4UI9K

Atomic structure of the human anaphase-promoting complex
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
526
structure length
493
Chain Sequence
NLERLRKRVRQYLDQQQYQSALFWADKVASLSREEPQDIYWLAQCLYLTAQYHRAAHALRSRKLDKLYEACRYLAARCHYAAKEHQQALDVLSIKSSICLLRGKIYDALDNRTLATYSYKEALKLDVYCFEAFDLLTSHHMLTAQEEKELLESLPLSKLCNEEQELLRFLFENKLKKYNKPSETVIPESVDGLEKNLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHKSCLPVHIGTLVELNKANELFYLSHKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVESEHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEVGVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYHRQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 178
structure length 493
sequence length 526
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF12895 ANAPC3 Anaphase-promoting complex, cyclosome, subunit 3
K PF13176 TPR_7 Tetratricopeptide repeat
K PF13424 TPR_12 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4ui9K00
2VQ2A 2LSVA 3IEGA 2UY1B 5CCMA 1ELRA 4HOTA 4GYOA 4NQ0A 5KJLA 5FJYA 1ELWA 3AS5A 3RKVA 4RG9A 5BW8C 4AIFA 3MV2B 1KLXA 3E4BA 5EKQD 4LEUA 3RO3A 3QOUA 3RIBA 4G2VA 2I6HA 3FFLA 3URZA 2C2LA 4N39A 2P58C 4AM9A 3ASFA 3GYZA 3S7BA 4ABNA 4AY5A 1A17A 2KCKA 4GZ5A 2NC9A 3CK9A 3OXLA 2IFUA 4GZ6A 1KT1A 2VYIA 3AS4A 3Q15A 3CK8A 2WPVA 4UI9C 1IYGA 4G23A 4GYWA 4WNEA 4WUYA 1YA0A 2R5SA 3O48A 4G26A 2LSUA 4UQYA 3R9AB 5JJ6A 3ULQA 1FCHA 3N71A 4I1AA 4BTBA 4J8EA 4UI9J 4XI0A 5KJNA 1NZNA 5EX3A 4F3VA 3LKUA 2VGYA 4N3BA 2XCCA 2XCBA 3GW4A 4YNDA 2XPIA 4WNFA 3SF4A 3ZGQA 5D0QD 4J8DA 5A6CA 2MHKA 2PQNA 4N3AA 4BT8A 4CGVA 3PE4A 2KCVA 3ESKA 2XGMA 2E2EA 3CVPA 4XI9A 2J9QA 5CHEE 3RU0A 4H7XA 4UI9K 2HR2A 1WM5A 3ASHA 2YHCA 2DBAA 3LPZA 4KXKB 2XEVA 3CKBA 2VSYA 3QDNA 5AYWD 4I9CA 3LYAA 4KYOB 3S7FA 4H7YA 3VTYA 2GW1A 2KCLA 3CK7A 3HYMB 4GPKA 3ZHEB 5ARGA 3MV3B 3TGOA 3AS8A 1XNFA 3Q5MA 4GCOA 4G1TA 4I17A 3RJVA 3ZN3A 3TG5A 2BUGA 2PL2A 4GCNA 4JA9A 4CDRA 3CVNA 3PE3A 3TAXA 4HOUA 4CGWA 5CCLA 2C0LA 5JJTA 4N2SA 4KBQA 3UPVA 4HOSA 3Q49B 3QWWA 2VSNA 4WNGA 5DIZA 5G04J 1WAO1 5FT9A 2HO1A 1B89A 5FZRA 3Q47B 4N3CA 4U0ZA 3MKRA 4Y6CA 4U04A 2C0MA 5FZSA 2HYZA 1ZU2A 2YQ8A 4A1SA 4UQZA 4HORA 1PC2A 3EDTB 3QWPA 4GA1A 2WQHA 5LCWJ 3JYSA 2Y4UA 5KJKA 3LY8A 1IHGA 3LCAA 4GA0A 4JA7A 1W3BA 2XGSA 3KS2A 3K9IA 5LCWC 3Q4AB 1KT0A 4HOQA 4JHRA 2PZIA 4I2ZA 4ME2A 2ONDA 5BNWA 4UQXA 1E96B 4GYYA 3U4TA 4RG6A 5G05J 4BT9A 4GZ3A 4U07A 3NF1A 3ZFWA 4U0SA 4IN3B 3KD7A 4YVOA 2FBNA 5G04C 3UQ3A 1P5QA 1HZ4A 2UY1A 2L6JA 3U3WA 3KAEA 3QKYA 4J0UA 3OXGA 4XIFA 2UWJG 3ASDA 1OUVA 4BWRA 5D0OD 4GA2A 4WNDA 2V5FA 3GZ1A 5KJMA 2OOEA 3CVQA 4NRHB 4U0UA 3MEKA 5EX0A 3ZPJA 4BTAA 1Y8MA 3QWVA 3BEEA 2LNIA 2VGXB 3CV0A 3FP3A 4N5CA 3ZHEA 2FF4A 2KC7A 2XGOA 3TG4A 5G05C 3LY7A 4O6FA 4Y6WA 4APOA 2FI7A 4G24A 3CEQA 3RO2A 3S7JA 4G25A 3S7DA 5FZQA 5HI7A 5ARFA 1NA3A 3LY9A 4N2QA 3UUXA 1NA0A 2Q7FA 2JLBA 2PQRA 4EQFA 1HXIA 4B94A 1QQEA 1TJCA 3GZ2A 2VGXA 4I2WA 2FO7A 5JJ7A 5C1DA 5M72A 4AY6A 1HH8A 2FEZA 2IF4A 5BT1A 3PDNA 3VTXA 3CVLA 4W9RA 5A7DB 4I9EA 2Y4TA 3WXXA 2QFCA 3ASGA 1ZBPA 3FWVA 5FTPA 4YVQC 2AVPA 3OXFA 4J8FA 3CKCA 4JL0A 5HQ8A 5DBKA 3SZ7A 3MA5A 1QZ2A 2KATA
chains in the Genus database with same CATH superfamily
5CRVA 2UY1B 3FTYA 1ELWA 3AS5A 3E4BA 3APFA 4AV7A 3NAWA 3JUEA 1MJ0A 4MKTA 5ANRA 1IQUA 2P9IG 3CK8A 2XEHA 1K1AA 5ITZF 4PUCA 3CSFA 2XCCA 3RRMB 4GB9A 4H7XA 5LFAA 3D9OA 4G8LA 1WM5A 3PZ1A 4GPMA 2AXVA 3QJZA 1H6PA 1BI7B 1H2UA 4ACLA 4KYOB 2Y1LE 5ARGA 3RJVA 2P9PG 5ENRD 3KSQA 3ESLA 4PS3A 2V4HC 2NSZA 3Q47B 4MS6A 3D3MA 2OEWA 5ENNA 4GMLA 3LY8A 2GRLA 1MZCA 4I2ZA 3C3OA 5LOZA 4EPZA 4B8AA 4TXQA 3L82A 2J8SD 3IHYA 3T8KA 3ZPJA 4DX6D 1FPPA 2CHZA 4ANUA 2R05A 5G05C 2XEEA 2WXKA 4G25A 3UIOC 2BF0X 2V8SE 1N11A 4ANVA 1U3DA 3CQGB 2P2CP 1QQEA 3WG7E 2WXHA 2BKKB 3ZYKA 3FU5A 2KBXA 1E8ZA 3IEGA 4E6HA 5BW8C 2OVBA 2P9KG 3OXLA 2XRYA 3HIZA 2R5SA 3O48A 3SHFA 1OCZE 4UI9J 3T5VA 1UJJA 1NL4A 3B7SA 3JQ1A 4HRNA 5BUZA 1KZPA 1HG5A 2IO3C 1OT8A 4I9CA 2A5UA 4GMRA 2IONA 5ENOD 3D9JA 2L9BA 4J6IA 3ZN3A 4DRXE 2RFAA 3HXFA 3TG5A 2EIKE 2LAHA 2H6HA 4KBQA 4HOSA 2RD0A 5DIZA 1WAO1 3SI5A 4JHJA 3RRNB 3EDTB 2WQHA 1S70B 2IOLA 2VSXE 4JA7A 4GA0A 3IHVA 3CHMA 1V55E 3O4ZA 5BNWA 4CT4A 4DI3A 3ULEG 4EHMA 4UWHA 2V5FA 2I2OA 3NB2A 5EX0A 4L2YA 4TXPA 4ZHBA 3FUIA 1YMPA 2IQCA 2OVFA 4N2QA 2ILRA 3HDXA 4FULA 3BUAA 4C0EA 1GW6A 3TWSA 3TXMA 1E90A 3WXXA 1UW4B 1HG2A 3NOCD 4JB8P 5J90A 3FY4A 4M7CA 3KEZA 2PM7A 3NZUA 4RG9A 3IXEA 3SO8A 4LNGA 3HVEA 2NC9A 2WXFA 4UI9C 3RAUA 3LEWA 5JJ6A 1K3ZD 3LVRE 5EX3A 3ZGQA 4N3AA 3ENEA 1DVPA 5CHEE 2WXQA 4KXKB 4FLHA 4U7EB 4APFA 1OWNA 4BETA 3FU0A 3B7UX 2BUGA 3Q78A 4HOUA 5EDSA 2Y4UA 4B89A 3PZ3A 1U2VG 4GYYA 4U0SA 3I3NA 3UQ3A 1P5QA 3NQPA 4FU3A 3KAEA 3QKYA 2YHEA 4U0UA 4RQIA 4UWLA 5KNGA 3CV0A 4DLOA 3TG4A 4Z68A 3UI2A 3S7JA 3TWXA 3ZUVB 4LCTA 3HHMA 4PDXA 4GAAA 2Y69E 4HXIA 3EIQC 4F1PA 5AENA 2WMNA 3CVLA 5A7DB 2RKKA 3ZRHA 4X8QA 3IBEA 5HQ8A 2MYOA 3MA5A 3DSUA 2XS8A 2WXIA 3AU4A 3TWQA 1H2TC 1SW6A 3URZA 4A3VA 1TYQG 4L23A 4ANWA 2HE0A 3AS4A 3D9PA 2GGFA 4L7TA 1K8KG 4WUYA 3UM2A 4DX7D 1NZNA 4N3BA 3GW4A 3TWTA 3B13A 2RG8A 1MX6A 3KEAA 3JQ0A 4UWFA 3CVPA 3RU0A 3FTSA 2HR2A 3LPZA 3Q75A 4XZ4A 1OCOE 3SBTB 4WAFA 3APDA 2JABA 3AS8A 1D9SA 1E8YA 3CVNA 3U64A 2VSNA 4WWPA 3E30A 4WWOA 4XKBA 4DX1A 3UM1A 1LF8A 2WXRA 4HOQA 4JHRA 4DLQA 4BT9A 3FHEA 3U3WA 3TJPA 3PREA 1O1RA 2UWJG 2J4DA 2OOEA 4HRLA 2VGXB 1Z3YA 3PZ4A 5KBAA 1UN9A 4UWGA 2WXJA 2H6FA 3CEQA 3S7DA 4A3TA 1NA3A 4GZDA 3VLFA 5JJ7A 1MQSA 3PEUB 2L0IA 1HH8A 1Z6TA 4A55A 3MYVA 3PDNA 3JXIA 4DPRA 5CERB 3SZ7A 2CFUA 2WXOA 2QC9A 2V5QC 5EKQD 1JCRA 4PS7A 5T8IA 2KCKA 3B95A 3RK6A 3MX3A 4G23A 4DUIA 1N4RA 3CVYA 2LSUA 1O5MA 3DSVA 4XI0A 5BV1A 3FU3A 1SA5A 5JHBA 1HU3A 1YCSB 3ESKA 2QZAA 1NFIE 4EZLA 2XEVA 2XPZA 3BG0B 1SZAA 3S7FA 3D9KA 3HYMB 1SQMA 4MLPA 3MV3B 3CVWA 1XNFA 3D9MA 4I17A 5CMWA 2PM6A 3TAXA 4ILIA 5CEAA 2H6IA 3QWWA 1BLXB 3AAAC 1MX2A 4L2LA 1IHGA 3K9IA 3PUJA 4K5BA 4U07A 4IN3B 3W9FA 3C3QA 4G8KA 4LRZA 4TUMA 4U8HA 3MEKA 4N5CA 2XGOA 2ETAA 1HO8A 5KNHD 4L1BA 5FINA 2KZTA 3GZ2A 3CVUA 1Y6IA 3FUEA 5C1DA 4XEIG 4B0ZA 5BT1A 4I6GA 4GTSA 3E37A 3D9NA 1HE8A 4LG6A 4KT6B 2VQ2A 2X3MA 3CHPA 1ZB1A 4OVUA 3RKVA 3TWWA 3QNKA 3MV2B 1N0RA 3RO3A 1H6OA 2X6FA 3QOUA 4AM9A 2DVWA 1O1TA 5B1AE 3W9GA 2BKGA 2F0YA 3MCXA 1TN7A 2WPVA 3I5PA 4FLBA 2WXPA 3SF4A 2AXUA 2IO2C 1UN8A 2E0IA 4CGVA 4UUCA 1TN6A 2VSOE 3FUJA 3UXGA 2VTBB 4H7YA 2WXMA 5D66A 4CDMA 3EHNA 2CHXA 2H6GA 3Q49B 3APCA 4Y6CA 4E85A 3FDHA 4A1SA 2I9CA 4UQZA 4U95D 5A23A 4GA1A 2R17C 2YINA 2R59A 2BTDA 2XHEA 4RSYA 2UY1A 3C98A 2X6HA 3OXGA 4YDOA 1OUVA 5D0OD 3GZSA 1Y8MA 1JWFA 3ZHEA 1LD8A 2MOWA 4BSZB 2ETCA 4O6FA 2J4BA 3RO2A 5HI7A 3CQCB 5AQ7A 1OCCE 4EQFA 2PQRA 3QB2A 3CHSA 4DK5A 5G2NA 2OV8A 3Q7FA 1U3CA 5M72A 1JWGA 1G3NB 2QY7A 3ZNGA 2Y4TA 5CRUA 5FTPA 4JPSA 3S7BA 1QZ2A 3CVXA 3KSLA 3UKRG 3X2QE 4O60A 3SNXA 4HS2A 4U8YD 2XPYA 3ASFA 4XX5A 4GTQA 4AJWA 3DSWA 4GYWA 3TWUA 3MKQB 3ABLE 5CBNA 3DEPA 5EIDA 4BT8A 2PQNA 3ZKJA 1JCQA 2DBAA 4V3IA 3MJWA 4R7LA 1N4SA 2LXLA 4GPKA 3Q5MA 5AARA 2PL2A 1H0AA 2C0LA 2IEJA 5G04J 3UM3A 3L54A 2IY0C 4B93B 2C0MA 4JXTA 3V31A 3EU5A 4HB5A 1UJKA 1TEZA 5EYLA 4ME2A 3B7RL 5FIOA 4RG6A 2DYRE 3NF1A 5G04C 1HX8A 2F37A 3UM0A 2IU1A 3BEEA 3L08A 4LNUD 4JZYA 2KC7A 2FI7A 4U8VD 4LNBA 5FZQA 3L13A 3LY9A 1Q2ZA 5LX8A 3R9MA 2GRQB 3V2XA 2KATA 3LS8A 1FVHA 2BEDA 3C3RA 3TWRA 5CECB 4GZ6A 4D10C 2J07A 4WNEA 4UWKA 3N71A 4BTBA 5KJNA 2VGYA 4GTMA 2M63A 4I6EA 4OAUC 2KCVA 2E2EA 2ZISA 2J9QA 3PH0C 2Y0BG 2XS1A 5B3SE 3FTXA 1MYOA 1MX4A 3ASNE 2DIWA 3PUKA 3FUNA 3T8MA 1DCQA 1OY3D 4GCNA 4N2SA 3ZYLA 2XQ0A 2AWIA 3HG0D 1BD8A 1ZU2A 1UOHA 3BU8A 3FTUA 5D2MC 2XGSA 3L17A 4M3OA 2L6BA 1E96B 3D9LA 3R7QA 5B1BE 1RW2A 3DPYA 1WY6A 3L22A 1SZ9A 4GA2A 4WNDA 4NRHB 1ELKA 2A4ZA 1HFAA 3LY7A 2ZGGA 3SFYA 4I1OB 4URKA 4OYSA 4BEPA 1H6KA 4BFRA 1N95A 4BX8A 4GTTA 2WM9A 4CCAA 4BX9A 4A1GA 4YVQC 2AVPA 3AG4E 3ABKE 1AWCB 2EQXA 5FJYA 4AIFA 3Q7AA 2I6HA 3PRZA 4FC8A 1BI8B 4AY5A 2P9NG 1A17A 1E8XA 5CBOA 4RLYA 2LXMA 2VTBA 3HXDA 3ZYQA 5H7PA 5D0QD 3TXNA 1NI1A 3G2TA 2XGMA 4N5QA 4XI9A 3DSTA 3ZW3A 3PZDA 2YHCA 2VSYA 3LVQE 3U9WA 4LSZE 2Y3AA 3EU9A 3VTYA 4K0RA 1BPOA 3SFZA 4FHKA 2OCCE 2DZNA 4IULA 3DXKG 4CGWA 4GTOA 1TNOA 3RSEG 1EDUA 5HKPA 4EBAG 4J8SA 1Z3XA 2ZXWE 5J08A 1TNZA 4UQXA 3ZFWA 1N4PA 4AP2A 4BY6A 3NOGD 4YDEA 4KZCA 1N52A 3FP3A 2AW6A 3EUVA 4EBAA 3ZVVA 4BSXA 3D9IA 3IKOB 3SBSA 2LAIA 3S2AA 2J09A 3VTXA 3SGHA 3ASGA 1ZBPA 3FWVA 3V79K 4JEUA 4HRMB 4HQDA 2PNNA 3UMVA 2LSVA 3PEVB 4K03A 4G2VA 1V54E 2V4LA 3FFLA 4F6RD 5ENPD 2VYIA 3L16A 3ULQA 4UQYA 1FCHA 4J8EA 4F3VA 3PNLB 4OVVA 2KZTB 3HVEB 2MHKA 2WXGA 5JA4D 4LUNU 1YYHA 4FHJA 3UTMA 1X5BA 1KPSB 2F8XK 1QYMA 4HNAD 3FUDA 2XRZA 3ABME 2LUHA 3TGOA 3BG1B 4G1TA 2L0TB 3LJ3A 4WWNA 3ZXSA 5FZRA 4KVOA 5BV0A 3JYSA 4NURA 1VDYA 3ONKA 4AVXA 3KS2A 3KD7A 3T9KA 1JPLA 2L6JA 3ASOE 4O1OA 1IKND 4L9PA 3FUMA 4A63B 3FEYA 4PH4B 1UG3A 3QWVA 2P9SG 3V2OA 2X6KA 2WQ6A 2R2LA 4HI8A 4B94A 4MBGA 1TJCA 2QYUA 1EYHA 1OWPA 4IYPA 3QC1A 5KWDA 3AU5A 4ACKA 2EINE 4BESA 4K5CA 2C2LA 5EIBE 3DEOA 1N94A 2GRMA 4EECA 1E7VA 4G26A 3R9AB 3FH5A 4NIKA 3AG2E 1WDYA 4C9BB 5A6CA 1OCRE 3PE4A 2DCPA 5AQAA 3B7BA 2P9UG 2GRPB 4CRWA 2B6CA 5AYWD 2WQ7A 1IQRA 4AOFA 2WXNA 5EILA 3R7RA 3P1UA 3UPVA 2YQ8A 5JHAA 3QWPA 4Q96A 3HXEA 2CHWA 3LCAA 3B7TA 5G05J 3EHRA 1H2VC 1S0PA 2X38A 3TWVA 1S64A 3FEXA 3EHQA 3ONLA 3GZ1A 1TN8A 3C72A 3FUHA 2LNIA 5AQ9A 3HXCA 4IRUA 2J08A 3VLEA 2WMOA 1LD7A 4TV3A 3EHMA 4J7WA 2IF4A 2HM8A 4I9EA 4OAVB 3OXFA 3ZU7B 4J8FA 1LTXA 5ENQD 3FUKA 3JUIA 4GYOA 5KCMA 4N39A 3SQVA 3UT4A 3E33A 3PS6A 4I1AA 3SD5A 4YNDA 2VJ8A 4ANXA 3EJNA 4UI9K 1OWMA 3ASHA 3MKQA 1L5JA 3UT7A 1QBQA 2EILE 1FT2A 1N9AA 2V0PA 5FQ7A 3MZLB 4I6JA 3PVLA 4XE0A 4FADA 5JJTA 2WVIA 3OTNA 4WNGA 1DNPA 3IV0A 4N3CA 1IXVA 3MKRA 4U96D 5BXOA 5KJKA 1W3BA 2EIME 4JHKA 4P29A 5AQBA 1FT1A 4XIFA 1MHQA 3CR3A 5ANLA 1SA4A 4JC8A 3MGBA 4ILGA 2A5EA 2ZIRA 5HRYA 2I1KA 4CDNA 3UUXA 1NA0A 2GRNB 5BPPA 1HXIA 4JW1A 4LERA 1TNUA 2I1JA 4AY6A 5JMND 3CLJA 1DCEA 4BERA 3LDZA 4EZKA 3FUFA 5DBKA 3G2VA 3AJIA 3E32A 5AJLA 4G11A 4TRQA 3LJNA 5G55A 5LP0A 4DI4A 3C5RA 4NACA 2P58C 3GYZA 3JXJA 3CK9A 4O1PA 3I4RB 3CIAA 2XPIA 4WNFA 3PNTB 3CVVA 5T4YA 2F8YA 2DYSE 2IJGX 4KZ0A 2KCLA 1OWLA 1TNBA 2FO1E 4GCOA 4JA9A 4CDRA 3PE3A 1E7UA 1SVXA 3EIJA 4CEMA 1TNYA 3FULA 4U04A 4JVSA 5ENSD 4HORA 4XKCA 1PC2A 1AP7A 2OEVA 3HRAA 2DZOA 1DC2A 5LCWC 1KT0A 4F7AA 2FBNA 3NBNB 1HZ4A 1H19A 4C48B 4FJZA 5E75A 2AXZA 3JCKC 2ZGDA 4J8YA 3J5PA 4APOA 3ZIMA 2X6IA 2Q7FA 2JLBA 4TXRA 3UX4A 2VGXA 3UINC 3ULYA 2QFCA 2LO6A 4HI9A 4JL0A 4ATZD 2J49A 1X81A 2KM4A 1ELRA 4CYMD 4KVMA 3RIBA 2FULA 3RRUA 1EF1C 4C0MA 4GZ5A 1NP7A 2IFUA 5BXUA 4GTRA 5FQ8A 3SY2A 1IYGA 1YA0A 3TL5A 3D9HA 3G2WA 4HVBA 1S63A 4I43A 4GMJA 3CHRA 3HXBA 3CKBA 3SFXA 4EZJA 3LYAA 4GTVA 1JCSA 4Q94A 4AXHA 2GW1A 1N4QA 1OWOA 3U66A 2XENA 2WXLA 1BU9A 3E34A 1B89A 1OXJA 2ZU6B 1O1SA 4PS8A 3G2SA 5LCWJ 2CG3A 2QYJA 2PZIA 1PAQA 2ONDA 3Q9NC 2P9LG 3QK0A 3ZXPA 5AJDA 5FWQA 3ML9A 4AEZC 3DPDA 3ASDA 4BWRA 3T5XA 5KJMA 4GZCA 4YDYA 2X6JA 1KZOA 1N54A 2MRIA 2FF4A 3CHQA 3Q73A 4CT0A 1D8EA 2NXPA 3DWLG 5AAOA 5EYPF 3NZSA 1JUQA 4JD2G 1K1BA 5EN5D 1XGWA 3ZYMA 4GTPA 1A5EA 2YNQA 4DX5D 1D8DA 3QAQA 4B8CB 3I4GA 3DRAA 3CGHA 5CEDB 1KT1A 3Q15A 2WB2A 3P2BA 5FQ4A 4CZ2D 1EPUA 3LKUA 4U63A 5ENTD 4J8DA 3AG3E 1N0QA 5FQ6A 2DWZA 4DX2A 3UIPC 3CSTA 3CHOA 1E8WA 2CG2A 3Q9UC 3FTZA 2HO1A 4U0ZA 3ML8A 2HYZA 3ISMC 2XZTG 4F53A 1INZA 2CFZA 3Q4AB 3U4TA 3PZ2A 4J0UA 3FU6A 3AG1E 3G2UA 3L6AA 4GU5A 3ZEFA 4MRUA 3J5QB 3FTWA 3L9TA 4Y6WA 4ATGA 4G24A 5T3RA 3QARA 4ZFHA 3BQOA 1TR4A 5AN8A 1RZ4A 1Z5SC 5CMYA 3LXUX 3FH7A 3V30A 5C2YA 3F6QA 4RVBA 4W9RA 2B0OE 4HOTA 5CCMA 4NQ0A 5KJLA 1IHBA 1HS6A 1KLXA 4LEUA 4QFVA 4YDWA 5AIJA 2GRRB 5HS0A 4ILHB 4HFGA 3DBSA 4K5AB 4Q69A 3UT8A 2XCBA 4FJYA 2GROB 2R02A 3QDNA 4DJAA 3CK7A 3ZHEB 2AJAA 4HLEA 4TUUA 2JEKA 5CCLA 1HF8A 4HBDA 2ETBA 3FTVA 3VLDA 2XZDG 5FT9A 2VGEA 5FZSA 2RFMA 2EIJE 4F1SA 4I1MA 4GZ3A 2NYJA 4ABNA 4YVOA 5E76A 4FP7A 3UKUG 3DSXA 3Q79A 5IY5E 4BTAA 3CVQA 3DSSA 3OAWA 2KXPC 4FA6A 1FVFA 1TJFA 5ARFA 1QNFA 1WG0A 3FH8A 4I2WA 2FO7A 2FEZA 4HLLA 1PY1A 3DXMG 4KMOA 2IOSA 4JEHA 3CKCA 2R03A 4QQIA
chains in the Genus database with same CATH topology
2EQXA 2UY1B 5AJLA 2CFUA 4G11A 3FTYA 2WXOA 5FJYA 4TRQA 5G55A 1ELWA 3AS5A 5LP0A 4AIFA 4DI4A 5EKQD 3E4BA 4HLEA 3APFA 4NACA 2I6HA 3PRZA 4FC8A 4PS7A 5T8IA 4AV7A 4AY5A 2P58C 3GYZA 1A17A 2KCKA 3CK9A 4MKTA 1E8XA 5ANRA 1IQUA 3RK6A 3CK8A 3MX3A 4G23A 3CVYA 2LSUA 3I4RB 3CIAA 4XI0A 4PUCA 3CSFA 5BV1A 2VTBA 3ZYQA 2XCCA 3FU3A 2XPIA 4WNFA 5D0QD 3TXNA 5JHBA 1HU3A 3G2TA 3RRMB 3ESKA 3PNTB 2XGMA 4XI9A 3ZW3A 4GB9A 3CVVA 5T4YA 4H7XA 5LFAA 3D9OA 3PZDA 1WM5A 2YHCA 2AXVA 4EZLA 2XEVA 3QJZA 2VSYA 2XPZA 3LVQE 3U9WA 3BG0B 1SZAA 1H2UA 2IJGX 4ACLA 4KYOB 2Y3AA 3S7FA 3VTYA 4K0RA 1BPOA 3D9KA 4KZ0A 2KCLA 3SFZA 1OWLA 3HYMB 1SQMA 4MLPA 3MV3B 5ARGA 4FHKA 3CVWA 1XNFA 3D9MA 4GCOA 4I17A 4IULA 3RJVA 5CMWA 4JA9A 4CDRA 4CGWA 2PM6A 3PE3A 3TAXA 3ESLA 1E7UA 4ILIA 3EIJA 1EDUA 4CEMA 4EBAG 3QWWA 4J8SA 4PS3A 2NSZA 3Q47B 3FULA 1Z3XA 4U04A 4JVSA 4MS6A 4HORA 4XKCA 1PC2A 3D3MA 5J08A 5ENNA 4L2LA 4GMLA 3LY8A 1IHGA 2GRLA 3K9IA 5LCWC 1KT0A 4I2ZA 4UQXA 5LOZA 4F7AA 4EPZA 3PUJA 4U07A 3ZFWA 4AP2A 4B8AA 4IN3B 2FBNA 1HZ4A 3IHYA 1H19A 4BY6A 4LRZA 4FJZA 4KZCA 5E75A 2AXZA 3JCKC 4U8HA 1N52A 3ZPJA 3MEKA 3FP3A 4N5CA 2CHZA 4ANUA 2XGOA 5G05C 2AW6A 4EBAA 1HO8A 4APOA 3ZVVA 2WXKA 4G25A 3ZIMA 2X6IA 4BSXA 3D9IA 2BF0X 3IKOB 2V8SE 4ANVA 2Q7FA 2JLBA 1U3DA 4L1BA 3CQGB 2KZTA 3UX4A 1QQEA 3SBSA 3GZ2A 2LAIA 3CVUA 1Y6IA 2VGXA 3FUEA 5C1DA 3S2AA 2J09A 4B0ZA 5BT1A 3VTXA 2WXHA 3SGHA 4I6GA 3ZYKA 3FU5A 2QFCA 2LO6A 3ASGA 1ZBPA 3FWVA 1E8ZA 3D9NA 1HE8A 4JL0A 4JEUA 2J49A 4KT6B 2KM4A 3UMVA 2VQ2A 2LSVA 3IEGA 1ELRA 2X3MA 3CHPA 4E6HA 3PEVB 4OVUA 3RKVA 5BW8C 3QNKA 3MV2B 4K03A 4KVMA 2OVBA 3RO3A 3QOUA 2X6FA 4G2VA 2V4LA 3RIBA 3FFLA 2FULA 3RRUA 4AM9A 1EF1C 4C0MA 4GZ5A 3OXLA 1NP7A 2IFUA 2XRYA 2VYIA 3MCXA 5FQ8A 3HIZA 2WPVA 1IYGA 1YA0A 2R5SA 3I5PA 3L16A 3O48A 4UQYA 3SHFA 3TL5A 3ULQA 1FCHA 4FLBA 4J8EA 4UI9J 3G2WA 4HVBA 2WXPA 3PNLB 4OVVA 4F3VA 3SF4A 2AXUA 3T5VA 2KZTB 1UJJA 1UN8A 2E0IA 3HVEB 2MHKA 2WXGA 4I43A 4GMJA 4LUNU 4CGVA 3CHRA 3B7SA 3JQ1A 4FHJA 2VSOE 5BUZA 1HG5A 1X5BA 3CKBA 3FUJA 2VTBB 4I9CA 2A5UA 4EZJA 3LYAA 4Q94A 2IONA 3FUDA 3D9JA 4AXHA 4H7YA 2XRZA 2GW1A 1OWOA 2WXMA 3U66A 2L9BA 3TGOA 4J6IA 3ZN3A 3BG1B 2WXLA 4G1TA 4CDMA 3EHNA 3TG5A 2CHXA 2LAHA 2L0TB 3LJ3A 4KBQA 4WWNA 4HOSA 3Q49B 3ZXSA 2RD0A 5DIZA 1WAO1 3SI5A 3APCA 1B89A 5FZRA 2ZU6B 4Y6CA 4E85A 4PS8A 3FDHA 4JHJA 4KVOA 4A1SA 2I9CA 4UQZA 3G2SA 3RRNB 3EDTB 4GA1A 2R17C 2WQHA 2IOLA 5A23A 5BV0A 5LCWJ 2CG3A 2YINA 3JYSA 4NURA 1VDYA 2VSXE 3ONKA 4AVXA 4JA7A 4GA0A 3KS2A 3IHVA 3CHMA 2R59A 2BTDA 2PZIA 3O4ZA 1PAQA 3ZYLA 2ONDA 5BNWA 2XHEA 4CT4A 3QK0A 4RSYA 5AJDA 3KD7A 4DI3A 1JPLA 2UY1A 3C98A 5FWQA 2L6JA 2X6HA 3ML9A 4AEZC 3OXGA 3DPDA 3ASDA 4BWRA 1OUVA 5D0OD 4UWHA 3FUMA 2V5FA 3T5XA 2I2OA 3GZSA 5KJMA 3FEYA 4GZCA 4L2YA 5EX0A 4PH4B 1Y8MA 2X6JA 1UG3A 3QWVA 1JWFA 1N54A 3FUIA 2MRIA 3ZHEA 2FF4A 3CHQA 2MOWA 4CT0A 2IQCA 4O6FA 2NXPA 2J4BA 2OVFA 3RO2A 5HI7A 4N2QA 2ILRA 3CQCB 1JUQA 3NZSA 2X6KA 2PQRA 3HDXA 3QB2A 3CHSA 4EQFA 4FULA 2WQ6A 4DK5A 5G2NA 1GW6A 4B94A 4C0EA 2OV8A 1TJCA 1U3CA 5M72A 1JWGA 1EYHA 1OWPA 3TXMA 1XGWA 2QY7A 1E90A 4IYPA 3WXXA 2Y4TA 3ZYMA 5FTPA 4JPSA 1UW4B 3QC1A 1HG2A 3S7BA 1QZ2A 5J90A 3AU5A 3CVXA 3FY4A 4ACKA 3KEZA 2PM7A 2YNQA 3NZUA 4RG9A 3SNXA 3QAQA 4HS2A 4B8CB 2XPYA 3I4GA 2C2LA 3HVEA 3ASFA 4XX5A 3CGHA 2NC9A 1KT1A 4AJWA 3Q15A 2GRMA 2WXFA 4UI9C 2WB2A 3P2BA 4EECA 3LEWA 4GYWA 5FQ4A 1E7VA 4G26A 3R9AB 5JJ6A 3FH5A 3LVRE 1EPUA 3MKQB 5EX3A 3LKUA 3ZGQA 4C9BB 4U63A 5A6CA 4J8DA 4N3AA 2PQNA 4BT8A 3ENEA 3PE4A 2DCPA 1DVPA 5CHEE 4CRWA 5FQ6A 2DBAA 2WXQA 4KXKB 4FLHA 4APFA 4V3IA 5AYWD 2WQ7A 1OWNA 1IQRA 4AOFA 2WXNA 3MJWA 4R7LA 3CSTA 4GPKA 3FU0A 3CHOA 3R7RA 3Q5MA 1E8WA 2CG2A 3B7UX 3P1UA 2BUGA 2PL2A 1H0AA 4HOUA 2C0LA 3FTZA 3UPVA 5G04J 3L54A 2HO1A 5EDSA 4U0ZA 2C0MA 3ML8A 2HYZA 2YQ8A 4JXTA 5JHAA 3QWPA 4Q96A 4F53A 2CHWA 2Y4UA 1INZA 3LCAA 1UJKA 2CFZA 4B89A 1TEZA 3Q4AB 3B7TA 4ME2A 3B7RL 4GYYA 3U4TA 4RG6A 5G05J 1H2VC 3NF1A 1S0PA 4U0SA 3I3NA 2X38A 5G04C 3UQ3A 1P5QA 1HX8A 3FEXA 3NQPA 4FU3A 3KAEA 3QKYA 4J0UA 3FU6A 2YHEA 3ONLA 3G2UA 3GZ1A 3L6AA 4GU5A 4U0UA 3ZEFA 2IU1A 3FUHA 4UWLA 4MRUA 3BEEA 3CV0A 2LNIA 3L08A 4DLOA 4JZYA 2KC7A 4IRUA 3TG4A 3FTWA 4Y6WA 2FI7A 4ATGA 4G24A 5T3RA 2J08A 3S7JA 5FZQA 3L13A 3LY9A 3QARA 3VLEA 2WMOA 4LCTA 3HHMA 4PDXA 4TV3A 4GAAA 3EHMA 5LX8A 2IF4A 2HM8A 5CMYA 3LXUX 3EIQC 3FH7A 4HXIA 5AENA 2WMNA 5C2YA 3CVLA 4RVBA 4W9RA 5A7DB 3ZRHA 4I9EA 3IBEA 3OXFA 4J8FA 5HQ8A 3MA5A 2KATA 3FUKA 3LS8A 4HOTA 3JUIA 5CCMA 2WXIA 1FVHA 4GYOA 4NQ0A 5KCMA 3AU4A 5KJLA 1HS6A 1KLXA 4LEUA 4QFVA 1H2TC 5AIJA 3URZA 4N39A 4A3VA 4L23A 3UT4A 4ANWA 4GZ6A 3AS4A 4ILHB 3D9PA 2GGFA 2J07A 4HFGA 4L7TA 3PS6A 4D10C 4WNEA 4WUYA 3DBSA 4UWKA 3N71A 4Q69A 4I1AA 4BTBA 5KJNA 1NZNA 3SD5A 3UT8A 2VGYA 4N3BA 4YNDA 2XCBA 3GW4A 2VJ8A 4ANXA 4FJYA 3B13A 2M63A 3EJNA 4I6EA 2RG8A 2KCVA 3JQ0A 4UWFA 2E2EA 3CVPA 2J9QA 3RU0A 3PH0C 3FTSA 4UI9K 1OWMA 2HR2A 3ASHA 3FTXA 3LPZA 3MKQA 3QDNA 4XZ4A 4DJAA 4AY6A 3SBTB 1L5JA 4WAFA 3APDA 3UT7A 3CK7A 2DIWA 3PUKA 3ZHEB 3FUNA 3T8MA 3AS8A 2V0PA 5FQ7A 3MZLB 4I6JA 4TUUA 2JEKA 1E8YA 3PVLA 4GCNA 1HF8A 4XE0A 3CVNA 3U64A 4FADA 2WVIA 5CCLA 5JJTA 4N2SA 3FTVA 2VSNA 2XQ0A 3OTNA 1DNPA 2AWIA 3IV0A 4WNGA 5FT9A 3VLDA 4N3CA 4WWPA 5FZSA 3MKRA 1ZU2A 4WWOA 4XKBA 5KJKA 3FTUA 1W3BA 2XGSA 1LF8A 3L17A 4M3OA 2WXRA 4HOQA 4JHRA 4DLQA 4F1SA 4I1MA 1E96B 3D9LA 3R7QA 4BT9A 4JHKA 4GZ3A 3FHEA 4ABNA 4YVOA 4P29A 5E76A 4FP7A 3U3WA 3TJPA 1WY6A 3PREA 4XIFA 1MHQA 2UWJG 1SZ9A 3L22A 3CR3A 4GA2A 5ANLA 4WNDA 2J4DA 2OOEA 3CVQA 4JC8A 4NRHB 4BTAA 3MGBA 1ELKA 2A4ZA 2VGXB 3OAWA 4ILGA 1Z3YA 4FA6A 1HFAA 3LY7A 1UN9A 1FVFA 1TJFA 4UWGA 4I1OB 2WXJA 4URKA 3CEQA 2I1KA 4OYSA 3S7DA 4CDNA 4A3TA 5ARFA 1NA3A 1H6KA 4BFRA 4BX8A 3UUXA 1NA0A 4GZDA 3VLFA 1QNFA 5BPPA 3FH8A 1HXIA 4JW1A 4LERA 1MQSA 2I1JA 2FO7A 3PEUB 4I2WA 5JJ7A 2WM9A 2L0IA 1HH8A 1Z6TA 2FEZA 4A55A 1PY1A 3CLJA 3MYVA 3PDNA 4CCAA 4BX9A 4A1GA 4EZKA 3LDZA 4DPRA 4YVQC 2AVPA 3FUFA 4KMOA 2IOSA 4JEHA 3CKCA 5DBKA 3SZ7A 3G2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQ2 A;  2LSV A;  3IEG A;  2UY1 B;  5CCM A;  1ELR A;  4HOT A;  4GYO A;  4NQ0 A;  5KJL A;  5FJY A;  1ELW A;  3AS5 A;  3RKV A;  4RG9 A;  5BW8 C;  4AIF A;  3MV2 B;  1KLX A;  3E4B A;  5EKQ D;  4LEU A;  3RO3 A;  3QOU A;  3RIB A;  4G2V A;  2I6H A;  3FFL A;  3URZ A;  2C2L A;  4N39 A;  2P58 C;  4AM9 A;  3ASF A;  3GYZ A;  3S7B A;  4ABN A;  4AY5 A;  1A17 A;  2KCK A;  4GZ5 A;  2NC9 A;  3CK9 A;  3OXL A;  2IFU A;  4GZ6 A;  1KT1 A;  2VYI A;  3AS4 A;  3Q15 A;  3CK8 A;  2WPV A;  4UI9 C;  1IYG A;  4G23 A;  4GYW A;  4WNE A;  4WUY A;  1YA0 A;  2R5S A;  3O48 A;  4G26 A;  2LSU A;  4UQY A;  3R9A B;  5JJ6 A;  3ULQ A;  1FCH A;  3N71 A;  4I1A A;  4BTB A;  4J8E A;  4UI9 J;  4XI0 A;  5KJN A;  1NZN A;  5EX3 A;  4F3V A;  3LKU A;  2VGY A;  4N3B A;  2XCC A;  2XCB A;  3GW4 A;  4YND A;  2XPI A;  4WNF A;  3SF4 A;  3ZGQ A;  5D0Q D;  4J8D A;  5A6C A;  2MHK A;  2PQN A;  4N3A A;  4BT8 A;  4CGV A;  3PE4 A;  2KCV A;  3ESK A;  2XGM A;  2E2E A;  3CVP A;  4XI9 A;  2J9Q A;  5CHE E;  3RU0 A;  4H7X A;  4UI9 K;  2HR2 A;  1WM5 A;  3ASH A;  2YHC A;  2DBA A;  3LPZ A;  4KXK B;  2XEV A;  3CKB A;  2VSY A;  3QDN A;  5AYW D;  4I9C A;  3LYA A;  4KYO B;  3S7F A;  4H7Y A;  3VTY A;  2GW1 A;  2KCL A;  3CK7 A;  3HYM B;  4GPK A;  3ZHE B;  5ARG A;  3MV3 B;  3TGO A;  3AS8 A;  1XNF A;  3Q5M A;  4GCO A;  4G1T A;  4I17 A;  3RJV A;  3ZN3 A;  3TG5 A;  2BUG A;  2PL2 A;  4GCN A;  4JA9 A;  4CDR A;  3CVN A;  3PE3 A;  3TAX A;  4HOU A;  4CGW A;  5CCL A;  2C0L A;  5JJT A;  4N2S A;  4KBQ A;  3UPV A;  4HOS A;  3Q49 B;  3QWW A;  2VSN A;  4WNG A;  5DIZ A;  5G04 J;  1WAO 1;  5FT9 A;  2HO1 A;  1B89 A;  5FZR A;  3Q47 B;  4N3C A;  4U0Z A;  3MKR A;  4Y6C A;  4U04 A;  2C0M A;  5FZS A;  2HYZ A;  1ZU2 A;  2YQ8 A;  4A1S A;  4UQZ A;  4HOR A;  1PC2 A;  3EDT B;  3QWP A;  4GA1 A;  2WQH A;  5LCW J;  3JYS A;  2Y4U A;  5KJK A;  3LY8 A;  1IHG A;  3LCA A;  4GA0 A;  4JA7 A;  1W3B A;  2XGS A;  3KS2 A;  3K9I A;  5LCW C;  3Q4A B;  1KT0 A;  4HOQ A;  4JHR A;  2PZI A;  4I2Z A;  4ME2 A;  2OND A;  5BNW A;  4UQX A;  1E96 B;  4GYY A;  3U4T A;  4RG6 A;  5G05 J;  4BT9 A;  4GZ3 A;  4U07 A;  3NF1 A;  3ZFW A;  4U0S A;  4IN3 B;  3KD7 A;  4YVO A;  2FBN A;  5G04 C;  3UQ3 A;  1P5Q A;  1HZ4 A;  2UY1 A;  2L6J A;  3U3W A;  3KAE A;  3QKY A;  4J0U A;  3OXG A;  4XIF A;  2UWJ G;  3ASD A;  1OUV A;  4BWR A;  5D0O D;  4GA2 A;  4WND A;  2V5F A;  3GZ1 A;  5KJM A;  2OOE A;  3CVQ A;  4NRH B;  4U0U A;  3MEK A;  5EX0 A;  3ZPJ A;  4BTA A;  1Y8M A;  3QWV A;  3BEE A;  2LNI A;  2VGX B;  3CV0 A;  3FP3 A;  4N5C A;  3ZHE A;  2FF4 A;  2KC7 A;  2XGO A;  3TG4 A;  5G05 C;  3LY7 A;  4O6F A;  4Y6W A;  4APO A;  2FI7 A;  4G24 A;  3CEQ A;  3RO2 A;  3S7J A;  4G25 A;  3S7D A;  5FZQ A;  5HI7 A;  5ARF A;  1NA3 A;  3LY9 A;  4N2Q A;  3UUX A;  1NA0 A;  2Q7F A;  2JLB A;  2PQR A;  4EQF A;  1HXI A;  4B94 A;  1QQE A;  1TJC A;  3GZ2 A;  2VGX A;  4I2W A;  2FO7 A;  5JJ7 A;  5C1D A;  5M72 A;  4AY6 A;  1HH8 A;  2FEZ A;  2IF4 A;  5BT1 A;  3PDN A;  3VTX A;  3CVL A;  4W9R A;  5A7D B;  4I9E A;  2Y4T A;  3WXX A;  2QFC A;  3ASG A;  1ZBP A;  3FWV A;  5FTP A;  4YVQ C;  2AVP A;  3OXF A;  4J8F A;  3CKC A;  4JL0 A;  5HQ8 A;  5DBK A;  3SZ7 A;  3MA5 A;  1QZ2 A;  2KAT A; 
#chains in the Genus database with same CATH topology
 5CRV A;  2UY1 B;  3FTY A;  1ELW A;  3AS5 A;  3E4B A;  3APF A;  4AV7 A;  3NAW A;  3JUE A;  1MJ0 A;  4MKT A;  5ANR A;  1IQU A;  2P9I G;  3CK8 A;  2XEH A;  1K1A A;  5ITZ F;  4PUC A;  3CSF A;  2XCC A;  3RRM B;  4GB9 A;  4H7X A;  5LFA A;  3D9O A;  4G8L A;  1WM5 A;  3PZ1 A;  4GPM A;  2AXV A;  3QJZ A;  1H6P A;  1BI7 B;  1H2U A;  4ACL A;  4KYO B;  2Y1L E;  5ARG A;  3RJV A;  2P9P G;  5ENR D;  3KSQ A;  3ESL A;  4PS3 A;  2V4H C;  2NSZ A;  3Q47 B;  4MS6 A;  3D3M A;  2OEW A;  5ENN A;  4GML A;  3LY8 A;  2GRL A;  1MZC A;  4I2Z A;  3C3O A;  5LOZ A;  4EPZ A;  4B8A A;  4TXQ A;  3L82 A;  2J8S D;  3IHY A;  3T8K A;  3ZPJ A;  4DX6 D;  1FPP A;  2CHZ A;  4ANU A;  2R05 A;  5G05 C;  2XEE A;  2WXK A;  4G25 A;  3UIO C;  2BF0 X;  2V8S E;  1N11 A;  4ANV A;  1U3D A;  3CQG B;  2P2C P;  1QQE A;  3WG7 E;  2WXH A;  2BKK B;  3ZYK A;  3FU5 A;  2KBX A;  1E8Z A;  3IEG A;  4E6H A;  5BW8 C;  2OVB A;  2P9K G;  3OXL A;  2XRY A;  3HIZ A;  2R5S A;  3O48 A;  3SHF A;  1OCZ E;  4UI9 J;  3T5V A;  1UJJ A;  1NL4 A;  3B7S A;  3JQ1 A;  4HRN A;  5BUZ A;  1KZP A;  1HG5 A;  2IO3 C;  1OT8 A;  4I9C A;  2A5U A;  4GMR A;  2ION A;  5ENO D;  3D9J A;  2L9B A;  4J6I A;  3ZN3 A;  4DRX E;  2RFA A;  3HXF A;  3TG5 A;  2EIK E;  2LAH A;  2H6H A;  4KBQ A;  4HOS A;  2RD0 A;  5DIZ A;  1WAO 1;  3SI5 A;  4JHJ A;  3RRN B;  3EDT B;  2WQH A;  1S70 B;  2IOL A;  2VSX E;  4JA7 A;  4GA0 A;  3IHV A;  3CHM A;  1V55 E;  3O4Z A;  5BNW A;  4CT4 A;  4DI3 A;  3ULE G;  4EHM A;  4UWH A;  2V5F A;  2I2O A;  3NB2 A;  5EX0 A;  4L2Y A;  4TXP A;  4ZHB A;  3FUI A;  1YMP A;  2IQC A;  2OVF A;  4N2Q A;  2ILR A;  3HDX A;  4FUL A;  3BUA A;  4C0E A;  1GW6 A;  3TWS A;  3TXM A;  1E90 A;  3WXX A;  1UW4 B;  1HG2 A;  3NOC D;  4JB8 P;  5J90 A;  3FY4 A;  4M7C A;  3KEZ A;  2PM7 A;  3NZU A;  4RG9 A;  3IXE A;  3SO8 A;  4LNG A;  3HVE A;  2NC9 A;  2WXF A;  4UI9 C;  3RAU A;  3LEW A;  5JJ6 A;  1K3Z D;  3LVR E;  5EX3 A;  3ZGQ A;  4N3A A;  3ENE A;  1DVP A;  5CHE E;  2WXQ A;  4KXK B;  4FLH A;  4U7E B;  4APF A;  1OWN A;  4BET A;  3FU0 A;  3B7U X;  2BUG A;  3Q78 A;  4HOU A;  5EDS A;  2Y4U A;  4B89 A;  3PZ3 A;  1U2V G;  4GYY A;  4U0S A;  3I3N A;  3UQ3 A;  1P5Q A;  3NQP A;  4FU3 A;  3KAE A;  3QKY A;  2YHE A;  4U0U A;  4RQI A;  4UWL A;  5KNG A;  3CV0 A;  4DLO A;  3TG4 A;  4Z68 A;  3UI2 A;  3S7J A;  3TWX A;  3ZUV B;  4LCT A;  3HHM A;  4PDX A;  4GAA A;  2Y69 E;  4HXI A;  3EIQ C;  4F1P A;  5AEN A;  2WMN A;  3CVL A;  5A7D B;  2RKK A;  3ZRH A;  4X8Q A;  3IBE A;  5HQ8 A;  2MYO A;  3MA5 A;  3DSU A;  2XS8 A;  2WXI A;  3AU4 A;  3TWQ A;  1H2T C;  1SW6 A;  3URZ A;  4A3V A;  1TYQ G;  4L23 A;  4ANW A;  2HE0 A;  3AS4 A;  3D9P A;  2GGF A;  4L7T A;  1K8K G;  4WUY A;  3UM2 A;  4DX7 D;  1NZN A;  4N3B A;  3GW4 A;  3TWT A;  3B13 A;  2RG8 A;  1MX6 A;  3KEA A;  3JQ0 A;  4UWF A;  3CVP A;  3RU0 A;  3FTS A;  2HR2 A;  3LPZ A;  3Q75 A;  4XZ4 A;  1OCO E;  3SBT B;  4WAF A;  3APD A;  2JAB A;  3AS8 A;  1D9S A;  1E8Y A;  3CVN A;  3U64 A;  2VSN A;  4WWP A;  3E30 A;  4WWO A;  4XKB A;  4DX1 A;  3UM1 A;  1LF8 A;  2WXR A;  4HOQ A;  4JHR A;  4DLQ A;  4BT9 A;  3FHE A;  3U3W A;  3TJP A;  3PRE A;  1O1R A;  2UWJ G;  2J4D A;  2OOE A;  4HRL A;  2VGX B;  1Z3Y A;  3PZ4 A;  5KBA A;  1UN9 A;  4UWG A;  2WXJ A;  2H6F A;  3CEQ A;  3S7D A;  4A3T A;  1NA3 A;  4GZD A;  3VLF A;  5JJ7 A;  1MQS A;  3PEU B;  2L0I A;  1HH8 A;  1Z6T A;  4A55 A;  3MYV A;  3PDN A;  3JXI A;  4DPR A;  5CER B;  3SZ7 A;  2CFU A;  2WXO A;  2QC9 A;  2V5Q C;  5EKQ D;  1JCR A;  4PS7 A;  5T8I A;  2KCK A;  3B95 A;  3RK6 A;  3MX3 A;  4G23 A;  4DUI A;  1N4R A;  3CVY A;  2LSU A;  1O5M A;  3DSV A;  4XI0 A;  5BV1 A;  3FU3 A;  1SA5 A;  5JHB A;  1HU3 A;  1YCS B;  3ESK A;  2QZA A;  1NFI E;  4EZL A;  2XEV A;  2XPZ A;  3BG0 B;  1SZA A;  3S7F A;  3D9K A;  3HYM B;  1SQM A;  4MLP A;  3MV3 B;  3CVW A;  1XNF A;  3D9M A;  4I17 A;  5CMW A;  2PM6 A;  3TAX A;  4ILI A;  5CEA A;  2H6I A;  3QWW A;  1BLX B;  3AAA C;  1MX2 A;  4L2L A;  1IHG A;  3K9I A;  3PUJ A;  4K5B A;  4U07 A;  4IN3 B;  3W9F A;  3C3Q A;  4G8K A;  4LRZ A;  4TUM A;  4U8H A;  3MEK A;  4N5C A;  2XGO A;  2ETA A;  1HO8 A;  5KNH D;  4L1B A;  5FIN A;  2KZT A;  3GZ2 A;  3CVU A;  1Y6I A;  3FUE A;  5C1D A;  4XEI G;  4B0Z A;  5BT1 A;  4I6G A;  4GTS A;  3E37 A;  3D9N A;  1HE8 A;  4LG6 A;  4KT6 B;  2VQ2 A;  2X3M A;  3CHP A;  1ZB1 A;  4OVU A;  3RKV A;  3TWW A;  3QNK A;  3MV2 B;  1N0R A;  3RO3 A;  1H6O A;  2X6F A;  3QOU A;  4AM9 A;  2DVW A;  1O1T A;  5B1A E;  3W9G A;  2BKG A;  2F0Y A;  3MCX A;  1TN7 A;  2WPV A;  3I5P A;  4FLB A;  2WXP A;  3SF4 A;  2AXU A;  2IO2 C;  1UN8 A;  2E0I A;  4CGV A;  4UUC A;  1TN6 A;  2VSO E;  3FUJ A;  3UXG A;  2VTB B;  4H7Y A;  2WXM A;  5D66 A;  4CDM A;  3EHN A;  2CHX A;  2H6G A;  3Q49 B;  3APC A;  4Y6C A;  4E85 A;  3FDH A;  4A1S A;  2I9C A;  4UQZ A;  4U95 D;  5A23 A;  4GA1 A;  2R17 C;  2YIN A;  2R59 A;  2BTD A;  2XHE A;  4RSY A;  2UY1 A;  3C98 A;  2X6H A;  3OXG A;  4YDO A;  1OUV A;  5D0O D;  3GZS A;  1Y8M A;  1JWF A;  3ZHE A;  1LD8 A;  2MOW A;  4BSZ B;  2ETC A;  4O6F A;  2J4B A;  3RO2 A;  5HI7 A;  3CQC B;  5AQ7 A;  1OCC E;  4EQF A;  2PQR A;  3QB2 A;  3CHS A;  4DK5 A;  5G2N A;  2OV8 A;  3Q7F A;  1U3C A;  5M72 A;  1JWG A;  1G3N B;  2QY7 A;  3ZNG A;  2Y4T A;  5CRU A;  5FTP A;  4JPS A;  3S7B A;  1QZ2 A;  3CVX A;  3KSL A;  3UKR G;  3X2Q E;  4O60 A;  3SNX A;  4HS2 A;  4U8Y D;  2XPY A;  3ASF A;  4XX5 A;  4GTQ A;  4AJW A;  3DSW A;  4GYW A;  3TWU A;  3MKQ B;  3ABL E;  5CBN A;  3DEP A;  5EID A;  4BT8 A;  2PQN A;  3ZKJ A;  1JCQ A;  2DBA A;  4V3I A;  3MJW A;  4R7L A;  1N4S A;  2LXL A;  4GPK A;  3Q5M A;  5AAR A;  2PL2 A;  1H0A A;  2C0L A;  2IEJ A;  5G04 J;  3UM3 A;  3L54 A;  2IY0 C;  4B93 B;  2C0M A;  4JXT A;  3V31 A;  3EU5 A;  4HB5 A;  1UJK A;  1TEZ A;  5EYL A;  4ME2 A;  3B7R L;  5FIO A;  4RG6 A;  2DYR E;  3NF1 A;  5G04 C;  1HX8 A;  2F37 A;  3UM0 A;  2IU1 A;  3BEE A;  3L08 A;  4LNU D;  4JZY A;  2KC7 A;  2FI7 A;  4U8V D;  4LNB A;  5FZQ A;  3L13 A;  3LY9 A;  1Q2Z A;  5LX8 A;  3R9M A;  2GRQ B;  3V2X A;  2KAT A;  3LS8 A;  1FVH A;  2BED A;  3C3R A;  3TWR A;  5CEC B;  4GZ6 A;  4D10 C;  2J07 A;  4WNE A;  4UWK A;  3N71 A;  4BTB A;  5KJN A;  2VGY A;  4GTM A;  2M63 A;  4I6E A;  4OAU C;  2KCV A;  2E2E A;  2ZIS A;  2J9Q A;  3PH0 C;  2Y0B G;  2XS1 A;  5B3S E;  3FTX A;  1MYO A;  1MX4 A;  3ASN E;  2DIW A;  3PUK A;  3FUN A;  3T8M A;  1DCQ A;  1OY3 D;  4GCN A;  4N2S A;  3ZYL A;  2XQ0 A;  2AWI A;  3HG0 D;  1BD8 A;  1ZU2 A;  1UOH A;  3BU8 A;  3FTU A;  5D2M C;  2XGS A;  3L17 A;  4M3O A;  2L6B A;  1E96 B;  3D9L A;  3R7Q A;  5B1B E;  1RW2 A;  3DPY A;  1WY6 A;  3L22 A;  1SZ9 A;  4GA2 A;  4WND A;  4NRH B;  1ELK A;  2A4Z A;  1HFA A;  3LY7 A;  2ZGG A;  3SFY A;  4I1O B;  4URK A;  4OYS A;  4BEP A;  1H6K A;  4BFR A;  1N95 A;  4BX8 A;  4GTT A;  2WM9 A;  4CCA A;  4BX9 A;  4A1G A;  4YVQ C;  2AVP A;  3AG4 E;  3ABK E;  1AWC B;  2EQX A;  5FJY A;  4AIF A;  3Q7A A;  2I6H A;  3PRZ A;  4FC8 A;  1BI8 B;  4AY5 A;  2P9N G;  1A17 A;  1E8X A;  5CBO A;  4RLY A;  2LXM A;  2VTB A;  3HXD A;  3ZYQ A;  5H7P A;  5D0Q D;  3TXN A;  1NI1 A;  3G2T A;  2XGM A;  4N5Q A;  4XI9 A;  3DST A;  3ZW3 A;  3PZD A;  2YHC A;  2VSY A;  3LVQ E;  3U9W A;  4LSZ E;  2Y3A A;  3EU9 A;  3VTY A;  4K0R A;  1BPO A;  3SFZ A;  4FHK A;  2OCC E;  2DZN A;  4IUL A;  3DXK G;  4CGW A;  4GTO A;  1TNO A;  3RSE G;  1EDU A;  5HKP A;  4EBA G;  4J8S A;  1Z3X A;  2ZXW E;  5J08 A;  1TNZ A;  4UQX A;  3ZFW A;  1N4P A;  4AP2 A;  4BY6 A;  3NOG D;  4YDE A;  4KZC A;  1N52 A;  3FP3 A;  2AW6 A;  3EUV A;  4EBA A;  3ZVV A;  4BSX A;  3D9I A;  3IKO B;  3SBS A;  2LAI A;  3S2A A;  2J09 A;  3VTX A;  3SGH A;  3ASG A;  1ZBP A;  3FWV A;  3V79 K;  4JEU A;  4HRM B;  4HQD A;  2PNN A;  3UMV A;  2LSV A;  3PEV B;  4K03 A;  4G2V A;  1V54 E;  2V4L A;  3FFL A;  4F6R D;  5ENP D;  2VYI A;  3L16 A;  3ULQ A;  4UQY A;  1FCH A;  4J8E A;  4F3V A;  3PNL B;  4OVV A;  2KZT B;  3HVE B;  2MHK A;  2WXG A;  5JA4 D;  4LUN U;  1YYH A;  4FHJ A;  3UTM A;  1X5B A;  1KPS B;  2F8X K;  1QYM A;  4HNA D;  3FUD A;  2XRZ A;  3ABM E;  2LUH A;  3TGO A;  3BG1 B;  4G1T A;  2L0T B;  3LJ3 A;  4WWN A;  3ZXS A;  5FZR A;  4KVO A;  5BV0 A;  3JYS A;  4NUR A;  1VDY A;  3ONK A;  4AVX A;  3KS2 A;  3KD7 A;  3T9K A;  1JPL A;  2L6J A;  3ASO E;  4O1O A;  1IKN D;  4L9P A;  3FUM A;  4A63 B;  3FEY A;  4PH4 B;  1UG3 A;  3QWV A;  2P9S G;  3V2O A;  2X6K A;  2WQ6 A;  2R2L A;  4HI8 A;  4B94 A;  4MBG A;  1TJC A;  2QYU A;  1EYH A;  1OWP A;  4IYP A;  3QC1 A;  5KWD A;  3AU5 A;  4ACK A;  2EIN E;  4BES A;  4K5C A;  2C2L A;  5EIB E;  3DEO A;  1N94 A;  2GRM A;  4EEC A;  1E7V A;  4G26 A;  3R9A B;  3FH5 A;  4NIK A;  3AG2 E;  1WDY A;  4C9B B;  5A6C A;  1OCR E;  3PE4 A;  2DCP A;  5AQA A;  3B7B A;  2P9U G;  2GRP B;  4CRW A;  2B6C A;  5AYW D;  2WQ7 A;  1IQR A;  4AOF A;  2WXN A;  5EIL A;  3R7R A;  3P1U A;  3UPV A;  2YQ8 A;  5JHA A;  3QWP A;  4Q96 A;  3HXE A;  2CHW A;  3LCA A;  3B7T A;  5G05 J;  3EHR A;  1H2V C;  1S0P A;  2X38 A;  3TWV A;  1S64 A;  3FEX A;  3EHQ A;  3ONL A;  3GZ1 A;  1TN8 A;  3C72 A;  3FUH A;  2LNI A;  5AQ9 A;  3HXC A;  4IRU A;  2J08 A;  3VLE A;  2WMO A;  1LD7 A;  4TV3 A;  3EHM A;  4J7W A;  2IF4 A;  2HM8 A;  4I9E A;  4OAV B;  3OXF A;  3ZU7 B;  4J8F A;  1LTX A;  5ENQ D;  3FUK A;  3JUI A;  4GYO A;  5KCM A;  4N39 A;  3SQV A;  3UT4 A;  3E33 A;  3PS6 A;  4I1A A;  3SD5 A;  4YND A;  2VJ8 A;  4ANX A;  3EJN A;  4UI9 K;  1OWM A;  3ASH A;  3MKQ A;  1L5J A;  3UT7 A;  1QBQ A;  2EIL E;  1FT2 A;  1N9A A;  2V0P A;  5FQ7 A;  3MZL B;  4I6J A;  3PVL A;  4XE0 A;  4FAD A;  5JJT A;  2WVI A;  3OTN A;  4WNG A;  1DNP A;  3IV0 A;  4N3C A;  1IXV A;  3MKR A;  4U96 D;  5BXO A;  5KJK A;  1W3B A;  2EIM E;  4JHK A;  4P29 A;  5AQB A;  1FT1 A;  4XIF A;  1MHQ A;  3CR3 A;  5ANL A;  1SA4 A;  4JC8 A;  3MGB A;  4ILG A;  2A5E A;  2ZIR A;  5HRY A;  2I1K A;  4CDN A;  3UUX A;  1NA0 A;  2GRN B;  5BPP A;  1HXI A;  4JW1 A;  4LER A;  1TNU A;  2I1J A;  4AY6 A;  5JMN D;  3CLJ A;  1DCE A;  4BER A;  3LDZ A;  4EZK A;  3FUF A;  5DBK A;  3G2V A;  3AJI A;  3E32 A;  5AJL A;  4G11 A;  4TRQ A;  3LJN A;  5G55 A;  5LP0 A;  4DI4 A;  3C5R A;  4NAC A;  2P58 C;  3GYZ A;  3JXJ A;  3CK9 A;  4O1P A;  3I4R B;  3CIA A;  2XPI A;  4WNF A;  3PNT B;  3CVV A;  5T4Y A;  2F8Y A;  2DYS E;  2IJG X;  4KZ0 A;  2KCL A;  1OWL A;  1TNB A;  2FO1 E;  4GCO A;  4JA9 A;  4CDR A;  3PE3 A;  1E7U A;  1SVX A;  3EIJ A;  4CEM A;  1TNY A;  3FUL A;  4U04 A;  4JVS A;  5ENS D;  4HOR A;  4XKC A;  1PC2 A;  1AP7 A;  2OEV A;  3HRA A;  2DZO A;  1DC2 A;  5LCW C;  1KT0 A;  4F7A A;  2FBN A;  3NBN B;  1HZ4 A;  1H19 A;  4C48 B;  4FJZ A;  5E75 A;  2AXZ A;  3JCK C;  2ZGD A;  4J8Y A;  3J5P A;  4APO A;  3ZIM A;  2X6I A;  2Q7F A;  2JLB A;  4TXR A;  3UX4 A;  2VGX A;  3UIN C;  3ULY A;  2QFC A;  2LO6 A;  4HI9 A;  4JL0 A;  4ATZ D;  2J49 A;  1X81 A;  2KM4 A;  1ELR A;  4CYM D;  4KVM A;  3RIB A;  2FUL A;  3RRU A;  1EF1 C;  4C0M A;  4GZ5 A;  1NP7 A;  2IFU A;  5BXU A;  4GTR A;  5FQ8 A;  3SY2 A;  1IYG A;  1YA0 A;  3TL5 A;  3D9H A;  3G2W A;  4HVB A;  1S63 A;  4I43 A;  4GMJ A;  3CHR A;  3HXB A;  3CKB A;  3SFX A;  4EZJ A;  3LYA A;  4GTV A;  1JCS A;  4Q94 A;  4AXH A;  2GW1 A;  1N4Q A;  1OWO A;  3U66 A;  2XEN A;  2WXL A;  1BU9 A;  3E34 A;  1B89 A;  1OXJ A;  2ZU6 B;  1O1S A;  4PS8 A;  3G2S A;  5LCW J;  2CG3 A;  2QYJ A;  2PZI A;  1PAQ A;  2OND A;  3Q9N C;  2P9L G;  3QK0 A;  3ZXP A;  5AJD A;  5FWQ A;  3ML9 A;  4AEZ C;  3DPD A;  3ASD A;  4BWR A;  3T5X A;  5KJM A;  4GZC A;  4YDY A;  2X6J A;  1KZO A;  1N54 A;  2MRI A;  2FF4 A;  3CHQ A;  3Q73 A;  4CT0 A;  1D8E A;  2NXP A;  3DWL G;  5AAO A;  5EYP F;  3NZS A;  1JUQ A;  4JD2 G;  1K1B A;  5EN5 D;  1XGW A;  3ZYM A;  4GTP A;  1A5E A;  2YNQ A;  4DX5 D;  1D8D A;  3QAQ A;  4B8C B;  3I4G A;  3DRA A;  3CGH A;  5CED B;  1KT1 A;  3Q15 A;  2WB2 A;  3P2B A;  5FQ4 A;  4CZ2 D;  1EPU A;  3LKU A;  4U63 A;  5ENT D;  4J8D A;  3AG3 E;  1N0Q A;  5FQ6 A;  2DWZ A;  4DX2 A;  3UIP C;  3CST A;  3CHO A;  1E8W A;  2CG2 A;  3Q9U C;  3FTZ A;  2HO1 A;  4U0Z A;  3ML8 A;  2HYZ A;  3ISM C;  2XZT G;  4F53 A;  1INZ A;  2CFZ A;  3Q4A B;  3U4T A;  3PZ2 A;  4J0U A;  3FU6 A;  3AG1 E;  3G2U A;  3L6A A;  4GU5 A;  3ZEF A;  4MRU A;  3J5Q B;  3FTW A;  3L9T A;  4Y6W A;  4ATG A;  4G24 A;  5T3R A;  3QAR A;  4ZFH A;  3BQO A;  1TR4 A;  5AN8 A;  1RZ4 A;  1Z5S C;  5CMY A;  3LXU X;  3FH7 A;  3V30 A;  5C2Y A;  3F6Q A;  4RVB A;  4W9R A;  2B0O E;  4HOT A;  5CCM A;  4NQ0 A;  5KJL A;  1IHB A;  1HS6 A;  1KLX A;  4LEU A;  4QFV A;  4YDW A;  5AIJ A;  2GRR B;  5HS0 A;  4ILH B;  4HFG A;  3DBS A;  4K5A B;  4Q69 A;  3UT8 A;  2XCB A;  4FJY A;  2GRO B;  2R02 A;  3QDN A;  4DJA A;  3CK7 A;  3ZHE B;  2AJA A;  4HLE A;  4TUU A;  2JEK A;  5CCL A;  1HF8 A;  4HBD A;  2ETB A;  3FTV A;  3VLD A;  2XZD G;  5FT9 A;  2VGE A;  5FZS A;  2RFM A;  2EIJ E;  4F1S A;  4I1M A;  4GZ3 A;  2NYJ A;  4ABN A;  4YVO A;  5E76 A;  4FP7 A;  3UKU G;  3DSX A;  3Q79 A;  5IY5 E;  4BTA A;  3CVQ A;  3DSS A;  3OAW A;  2KXP C;  4FA6 A;  1FVF A;  1TJF A;  5ARF A;  1QNF A;  1WG0 A;  3FH8 A;  4I2W A;  2FO7 A;  2FEZ A;  4HLL A;  1PY1 A;  3DXM G;  4KMO A;  2IOS A;  4JEH A;  3CKC A;  2R03 A;  4QQI A; 
#chains in the Genus database with same CATH homology
 2EQX A;  2UY1 B;  5AJL A;  2CFU A;  4G11 A;  3FTY A;  2WXO A;  5FJY A;  4TRQ A;  5G55 A;  1ELW A;  3AS5 A;  5LP0 A;  4AIF A;  4DI4 A;  5EKQ D;  3E4B A;  4HLE A;  3APF A;  4NAC A;  2I6H A;  3PRZ A;  4FC8 A;  4PS7 A;  5T8I A;  4AV7 A;  4AY5 A;  2P58 C;  3GYZ A;  1A17 A;  2KCK A;  3CK9 A;  4MKT A;  1E8X A;  5ANR A;  1IQU A;  3RK6 A;  3CK8 A;  3MX3 A;  4G23 A;  3CVY A;  2LSU A;  3I4R B;  3CIA A;  4XI0 A;  4PUC A;  3CSF A;  5BV1 A;  2VTB A;  3ZYQ A;  2XCC A;  3FU3 A;  2XPI A;  4WNF A;  5D0Q D;  3TXN A;  5JHB A;  1HU3 A;  3G2T A;  3RRM B;  3ESK A;  3PNT B;  2XGM A;  4XI9 A;  3ZW3 A;  4GB9 A;  3CVV A;  5T4Y A;  4H7X A;  5LFA A;  3D9O A;  3PZD A;  1WM5 A;  2YHC A;  2AXV A;  4EZL A;  2XEV A;  3QJZ A;  2VSY A;  2XPZ A;  3LVQ E;  3U9W A;  3BG0 B;  1SZA A;  1H2U A;  2IJG X;  4ACL A;  4KYO B;  2Y3A A;  3S7F A;  3VTY A;  4K0R A;  1BPO A;  3D9K A;  4KZ0 A;  2KCL A;  3SFZ A;  1OWL A;  3HYM B;  1SQM A;  4MLP A;  3MV3 B;  5ARG A;  4FHK A;  3CVW A;  1XNF A;  3D9M A;  4GCO A;  4I17 A;  4IUL A;  3RJV A;  5CMW A;  4JA9 A;  4CDR A;  4CGW A;  2PM6 A;  3PE3 A;  3TAX A;  3ESL A;  1E7U A;  4ILI A;  3EIJ A;  1EDU A;  4CEM A;  4EBA G;  3QWW A;  4J8S A;  4PS3 A;  2NSZ A;  3Q47 B;  3FUL A;  1Z3X A;  4U04 A;  4JVS A;  4MS6 A;  4HOR A;  4XKC A;  1PC2 A;  3D3M A;  5J08 A;  5ENN A;  4L2L A;  4GML A;  3LY8 A;  1IHG A;  2GRL A;  3K9I A;  5LCW C;  1KT0 A;  4I2Z A;  4UQX A;  5LOZ A;  4F7A A;  4EPZ A;  3PUJ A;  4U07 A;  3ZFW A;  4AP2 A;  4B8A A;  4IN3 B;  2FBN A;  1HZ4 A;  3IHY A;  1H19 A;  4BY6 A;  4LRZ A;  4FJZ A;  4KZC A;  5E75 A;  2AXZ A;  3JCK C;  4U8H A;  1N52 A;  3ZPJ A;  3MEK A;  3FP3 A;  4N5C A;  2CHZ A;  4ANU A;  2XGO A;  5G05 C;  2AW6 A;  4EBA A;  1HO8 A;  4APO A;  3ZVV A;  2WXK A;  4G25 A;  3ZIM A;  2X6I A;  4BSX A;  3D9I A;  2BF0 X;  3IKO B;  2V8S E;  4ANV A;  2Q7F A;  2JLB A;  1U3D A;  4L1B A;  3CQG B;  2KZT A;  3UX4 A;  1QQE A;  3SBS A;  3GZ2 A;  2LAI A;  3CVU A;  1Y6I A;  2VGX A;  3FUE A;  5C1D A;  3S2A A;  2J09 A;  4B0Z A;  5BT1 A;  3VTX A;  2WXH A;  3SGH A;  4I6G A;  3ZYK A;  3FU5 A;  2QFC A;  2LO6 A;  3ASG A;  1ZBP A;  3FWV A;  1E8Z A;  3D9N A;  1HE8 A;  4JL0 A;  4JEU A;  2J49 A;  4KT6 B;  2KM4 A;  3UMV A;  2VQ2 A;  2LSV A;  3IEG A;  1ELR A;  2X3M A;  3CHP A;  4E6H A;  3PEV B;  4OVU A;  3RKV A;  5BW8 C;  3QNK A;  3MV2 B;  4K03 A;  4KVM A;  2OVB A;  3RO3 A;  3QOU A;  2X6F A;  4G2V A;  2V4L A;  3RIB A;  3FFL A;  2FUL A;  3RRU A;  4AM9 A;  1EF1 C;  4C0M A;  4GZ5 A;  3OXL A;  1NP7 A;  2IFU A;  2XRY A;  2VYI A;  3MCX A;  5FQ8 A;  3HIZ A;  2WPV A;  1IYG A;  1YA0 A;  2R5S A;  3I5P A;  3L16 A;  3O48 A;  4UQY A;  3SHF A;  3TL5 A;  3ULQ A;  1FCH A;  4FLB A;  4J8E A;  4UI9 J;  3G2W A;  4HVB A;  2WXP A;  3PNL B;  4OVV A;  4F3V A;  3SF4 A;  2AXU A;  3T5V A;  2KZT B;  1UJJ A;  1UN8 A;  2E0I A;  3HVE B;  2MHK A;  2WXG A;  4I43 A;  4GMJ A;  4LUN U;  4CGV A;  3CHR A;  3B7S A;  3JQ1 A;  4FHJ A;  2VSO E;  5BUZ A;  1HG5 A;  1X5B A;  3CKB A;  3FUJ A;  2VTB B;  4I9C A;  2A5U A;  4EZJ A;  3LYA A;  4Q94 A;  2ION A;  3FUD A;  3D9J A;  4AXH A;  4H7Y A;  2XRZ A;  2GW1 A;  1OWO A;  2WXM A;  3U66 A;  2L9B A;  3TGO A;  4J6I A;  3ZN3 A;  3BG1 B;  2WXL A;  4G1T A;  4CDM A;  3EHN A;  3TG5 A;  2CHX A;  2LAH A;  2L0T B;  3LJ3 A;  4KBQ A;  4WWN A;  4HOS A;  3Q49 B;  3ZXS A;  2RD0 A;  5DIZ A;  1WAO 1;  3SI5 A;  3APC A;  1B89 A;  5FZR A;  2ZU6 B;  4Y6C A;  4E85 A;  4PS8 A;  3FDH A;  4JHJ A;  4KVO A;  4A1S A;  2I9C A;  4UQZ A;  3G2S A;  3RRN B;  3EDT B;  4GA1 A;  2R17 C;  2WQH A;  2IOL A;  5A23 A;  5BV0 A;  5LCW J;  2CG3 A;  2YIN A;  3JYS A;  4NUR A;  1VDY A;  2VSX E;  3ONK A;  4AVX A;  4JA7 A;  4GA0 A;  3KS2 A;  3IHV A;  3CHM A;  2R59 A;  2BTD A;  2PZI A;  3O4Z A;  1PAQ A;  3ZYL A;  2OND A;  5BNW A;  2XHE A;  4CT4 A;  3QK0 A;  4RSY A;  5AJD A;  3KD7 A;  4DI3 A;  1JPL A;  2UY1 A;  3C98 A;  5FWQ A;  2L6J A;  2X6H A;  3ML9 A;  4AEZ C;  3OXG A;  3DPD A;  3ASD A;  4BWR A;  1OUV A;  5D0O D;  4UWH A;  3FUM A;  2V5F A;  3T5X A;  2I2O A;  3GZS A;  5KJM A;  3FEY A;  4GZC A;  4L2Y A;  5EX0 A;  4PH4 B;  1Y8M A;  2X6J A;  1UG3 A;  3QWV A;  1JWF A;  1N54 A;  3FUI A;  2MRI A;  3ZHE A;  2FF4 A;  3CHQ A;  2MOW A;  4CT0 A;  2IQC A;  4O6F A;  2NXP A;  2J4B A;  2OVF A;  3RO2 A;  5HI7 A;  4N2Q A;  2ILR A;  3CQC B;  1JUQ A;  3NZS A;  2X6K A;  2PQR A;  3HDX A;  3QB2 A;  3CHS A;  4EQF A;  4FUL A;  2WQ6 A;  4DK5 A;  5G2N A;  1GW6 A;  4B94 A;  4C0E A;  2OV8 A;  1TJC A;  1U3C A;  5M72 A;  1JWG A;  1EYH A;  1OWP A;  3TXM A;  1XGW A;  2QY7 A;  1E90 A;  4IYP A;  3WXX A;  2Y4T A;  3ZYM A;  5FTP A;  4JPS A;  1UW4 B;  3QC1 A;  1HG2 A;  3S7B A;  1QZ2 A;  5J90 A;  3AU5 A;  3CVX A;  3FY4 A;  4ACK A;  3KEZ A;  2PM7 A;  2YNQ A;  3NZU A;  4RG9 A;  3SNX A;  3QAQ A;  4HS2 A;  4B8C B;  2XPY A;  3I4G A;  2C2L A;  3HVE A;  3ASF A;  4XX5 A;  3CGH A;  2NC9 A;  1KT1 A;  4AJW A;  3Q15 A;  2GRM A;  2WXF A;  4UI9 C;  2WB2 A;  3P2B A;  4EEC A;  3LEW A;  4GYW A;  5FQ4 A;  1E7V A;  4G26 A;  3R9A B;  5JJ6 A;  3FH5 A;  3LVR E;  1EPU A;  3MKQ B;  5EX3 A;  3LKU A;  3ZGQ A;  4C9B B;  4U63 A;  5A6C A;  4J8D A;  4N3A A;  2PQN A;  4BT8 A;  3ENE A;  3PE4 A;  2DCP A;  1DVP A;  5CHE E;  4CRW A;  5FQ6 A;  2DBA A;  2WXQ A;  4KXK B;  4FLH A;  4APF A;  4V3I A;  5AYW D;  2WQ7 A;  1OWN A;  1IQR A;  4AOF A;  2WXN A;  3MJW A;  4R7L A;  3CST A;  4GPK A;  3FU0 A;  3CHO A;  3R7R A;  3Q5M A;  1E8W A;  2CG2 A;  3B7U X;  3P1U A;  2BUG A;  2PL2 A;  1H0A A;  4HOU A;  2C0L A;  3FTZ A;  3UPV A;  5G04 J;  3L54 A;  2HO1 A;  5EDS A;  4U0Z A;  2C0M A;  3ML8 A;  2HYZ A;  2YQ8 A;  4JXT A;  5JHA A;  3QWP A;  4Q96 A;  4F53 A;  2CHW A;  2Y4U A;  1INZ A;  3LCA A;  1UJK A;  2CFZ A;  4B89 A;  1TEZ A;  3Q4A B;  3B7T A;  4ME2 A;  3B7R L;  4GYY A;  3U4T A;  4RG6 A;  5G05 J;  1H2V C;  3NF1 A;  1S0P A;  4U0S A;  3I3N A;  2X38 A;  5G04 C;  3UQ3 A;  1P5Q A;  1HX8 A;  3FEX A;  3NQP A;  4FU3 A;  3KAE A;  3QKY A;  4J0U A;  3FU6 A;  2YHE A;  3ONL A;  3G2U A;  3GZ1 A;  3L6A A;  4GU5 A;  4U0U A;  3ZEF A;  2IU1 A;  3FUH A;  4UWL A;  4MRU A;  3BEE A;  3CV0 A;  2LNI A;  3L08 A;  4DLO A;  4JZY A;  2KC7 A;  4IRU A;  3TG4 A;  3FTW A;  4Y6W A;  2FI7 A;  4ATG A;  4G24 A;  5T3R A;  2J08 A;  3S7J A;  5FZQ A;  3L13 A;  3LY9 A;  3QAR A;  3VLE A;  2WMO A;  4LCT A;  3HHM A;  4PDX A;  4TV3 A;  4GAA A;  3EHM A;  5LX8 A;  2IF4 A;  2HM8 A;  5CMY A;  3LXU X;  3EIQ C;  3FH7 A;  4HXI A;  5AEN A;  2WMN A;  5C2Y A;  3CVL A;  4RVB A;  4W9R A;  5A7D B;  3ZRH A;  4I9E A;  3IBE A;  3OXF A;  4J8F A;  5HQ8 A;  3MA5 A;  2KAT A;  3FUK A;  3LS8 A;  4HOT A;  3JUI A;  5CCM A;  2WXI A;  1FVH A;  4GYO A;  4NQ0 A;  5KCM A;  3AU4 A;  5KJL A;  1HS6 A;  1KLX A;  4LEU A;  4QFV A;  1H2T C;  5AIJ A;  3URZ A;  4N39 A;  4A3V A;  4L23 A;  3UT4 A;  4ANW A;  4GZ6 A;  3AS4 A;  4ILH B;  3D9P A;  2GGF A;  2J07 A;  4HFG A;  4L7T A;  3PS6 A;  4D10 C;  4WNE A;  4WUY A;  3DBS A;  4UWK A;  3N71 A;  4Q69 A;  4I1A A;  4BTB A;  5KJN A;  1NZN A;  3SD5 A;  3UT8 A;  2VGY A;  4N3B A;  4YND A;  2XCB A;  3GW4 A;  2VJ8 A;  4ANX A;  4FJY A;  3B13 A;  2M63 A;  3EJN A;  4I6E A;  2RG8 A;  2KCV A;  3JQ0 A;  4UWF A;  2E2E A;  3CVP A;  2J9Q A;  3RU0 A;  3PH0 C;  3FTS A;  4UI9 K;  1OWM A;  2HR2 A;  3ASH A;  3FTX A;  3LPZ A;  3MKQ A;  3QDN A;  4XZ4 A;  4DJA A;  4AY6 A;  3SBT B;  1L5J A;  4WAF A;  3APD A;  3UT7 A;  3CK7 A;  2DIW A;  3PUK A;  3ZHE B;  3FUN A;  3T8M A;  3AS8 A;  2V0P A;  5FQ7 A;  3MZL B;  4I6J A;  4TUU A;  2JEK A;  1E8Y A;  3PVL A;  4GCN A;  1HF8 A;  4XE0 A;  3CVN A;  3U64 A;  4FAD A;  2WVI A;  5CCL A;  5JJT A;  4N2S A;  3FTV A;  2VSN A;  2XQ0 A;  3OTN A;  1DNP A;  2AWI A;  3IV0 A;  4WNG A;  5FT9 A;  3VLD A;  4N3C A;  4WWP A;  5FZS A;  3MKR A;  1ZU2 A;  4WWO A;  4XKB A;  5KJK A;  3FTU A;  1W3B A;  2XGS A;  1LF8 A;  3L17 A;  4M3O A;  2WXR A;  4HOQ A;  4JHR A;  4DLQ A;  4F1S A;  4I1M A;  1E96 B;  3D9L A;  3R7Q A;  4BT9 A;  4JHK A;  4GZ3 A;  3FHE A;  4ABN A;  4YVO A;  4P29 A;  5E76 A;  4FP7 A;  3U3W A;  3TJP A;  1WY6 A;  3PRE A;  4XIF A;  1MHQ A;  2UWJ G;  1SZ9 A;  3L22 A;  3CR3 A;  4GA2 A;  5ANL A;  4WND A;  2J4D A;  2OOE A;  3CVQ A;  4JC8 A;  4NRH B;  4BTA A;  3MGB A;  1ELK A;  2A4Z A;  2VGX B;  3OAW A;  4ILG A;  1Z3Y A;  4FA6 A;  1HFA A;  3LY7 A;  1UN9 A;  1FVF A;  1TJF A;  4UWG A;  4I1O B;  2WXJ A;  4URK A;  3CEQ A;  2I1K A;  4OYS A;  3S7D A;  4CDN A;  4A3T A;  5ARF A;  1NA3 A;  1H6K A;  4BFR A;  4BX8 A;  3UUX A;  1NA0 A;  4GZD A;  3VLF A;  1QNF A;  5BPP A;  3FH8 A;  1HXI A;  4JW1 A;  4LER A;  1MQS A;  2I1J A;  2FO7 A;  3PEU B;  4I2W A;  5JJ7 A;  2WM9 A;  2L0I A;  1HH8 A;  1Z6T A;  2FEZ A;  4A55 A;  1PY1 A;  3CLJ A;  3MYV A;  3PDN A;  4CCA A;  4BX9 A;  4A1G A;  4EZK A;  3LDZ A;  4DPR A;  4YVQ C;  2AVP A;  3FUF A;  4KMO A;  2IOS A;  4JEH A;  3CKC A;  5DBK A;  3SZ7 A;  3G2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...