3EU5A

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10) in complex with biotingpp
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the eukaryotic prenylome by isoprenoid affinity tagging
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3eu5A00
3DSVA 1SA4A 1D8DA 1NL4A 3C72A 3EU5A 3E30A 4GTQA 1FT1A 1O1TA 1KZOA 1O5MA 1FT2A 1LD7A 3Q78A 1LD8A 3Q79A 4GTRA 1JCQA 2IEJA 3DRAA 3PZ3A 4LNGA 3E32A 3HXEA 1O1SA 2ZISA 3E33A 4YDOA 3DPYA 1TN8A 2BEDA 4EHMA 1N4PA 1X81A 1N95A 1TN7A 4GTVA 3DSSA 4GTTA 2H6FA 3SFXA 3HXCA 2H6IA 1N4SA 1SA5A 1FPPA 2ZIRA 3KSQA 1N94A 2F0YA 4YDEA 3DSUA 1MZCA 1TNOA 2R2LA 3Q73A 3HXFA 1N4RA 4GTOA 1O1RA 4L9PA 4GTMA 2H6GA 3E34A 1S63A 1N4QA 1TNBA 1TNZA 3HXBA 3Q75A 3DSWA 1KZPA 3HXDA 1NI1A 1TNUA 3PZ1A 4GTPA 3DSXA 3Q7AA 1DCEA 1JCRA 1TN6A 4LNBA 3Q7FA 1TNYA 1D8EA 3EUVA 3E37A 1S64A 3DSTA 3SFYA 4GTSA 4MBGA 1QBQA 1JCSA 3KSLA 2H6HA 1N9AA 3PZ2A 3PZ4A 1LTXA
chains in the Genus database with same CATH superfamily
3L13A 3E30A 3J5PA 3QK0A 4KVOA 2X6KA 1FVFA 3CKBA 3FP3A 2IEJA 5H7PA 3U66A 4N5CA 3GZ1A 2CG2A 1D9SA 4JC8A 2KC7A 2L0TB 2OOEA 3APDA 4BX8A 2XS8A 4KMOA 4CRWA 2RG8A 1H0AA 2EINE 2J09A 3TL5A 2YNQA 3KSQA 5A23A 3ZYKA 1TJCA 2VSXE 2GW1A 1V54E 3UM1A 1X5BA 3X2QE 3JQ1A 4MS6A 4P29A 3BQOA 3BUAA 5JJ6A 3BEEA 1SQMA 1ZBPA 3NAWA 3Q75A 3ZUVB 3F6QA 3HXDA 3L08A 2GGFA 3MKRA 4F7AA 3EIJA 3OXGA 1NP7A 2EQXA 1OUVA 5AJDA 3ZPJA 4CGWA 4KXKB 1SVXA 3FTWA 3SQVA 3NOGD 4HOTA 2AVPA 3O48A 3PEUB 4WAFA 2Q7FA 2VYIA 3LY8A 1O1TA 2Y69E 2L6JA 1IKND 3ONLA 4PS3A 1ELRA 3DBSA 3IEGA 3TWTA 1N0QA 5FTPA 4PUCA 5KNGA 3MZLB 4FHJA 5KJNA 2CHWA 4I9CA 2XS1A 2R05A 4AVXA 3LCAA 2XGOA 5G05J 2IQCA 3FU5A 1EYHA 1YYHA 1KLXA 4I1AA 4MRUA 4YDYA 4XKCA 4LG6A 3AG4E 4H7YA 3CGHA 5BV0A 4FU3A 2HM8A 4A1SA 2R59A 1E7VA 4KZCA 1B89A 4IULA 2CHXA 2LUHA 3BG0B 5FQ7A 4N3AA 3QWPA 3SY2A 1EPUA 4AXHA 3SHFA 4F3VA 2QFCA 1HZ4A 4BT9A 2DYRE 3NZSA 2I6HA 5D0OD 3AS5A 3VTYA 3D9LA 2H6HA 1TR4A 5M72A 5EILA 3ML9A 1SZ9A 5FT9A 2KCLA 5J08A 4HRMB 3PEVB 2HO1A 3ASNE 3FY4A 4DX5D 5T8IA 1KZOA 1H19A 3HG0D 4B8AA 4ABNA 4URKA 4IRUA 2PQRA 3CQGB 3EHNA 3T5XA 3QDNA 3HVEB 1U3DA 3E4BA 4EECA 4U8HA 1UJJA 3R9MA 1V55E 2WXKA 5ENQD 1E96B 2AXZA 2RFMA 1HU3A 1SZAA 5ENTD 2QYUA 5JA4D 3PREA 5ENRD 4I17A 4BESA 1MZCA 4B94A 4CYMD 2WPVA 2X6IA 2VSNA 3LY7A 5LFAA 5A7DB 3UIPC 5E76A 1N4QA 4K0RA 3ABLE 3ZRHA 1H6PA 3IHYA 4B0ZA 5C1DA 4U95D 3SFZA 4GTPA 3FTUA 4K03A 1KPSB 3UX4A 2IO3C 2FO1E 3EUVA 1OY3D 2GROB 3IBEA 2PM7A 4EBAA 3LDZA 3PZDA 5KJKA 4I6JA 5AQ9A 2YHCA 2HR2A 2P9KG 2IF4A 4LSZE 3URZA 3GZSA 1LD7A 3C5RA 1LD8A 4EZLA 5CBOA 3RJVA 1BU9A 2A5UA 5FZQA 4HNAD 3PZ3A 4FULA 5BPPA 3GZ2A 3E32A 4UWFA 4HVBA 4GCOA 3FUMA 1UJKA 2P9LG 5ENPD 2XQ0A 3UT4A 2XZDG 3PRZA 3ZFWA 3LJNA 4WNEA 5LCWJ 2OVBA 4C9BB 4GYYA 4BX9A 3LKUA 4GTVA 4I1OB 4HRNA 2FULA 1MX4A 1WM5A 3LEWA 5EIBE 2GRQB 3MX3A 2J8SD 3K9IA 3Q9NC 4NIKA 3B7SA 4PDXA 2P2CP 3CHPA 3OTNA 2ZU6B 5AQ7A 4AJWA 2BF0X 2R03A 4GTOA 1FVHA 4L9PA 1JPLA 4APFA 5JMND 3ESKA 2NYJA 2WXOA 3FEXA 5CMWA 4F1PA 3PNTB 1KZPA 4BT8A 1TNUA 3FUJA 4RG6A 3PUKA 2J07A 2LNIA 2XRZA 3PZ1A 3IV0A 5FQ6A 3TAXA 1MJ0A 2I1KA 1DCQA 3ASDA 4J8FA 2CHZA 4DI3A 4DJAA 2I9CA 4U96D 3S7JA 3WG7E 3AAAC 4I6GA 5ITZF 5T3RA 2OVFA 1UN8A 3CVPA 1PAQA 3ML8A 4Q94A 4HORA 1OXJA 4QFVA 2BKKB 4AIFA 2AJAA 4C0EA 1D8DA 5FQ4A 5T4YA 3C72A 5AYWD 2OV8A 5BUZA 3KAEA 1O5MA 3ABKE 2V4LA 4LERA 4LCTA 1A17A 4HI8A 3Q9UC 3C3OA 1EF1C 2J08A 2WQHA 1SW6A 3LY9A 2WXMA 3UM2A 2F8YA 1TN7A 3ESLA 3ISMC 2QYJA 3SD5A 2VQ2A 5ANRA 3HXCA 2XGMA 4ILIA 3IHVA 2IU1A 2F0YA 3NOCD 3OXLA 4FADA 3PNLB 1N11A 3UT8A 3CHOA 1U3CA 3AS4A 3UM0A 3FUEA 3APFA 2FO7A 1L5JA 4FC8A 3TXNA 3PVLA 3MV2B 4A55A 4ATZD 4J7WA 2VGYA 3JUIA 2QC9A 3D9HA 3SZ7A 3LXUX 2V8SE 2X6FA 2KCVA 4ANWA 4EZKA 3C98A 3KSLA 2LAHA 1N52A 2DZOA 1Z3YA 3EDTB 2E0IA 3U4TA 2P58C 4JVSA 3R9AB 5KBAA 5ANLA 2VSYA 5EKQD 1PY1A 3CHQA 4O60A 5BW8C 3ZXPA 3MA5A 3QJZA 1MYOA 4XI9A 4JHRA 4ATGA 5HRYA 1WY6A 2V5FA 3CK7A 4N3CA 4ME2A 2RKKA 3RAUA 4GAAA 3CSTA 3FU3A 4I43A 5KNHD 4Q69A 3DSUA 4M3OA 4UQXA 5G05C 3CLJA 2Y3AA 3R7QA 4J6IA 3AG2E 4AM9A 5BV1A 2WVIA 2ETAA 3ZVVA 1NI1A 2VGEA 4BTAA 3L9TA 3TXMA 4G23A 3S7FA 4G8KA 3I3NA 1Y6IA 5HQ8A 2YQ8A 2XZTG 1QNFA 3V79K 4KYOB 5KWDA 5BT1A 2DWZA 2KM4A 5CERB 4OAUC 2WXQA 4JHKA 3AG1E 4A3VA 3DSVA 1OCZE 2MOWA 2HE0A 4QQIA 5D66A 4GTQA 3NQPA 5HS0A 3UINC 4TXRA 4ANVA 3TG4A 5FIOA 2WMNA 3G2VA 4BTBA 1N54A 5IY5E 4W9RA 1VDYA 5AENA 2LAIA 2RFAA 3L6AA 2OEWA 3FTVA 2JABA 1MX2A 4O6FA 4JXTA 4J8YA 1BI7B 3CVYA 5EN5D 2WB2A 3FTZA 3FFLA 4PH4B 3J5QB 4FHKA 2A5EA 2J49A 4Q96A 1S63A 1TNZA 1W3BA 3ASFA 4GU5A 4WWOA 4Y6WA 2PNNA 4GPMA 1TN6A 4GYOA 1ELWA 2XEVA 3ASOE 4AOFA 4O1OA 3JYSA 4HB5A 1HXIA 5FWQA 3B13A 3UQ3A 2FEZA 4B89A 2M63A 1XNFA 2LXLA 3UKRG 4AY5A 1FT2A 5G04J 3V30A 4LRZA 4RQIA 3FUIA 5A6CA 1K3ZD 2LXMA 3MV3B 5KJLA 2OCCE 4UI9J 2XCBA 3Q47B 1HG2A 1DC2A 3I5PA 5JJTA 3CHMA 2CG3A 2H6FA 2PQNA 3SFXA 4BSZB 3D9MA 4UQYA 3D3MA 1TNOA 3IKOB 2XPZA 4PS8A 2WXLA 5KJMA 3LJ3A 2XENA 3CR3A 4NRHB 1Z5SC 3L82A 1IQUA 4C0MA 4DPRA 4EBAG 3HXBA 2L0IA 3DSWA 3DXMG 1P5QA 5J90A 4OAVB 4GMRA 2B6CA 4U0UA 2BUGA 3D9JA 4JA9A 3ZHEB 2DBAA 3DEOA 2XRYA 2MYOA 3QB2A 5BXOA 4IN3B 2Y4TA 2WXNA 3CK8A 1OWOA 3TWQA 1NA0A 3CVXA 3QOUA 1JWFA 1N9AA 3PZ2A 4ACLA 1EDUA 1HH8A 1NL4A 1Y8MA 1Q2ZA 5CCMA 5AAOA 3Q79A 3ZYLA 4APOA 4HI9A 4U0SA 2GRRB 4G1TA 4HFGA 3RRUA 3TWUA 4CT0A 4G26A 4BY6A 3HRAA 1OWMA 1DNPA 5AN8A 4BERA 4A1GA 3UXGA 4J8DA 1K8KG 4L7TA 2UWJG 3CVLA 5EX3A 3HYMB 3HDXA 4ANUA 3TWXA 3TWWA 4WUYA 4AP2A 2ZGDA 2ETCA 5FJYA 5AQAA 5LX8A 1OCCE 4O1PA 3Q73A 3FDHA 3SBTB 3HVEA 3ONKA 1TNBA 4HLEA 4RVBA 3MEKA 3T9KA 3U3WA 3DXKG 3EHMA 2OEVA 3B7RL 4I9EA 2IY0C 5JHBA 1H2VC 1TNYA 3SO8A 4GA0A 4AY6A 4GZ5A 4OVVA 4MBGA 4N3BA 1JCSA 4CZ2D 3QWWA 3T8KA 3VTXA 3Q49B 1IYGA 1BD8A 5D0QD 3LS8A 3MKQA 3IXEA 1WAO1 4GZ6A 2DIWA 4WNFA 4D10C 1NZNA 4WWPA 2NXPA 3U64A 5LOZA 5EIDA 3JUEA 3P1UA 3JQ0A 4XIFA 4GZCA 3BU8A 3MGBA 4XE0A 3V2OA 2LSUA 4JW1A 4L2YA 4M7CA 3ZU7B 4UQZA 3FUDA 1HS6A 1HFAA 3FH8A 3N71A 4NURA 1E8WA 5CEAA 4ILGA 3RKVA 3O4ZA 2GRMA 3S2AA 3G2WA 1Z3XA 4CCAA 4PS7A 2J4DA 2ZGGA 2ILRA 2XCCA 2WXPA 2IONA 5BNWA 1HG5A 3JCKC 4K5CA 4MLPA 2AW6A 2KCKA 3L22A 5CRVA 1PC2A 3SI5A 2KATA 5B3SE 1OWNA 3VLEA 4DX2A 1IXVA 1RW2A 3G2TA 2A4ZA 5AIJA 5FZSA 2GRPB 1E8ZA 4OVUA 3SFYA 4HBDA 1AWCB 2VJ8A 3RK6A 4EQFA 5CCLA 4F6RD 1ZU2A 4FJYA 2J9QA 3ZEFA 1UG3A 4CDNA 5E75A 2EIJE 3UUXA 3GW4A 1N0RA 3DWLG 4R7LA 4UWHA 4FP7A 2F8XK 3ZW3A 4HQDA 3TWRA 2WXRA 4KT6B 3DPYA 3FUFA 4WWNA 2BEDA 4YDWA 4EHMA 1QZ2A 3RO2A 3RRMB 3T8MA 3KEZA 4XZ4A 4I2WA 3ZN3A 3NBNB 3KEAA 5EYPF 4F53A 3AJIA 4HOSA 2R5SA 3PE3A 1BLXB 3MYVA 3TJPA 2VTBA 5JHAA 4GA1A 2R2LA 2FI7A 4U8VD 2C2LA 3PUJA 2H6GA 3G2SA 4DLQA 4JA7A 3U9WA 2NSZA 2I1JA 3L16A 2QY7A 2WXIA 3Q7AA 3MJWA 1MHQA 4UWGA 3GYZA 1S70B 3CVNA 2P9IG 3PDNA 3S7DA 4DX7D 4IYPA 2CFUA 5ARGA 4U7EB 4G8LA 1K1BA 3AU5A 1IQRA 5D2MC 4EZJA 2R17C 3V31A 4MKTA 4BFRA 2C0LA 1E8YA 4HLLA 4DX1A 1JCQA 3L17A 4HXIA 1HO8A 4DI4A 1E90A 5B1BE 1UOHA 3EIQC 4OYSA 3OXFA 1H2TC 4BSXA 3D9KA 1N4PA 2AWIA 3CIAA 5EYLA 3VLDA 4CDRA 4A63B 3DSSA 1A5EA 3CSFA 2V5QC 5AARA 1QYMA 1SA5A 1FPPA 3LPZA 4GZDA 2NC9A 5CBNA 4TRQA 3ZNGA 4TV3A 4KZ0A 3ULQA 3SNXA 3B7BA 5DIZA 1AP7A 4ACKA 3I4RB 3FH7A 5JJ7A 1G3NB 2KZTB 4JL0A 2LSVA 4G24A 3LYAA 4C48B 4FJZA 2IOLA 3B95A 4I1MA 3ZGQA 4EPZA 4ANXA 3CVVA 1YA0A 3FUKA 2VGXB 3PS6A 3E37A 3FTXA 3ZKJA 4A3TA 3ZIMA 4F1SA 2WXJA 3RSEG 3ABME 3NB2A 1QBQA 1BI8B 2LO6A 3D9IA 5HKPA 3Q4AB 3APCA 1OT8A 4DX6D 1INZA 3SGHA 4U8YD 2XEHA 3FH5A 3D9NA 3CHSA 1RZ4A 4L23A 2V0PA 1XGWA 3MCXA 2F37A 4FLHA 2GRNB 3C3RA 2EIME 2ZISA 5ENSD 3E33A 1JUQA 1TN8A 4RSYA 4G11A 4G2VA 5CEDB 1N95A 2QZAA 4BETA 2MHKA 1E7UA 5G2NA 4JEHA 4ILHB 2ZIRA 1ELKA 3FULA 3TWSA 4ZFHA 2DYSE 1KT1A 1WDYA 2ONDA 3TWVA 3ZXSA 5G04C 5ENNA 1N4RA 3BG1B 2C0MA 3UMVA 4U63A 2X6JA 1KT0A 5CHEE 3E34A 2P9PG 4UWLA 4HRLA 5DBKA 1K1AA 3CKCA 4E6HA 3FEYA 4NQ0A 2KZTA 4I2ZA 4N2SA 4GCNA 4BWRA 2FBNA 4GZ3A 2Y0BG 4HS2A 3ASHA 2X3MA 3Q5MA 2WXGA 3FUHA 1IHBA 1OCOE 4GTSA 1LF8A 2DZNA 1QQEA 3OAWA 4UI9C 3D9OA 3Q15A 1YCSB 3LVRE 4V3IA 3HIZA 1YMPA 4AEZC 4N2QA 4L2LA 1JWGA 2WM9A 2AXUA 3UKUG 2UY1A 3NF1A 3TG5A 3G2UA 3RIBA 5ARFA 1IHGA 3TGOA 2IFUA 4KVMA 4UWKA 2XEEA 4DRXE 4KBQA 3QAQA 4LNGA 3HXEA 1DVPA 3AG3E 4BEPA 2XHEA 3FU0A 1NFIE 3RRNB 3CQCB 4GMLA 4K5BA 3CK9A 4RG9A 3KD7A 5LCWC 3CVWA 3SF4A 4CGVA 3KS2A 3P2BA 3UI2A 2H6IA 4TXPA 2VTBB 4UI9K 1N94A 2AXVA 4E85A 2I2OA 5FZRA 1NA3A 3DPDA 5EDSA 1MX6A 1WG0A 5AJLA 3CV0A 3ZHEA 1TJFA 3CHRA 5AQBA 4N5QA 1U2VG 2BKGA 3ENEA 1H6KA 4XKBA 2ETBA 3FU6A 4JEUA 2CFZA 3QC1A 5CMYA 3DEPA 3QWVA 3L54A 4GMJA 4UUCA 3QKYA 2ZXWE 3DSXA 1JCRA 3UT7A 3EJNA 3FUNA 2GRLA 3CEQA 3B7TA 3UM3A 5FQ8A 3UPVA 4JB8P 5HI7A 1S0PA 3ASGA 4TXQA 2XPYA 3PZ4A 2DVWA 2WQ7A 3HHMA 2IOSA 2YHEA 5LP0A 4WNDA 1SA4A 4HOQA 4U04A 3JXJA 4YVOA 3RO3A 5C2YA 4J0UA 5BXUA 1OWLA 4I6EA 1FT1A 4Y6CA 2Y4UA 4TUMA 3T5VA 3DRAA 3EHRA 2FF4A 2VGXA 1FCHA 4YDOA 2R02A 1UW4B 2WQ6A 2DCPA 3ULYA 1BPOA 2MRIA 4ZHBA 1X81A 2HYZA 4J8SA 3ZYQA 1H6OA 2L9BA 2V4HC 2IJGX 3QNKA 3FHEA 4GTTA 4RLYA 3NZUA 3ZYMA 3AU4A 1ZB1A 1N4SA 3V2XA 1TEZA 1HE8A 4XEIG 4YDEA 2KXPC 2J4BA 1OCRE 2P9SG 2WXHA 3R7RA 5KCMA 4JHJA 1E8XA 4LUNU 4N39A 5FINA 2BTDA 1O1RA 4X8QA 4DLOA 4CT4A 4NACA 4GTMA 3D9PA 4XI0A 3MKQB 2X6HA 2E2EA 3UTMA 2L6BA 1Z6TA 3UIOC 1DCEA 4LNBA 2KBXA 3FTYA 5B1AE 3AS8A 1S64A 3LVQE 4FA6A 3FWVA 1UN9A 3QARA 4DUIA 2EIKE 2P9NG 1H2UA 3EU9A 2WXFA 1LTXA 2P9UG 4J8EA 3CVQA 1OWPA 1HX8A 2EILE 1MQSA 3EU5A 5EX0A 4YNDA 3W9FA 4XX5A 3Q78A 2XGSA 2X38A 3C3QA 4GTRA 4GB9A 4JD2G 1TYQG 3W9GA 4GPKA 1HF8A 4TUUA 3CVUA 1GW6A 3B7UX 1O1SA 2PM6A 3JXIA 4DK5A 5G55A 3WXXA 4AV7A 4HOUA 3FTSA 5CECB 2B0OE 4YVQC 4L1BA 2IO2C 4B8CB 3SBSA 2RD0A 2VSOE 3PE4A 4GYWA 3I4GA 4H7XA 4U0ZA 4LEUA 3HXFA 2PL2A 3EHQA 3VLFA 4GA2A 3ULEG 4B93B 3PH0C 5CRUA 3S7BA 4JPSA 2JEKA 2XPIA 3RU0A 4LNUD 2WMOA 4Z68A 3Q7FA 4CDMA 1D8EA 5ENOD 4G25A 3DSTA 2Y1LE 4JZYA 4WNGA 2PZIA 4U07A 4CEMA 2YINA 4FLBA 2JLBA 2UY1B 4K5AB
chains in the Genus database with same CATH topology
3DSVA 1SA4A 1D8DA 1NL4A 3C72A 3EU5A 3E30A 4GTQA 1FT1A 1O1TA 1KZOA 1O5MA 1FT2A 1LD7A 3Q78A 1LD8A 3Q79A 4GTRA 1JCQA 2IEJA 3DRAA 3PZ3A 4LNGA 3E32A 3HXEA 1O1SA 2ZISA 3E33A 4YDOA 3DPYA 1TN8A 2BEDA 4EHMA 1N4PA 1X81A 1N95A 1TN7A 4GTVA 3DSSA 4GTTA 2H6FA 3SFXA 3HXCA 2H6IA 1N4SA 1SA5A 1FPPA 2ZIRA 3KSQA 1N94A 2F0YA 4YDEA 3DSUA 1MZCA 1TNOA 2R2LA 3Q73A 3HXFA 1N4RA 4GTOA 1O1RA 4L9PA 4GTMA 2H6GA 3E34A 1S63A 1N4QA 1TNBA 1TNZA 3HXBA 3Q75A 3DSWA 1KZPA 3HXDA 1NI1A 1TNUA 3PZ1A 4GTPA 3DSXA 3Q7AA 1DCEA 1JCRA 1TN6A 4LNBA 3Q7FA 1TNYA 1D8EA 3EUVA 3E37A 1S64A 3DSTA 3SFYA 4GTSA 4MBGA 1QBQA 1JCSA 3KSLA 2H6HA 1N9AA 3PZ2A 3PZ4A 1LTXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DSV A;  1SA4 A;  1D8D A;  1NL4 A;  3C72 A;  3EU5 A;  3E30 A;  4GTQ A;  1FT1 A;  1O1T A;  1KZO A;  1O5M A;  1FT2 A;  1LD7 A;  3Q78 A;  1LD8 A;  3Q79 A;  4GTR A;  1JCQ A;  2IEJ A;  3DRA A;  3PZ3 A;  4LNG A;  3E32 A;  3HXE A;  1O1S A;  2ZIS A;  3E33 A;  4YDO A;  3DPY A;  1TN8 A;  2BED A;  4EHM A;  1N4P A;  1X81 A;  1N95 A;  1TN7 A;  4GTV A;  3DSS A;  4GTT A;  2H6F A;  3SFX A;  3HXC A;  2H6I A;  1N4S A;  1SA5 A;  1FPP A;  2ZIR A;  3KSQ A;  1N94 A;  2F0Y A;  4YDE A;  3DSU A;  1MZC A;  1TNO A;  2R2L A;  3Q73 A;  3HXF A;  1N4R A;  4GTO A;  1O1R A;  4L9P A;  4GTM A;  2H6G A;  3E34 A;  1S63 A;  1N4Q A;  1TNB A;  1TNZ A;  3HXB A;  3Q75 A;  3DSW A;  1KZP A;  3HXD A;  1NI1 A;  1TNU A;  3PZ1 A;  4GTP A;  3DSX A;  3Q7A A;  1DCE A;  1JCR A;  1TN6 A;  4LNB A;  3Q7F A;  1TNY A;  1D8E A;  3EUV A;  3E37 A;  1S64 A;  3DST A;  3SFY A;  4GTS A;  4MBG A;  1QBQ A;  1JCS A;  3KSL A;  2H6H A;  1N9A A;  3PZ2 A;  3PZ4 A;  1LTX A; 
#chains in the Genus database with same CATH topology
 3L13 A;  3E30 A;  3J5P A;  3QK0 A;  4KVO A;  2X6K A;  1FVF A;  3CKB A;  3FP3 A;  2IEJ A;  5H7P A;  3U66 A;  4N5C A;  3GZ1 A;  2CG2 A;  1D9S A;  4JC8 A;  2KC7 A;  2L0T B;  2OOE A;  3APD A;  4BX8 A;  2XS8 A;  4KMO A;  4CRW A;  2RG8 A;  1H0A A;  2EIN E;  2J09 A;  3TL5 A;  2YNQ A;  3KSQ A;  5A23 A;  3ZYK A;  1TJC A;  2VSX E;  2GW1 A;  1V54 E;  3UM1 A;  1X5B A;  3X2Q E;  3JQ1 A;  4MS6 A;  4P29 A;  3BQO A;  3BUA A;  5JJ6 A;  3BEE A;  1SQM A;  1ZBP A;  3NAW A;  3Q75 A;  3ZUV B;  3F6Q A;  3HXD A;  3L08 A;  2GGF A;  3MKR A;  4F7A A;  3EIJ A;  3OXG A;  1NP7 A;  2EQX A;  1OUV A;  5AJD A;  3ZPJ A;  4CGW A;  4KXK B;  1SVX A;  3FTW A;  3SQV A;  3NOG D;  4HOT A;  2AVP A;  3O48 A;  3PEU B;  4WAF A;  2Q7F A;  2VYI A;  3LY8 A;  1O1T A;  2Y69 E;  2L6J A;  1IKN D;  3ONL A;  4PS3 A;  1ELR A;  3DBS A;  3IEG A;  3TWT A;  1N0Q A;  5FTP A;  4PUC A;  5KNG A;  3MZL B;  4FHJ A;  5KJN A;  2CHW A;  4I9C A;  2XS1 A;  2R05 A;  4AVX A;  3LCA A;  2XGO A;  5G05 J;  2IQC A;  3FU5 A;  1EYH A;  1YYH A;  1KLX A;  4I1A A;  4MRU A;  4YDY A;  4XKC A;  4LG6 A;  3AG4 E;  4H7Y A;  3CGH A;  5BV0 A;  4FU3 A;  2HM8 A;  4A1S A;  2R59 A;  1E7V A;  4KZC A;  1B89 A;  4IUL A;  2CHX A;  2LUH A;  3BG0 B;  5FQ7 A;  4N3A A;  3QWP A;  3SY2 A;  1EPU A;  4AXH A;  3SHF A;  4F3V A;  2QFC A;  1HZ4 A;  4BT9 A;  2DYR E;  3NZS A;  2I6H A;  5D0O D;  3AS5 A;  3VTY A;  3D9L A;  2H6H A;  1TR4 A;  5M72 A;  5EIL A;  3ML9 A;  1SZ9 A;  5FT9 A;  2KCL A;  5J08 A;  4HRM B;  3PEV B;  2HO1 A;  3ASN E;  3FY4 A;  4DX5 D;  5T8I A;  1KZO A;  1H19 A;  3HG0 D;  4B8A A;  4ABN A;  4URK A;  4IRU A;  2PQR A;  3CQG B;  3EHN A;  3T5X A;  3QDN A;  3HVE B;  1U3D A;  3E4B A;  4EEC A;  4U8H A;  1UJJ A;  3R9M A;  1V55 E;  2WXK A;  5ENQ D;  1E96 B;  2AXZ A;  2RFM A;  1HU3 A;  1SZA A;  5ENT D;  2QYU A;  5JA4 D;  3PRE A;  5ENR D;  4I17 A;  4BES A;  1MZC A;  4B94 A;  4CYM D;  2WPV A;  2X6I A;  2VSN A;  3LY7 A;  5LFA A;  5A7D B;  3UIP C;  5E76 A;  1N4Q A;  4K0R A;  3ABL E;  3ZRH A;  1H6P A;  3IHY A;  4B0Z A;  5C1D A;  4U95 D;  3SFZ A;  4GTP A;  3FTU A;  4K03 A;  1KPS B;  3UX4 A;  2IO3 C;  2FO1 E;  3EUV A;  1OY3 D;  2GRO B;  3IBE A;  2PM7 A;  4EBA A;  3LDZ A;  3PZD A;  5KJK A;  4I6J A;  5AQ9 A;  2YHC A;  2HR2 A;  2P9K G;  2IF4 A;  4LSZ E;  3URZ A;  3GZS A;  1LD7 A;  3C5R A;  1LD8 A;  4EZL A;  5CBO A;  3RJV A;  1BU9 A;  2A5U A;  5FZQ A;  4HNA D;  3PZ3 A;  4FUL A;  5BPP A;  3GZ2 A;  3E32 A;  4UWF A;  4HVB A;  4GCO A;  3FUM A;  1UJK A;  2P9L G;  5ENP D;  2XQ0 A;  3UT4 A;  2XZD G;  3PRZ A;  3ZFW A;  3LJN A;  4WNE A;  5LCW J;  2OVB A;  4C9B B;  4GYY A;  4BX9 A;  3LKU A;  4GTV A;  4I1O B;  4HRN A;  2FUL A;  1MX4 A;  1WM5 A;  3LEW A;  5EIB E;  2GRQ B;  3MX3 A;  2J8S D;  3K9I A;  3Q9N C;  4NIK A;  3B7S A;  4PDX A;  2P2C P;  3CHP A;  3OTN A;  2ZU6 B;  5AQ7 A;  4AJW A;  2BF0 X;  2R03 A;  4GTO A;  1FVH A;  4L9P A;  1JPL A;  4APF A;  5JMN D;  3ESK A;  2NYJ A;  2WXO A;  3FEX A;  5CMW A;  4F1P A;  3PNT B;  1KZP A;  4BT8 A;  1TNU A;  3FUJ A;  4RG6 A;  3PUK A;  2J07 A;  2LNI A;  2XRZ A;  3PZ1 A;  3IV0 A;  5FQ6 A;  3TAX A;  1MJ0 A;  2I1K A;  1DCQ A;  3ASD A;  4J8F A;  2CHZ A;  4DI3 A;  4DJA A;  2I9C A;  4U96 D;  3S7J A;  3WG7 E;  3AAA C;  4I6G A;  5ITZ F;  5T3R A;  2OVF A;  1UN8 A;  3CVP A;  1PAQ A;  3ML8 A;  4Q94 A;  4HOR A;  1OXJ A;  4QFV A;  2BKK B;  4AIF A;  2AJA A;  4C0E A;  1D8D A;  5FQ4 A;  5T4Y A;  3C72 A;  5AYW D;  2OV8 A;  5BUZ A;  3KAE A;  1O5M A;  3ABK E;  2V4L A;  4LER A;  4LCT A;  1A17 A;  4HI8 A;  3Q9U C;  3C3O A;  1EF1 C;  2J08 A;  2WQH A;  1SW6 A;  3LY9 A;  2WXM A;  3UM2 A;  2F8Y A;  1TN7 A;  3ESL A;  3ISM C;  2QYJ A;  3SD5 A;  2VQ2 A;  5ANR A;  3HXC A;  2XGM A;  4ILI A;  3IHV A;  2IU1 A;  2F0Y A;  3NOC D;  3OXL A;  4FAD A;  3PNL B;  1N11 A;  3UT8 A;  3CHO A;  1U3C A;  3AS4 A;  3UM0 A;  3FUE A;  3APF A;  2FO7 A;  1L5J A;  4FC8 A;  3TXN A;  3PVL A;  3MV2 B;  4A55 A;  4ATZ D;  4J7W A;  2VGY A;  3JUI A;  2QC9 A;  3D9H A;  3SZ7 A;  3LXU X;  2V8S E;  2X6F A;  2KCV A;  4ANW A;  4EZK A;  3C98 A;  3KSL A;  2LAH A;  1N52 A;  2DZO A;  1Z3Y A;  3EDT B;  2E0I A;  3U4T A;  2P58 C;  4JVS A;  3R9A B;  5KBA A;  5ANL A;  2VSY A;  5EKQ D;  1PY1 A;  3CHQ A;  4O60 A;  5BW8 C;  3ZXP A;  3MA5 A;  3QJZ A;  1MYO A;  4XI9 A;  4JHR A;  4ATG A;  5HRY A;  1WY6 A;  2V5F A;  3CK7 A;  4N3C A;  4ME2 A;  2RKK A;  3RAU A;  4GAA A;  3CST A;  3FU3 A;  4I43 A;  5KNH D;  4Q69 A;  3DSU A;  4M3O A;  4UQX A;  5G05 C;  3CLJ A;  2Y3A A;  3R7Q A;  4J6I A;  3AG2 E;  4AM9 A;  5BV1 A;  2WVI A;  2ETA A;  3ZVV A;  1NI1 A;  2VGE A;  4BTA A;  3L9T A;  3TXM A;  4G23 A;  3S7F A;  4G8K A;  3I3N A;  1Y6I A;  5HQ8 A;  2YQ8 A;  2XZT G;  1QNF A;  3V79 K;  4KYO B;  5KWD A;  5BT1 A;  2DWZ A;  2KM4 A;  5CER B;  4OAU C;  2WXQ A;  4JHK A;  3AG1 E;  4A3V A;  3DSV A;  1OCZ E;  2MOW A;  2HE0 A;  4QQI A;  5D66 A;  4GTQ A;  3NQP A;  5HS0 A;  3UIN C;  4TXR A;  4ANV A;  3TG4 A;  5FIO A;  2WMN A;  3G2V A;  4BTB A;  1N54 A;  5IY5 E;  4W9R A;  1VDY A;  5AEN A;  2LAI A;  2RFA A;  3L6A A;  2OEW A;  3FTV A;  2JAB A;  1MX2 A;  4O6F A;  4JXT A;  4J8Y A;  1BI7 B;  3CVY A;  5EN5 D;  2WB2 A;  3FTZ A;  3FFL A;  4PH4 B;  3J5Q B;  4FHK A;  2A5E A;  2J49 A;  4Q96 A;  1S63 A;  1TNZ A;  1W3B A;  3ASF A;  4GU5 A;  4WWO A;  4Y6W A;  2PNN A;  4GPM A;  1TN6 A;  4GYO A;  1ELW A;  2XEV A;  3ASO E;  4AOF A;  4O1O A;  3JYS A;  4HB5 A;  1HXI A;  5FWQ A;  3B13 A;  3UQ3 A;  2FEZ A;  4B89 A;  2M63 A;  1XNF A;  2LXL A;  3UKR G;  4AY5 A;  1FT2 A;  5G04 J;  3V30 A;  4LRZ A;  4RQI A;  3FUI A;  5A6C A;  1K3Z D;  2LXM A;  3MV3 B;  5KJL A;  2OCC E;  4UI9 J;  2XCB A;  3Q47 B;  1HG2 A;  1DC2 A;  3I5P A;  5JJT A;  3CHM A;  2CG3 A;  2H6F A;  2PQN A;  3SFX A;  4BSZ B;  3D9M A;  4UQY A;  3D3M A;  1TNO A;  3IKO B;  2XPZ A;  4PS8 A;  2WXL A;  5KJM A;  3LJ3 A;  2XEN A;  3CR3 A;  4NRH B;  1Z5S C;  3L82 A;  1IQU A;  4C0M A;  4DPR A;  4EBA G;  3HXB A;  2L0I A;  3DSW A;  3DXM G;  1P5Q A;  5J90 A;  4OAV B;  4GMR A;  2B6C A;  4U0U A;  2BUG A;  3D9J A;  4JA9 A;  3ZHE B;  2DBA A;  3DEO A;  2XRY A;  2MYO A;  3QB2 A;  5BXO A;  4IN3 B;  2Y4T A;  2WXN A;  3CK8 A;  1OWO A;  3TWQ A;  1NA0 A;  3CVX A;  3QOU A;  1JWF A;  1N9A A;  3PZ2 A;  4ACL A;  1EDU A;  1HH8 A;  1NL4 A;  1Y8M A;  1Q2Z A;  5CCM A;  5AAO A;  3Q79 A;  3ZYL A;  4APO A;  4HI9 A;  4U0S A;  2GRR B;  4G1T A;  4HFG A;  3RRU A;  3TWU A;  4CT0 A;  4G26 A;  4BY6 A;  3HRA A;  1OWM A;  1DNP A;  5AN8 A;  4BER A;  4A1G A;  3UXG A;  4J8D A;  1K8K G;  4L7T A;  2UWJ G;  3CVL A;  5EX3 A;  3HYM B;  3HDX A;  4ANU A;  3TWX A;  3TWW A;  4WUY A;  4AP2 A;  2ZGD A;  2ETC A;  5FJY A;  5AQA A;  5LX8 A;  1OCC E;  4O1P A;  3Q73 A;  3FDH A;  3SBT B;  3HVE A;  3ONK A;  1TNB A;  4HLE A;  4RVB A;  3MEK A;  3T9K A;  3U3W A;  3DXK G;  3EHM A;  2OEV A;  3B7R L;  4I9E A;  2IY0 C;  5JHB A;  1H2V C;  1TNY A;  3SO8 A;  4GA0 A;  4AY6 A;  4GZ5 A;  4OVV A;  4MBG A;  4N3B A;  1JCS A;  4CZ2 D;  3QWW A;  3T8K A;  3VTX A;  3Q49 B;  1IYG A;  1BD8 A;  5D0Q D;  3LS8 A;  3MKQ A;  3IXE A;  1WAO 1;  4GZ6 A;  2DIW A;  4WNF A;  4D10 C;  1NZN A;  4WWP A;  2NXP A;  3U64 A;  5LOZ A;  5EID A;  3JUE A;  3P1U A;  3JQ0 A;  4XIF A;  4GZC A;  3BU8 A;  3MGB A;  4XE0 A;  3V2O A;  2LSU A;  4JW1 A;  4L2Y A;  4M7C A;  3ZU7 B;  4UQZ A;  3FUD A;  1HS6 A;  1HFA A;  3FH8 A;  3N71 A;  4NUR A;  1E8W A;  5CEA A;  4ILG A;  3RKV A;  3O4Z A;  2GRM A;  3S2A A;  3G2W A;  1Z3X A;  4CCA A;  4PS7 A;  2J4D A;  2ZGG A;  2ILR A;  2XCC A;  2WXP A;  2ION A;  5BNW A;  1HG5 A;  3JCK C;  4K5C A;  4MLP A;  2AW6 A;  2KCK A;  3L22 A;  5CRV A;  1PC2 A;  3SI5 A;  2KAT A;  5B3S E;  1OWN A;  3VLE A;  4DX2 A;  1IXV A;  1RW2 A;  3G2T A;  2A4Z A;  5AIJ A;  5FZS A;  2GRP B;  1E8Z A;  4OVU A;  3SFY A;  4HBD A;  1AWC B;  2VJ8 A;  3RK6 A;  4EQF A;  5CCL A;  4F6R D;  1ZU2 A;  4FJY A;  2J9Q A;  3ZEF A;  1UG3 A;  4CDN A;  5E75 A;  2EIJ E;  3UUX A;  3GW4 A;  1N0R A;  3DWL G;  4R7L A;  4UWH A;  4FP7 A;  2F8X K;  3ZW3 A;  4HQD A;  3TWR A;  2WXR A;  4KT6 B;  3DPY A;  3FUF A;  4WWN A;  2BED A;  4YDW A;  4EHM A;  1QZ2 A;  3RO2 A;  3RRM B;  3T8M A;  3KEZ A;  4XZ4 A;  4I2W A;  3ZN3 A;  3NBN B;  3KEA A;  5EYP F;  4F53 A;  3AJI A;  4HOS A;  2R5S A;  3PE3 A;  1BLX B;  3MYV A;  3TJP A;  2VTB A;  5JHA A;  4GA1 A;  2R2L A;  2FI7 A;  4U8V D;  2C2L A;  3PUJ A;  2H6G A;  3G2S A;  4DLQ A;  4JA7 A;  3U9W A;  2NSZ A;  2I1J A;  3L16 A;  2QY7 A;  2WXI A;  3Q7A A;  3MJW A;  1MHQ A;  4UWG A;  3GYZ A;  1S70 B;  3CVN A;  2P9I G;  3PDN A;  3S7D A;  4DX7 D;  4IYP A;  2CFU A;  5ARG A;  4U7E B;  4G8L A;  1K1B A;  3AU5 A;  1IQR A;  5D2M C;  4EZJ A;  2R17 C;  3V31 A;  4MKT A;  4BFR A;  2C0L A;  1E8Y A;  4HLL A;  4DX1 A;  1JCQ A;  3L17 A;  4HXI A;  1HO8 A;  4DI4 A;  1E90 A;  5B1B E;  1UOH A;  3EIQ C;  4OYS A;  3OXF A;  1H2T C;  4BSX A;  3D9K A;  1N4P A;  2AWI A;  3CIA A;  5EYL A;  3VLD A;  4CDR A;  4A63 B;  3DSS A;  1A5E A;  3CSF A;  2V5Q C;  5AAR A;  1QYM A;  1SA5 A;  1FPP A;  3LPZ A;  4GZD A;  2NC9 A;  5CBN A;  4TRQ A;  3ZNG A;  4TV3 A;  4KZ0 A;  3ULQ A;  3SNX A;  3B7B A;  5DIZ A;  1AP7 A;  4ACK A;  3I4R B;  3FH7 A;  5JJ7 A;  1G3N B;  2KZT B;  4JL0 A;  2LSV A;  4G24 A;  3LYA A;  4C48 B;  4FJZ A;  2IOL A;  3B95 A;  4I1M A;  3ZGQ A;  4EPZ A;  4ANX A;  3CVV A;  1YA0 A;  3FUK A;  2VGX B;  3PS6 A;  3E37 A;  3FTX A;  3ZKJ A;  4A3T A;  3ZIM A;  4F1S A;  2WXJ A;  3RSE G;  3ABM E;  3NB2 A;  1QBQ A;  1BI8 B;  2LO6 A;  3D9I A;  5HKP A;  3Q4A B;  3APC A;  1OT8 A;  4DX6 D;  1INZ A;  3SGH A;  4U8Y D;  2XEH A;  3FH5 A;  3D9N A;  3CHS A;  1RZ4 A;  4L23 A;  2V0P A;  1XGW A;  3MCX A;  2F37 A;  4FLH A;  2GRN B;  3C3R A;  2EIM E;  2ZIS A;  5ENS D;  3E33 A;  1JUQ A;  1TN8 A;  4RSY A;  4G11 A;  4G2V A;  5CED B;  1N95 A;  2QZA A;  4BET A;  2MHK A;  1E7U A;  5G2N A;  4JEH A;  4ILH B;  2ZIR A;  1ELK A;  3FUL A;  3TWS A;  4ZFH A;  2DYS E;  1KT1 A;  1WDY A;  2OND A;  3TWV A;  3ZXS A;  5G04 C;  5ENN A;  1N4R A;  3BG1 B;  2C0M A;  3UMV A;  4U63 A;  2X6J A;  1KT0 A;  5CHE E;  3E34 A;  2P9P G;  4UWL A;  4HRL A;  5DBK A;  1K1A A;  3CKC A;  4E6H A;  3FEY A;  4NQ0 A;  2KZT A;  4I2Z A;  4N2S A;  4GCN A;  4BWR A;  2FBN A;  4GZ3 A;  2Y0B G;  4HS2 A;  3ASH A;  2X3M A;  3Q5M A;  2WXG A;  3FUH A;  1IHB A;  1OCO E;  4GTS A;  1LF8 A;  2DZN A;  1QQE A;  3OAW A;  4UI9 C;  3D9O A;  3Q15 A;  1YCS B;  3LVR E;  4V3I A;  3HIZ A;  1YMP A;  4AEZ C;  4N2Q A;  4L2L A;  1JWG A;  2WM9 A;  2AXU A;  3UKU G;  2UY1 A;  3NF1 A;  3TG5 A;  3G2U A;  3RIB A;  5ARF A;  1IHG A;  3TGO A;  2IFU A;  4KVM A;  4UWK A;  2XEE A;  4DRX E;  4KBQ A;  3QAQ A;  4LNG A;  3HXE A;  1DVP A;  3AG3 E;  4BEP A;  2XHE A;  3FU0 A;  1NFI E;  3RRN B;  3CQC B;  4GML A;  4K5B A;  3CK9 A;  4RG9 A;  3KD7 A;  5LCW C;  3CVW A;  3SF4 A;  4CGV A;  3KS2 A;  3P2B A;  3UI2 A;  2H6I A;  4TXP A;  2VTB B;  4UI9 K;  1N94 A;  2AXV A;  4E85 A;  2I2O A;  5FZR A;  1NA3 A;  3DPD A;  5EDS A;  1MX6 A;  1WG0 A;  5AJL A;  3CV0 A;  3ZHE A;  1TJF A;  3CHR A;  5AQB A;  4N5Q A;  1U2V G;  2BKG A;  3ENE A;  1H6K A;  4XKB A;  2ETB A;  3FU6 A;  4JEU A;  2CFZ A;  3QC1 A;  5CMY A;  3DEP A;  3QWV A;  3L54 A;  4GMJ A;  4UUC A;  3QKY A;  2ZXW E;  3DSX A;  1JCR A;  3UT7 A;  3EJN A;  3FUN A;  2GRL A;  3CEQ A;  3B7T A;  3UM3 A;  5FQ8 A;  3UPV A;  4JB8 P;  5HI7 A;  1S0P A;  3ASG A;  4TXQ A;  2XPY A;  3PZ4 A;  2DVW A;  2WQ7 A;  3HHM A;  2IOS A;  2YHE A;  5LP0 A;  4WND A;  1SA4 A;  4HOQ A;  4U04 A;  3JXJ A;  4YVO A;  3RO3 A;  5C2Y A;  4J0U A;  5BXU A;  1OWL A;  4I6E A;  1FT1 A;  4Y6C A;  2Y4U A;  4TUM A;  3T5V A;  3DRA A;  3EHR A;  2FF4 A;  2VGX A;  1FCH A;  4YDO A;  2R02 A;  1UW4 B;  2WQ6 A;  2DCP A;  3ULY A;  1BPO A;  2MRI A;  4ZHB A;  1X81 A;  2HYZ A;  4J8S A;  3ZYQ A;  1H6O A;  2L9B A;  2V4H C;  2IJG X;  3QNK A;  3FHE A;  4GTT A;  4RLY A;  3NZU A;  3ZYM A;  3AU4 A;  1ZB1 A;  1N4S A;  3V2X A;  1TEZ A;  1HE8 A;  4XEI G;  4YDE A;  2KXP C;  2J4B A;  1OCR E;  2P9S G;  2WXH A;  3R7R A;  5KCM A;  4JHJ A;  1E8X A;  4LUN U;  4N39 A;  5FIN A;  2BTD A;  1O1R A;  4X8Q A;  4DLO A;  4CT4 A;  4NAC A;  4GTM A;  3D9P A;  4XI0 A;  3MKQ B;  2X6H A;  2E2E A;  3UTM A;  2L6B A;  1Z6T A;  3UIO C;  1DCE A;  4LNB A;  2KBX A;  3FTY A;  5B1A E;  3AS8 A;  1S64 A;  3LVQ E;  4FA6 A;  3FWV A;  1UN9 A;  3QAR A;  4DUI A;  2EIK E;  2P9N G;  1H2U A;  3EU9 A;  2WXF A;  1LTX A;  2P9U G;  4J8E A;  3CVQ A;  1OWP A;  1HX8 A;  2EIL E;  1MQS A;  3EU5 A;  5EX0 A;  4YND A;  3W9F A;  4XX5 A;  3Q78 A;  2XGS A;  2X38 A;  3C3Q A;  4GTR A;  4GB9 A;  4JD2 G;  1TYQ G;  3W9G A;  4GPK A;  1HF8 A;  4TUU A;  3CVU A;  1GW6 A;  3B7U X;  1O1S A;  2PM6 A;  3JXI A;  4DK5 A;  5G55 A;  3WXX A;  4AV7 A;  4HOU A;  3FTS A;  5CEC B;  2B0O E;  4YVQ C;  4L1B A;  2IO2 C;  4B8C B;  3SBS A;  2RD0 A;  2VSO E;  3PE4 A;  4GYW A;  3I4G A;  4H7X A;  4U0Z A;  4LEU A;  3HXF A;  2PL2 A;  3EHQ A;  3VLF A;  4GA2 A;  3ULE G;  4B93 B;  3PH0 C;  5CRU A;  3S7B A;  4JPS A;  2JEK A;  2XPI A;  3RU0 A;  4LNU D;  2WMO A;  4Z68 A;  3Q7F A;  4CDM A;  1D8E A;  5ENO D;  4G25 A;  3DST A;  2Y1L E;  4JZY A;  4WNG A;  2PZI A;  4U07 A;  4CEM A;  2YIN A;  4FLB A;  2JLB A;  2UY1 B;  4K5A B; 
#chains in the Genus database with same CATH homology
 3DSV A;  1SA4 A;  1D8D A;  1NL4 A;  3C72 A;  3EU5 A;  3E30 A;  4GTQ A;  1FT1 A;  1O1T A;  1KZO A;  1O5M A;  1FT2 A;  1LD7 A;  3Q78 A;  1LD8 A;  3Q79 A;  4GTR A;  1JCQ A;  2IEJ A;  3DRA A;  3PZ3 A;  4LNG A;  3E32 A;  3HXE A;  1O1S A;  2ZIS A;  3E33 A;  4YDO A;  3DPY A;  1TN8 A;  2BED A;  4EHM A;  1N4P A;  1X81 A;  1N95 A;  1TN7 A;  4GTV A;  3DSS A;  4GTT A;  2H6F A;  3SFX A;  3HXC A;  2H6I A;  1N4S A;  1SA5 A;  1FPP A;  2ZIR A;  3KSQ A;  1N94 A;  2F0Y A;  4YDE A;  3DSU A;  1MZC A;  1TNO A;  2R2L A;  3Q73 A;  3HXF A;  1N4R A;  4GTO A;  1O1R A;  4L9P A;  4GTM A;  2H6G A;  3E34 A;  1S63 A;  1N4Q A;  1TNB A;  1TNZ A;  3HXB A;  3Q75 A;  3DSW A;  1KZP A;  3HXD A;  1NI1 A;  1TNU A;  3PZ1 A;  4GTP A;  3DSX A;  3Q7A A;  1DCE A;  1JCR A;  1TN6 A;  4LNB A;  3Q7F A;  1TNY A;  1D8E A;  3EUV A;  3E37 A;  1S64 A;  3DST A;  3SFY A;  4GTS A;  4MBG A;  1QBQ A;  1JCS A;  3KSL A;  2H6H A;  1N9A A;  3PZ2 A;  3PZ4 A;  1LTX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...