4UI9K

Atomic structure of the human anaphase-promoting complex
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
493
Chain Sequence
b'NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHKSCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 178
structure length 493
sequence length 526
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
K PF13176 TPR_7 Tetratricopeptide repeat
K PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9K00
1KT1A 4AIFA 2LSUA 5CCMA 3ASFA 5KJLA 3ZN3A 4F3VA 1HXIA 3U3WA 3Q49B 2XCCA 3HYMB 3PDNA 4N3BA 2HO1A 3RJVA 3QKYA 2VSNA 2WPVA 3CVQA 2KCVA 1KLXA 2C2LA 2XCBA 4YNDA 4I9CA 4UI9J 4BTBA 3E4BA 3CVLA 5DBKA 3MKRA 4U0UA 3MV2B 1TJCA 4G25A 3ASHA 1ELWA 3CVNA 3CKBA 4HOQA 4GZ5A 4HORA 2XPIA 1W3BA 3LY7A 3S7JA 3LPZA 2FF4A 3NF1A 4N2SA 2XGMA 4NRHB 2E2EA 3UUXA 3ZFWA 1P5QA 5JJ7A 1ZU2A 3URZA 5CCLA 4G23A 4BT8A 4GYWA 5JJTA 4W9RA 5A7DB 4UQXA 1IYGA 2VSYA 3ASGA 2FEZA 4UQYA 1WAO1 5KJMA 4U04A 2UY1A 4G2VA 3LY8A 1IHGA 2AVPA 3QWVA 3JYSA 2V5FA 3QWPA 2XGSA 1XNFA 3SZ7A 5G04C 2VQ2A 3RO2A 4HOUA 3QWWA 3MA5A 5EKQD 4GA0A 2P58C 1ZBPA 3CK8A 3RO3A 1FCHA 2DBAA 3N71A 4HOSA 2C0LA 4GCNA 2FO7A 3K9IA 4UI9K 4WUYA 1NZNA 4G24A 4JHRA 3ZGQA 1PC2A 4JA9A 2BUGA 5FZQA 3Q4AB 3TG4A 4N5CA 2UY1B 3KD7A 4GA1A 2C0MA 5FJYA 3OXLA 4JL0A 2L6JA 3ZPJA 3ZHEA 3LCAA 2VGXA 4AY6A 3MV3B 3AS4A 4WNEA 5LCWJ 2PQRA 5HI7A 3UQ3A 4XI0A 4UQZA 4KYOB 1YA0A 4UI9C 5D0OD 4EQFA 2FBNA 4CGWA 4J8FA 3UPVA 1Y8MA 2LSVA 3KS2A 2VGYA 1KT0A 3Q15A 2QFCA 3Q5MA 1OUVA 3CK7A 4U07A 3S7DA 4GZ6A 5ARFA 3LKUA 3GW4A 3SF4A 5CHEE 4N2QA 5G05J 2HYZA 2UWJG 5FT9A 3AS8A 5BT1A 4I9EA 2GW1A 4XIFA 4N39A 4O6FA 1B89A 3Q47B 5BNWA 5FZSA 4A1SA 3FP3A 4NQ0A 2PQNA 4XI9A 2MHKA 3LYAA 3VTXA 3GYZA 4ABNA 3ULQA 5FZRA 4LEUA 2YHCA 5JJ6A 2Y4TA 3MEKA 4B94A 3R9AB 4H7XA 2Y4UA 3ZHEB 3RIBA 2VGXB 3LY9A 4KXKB 4RG9A 2JLBA 4J8DA 2KC7A 2OOEA 3O48A 4GPKA 5EX0A 2KCLA 4APOA 3TG5A 3OXFA 1HZ4A 4WNFA 5KJKA 4BWRA 3ESKA 4KBQA 5C1DA 3RKVA 1A17A 1QQEA 1NA0A 4WNDA 2IF4A 2VYIA 1QZ2A 4I17A 4Y6WA 4BTAA 2NC9A 4GCOA 4H7YA 4I2ZA 3CEQA 5KJNA 4GYYA 5AYWD 3BEEA 3CKCA 4HOTA 3FFLA 3PE4A 2ONDA 2HR2A 1E96B 3KAEA 2WQHA 5FTPA 4J8EA 3GZ1A 3CVPA 4Y6CA 5BW8C 2J9QA 2FI7A 2XEVA 2YQ8A 5HQ8A 1HH8A 3GZ2A 3AS5A 4N3CA 5ARGA 5EX3A 2KATA 5M72A 2PZIA 4YVOA 3QOUA 5LCWC 3ASDA 3WXXA 1ELRA 4YVQC 4GZ3A 4J0UA 3QDNA 4CDRA 5DIZA 2Q7FA 4AY5A 3OXGA 1NA3A 2PL2A 2KCKA 4G26A 4U0SA 5G05C 4G1TA 2LNIA 3TAXA 1WM5A 3EDTB 3PE3A 5D0QD 4RG6A 4IN3B 4N3AA 3TGOA 5G04J 2IFUA 3FWVA 3RU0A 4GYOA 3IEGA 4ME2A 4BT9A 2XGOA 4I1AA 4U0ZA 3CV0A 3S7FA 3VTYA 4JA7A 4I2WA 4WNGA 4CGVA 3CK9A 5A6CA 2R5SA 3U4TA 2I6HA 4GA2A 3S7BA 4AM9A
chains in the Genus database with same CATH superfamily
4K5AB 4AIFA 1N11A 5FIOA 5CCMA 3TWVA 1Y6IA 4F3VA 1E8ZA 1RZ4A 3PZ3A 1HO8A 5B1AE 3RJVA 1JCSA 4EZKA 3QKYA 2EIKE 4YNDA 1GW6A 3E34A 1OXJA 3CVLA 3FU6A 3ZXPA 2R59A 1TJCA 1DNPA 2JEKA 5ENTD 4MBGA 4AXHA 5AIJA 2KZTA 4O1OA 4XKCA 3CKBA 2OVBA 4GTPA 4DLOA 3U9WA 2DVWA 2CHXA 3RRUA 1SA4A 4MRUA 3LPZA 4DX5D 4N2SA 3E33A 2XGMA 2IOSA 3G2WA 3ZFWA 3ZRHA 1O1RA 3ZNGA 1ZU2A 3R7QA 2PNNA 4G23A 3SBTB 4BT8A 3SFZA 4G8LA 5JJTA 3L13A 3IBEA 3ESLA 4JZYA 4E85A 1PY1A 4ATZD 3FTVA 4A63B 3AG3E 4UQYA 1SW6A 2QC9A 3UXGA 4U04A 3LVRE 4F1SA 1IHGA 3ASNE 3QWVA 4QQIA 2V5FA 4L7TA 3AU5A 2AJAA 3FUMA 3PH0C 4P29A 3UINC 3TWUA 3DBSA 4RSYA 5G04C 2KZTB 2VQ2A 3MCXA 5BV1A 4JB8P 2WXHA 3Q9UC 5CBNA 3RO3A 4GTTA 3N71A 3NAWA 4HOSA 2CFZA 4TXRA 1TNYA 3FEYA 5EYLA 2LXMA 2A4ZA 3ZU7B 4YDWA 2FO7A 3FU0A 3B95A 2GRRB 1MHQA 4AVXA 4JEHA 5ITZF 3QJZA 4HXIA 5FINA 2BUGA 3TG4A 3HXDA 3PNLB 2EILE 3HRAA 3PVLA 3OXLA 4JL0A 1LTXA 4HLEA 2VGXA 4AY6A 3AS4A 3CSTA 5LCWJ 3D9OA 2WXJA 3D9PA 1E8XA 5CMWA 4UQZA 1D9SA 4EQFA 4ANXA 1K8KG 2L0IA 4CGWA 1Y8MA 3GZSA 1KT0A 2QFCA 2DYSE 3CK7A 2CG3A 3S7DA 4GZ6A 4AEZC 4HB5A 4J8YA 1O5MA 4A55A 4DI3A 2OVFA 3F6QA 2RD0A 5G05J 3CHOA 2HYZA 4ILHB 2WQ6A 4PUCA 4RQIA 3CQCB 2X3MA 3I5PA 5ENNA 5BT1A 4C9BB 3FU5A 4HQDA 1D8EA 2WMNA 1OCCE 3UX4A 4A1SA 2OEVA 3MGBA 4NQ0A 2MHKA 3VTXA 3GYZA 4ABNA 2IQCA 3ULQA 3TL5A 4WWNA 3ONKA 1IXVA 5JJ6A 1DCQA 2J49A 3ML8A 5T8IA 4I6GA 2YINA 3PUKA 4UWKA 2VGXB 2XRZA 3NOGD 4L1BA 3HVEA 2KC7A 5KNGA 2OOEA 1E7VA 3O48A 4GPKA 5EX0A 1EF1C 4I6EA 2KM4A 3ZEFA 4M3OA 3J5PA 1HZ4A 1E7UA 2WXFA 5KJKA 1NI1A 3UM3A 5CEAA 2DCPA 4CRWA 4FLBA 4WNDA 3MJWA 3ZYMA 1QZ2A 1Q2ZA 4BTAA 1EPUA 3FUJA 4HS2A 4H7YA 4I2ZA 3LXUX 5KJNA 3B7BA 3BEEA 5C2YA 4CDMA 3PE4A 2CHZA 2ETCA 3FFLA 2ONDA 5FTPA 4EPZA 3DPDA 3OAWA 4FC8A 5ANRA 1E8WA 5IY5E 5BW8C 4M7CA 2J9QA 3ZUVB 2XPZA 4G8KA 2XEVA 2GGFA 5HQ8A 3QB2A 3P2BA 3TWQA 3HVEB 2R05A 5EX3A 3D9KA 1TEZA 3BU8A 3RRMB 4PS3A 2PZIA 4PS8A 5LCWC 3UT8A 3ASDA 4KZ0A 3G2VA 4GZ3A 4TXPA 5AQ7A 1ZB1A 2Q7FA 3PRZA 4HBDA 5JHBA 2KCKA 3G2UA 3AU4A 2XQ0A 5AQ9A 3CQGB 4U0SA 5G05C 4JEUA 1H19A 4IRUA 2VSXE 1IKND 1BI8B 4IN3B 2R02A 2BKGA 1K3ZD 4YDYA 1N9AA 4GYOA 3B7RL 4F7AA 4FJZA 1E8YA 2ETAA 1H6PA 4CEMA 2WXRA 2XGOA 2BTDA 4BT9A 3SY2A 1RW2A 4OYSA 5ANLA 5B3SE 5AARA 4WNGA 4CGVA 3CK9A 4BSXA 2IO3C 5A6CA 3FUNA 4DPRA 4KVMA 4GA2A 4K5CA 1KZOA 3L16A 2V0PA 3ASFA 3DEPA 3VLEA 3ZN3A 1TN7A 2NYJA 1NP7A 1OWNA 4WWPA 3T8KA 1HXIA 3U3WA 4BESA 3Q49B 3TWRA 2Y3AA 3KSLA 2HO1A 3FEXA 3HXBA 3EHMA 3CVQA 4UWGA 1KLXA 2C2LA 2IO2C 4UI9J 2H6IA 3ONLA 1S0PA 3LVQE 1DCEA 5FQ6A 3RRNB 3HXEA 3MKRA 4U0UA 3MV2B 2GROB 4JD2G 1FVHA 4G25A 3L82A 2J09A 4URKA 3G2TA 1N4SA 4HLLA 4FLHA 3IHVA 3CVNA 3IXEA 4EECA 3PUJA 4LNUD 4GZ5A 4OVUA 4HORA 5JHAA 2WXOA 5EIBE 1N52A 1Z3XA 3L9TA 1OCRE 3NF1A 3LJNA 4MKTA 2E2EA 1OT8A 3EIQC 1H2UA 2XS1A 3JQ0A 4ANUA 1YCSB 3URZA 3RAUA 3D9HA 4CYMD 5D66A 4GYWA 4WWOA 4IULA 4HVBA 1IYGA 2DYRE 4A1GA 3E30A 4B8AA 3V30A 4ATGA 1WAO1 4N5QA 1WY6A 2UY1A 3E32A 3FUKA 3LY8A 2AVPA 3O4ZA 3JYSA 4KZCA 4BX8A 4Q96A 3SZ7A 3QC1A 2GRQB 1X81A 1OWMA 3KSQA 4F53A 3C3QA 2DWZA 3ZIMA 5J08A 3Q9NC 3C98A 5E75A 4HOUA 5EN5D 2X6JA 3HIZA 1S63A 1HE8A 2P58C 2AXZA 3W9FA 3CVWA 1FCHA 2WXPA 3SFYA 2C0LA 2X6IA 3C72A 4B89A 2XZTG 3LEWA 4GTRA 3D9LA 4LCTA 4GCNA 5AQBA 1SA5A 4HI8A 1HU3A 5CBOA 3BG1B 4U8YD 3FTWA 2E0IA 4UI9K 2R03A 2OV8A 4U63A 3APFA 1O1SA 1PC2A 1KPSB 3OTNA 3Q4AB 2IY0C 3I3NA 4AJWA 2UY1B 3KD7A 4DX1A 1BD8A 4GA1A 2QY7A 2C0MA 1N0RA 2L6JA 3ZPJA 4HFGA 2PQRA 4UWHA 3UQ3A 4XI0A 4DI4A 4KYOB 1YA0A 4UI9C 5D0OD 3AJIA 3LDZA 3ULYA 2XPYA 4OAUC 3UPVA 4J8FA 4NURA 3KS2A 3ZYKA 3Q15A 3Q5MA 2P2CP 1UN8A 5ARFA 4TXQA 3ULEG 3W9GA 3LJ3A 4U8HA 5CHEE 3U66A 3B7SA 3DPYA 3SD5A 1H2TC 5AAOA 5B1BE 1JWFA 4ILGA 3AS8A 3SQVA 2V8SE 4GPMA 3CVXA 1FVFA 4O6FA 2LAHA 1SZAA 2HM8A 5FZSA 5LX8A 4XI9A 3ML9A 3LYAA 2WQ7A 4GMLA 3C3RA 1AWCB 1TN6A 3NZUA 4B94A 5CRUA 4ILIA 3R9AB 2J08A 3RIBA 1JCRA 3LY9A 3V2OA 1FPPA 4RG9A 2JLBA 3PREA 4U8VD 3EUVA 1VDYA 3UIOC 4APOA 3BQOA 3HDXA 3OXFA 4I43A 2VGEA 4WNFA 3UIPC 3EU9A 3ESKA 3DXKG 5C1DA 5AJLA 1QQEA 4I1MA 2V4HC 4Y6WA 1KZPA 3ZYLA 2NC9A 2A5EA 4GCOA 1OCOE 3CEQA 1BPOA 4A3TA 4GZDA 3DRAA 4YDEA 2VJ8A 1EYHA 5H7PA 3FUHA 3RSEG 2HR2A 3DEOA 3PEUB 3KAEA 2WQHA 4J8EA 1BLXB 4KT6B 4A3VA 3CVPA 2EIJE 4ANWA 4L9PA 4TUUA 4L2YA 5CECB 2LXLA 3D9MA 3GZ2A 3UT4A 2KATA 3JQ1A 2F37A 5CEDB 4YVOA 2V5QC 3X2QE 3ABLE 3QOUA 5EYPF 4DUIA 3R9MA 1ELRA 4GTMA 2LUHA 4YVQC 4UUCA 4J0UA 5CERB 2DZNA 3CHMA 3QDNA 3ZKJA 1MX2A 4AY5A 1NA3A 4X8QA 4G26A 3QARA 4CCAA 3SGHA 3IHYA 4GTOA 1WM5A 1V54E 5ENOD 5JA4D 3KEZA 4N3AA 3TGOA 1TR4A 2IFUA 4V3IA 3CHQA 3I4GA 3S2AA 3HHMA 3IEGA 3KEAA 4FA6A 4BERA 4K5BA 2WXGA 4U0ZA 2X6HA 4D10C 1U3DA 2PM6A 1UN9A 2R5SA 5ENQD 3U4TA 1LD7A 4AM9A 1K1AA 1KT1A 1X5BA 3WG7E 3QAQA 5KJLA 1MYOA 1UJJA 4QFVA 5AENA 2XCCA 2I1JA 3HYMB 3FH5A 4N3BA 3TXMA 2NSZA 4L2LA 2IONA 4J8SA 1UG3A 5J90A 4TV3A 2VSNA 2AXUA 2ZISA 2XCBA 2HE0A 2IU1A 4K0RA 3E4BA 1OWPA 3ISMC 5DBKA 4BFRA 3FULA 4F1PA 5G55A 4HRMB 3ASHA 4DX7D 3NZSA 4AV7A 2GRLA 2R17C 2ZGGA 3DWLG 3LY7A 5D2MC 1NFIE 4PH4B 3FHEA 3FUFA 3UUXA 5JJ7A 3CLJA 4GTSA 4NIKA 1NL4A 3DSWA 5CCLA 2Y1LE 4CDNA 4PDXA 4RVBA 5A7DB 4U7EB 2FEZA 4I1OB 3APCA 3BUAA 2YNQA 1MQSA 3QWPA 1XNFA 3UTMA 4GZCA 4IYPA 2AXVA 1G3NB 3NOCD 3L08A 1WG0A 3UKRG 5EILA 1OWLA 5HRYA 1TNUA 3MA5A 2XEEA 5EKQD 1DC2A 1ZBPA 3T5XA 3CK8A 2QZAA 2DBAA 5T3RA 3JXIA 3L22A 2BKKB 3ENEA 2BF0X 2DIWA 3D3MA 3TXNA 3K9IA 4Q94A 4TUMA 1D8DA 2XRYA 4G24A 1O1TA 4JHRA 4UWFA 3J5QB 4BSZB 3ZGQA 4B0ZA 4JA9A 4FJYA 4LNBA 5FZQA 3FH8A 3CVUA 3QK0A 5ENSD 3UM2A 4APFA 2WB2A 3FH7A 2GRPB 3PS6A 3LCAA 3MV3B 3TWSA 3HXCA 4OAVB 1EDUA 2XZDG 3ASOE 4ANVA 2WXNA 1H0AA 2FBNA 3Q78A 3ABME 4UWLA 3SI5A 2VGYA 3FY4A 1N95A 1S64A 4B93B 4GMJA 3SF4A 1Z3YA 4LNGA 3SO8A 4FHKA 1WDYA 2Y0BG 1FT1A 4OVVA 1SZ9A 5FT9A 3FTYA 4I9EA 4HRNA 3BG0B 4XIFA 2P9SG 1A5EA 3Q7FA 4GTVA 3Q47B 4HRLA 1YYHA 1Z5SC 3FP3A 2X6KA 1S70B 2PQNA 3UKUG 1HFAA 3MX3A 4DLQA 3Q7AA 3TJPA 5FZRA 4LEUA 5BXUA 2YHCA 2ETBA 2DZOA 3CHPA 2NXPA 3MEKA 3FUDA 1JWGA 1LD8A 4ACLA 5ENRD 4H7XA 2Y4UA 4HNAD 3UI2A 2GRNB 1H6KA 4B8CB 4J8DA 3T8MA 4AP2A 3NB2A 4GTQA 2KCLA 2WXQA 4ACKA 4JHJA 2AWIA 3AG2E 2PM7A 1A17A 2IF4A 2VYIA 1HF8A 2QYJA 1TNOA 1U2VG 4LSZE 2AW6A 4DJAA 3V31A 3DSSA 5AYWD 3CKCA 4O1PA 4HOTA 3CGHA 3R7RA 3TWWA 1E96B 1HG5A 2J8SD 4GU5A 4DX2A 3GZ1A 4U96D 4CT0A 4Y6CA 2YHEA 4R7LA 3P1UA 3RK6A 2YQ8A 3EJNA 5AN8A 4N3CA 5BXOA 5ARGA 5KBAA 2VTBA 5M72A 5HS0A 2EIME 1QYMA 4LG6A 1YMPA 4Q69A 1MX4A 4GAAA 3JXJA 1OY3D 5AJDA 2GRMA 4LRZA 2RFMA 1XGWA 4J6IA 1HS6A 2PL2A 5FQ8A 2R2LA 3NBNB 1UOHA 4AOFA 2X6FA 3TAXA 3EDTB 5CMYA 5D0QD 4BY6A 4RG6A 2F8XK 3ZXSA 3EIJA 4ZHBA 3FWVA 2A5UA 4G11A 1SQMA 3IV0A 3MYVA 1AP7A 2LO6A 3PZDA 1JCQA 2H6GA 1IQRA 4ME2A 4BX9A 2H6HA 1PAQA 4I1AA 3PZ4A 4FADA 3L17A 3CV0A 3DSTA 2VTBB 3VTYA 3IKOB 2IEJA 2ZXWE 4JA7A 2JABA 1K1BA 2B6CA 5EDSA 2BEDA 4JVSA 2ZU6B 2P9KG 3S7BA 5BV0A 1IHBA 2XS8A 2P9IG 2LSUA 4JHKA 2RFAA 1MJ0A 3V79K 3QNKA 3FUIA 3EHRA 3UT7A 4MS6A 4BETA 5BUZA 4NACA 3FU3A 4GMRA 3PDNA 4FHJA 3FDHA 4K03A 3UMVA 3CHRA 2EINE 2WPVA 2KCVA 2MOWA 2J07A 3G2SA 4I9CA 4BTBA 2L6BA 3ZVVA 3Q73A 1HX8A 1MX6A 2CFUA 1H2VC 2MRIA 3FTZA 1ELWA 2LAIA 2P9NG 4Z68A 2X38A 5AQAA 4HOQA 3CVYA 2XPIA 4O60A 1W3BA 3L54A 3TWTA 4JW1A 2J4DA 4I6JA 3S7JA 4C48B 2FF4A 4FP7A 4NRHB 5FQ4A 3D9JA 2ZIRA 1P5QA 1Z6TA 2F0YA 3SBSA 4YDOA 4HI9A 2WXKA 3B7UX 5G2NA 4W9RA 4UQXA 1TJFA 2VSYA 3ASGA 4C0EA 4DRXE 1QNFA 1QBQA 1SVXA 3MZLB 3B7TA 1TN8A 5KJMA 3CR3A 2P9LG 4G2VA 3NQPA 1V55E 1N0QA 2XGSA 1JUQA 3PZ2A 3LS8A 1INZA 1TYQG 3RO2A 3QWWA 3JUEA 2WXMA 4PS7A 4GA0A 2WM9A 2J4BA 5CRVA 1N4RA 3C3OA 4WAFA 3UM0A 2Y69E 4EBAA 3T9KA 1IQUA 2I2OA 4MLPA 5LFAA 3CVVA 4FU3A 2IOLA 1N54A 3DSXA 4DK5A 2VSOE 4WUYA 2OEWA 5T4YA 4JPSA 1NZNA 3Q75A 3JCKC 1UJKA 3AAAC 4DX6D 3Q79A 5KCMA 3PEVB 4N5CA 4FULA 5FJYA 3AG1E 3HG0D 3CIAA 2EQXA 3ZHEA 5E76A 4WNEA 2L0TB 3PZ1A 2FO1E 5FWQA 5HI7A 2OCCE 3E37A 1OCZE 3C5RA 2WVIA 3FTXA 2LSVA 2MYOA 3ABKE 3PNTB 5BPPA 1OUVA 2FULA 4U07A 3LKUA 5JMND 3GW4A 3AG4E 4U95D 4N2QA 3DSUA 3B13A 2RKKA 4XX5A 4E6HA 4RLYA 2UWJG 1JPLA 3I4RB 1BU9A 2GW1A 2B0OE 3EHQA 4XZ4A 2XEHA 4N39A 3FTSA 5LP0A 1ELKA 1B89A 5BNWA 2M63A 2ILRA 3D9IA 3DXMG 2KXPC 3D9NA 4CT4A 2Y4TA 2QYUA 3ZHEB 3FTUA 2F8YA 2IJGX 2RG8A 3SFXA 4KXKB 3EHNA 2V4LA 5LOZA 4TRQA 3SHFA 2ZGDA 3EU5A 3TG5A 5A23A 1FT2A 5HKPA 4LUNU 5FQ7A 4F6RD 4BWRA 4CZ2D 1L5JA 4KBQA 3FUEA 3RKVA 1HG2A 1NA0A 2WXIA 4I17A 3APDA 1DVPA 1U3CA 3ZW3A 4XE0A 3HXFA 3TWXA 4KMOA 4XEIG 3MKQA 2P9PG 3VLFA 3SNXA 4GYYA 3T5VA 2CG2A 1N94A 1LF8A 1UW4B 4EZJA 4KVOA 4EBAG 3CSFA 5KWDA 2XENA 2FI7A 3U64A 4C0MA 1TNBA 3VLDA 3V2XA 5EIDA 1HH8A 3AS5A 1OWOA 1E90A 2WMOA 1MZCA 3WXXA 4ZFHA 3CHSA 1H6OA 2P9UG 1N4QA 2I9CA 4XKBA 2WXLA 4CDRA 3L6AA 5DIZA 5KNHD 3OXGA 1BI7B 3MKQB 1N4PA 4G1TA 4BEPA 2LNIA 2L9BA 2CHWA 4LERA 3PE3A 2H6FA 4J7WA 5G04J 3RU0A 4JC8A 3UM1A 3ZYQA 2KBXA 4EZLA 4L23A 2XHEA 4EHMA 2I1KA 3JUIA 3S7FA 4JXTA 5ENPD 3DSVA 1TNZA 4I2WA 2I6HA 4GB9A
chains in the Genus database with same CATH topology
1KT1A 4AIFA 2LSUA 1X5BA 5CCMA 3ASFA 3QAQA 4JHKA 5KJLA 1Y6IA 3VLEA 3ZN3A 4F3VA 3QNKA 3FUIA 3UT7A 4MS6A 1E8ZA 1NP7A 1OWNA 4WWPA 5BUZA 1HXIA 1UJJA 4QFVA 5AENA 3U3WA 4NACA 3FU3A 3Q49B 2XCCA 2I1JA 3HYMB 3PDNA 3FH5A 4FHJA 2Y3AA 3FDHA 1HO8A 4N3BA 3TXMA 2HO1A 4K03A 2NSZA 4L2LA 3UMVA 3FEXA 2IONA 3EHMA 4J8SA 3RJVA 1UG3A 5J90A 4EZKA 3CHRA 3QKYA 4TV3A 2VSNA 2AXUA 2WPVA 3CVQA 2KCVA 4UWGA 1KLXA 2C2LA 2MOWA 2XCBA 2J07A 4YNDA 1GW6A 3G2SA 2IU1A 4I9CA 4UI9J 4K0RA 4BTBA 3ONLA 3ZVVA 1S0PA 3LVQE 3E4BA 1OWPA 3CVLA 5FQ6A 5DBKA 3RRNB 3FU6A 3MKRA 1HX8A 2R59A 3MV2B 4U0UA 4BFRA 1TJCA 1DNPA 2JEKA 3FULA 2CFUA 1FVHA 4G25A 1H2VC 2J09A 4AXHA 2MRIA 4URKA 5G55A 3G2TA 5AIJA 3FTZA 2KZTA 3ASHA 4FLHA 4XKCA 3IHVA 3NZSA 1ELWA 2LAIA 4AV7A 2GRLA 3CVNA 2R17C 2X38A 3CKBA 3PUJA 4EECA 4HOQA 2OVBA 4DLOA 3U9WA 4GZ5A 3CVYA 4OVUA 2XPIA 4HORA 1W3BA 2CHXA 2WXOA 5JHAA 3L54A 3RRUA 4JW1A 2J4DA 1N52A 1Z3XA 3LY7A 3LPZA 4I6JA 4MRUA 3S7JA 2FF4A 3NF1A 4FP7A 4PH4B 4N2SA 3FHEA 3FUFA 4MKTA 2XGMA 4NRHB 5FQ4A 2E2EA 2IOSA 3EIQC 3D9JA 3UUXA 1H2UA 3G2WA 3ZFWA 3ZRHA 1P5QA 1Z6TA 5JJ7A 3CLJA 3JQ0A 4ANUA 1ZU2A 3URZA 3R7QA 5CCLA 3SBSA 4G23A 3SBTB 4BT8A 2WXKA 3B7UX 3SFZA 4CDNA 4GYWA 4WWOA 5G2NA 4IULA 5JJTA 3L13A 3IBEA 3ESLA 4PDXA 4JZYA 4RVBA 4W9RA 4HVBA 5A7DB 4UQXA 4E85A 1IYGA 4B8AA 4A1GA 1TJFA 2VSYA 3ASGA 4C0EA 1PY1A 1QNFA 2FEZA 3MZLB 3FTVA 4I1OB 3B7TA 3APCA 4UQYA 1WAO1 4ATGA 5KJMA 1WY6A 3LVRE 4U04A 2UY1A 3FUKA 3CR3A 4F1SA 4G2VA 2YNQA 3LY8A 3NQPA 1IHGA 2AVPA 3QWVA 1MQSA 3O4ZA 3JYSA 2V5FA 3QWPA 4KZCA 2XGSA 1XNFA 4BX8A 4Q96A 1JUQA 3SZ7A 3QC1A 1OWMA 4GZCA 4IYPA 4L7TA 3AU5A 2AXVA 4F53A 3FUMA 3L08A 3PH0C 4P29A 3LS8A 1INZA 3ZIMA 5J08A 3DBSA 4RSYA 5G04C 3C98A 2KZTB 2VQ2A 3RO2A 1OWLA 5E75A 4HOUA 3MCXA 3QWWA 5BV1A 3MA5A 2X6JA 2WXMA 4PS7A 3HIZA 2WXHA 5EKQD 4GA0A 1HE8A 2P58C 1ZBPA 3T5XA 2AXZA 2WM9A 2J4BA 3CK8A 3RO3A 3CVWA 1FCHA 2DBAA 2WXPA 5T3RA 3N71A 4HOSA 2C0LA 2X6IA 4WAFA 4B89A 3LEWA 3L22A 3D9LA 4LCTA 4EBAA 4GCNA 3ENEA 1IQUA 2I2OA 2CFZA 4MLPA 3FEYA 5LFAA 2BF0X 3CVVA 2DIWA 2A4ZA 4FU3A 1HU3A 3D3MA 3TXNA 3BG1B 3FTWA 2FO7A 3FU0A 2IOLA 1N54A 4DK5A 1MHQA 2E0IA 3K9IA 4Q94A 2VSOE 4UI9K 4WUYA 5T4YA 2OV8A 4AVXA 4JEHA 2XRYA 3QJZA 4JPSA 1NZNA 4G24A 4JHRA 4UWFA 4U63A 3APFA 3JCKC 1UJKA 3ZGQA 1PC2A 4HXIA 4B0ZA 4JA9A 2BUGA 4FJYA 3OTNA 5FZQA 3FH8A 3Q4AB 3TG4A 3I3NA 5KCMA 4AJWA 3PEVB 3QK0A 4N5CA 3CVUA 2UY1B 3KD7A 3PNLB 4GA1A 3PVLA 4FULA 2QY7A 2C0MA 5FJYA 4APFA 3OXLA 4JL0A 2WB2A 3FH7A 2L6JA 3CIAA 4HLEA 3ZPJA 3PS6A 2EQXA 4HFGA 3ZHEA 3LCAA 2VGXA 4AY6A 3MV3B 3AS4A 5E76A 3CSTA 4WNEA 5LCWJ 1EDUA 2PQRA 2L0TB 3D9OA 4UWHA 2WXJA 3D9PA 5FWQA 1E8XA 5HI7A 3UQ3A 5CMWA 4XI0A 4UQZA 2WXNA 1YA0A 4KYOB 4UI9C 5D0OD 4ANVA 3LDZA 4DI4A 2XPYA 1H0AA 4EQFA 2WVIA 3FTXA 2FBNA 4ANXA 2L0IA 4CGWA 4J8FA 4UWLA 4NURA 3UPVA 1Y8MA 3SI5A 2LSVA 3GZSA 3KS2A 3ZYKA 2VGYA 3FY4A 3PNTB 5BPPA 1KT0A 3Q15A 2QFCA 3Q5MA 1OUVA 1UN8A 2FULA 2CG3A 3CK7A 4U07A 3S7DA 4GZ6A 5ARFA 4AEZC 3LKUA 3LJ3A 4U8HA 3GW4A 4GMJA 2OVFA 5CHEE 3SF4A 4A55A 4DI3A 3U66A 2RD0A 4N2QA 3B7SA 5G05J 1Z3YA 2HYZA 3CHOA 3B13A 4ILHB 3SD5A 1H2TC 4PUCA 2WQ6A 3CQCB 4XX5A 4FHKA 1JWFA 2X3MA 4ILGA 4E6HA 4OVVA 3I5PA 1SZ9A 2UWJG 1JPLA 5ENNA 5FT9A 3AS8A 5BT1A 3FTYA 3I4RB 4I9EA 2GW1A 4C9BB 2V8SE 3BG0B 3CVXA 4XZ4A 4XIFA 1FVFA 3FU5A 3FTSA 4N39A 4O6FA 5LP0A 1ELKA 2WMNA 1B89A 2LAHA 1SZAA 3UX4A 3Q47B 5BNWA 2HM8A 2M63A 2ILRA 3D9IA 5FZSA 4A1SA 3FP3A 3MGBA 4NQ0A 2X6KA 5LX8A 2PQNA 4XI9A 2MHKA 3ML9A 3LYAA 3D9NA 3VTXA 2WQ7A 1HFAA 3GYZA 3MX3A 4GMLA 4ABNA 4DLQA 2IQCA 3ULQA 3TJPA 5FZRA 4LEUA 3TL5A 4WWNA 2YHCA 3ONKA 4CT4A 3CHPA 5JJ6A 2NXPA 2J49A 3NZUA 3ML8A 2Y4TA 3MEKA 4I6GA 5T8IA 4B94A 3FUDA 1JWGA 4ILIA 4ACLA 2YINA 3R9AB 4H7XA 2J08A 3PUKA 2Y4UA 3ZHEB 3RIBA 3FTUA 2VGXB 4UWKA 2XRZA 3LY9A 2IJGX 4L1BA 2RG8A 4B8CB 4KXKB 1H6KA 3EHNA 3HVEA 2V4LA 4RG9A 2JLBA 3PREA 4J8DA 2KC7A 5LOZA 3T8MA 4TRQA 2OOEA 1VDYA 1E7VA 3SHFA 4AP2A 3O48A 4GPKA 5EX0A 2KCLA 1EF1C 2WXQA 4I6EA 4ACKA 2KM4A 4APOA 4JHJA 3TG5A 3OXFA 3HDXA 4I43A 3ZEFA 4M3OA 5A23A 1HZ4A 4WNFA 1E7UA 4LUNU 5FQ7A 2WXFA 5KJKA 4BWRA 2AWIA 1L5JA 3ESKA 4KBQA 5C1DA 3FUEA 5AJLA 2DCPA 3RKVA 2PM7A 4CRWA 1A17A 4FLBA 1HG2A 1NA0A 1QQEA 4WNDA 2IF4A 2WXIA 3MJWA 4I1MA 3ZYMA 2VYIA 1QZ2A 4I17A 3APDA 4Y6WA 1DVPA 3ZYLA 1HF8A 1U3CA 4BTAA 1EPUA 2NC9A 3ZW3A 3FUJA 4XE0A 4KMOA 3MKQA 4GCOA 2AW6A 4DJAA 4HS2A 4H7YA 3VLFA 4I2ZA 3SNXA 3LXUX 3CEQA 5KJNA 4GYYA 1BPOA 4A3TA 4GZDA 5AYWD 3T5VA 3BEEA 3CKCA 2CG2A 2VJ8A 1EYHA 5C2YA 4CDMA 4HOTA 3CGHA 3R7RA 1LF8A 2CHZA 3FFLA 3FUHA 2ONDA 2HR2A 3PE4A 1E96B 1UW4B 4EZJA 3PEUB 1HG5A 4GU5A 3KAEA 2WQHA 5FTPA 4J8EA 4KVOA 3GZ1A 4KT6B 4A3VA 3CVPA 4ANWA 4EBAG 4EPZA 3DPDA 3OAWA 4CT0A 4FC8A 4Y6CA 3CSFA 5ANRA 1E8WA 5BW8C 2YHEA 4TUUA 2J9QA 4R7LA 4L2YA 2FI7A 3P1UA 2XPZA 3RK6A 2XEVA 2YQ8A 2GGFA 3U64A 3QB2A 5HQ8A 3P2BA 3EJNA 4C0MA 3VLDA 1HH8A 3D9MA 3GZ2A 3AS5A 3HVEB 1OWOA 4N3CA 3UT4A 5ARGA 5EX3A 2VTBA 3D9KA 2KATA 5M72A 1TEZA 3JQ1A 1E90A 3RRMB 4PS3A 2WMOA 2PZIA 4YVOA 3QOUA 4PS8A 4Q69A 5LCWC 4GAAA 3UT8A 3ASDA 3WXXA 1ELRA 4KZ0A 3CHSA 5AJDA 4YVQC 3G2VA 4GZ3A 2GRMA 4LRZA 4J0UA 2I9CA 4XKBA 3CHMA 2WXLA 3QDNA 1XGWA 3L6AA 4CDRA 5DIZA 2Q7FA 4J6IA 3PRZA 4AY5A 3OXGA 1HS6A 5JHBA 1NA3A 2PL2A 5FQ8A 2KCKA 3G2UA 4G26A 3MKQB 3QARA 4CCAA 3AU4A 2XQ0A 4AOFA 3CQGB 4U0SA 2X6FA 4G1TA 5G05C 4JEUA 3SGHA 3IHYA 2LNIA 2L9BA 3TAXA 1H19A 4IRUA 1WM5A 3EDTB 2VSXE 5CMYA 2CHWA 4LERA 3PE3A 5D0QD 4BY6A 4RG6A 4IN3B 3KEZA 3ZXSA 3EIJA 4N3AA 3TGOA 5G04J 2IFUA 3FWVA 2A5UA 4G11A 3RU0A 4V3IA 3CHQA 4JC8A 1SQMA 3IV0A 3MYVA 3I4GA 3S2AA 4GYOA 2LO6A 3PZDA 3HHMA 3IEGA 3B7RL 4F7AA 4FJZA 1E8YA 3ZYQA 4FA6A 1IQRA 4ME2A 2WXGA 4BX9A 4CEMA 4EZLA 4L23A 2WXRA 2XGOA 2BTDA 4BT9A 2XHEA 1PAQA 4I1AA 4U0ZA 4FADA 2X6HA 4D10C 2I1KA 3JUIA 3CV0A 3L17A 4JXTA 1U3DA 3S7FA 2VTBB 3VTYA 4OYSA 3IKOB 2PM6A 4JA7A 5ANLA 4I2WA 4WNGA 1UN9A 4CGVA 3CK9A 4BSXA 5A6CA 2R5SA 5EDSA 3FUNA 4DPRA 3U4TA 4JVSA 4KVMA 2ZU6B 2I6HA 4GA2A 3S7BA 5BV0A 3L16A 4AM9A 2V0PA 4GB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT1 A;  4AIF A;  2LSU A;  5CCM A;  3ASF A;  5KJL A;  3ZN3 A;  4F3V A;  1HXI A;  3U3W A;  3Q49 B;  2XCC A;  3HYM B;  3PDN A;  4N3B A;  2HO1 A;  3RJV A;  3QKY A;  2VSN A;  2WPV A;  3CVQ A;  2KCV A;  1KLX A;  2C2L A;  2XCB A;  4YND A;  4I9C A;  4UI9 J;  4BTB A;  3E4B A;  3CVL A;  5DBK A;  3MKR A;  4U0U A;  3MV2 B;  1TJC A;  4G25 A;  3ASH A;  1ELW A;  3CVN A;  3CKB A;  4HOQ A;  4GZ5 A;  4HOR A;  2XPI A;  1W3B A;  3LY7 A;  3S7J A;  3LPZ A;  2FF4 A;  3NF1 A;  4N2S A;  2XGM A;  4NRH B;  2E2E A;  3UUX A;  3ZFW A;  1P5Q A;  5JJ7 A;  1ZU2 A;  3URZ A;  5CCL A;  4G23 A;  4BT8 A;  4GYW A;  5JJT A;  4W9R A;  5A7D B;  4UQX A;  1IYG A;  2VSY A;  3ASG A;  2FEZ A;  4UQY A;  1WAO 1;  5KJM A;  4U04 A;  2UY1 A;  4G2V A;  3LY8 A;  1IHG A;  2AVP A;  3QWV A;  3JYS A;  2V5F A;  3QWP A;  2XGS A;  1XNF A;  3SZ7 A;  5G04 C;  2VQ2 A;  3RO2 A;  4HOU A;  3QWW A;  3MA5 A;  5EKQ D;  4GA0 A;  2P58 C;  1ZBP A;  3CK8 A;  3RO3 A;  1FCH A;  2DBA A;  3N71 A;  4HOS A;  2C0L A;  4GCN A;  2FO7 A;  3K9I A;  4UI9 K;  4WUY A;  1NZN A;  4G24 A;  4JHR A;  3ZGQ A;  1PC2 A;  4JA9 A;  2BUG A;  5FZQ A;  3Q4A B;  3TG4 A;  4N5C A;  2UY1 B;  3KD7 A;  4GA1 A;  2C0M A;  5FJY A;  3OXL A;  4JL0 A;  2L6J A;  3ZPJ A;  3ZHE A;  3LCA A;  2VGX A;  4AY6 A;  3MV3 B;  3AS4 A;  4WNE A;  5LCW J;  2PQR A;  5HI7 A;  3UQ3 A;  4XI0 A;  4UQZ A;  4KYO B;  1YA0 A;  4UI9 C;  5D0O D;  4EQF A;  2FBN A;  4CGW A;  4J8F A;  3UPV A;  1Y8M A;  2LSV A;  3KS2 A;  2VGY A;  1KT0 A;  3Q15 A;  2QFC A;  3Q5M A;  1OUV A;  3CK7 A;  4U07 A;  3S7D A;  4GZ6 A;  5ARF A;  3LKU A;  3GW4 A;  3SF4 A;  5CHE E;  4N2Q A;  5G05 J;  2HYZ A;  2UWJ G;  5FT9 A;  3AS8 A;  5BT1 A;  4I9E A;  2GW1 A;  4XIF A;  4N39 A;  4O6F A;  1B89 A;  3Q47 B;  5BNW A;  5FZS A;  4A1S A;  3FP3 A;  4NQ0 A;  2PQN A;  4XI9 A;  2MHK A;  3LYA A;  3VTX A;  3GYZ A;  4ABN A;  3ULQ A;  5FZR A;  4LEU A;  2YHC A;  5JJ6 A;  2Y4T A;  3MEK A;  4B94 A;  3R9A B;  4H7X A;  2Y4U A;  3ZHE B;  3RIB A;  2VGX B;  3LY9 A;  4KXK B;  4RG9 A;  2JLB A;  4J8D A;  2KC7 A;  2OOE A;  3O48 A;  4GPK A;  5EX0 A;  2KCL A;  4APO A;  3TG5 A;  3OXF A;  1HZ4 A;  4WNF A;  5KJK A;  4BWR A;  3ESK A;  4KBQ A;  5C1D A;  3RKV A;  1A17 A;  1QQE A;  1NA0 A;  4WND A;  2IF4 A;  2VYI A;  1QZ2 A;  4I17 A;  4Y6W A;  4BTA A;  2NC9 A;  4GCO A;  4H7Y A;  4I2Z A;  3CEQ A;  5KJN A;  4GYY A;  5AYW D;  3BEE A;  3CKC A;  4HOT A;  3FFL A;  3PE4 A;  2OND A;  2HR2 A;  1E96 B;  3KAE A;  2WQH A;  5FTP A;  4J8E A;  3GZ1 A;  3CVP A;  4Y6C A;  5BW8 C;  2J9Q A;  2FI7 A;  2XEV A;  2YQ8 A;  5HQ8 A;  1HH8 A;  3GZ2 A;  3AS5 A;  4N3C A;  5ARG A;  5EX3 A;  2KAT A;  5M72 A;  2PZI A;  4YVO A;  3QOU A;  5LCW C;  3ASD A;  3WXX A;  1ELR A;  4YVQ C;  4GZ3 A;  4J0U A;  3QDN A;  4CDR A;  5DIZ A;  2Q7F A;  4AY5 A;  3OXG A;  1NA3 A;  2PL2 A;  2KCK A;  4G26 A;  4U0S A;  5G05 C;  4G1T A;  2LNI A;  3TAX A;  1WM5 A;  3EDT B;  3PE3 A;  5D0Q D;  4RG6 A;  4IN3 B;  4N3A A;  3TGO A;  5G04 J;  2IFU A;  3FWV A;  3RU0 A;  4GYO A;  3IEG A;  4ME2 A;  4BT9 A;  2XGO A;  4I1A A;  4U0Z A;  3CV0 A;  3S7F A;  3VTY A;  4JA7 A;  4I2W A;  4WNG A;  4CGV A;  3CK9 A;  5A6C A;  2R5S A;  3U4T A;  2I6H A;  4GA2 A;  3S7B A;  4AM9 A; 
#chains in the Genus database with same CATH topology
 4K5A B;  4AIF A;  1N11 A;  5FIO A;  5CCM A;  3TWV A;  1Y6I A;  4F3V A;  1E8Z A;  1RZ4 A;  3PZ3 A;  1HO8 A;  5B1A E;  3RJV A;  1JCS A;  4EZK A;  3QKY A;  2EIK E;  4YND A;  1GW6 A;  3E34 A;  1OXJ A;  3CVL A;  3FU6 A;  3ZXP A;  2R59 A;  1TJC A;  1DNP A;  2JEK A;  5ENT D;  4MBG A;  4AXH A;  5AIJ A;  2KZT A;  4O1O A;  4XKC A;  3CKB A;  2OVB A;  4GTP A;  4DLO A;  3U9W A;  2DVW A;  2CHX A;  3RRU A;  1SA4 A;  4MRU A;  3LPZ A;  4DX5 D;  4N2S A;  3E33 A;  2XGM A;  2IOS A;  3G2W A;  3ZFW A;  3ZRH A;  1O1R A;  3ZNG A;  1ZU2 A;  3R7Q A;  2PNN A;  4G23 A;  3SBT B;  4BT8 A;  3SFZ A;  4G8L A;  5JJT A;  3L13 A;  3IBE A;  3ESL A;  4JZY A;  4E85 A;  1PY1 A;  4ATZ D;  3FTV A;  4A63 B;  3AG3 E;  4UQY A;  1SW6 A;  2QC9 A;  3UXG A;  4U04 A;  3LVR E;  4F1S A;  1IHG A;  3ASN E;  3QWV A;  4QQI A;  2V5F A;  4L7T A;  3AU5 A;  2AJA A;  3FUM A;  3PH0 C;  4P29 A;  3UIN C;  3TWU A;  3DBS A;  4RSY A;  5G04 C;  2KZT B;  2VQ2 A;  3MCX A;  5BV1 A;  4JB8 P;  2WXH A;  3Q9U C;  5CBN A;  3RO3 A;  4GTT A;  3N71 A;  3NAW A;  4HOS A;  2CFZ A;  4TXR A;  1TNY A;  3FEY A;  5EYL A;  2LXM A;  2A4Z A;  3ZU7 B;  4YDW A;  2FO7 A;  3FU0 A;  3B95 A;  2GRR B;  1MHQ A;  4AVX A;  4JEH A;  5ITZ F;  3QJZ A;  4HXI A;  5FIN A;  2BUG A;  3TG4 A;  3HXD A;  3PNL B;  2EIL E;  3HRA A;  3PVL A;  3OXL A;  4JL0 A;  1LTX A;  4HLE A;  2VGX A;  4AY6 A;  3AS4 A;  3CST A;  5LCW J;  3D9O A;  2WXJ A;  3D9P A;  1E8X A;  5CMW A;  4UQZ A;  1D9S A;  4EQF A;  4ANX A;  1K8K G;  2L0I A;  4CGW A;  1Y8M A;  3GZS A;  1KT0 A;  2QFC A;  2DYS E;  3CK7 A;  2CG3 A;  3S7D A;  4GZ6 A;  4AEZ C;  4HB5 A;  4J8Y A;  1O5M A;  4A55 A;  4DI3 A;  2OVF A;  3F6Q A;  2RD0 A;  5G05 J;  3CHO A;  2HYZ A;  4ILH B;  2WQ6 A;  4PUC A;  4RQI A;  3CQC B;  2X3M A;  3I5P A;  5ENN A;  5BT1 A;  4C9B B;  3FU5 A;  4HQD A;  1D8E A;  2WMN A;  1OCC E;  3UX4 A;  4A1S A;  2OEV A;  3MGB A;  4NQ0 A;  2MHK A;  3VTX A;  3GYZ A;  4ABN A;  2IQC A;  3ULQ A;  3TL5 A;  4WWN A;  3ONK A;  1IXV A;  5JJ6 A;  1DCQ A;  2J49 A;  3ML8 A;  5T8I A;  4I6G A;  2YIN A;  3PUK A;  4UWK A;  2VGX B;  2XRZ A;  3NOG D;  4L1B A;  3HVE A;  2KC7 A;  5KNG A;  2OOE A;  1E7V A;  3O48 A;  4GPK A;  5EX0 A;  1EF1 C;  4I6E A;  2KM4 A;  3ZEF A;  4M3O A;  3J5P A;  1HZ4 A;  1E7U A;  2WXF A;  5KJK A;  1NI1 A;  3UM3 A;  5CEA A;  2DCP A;  4CRW A;  4FLB A;  4WND A;  3MJW A;  3ZYM A;  1QZ2 A;  1Q2Z A;  4BTA A;  1EPU A;  3FUJ A;  4HS2 A;  4H7Y A;  4I2Z A;  3LXU X;  5KJN A;  3B7B A;  3BEE A;  5C2Y A;  4CDM A;  3PE4 A;  2CHZ A;  2ETC A;  3FFL A;  2OND A;  5FTP A;  4EPZ A;  3DPD A;  3OAW A;  4FC8 A;  5ANR A;  1E8W A;  5IY5 E;  5BW8 C;  4M7C A;  2J9Q A;  3ZUV B;  2XPZ A;  4G8K A;  2XEV A;  2GGF A;  5HQ8 A;  3QB2 A;  3P2B A;  3TWQ A;  3HVE B;  2R05 A;  5EX3 A;  3D9K A;  1TEZ A;  3BU8 A;  3RRM B;  4PS3 A;  2PZI A;  4PS8 A;  5LCW C;  3UT8 A;  3ASD A;  4KZ0 A;  3G2V A;  4GZ3 A;  4TXP A;  5AQ7 A;  1ZB1 A;  2Q7F A;  3PRZ A;  4HBD A;  5JHB A;  2KCK A;  3G2U A;  3AU4 A;  2XQ0 A;  5AQ9 A;  3CQG B;  4U0S A;  5G05 C;  4JEU A;  1H19 A;  4IRU A;  2VSX E;  1IKN D;  1BI8 B;  4IN3 B;  2R02 A;  2BKG A;  1K3Z D;  4YDY A;  1N9A A;  4GYO A;  3B7R L;  4F7A A;  4FJZ A;  1E8Y A;  2ETA A;  1H6P A;  4CEM A;  2WXR A;  2XGO A;  2BTD A;  4BT9 A;  3SY2 A;  1RW2 A;  4OYS A;  5ANL A;  5B3S E;  5AAR A;  4WNG A;  4CGV A;  3CK9 A;  4BSX A;  2IO3 C;  5A6C A;  3FUN A;  4DPR A;  4KVM A;  4GA2 A;  4K5C A;  1KZO A;  3L16 A;  2V0P A;  3ASF A;  3DEP A;  3VLE A;  3ZN3 A;  1TN7 A;  2NYJ A;  1NP7 A;  1OWN A;  4WWP A;  3T8K A;  1HXI A;  3U3W A;  4BES A;  3Q49 B;  3TWR A;  2Y3A A;  3KSL A;  2HO1 A;  3FEX A;  3HXB A;  3EHM A;  3CVQ A;  4UWG A;  1KLX A;  2C2L A;  2IO2 C;  4UI9 J;  2H6I A;  3ONL A;  1S0P A;  3LVQ E;  1DCE A;  5FQ6 A;  3RRN B;  3HXE A;  3MKR A;  4U0U A;  3MV2 B;  2GRO B;  4JD2 G;  1FVH A;  4G25 A;  3L82 A;  2J09 A;  4URK A;  3G2T A;  1N4S A;  4HLL A;  4FLH A;  3IHV A;  3CVN A;  3IXE A;  4EEC A;  3PUJ A;  4LNU D;  4GZ5 A;  4OVU A;  4HOR A;  5JHA A;  2WXO A;  5EIB E;  1N52 A;  1Z3X A;  3L9T A;  1OCR E;  3NF1 A;  3LJN A;  4MKT A;  2E2E A;  1OT8 A;  3EIQ C;  1H2U A;  2XS1 A;  3JQ0 A;  4ANU A;  1YCS B;  3URZ A;  3RAU A;  3D9H A;  4CYM D;  5D66 A;  4GYW A;  4WWO A;  4IUL A;  4HVB A;  1IYG A;  2DYR E;  4A1G A;  3E30 A;  4B8A A;  3V30 A;  4ATG A;  1WAO 1;  4N5Q A;  1WY6 A;  2UY1 A;  3E32 A;  3FUK A;  3LY8 A;  2AVP A;  3O4Z A;  3JYS A;  4KZC A;  4BX8 A;  4Q96 A;  3SZ7 A;  3QC1 A;  2GRQ B;  1X81 A;  1OWM A;  3KSQ A;  4F53 A;  3C3Q A;  2DWZ A;  3ZIM A;  5J08 A;  3Q9N C;  3C98 A;  5E75 A;  4HOU A;  5EN5 D;  2X6J A;  3HIZ A;  1S63 A;  1HE8 A;  2P58 C;  2AXZ A;  3W9F A;  3CVW A;  1FCH A;  2WXP A;  3SFY A;  2C0L A;  2X6I A;  3C72 A;  4B89 A;  2XZT G;  3LEW A;  4GTR A;  3D9L A;  4LCT A;  4GCN A;  5AQB A;  1SA5 A;  4HI8 A;  1HU3 A;  5CBO A;  3BG1 B;  4U8Y D;  3FTW A;  2E0I A;  4UI9 K;  2R03 A;  2OV8 A;  4U63 A;  3APF A;  1O1S A;  1PC2 A;  1KPS B;  3OTN A;  3Q4A B;  2IY0 C;  3I3N A;  4AJW A;  2UY1 B;  3KD7 A;  4DX1 A;  1BD8 A;  4GA1 A;  2QY7 A;  2C0M A;  1N0R A;  2L6J A;  3ZPJ A;  4HFG A;  2PQR A;  4UWH A;  3UQ3 A;  4XI0 A;  4DI4 A;  4KYO B;  1YA0 A;  4UI9 C;  5D0O D;  3AJI A;  3LDZ A;  3ULY A;  2XPY A;  4OAU C;  3UPV A;  4J8F A;  4NUR A;  3KS2 A;  3ZYK A;  3Q15 A;  3Q5M A;  2P2C P;  1UN8 A;  5ARF A;  4TXQ A;  3ULE G;  3W9G A;  3LJ3 A;  4U8H A;  5CHE E;  3U66 A;  3B7S A;  3DPY A;  3SD5 A;  1H2T C;  5AAO A;  5B1B E;  1JWF A;  4ILG A;  3AS8 A;  3SQV A;  2V8S E;  4GPM A;  3CVX A;  1FVF A;  4O6F A;  2LAH A;  1SZA A;  2HM8 A;  5FZS A;  5LX8 A;  4XI9 A;  3ML9 A;  3LYA A;  2WQ7 A;  4GML A;  3C3R A;  1AWC B;  1TN6 A;  3NZU A;  4B94 A;  5CRU A;  4ILI A;  3R9A B;  2J08 A;  3RIB A;  1JCR A;  3LY9 A;  3V2O A;  1FPP A;  4RG9 A;  2JLB A;  3PRE A;  4U8V D;  3EUV A;  1VDY A;  3UIO C;  4APO A;  3BQO A;  3HDX A;  3OXF A;  4I43 A;  2VGE A;  4WNF A;  3UIP C;  3EU9 A;  3ESK A;  3DXK G;  5C1D A;  5AJL A;  1QQE A;  4I1M A;  2V4H C;  4Y6W A;  1KZP A;  3ZYL A;  2NC9 A;  2A5E A;  4GCO A;  1OCO E;  3CEQ A;  1BPO A;  4A3T A;  4GZD A;  3DRA A;  4YDE A;  2VJ8 A;  1EYH A;  5H7P A;  3FUH A;  3RSE G;  2HR2 A;  3DEO A;  3PEU B;  3KAE A;  2WQH A;  4J8E A;  1BLX B;  4KT6 B;  4A3V A;  3CVP A;  2EIJ E;  4ANW A;  4L9P A;  4TUU A;  4L2Y A;  5CEC B;  2LXL A;  3D9M A;  3GZ2 A;  3UT4 A;  2KAT A;  3JQ1 A;  2F37 A;  5CED B;  4YVO A;  2V5Q C;  3X2Q E;  3ABL E;  3QOU A;  5EYP F;  4DUI A;  3R9M A;  1ELR A;  4GTM A;  2LUH A;  4YVQ C;  4UUC A;  4J0U A;  5CER B;  2DZN A;  3CHM A;  3QDN A;  3ZKJ A;  1MX2 A;  4AY5 A;  1NA3 A;  4X8Q A;  4G26 A;  3QAR A;  4CCA A;  3SGH A;  3IHY A;  4GTO A;  1WM5 A;  1V54 E;  5ENO D;  5JA4 D;  3KEZ A;  4N3A A;  3TGO A;  1TR4 A;  2IFU A;  4V3I A;  3CHQ A;  3I4G A;  3S2A A;  3HHM A;  3IEG A;  3KEA A;  4FA6 A;  4BER A;  4K5B A;  2WXG A;  4U0Z A;  2X6H A;  4D10 C;  1U3D A;  2PM6 A;  1UN9 A;  2R5S A;  5ENQ D;  3U4T A;  1LD7 A;  4AM9 A;  1K1A A;  1KT1 A;  1X5B A;  3WG7 E;  3QAQ A;  5KJL A;  1MYO A;  1UJJ A;  4QFV A;  5AEN A;  2XCC A;  2I1J A;  3HYM B;  3FH5 A;  4N3B A;  3TXM A;  2NSZ A;  4L2L A;  2ION A;  4J8S A;  1UG3 A;  5J90 A;  4TV3 A;  2VSN A;  2AXU A;  2ZIS A;  2XCB A;  2HE0 A;  2IU1 A;  4K0R A;  3E4B A;  1OWP A;  3ISM C;  5DBK A;  4BFR A;  3FUL A;  4F1P A;  5G55 A;  4HRM B;  3ASH A;  4DX7 D;  3NZS A;  4AV7 A;  2GRL A;  2R17 C;  2ZGG A;  3DWL G;  3LY7 A;  5D2M C;  1NFI E;  4PH4 B;  3FHE A;  3FUF A;  3UUX A;  5JJ7 A;  3CLJ A;  4GTS A;  4NIK A;  1NL4 A;  3DSW A;  5CCL A;  2Y1L E;  4CDN A;  4PDX A;  4RVB A;  5A7D B;  4U7E B;  2FEZ A;  4I1O B;  3APC A;  3BUA A;  2YNQ A;  1MQS A;  3QWP A;  1XNF A;  3UTM A;  4GZC A;  4IYP A;  2AXV A;  1G3N B;  3NOC D;  3L08 A;  1WG0 A;  3UKR G;  5EIL A;  1OWL A;  5HRY A;  1TNU A;  3MA5 A;  2XEE A;  5EKQ D;  1DC2 A;  1ZBP A;  3T5X A;  3CK8 A;  2QZA A;  2DBA A;  5T3R A;  3JXI A;  3L22 A;  2BKK B;  3ENE A;  2BF0 X;  2DIW A;  3D3M A;  3TXN A;  3K9I A;  4Q94 A;  4TUM A;  1D8D A;  2XRY A;  4G24 A;  1O1T A;  4JHR A;  4UWF A;  3J5Q B;  4BSZ B;  3ZGQ A;  4B0Z A;  4JA9 A;  4FJY A;  4LNB A;  5FZQ A;  3FH8 A;  3CVU A;  3QK0 A;  5ENS D;  3UM2 A;  4APF A;  2WB2 A;  3FH7 A;  2GRP B;  3PS6 A;  3LCA A;  3MV3 B;  3TWS A;  3HXC A;  4OAV B;  1EDU A;  2XZD G;  3ASO E;  4ANV A;  2WXN A;  1H0A A;  2FBN A;  3Q78 A;  3ABM E;  4UWL A;  3SI5 A;  2VGY A;  3FY4 A;  1N95 A;  1S64 A;  4B93 B;  4GMJ A;  3SF4 A;  1Z3Y A;  4LNG A;  3SO8 A;  4FHK A;  1WDY A;  2Y0B G;  1FT1 A;  4OVV A;  1SZ9 A;  5FT9 A;  3FTY A;  4I9E A;  4HRN A;  3BG0 B;  4XIF A;  2P9S G;  1A5E A;  3Q7F A;  4GTV A;  3Q47 B;  4HRL A;  1YYH A;  1Z5S C;  3FP3 A;  2X6K A;  1S70 B;  2PQN A;  3UKU G;  1HFA A;  3MX3 A;  4DLQ A;  3Q7A A;  3TJP A;  5FZR A;  4LEU A;  5BXU A;  2YHC A;  2ETB A;  2DZO A;  3CHP A;  2NXP A;  3MEK A;  3FUD A;  1JWG A;  1LD8 A;  4ACL A;  5ENR D;  4H7X A;  2Y4U A;  4HNA D;  3UI2 A;  2GRN B;  1H6K A;  4B8C B;  4J8D A;  3T8M A;  4AP2 A;  3NB2 A;  4GTQ A;  2KCL A;  2WXQ A;  4ACK A;  4JHJ A;  2AWI A;  3AG2 E;  2PM7 A;  1A17 A;  2IF4 A;  2VYI A;  1HF8 A;  2QYJ A;  1TNO A;  1U2V G;  4LSZ E;  2AW6 A;  4DJA A;  3V31 A;  3DSS A;  5AYW D;  3CKC A;  4O1P A;  4HOT A;  3CGH A;  3R7R A;  3TWW A;  1E96 B;  1HG5 A;  2J8S D;  4GU5 A;  4DX2 A;  3GZ1 A;  4U96 D;  4CT0 A;  4Y6C A;  2YHE A;  4R7L A;  3P1U A;  3RK6 A;  2YQ8 A;  3EJN A;  5AN8 A;  4N3C A;  5BXO A;  5ARG A;  5KBA A;  2VTB A;  5M72 A;  5HS0 A;  2EIM E;  1QYM A;  4LG6 A;  1YMP A;  4Q69 A;  1MX4 A;  4GAA A;  3JXJ A;  1OY3 D;  5AJD A;  2GRM A;  4LRZ A;  2RFM A;  1XGW A;  4J6I A;  1HS6 A;  2PL2 A;  5FQ8 A;  2R2L A;  3NBN B;  1UOH A;  4AOF A;  2X6F A;  3TAX A;  3EDT B;  5CMY A;  5D0Q D;  4BY6 A;  4RG6 A;  2F8X K;  3ZXS A;  3EIJ A;  4ZHB A;  3FWV A;  2A5U A;  4G11 A;  1SQM A;  3IV0 A;  3MYV A;  1AP7 A;  2LO6 A;  3PZD A;  1JCQ A;  2H6G A;  1IQR A;  4ME2 A;  4BX9 A;  2H6H A;  1PAQ A;  4I1A A;  3PZ4 A;  4FAD A;  3L17 A;  3CV0 A;  3DST A;  2VTB B;  3VTY A;  3IKO B;  2IEJ A;  2ZXW E;  4JA7 A;  2JAB A;  1K1B A;  2B6C A;  5EDS A;  2BED A;  4JVS A;  2ZU6 B;  2P9K G;  3S7B A;  5BV0 A;  1IHB A;  2XS8 A;  2P9I G;  2LSU A;  4JHK A;  2RFA A;  1MJ0 A;  3V79 K;  3QNK A;  3FUI A;  3EHR A;  3UT7 A;  4MS6 A;  4BET A;  5BUZ A;  4NAC A;  3FU3 A;  4GMR A;  3PDN A;  4FHJ A;  3FDH A;  4K03 A;  3UMV A;  3CHR A;  2EIN E;  2WPV A;  2KCV A;  2MOW A;  2J07 A;  3G2S A;  4I9C A;  4BTB A;  2L6B A;  3ZVV A;  3Q73 A;  1HX8 A;  1MX6 A;  2CFU A;  1H2V C;  2MRI A;  3FTZ A;  1ELW A;  2LAI A;  2P9N G;  4Z68 A;  2X38 A;  5AQA A;  4HOQ A;  3CVY A;  2XPI A;  4O60 A;  1W3B A;  3L54 A;  3TWT A;  4JW1 A;  2J4D A;  4I6J A;  3S7J A;  4C48 B;  2FF4 A;  4FP7 A;  4NRH B;  5FQ4 A;  3D9J A;  2ZIR A;  1P5Q A;  1Z6T A;  2F0Y A;  3SBS A;  4YDO A;  4HI9 A;  2WXK A;  3B7U X;  5G2N A;  4W9R A;  4UQX A;  1TJF A;  2VSY A;  3ASG A;  4C0E A;  4DRX E;  1QNF A;  1QBQ A;  1SVX A;  3MZL B;  3B7T A;  1TN8 A;  5KJM A;  3CR3 A;  2P9L G;  4G2V A;  3NQP A;  1V55 E;  1N0Q A;  2XGS A;  1JUQ A;  3PZ2 A;  3LS8 A;  1INZ A;  1TYQ G;  3RO2 A;  3QWW A;  3JUE A;  2WXM A;  4PS7 A;  4GA0 A;  2WM9 A;  2J4B A;  5CRV A;  1N4R A;  3C3O A;  4WAF A;  3UM0 A;  2Y69 E;  4EBA A;  3T9K A;  1IQU A;  2I2O A;  4MLP A;  5LFA A;  3CVV A;  4FU3 A;  2IOL A;  1N54 A;  3DSX A;  4DK5 A;  2VSO E;  4WUY A;  2OEW A;  5T4Y A;  4JPS A;  1NZN A;  3Q75 A;  3JCK C;  1UJK A;  3AAA C;  4DX6 D;  3Q79 A;  5KCM A;  3PEV B;  4N5C A;  4FUL A;  5FJY A;  3AG1 E;  3HG0 D;  3CIA A;  2EQX A;  3ZHE A;  5E76 A;  4WNE A;  2L0T B;  3PZ1 A;  2FO1 E;  5FWQ A;  5HI7 A;  2OCC E;  3E37 A;  1OCZ E;  3C5R A;  2WVI A;  3FTX A;  2LSV A;  2MYO A;  3ABK E;  3PNT B;  5BPP A;  1OUV A;  2FUL A;  4U07 A;  3LKU A;  5JMN D;  3GW4 A;  3AG4 E;  4U95 D;  4N2Q A;  3DSU A;  3B13 A;  2RKK A;  4XX5 A;  4E6H A;  4RLY A;  2UWJ G;  1JPL A;  3I4R B;  1BU9 A;  2GW1 A;  2B0O E;  3EHQ A;  4XZ4 A;  2XEH A;  4N39 A;  3FTS A;  5LP0 A;  1ELK A;  1B89 A;  5BNW A;  2M63 A;  2ILR A;  3D9I A;  3DXM G;  2KXP C;  3D9N A;  4CT4 A;  2Y4T A;  2QYU A;  3ZHE B;  3FTU A;  2F8Y A;  2IJG X;  2RG8 A;  3SFX A;  4KXK B;  3EHN A;  2V4L A;  5LOZ A;  4TRQ A;  3SHF A;  2ZGD A;  3EU5 A;  3TG5 A;  5A23 A;  1FT2 A;  5HKP A;  4LUN U;  5FQ7 A;  4F6R D;  4BWR A;  4CZ2 D;  1L5J A;  4KBQ A;  3FUE A;  3RKV A;  1HG2 A;  1NA0 A;  2WXI A;  4I17 A;  3APD A;  1DVP A;  1U3C A;  3ZW3 A;  4XE0 A;  3HXF A;  3TWX A;  4KMO A;  4XEI G;  3MKQ A;  2P9P G;  3VLF A;  3SNX A;  4GYY A;  3T5V A;  2CG2 A;  1N94 A;  1LF8 A;  1UW4 B;  4EZJ A;  4KVO A;  4EBA G;  3CSF A;  5KWD A;  2XEN A;  2FI7 A;  3U64 A;  4C0M A;  1TNB A;  3VLD A;  3V2X A;  5EID A;  1HH8 A;  3AS5 A;  1OWO A;  1E90 A;  2WMO A;  1MZC A;  3WXX A;  4ZFH A;  3CHS A;  1H6O A;  2P9U G;  1N4Q A;  2I9C A;  4XKB A;  2WXL A;  4CDR A;  3L6A A;  5DIZ A;  5KNH D;  3OXG A;  1BI7 B;  3MKQ B;  1N4P A;  4G1T A;  4BEP A;  2LNI A;  2L9B A;  2CHW A;  4LER A;  3PE3 A;  2H6F A;  4J7W A;  5G04 J;  3RU0 A;  4JC8 A;  3UM1 A;  3ZYQ A;  2KBX A;  4EZL A;  4L23 A;  2XHE A;  4EHM A;  2I1K A;  3JUI A;  3S7F A;  4JXT A;  5ENP D;  3DSV A;  1TNZ A;  4I2W A;  2I6H A;  4GB9 A; 
#chains in the Genus database with same CATH homology
 1KT1 A;  4AIF A;  2LSU A;  1X5B A;  5CCM A;  3ASF A;  3QAQ A;  4JHK A;  5KJL A;  1Y6I A;  3VLE A;  3ZN3 A;  4F3V A;  3QNK A;  3FUI A;  3UT7 A;  4MS6 A;  1E8Z A;  1NP7 A;  1OWN A;  4WWP A;  5BUZ A;  1HXI A;  1UJJ A;  4QFV A;  5AEN A;  3U3W A;  4NAC A;  3FU3 A;  3Q49 B;  2XCC A;  2I1J A;  3HYM B;  3PDN A;  3FH5 A;  4FHJ A;  2Y3A A;  3FDH A;  1HO8 A;  4N3B A;  3TXM A;  2HO1 A;  4K03 A;  2NSZ A;  4L2L A;  3UMV A;  3FEX A;  2ION A;  3EHM A;  4J8S A;  3RJV A;  1UG3 A;  5J90 A;  4EZK A;  3CHR A;  3QKY A;  4TV3 A;  2VSN A;  2AXU A;  2WPV A;  3CVQ A;  2KCV A;  4UWG A;  1KLX A;  2C2L A;  2MOW A;  2XCB A;  2J07 A;  4YND A;  1GW6 A;  3G2S A;  2IU1 A;  4I9C A;  4UI9 J;  4K0R A;  4BTB A;  3ONL A;  3ZVV A;  1S0P A;  3LVQ E;  3E4B A;  1OWP A;  3CVL A;  5FQ6 A;  5DBK A;  3RRN B;  3FU6 A;  3MKR A;  1HX8 A;  2R59 A;  3MV2 B;  4U0U A;  4BFR A;  1TJC A;  1DNP A;  2JEK A;  3FUL A;  2CFU A;  1FVH A;  4G25 A;  1H2V C;  2J09 A;  4AXH A;  2MRI A;  4URK A;  5G55 A;  3G2T A;  5AIJ A;  3FTZ A;  2KZT A;  3ASH A;  4FLH A;  4XKC A;  3IHV A;  3NZS A;  1ELW A;  2LAI A;  4AV7 A;  2GRL A;  3CVN A;  2R17 C;  2X38 A;  3CKB A;  3PUJ A;  4EEC A;  4HOQ A;  2OVB A;  4DLO A;  3U9W A;  4GZ5 A;  3CVY A;  4OVU A;  2XPI A;  4HOR A;  1W3B A;  2CHX A;  2WXO A;  5JHA A;  3L54 A;  3RRU A;  4JW1 A;  2J4D A;  1N52 A;  1Z3X A;  3LY7 A;  3LPZ A;  4I6J A;  4MRU A;  3S7J A;  2FF4 A;  3NF1 A;  4FP7 A;  4PH4 B;  4N2S A;  3FHE A;  3FUF A;  4MKT A;  2XGM A;  4NRH B;  5FQ4 A;  2E2E A;  2IOS A;  3EIQ C;  3D9J A;  3UUX A;  1H2U A;  3G2W A;  3ZFW A;  3ZRH A;  1P5Q A;  1Z6T A;  5JJ7 A;  3CLJ A;  3JQ0 A;  4ANU A;  1ZU2 A;  3URZ A;  3R7Q A;  5CCL A;  3SBS A;  4G23 A;  3SBT B;  4BT8 A;  2WXK A;  3B7U X;  3SFZ A;  4CDN A;  4GYW A;  4WWO A;  5G2N A;  4IUL A;  5JJT A;  3L13 A;  3IBE A;  3ESL A;  4PDX A;  4JZY A;  4RVB A;  4W9R A;  4HVB A;  5A7D B;  4UQX A;  4E85 A;  1IYG A;  4B8A A;  4A1G A;  1TJF A;  2VSY A;  3ASG A;  4C0E A;  1PY1 A;  1QNF A;  2FEZ A;  3MZL B;  3FTV A;  4I1O B;  3B7T A;  3APC A;  4UQY A;  1WAO 1;  4ATG A;  5KJM A;  1WY6 A;  3LVR E;  4U04 A;  2UY1 A;  3FUK A;  3CR3 A;  4F1S A;  4G2V A;  2YNQ A;  3LY8 A;  3NQP A;  1IHG A;  2AVP A;  3QWV A;  1MQS A;  3O4Z A;  3JYS A;  2V5F A;  3QWP A;  4KZC A;  2XGS A;  1XNF A;  4BX8 A;  4Q96 A;  1JUQ A;  3SZ7 A;  3QC1 A;  1OWM A;  4GZC A;  4IYP A;  4L7T A;  3AU5 A;  2AXV A;  4F53 A;  3FUM A;  3L08 A;  3PH0 C;  4P29 A;  3LS8 A;  1INZ A;  3ZIM A;  5J08 A;  3DBS A;  4RSY A;  5G04 C;  3C98 A;  2KZT B;  2VQ2 A;  3RO2 A;  1OWL A;  5E75 A;  4HOU A;  3MCX A;  3QWW A;  5BV1 A;  3MA5 A;  2X6J A;  2WXM A;  4PS7 A;  3HIZ A;  2WXH A;  5EKQ D;  4GA0 A;  1HE8 A;  2P58 C;  1ZBP A;  3T5X A;  2AXZ A;  2WM9 A;  2J4B A;  3CK8 A;  3RO3 A;  3CVW A;  1FCH A;  2DBA A;  2WXP A;  5T3R A;  3N71 A;  4HOS A;  2C0L A;  2X6I A;  4WAF A;  4B89 A;  3LEW A;  3L22 A;  3D9L A;  4LCT A;  4EBA A;  4GCN A;  3ENE A;  1IQU A;  2I2O A;  2CFZ A;  4MLP A;  3FEY A;  5LFA A;  2BF0 X;  3CVV A;  2DIW A;  2A4Z A;  4FU3 A;  1HU3 A;  3D3M A;  3TXN A;  3BG1 B;  3FTW A;  2FO7 A;  3FU0 A;  2IOL A;  1N54 A;  4DK5 A;  1MHQ A;  2E0I A;  3K9I A;  4Q94 A;  2VSO E;  4UI9 K;  4WUY A;  5T4Y A;  2OV8 A;  4AVX A;  4JEH A;  2XRY A;  3QJZ A;  4JPS A;  1NZN A;  4G24 A;  4JHR A;  4UWF A;  4U63 A;  3APF A;  3JCK C;  1UJK A;  3ZGQ A;  1PC2 A;  4HXI A;  4B0Z A;  4JA9 A;  2BUG A;  4FJY A;  3OTN A;  5FZQ A;  3FH8 A;  3Q4A B;  3TG4 A;  3I3N A;  5KCM A;  4AJW A;  3PEV B;  3QK0 A;  4N5C A;  3CVU A;  2UY1 B;  3KD7 A;  3PNL B;  4GA1 A;  3PVL A;  4FUL A;  2QY7 A;  2C0M A;  5FJY A;  4APF A;  3OXL A;  4JL0 A;  2WB2 A;  3FH7 A;  2L6J A;  3CIA A;  4HLE A;  3ZPJ A;  3PS6 A;  2EQX A;  4HFG A;  3ZHE A;  3LCA A;  2VGX A;  4AY6 A;  3MV3 B;  3AS4 A;  5E76 A;  3CST A;  4WNE A;  5LCW J;  1EDU A;  2PQR A;  2L0T B;  3D9O A;  4UWH A;  2WXJ A;  3D9P A;  5FWQ A;  1E8X A;  5HI7 A;  3UQ3 A;  5CMW A;  4XI0 A;  4UQZ A;  2WXN A;  1YA0 A;  4KYO B;  4UI9 C;  5D0O D;  4ANV A;  3LDZ A;  4DI4 A;  2XPY A;  1H0A A;  4EQF A;  2WVI A;  3FTX A;  2FBN A;  4ANX A;  2L0I A;  4CGW A;  4J8F A;  4UWL A;  4NUR A;  3UPV A;  1Y8M A;  3SI5 A;  2LSV A;  3GZS A;  3KS2 A;  3ZYK A;  2VGY A;  3FY4 A;  3PNT B;  5BPP A;  1KT0 A;  3Q15 A;  2QFC A;  3Q5M A;  1OUV A;  1UN8 A;  2FUL A;  2CG3 A;  3CK7 A;  4U07 A;  3S7D A;  4GZ6 A;  5ARF A;  4AEZ C;  3LKU A;  3LJ3 A;  4U8H A;  3GW4 A;  4GMJ A;  2OVF A;  5CHE E;  3SF4 A;  4A55 A;  4DI3 A;  3U66 A;  2RD0 A;  4N2Q A;  3B7S A;  5G05 J;  1Z3Y A;  2HYZ A;  3CHO A;  3B13 A;  4ILH B;  3SD5 A;  1H2T C;  4PUC A;  2WQ6 A;  3CQC B;  4XX5 A;  4FHK A;  1JWF A;  2X3M A;  4ILG A;  4E6H A;  4OVV A;  3I5P A;  1SZ9 A;  2UWJ G;  1JPL A;  5ENN A;  5FT9 A;  3AS8 A;  5BT1 A;  3FTY A;  3I4R B;  4I9E A;  2GW1 A;  4C9B B;  2V8S E;  3BG0 B;  3CVX A;  4XZ4 A;  4XIF A;  1FVF A;  3FU5 A;  3FTS A;  4N39 A;  4O6F A;  5LP0 A;  1ELK A;  2WMN A;  1B89 A;  2LAH A;  1SZA A;  3UX4 A;  3Q47 B;  5BNW A;  2HM8 A;  2M63 A;  2ILR A;  3D9I A;  5FZS A;  4A1S A;  3FP3 A;  3MGB A;  4NQ0 A;  2X6K A;  5LX8 A;  2PQN A;  4XI9 A;  2MHK A;  3ML9 A;  3LYA A;  3D9N A;  3VTX A;  2WQ7 A;  1HFA A;  3GYZ A;  3MX3 A;  4GML A;  4ABN A;  4DLQ A;  2IQC A;  3ULQ A;  3TJP A;  5FZR A;  4LEU A;  3TL5 A;  4WWN A;  2YHC A;  3ONK A;  4CT4 A;  3CHP A;  5JJ6 A;  2NXP A;  2J49 A;  3NZU A;  3ML8 A;  2Y4T A;  3MEK A;  4I6G A;  5T8I A;  4B94 A;  3FUD A;  1JWG A;  4ILI A;  4ACL A;  2YIN A;  3R9A B;  4H7X A;  2J08 A;  3PUK A;  2Y4U A;  3ZHE B;  3RIB A;  3FTU A;  2VGX B;  4UWK A;  2XRZ A;  3LY9 A;  2IJG X;  4L1B A;  2RG8 A;  4B8C B;  4KXK B;  1H6K A;  3EHN A;  3HVE A;  2V4L A;  4RG9 A;  2JLB A;  3PRE A;  4J8D A;  2KC7 A;  5LOZ A;  3T8M A;  4TRQ A;  2OOE A;  1VDY A;  1E7V A;  3SHF A;  4AP2 A;  3O48 A;  4GPK A;  5EX0 A;  2KCL A;  1EF1 C;  2WXQ A;  4I6E A;  4ACK A;  2KM4 A;  4APO A;  4JHJ A;  3TG5 A;  3OXF A;  3HDX A;  4I43 A;  3ZEF A;  4M3O A;  5A23 A;  1HZ4 A;  4WNF A;  1E7U A;  4LUN U;  5FQ7 A;  2WXF A;  5KJK A;  4BWR A;  2AWI A;  1L5J A;  3ESK A;  4KBQ A;  5C1D A;  3FUE A;  5AJL A;  2DCP A;  3RKV A;  2PM7 A;  4CRW A;  1A17 A;  4FLB A;  1HG2 A;  1NA0 A;  1QQE A;  4WND A;  2IF4 A;  2WXI A;  3MJW A;  4I1M A;  3ZYM A;  2VYI A;  1QZ2 A;  4I17 A;  3APD A;  4Y6W A;  1DVP A;  3ZYL A;  1HF8 A;  1U3C A;  4BTA A;  1EPU A;  2NC9 A;  3ZW3 A;  3FUJ A;  4XE0 A;  4KMO A;  3MKQ A;  4GCO A;  2AW6 A;  4DJA A;  4HS2 A;  4H7Y A;  3VLF A;  4I2Z A;  3SNX A;  3LXU X;  3CEQ A;  5KJN A;  4GYY A;  1BPO A;  4A3T A;  4GZD A;  5AYW D;  3T5V A;  3BEE A;  3CKC A;  2CG2 A;  2VJ8 A;  1EYH A;  5C2Y A;  4CDM A;  4HOT A;  3CGH A;  3R7R A;  1LF8 A;  2CHZ A;  3FFL A;  3FUH A;  2OND A;  2HR2 A;  3PE4 A;  1E96 B;  1UW4 B;  4EZJ A;  3PEU B;  1HG5 A;  4GU5 A;  3KAE A;  2WQH A;  5FTP A;  4J8E A;  4KVO A;  3GZ1 A;  4KT6 B;  4A3V A;  3CVP A;  4ANW A;  4EBA G;  4EPZ A;  3DPD A;  3OAW A;  4CT0 A;  4FC8 A;  4Y6C A;  3CSF A;  5ANR A;  1E8W A;  5BW8 C;  2YHE A;  4TUU A;  2J9Q A;  4R7L A;  4L2Y A;  2FI7 A;  3P1U A;  2XPZ A;  3RK6 A;  2XEV A;  2YQ8 A;  2GGF A;  3U64 A;  3QB2 A;  5HQ8 A;  3P2B A;  3EJN A;  4C0M A;  3VLD A;  1HH8 A;  3D9M A;  3GZ2 A;  3AS5 A;  3HVE B;  1OWO A;  4N3C A;  3UT4 A;  5ARG A;  5EX3 A;  2VTB A;  3D9K A;  2KAT A;  5M72 A;  1TEZ A;  3JQ1 A;  1E90 A;  3RRM B;  4PS3 A;  2WMO A;  2PZI A;  4YVO A;  3QOU A;  4PS8 A;  4Q69 A;  5LCW C;  4GAA A;  3UT8 A;  3ASD A;  3WXX A;  1ELR A;  4KZ0 A;  3CHS A;  5AJD A;  4YVQ C;  3G2V A;  4GZ3 A;  2GRM A;  4LRZ A;  4J0U A;  2I9C A;  4XKB A;  3CHM A;  2WXL A;  3QDN A;  1XGW A;  3L6A A;  4CDR A;  5DIZ A;  2Q7F A;  4J6I A;  3PRZ A;  4AY5 A;  3OXG A;  1HS6 A;  5JHB A;  1NA3 A;  2PL2 A;  5FQ8 A;  2KCK A;  3G2U A;  4G26 A;  3MKQ B;  3QAR A;  4CCA A;  3AU4 A;  2XQ0 A;  4AOF A;  3CQG B;  4U0S A;  2X6F A;  4G1T A;  5G05 C;  4JEU A;  3SGH A;  3IHY A;  2LNI A;  2L9B A;  3TAX A;  1H19 A;  4IRU A;  1WM5 A;  3EDT B;  2VSX E;  5CMY A;  2CHW A;  4LER A;  3PE3 A;  5D0Q D;  4BY6 A;  4RG6 A;  4IN3 B;  3KEZ A;  3ZXS A;  3EIJ A;  4N3A A;  3TGO A;  5G04 J;  2IFU A;  3FWV A;  2A5U A;  4G11 A;  3RU0 A;  4V3I A;  3CHQ A;  4JC8 A;  1SQM A;  3IV0 A;  3MYV A;  3I4G A;  3S2A A;  4GYO A;  2LO6 A;  3PZD A;  3HHM A;  3IEG A;  3B7R L;  4F7A A;  4FJZ A;  1E8Y A;  3ZYQ A;  4FA6 A;  1IQR A;  4ME2 A;  2WXG A;  4BX9 A;  4CEM A;  4EZL A;  4L23 A;  2WXR A;  2XGO A;  2BTD A;  4BT9 A;  2XHE A;  1PAQ A;  4I1A A;  4U0Z A;  4FAD A;  2X6H A;  4D10 C;  2I1K A;  3JUI A;  3CV0 A;  3L17 A;  4JXT A;  1U3D A;  3S7F A;  2VTB B;  3VTY A;  4OYS A;  3IKO B;  2PM6 A;  4JA7 A;  5ANL A;  4I2W A;  4WNG A;  1UN9 A;  4CGV A;  3CK9 A;  4BSX A;  5A6C A;  2R5S A;  5EDS A;  3FUN A;  4DPR A;  3U4T A;  4JVS A;  4KVM A;  2ZU6 B;  2I6H A;  4GA2 A;  3S7B A;  5BV0 A;  3L16 A;  4AM9 A;  2V0P A;  4GB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...