4UI9K

Atomic structure of the human anaphase-promoting complex
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
493
Chain Sequence
b'NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHKSCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 178
structure length 493
sequence length 526
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
K PF13176 TPR_7 Tetratricopeptide repeat
K PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9K00
4WUYA 2AVPA 4GCNA 3S7FA 3ZGQA 3CK8A 2V5FA 2IF4A 4UI9C 2VGXA 2E2EA 4AIFA 2XCBA 4YNDA 1NZNA 3AS8A 2WQHA 4H7XA 3S7DA 3TG4A 3CVLA 1ELRA 3FP3A 4O6FA 2FF4A 4G23A 3CKCA 4WNEA 3ZPJA 2VGYA 3GZ1A 3LY8A 2HYZA 2VGXB 3MV3B 3MV2B 2BUGA 3URZA 4J0UA 5CCLA 4U07A 4J8DA 4UI9K 2KC7A 2YQ8A 3GYZA 5FTPA 5BT1A 5G04J 4HOSA 2PZIA 4F3VA 4GZ5A 2PQRA 5AYWD 4NQ0A 3QWPA 3QDNA 5BNWA 3ZN3A 3TGOA 4UQZA 3ASFA 3GZ2A 2J9QA 2UY1A 5FZSA 3LPZA 4RG9A 1KT0A 4APOA 4ABNA 3KS2A 4KYOB 4AM9A 3U4TA 5JJ7A 4N3CA 4J8FA 4GZ6A 3WXXA 3N71A 1B89A 4GA2A 2DBAA 5BW8C 2HO1A 5FZRA 3RKVA 4I1AA 3LY7A 3IEGA 1YA0A 1PC2A 5HI7A 2XGSA 4N5CA 2UY1B 5KJLA 2VYIA 3BEEA 3HYMB 3Q4AB 3LCAA 5LCWJ 4N2QA 2ONDA 3LYAA 3K9IA 3Q5MA 3VTYA 3FFLA 3U3WA 2GW1A 5EX0A 4BWRA 4IN3B 2XPIA 4CGWA 4CDRA 3R9AB 2C2LA 5G04C 3SF4A 2C0MA 3VTXA 2FBNA 2C0LA 4KBQA 2PL2A 3S7BA 4KXKB 3LY9A 3Q47B 5ARFA 3UQ3A 3PE3A 5A6CA 3PDNA 2WPVA 5G05J 4GPKA 2LNIA 5FT9A 3E4BA 3EDTB 4A1SA 4W9RA 4GCOA 4GYWA 2FI7A 3MKRA 4UQXA 2KATA 3O48A 4JHRA 4N39A 4HOTA 3OXFA 4I9EA 3NF1A 4GA1A 4G1TA 4I2ZA 1QZ2A 2P58C 5FZQA 1A17A 2VSYA 4RG6A 5LCWC 4XIFA 3TAXA 2LSVA 2I6HA 2L6JA 4U0UA 3Q15A 4GYYA 3ZFWA 3CVNA 1QQEA 4BTAA 1KLXA 2XEVA 5DIZA 3CVPA 4HORA 4I2WA 4U04A 2VQ2A 2PQNA 4J8EA 1IYGA 2OOEA 4AY6A 4I17A 1ZBPA 2KCLA 2Y4TA 2UWJG 1XNFA 3ESKA 4NRHB 4G2VA 3RO3A 3RO2A 3UUXA 2Q7FA 3KD7A 1P5QA 3LKUA 4N3BA 2XCCA 3ZHEB 2R5SA 3JYSA 5G05C 5EKQD 4U0SA 2QFCA 3ASGA 1WAO1 4GA0A 4BT8A 2XGMA 1IHGA 5DBKA 3QOUA 1NA3A 3CV0A 5KJMA 1OUVA 3S7JA 4H7YA 4XI9A 5EX3A 4WNGA 5FJYA 3OXLA 4HOQA 2YHCA 4CGVA 3CEQA 4B94A 5D0OD 3OXGA 3RU0A 4EQFA 1KT1A 1Y8MA 4BT9A 2XGOA 1ZU2A 4ME2A 4BTBA 4I9CA 4JA9A 5JJ6A 3CK9A 4LEUA 3MEKA 1HH8A 4N2SA 3QWVA 4WNFA 4Y6WA 1HZ4A 3ASHA 1ELWA 1HXIA 2FO7A 3ULQA 3AS4A 1E96B 5CCMA 3Q49B 4XI0A 5D0QD 3ASDA 1NA0A 2Y4UA 3RIBA 4UI9J 5C1DA 3TG5A 4YVQC 3RJVA 4U0ZA 2LSUA 5ARGA 2JLBA 4G24A 3ZHEA 3GW4A 3CVQA 4G26A 4Y6CA 1WM5A 5KJKA 3AS5A 2MHKA 5A7DB 1TJCA 2VSNA 4N3AA 3UPVA 3KAEA 1W3BA 4GYOA 4WNDA 3QKYA 4AY5A 3CK7A 4JA7A 5KJNA 4GZ3A 4JL0A 3FWVA 2HR2A 3PE4A 5M72A 2KCKA 4UQYA 3MA5A 2KCVA 5HQ8A 4YVOA 3SZ7A 3QWWA 5CHEE 5JJTA 2NC9A 2IFUA 1FCHA 2FEZA 4HOUA 4G25A 3CKBA
chains in the Genus database with same CATH superfamily
3TWRA 5BV0A 5ITZF 3FTUA 1JCSA 4GTPA 2IF4A 4A63B 3CQGB 1TEZA 1E7UA 1NZNA 4K5CA 1MQSA 3ZYKA 2KXPC 2I2OA 3LJNA 1K3ZD 1TNZA 3FP3A 4HNAD 4EECA 3O4ZA 2FF4A 4G23A 3CKCA 2ZISA 4HI9A 4OVUA 2BTDA 2OEWA 4ANVA 1JWGA 2ZIRA 5LX8A 3C72A 4CYMD 3MV2B 2P2CP 5BXUA 2YNQA 3RRMB 5CCLA 5FTPA 5B1AE 3SGHA 4GMRA 1LD7A 5BT1A 4DRXE 5AJDA 1DVPA 1Q2ZA 2RFAA 3ZN3A 3FU5A 5CEAA 3ZW3A 3HHMA 2HE0A 4HXIA 2IQCA 1S63A 3PUKA 2GGFA 2J9QA 3BG0B 3LPZA 3UT7A 2P9IG 4RG9A 4HLLA 4PH4B 4APOA 4ANWA 4KYOB 4K5BA 1Y6IA 5D66A 2QYUA 5BPPA 1H2TC 2EILE 3N71A 2I1KA 5AARA 1B89A 4ANXA 2I1JA 2DBAA 1BD8A 3NOCD 4ZHBA 4I1AA 1K1BA 2WVIA 2XGSA 4XKCA 5FINA 5KJLA 1N94A 3ESLA 5LCWJ 3RAUA 4JEUA 4JC8A 2XHEA 3LYAA 3TWWA 4FULA 3U66A 2GW1A 3DSXA 1N52A 3VLDA 4IN3B 5KBAA 3D9OA 2XRYA 2DYRE 4CGWA 3E32A 3T5XA 3G2TA 3R9AB 3DSTA 4XE0A 2C2LA 3SF4A 2C0MA 3RRUA 3VLFA 3L22A 4L9PA 2C0LA 2PL2A 1Z3XA 1TNOA 4B93B 5ARFA 4U8YD 2V4HC 5G05J 1UN9A 2KM4A 3IV0A 5FT9A 3E4BA 3EDTB 4P29A 2A4ZA 3TXNA 3UIPC 4CRWA 2XEHA 2JABA 3L16A 2WQ6A 3APDA 3Q75A 4DX2A 3IHYA 3TJPA 1INZA 1H6PA 3JUEA 1A17A 1FPPA 5T8IA 3SBSA 4XIFA 3Q7FA 4EBAA 2FO1E 5B1BE 3MKQB 2KBXA 3ZFWA 1QQEA 3D3MA 5G55A 2XEVA 5DIZA 4N5QA 5ENQD 3TWUA 2DIWA 4OYSA 3BG1B 2CHWA 2PQNA 3CHPA 4KT6B 1ZBPA 2F8YA 2J4BA 2XRZA 1XNFA 3UT8A 3LJ3A 3G2SA 4G2VA 2RD0A 3DSWA 3RO2A 5AIJA 3UUXA 2CG2A 4N3BA 4GPMA 2OV8A 1HO8A 3ZRHA 4FC8A 3JYSA 2ETAA 4HVBA 2QFCA 3ASGA 1PAQA 3HVEB 2GRLA 4A3TA 4GA0A 4A55A 4O1OA 2LO6A 3CV0A 2DZNA 3CVYA 4U8HA 2WM9A 3CEQA 3FUIA 5AQ9A 1D9SA 4DI4A 1KZPA 3CVXA 4JXTA 3APFA 2EQXA 1X81A 2QZAA 3D9IA 4BT9A 4ME2A 4I9CA 5JJ6A 1OWPA 4LEUA 4N2SA 4F1SA 4Y6WA 1H6OA 2XZDG 3ASHA 4C0EA 2PM6A 1QBQA 3CR3A 4DX1A 2FO7A 1SA5A 2V8SE 4GB9A 5CCMA 1E8ZA 3ASDA 3U9WA 2WXHA 4CDMA 2MRIA 4D10C 2AJAA 4HQDA 4YVQC 2WXOA 3QC1A 1UN8A 1OWNA 2J07A 5E76A 2QC9A 4HI8A 1OT8A 3ZHEA 3CVUA 1IQUA 4Y6CA 4B8CB 2Y0BG 1MX4A 4URKA 3RK6A 2MHKA 5A7DB 1SA4A 4MKTA 1NI1A 3E30A 4U7EB 3B7SA 3LVQE 1OCCE 4GYOA 4F6RD 4QFVA 2XZTG 2H6GA 4HRNA 2WXNA 4JVSA 2H6HA 3PEVB 2J8SD 3AJIA 2CG3A 2KCKA 1N4RA 4UQYA 4TXPA 2KCVA 5A23A 5HQ8A 3KSLA 4ILIA 1FVHA 3NAWA 2VSOE 3EUVA 2KZTA 4U95D 5CRUA 3DXKG 2FEZA 1UJKA 3R7RA 4G25A 2EINE 3UTMA 4J6IA 3FUDA 3R9MA 2Y3AA 3CK8A 3TXMA 4G8KA 3SFXA 3PNLB 2Y1LE 3HXCA 5ENNA 3PZDA 2ETCA 2QY7A 3ZXSA 3DSSA 2WQHA 3SBTB 3TG4A 1FVFA 3FTZA 3MJWA 2XEEA 1ELRA 2DYSE 4FJYA 5FIOA 4EPZA 3NB2A 3PZ3A 4TRQA 2EIJE 4O1PA 1UJJA 2WMOA 2J08A 3ENEA 1NL4A 2HYZA 2P9KG 1HG5A 3Q73A 2VGXB 3UXGA 3U64A 1U3CA 1IKND 2M63A 5E75A 4F1PA 1S70B 3C3QA 4WWPA 3KSQA 3MGBA 4U07A 3EHQA 5HRYA 4CCAA 2XS8A 2OEVA 2PZIA 2WXRA 4F3VA 4QQIA 3LVRE 4GZ5A 4ILHB 3UX4A 3BQOA 2MOWA 3QDNA 2QYJA 1MJ0A 3V2XA 5BNWA 4UQZA 1HS6A 3OTNA 3EHMA 2B6CA 3PUJA 3TWTA 1RZ4A 5FZSA 5B3SE 3L08A 3ABKE 1H19A 3QARA 3KS2A 2CFUA 3VLEA 5J90A 4KZCA 5AQBA 1BPOA 1BLXB 2LAHA 2P9UG 3B7TA 3DXMG 3CQCB 3HXEA 1JWFA 2DWZA 3C3OA 3LY7A 4MS6A 1PC2A 4JHJA 4OVVA 1AWCB 3CVVA 4N5CA 4I43A 4RSYA 3BEEA 5KCMA 3LCAA 2ONDA 3E33A 1VDYA 2X38A 2NXPA 2R03A 3FFLA 4UWHA 1LD8A 3RRNB 4DX7D 2EIME 3P2BA 2XPIA 1PY1A 1HF8A 5G04C 4ATGA 3T5VA 2IU1A 1JUQA 1QYMA 3QNKA 3VTXA 1D8EA 2FBNA 3ISMC 1TN8A 3C5RA 3L82A 3S7BA 1MHQA 2NYJA 2LUHA 2Y69E 4TV3A 3AG4E 3RSEG 4GPKA 3MKQA 3FUMA 1S64A 1DNPA 1HE8A 2WXKA 4PS8A 1YCSB 3FUHA 5AQ7A 4GCOA 4I1OB 4C48B 4HB5A 4GYWA 2FI7A 1ZB1A 4UUCA 5ENRD 3MKRA 3FY4A 1FT1A 4JHRA 4N39A 3OXFA 2V0PA 1UG3A 3EIJA 4FLBA 4GA1A 4FHKA 1N4QA 1QZ2A 3AU4A 1D8DA 5FZQA 4U96D 3TAXA 3Q15A 3TWQA 2WXGA 4R7LA 2ZGDA 3CVNA 4BTAA 4BX9A 3B7RL 3CVPA 1TNYA 3ASNE 3FTXA 3HVEA 3B7UX 4TXRA 3V31A 4JB8P 2X6IA 4J8EA 5CBNA 3I5PA 1NP7A 2OOEA 4AY6A 3UM3A 2Y4TA 5LP0A 3C3RA 4UWFA 3SFZA 3RO3A 4X8QA 4XX5A 3KD7A 3LKUA 4Q96A 2VGEA 1JPLA 4E85A 5EKQD 1X5BA 4BT8A 2XGMA 5DBKA 5ENPD 3S7JA 5FQ4A 5EX3A 5T3RA 4WNGA 2WXIA 1N95A 2H6FA 1TNBA 5FJYA 4HOQA 5D0OD 3HIZA 1OWMA 3UM0A 3FUJA 1G3NB 4JD2G 3FEYA 3DSVA 4RLYA 3IKOB 1OWLA 1ZU2A 2BF0X 3JUIA 2AWIA 4GU5A 4NACA 1EF1C 1HZ4A 1JCRA 3D9JA 1ELWA 5J08A 4GMJA 3AS4A 4BSZB 3ZYLA 2IJGX 3PH0C 3UINC 1YMPA 4YDYA 3X2QE 1NA0A 2Y4UA 1OCOE 4MBGA 3UM1A 3RIBA 3SO8A 1WY6A 5C1DA 5FWQA 5D2MC 3MCXA 2A5UA 4KMOA 2JLBA 3I4RB 3CVQA 4G26A 4I6GA 3AS5A 5KNHD 1TJCA 5CECB 2VSNA 1W3BA 1KPSB 2P9NG 3EU5A 4APFA 1LTXA 3PVLA 3CK7A 4UWKA 3FDHA 4JL0A 3FWVA 2OVBA 1ELKA 3SY2A 4LUNU 3I3NA 2BEDA 4YVOA 3SZ7A 1QNFA 3FU0A 5CHEE 2VJ8A 3ULYA 3NQPA 4BX8A 5BUZA 5ANLA 4DX6D 5AJLA 4U63A 4WUYA 3V79K 3KEZA 4GCNA 4L7TA 3JQ0A 4HBDA 4BFRA 3L6AA 2V5FA 3HRAA 4UI9C 3UKRG 2VGXA 4ANUA 2XPYA 3ZU7B 1N4SA 2E2EA 5ENSD 3LXUX 4H7XA 3CVLA 4EZKA 3ML8A 4YDWA 2YHEA 3FULA 4YDEA 3TWSA 5C2YA 3TL5A 2VGYA 3GZ1A 3LY8A 3ZYMA 4FP7A 4EZLA 3E34A 4C9BB 4NIKA 3B95A 3P1UA 3FUKA 3FHEA 2BUGA 5AN8A 1E8XA 2IEJA 4BEPA 3FH5A 4RVBA 2R02A 2VTBB 4J8DA 1K1AA 2DZOA 3AG3E 5EDSA 4HOSA 4NQ0A 5AYWD 3TGOA 4AVXA 3ASFA 3ZKJA 2ZU6B 1V54E 3CSFA 4EBAG 1KT0A 2WB2A 1OCRE 4ABNA 4KVOA 5JJ7A 3DPYA 3ZEFA 4GZ6A 2R05A 4GTQA 1O1SA 2J49A 4GA2A 1HX8A 2HO1A 5ENOD 5CRVA 5FZRA 5HI7A 1H6KA 4HS2A 4PS3A 1SVXA 3AG1E 1WG0A 2UY1B 2VYIA 1N0QA 3HYMB 2VSXE 4FADA 3K9IA 3Q5MA 2F0YA 2BKGA 1E8YA 1OWOA 4TUMA 3CSTA 5EX0A 4KZ0A 4BWRA 4L2YA 2L0TB 1Z5SC 2DCPA 3FH8A 5H7PA 5LFAA 2J4DA 3FUEA 2IO3C 4KBQA 4BERA 2X6HA 3PZ4A 3Q9UC 4LNGA 4KXKB 3LY9A 2IOLA 5A6CA 3PDNA 1E90A 1H2UA 1L5JA 4AEZC 3S2AA 3CLJA 1BI7B 2LNIA 4PUCA 4A1SA 4FJZA 4MRUA 3CGHA 2WXFA 2KATA 2P9SG 4K0RA 3O48A 3Q78A 4GTMA 2P9PG 2GRPB 3SHFA 4I2ZA 2P58C 3SFYA 4GTVA 1EPUA 5LCWC 3DRAA 1TNUA 4B0ZA 4CT4A 2H6IA 2LSVA 2I6HA 2L6JA 1BI8B 2IONA 3F6QA 3L13A 3ZXPA 1KLXA 1DCQA 4HORA 5CMYA 4I2WA 3DEOA 3NZUA 2A5EA 3ABLE 1A5EA 2DVWA 4CDNA 3EHNA 2VQ2A 2CHZA 5EIBE 4JW1A 4IRUA 4NURA 1UOHA 3L54A 3UMVA 2GRMA 2UWJG 4NRHB 4CT0A 2Q7FA 3CHMA 3DPDA 3BUAA 4A3VA 3ZHEB 2R5SA 5G05C 4G11A 4J8SA 4UWGA 1WAO1 4DUIA 3FU3A 2MYOA 1IHGA 4I1MA 4GAAA 3ZIMA 5KJMA 4H7YA 4XI9A 1MX6A 4BY6A 1AP7A 4LRZA 3I4GA 2YHCA 4CGVA 3BU8A 2XS1A 4B94A 3OXGA 3NOGD 4EQFA 4B89A 2X3MA 3W9FA 1KT1A 1Y8MA 3TWXA 4HRLA 4L2LA 4LNBA 3PZ1A 1RW2A 4GTTA 4ATZD 4BTBA 2E0IA 4GZDA 2J09A 1E7VA 1HH8A 3ML9A 2KZTB 2WXLA 2X6FA 4GTSA 2LXLA 1HXIA 3ABME 2GRRB 3WG7E 3DWLG 1E96B 2IO2C 3Q49B 4XI0A 2WQ7A 1UW4B 4BETA 2V4LA 4OAVB 1N11A 4J7WA 3QK0A 3UM2A 4O60A 3RJVA 4U0ZA 5BV1A 2LSUA 3E37A 3AAAC 3MX3A 3PNTB 5KNGA 5AAOA 4GTRA 5IY5E 4YDOA 3GW4A 5G2NA 1WM5A 5KJKA 2LAIA 1MX2A 4FLHA 2WXMA 3FUFA 4N3AA 1TR4A 3UPVA 3KAEA 5LOZA 2NSZA 1YYHA 4EHMA 3FTVA 4WNDA 2WXJA 3EU9A 4AY5A 5ANRA 5JHBA 1HG2A 3HDXA 4I6JA 4K03A 4IYPA 3R7QA 4DX5D 2HR2A 3SI5A 4LG6A 3MA5A 3QWWA 3PRZA 4FHJA 2XPZA 2NC9A 4XKBA 3HXBA 2IFUA 4L23A 4RQIA 3JXIA 4DI3A 2AVPA 3S7FA 3ZGQA 4JZYA 1WDYA 5JHAA 2IOSA 4JEHA 3FH7A 4AV7A 3PEUB 4CEMA 4OAUC 3J5PA 3FTSA 4JHKA 2R17C 4DLQA 2YINA 1EYHA 4CZ2D 3G2WA 3FTYA 4HLEA 1SZ9A 4AIFA 3UKUG 3B7BA 2B0OE 2XCBA 4YNDA 3AS8A 3MYVA 2OVFA 3S7DA 2ILRA 2VTBA 1K8KG 3D9LA 4ZFHA 5JMND 4G8LA 3L17A 2ZGGA 4O6FA 2PM7A 4WNEA 3ZPJA 2AW6A 1TN6A 3J5QB 4M3OA 2XQ0A 1SW6A 3ZUVB 4AXHA 3UIOC 3MV3B 3ZVVA 3URZA 4J0UA 5CMWA 3CHSA 4EZJA 4UI9K 2KC7A 2YQ8A 2ZXWE 3G2VA 3GYZA 4WAFA 4M7CA 5G04J 2F37A 4IULA 2PQRA 5EN5D 3SD5A 3QWPA 1KZOA 3CIAA 2IY0C 5AENA 3CVWA 4LCTA 3GZ2A 2UY1A 4U8VD 2RKKA 2WMNA 3JXJA 4AJWA 4AM9A 3U4TA 4N3CA 4J8FA 1Z6TA 1MYOA 1E8WA 3T8KA 4C0MA 1XGWA 3WXXA 1N54A 1N9AA 5FQ6A 5BW8C 3JCKC 3FU6A 2R59A 4ACKA 3RKVA 3IEGA 1YA0A 1EDUA 1N4PA 4DJAA 3HXFA 1HU3A 3NZSA 3V30A 3Q4AB 4N2QA 1IQRA 3LS8A 1S0PA 3VTYA 5ENTD 5CBOA 5FQ7A 5EYPF 4V3IA 3U3WA 4GTOA 2AXUA 3JQ1A 5HS0A 3CHQA 3FTWA 3PS6A 3EIQC 1LF8A 4CDRA 1JCQA 1H2VC 3DSUA 5FQ8A 3LDZA 3TWVA 1O1TA 5EIDA 2RG8A 3ONKA 2CFZA 4BSXA 2FULA 4FU3A 3Q47B 3IHVA 2P9LG 3UQ3A 3PE3A 2WPVA 1FT2A 1TYQG 4MLPA 4W9RA 4KVMA 2JEKA 2BKKB 3SQVA 4UQXA 2CHXA 4TXQA 2L6BA 4HOTA 2AXZA 1U3DA 4I9EA 3D9NA 3NF1A 3T8MA 3ZNGA 4G1TA 3Q79A 3APCA 3SNXA 1IHBA 4GZCA 2VSYA 4RG6A 4FA6A 3W9GA 1SQMA 1GW6A 4DK5A 3QJZA 4U0UA 4GYYA 3IBEA 1MZCA 3DBSA 4JPSA 3AG2E 1O1RA 5CERB 2X6JA 1V55E 2L0IA 3LEWA 2XENA 2HM8A 4E6HA 1TJFA 4HRMB 4U04A 4TUUA 4F53A 1IYGA 3KEAA 4I17A 5CEDB 4WWOA 4HFGA 1OCZE 2KCLA 3ONLA 2V5QC 5JA4D 3OAWA 3ESKA 4Q94A 3V2OA 1P5QA 4Z68A 3PREA 4XEIG 3HG0D 2WXQA 2WXPA 4PDXA 2XCCA 5KWDA 4DPRA 4U0SA 3D9PA 2GROB 4AOFA 4DLOA 3B13A 3QOUA 1NA3A 1DCEA 4BESA 1OUVA 3CHRA 3D9HA 5BXOA 4I6EA 3OXLA 1Z3YA 1U2VG 4B8AA 4LSZE 3RU0A 2GRNB 5EILA 4ACLA 4F7AA 1NFIE 4PS7A 2XGOA 4JA9A 2PNNA 3ZYQA 3CK9A 3UI2A 3NBNB 1OXJA 4ILGA 3MEKA 3L9TA 3QWVA 5HKPA 4WNFA 3Q9NC 2EIKE 2GRQB 2F8XK 2AXVA 4LNUD 3PZ2A 3ULQA 2ETBA 1DC2A 5EYLA 5D0QD 1TN7A 1SZAA 3Q7AA 4UWLA 3FUNA 5AQAA 1H0AA 4L1BA 4Q69A 4UI9J 1IXVA 5T4YA 3TG5A 3MZLB 3IXEA 4A1GA 3ULEG 3UT4A 3D9MA 5ARGA 3G2UA 3HXDA 4G24A 1O5MA 2L9BA 4LERA 3EHRA 4K5AB 3FEXA 3T9KA 3AU5A 2RFMA 2I9CA 3QKYA 3C98A 2LXMA 4JA7A 5KJNA 4GZ3A 4XZ4A 3PE4A 5M72A 4WWNA 3D9KA 2OCCE 4J8YA 3QAQA 1BU9A 3DEPA 4AP2A 3ASOE 3CHOA 3QB2A 3EJNA 5JJTA 3GZSA 1HFAA 4GMLA 1N0RA 2R2LA 1FCHA 2X6KA 1OY3D 4HOUA 3CKBA
chains in the Genus database with same CATH topology
4U63A 4WUYA 2AVPA 3KEZA 4GCNA 5BV0A 3S7FA 4L7TA 3JQ0A 4JZYA 3FUDA 4J6IA 3ZGQA 4GPKA 4BFRA 5JHAA 2IOSA 2Y3AA 3CK8A 4JEHA 3TXMA 3FH7A 4AV7A 3PEUB 3FTUA 4CEMA 3L6AA 3FTSA 4JHKA 2R17C 2V5FA 3PNLB 2IF4A 4DLQA 2YINA 1EYHA 4UI9C 3CQGB 2VGXA 3G2WA 1TEZA 4ANUA 2XPYA 3FTYA 4HLEA 2E2EA 5ENNA 3PZDA 1SZ9A 4AIFA 2XCBA 1E7UA 2QY7A 3ZXSA 4YNDA 1NZNA 3AS8A 3MYVA 2WQHA 2OVFA 1MQSA 3LXUX 4H7XA 3S7DA 2ILRA 3SBTB 3TG4A 2VTBA 1FVFA 3ZYKA 3FTZA 3D9LA 3CVLA 3MJWA 4EZKA 1ELRA 3ML8A 2I2OA 3L17A 4FJYA 4EPZA 2YHEA 3FP3A 3FULA 4EECA 3O4ZA 4O6FA 2PM7A 2FF4A 4G23A 4TRQA 5C2YA 3CKCA 4WNEA 3TL5A 2VGYA 3GZ1A 3ZPJA 4OVUA 2BTDA 3LY8A 2WMOA 2J08A 3ENEA 2AW6A 4FP7A 3ZYMA 4EZLA 2HYZA 4C9BB 1HG5A 4M3OA 4ANVA 1JWGA 2XQ0A 2VGXB 5LX8A 4AXHA 3U64A 1U3CA 3P1UA 3FUKA 2M63A 3MV3B 3MV2B 5E75A 3FHEA 3ZVVA 2BUGA 2YNQA 3RRMB 3URZA 1E8XA 4J0UA 4WWPA 5CCLA 3MGBA 4U07A 3FH5A 4RVBA 5CMWA 3CHSA 2VTBB 4EZJA 4J8DA 4UI9K 2KC7A 2YQ8A 5EDSA 3G2VA 3GYZA 5FTPA 4WAFA 3SGHA 5BT1A 4CCAA 5AJDA 5G04J 4HOSA 2PZIA 2WXRA 4F3VA 3LVRE 4GZ5A 4ILHB 4IULA 2PQRA 3UX4A 1DVPA 3SD5A 4NQ0A 2MOWA 3QDNA 3QWPA 5AYWD 3CIAA 5AENA 3CVWA 5BNWA 3ZN3A 3TGOA 3FU5A 3ZW3A 4AVXA 3HHMA 4UQZA 1HS6A 3ASFA 3OTNA 4HXIA 4LCTA 3GZ2A 2IQCA 2ZU6B 3EHMA 3PUKA 3PUJA 2GGFA 2J9QA 2UY1A 3BG0B 5FZSA 3LPZA 3UT7A 3CSFA 4RG9A 4EBAG 3L08A 1KT0A 2WB2A 4PH4B 2WMNA 4APOA 1H19A 4ABNA 4AJWA 3QARA 3KS2A 4ANWA 4KYOB 4KVOA 2CFUA 3U4TA 4AM9A 3VLEA 5JJ7A 4N3CA 4J8FA 5J90A 4KZCA 1Y6IA 3ZEFA 1Z6TA 4GZ6A 1BPOA 5BPPA 2LAHA 1E8WA 4C0MA 3B7TA 1XGWA 1H2TC 3WXXA 3N71A 2I1KA 4ANXA 1B89A 2J49A 4GA2A 2I1JA 1N54A 5FQ6A 1HX8A 2DBAA 5BW8C 3CQCB 2HO1A 1JWFA 3JCKC 3FU6A 2R59A 5FZRA 3RKVA 4I1AA 4ACKA 3LY7A 3IEGA 1YA0A 4MS6A 1PC2A 1EDUA 5HI7A 4JHJA 4OVVA 1H6KA 4HS2A 3CVVA 2WVIA 2XGSA 4N5CA 4PS3A 4DJAA 4I43A 1HU3A 2UY1B 4XKCA 2VYIA 5KJLA 3ESLA 3NZSA 4RSYA 3BEEA 3HYMB 3Q4AB 5KCMA 3LCAA 5LCWJ 2VSXE 4FADA 4N2QA 2ONDA 4JEUA 1IQRA 2XHEA 3LYAA 3K9IA 3LS8A 4JC8A 3Q5MA 1S0PA 3VTYA 1VDYA 2X38A 4FULA 5FQ7A 2NXPA 3U66A 1E8YA 4V3IA 3FFLA 3U3WA 2GW1A 4UWHA 1OWOA 3RRNB 2AXUA 3CSTA 1N52A 3JQ1A 5EX0A 3VLDA 4KZ0A 4BWRA 4IN3B 3CHQA 3FTWA 3PS6A 2L0TB 4L2YA 3D9OA 2XRYA 3P2BA 2XPIA 3EIQC 4CGWA 2DCPA 1LF8A 4CDRA 3FH8A 3T5XA 3G2TA 3R9AB 1PY1A 4XE0A 1HF8A 2C2LA 1H2VC 5G04C 4ATGA 3SF4A 5LFAA 2J4DA 3T5VA 2IU1A 1JUQA 5FQ8A 2C0MA 3FUEA 3QNKA 3LDZA 3RRUA 3VTXA 3VLFA 2FBNA 3L22A 2C0LA 4KBQA 2X6HA 2PL2A 3S7BA 2RG8A 1MHQA 1Z3XA 3ONKA 2CFZA 4BSXA 2FULA 4FU3A 4KXKB 3LY9A 3Q47B 3IHVA 4TV3A 5ARFA 3UQ3A 2IOLA 3PE3A 3PDNA 5A6CA 1E90A 1H2UA 2WPVA 1L5JA 5G05J 4AEZC 1UN9A 2KM4A 3FUMA 3CLJA 2LNIA 3IV0A 3MKQA 1DNPA 4PUCA 3E4BA 5FT9A 3EDTB 1HE8A 4A1SA 2WXKA 4PS8A 3FUHA 4FJZA 4MLPA 4P29A 4MRUA 4W9RA 2A4ZA 3CGHA 4GCOA 4I1OB 3TXNA 4KVMA 2JEKA 4GYWA 2FI7A 3MKRA 4UQXA 2WXFA 2KATA 2CHXA 3FY4A 4CRWA 4K0RA 3O48A 4HOUA 4JHRA 3L16A 4N39A 4HOTA 3OXFA 2AXZA 2WQ6A 3APDA 1U3DA 3IHYA 4I9EA 2V0PA 1UG3A 3D9NA 3NF1A 3EIJA 4FLBA 3TJPA 3T8MA 1INZA 4GA1A 4G1TA 3APCA 4I2ZA 4FHKA 3SHFA 3SNXA 1QZ2A 2P58C 3AU4A 5FZQA 1A17A 4GZCA 2VSYA 4RG6A 5T8IA 1EPUA 3SBSA 4XIFA 5LCWC 4B0ZA 4EBAA 4FA6A 4CT4A 3TAXA 2LSVA 1SQMA 2I6HA 2L6JA 1GW6A 4DK5A 3QJZA 4U0UA 3MKQB 3Q15A 4GYYA 3IBEA 2WXGA 3ZFWA 3DBSA 4R7LA 4JPSA 2IONA 3CVNA 1QQEA 3D3MA 3L13A 4BTAA 1KLXA 5G55A 2XEVA 5DIZA 3S2AA 3B7RL 4BX9A 3CVPA 2X6JA 3FTXA 4HORA 3HVEA 5CMYA 4I2WA 2L0IA 3LEWA 3B7UX 3NZUA 2HM8A 4E6HA 1TJFA 4DI3A 2DIWA 4OYSA 4U04A 2X6IA 4CDNA 3EHNA 4TUUA 4F53A 3BG1B 2VQ2A 2CHZA 2CHWA 2PQNA 4J8EA 3CHPA 4JW1A 3I5PA 4IRUA 4KT6B 1IYGA 1NP7A 2OOEA 4NURA 4AY6A 4I17A 4WWOA 1ZBPA 3L54A 2KCLA 3ONLA 4HFGA 3UMVA 2Y4TA 5LP0A 2J4BA 2XRZA 3OAWA 2GRMA 2UWJG 1XNFA 4UWFA 3SFZA 3ESKA 3UT8A 4NRHB 3LJ3A 3G2SA 4CT0A 4G2VA 4Q94A 2RD0A 3RO3A 3RO2A 5AIJA 4XX5A 3UUXA 2Q7FA 3CHMA 1P5QA 3DPDA 3KD7A 3PREA 3LKUA 4Q96A 2CG2A 4N3BA 2OV8A 2WXQA 2WXPA 3R7RA 1JPLA 1HO8A 4E85A 4A3VA 4PDXA 2XCCA 3ZHEB 3ZRHA 4FC8A 2R5SA 3JYSA 5G05C 4G11A 5EKQD 4DPRA 4U0SA 4HVBA 2QFCA 1X5BA 4J8SA 3ASGA 3D9PA 1PAQA 1WAO1 3HVEB 4UWGA 2GRLA 3FU3A 4GA0A 4A3TA 4AOFA 4BT8A 4A55A 2XGMA 1IHGA 4I1MA 4DLOA 3B13A 5DBKA 3QOUA 4GAAA 1NA3A 2LO6A 3ZIMA 3CV0A 5KJMA 1OUVA 3S7JA 4H7YA 5FQ4A 4XI9A 3CHRA 5EX3A 5T3RA 4WNGA 2WXIA 4BY6A 4I6EA 5FJYA 3OXLA 4HOQA 4LRZA 1Z3YA 3I4GA 3CVYA 2YHCA 4U8HA 4CGVA 2WM9A 3CEQA 4B8AA 4B94A 5D0OD 3OXGA 3RU0A 4EQFA 4B89A 3HIZA 2X3MA 1KT1A 3FUIA 1OWMA 1Y8MA 4ACLA 4F7AA 3FUJA 4DI4A 4L2LA 3CVXA 4JXTA 3APFA 3FEYA 2EQXA 3IKOB 4PS7A 4BT9A 3D9IA 2XGOA 1OWLA 1ZU2A 2BF0X 4ME2A 4BTBA 3JUIA 2E0IA 4I9CA 2AWIA 4GZDA 4JA9A 2J09A 5JJ6A 3CK9A 3ZYQA 4GU5A 1OWPA 1E7VA 4ILGA 4NACA 1HH8A 3MEKA 4LEUA 4N2SA 4F1SA 3QWVA 4WNFA 1EF1C 3ML9A 2KZTB 4Y6WA 1HZ4A 2WXLA 2X6FA 3ASHA 4C0EA 2AXVA 2PM6A 3D9JA 1ELWA 3CR3A 1HXIA 5J08A 2FO7A 3ULQA 4GMJA 3AS4A 3ZYLA 2V8SE 4GB9A 2IJGX 1E96B 3PH0C 5CCMA 1E8ZA 3Q49B 4XI0A 5D0QD 3ASDA 1SZAA 4UWLA 3FUNA 1NA0A 1H0AA 2Y4UA 3U9WA 2WXHA 4L1BA 2WQ7A 1UW4B 4Q69A 3RIBA 4CDMA 1WY6A 2V4LA 4UI9J 2MRIA 5C1DA 4D10C 5FWQA 5T4YA 3QK0A 4YVQC 3TG5A 3MZLB 2WXOA 3MCXA 3RJVA 4U0ZA 5BV1A 2A5UA 2LSUA 4A1GA 3UT4A 3QC1A 1UN8A 3MX3A 4KMOA 1OWNA 3PNTB 3D9MA 5ARGA 3G2UA 2J07A 2JLBA 3I4RB 4G24A 5E76A 3ZHEA 2L9BA 3GW4A 4LERA 3CVQA 3CVUA 4G26A 1IQUA 4Y6CA 5G2NA 4I6GA 4B8CB 1WM5A 4URKA 5KJKA 3AS5A 2LAIA 2MHKA 1TJCA 4FLHA 5A7DB 3RK6A 2WXMA 3FUFA 2VSNA 3FEXA 4N3AA 3UPVA 3KAEA 4MKTA 1W3BA 5LOZA 2NSZA 3B7SA 3LVQE 4GYOA 3AU5A 3FTVA 4APFA 4WNDA 4QFVA 2I9CA 3QKYA 2WXJA 4AY5A 5ANRA 2WXNA 5JHBA 1HG2A 3HDXA 3C98A 3CK7A 3PEVB 3PVLA 4JVSA 4UWKA 4I6JA 3FDHA 4IYPA 4JA7A 4GZ3A 4K03A 4JL0A 3FWVA 3R7QA 5KJNA 4XZ4A 2HR2A 3PE4A 2OVBA 1ELKA 3SI5A 4WWNA 5M72A 2CG3A 4LUNU 2KCKA 4UQYA 3D9KA 3MA5A 3I3NA 3QAQA 2KCVA 5A23A 4AP2A 4YVOA 3SZ7A 5HQ8A 1QNFA 3FU0A 3QWWA 3CHOA 2VJ8A 3QB2A 5CHEE 3PRZA 3EJNA 4ILIA 3NQPA 4FHJA 4BX8A 1FVHA 5JJTA 3GZSA 5BUZA 2XPZA 5ANLA 2VSOE 1HFAA 2NC9A 4XKBA 4GMLA 2KZTA 5AJLA 2IFUA 4L23A 1FCHA 2X6KA 2FEZA 1UJKA 1UJJA 4G25A 3CKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WUY A;  2AVP A;  4GCN A;  3S7F A;  3ZGQ A;  3CK8 A;  2V5F A;  2IF4 A;  4UI9 C;  2VGX A;  2E2E A;  4AIF A;  2XCB A;  4YND A;  1NZN A;  3AS8 A;  2WQH A;  4H7X A;  3S7D A;  3TG4 A;  3CVL A;  1ELR A;  3FP3 A;  4O6F A;  2FF4 A;  4G23 A;  3CKC A;  4WNE A;  3ZPJ A;  2VGY A;  3GZ1 A;  3LY8 A;  2HYZ A;  2VGX B;  3MV3 B;  3MV2 B;  2BUG A;  3URZ A;  4J0U A;  5CCL A;  4U07 A;  4J8D A;  4UI9 K;  2KC7 A;  2YQ8 A;  3GYZ A;  5FTP A;  5BT1 A;  5G04 J;  4HOS A;  2PZI A;  4F3V A;  4GZ5 A;  2PQR A;  5AYW D;  4NQ0 A;  3QWP A;  3QDN A;  5BNW A;  3ZN3 A;  3TGO A;  4UQZ A;  3ASF A;  3GZ2 A;  2J9Q A;  2UY1 A;  5FZS A;  3LPZ A;  4RG9 A;  1KT0 A;  4APO A;  4ABN A;  3KS2 A;  4KYO B;  4AM9 A;  3U4T A;  5JJ7 A;  4N3C A;  4J8F A;  4GZ6 A;  3WXX A;  3N71 A;  1B89 A;  4GA2 A;  2DBA A;  5BW8 C;  2HO1 A;  5FZR A;  3RKV A;  4I1A A;  3LY7 A;  3IEG A;  1YA0 A;  1PC2 A;  5HI7 A;  2XGS A;  4N5C A;  2UY1 B;  5KJL A;  2VYI A;  3BEE A;  3HYM B;  3Q4A B;  3LCA A;  5LCW J;  4N2Q A;  2OND A;  3LYA A;  3K9I A;  3Q5M A;  3VTY A;  3FFL A;  3U3W A;  2GW1 A;  5EX0 A;  4BWR A;  4IN3 B;  2XPI A;  4CGW A;  4CDR A;  3R9A B;  2C2L A;  5G04 C;  3SF4 A;  2C0M A;  3VTX A;  2FBN A;  2C0L A;  4KBQ A;  2PL2 A;  3S7B A;  4KXK B;  3LY9 A;  3Q47 B;  5ARF A;  3UQ3 A;  3PE3 A;  5A6C A;  3PDN A;  2WPV A;  5G05 J;  4GPK A;  2LNI A;  5FT9 A;  3E4B A;  3EDT B;  4A1S A;  4W9R A;  4GCO A;  4GYW A;  2FI7 A;  3MKR A;  4UQX A;  2KAT A;  3O48 A;  4JHR A;  4N39 A;  4HOT A;  3OXF A;  4I9E A;  3NF1 A;  4GA1 A;  4G1T A;  4I2Z A;  1QZ2 A;  2P58 C;  5FZQ A;  1A17 A;  2VSY A;  4RG6 A;  5LCW C;  4XIF A;  3TAX A;  2LSV A;  2I6H A;  2L6J A;  4U0U A;  3Q15 A;  4GYY A;  3ZFW A;  3CVN A;  1QQE A;  4BTA A;  1KLX A;  2XEV A;  5DIZ A;  3CVP A;  4HOR A;  4I2W A;  4U04 A;  2VQ2 A;  2PQN A;  4J8E A;  1IYG A;  2OOE A;  4AY6 A;  4I17 A;  1ZBP A;  2KCL A;  2Y4T A;  2UWJ G;  1XNF A;  3ESK A;  4NRH B;  4G2V A;  3RO3 A;  3RO2 A;  3UUX A;  2Q7F A;  3KD7 A;  1P5Q A;  3LKU A;  4N3B A;  2XCC A;  3ZHE B;  2R5S A;  3JYS A;  5G05 C;  5EKQ D;  4U0S A;  2QFC A;  3ASG A;  1WAO 1;  4GA0 A;  4BT8 A;  2XGM A;  1IHG A;  5DBK A;  3QOU A;  1NA3 A;  3CV0 A;  5KJM A;  1OUV A;  3S7J A;  4H7Y A;  4XI9 A;  5EX3 A;  4WNG A;  5FJY A;  3OXL A;  4HOQ A;  2YHC A;  4CGV A;  3CEQ A;  4B94 A;  5D0O D;  3OXG A;  3RU0 A;  4EQF A;  1KT1 A;  1Y8M A;  4BT9 A;  2XGO A;  1ZU2 A;  4ME2 A;  4BTB A;  4I9C A;  4JA9 A;  5JJ6 A;  3CK9 A;  4LEU A;  3MEK A;  1HH8 A;  4N2S A;  3QWV A;  4WNF A;  4Y6W A;  1HZ4 A;  3ASH A;  1ELW A;  1HXI A;  2FO7 A;  3ULQ A;  3AS4 A;  1E96 B;  5CCM A;  3Q49 B;  4XI0 A;  5D0Q D;  3ASD A;  1NA0 A;  2Y4U A;  3RIB A;  4UI9 J;  5C1D A;  3TG5 A;  4YVQ C;  3RJV A;  4U0Z A;  2LSU A;  5ARG A;  2JLB A;  4G24 A;  3ZHE A;  3GW4 A;  3CVQ A;  4G26 A;  4Y6C A;  1WM5 A;  5KJK A;  3AS5 A;  2MHK A;  5A7D B;  1TJC A;  2VSN A;  4N3A A;  3UPV A;  3KAE A;  1W3B A;  4GYO A;  4WND A;  3QKY A;  4AY5 A;  3CK7 A;  4JA7 A;  5KJN A;  4GZ3 A;  4JL0 A;  3FWV A;  2HR2 A;  3PE4 A;  5M72 A;  2KCK A;  4UQY A;  3MA5 A;  2KCV A;  5HQ8 A;  4YVO A;  3SZ7 A;  3QWW A;  5CHE E;  5JJT A;  2NC9 A;  2IFU A;  1FCH A;  2FEZ A;  4HOU A;  4G25 A;  3CKB A; 
#chains in the Genus database with same CATH topology
 3TWR A;  5BV0 A;  5ITZ F;  3FTU A;  1JCS A;  4GTP A;  2IF4 A;  4A63 B;  3CQG B;  1TEZ A;  1E7U A;  1NZN A;  4K5C A;  1MQS A;  3ZYK A;  2KXP C;  2I2O A;  3LJN A;  1K3Z D;  1TNZ A;  3FP3 A;  4HNA D;  4EEC A;  3O4Z A;  2FF4 A;  4G23 A;  3CKC A;  2ZIS A;  4HI9 A;  4OVU A;  2BTD A;  2OEW A;  4ANV A;  1JWG A;  2ZIR A;  5LX8 A;  3C72 A;  4CYM D;  3MV2 B;  2P2C P;  5BXU A;  2YNQ A;  3RRM B;  5CCL A;  5FTP A;  5B1A E;  3SGH A;  4GMR A;  1LD7 A;  5BT1 A;  4DRX E;  5AJD A;  1DVP A;  1Q2Z A;  2RFA A;  3ZN3 A;  3FU5 A;  5CEA A;  3ZW3 A;  3HHM A;  2HE0 A;  4HXI A;  2IQC A;  1S63 A;  3PUK A;  2GGF A;  2J9Q A;  3BG0 B;  3LPZ A;  3UT7 A;  2P9I G;  4RG9 A;  4HLL A;  4PH4 B;  4APO A;  4ANW A;  4KYO B;  4K5B A;  1Y6I A;  5D66 A;  2QYU A;  5BPP A;  1H2T C;  2EIL E;  3N71 A;  2I1K A;  5AAR A;  1B89 A;  4ANX A;  2I1J A;  2DBA A;  1BD8 A;  3NOC D;  4ZHB A;  4I1A A;  1K1B A;  2WVI A;  2XGS A;  4XKC A;  5FIN A;  5KJL A;  1N94 A;  3ESL A;  5LCW J;  3RAU A;  4JEU A;  4JC8 A;  2XHE A;  3LYA A;  3TWW A;  4FUL A;  3U66 A;  2GW1 A;  3DSX A;  1N52 A;  3VLD A;  4IN3 B;  5KBA A;  3D9O A;  2XRY A;  2DYR E;  4CGW A;  3E32 A;  3T5X A;  3G2T A;  3R9A B;  3DST A;  4XE0 A;  2C2L A;  3SF4 A;  2C0M A;  3RRU A;  3VLF A;  3L22 A;  4L9P A;  2C0L A;  2PL2 A;  1Z3X A;  1TNO A;  4B93 B;  5ARF A;  4U8Y D;  2V4H C;  5G05 J;  1UN9 A;  2KM4 A;  3IV0 A;  5FT9 A;  3E4B A;  3EDT B;  4P29 A;  2A4Z A;  3TXN A;  3UIP C;  4CRW A;  2XEH A;  2JAB A;  3L16 A;  2WQ6 A;  3APD A;  3Q75 A;  4DX2 A;  3IHY A;  3TJP A;  1INZ A;  1H6P A;  3JUE A;  1A17 A;  1FPP A;  5T8I A;  3SBS A;  4XIF A;  3Q7F A;  4EBA A;  2FO1 E;  5B1B E;  3MKQ B;  2KBX A;  3ZFW A;  1QQE A;  3D3M A;  5G55 A;  2XEV A;  5DIZ A;  4N5Q A;  5ENQ D;  3TWU A;  2DIW A;  4OYS A;  3BG1 B;  2CHW A;  2PQN A;  3CHP A;  4KT6 B;  1ZBP A;  2F8Y A;  2J4B A;  2XRZ A;  1XNF A;  3UT8 A;  3LJ3 A;  3G2S A;  4G2V A;  2RD0 A;  3DSW A;  3RO2 A;  5AIJ A;  3UUX A;  2CG2 A;  4N3B A;  4GPM A;  2OV8 A;  1HO8 A;  3ZRH A;  4FC8 A;  3JYS A;  2ETA A;  4HVB A;  2QFC A;  3ASG A;  1PAQ A;  3HVE B;  2GRL A;  4A3T A;  4GA0 A;  4A55 A;  4O1O A;  2LO6 A;  3CV0 A;  2DZN A;  3CVY A;  4U8H A;  2WM9 A;  3CEQ A;  3FUI A;  5AQ9 A;  1D9S A;  4DI4 A;  1KZP A;  3CVX A;  4JXT A;  3APF A;  2EQX A;  1X81 A;  2QZA A;  3D9I A;  4BT9 A;  4ME2 A;  4I9C A;  5JJ6 A;  1OWP A;  4LEU A;  4N2S A;  4F1S A;  4Y6W A;  1H6O A;  2XZD G;  3ASH A;  4C0E A;  2PM6 A;  1QBQ A;  3CR3 A;  4DX1 A;  2FO7 A;  1SA5 A;  2V8S E;  4GB9 A;  5CCM A;  1E8Z A;  3ASD A;  3U9W A;  2WXH A;  4CDM A;  2MRI A;  4D10 C;  2AJA A;  4HQD A;  4YVQ C;  2WXO A;  3QC1 A;  1UN8 A;  1OWN A;  2J07 A;  5E76 A;  2QC9 A;  4HI8 A;  1OT8 A;  3ZHE A;  3CVU A;  1IQU A;  4Y6C A;  4B8C B;  2Y0B G;  1MX4 A;  4URK A;  3RK6 A;  2MHK A;  5A7D B;  1SA4 A;  4MKT A;  1NI1 A;  3E30 A;  4U7E B;  3B7S A;  3LVQ E;  1OCC E;  4GYO A;  4F6R D;  4QFV A;  2XZT G;  2H6G A;  4HRN A;  2WXN A;  4JVS A;  2H6H A;  3PEV B;  2J8S D;  3AJI A;  2CG3 A;  2KCK A;  1N4R A;  4UQY A;  4TXP A;  2KCV A;  5A23 A;  5HQ8 A;  3KSL A;  4ILI A;  1FVH A;  3NAW A;  2VSO E;  3EUV A;  2KZT A;  4U95 D;  5CRU A;  3DXK G;  2FEZ A;  1UJK A;  3R7R A;  4G25 A;  2EIN E;  3UTM A;  4J6I A;  3FUD A;  3R9M A;  2Y3A A;  3CK8 A;  3TXM A;  4G8K A;  3SFX A;  3PNL B;  2Y1L E;  3HXC A;  5ENN A;  3PZD A;  2ETC A;  2QY7 A;  3ZXS A;  3DSS A;  2WQH A;  3SBT B;  3TG4 A;  1FVF A;  3FTZ A;  3MJW A;  2XEE A;  1ELR A;  2DYS E;  4FJY A;  5FIO A;  4EPZ A;  3NB2 A;  3PZ3 A;  4TRQ A;  2EIJ E;  4O1P A;  1UJJ A;  2WMO A;  2J08 A;  3ENE A;  1NL4 A;  2HYZ A;  2P9K G;  1HG5 A;  3Q73 A;  2VGX B;  3UXG A;  3U64 A;  1U3C A;  1IKN D;  2M63 A;  5E75 A;  4F1P A;  1S70 B;  3C3Q A;  4WWP A;  3KSQ A;  3MGB A;  4U07 A;  3EHQ A;  5HRY A;  4CCA A;  2XS8 A;  2OEV A;  2PZI A;  2WXR A;  4F3V A;  4QQI A;  3LVR E;  4GZ5 A;  4ILH B;  3UX4 A;  3BQO A;  2MOW A;  3QDN A;  2QYJ A;  1MJ0 A;  3V2X A;  5BNW A;  4UQZ A;  1HS6 A;  3OTN A;  3EHM A;  2B6C A;  3PUJ A;  3TWT A;  1RZ4 A;  5FZS A;  5B3S E;  3L08 A;  3ABK E;  1H19 A;  3QAR A;  3KS2 A;  2CFU A;  3VLE A;  5J90 A;  4KZC A;  5AQB A;  1BPO A;  1BLX B;  2LAH A;  2P9U G;  3B7T A;  3DXM G;  3CQC B;  3HXE A;  1JWF A;  2DWZ A;  3C3O A;  3LY7 A;  4MS6 A;  1PC2 A;  4JHJ A;  4OVV A;  1AWC B;  3CVV A;  4N5C A;  4I43 A;  4RSY A;  3BEE A;  5KCM A;  3LCA A;  2OND A;  3E33 A;  1VDY A;  2X38 A;  2NXP A;  2R03 A;  3FFL A;  4UWH A;  1LD8 A;  3RRN B;  4DX7 D;  2EIM E;  3P2B A;  2XPI A;  1PY1 A;  1HF8 A;  5G04 C;  4ATG A;  3T5V A;  2IU1 A;  1JUQ A;  1QYM A;  3QNK A;  3VTX A;  1D8E A;  2FBN A;  3ISM C;  1TN8 A;  3C5R A;  3L82 A;  3S7B A;  1MHQ A;  2NYJ A;  2LUH A;  2Y69 E;  4TV3 A;  3AG4 E;  3RSE G;  4GPK A;  3MKQ A;  3FUM A;  1S64 A;  1DNP A;  1HE8 A;  2WXK A;  4PS8 A;  1YCS B;  3FUH A;  5AQ7 A;  4GCO A;  4I1O B;  4C48 B;  4HB5 A;  4GYW A;  2FI7 A;  1ZB1 A;  4UUC A;  5ENR D;  3MKR A;  3FY4 A;  1FT1 A;  4JHR A;  4N39 A;  3OXF A;  2V0P A;  1UG3 A;  3EIJ A;  4FLB A;  4GA1 A;  4FHK A;  1N4Q A;  1QZ2 A;  3AU4 A;  1D8D A;  5FZQ A;  4U96 D;  3TAX A;  3Q15 A;  3TWQ A;  2WXG A;  4R7L A;  2ZGD A;  3CVN A;  4BTA A;  4BX9 A;  3B7R L;  3CVP A;  1TNY A;  3ASN E;  3FTX A;  3HVE A;  3B7U X;  4TXR A;  3V31 A;  4JB8 P;  2X6I A;  4J8E A;  5CBN A;  3I5P A;  1NP7 A;  2OOE A;  4AY6 A;  3UM3 A;  2Y4T A;  5LP0 A;  3C3R A;  4UWF A;  3SFZ A;  3RO3 A;  4X8Q A;  4XX5 A;  3KD7 A;  3LKU A;  4Q96 A;  2VGE A;  1JPL A;  4E85 A;  5EKQ D;  1X5B A;  4BT8 A;  2XGM A;  5DBK A;  5ENP D;  3S7J A;  5FQ4 A;  5EX3 A;  5T3R A;  4WNG A;  2WXI A;  1N95 A;  2H6F A;  1TNB A;  5FJY A;  4HOQ A;  5D0O D;  3HIZ A;  1OWM A;  3UM0 A;  3FUJ A;  1G3N B;  4JD2 G;  3FEY A;  3DSV A;  4RLY A;  3IKO B;  1OWL A;  1ZU2 A;  2BF0 X;  3JUI A;  2AWI A;  4GU5 A;  4NAC A;  1EF1 C;  1HZ4 A;  1JCR A;  3D9J A;  1ELW A;  5J08 A;  4GMJ A;  3AS4 A;  4BSZ B;  3ZYL A;  2IJG X;  3PH0 C;  3UIN C;  1YMP A;  4YDY A;  3X2Q E;  1NA0 A;  2Y4U A;  1OCO E;  4MBG A;  3UM1 A;  3RIB A;  3SO8 A;  1WY6 A;  5C1D A;  5FWQ A;  5D2M C;  3MCX A;  2A5U A;  4KMO A;  2JLB A;  3I4R B;  3CVQ A;  4G26 A;  4I6G A;  3AS5 A;  5KNH D;  1TJC A;  5CEC B;  2VSN A;  1W3B A;  1KPS B;  2P9N G;  3EU5 A;  4APF A;  1LTX A;  3PVL A;  3CK7 A;  4UWK A;  3FDH A;  4JL0 A;  3FWV A;  2OVB A;  1ELK A;  3SY2 A;  4LUN U;  3I3N A;  2BED A;  4YVO A;  3SZ7 A;  1QNF A;  3FU0 A;  5CHE E;  2VJ8 A;  3ULY A;  3NQP A;  4BX8 A;  5BUZ A;  5ANL A;  4DX6 D;  5AJL A;  4U63 A;  4WUY A;  3V79 K;  3KEZ A;  4GCN A;  4L7T A;  3JQ0 A;  4HBD A;  4BFR A;  3L6A A;  2V5F A;  3HRA A;  4UI9 C;  3UKR G;  2VGX A;  4ANU A;  2XPY A;  3ZU7 B;  1N4S A;  2E2E A;  5ENS D;  3LXU X;  4H7X A;  3CVL A;  4EZK A;  3ML8 A;  4YDW A;  2YHE A;  3FUL A;  4YDE A;  3TWS A;  5C2Y A;  3TL5 A;  2VGY A;  3GZ1 A;  3LY8 A;  3ZYM A;  4FP7 A;  4EZL A;  3E34 A;  4C9B B;  4NIK A;  3B95 A;  3P1U A;  3FUK A;  3FHE A;  2BUG A;  5AN8 A;  1E8X A;  2IEJ A;  4BEP A;  3FH5 A;  4RVB A;  2R02 A;  2VTB B;  4J8D A;  1K1A A;  2DZO A;  3AG3 E;  5EDS A;  4HOS A;  4NQ0 A;  5AYW D;  3TGO A;  4AVX A;  3ASF A;  3ZKJ A;  2ZU6 B;  1V54 E;  3CSF A;  4EBA G;  1KT0 A;  2WB2 A;  1OCR E;  4ABN A;  4KVO A;  5JJ7 A;  3DPY A;  3ZEF A;  4GZ6 A;  2R05 A;  4GTQ A;  1O1S A;  2J49 A;  4GA2 A;  1HX8 A;  2HO1 A;  5ENO D;  5CRV A;  5FZR A;  5HI7 A;  1H6K A;  4HS2 A;  4PS3 A;  1SVX A;  3AG1 E;  1WG0 A;  2UY1 B;  2VYI A;  1N0Q A;  3HYM B;  2VSX E;  4FAD A;  3K9I A;  3Q5M A;  2F0Y A;  2BKG A;  1E8Y A;  1OWO A;  4TUM A;  3CST A;  5EX0 A;  4KZ0 A;  4BWR A;  4L2Y A;  2L0T B;  1Z5S C;  2DCP A;  3FH8 A;  5H7P A;  5LFA A;  2J4D A;  3FUE A;  2IO3 C;  4KBQ A;  4BER A;  2X6H A;  3PZ4 A;  3Q9U C;  4LNG A;  4KXK B;  3LY9 A;  2IOL A;  5A6C A;  3PDN A;  1E90 A;  1H2U A;  1L5J A;  4AEZ C;  3S2A A;  3CLJ A;  1BI7 B;  2LNI A;  4PUC A;  4A1S A;  4FJZ A;  4MRU A;  3CGH A;  2WXF A;  2KAT A;  2P9S G;  4K0R A;  3O48 A;  3Q78 A;  4GTM A;  2P9P G;  2GRP B;  3SHF A;  4I2Z A;  2P58 C;  3SFY A;  4GTV A;  1EPU A;  5LCW C;  3DRA A;  1TNU A;  4B0Z A;  4CT4 A;  2H6I A;  2LSV A;  2I6H A;  2L6J A;  1BI8 B;  2ION A;  3F6Q A;  3L13 A;  3ZXP A;  1KLX A;  1DCQ A;  4HOR A;  5CMY A;  4I2W A;  3DEO A;  3NZU A;  2A5E A;  3ABL E;  1A5E A;  2DVW A;  4CDN A;  3EHN A;  2VQ2 A;  2CHZ A;  5EIB E;  4JW1 A;  4IRU A;  4NUR A;  1UOH A;  3L54 A;  3UMV A;  2GRM A;  2UWJ G;  4NRH B;  4CT0 A;  2Q7F A;  3CHM A;  3DPD A;  3BUA A;  4A3V A;  3ZHE B;  2R5S A;  5G05 C;  4G11 A;  4J8S A;  4UWG A;  1WAO 1;  4DUI A;  3FU3 A;  2MYO A;  1IHG A;  4I1M A;  4GAA A;  3ZIM A;  5KJM A;  4H7Y A;  4XI9 A;  1MX6 A;  4BY6 A;  1AP7 A;  4LRZ A;  3I4G A;  2YHC A;  4CGV A;  3BU8 A;  2XS1 A;  4B94 A;  3OXG A;  3NOG D;  4EQF A;  4B89 A;  2X3M A;  3W9F A;  1KT1 A;  1Y8M A;  3TWX A;  4HRL A;  4L2L A;  4LNB A;  3PZ1 A;  1RW2 A;  4GTT A;  4ATZ D;  4BTB A;  2E0I A;  4GZD A;  2J09 A;  1E7V A;  1HH8 A;  3ML9 A;  2KZT B;  2WXL A;  2X6F A;  4GTS A;  2LXL A;  1HXI A;  3ABM E;  2GRR B;  3WG7 E;  3DWL G;  1E96 B;  2IO2 C;  3Q49 B;  4XI0 A;  2WQ7 A;  1UW4 B;  4BET A;  2V4L A;  4OAV B;  1N11 A;  4J7W A;  3QK0 A;  3UM2 A;  4O60 A;  3RJV A;  4U0Z A;  5BV1 A;  2LSU A;  3E37 A;  3AAA C;  3MX3 A;  3PNT B;  5KNG A;  5AAO A;  4GTR A;  5IY5 E;  4YDO A;  3GW4 A;  5G2N A;  1WM5 A;  5KJK A;  2LAI A;  1MX2 A;  4FLH A;  2WXM A;  3FUF A;  4N3A A;  1TR4 A;  3UPV A;  3KAE A;  5LOZ A;  2NSZ A;  1YYH A;  4EHM A;  3FTV A;  4WND A;  2WXJ A;  3EU9 A;  4AY5 A;  5ANR A;  5JHB A;  1HG2 A;  3HDX A;  4I6J A;  4K03 A;  4IYP A;  3R7Q A;  4DX5 D;  2HR2 A;  3SI5 A;  4LG6 A;  3MA5 A;  3QWW A;  3PRZ A;  4FHJ A;  2XPZ A;  2NC9 A;  4XKB A;  3HXB A;  2IFU A;  4L23 A;  4RQI A;  3JXI A;  4DI3 A;  2AVP A;  3S7F A;  3ZGQ A;  4JZY A;  1WDY A;  5JHA A;  2IOS A;  4JEH A;  3FH7 A;  4AV7 A;  3PEU B;  4CEM A;  4OAU C;  3J5P A;  3FTS A;  4JHK A;  2R17 C;  4DLQ A;  2YIN A;  1EYH A;  4CZ2 D;  3G2W A;  3FTY A;  4HLE A;  1SZ9 A;  4AIF A;  3UKU G;  3B7B A;  2B0O E;  2XCB A;  4YND A;  3AS8 A;  3MYV A;  2OVF A;  3S7D A;  2ILR A;  2VTB A;  1K8K G;  3D9L A;  4ZFH A;  5JMN D;  4G8L A;  3L17 A;  2ZGG A;  4O6F A;  2PM7 A;  4WNE A;  3ZPJ A;  2AW6 A;  1TN6 A;  3J5Q B;  4M3O A;  2XQ0 A;  1SW6 A;  3ZUV B;  4AXH A;  3UIO C;  3MV3 B;  3ZVV A;  3URZ A;  4J0U A;  5CMW A;  3CHS A;  4EZJ A;  4UI9 K;  2KC7 A;  2YQ8 A;  2ZXW E;  3G2V A;  3GYZ A;  4WAF A;  4M7C A;  5G04 J;  2F37 A;  4IUL A;  2PQR A;  5EN5 D;  3SD5 A;  3QWP A;  1KZO A;  3CIA A;  2IY0 C;  5AEN A;  3CVW A;  4LCT A;  3GZ2 A;  2UY1 A;  4U8V D;  2RKK A;  2WMN A;  3JXJ A;  4AJW A;  4AM9 A;  3U4T A;  4N3C A;  4J8F A;  1Z6T A;  1MYO A;  1E8W A;  3T8K A;  4C0M A;  1XGW A;  3WXX A;  1N54 A;  1N9A A;  5FQ6 A;  5BW8 C;  3JCK C;  3FU6 A;  2R59 A;  4ACK A;  3RKV A;  3IEG A;  1YA0 A;  1EDU A;  1N4P A;  4DJA A;  3HXF A;  1HU3 A;  3NZS A;  3V30 A;  3Q4A B;  4N2Q A;  1IQR A;  3LS8 A;  1S0P A;  3VTY A;  5ENT D;  5CBO A;  5FQ7 A;  5EYP F;  4V3I A;  3U3W A;  4GTO A;  2AXU A;  3JQ1 A;  5HS0 A;  3CHQ A;  3FTW A;  3PS6 A;  3EIQ C;  1LF8 A;  4CDR A;  1JCQ A;  1H2V C;  3DSU A;  5FQ8 A;  3LDZ A;  3TWV A;  1O1T A;  5EID A;  2RG8 A;  3ONK A;  2CFZ A;  4BSX A;  2FUL A;  4FU3 A;  3Q47 B;  3IHV A;  2P9L G;  3UQ3 A;  3PE3 A;  2WPV A;  1FT2 A;  1TYQ G;  4MLP A;  4W9R A;  4KVM A;  2JEK A;  2BKK B;  3SQV A;  4UQX A;  2CHX A;  4TXQ A;  2L6B A;  4HOT A;  2AXZ A;  1U3D A;  4I9E A;  3D9N A;  3NF1 A;  3T8M A;  3ZNG A;  4G1T A;  3Q79 A;  3APC A;  3SNX A;  1IHB A;  4GZC A;  2VSY A;  4RG6 A;  4FA6 A;  3W9G A;  1SQM A;  1GW6 A;  4DK5 A;  3QJZ A;  4U0U A;  4GYY A;  3IBE A;  1MZC A;  3DBS A;  4JPS A;  3AG2 E;  1O1R A;  5CER B;  2X6J A;  1V55 E;  2L0I A;  3LEW A;  2XEN A;  2HM8 A;  4E6H A;  1TJF A;  4HRM B;  4U04 A;  4TUU A;  4F53 A;  1IYG A;  3KEA A;  4I17 A;  5CED B;  4WWO A;  4HFG A;  1OCZ E;  2KCL A;  3ONL A;  2V5Q C;  5JA4 D;  3OAW A;  3ESK A;  4Q94 A;  3V2O A;  1P5Q A;  4Z68 A;  3PRE A;  4XEI G;  3HG0 D;  2WXQ A;  2WXP A;  4PDX A;  2XCC A;  5KWD A;  4DPR A;  4U0S A;  3D9P A;  2GRO B;  4AOF A;  4DLO A;  3B13 A;  3QOU A;  1NA3 A;  1DCE A;  4BES A;  1OUV A;  3CHR A;  3D9H A;  5BXO A;  4I6E A;  3OXL A;  1Z3Y A;  1U2V G;  4B8A A;  4LSZ E;  3RU0 A;  2GRN B;  5EIL A;  4ACL A;  4F7A A;  1NFI E;  4PS7 A;  2XGO A;  4JA9 A;  2PNN A;  3ZYQ A;  3CK9 A;  3UI2 A;  3NBN B;  1OXJ A;  4ILG A;  3MEK A;  3L9T A;  3QWV A;  5HKP A;  4WNF A;  3Q9N C;  2EIK E;  2GRQ B;  2F8X K;  2AXV A;  4LNU D;  3PZ2 A;  3ULQ A;  2ETB A;  1DC2 A;  5EYL A;  5D0Q D;  1TN7 A;  1SZA A;  3Q7A A;  4UWL A;  3FUN A;  5AQA A;  1H0A A;  4L1B A;  4Q69 A;  4UI9 J;  1IXV A;  5T4Y A;  3TG5 A;  3MZL B;  3IXE A;  4A1G A;  3ULE G;  3UT4 A;  3D9M A;  5ARG A;  3G2U A;  3HXD A;  4G24 A;  1O5M A;  2L9B A;  4LER A;  3EHR A;  4K5A B;  3FEX A;  3T9K A;  3AU5 A;  2RFM A;  2I9C A;  3QKY A;  3C98 A;  2LXM A;  4JA7 A;  5KJN A;  4GZ3 A;  4XZ4 A;  3PE4 A;  5M72 A;  4WWN A;  3D9K A;  2OCC E;  4J8Y A;  3QAQ A;  1BU9 A;  3DEP A;  4AP2 A;  3ASO E;  3CHO A;  3QB2 A;  3EJN A;  5JJT A;  3GZS A;  1HFA A;  4GML A;  1N0R A;  2R2L A;  1FCH A;  2X6K A;  1OY3 D;  4HOU A;  3CKB A; 
#chains in the Genus database with same CATH homology
 4U63 A;  4WUY A;  2AVP A;  3KEZ A;  4GCN A;  5BV0 A;  3S7F A;  4L7T A;  3JQ0 A;  4JZY A;  3FUD A;  4J6I A;  3ZGQ A;  4GPK A;  4BFR A;  5JHA A;  2IOS A;  2Y3A A;  3CK8 A;  4JEH A;  3TXM A;  3FH7 A;  4AV7 A;  3PEU B;  3FTU A;  4CEM A;  3L6A A;  3FTS A;  4JHK A;  2R17 C;  2V5F A;  3PNL B;  2IF4 A;  4DLQ A;  2YIN A;  1EYH A;  4UI9 C;  3CQG B;  2VGX A;  3G2W A;  1TEZ A;  4ANU A;  2XPY A;  3FTY A;  4HLE A;  2E2E A;  5ENN A;  3PZD A;  1SZ9 A;  4AIF A;  2XCB A;  1E7U A;  2QY7 A;  3ZXS A;  4YND A;  1NZN A;  3AS8 A;  3MYV A;  2WQH A;  2OVF A;  1MQS A;  3LXU X;  4H7X A;  3S7D A;  2ILR A;  3SBT B;  3TG4 A;  2VTB A;  1FVF A;  3ZYK A;  3FTZ A;  3D9L A;  3CVL A;  3MJW A;  4EZK A;  1ELR A;  3ML8 A;  2I2O A;  3L17 A;  4FJY A;  4EPZ A;  2YHE A;  3FP3 A;  3FUL A;  4EEC A;  3O4Z A;  4O6F A;  2PM7 A;  2FF4 A;  4G23 A;  4TRQ A;  5C2Y A;  3CKC A;  4WNE A;  3TL5 A;  2VGY A;  3GZ1 A;  3ZPJ A;  4OVU A;  2BTD A;  3LY8 A;  2WMO A;  2J08 A;  3ENE A;  2AW6 A;  4FP7 A;  3ZYM A;  4EZL A;  2HYZ A;  4C9B B;  1HG5 A;  4M3O A;  4ANV A;  1JWG A;  2XQ0 A;  2VGX B;  5LX8 A;  4AXH A;  3U64 A;  1U3C A;  3P1U A;  3FUK A;  2M63 A;  3MV3 B;  3MV2 B;  5E75 A;  3FHE A;  3ZVV A;  2BUG A;  2YNQ A;  3RRM B;  3URZ A;  1E8X A;  4J0U A;  4WWP A;  5CCL A;  3MGB A;  4U07 A;  3FH5 A;  4RVB A;  5CMW A;  3CHS A;  2VTB B;  4EZJ A;  4J8D A;  4UI9 K;  2KC7 A;  2YQ8 A;  5EDS A;  3G2V A;  3GYZ A;  5FTP A;  4WAF A;  3SGH A;  5BT1 A;  4CCA A;  5AJD A;  5G04 J;  4HOS A;  2PZI A;  2WXR A;  4F3V A;  3LVR E;  4GZ5 A;  4ILH B;  4IUL A;  2PQR A;  3UX4 A;  1DVP A;  3SD5 A;  4NQ0 A;  2MOW A;  3QDN A;  3QWP A;  5AYW D;  3CIA A;  5AEN A;  3CVW A;  5BNW A;  3ZN3 A;  3TGO A;  3FU5 A;  3ZW3 A;  4AVX A;  3HHM A;  4UQZ A;  1HS6 A;  3ASF A;  3OTN A;  4HXI A;  4LCT A;  3GZ2 A;  2IQC A;  2ZU6 B;  3EHM A;  3PUK A;  3PUJ A;  2GGF A;  2J9Q A;  2UY1 A;  3BG0 B;  5FZS A;  3LPZ A;  3UT7 A;  3CSF A;  4RG9 A;  4EBA G;  3L08 A;  1KT0 A;  2WB2 A;  4PH4 B;  2WMN A;  4APO A;  1H19 A;  4ABN A;  4AJW A;  3QAR A;  3KS2 A;  4ANW A;  4KYO B;  4KVO A;  2CFU A;  3U4T A;  4AM9 A;  3VLE A;  5JJ7 A;  4N3C A;  4J8F A;  5J90 A;  4KZC A;  1Y6I A;  3ZEF A;  1Z6T A;  4GZ6 A;  1BPO A;  5BPP A;  2LAH A;  1E8W A;  4C0M A;  3B7T A;  1XGW A;  1H2T C;  3WXX A;  3N71 A;  2I1K A;  4ANX A;  1B89 A;  2J49 A;  4GA2 A;  2I1J A;  1N54 A;  5FQ6 A;  1HX8 A;  2DBA A;  5BW8 C;  3CQC B;  2HO1 A;  1JWF A;  3JCK C;  3FU6 A;  2R59 A;  5FZR A;  3RKV A;  4I1A A;  4ACK A;  3LY7 A;  3IEG A;  1YA0 A;  4MS6 A;  1PC2 A;  1EDU A;  5HI7 A;  4JHJ A;  4OVV A;  1H6K A;  4HS2 A;  3CVV A;  2WVI A;  2XGS A;  4N5C A;  4PS3 A;  4DJA A;  4I43 A;  1HU3 A;  2UY1 B;  4XKC A;  2VYI A;  5KJL A;  3ESL A;  3NZS A;  4RSY A;  3BEE A;  3HYM B;  3Q4A B;  5KCM A;  3LCA A;  5LCW J;  2VSX E;  4FAD A;  4N2Q A;  2OND A;  4JEU A;  1IQR A;  2XHE A;  3LYA A;  3K9I A;  3LS8 A;  4JC8 A;  3Q5M A;  1S0P A;  3VTY A;  1VDY A;  2X38 A;  4FUL A;  5FQ7 A;  2NXP A;  3U66 A;  1E8Y A;  4V3I A;  3FFL A;  3U3W A;  2GW1 A;  4UWH A;  1OWO A;  3RRN B;  2AXU A;  3CST A;  1N52 A;  3JQ1 A;  5EX0 A;  3VLD A;  4KZ0 A;  4BWR A;  4IN3 B;  3CHQ A;  3FTW A;  3PS6 A;  2L0T B;  4L2Y A;  3D9O A;  2XRY A;  3P2B A;  2XPI A;  3EIQ C;  4CGW A;  2DCP A;  1LF8 A;  4CDR A;  3FH8 A;  3T5X A;  3G2T A;  3R9A B;  1PY1 A;  4XE0 A;  1HF8 A;  2C2L A;  1H2V C;  5G04 C;  4ATG A;  3SF4 A;  5LFA A;  2J4D A;  3T5V A;  2IU1 A;  1JUQ A;  5FQ8 A;  2C0M A;  3FUE A;  3QNK A;  3LDZ A;  3RRU A;  3VTX A;  3VLF A;  2FBN A;  3L22 A;  2C0L A;  4KBQ A;  2X6H A;  2PL2 A;  3S7B A;  2RG8 A;  1MHQ A;  1Z3X A;  3ONK A;  2CFZ A;  4BSX A;  2FUL A;  4FU3 A;  4KXK B;  3LY9 A;  3Q47 B;  3IHV A;  4TV3 A;  5ARF A;  3UQ3 A;  2IOL A;  3PE3 A;  3PDN A;  5A6C A;  1E90 A;  1H2U A;  2WPV A;  1L5J A;  5G05 J;  4AEZ C;  1UN9 A;  2KM4 A;  3FUM A;  3CLJ A;  2LNI A;  3IV0 A;  3MKQ A;  1DNP A;  4PUC A;  3E4B A;  5FT9 A;  3EDT B;  1HE8 A;  4A1S A;  2WXK A;  4PS8 A;  3FUH A;  4FJZ A;  4MLP A;  4P29 A;  4MRU A;  4W9R A;  2A4Z A;  3CGH A;  4GCO A;  4I1O B;  3TXN A;  4KVM A;  2JEK A;  4GYW A;  2FI7 A;  3MKR A;  4UQX A;  2WXF A;  2KAT A;  2CHX A;  3FY4 A;  4CRW A;  4K0R A;  3O48 A;  4HOU A;  4JHR A;  3L16 A;  4N39 A;  4HOT A;  3OXF A;  2AXZ A;  2WQ6 A;  3APD A;  1U3D A;  3IHY A;  4I9E A;  2V0P A;  1UG3 A;  3D9N A;  3NF1 A;  3EIJ A;  4FLB A;  3TJP A;  3T8M A;  1INZ A;  4GA1 A;  4G1T A;  3APC A;  4I2Z A;  4FHK A;  3SHF A;  3SNX A;  1QZ2 A;  2P58 C;  3AU4 A;  5FZQ A;  1A17 A;  4GZC A;  2VSY A;  4RG6 A;  5T8I A;  1EPU A;  3SBS A;  4XIF A;  5LCW C;  4B0Z A;  4EBA A;  4FA6 A;  4CT4 A;  3TAX A;  2LSV A;  1SQM A;  2I6H A;  2L6J A;  1GW6 A;  4DK5 A;  3QJZ A;  4U0U A;  3MKQ B;  3Q15 A;  4GYY A;  3IBE A;  2WXG A;  3ZFW A;  3DBS A;  4R7L A;  4JPS A;  2ION A;  3CVN A;  1QQE A;  3D3M A;  3L13 A;  4BTA A;  1KLX A;  5G55 A;  2XEV A;  5DIZ A;  3S2A A;  3B7R L;  4BX9 A;  3CVP A;  2X6J A;  3FTX A;  4HOR A;  3HVE A;  5CMY A;  4I2W A;  2L0I A;  3LEW A;  3B7U X;  3NZU A;  2HM8 A;  4E6H A;  1TJF A;  4DI3 A;  2DIW A;  4OYS A;  4U04 A;  2X6I A;  4CDN A;  3EHN A;  4TUU A;  4F53 A;  3BG1 B;  2VQ2 A;  2CHZ A;  2CHW A;  2PQN A;  4J8E A;  3CHP A;  4JW1 A;  3I5P A;  4IRU A;  4KT6 B;  1IYG A;  1NP7 A;  2OOE A;  4NUR A;  4AY6 A;  4I17 A;  4WWO A;  1ZBP A;  3L54 A;  2KCL A;  3ONL A;  4HFG A;  3UMV A;  2Y4T A;  5LP0 A;  2J4B A;  2XRZ A;  3OAW A;  2GRM A;  2UWJ G;  1XNF A;  4UWF A;  3SFZ A;  3ESK A;  3UT8 A;  4NRH B;  3LJ3 A;  3G2S A;  4CT0 A;  4G2V A;  4Q94 A;  2RD0 A;  3RO3 A;  3RO2 A;  5AIJ A;  4XX5 A;  3UUX A;  2Q7F A;  3CHM A;  1P5Q A;  3DPD A;  3KD7 A;  3PRE A;  3LKU A;  4Q96 A;  2CG2 A;  4N3B A;  2OV8 A;  2WXQ A;  2WXP A;  3R7R A;  1JPL A;  1HO8 A;  4E85 A;  4A3V A;  4PDX A;  2XCC A;  3ZHE B;  3ZRH A;  4FC8 A;  2R5S A;  3JYS A;  5G05 C;  4G11 A;  5EKQ D;  4DPR A;  4U0S A;  4HVB A;  2QFC A;  1X5B A;  4J8S A;  3ASG A;  3D9P A;  1PAQ A;  1WAO 1;  3HVE B;  4UWG A;  2GRL A;  3FU3 A;  4GA0 A;  4A3T A;  4AOF A;  4BT8 A;  4A55 A;  2XGM A;  1IHG A;  4I1M A;  4DLO A;  3B13 A;  5DBK A;  3QOU A;  4GAA A;  1NA3 A;  2LO6 A;  3ZIM A;  3CV0 A;  5KJM A;  1OUV A;  3S7J A;  4H7Y A;  5FQ4 A;  4XI9 A;  3CHR A;  5EX3 A;  5T3R A;  4WNG A;  2WXI A;  4BY6 A;  4I6E A;  5FJY A;  3OXL A;  4HOQ A;  4LRZ A;  1Z3Y A;  3I4G A;  3CVY A;  2YHC A;  4U8H A;  4CGV A;  2WM9 A;  3CEQ A;  4B8A A;  4B94 A;  5D0O D;  3OXG A;  3RU0 A;  4EQF A;  4B89 A;  3HIZ A;  2X3M A;  1KT1 A;  3FUI A;  1OWM A;  1Y8M A;  4ACL A;  4F7A A;  3FUJ A;  4DI4 A;  4L2L A;  3CVX A;  4JXT A;  3APF A;  3FEY A;  2EQX A;  3IKO B;  4PS7 A;  4BT9 A;  3D9I A;  2XGO A;  1OWL A;  1ZU2 A;  2BF0 X;  4ME2 A;  4BTB A;  3JUI A;  2E0I A;  4I9C A;  2AWI A;  4GZD A;  4JA9 A;  2J09 A;  5JJ6 A;  3CK9 A;  3ZYQ A;  4GU5 A;  1OWP A;  1E7V A;  4ILG A;  4NAC A;  1HH8 A;  3MEK A;  4LEU A;  4N2S A;  4F1S A;  3QWV A;  4WNF A;  1EF1 C;  3ML9 A;  2KZT B;  4Y6W A;  1HZ4 A;  2WXL A;  2X6F A;  3ASH A;  4C0E A;  2AXV A;  2PM6 A;  3D9J A;  1ELW A;  3CR3 A;  1HXI A;  5J08 A;  2FO7 A;  3ULQ A;  4GMJ A;  3AS4 A;  3ZYL A;  2V8S E;  4GB9 A;  2IJG X;  1E96 B;  3PH0 C;  5CCM A;  1E8Z A;  3Q49 B;  4XI0 A;  5D0Q D;  3ASD A;  1SZA A;  4UWL A;  3FUN A;  1NA0 A;  1H0A A;  2Y4U A;  3U9W A;  2WXH A;  4L1B A;  2WQ7 A;  1UW4 B;  4Q69 A;  3RIB A;  4CDM A;  1WY6 A;  2V4L A;  4UI9 J;  2MRI A;  5C1D A;  4D10 C;  5FWQ A;  5T4Y A;  3QK0 A;  4YVQ C;  3TG5 A;  3MZL B;  2WXO A;  3MCX A;  3RJV A;  4U0Z A;  5BV1 A;  2A5U A;  2LSU A;  4A1G A;  3UT4 A;  3QC1 A;  1UN8 A;  3MX3 A;  4KMO A;  1OWN A;  3PNT B;  3D9M A;  5ARG A;  3G2U A;  2J07 A;  2JLB A;  3I4R B;  4G24 A;  5E76 A;  3ZHE A;  2L9B A;  3GW4 A;  4LER A;  3CVQ A;  3CVU A;  4G26 A;  1IQU A;  4Y6C A;  5G2N A;  4I6G A;  4B8C B;  1WM5 A;  4URK A;  5KJK A;  3AS5 A;  2LAI A;  2MHK A;  1TJC A;  4FLH A;  5A7D B;  3RK6 A;  2WXM A;  3FUF A;  2VSN A;  3FEX A;  4N3A A;  3UPV A;  3KAE A;  4MKT A;  1W3B A;  5LOZ A;  2NSZ A;  3B7S A;  3LVQ E;  4GYO A;  3AU5 A;  3FTV A;  4APF A;  4WND A;  4QFV A;  2I9C A;  3QKY A;  2WXJ A;  4AY5 A;  5ANR A;  2WXN A;  5JHB A;  1HG2 A;  3HDX A;  3C98 A;  3CK7 A;  3PEV B;  3PVL A;  4JVS A;  4UWK A;  4I6J A;  3FDH A;  4IYP A;  4JA7 A;  4GZ3 A;  4K03 A;  4JL0 A;  3FWV A;  3R7Q A;  5KJN A;  4XZ4 A;  2HR2 A;  3PE4 A;  2OVB A;  1ELK A;  3SI5 A;  4WWN A;  5M72 A;  2CG3 A;  4LUN U;  2KCK A;  4UQY A;  3D9K A;  3MA5 A;  3I3N A;  3QAQ A;  2KCV A;  5A23 A;  4AP2 A;  4YVO A;  3SZ7 A;  5HQ8 A;  1QNF A;  3FU0 A;  3QWW A;  3CHO A;  2VJ8 A;  3QB2 A;  5CHE E;  3PRZ A;  3EJN A;  4ILI A;  3NQP A;  4FHJ A;  4BX8 A;  1FVH A;  5JJT A;  3GZS A;  5BUZ A;  2XPZ A;  5ANL A;  2VSO E;  1HFA A;  2NC9 A;  4XKB A;  4GML A;  2KZT A;  5AJL A;  2IFU A;  4L23 A;  1FCH A;  2X6K A;  2FEZ A;  1UJK A;  1UJJ A;  4G25 A;  3CKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...