DUI A;  2MYO A;  4RVB A;  4HOS A;  4YDE A;  3V2O A;  4A63 B;  1UN8 A;  2IOS A;  2XZT G;  1N0Q A;  4DX2 A;  1LD7 A;  3FTU A;  2Y3A A;  4IYP A;  1OCZ E;  2ION A;  3DSU A;  2XEE A;  4UI9 K;  1SA5 A;  4I6E A;  3LCA A;  1S64 A;  3LXU X;  3ZXP A;  3SBT B;  2UY1 A;  4CCA A;  4BES A;  4BT8 A;  2DCP A;  2WXR A;  4L7T A;  4K0R A;  4LNU D;  5FIN A;  1OWL A;  2J4B A;  1ELK A;  3UIO C;  2FEZ A;  3CVW A;  3QWW A;  4I6J A;  2CFU A;  1FVF A;  1OCO E;  1PC2 A;  3R7Q A;  3EJN A;  2WXJ A;  4ATZ D;  1OWN A;  3CHP A;  3RO3 A;  4K5C A;  2VSN A;  3AJI A;  4QQI A;  3ZXS A;  4RLY A;  4UI9 J;  3AG3 E;  4J7W A;  3GYZ A;  5ARF A;  4KZC A;  4DRX E;  3LJ3 A;  4N3B A;  3KEA A;  3NF1 A;  4A1G A;  3ZGQ A;  3PS6 A;  4UQX A;  2IU1 A;  5KJN A;  3L82 A;  1QYM A;  3PH0 C;  5CCL A;  3QWP A;  4AM9 A;  1HXI A;  4DPR A;  1HU3 A;  3MCX A;  4FA6 A;  4AY5 A;  2PNN A;  1UN9 A;  2EQX A;  3PZ2 A;  2DBA A;  1TNB A;  4EPZ A;  3E30 A;  2ETB A;  2I1K A;  3QWV A;  3ZYL A;  1TYQ G;  1XNF A;  2AXZ A;  2WMO A;  2ILR A;  3B7B A;  4GCO A;  1HX8 A;  2WQH A;  2BKK B;  4I9C A;  3ABM E;  3D9N A;  3Q15 A;  4BEP A;  2NSZ A;  3FU6 A;  3SQV A;  4JD2 G;  2YHE A;  3U64 A;  4LRZ A;  3Q79 A;  3L17 A;  3RO2 A;  3BG1 B;  3KSL A;  4IN3 B;  4G8K A;  5CMY A;  3WXX A;  3DSW A;  1D8E A;  5C1D A;  4UUC A;  2AXV A;  4Q94 A;  3S2A A;  3L13 A;  4O1P A;  3B7R L;  5G55 A;  1WM5 A;  3LDZ A;  2VGX B;  2P9U G;  5ENP D;  4FHK A;  3J5P A;  1OCC E;  3DXM G;  4G25 A;  5FTP A;  3LY7 A;  1H2V C;  2OVB A;  3VTX A;  5LX8 A;  2X6H A;  2WXL A;  3MKQ B;  4GA1 A;  3ZFW A;  4NIK A;  1EDU A;  3AS5 A;  2OND A;  3PZ3 A;  3FFL A;  2H6F A;  3QAQ A;  2OOE A;  4JA7 A;  3NBN B;  4WNG A;  4AV7 A;  1JWF A;  3B13 A;  3QOU A;  5KJM A;  4I1M A;  4LUN U;  3TXN A;  4HRN A;  4LG6 A;  4AY6 A;  5AQ7 A;  3TG5 A;  4EZL A;  3T9K A;  3LS8 A;  5A7D B;  4JHK A;  3ZYM A;  1UJJ A;  2A5U A;  3S7J A;  1HF8 A;  3Q75 A;  1ELW A;  3FUJ A;  2QYU A;  4N3A A;  4U07 A;  3U3W A;  3IBE A;  1PAQ A;  4OAU C;  2Y0B G;  4J8E A;  3MV2 B;  5KWD A;  1JWG A;  3FUE A;  4H7Y A;  3Q47 B;  1OCR E;  3DEP A;  4RG6 A;  3SY2 A;  1BLX B;  1INZ A;  4K5B A;  2ETC A;  3DST A;  4N3C A;  4F53 A;  2CG2 A;  3U66 A;  3V30 A;  3E32 A;  3RRU A;  3CVY A;  4B93 B;  4EQF A;  2F37 A;  2X38 A;  3EHQ A;  3PNT B;  3BUA A;  4G8L A;  3B7S A;  3ZNG A;  2DZO A;  3HXB A;  3NQP A;  3PEV B;  3ZHE A;  4PS8 A;  5D66 A;  4U8V D;  2RD0 A;  3FU3 A;  4G26 A;  4ILI A;  1IHB A;  1N4Q A;  2XS1 A;  4EBA G;  1BI7 B;  4CEM A;  1YMP A;  2WM9 A;  1S70 B;  1HFA A;  2VGX A;  1FT2 A;  4I2W A;  5ANL A;  2CG3 A;  5KCM A;  1AWC B;  2JAB A;  3FUN A;  3FEY A;  5JA4 D;  2HYZ A;  4JVS A;  2WXN A;  2KC7 A;  2BTD A;  5HI7 A;  4U04 A;  4OYS A;  3PUJ A;  1IHG A;  5EID A;  5BT1 A;  3FTZ A;  5LOZ A;  3TAX A;  3MKQ A;  1KT0 A;  4JZY A;  2FUL A;  3D9O A;  5DBK A;  1KPS B;  1AP7 A;  2WXG A;  5AJL A;  2GRL A;  3TWQ A;  4I6G A;  3ML8 A;  1SVX A;  3WG7 E;  2XPZ A;  2ZIR A;  4G24 A;  4W9R A;  5AQ9 A;  4FAD A;  2RFM A;  2DYS E;  4GZ5 A;  2F8Y A;  4F1P A;  2V4L A;  2VYI A;  3HXC A;  2WXK A;  4F3V A;  5G05 C;  1SA4 A;  5ENT D;  4MBG A;  2Y4U A;  3ZYK A;  3ZU7 B;  2YNQ A;  5B1B E;  1TNU A;  1Z5S C;  3RRN B;  3RJV A;  5JMN D;  3TWS A;  2XPI A;  4NUR A;  5CRU A;  4Y6W A;  3D9K A;  4YND A;  5EYP F;  4AEZ C;  3S7F A;  1H19 A;  3T8M A;  3APF A;  3CK8 A;  3AS8 A;  4RSY A;  3AG2 E;  3FUD A;  3PEU B;  1KT1 A;  4FUL A;  4HRL A;  2J8S D;  2LAH A;  4NAC A;  3E4B A;  1X81 A;  3ZVV A;  4B0Z A;  4J6I A;  3RK6 A;  3CLJ A;  3NZU A;  4TUM A;  5AQA A;  4AIF A;  2DVW A;  2AW6 A;  2GRN B;  2ZGG A;  4LNG A;  4DI3 A;  4UWK A;  1MQS A;  3R9A B;  4JB8 P;  2WXM A;  1XGW A;  5ANR A;  4ACK A;  1SZA A;  3Q7A A;  4JW1 A;  1TJF A;  4C0M A;  4I9E A;  5BPP A;  4UWL A;  3FUL A;  3V79 K;  3FUI A;  4HS2 A;  4NRH B;  4OAV B;  4CT4 A;  3CKC A;  3ULE G;  1RZ4 A;  1NA3 A;  4YVQ C;  4C48 B;  2XRY A;  4N5Q A;  3E33 A;  2WQ6 A;  2J4D A;  4BX8 A;  3DXK G;  1D8D A;  3FH7 A;  3Q4A B;  1B89 A;  1Z3X A;  3SFY A;  3FTW A;  4HNA D;  5HS0 A;  2OVF A;  1IKN D;  5D2M C;  2EIN E;  4U8Y D;  5CCM A;  1N95 A;  3EIQ C;  2P9S G;  2PQR A;  4KYO B;  3PRE A;  4B8A A;  3ZPJ A;  3Q49 B;  3JXI A;  3FWV A;  3CR3 A;  2YQ8 A;  4C9B B;  4WUY A;  2YIN A;  4J0U A;  3ULQ A;  3AG4 E;  2XZD G;  3AS4 A;  2GRO B;  3HHM A;  2F8X K;  3QJZ A;  2DZN A;  5CRV A;  4A3T A;  2VTB B;  1TN7 A;  1QQE A;  1EPU A;  3LPZ A;  2QY7 A;  3IHV A;  1O5M A;  3B95 A;  4MS6 A;  4HOT A;  4MLP A;  4HOR A;  2IEJ A;  5CHE E;  5EX3 A;  1OWM A;  5G05 J;  2WQ7 A;  4EEC A;  2L9B A;  1TN8 A;  2VGE A;  1VDY A;  3EIJ A;  4AOF A;  5CED B;  2FO7 A;  3O48 A;  3HXF A;  5B1A E;  4JEU A;  2R2L A;  4EZJ A;  3SNX A;  1WG0 A;  5HQ8 A;  4A1S A;  4GA2 A;  2X3M A;  2VGY A;  5LFA A;  2IF4 A;  4RQI A;  4TXQ A;  2KCV A;  4KBQ A;  4HRM B;  3QAR A;  5FJY A;  2P58 C;  3FUH A;  3G2T A;  2VSX E;  3VTY A;  2EIJ E;  3JQ0 A;  4WND A;  4CDM A;  1A5E A;  2NC9 A;  4C0E A;  3AU4 A;  1E7V A;  2XGO A;  2P2C P;  2XGS A;  3I5P A;  4DLQ A;  1MZC A;  5EDS A;  4HI8 A;  4HB5 A;  2L0I A;  4JXT A;  1IQR A;  5D0Q D;  5HRY A;  4BET A;  1HG5 A;  3CVL A;  4V3I A;  4A3V A;  5LP0 A;  1LD8 A;  3PDN A;  1K3Z D;  4FC8 A;  3KSQ A;  5KNH D;  2ZU6 B;  5G2N A;  1O1R A;  4ABN A;  1MX6 A;  5AAR A;  5FT9 A;  1MHQ A;  2XCC A;  2OCC E;  2MRI A;  1V55 E;  4L2L A;  2V5F A;  4M3O A;  3SHF A;  4GML A;  3JCK C;  3APD A;  2J49 A;  3L9T A;  4L9P A;  2HE0 A;  3MV3 B;  5FZR A;  4APO A;  2I1J A;  5C2Y A;  1H2U A;  3V2X A;  3VLD A;  5CER B;  3S7B A;  4PS7 A;  3UM2 A;  4GTR A;  5AQB A;  3RKV A;  3C3Q A;  3LVQ E;  2VTB A;  3DBS A;  1HE8 A;  3DPD A;  4G23 A;  2LUH A;  3UPV A;  2X6F A;  3LJN A;  1OT8 A;  2YHC A;  3CHR A;  5EIL A;  3PRZ A;  3ZHE B;  2P9N G;  3C72 A;  1H6O A;  3K9I A;  3ASO E;  3NZS A;  4MRU A;  4JC8 A; 
#chains in the Genus database with same CATH homology
 2C2L A;  5DIZ A;  5FWQ A;  3SI5 A;  2RD0 A;  3BEE A;  4BT9 A;  2J08 A;  4Q96 A;  3FU3 A;  3TJP A;  2JEK A;  3CEQ A;  4I43 A;  2XGM A;  4G26 A;  3ZW3 A;  2UY1 B;  4AVX A;  4H7X A;  1QZ2 A;  4ILI A;  2L6J A;  2AXU A;  3CVN A;  1TJC A;  4E85 A;  4U0U A;  3ASH A;  3EHM A;  3IV0 A;  3CIA A;  2UWJ G;  4KT6 B;  3L08 A;  4EBA G;  3UT7 A;  1DVP A;  4UI9 C;  4CEM A;  3URZ A;  2GW1 A;  3OTN A;  4ME2 A;  2LSV A;  4UQY A;  5E75 A;  2WM9 A;  2HR2 A;  2VJ8 A;  2LNI A;  2FF4 A;  1HFA A;  2VGX A;  2CHW A;  4I2W A;  5ANL A;  2CG3 A;  5KCM A;  5G04 C;  4HVB A;  1DNP A;  2RG8 A;  4FHJ A;  4I2Z A;  3ESK A;  1PY1 A;  3FUN A;  3QNK A;  3FEY A;  2VSY A;  3CV0 A;  1HS6 A;  2JLB A;  2HYZ A;  4ILH B;  5LCW J;  3CVX A;  3QDN A;  2J07 A;  4JVS A;  4ACL A;  2WXN A;  2KC7 A;  1N54 A;  2BTD A;  4FJZ A;  5HI7 A;  2R59 A;  3KEZ A;  1EYH A;  4OYS A;  4U04 A;  4GYW A;  2DIW A;  1Z3Y A;  3PUJ A;  1IHG A;  1OUV A;  2I2O A;  5EKQ D;  2V8S E;  5BT1 A;  3FTZ A;  1QNF A;  5LOZ A;  3TAX A;  3MKQ A;  4B94 A;  1E96 B;  1KT0 A;  3TGO A;  4RG9 A;  3CHM A;  4JZY A;  4BWR A;  3IHY A;  2FUL A;  3D9O A;  3L22 A;  5DBK A;  4F7A A;  3FUM A;  3G2W A;  3FTS A;  4FLH A;  2WXG A;  4LEU A;  1Y6I A;  5AJL A;  2PQN A;  4HXI A;  2GRL A;  1FVH A;  4JHJ A;  5AIJ A;  4BTA A;  1HG2 A;  1NP7 A;  4HOQ A;  2MHK A;  2IOL A;  3C98 A;  4I6G A;  5BV1 A;  3ML8 A;  4XX5 A;  3D3M A;  4UWF A;  5BUZ A;  3SD5 A;  5M72 A;  2XPZ A;  2CHZ A;  3TG4 A;  2Q7F A;  2XHE A;  4N2Q A;  3CSF A;  4G24 A;  4W9R A;  3MX3 A;  4L2Y A;  4J8D A;  5FQ8 A;  1WY6 A;  4FAD A;  1SZ9 A;  2KZT A;  4GZ5 A;  1NZN A;  3FUF A;  2V4L A;  3CVQ A;  2VYI A;  3HDX A;  3OXL A;  3RRM B;  3AU5 A;  4FLB A;  4HFG A;  2WXK A;  4F3V A;  2LSU A;  4BFR A;  3CHO A;  5G05 C;  4EZK A;  3APC A;  4ATG A;  3SGH A;  4BX9 A;  3S7D A;  4HOU A;  2Y4U A;  3ZYK A;  4R7L A;  4B89 A;  4J8S A;  2YNQ A;  1GW6 A;  4KVO A;  4N39 A;  3FDH A;  5JJ6 A;  1L5J A;  3RRN B;  3RJV A;  5FZQ A;  4CT0 A;  3FU5 A;  3CHQ A;  4XKB A;  1IQU A;  2FBN A;  2XPI A;  3QK0 A;  4GYO A;  4NUR A;  4WAF A;  3CGH A;  4GYY A;  4XIF A;  4JPS A;  4Y6W A;  3D9K A;  4YND A;  3R7R A;  4WWN A;  3SZ7 A;  1UW4 B;  5A6C A;  2FI7 A;  4GB9 A;  4E6H A;  3ASD A;  2R5S A;  4AEZ C;  1HH8 A;  4ANW A;  4QFV A;  3S7F A;  4HLE A;  2WXF A;  1H19 A;  3T8M A;  4BSX A;  4RVB A;  2I9C A;  4CDR A;  4HOS A;  1IYG A;  3APF A;  4U0S A;  3ZN3 A;  3MYV A;  3CK8 A;  2J9Q A;  1E8Y A;  3AS8 A;  1UN8 A;  4RSY A;  2XQ0 A;  2IOS A;  2XPY A;  3FUD A;  3PEU B;  1KT1 A;  5AYW D;  2XRZ A;  3GZ1 A;  1H6K A;  4FUL A;  3L16 A;  4YVO A;  2C0M A;  2XCB A;  2LAH A;  1HO8 A;  4NAC A;  1H2T C;  2XEV A;  2PL2 A;  4DJA A;  4ANV A;  4PH4 B;  3E4B A;  4CGV A;  2I6H A;  3FTU A;  2Y3A A;  4IYP A;  1E8X A;  1WAO 1;  2PZI A;  4WNF A;  3ZVV A;  2ION A;  2CHX A;  4UWG A;  4B0Z A;  3CVV A;  3UT8 A;  4UI9 K;  5BW8 C;  4J6I A;  5ENN A;  3RK6 A;  4I6E A;  3CLJ A;  4U63 A;  3LCA A;  3IEG A;  3NZU A;  2IQC A;  3LXU X;  4XZ4 A;  2KM4 A;  4AIF A;  4DK5 A;  1OWP A;  3SBT B;  2UY1 A;  2HM8 A;  3PE3 A;  4CCA A;  4IRU A;  4BT8 A;  2DCP A;  2WXR A;  4L7T A;  4K0R A;  5AEN A;  3ZRH A;  2AW6 A;  3L6A A;  1ZU2 A;  4GU5 A;  4GAA A;  4DI3 A;  1OWL A;  4UWK A;  1MQS A;  3CQG B;  3R9A B;  2J4B A;  3G2S A;  2WXM A;  1XGW A;  1ELK A;  2E0I A;  2VQ2 A;  5AJD A;  5ANR A;  4ACK A;  1SZA A;  2FEZ A;  1TJF A;  4JW1 A;  3CST A;  3CVW A;  4C0M A;  2WXH A;  5JHA A;  4I9E A;  5BPP A;  4UWL A;  4APF A;  3FUL A;  3QWW A;  4I6J A;  3FUI A;  4HS2 A;  4NRH B;  3JQ1 A;  3OXF A;  4DLO A;  3P2B A;  2PM7 A;  3CK9 A;  3RIB A;  2CFU A;  3T5X A;  5E76 A;  1FVF A;  4CT4 A;  4ANX A;  3CKC A;  4MKT A;  1PC2 A;  3R7Q A;  2WMN A;  3D9I A;  3EJN A;  4ANU A;  1NA3 A;  4KMO A;  2WXJ A;  4CRW A;  1OWN A;  1FCH A;  1U3C A;  5JJ7 A;  4YVQ C;  3D9P A;  2AVP A;  3FY4 A;  4O6F A;  2XRY A;  3FU0 A;  1X5B A;  5BNW A;  1Z6T A;  2IJG X;  3CHP A;  4FU3 A;  3RO3 A;  3QC1 A;  2WQ6 A;  2J4D A;  2VSN A;  4L1B A;  4TRQ A;  3QKY A;  4BX8 A;  3ZXS A;  4UI9 J;  1HZ4 A;  3TL5 A;  3Q4A B;  3FH7 A;  3ASF A;  3GW4 A;  3EDT B;  3SFZ A;  2J09 A;  1ELR A;  4P29 A;  3LY9 A;  2KAT A;  3GYZ A;  1B89 A;  5ARF A;  3TXM A;  1U3D A;  4KZC A;  4WWP A;  1Z3X A;  5G04 J;  3LJ3 A;  3FTW A;  4N3B A;  4BTB A;  2OVF A;  4URK A;  3NF1 A;  1E7U A;  4PDX A;  4A1G A;  3ZGQ A;  3PS6 A;  3CHS A;  4UQX A;  2IU1 A;  5KJN A;  5CCM A;  3EIQ C;  3UX4 A;  1JUQ A;  3I3N A;  3PH0 C;  5CCL A;  2PQR A;  4KYO B;  3UQ3 A;  3PRE A;  2GRM A;  3QWP A;  4B8A A;  3JYS A;  4AM9 A;  3ZPJ A;  3Q49 B;  1HXI A;  4DPR A;  4LER A;  1HU3 A;  3FWV A;  3MCX A;  3CR3 A;  4EBA A;  2YQ8 A;  4C9B B;  4FA6 A;  4GPK A;  4AY5 A;  4WUY A;  1LF8 A;  2YIN A;  2LAI A;  3MJW A;  3MZL B;  4J0U A;  3ULQ A;  1UN9 A;  5FQ6 A;  2E2E A;  2EQX A;  3AS4 A;  2DBA A;  3G2U A;  3HVE B;  3SF4 A;  3HHM A;  4EPZ A;  2I1K A;  1E8Z A;  4GZ6 A;  3QWV A;  3ZYL A;  1KLX A;  3GZ2 A;  3QJZ A;  4JL0 A;  4J8F A;  4G2V A;  1XNF A;  2AXZ A;  2WMO A;  2ILR A;  2WXO A;  3L54 A;  4GCO A;  1HX8 A;  4A3T A;  2VTB B;  2WQH A;  1QQE A;  4I9C A;  3D9N A;  3Q15 A;  2VSO E;  1EPU A;  2NSZ A;  3LPZ A;  2BUG A;  2WXQ A;  2QY7 A;  3MEK A;  3IHV A;  4GMJ A;  4OVU A;  3CK7 A;  3FU6 A;  4MS6 A;  2X6I A;  3FP3 A;  4HOT A;  5CMW A;  4MLP A;  4HOR A;  5D0O D;  2YHE A;  3U64 A;  3P1U A;  2A4Z A;  4LRZ A;  5CHE E;  3CVP A;  4XKC A;  2Y4T A;  4A55 A;  4BY6 A;  4KVM A;  5EX3 A;  1OWM A;  5G05 J;  2WQ7 A;  4EEC A;  2L9B A;  3L17 A;  3RO2 A;  3BG1 B;  4IUL A;  5LCW C;  4L23 A;  1VDY A;  3EIJ A;  4AOF A;  3HIZ A;  3PNL B;  3UT4 A;  2FO7 A;  3O48 A;  1W3B A;  1E8W A;  4IN3 B;  1EF1 C;  3FEX A;  5CMY A;  3WXX A;  5C1D A;  3PE4 A;  4JEU A;  1E90 A;  4EZJ A;  5A23 A;  4U8H A;  2M63 A;  3SNX A;  1S0P A;  4GZC A;  5HQ8 A;  3ML9 A;  5FQ7 A;  4A1S A;  4GA2 A;  4AP2 A;  4AJW A;  2X3M A;  2VGY A;  4TV3 A;  5LFA A;  2IF4 A;  3FTX A;  2KCV A;  4N2S A;  1JPL A;  2AXV A;  4Q94 A;  4KBQ A;  3S2A A;  2BF0 X;  3T5V A;  3QAR A;  4NQ0 A;  1P5Q A;  3FHE A;  3L13 A;  5FJY A;  2P58 C;  3FUH A;  4DI4 A;  3CVU A;  3B7R L;  3KAE A;  3G2T A;  5G55 A;  2VSX E;  5JJT A;  4U0Z A;  5KJL A;  3B7T A;  3FTY A;  1WM5 A;  3LDZ A;  3VTY A;  1N52 A;  4JA9 A;  3JQ0 A;  3ESL A;  2VGX B;  3U9W A;  4WND A;  4B8C B;  4FHK A;  3EHN A;  2WB2 A;  4CDM A;  3CQC B;  3N71 A;  3Q5M A;  2NC9 A;  4C0E A;  3VLF A;  3AU4 A;  1E7V A;  3PUK A;  2XGO A;  4Q69 A;  4CGW A;  2XGS A;  3OXG A;  3I5P A;  4G25 A;  4DLQ A;  4FJY A;  4I17 A;  2GGF A;  4WWO A;  2X6K A;  3ONK A;  4OVV A;  5EDS A;  4FP7 A;  2L0I A;  4JXT A;  4I1A A;  5FTP A;  1IQR A;  3LY7 A;  5D0Q D;  2MOW A;  1H2V C;  3ZIM A;  4N5C A;  2OVB A;  1HG5 A;  3VTX A;  4AXH A;  3KS2 A;  5KJK A;  2X6H A;  4GZD A;  5LX8 A;  2WXL A;  3MKQ B;  4I1O B;  3CVL A;  3MA5 A;  5FZS A;  1ZBP A;  4GA1 A;  4V3I A;  3ZFW A;  5T8I A;  4K03 A;  4A3V A;  5LP0 A;  1EDU A;  3AS5 A;  1BPO A;  3PDN A;  2L0T B;  5T3R A;  3D9J A;  2OND A;  3FFL A;  3LVR E;  3LEW A;  2V0P A;  4FC8 A;  3QAQ A;  2OOE A;  2ZU6 B;  2KCK A;  1YA0 A;  2X6J A;  4JA7 A;  4UQZ A;  4JHR A;  5G2N A;  2R17 C;  3D9L A;  1NA0 A;  3FH8 A;  3UMV A;  5J08 A;  4XI9 A;  1A17 A;  4WNG A;  4ABN A;  4AV7 A;  3U4T A;  2WXP A;  5ARG A;  1JWF A;  3B13 A;  4LCT A;  5FT9 A;  3QOU A;  4JEH A;  2KCL A;  2LO6 A;  2C0L A;  4GA0 A;  5KJM A;  1MHQ A;  3O4Z A;  3KD7 A;  2XCC A;  3PVL A;  4I1M A;  4LUN U;  5EX0 A;  2MRI A;  4L2L A;  2V5F A;  4M3O A;  2KZT B;  3G2V A;  3SHF A;  4WNE A;  3QB2 A;  3TXN A;  4GML A;  3MGB A;  4D10 C;  4AY6 A;  3JCK C;  1UJK A;  4TUU A;  3I4G A;  3HYM B;  2QFC A;  3TG5 A;  3APD A;  4EZL A;  2J49 A;  5JHB A;  1Y8M A;  2PM6 A;  3LS8 A;  5A7D B;  5FQ4 A;  4JHK A;  3RU0 A;  3SBS A;  3LY8 A;  3ZYM A;  3MV3 B;  1UJJ A;  2IFU A;  5FZR A;  3FH5 A;  2A5U A;  3IKO B;  3S7J A;  3BG0 B;  4APO A;  2AWI A;  2I1J A;  5C2Y A;  5T4Y A;  3B7U X;  1HF8 A;  1H2U A;  3FTV A;  4G11 A;  1ELW A;  3FUJ A;  4GCN A;  4CDN A;  2WVI A;  2NXP A;  3LYA A;  4G1T A;  4N3A A;  4PUC A;  4U07 A;  3VLE A;  3IBE A;  1PAQ A;  3VLD A;  3U3W A;  3S7B A;  3ONL A;  4J8E A;  3CKB A;  4PS7 A;  3MV2 B;  1JWG A;  3ENE A;  3HVE A;  3FUE A;  4H7Y A;  1SQM A;  3Q47 B;  2WXI A;  3FUK A;  4RG6 A;  3GZS A;  3JUI A;  3UUX A;  3RKV A;  3LVQ E;  2VTB A;  5J90 A;  3DBS A;  1HE8 A;  3DPD A;  4G23 A;  5BV0 A;  1H0A A;  3UPV A;  2X6F A;  3LKU A;  4XI0 A;  1INZ A;  2OV8 A;  3ZYQ A;  3MKR A;  1OWO A;  4KZ0 A;  3OAW A;  3PZD A;  1UG3 A;  4N3C A;  1TEZ A;  4F53 A;  2CG2 A;  4UWH A;  3U66 A;  4GZ3 A;  3ASG A;  2YHC A;  4F1S A;  4PS3 A;  3CHR A;  4ILG A;  3RRU A;  3CVY A;  4EQF A;  2X38 A;  3PNT B;  3PRZ A;  2WPV A;  3ZEF A;  3ZHE B;  4XE0 A;  2HO1 A;  4KXK B;  2CFZ A;  3B7S A;  3K9I A;  3NZS A;  4MRU A;  3D9M A;  3NQP A;  3I4R B;  3PEV B;  3ZHE A;  4PS8 A;  4Y6C A;  4JC8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...