3EU5A

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10) in complex with biotingpp
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Analysis of the eukaryotic prenylome by isoprenoid affinity tagging
pubmed doi rcsb
source organism Rattus norvegicus
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3eu5A00
3SFXA 1S63A 3C72A 4GTOA 3HXFA 4GTSA 1O1SA 1QBQA 1SA4A 1DCEA 3DSUA 3Q7FA 3Q73A 1LTXA 1N94A 1O5MA 2ZIRA 1TN8A 4GTMA 3PZ1A 4GTQA 3KSLA 3E34A 1S64A 3EUVA 3E33A 1KZPA 1D8DA 1NI1A 3DSWA 3PZ4A 4GTRA 1N95A 4MBGA 3DSXA 4LNGA 2H6IA 3HXDA 3SFYA 1FT1A 3E37A 3DSTA 2H6FA 1JCRA 4YDOA 1MZCA 4GTTA 1SA5A 1JCSA 3Q79A 2BEDA 2R2LA 3DSSA 1N4RA 4GTVA 2H6HA 3HXBA 1NL4A 1LD7A 3HXCA 4LNBA 2F0YA 3PZ2A 1TNZA 3E30A 4YDEA 1JCQA 2ZISA 1O1TA 1TNOA 3PZ3A 1TNBA 1D8EA 1O1RA 2H6GA 1X81A 3E32A 1TN6A 1N4PA 2IEJA 3KSQA 3Q75A 3HXEA 4GTPA 4L9PA 3DPYA 1TNUA 1LD8A 3Q78A 1N4SA 3EU5A 3DRAA 1TNYA 3Q7AA 1FT2A 4EHMA 1TN7A 1KZOA 1N9AA 1N4QA 1FPPA 3DSVA
chains in the Genus database with same CATH superfamily
1HF8A 5FJYA 3L17A 2EIKE 4G8KA 2ZGGA 4JZYA 2MYOA 4Q96A 3ZGQA 3AG2E 4DRXE 1HG5A 3FTXA 1YYHA 4OAUC 2LNIA 3BG1B 3CGHA 2L0IA 3S7JA 2XEVA 2P9NG 1NI1A 3NF1A 3BU8A 5KCMA 4H7YA 4KVOA 3JXIA 4LSZE 4GCNA 3AS8A 4MLPA 4MBGA 4G24A 2GW1A 1FT1A 2CHXA 2QYUA 3D3MA 2IJGX 2L6BA 4JHJA 2CFZA 4HS2A 4TUUA 4Q69A 1HE8A 3P1UA 4HFGA 4BTBA 2RKKA 4B8CB 2GROB 5BT1A 4I9CA 1MX4A 2XPYA 2R05A 3CV0A 4EQFA 3T8KA 2R59A 3DBSA 4DX1A 4EPZA 4UQZA 2HO1A 2KCVA 2PQRA 3RSEG 2VGXA 4U0UA 5C1DA 4CEMA 3KD7A 5E76A 3FTUA 3IXEA 2GGFA 4TV3A 4BX9A 4ILHB 3ZYQA 3LDZA 3Q9NC 3OXFA 2DYRE 1S63A 4DUIA 3RO2A 3SQVA 4J8EA 4ILIA 1HFAA 3EHQA 4GZ3A 1GW6A 1HH8A 2FEZA 1WAO1 2L0TB 3APFA 2XCBA 4GTQA 2XPZA 2I1KA 5G55A 4P29A 4FHKA 2XEEA 1D8DA 3PZ4A 2VTBB 4AXHA 1H6PA 3L6AA 2YHCA 2XZTG 2PNNA 2P9PG 4G11A 3J5QB 2UWJG 3SFYA 1INZA 3V31A 3Q4AB 2GRLA 4TRQA 2H6FA 2OEWA 5FTPA 2VGXB 4CDRA 3C3QA 4N2SA 3FTVA 1U3CA 1H2VC 1TJFA 1BI8B 4EECA 3AU5A 4BETA 4PH4B 2J8SD 3PZ2A 2V5QC 4YDEA 4M3OA 3P2BA 3QK0A 3UQ3A 2XGSA 4FULA 5KJLA 1O1RA 3UM2A 3EHRA 3ZN3A 1ELRA 1EYHA 2FO1E 1N4PA 3BUAA 3MKRA 3MKQA 4AEZC 4RSYA 3JQ0A 5ENQD 4OYSA 4FLBA 1X5BA 2VYIA 2WXHA 2VGEA 5ENSD 2I6HA 1Y6IA 2CFUA 4U07A 3TG5A 3PEVB 2MOWA 2KZTA 4BT9A 3CHPA 1Q2ZA 3D9LA 5JHBA 2YHEA 5FZRA 4E6HA 3HDXA 2J9QA 4AY6A 4U04A 1OUVA 5EILA 2JLBA 3CLJA 2A5UA 3RU0A 2GRNB 2PL2A 4AY5A 4BY6A 3LJ3A 4NURA 3ZNGA 3V2OA 2MRIA 4JHRA 3EU9A 3UT8A 3D9PA 3DXMG 5G04J 2XZDG 5KWDA 3AG1E 5CECB 5AYWD 2ETAA 4ANVA 4HOQA 3UIOC 3TG4A 3DSXA 3ZPJA 1UG3A 3PE3A 5EDSA 4C0MA 3L9TA 4GTTA 2RFAA 2V5FA 2BEDA 3CQCB 4XI0A 2EQXA 2R02A 3HG0D 1H19A 1H2TC 4K5CA 5ARGA 3CVYA 4A3VA 2F0YA 1TNZA 3ZXPA 1Z6TA 3UT7A 1TNOA 4HXIA 3ENEA 4KBQA 5FWQA 3ZEFA 3B7TA 2ONDA 2L9BA 3ONKA 5D0QD 3OAWA 4L9PA 4EZLA 1IKND 2OV8A 4JD2G 3GW4A 1OWOA 3CSFA 4F6RD 3PRZA 4XIFA 3NOGD 4CT0A 2IU1A 2Q7FA 1N9AA 4NQ0A 3QAQA 4W9RA 4F1PA 4QQIA 5E75A 4GTOA 4GZ6A 3RJVA 2X3MA 3MV3B 3DSUA 3PEUB 2AXZA 4LG6A 2V4HC 2EINE 4C9BB 1TN8A 3PZ1A 3FP3A 3D9KA 3E34A 3DEOA 3UUXA 3CVVA 5HI7A 4UUCA 4BFRA 3FDHA 4KVMA 4I9EA 3UIPC 5AAOA 1KLXA 2H6IA 1RZ4A 4E85A 2QZAA 3LVQE 2OVFA 3FU5A 5A7DB 1MZCA 2WQ6A 3FUFA 2FULA 5CEDB 2Y4UA 2VSXE 4DJAA 4MRUA 3ZHEA 5BXUA 4ANUA 1SQMA 5CBOA 2ZU6B 4HB5A 2WQ7A 4J7WA 2XCCA 2ILRA 5ANRA 2V8SE 4I6EA 5AJLA 4DPRA 1TR4A 2M63A 1ZU2A 3L54A 3Q78A 4DLOA 4JPSA 5CRVA 5FT9A 5D2MC 4YVQC 3B7BA 1JWFA 3IV0A 5G2NA 3BQOA 2WXGA 4I6GA 2WVIA 3C3RA 4HRNA 3FTWA 4DX7D 3I4RB 1EF1C 1QBQA 1SA4A 2GRRB 4PUCA 3Q49B 3Q73A 3RO3A 4GYOA 4GTMA 3HRAA 3UTMA 3B95A 5AJDA 2AXVA 4KZCA 4BSXA 1BI7B 4I43A 2BKGA 3UX4A 4LERA 1MQSA 2X6HA 2GRMA 2J08A 3R7QA 5EKQD 2ZGDA 2VSOE 5CHEE 2WB2A 3KEAA 3G2TA 4X8QA 1HG2A 2I1JA 1HX8A 1JUQA 1UN9A 5ENPD 5M72A 1N4RA 2HR2A 4N3AA 4AOFA 5EX0A 5HKPA 2F8XK 1RW2A 3MX3A 3QDNA 2P9KG 3PZ3A 5EN5D 3JUIA 3R9MA 4DX5D 4AJWA 4KYOB 4FP7A 5AN8A 3ULYA 4HORA 2PZIA 2ETCA 2PM7A 4MKTA 5H7PA 3RAUA 4A63B 4XI9A 4BERA 2IQCA 4QFVA 4B8AA 1U2VG 1Z5SC 2BKKB 1OCZE 3Q9UC 2BF0X 2I9CA 3AG3E 3ASOE 4J8DA 5FINA 3S2AA 3SFXA 2RD0A 5BNWA 3ESKA 1EDUA 5D66A 2VJ8A 3ZYKA 2FBNA 2XEHA 1LTXA 5FIOA 3AS5A 3V79K 4WUYA 3UMVA 4BX8A 2BUGA 1K8KG 1IHGA 2P2CP 5ENTD 1IQRA 4GCOA 1N95A 3TGOA 1U3DA 4FHJA 5A6CA 4PDXA 2HYZA 1OCRE 4WAFA 3CVNA 4HI9A 1K1BA 3UINC 1E7VA 3DSTA 4F7AA 1FVFA 4K5AB 4CDMA 1SVXA 2WM9A 2X6KA 3K9IA 1QQEA 1LD7A 3MCXA 1YCSB 4RVBA 1MX2A 3QKYA 2OEVA 5ENRD 2DYSE 1OWMA 1OWLA 1O1TA 3KAEA 4F1SA 3SD5A 4YVOA 3FU0A 5D0OD 2WXFA 4GA0A 4GZDA 3FTSA 1TEZA 4GA1A 4GTPA 3RRMB 1YMPA 2IOLA 2I2OA 1IHBA 4JHKA 2JABA 4JL0A 4RLYA 3PZDA 5AQ7A 2WXQA 3LCAA 3LPZA 4HQDA 4PS8A 3SBTB 4XKBA 5BW8C 1OCOE 1TJCA 3ASFA 3IKOB 4UWHA 4O1OA 2WXNA 3FTYA 4URKA 4NIKA 4N3BA 3IEGA 1UJKA 4J8YA 3ABME 4GYYA 4MS6A 1EPUA 3CKBA 5A23A 5JJ7A 4GTRA 1NA0A 5G04C 3D9OA 2CG2A 3QB2A 5FZSA 2VSYA 3OXGA 2AVPA 3QNKA 3NQPA 1LF8A 3ZVVA 3MV2B 5BUZA 3NAWA 4YNDA 3UI2A 5ENNA 3ASGA 2IF4A 3AU4A 3TWSA 1PAQA 1IXVA 2WQHA 3E30A 1JCQA 3RK6A 2WMNA 2LXMA 3AJIA 4DX2A 2YQ8A 3U9WA 1NP7A 3VLDA 2IEJA 3ESLA 5CMYA 3KSQA 3Q75A 3UT4A 3B13A 2LAHA 2QC9A 3TWVA 2C0LA 3S7DA 4YDYA 4CYMD 1LD8A 1N4SA 3PVLA 3L08A 1TNYA 5G05C 5JA4D 3I3NA 3PREA 4U7EB 4G26A 2GRPB 5CERB 1PY1A 4JVSA 2LXLA 2QFCA 4L7TA 5KNHD 1O1SA 1DCEA 1NFIE 3U66A 4ABNA 3D9NA 4HOSA 2LO6A 5KNGA 4TXPA 5B1AE 5T8IA 3S7BA 3KS2A 2B0OE 4HLEA 4L2LA 3UM1A 4FC8A 1IYGA 3EIQC 2XGOA 4APOA 3PH0C 3T5XA 3W9GA 4N5QA 4IN3B 1G3NB 2J49A 3WXXA 4I1MA 1ELKA 4A1GA 3G2WA 2RFMA 3O4ZA 3MZLB 3MKQB 4WNFA 5CRUA 3Q47B 3UKUG 1TNBA 3E32A 3HXEA 1BLXB 1OCCE 4DLQA 2R17C 1NZNA 2KZTB 1E90A 2X6FA 2L6JA 3CHMA 3EIJA 3CVUA 2AJAA 3DRAA 1KPSB 3Q7AA 4EHMA 2BTDA 2CG3A 1KZOA 1FPPA 2WPVA 5T4YA 3LS8A 2F8YA 3TAXA 2FF4A 4GTSA 4UWLA 4ANXA 1W3BA 3SY2A 4WWNA 5G05J 4A55A 2WXIA 2WMOA 4TXRA 1O5MA 1E8YA 1BU9A 5JJTA 2LAIA 5ITZF 2R5SA 3CK9A 4G25A 3UM0A 1UW4B 5CCMA 2FO7A 3PNTB 2E2EA 2V4LA 2NSZA 2AW6A 1ELWA 3EJNA 2DBAA 3ASNE 4TXQA 1FCHA 3C98A 4U0SA 4AIFA 3DSSA 4J0UA 3O48A 2XRZA 4C48B 3SO8A 3HXBA 4BWRA 4I6JA 3ZW3A 5BPPA 4AVXA 4I2WA 3UPVA 3MGBA 3MYVA 3OXLA 2ZXWE 4A3TA 2PQNA 3V2XA 4HRLA 5ENOD 1YA0A 3AG4E 2LSVA 3SNXA 1N11A 5LCWJ 3FUHA 1PC2A 1H6KA 3S7FA 3TL5A 2XENA 4I2ZA 3ZRHA 4PS3A 1V54E 3UM3A 3TWXA 3LKUA 1B89A 3FUNA 2WXKA 2DVWA 3MA5A 4HOUA 3FU3A 4N39A 2P58C 5HRYA 4F3VA 4IYPA 3AS4A 4BT8A 4XX5A 4O1PA 2KBXA 3GZSA 4RQIA 1UJJA 3URZA 3CQGB 3IHYA 4U95D 4XE0A 2HE0A 1HS6A 4YDWA 1E8ZA 4UI9J 4GAAA 3PUJA 2CHWA 4A1SA 5CCLA 4IULA 4GPKA 2J09A 4LNGA 1JWGA 2KM4A 2XHEA 3ASDA 2RG8A 5BV1A 4BEPA 4KT6B 4WNGA 3ZHEB 3Q15A 3FH8A 3TWTA 4KMOA 3LJNA 3TXMA 2NC9A 1UOHA 4CDNA 5LX8A 5AQAA 4LUNU 1BD8A 5LP0A 2X6IA 3DEPA 3FH5A 3LY9A 2ZISA 3JXJA 4OVUA 4Z68A 1WG0A 3SGHA 4KXKB 5LOZA 3CR3A 3ULEG 1K3ZD 4B93B 3APDA 4B0ZA 3CHQA 3CVQA 1TYQG 2KCLA 4K0RA 3U4TA 2YNQA 3SBSA 3RIBA 1N4QA 3DSVA 3D9MA 3BEEA 3MJWA 3SFZA 3GZ2A 3BG0B 3U64A 4GMRA 3HXFA 4U8YD 3FY4A 3ZYMA 4G23A 3ASHA 2J4BA 4AM9A 5CEAA 3W9FA 2IO2C 3E33A 3SZ7A 3RRUA 2DZNA 3FEYA 1DC2A 2IOSA 2DIWA 3EHNA 3FTZA 5EIBE 3MEKA 5EIDA 5B3SE 4UI9K 3CIAA 5EYLA 3R9AB 3L82A 2OCCE 4D10C 2F37A 5FQ4A 3RRNB 1N54A 1JCSA 2ETBA 4J6IA 3SI5A 3SHFA 3U3WA 4UQYA 4B89A 3QOUA 3FUDA 2Y69E 4NRHB 2WXOA 2X38A 1OWPA 2DCPA 4ANWA 5KJNA 1DNPA 1IQUA 1TNUA 1Z3XA 1H6OA 4G8LA 2IFUA 1BPOA 4CZ2D 4R7LA 1AWCB 3CSTA 3ONLA 1TN7A 3X2QE 4Y6WA 4UQXA 4HI8A 4K03A 3GYZA 3T8MA 4ACLA 4PS7A 5IY5E 4HRMB 3HVEA 2WXRA 3Q7FA 3TWUA 4GYWA 2J4DA 5BV0A 5J08A 1S64A 3I4GA 4NACA 2P9UG 4O60A 4O6FA 3QWPA 1MJ0A 4XEIG 4DK5A 3VLFA 3OTNA 3J5PA 3ML8A 5FZQA 2KXPC 2VTBA 5JMND 3D9JA 4GZCA 4GMJA 2IO3C 2QY7A 2J07A 4ZHBA 3TJPA 3G2VA 2B6CA 4GTVA 2H6HA 1KT1A 1NL4A 4L23A 3TWWA 4ATGA 3HXCA 4L2YA 5CBNA 3JCKC 2XRYA 3EHMA 4JC8A 1E8WA 2P9IG 1E7UA 1VDYA 4IRUA 2XS8A 3SF4A 5KJKA 2H6GA 5HQ8A 1X81A 3HVEB 3L13A 4GB9A 1N52A 1XNFA 3HIZA 2A4ZA 3LXUX 1FT2A 3N71A 1Z3YA 4HVBA 3R7RA 1KT0A 3C72A 4JA9A 5AQ9A 3AAAC 5AENA 1N94A 4XZ4A 4C0EA 3KSLA 3EDTB 3T9KA 4BTAA 4WNEA 5LFAA 1K1AA 1H0AA 3L16A 2JEKA 3FUEA 1DCQA 3ISMC 3C5RA 5DBKA 3C3OA 1OT8A 4N2QA 4I1AA 5T3RA 1MYOA 3G2UA 5FQ6A 3NBNB 2R03A 1WDYA 2Y0BG 3TXNA 3ML9A 3FUMA 1SA5A 3Q79A 3GZ1A 4UWGA 3LYAA 3I5PA 4J8SA 5AIJA 5EX3A 4BESA 3T5VA 2V0PA 4RG6A 4LNUD 4G2VA 4GA2A 4APFA 3E4BA 4I17A 2YINA 3CHOA 4ATZD 3CVXA 5KBAA 1SW6A 4EZJA 4DI4A 3CK7A 5LCWC 3FFLA 2WXPA 4CT4A 2C2LA 3CHSA 1V55E 2OOEA 3ZXSA 4U8HA 1QNFA 2QYJA 1XGWA 2P9SG 4Y6CA 2AXUA 4XKCA 4V3IA 1E8XA 4ME2A 4EBAA 3PNLB 2UY1A 3VTXA 4JXTA 3UKRG 1QYMA 4FJYA 4WWOA 5FQ7A 3APCA 4BSZB 4OAVB 2NXPA 4GPMA 3EUVA 4N5CA 4FJZA 1KZPA 4HLLA 3QARA 3NOCD 3PE4A 2LUHA 3FUIA 4UI9C 5HS0A 1N0QA 3PDNA 2HM8A 2WXJA 4GZ5A 5AARA 1MX6A 3FH7A 1JCRA 4YDOA 1P5QA 4U8VD 5ANLA 3DPDA 4FU3A 1JPLA 2EIJE 4FA6A 5B1BE 3ZYLA 4HOTA 2WXMA 4LNBA 1ZB1A 2XGMA 3PUKA 4UWKA 2KATA 4F53A 3DWLG 1NA3A 2DZOA 2VQ2A 3B7SA 3IHVA 2UY1B 4JB8P 4CRWA 3JYSA 2P9LG 3DPYA 1L5JA 1WM5A 4RG9A 1HZ4A 3CHRA 2VSNA 3CKCA 3EU5A 3WG7E 3FU6A 2NYJA 5BXOA 5FQ8A 3NZSA 3FHEA 5C2YA 3D9IA 3ABKE 3LY7A 3F6QA 1OXJA 5KJMA 2KC7A 4EBAG 3L22A 4U63A 3FEXA 3CVPA 3UXGA 4AV7A 2XS1A 3ZFWA 4GU5A 2KCKA 1H2UA 5J90A 3VTYA 2Y3AA 3FUKA 1N0RA 2CHZA 4LEUA 1UN8A 3CVLA 3FULA 5DIZA 4CGWA 2WXLA 4TUMA 3ABLE 3HXDA 4B94A 4HNAD 3HHMA 1MHQA 3DXKG 2IY0C 1A17A 1WY6A 3ZUVB 4GMLA 2XQ0A 1D9SA 5AQBA 2GRQB 3QC1A 3LVRE 2X6JA 2IONA 1SZAA 3ZIMA 4LRZA 4UWFA 3CEQA 2E0IA 4JW1A 4L1BA 1ZBPA 3ULQA 3TWRA 4DX6D 4EZKA 4M7CA 5CMWA 1QZ2A 1DVPA 1OY3D 2VGYA 4FLHA 4LCTA 3TWQA 4WNDA 3PS6A 5JJ6A 4FADA 1S70B 4N3CA 3FUJA 2AWIA 4K5BA 2ZIRA 4J8FA 3QWWA 3Q5MA 2A5EA 3CVWA 2EILE 2Y1LE 3DSWA 5JHAA 4JEUA 2PM6A 4G1TA 4U0ZA 3LY8A 3D9HA 3KEZA 2C0MA 3LEWA 4DI3A 3NZUA 4JEHA 4I1OB 5EYPF 1E96B 3E37A 4HBDA 1A5EA 4ACKA 4AP2A 1Y8MA 4ILGA 4KZ0A 3CK8A 4U96D 3V30A 2R2LA 3ZU7B 2Y4TA 3HYMB 4Q94A 1HXIA 1S0PA 3JQ1A 2MHKA 3QJZA 3FWVA 4H7XA 4JA7A 3G2SA 3JUEA 1D8EA 2OVBA 1TN6A 2XPIA 1AP7A 3B7RL 2DWZA 3QWVA 3RKVA 5ARFA 3VLEA 3ZKJA 2EIME 4CGVA 1SZ9A 1HU3A 4OVVA 3B7UX 4CCAA 3NB2A 4WWPA 3IBEA 1HO8A 1OWNA 1FVHA 2FI7A 4ZFHA 2LSUA
chains in the Genus database with same CATH topology
3SFXA 1S63A 3C72A 4GTOA 3HXFA 4GTSA 1O1SA 1QBQA 1SA4A 1DCEA 3DSUA 3Q7FA 3Q73A 1LTXA 1N94A 1O5MA 2ZIRA 1TN8A 4GTMA 3PZ1A 4GTQA 3KSLA 3E34A 1S64A 3EUVA 3E33A 1KZPA 1D8DA 1NI1A 3DSWA 3PZ4A 4GTRA 1N95A 4MBGA 3DSXA 4LNGA 2H6IA 3HXDA 3SFYA 1FT1A 3E37A 3DSTA 2H6FA 1JCRA 4YDOA 1MZCA 4GTTA 1SA5A 1JCSA 3Q79A 2BEDA 2R2LA 3DSSA 1N4RA 4GTVA 2H6HA 3HXBA 1NL4A 1LD7A 3HXCA 4LNBA 2F0YA 3PZ2A 1TNZA 3E30A 4YDEA 1JCQA 2ZISA 1O1TA 1TNOA 3PZ3A 1TNBA 1D8EA 1O1RA 2H6GA 1X81A 3E32A 1TN6A 1N4PA 2IEJA 3KSQA 3Q75A 3HXEA 4GTPA 4L9PA 3DPYA 1TNUA 1LD8A 3Q78A 1N4SA 3EU5A 3DRAA 1TNYA 3Q7AA 1FT2A 4EHMA 1TN7A 1KZOA 1N9AA 1N4QA 1FPPA 3DSVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SFX A;  1S63 A;  3C72 A;  4GTO A;  3HXF A;  4GTS A;  1O1S A;  1QBQ A;  1SA4 A;  1DCE A;  3DSU A;  3Q7F A;  3Q73 A;  1LTX A;  1N94 A;  1O5M A;  2ZIR A;  1TN8 A;  4GTM A;  3PZ1 A;  4GTQ A;  3KSL A;  3E34 A;  1S64 A;  3EUV A;  3E33 A;  1KZP A;  1D8D A;  1NI1 A;  3DSW A;  3PZ4 A;  4GTR A;  1N95 A;  4MBG A;  3DSX A;  4LNG A;  2H6I A;  3HXD A;  3SFY A;  1FT1 A;  3E37 A;  3DST A;  2H6F A;  1JCR A;  4YDO A;  1MZC A;  4GTT A;  1SA5 A;  1JCS A;  3Q79 A;  2BED A;  2R2L A;  3DSS A;  1N4R A;  4GTV A;  2H6H A;  3HXB A;  1NL4 A;  1LD7 A;  3HXC A;  4LNB A;  2F0Y A;  3PZ2 A;  1TNZ A;  3E30 A;  4YDE A;  1JCQ A;  2ZIS A;  1O1T A;  1TNO A;  3PZ3 A;  1TNB A;  1D8E A;  1O1R A;  2H6G A;  1X81 A;  3E32 A;  1TN6 A;  1N4P A;  2IEJ A;  3KSQ A;  3Q75 A;  3HXE A;  4GTP A;  4L9P A;  3DPY A;  1TNU A;  1LD8 A;  3Q78 A;  1N4S A;  3EU5 A;  3DRA A;  1TNY A;  3Q7A A;  1FT2 A;  4EHM A;  1TN7 A;  1KZO A;  1N9A A;  1N4Q A;  1FPP A;  3DSV A; 
#chains in the Genus database with same CATH topology
 1HF8 A;  5FJY A;  3L17 A;  2EIK E;  4G8K A;  2ZGG A;  4JZY A;  2MYO A;  4Q96 A;  3ZGQ A;  3AG2 E;  4DRX E;  1HG5 A;  3FTX A;  1YYH A;  4OAU C;  2LNI A;  3BG1 B;  3CGH A;  2L0I A;  3S7J A;  2XEV A;  2P9N G;  1NI1 A;  3NF1 A;  3BU8 A;  5KCM A;  4H7Y A;  4KVO A;  3JXI A;  4LSZ E;  4GCN A;  3AS8 A;  4MLP A;  4MBG A;  4G24 A;  2GW1 A;  1FT1 A;  2CHX A;  2QYU A;  3D3M A;  2IJG X;  2L6B A;  4JHJ A;  2CFZ A;  4HS2 A;  4TUU A;  4Q69 A;  1HE8 A;  3P1U A;  4HFG A;  4BTB A;  2RKK A;  4B8C B;  2GRO B;  5BT1 A;  4I9C A;  1MX4 A;  2XPY A;  2R05 A;  3CV0 A;  4EQF A;  3T8K A;  2R59 A;  3DBS A;  4DX1 A;  4EPZ A;  4UQZ A;  2HO1 A;  2KCV A;  2PQR A;  3RSE G;  2VGX A;  4U0U A;  5C1D A;  4CEM A;  3KD7 A;  5E76 A;  3FTU A;  3IXE A;  2GGF A;  4TV3 A;  4BX9 A;  4ILH B;  3ZYQ A;  3LDZ A;  3Q9N C;  3OXF A;  2DYR E;  1S63 A;  4DUI A;  3RO2 A;  3SQV A;  4J8E A;  4ILI A;  1HFA A;  3EHQ A;  4GZ3 A;  1GW6 A;  1HH8 A;  2FEZ A;  1WAO 1;  2L0T B;  3APF A;  2XCB A;  4GTQ A;  2XPZ A;  2I1K A;  5G55 A;  4P29 A;  4FHK A;  2XEE A;  1D8D A;  3PZ4 A;  2VTB B;  4AXH A;  1H6P A;  3L6A A;  2YHC A;  2XZT G;  2PNN A;  2P9P G;  4G11 A;  3J5Q B;  2UWJ G;  3SFY A;  1INZ A;  3V31 A;  3Q4A B;  2GRL A;  4TRQ A;  2H6F A;  2OEW A;  5FTP A;  2VGX B;  4CDR A;  3C3Q A;  4N2S A;  3FTV A;  1U3C A;  1H2V C;  1TJF A;  1BI8 B;  4EEC A;  3AU5 A;  4BET A;  4PH4 B;  2J8S D;  3PZ2 A;  2V5Q C;  4YDE A;  4M3O A;  3P2B A;  3QK0 A;  3UQ3 A;  2XGS A;  4FUL A;  5KJL A;  1O1R A;  3UM2 A;  3EHR A;  3ZN3 A;  1ELR A;  1EYH A;  2FO1 E;  1N4P A;  3BUA A;  3MKR A;  3MKQ A;  4AEZ C;  4RSY A;  3JQ0 A;  5ENQ D;  4OYS A;  4FLB A;  1X5B A;  2VYI A;  2WXH A;  2VGE A;  5ENS D;  2I6H A;  1Y6I A;  2CFU A;  4U07 A;  3TG5 A;  3PEV B;  2MOW A;  2KZT A;  4BT9 A;  3CHP A;  1Q2Z A;  3D9L A;  5JHB A;  2YHE A;  5FZR A;  4E6H A;  3HDX A;  2J9Q A;  4AY6 A;  4U04 A;  1OUV A;  5EIL A;  2JLB A;  3CLJ A;  2A5U A;  3RU0 A;  2GRN B;  2PL2 A;  4AY5 A;  4BY6 A;  3LJ3 A;  4NUR A;  3ZNG A;  3V2O A;  2MRI A;  4JHR A;  3EU9 A;  3UT8 A;  3D9P A;  3DXM G;  5G04 J;  2XZD G;  5KWD A;  3AG1 E;  5CEC B;  5AYW D;  2ETA A;  4ANV A;  4HOQ A;  3UIO C;  3TG4 A;  3DSX A;  3ZPJ A;  1UG3 A;  3PE3 A;  5EDS A;  4C0M A;  3L9T A;  4GTT A;  2RFA A;  2V5F A;  2BED A;  3CQC B;  4XI0 A;  2EQX A;  2R02 A;  3HG0 D;  1H19 A;  1H2T C;  4K5C A;  5ARG A;  3CVY A;  4A3V A;  2F0Y A;  1TNZ A;  3ZXP A;  1Z6T A;  3UT7 A;  1TNO A;  4HXI A;  3ENE A;  4KBQ A;  5FWQ A;  3ZEF A;  3B7T A;  2OND A;  2L9B A;  3ONK A;  5D0Q D;  3OAW A;  4L9P A;  4EZL A;  1IKN D;  2OV8 A;  4JD2 G;  3GW4 A;  1OWO A;  3CSF A;  4F6R D;  3PRZ A;  4XIF A;  3NOG D;  4CT0 A;  2IU1 A;  2Q7F A;  1N9A A;  4NQ0 A;  3QAQ A;  4W9R A;  4F1P A;  4QQI A;  5E75 A;  4GTO A;  4GZ6 A;  3RJV A;  2X3M A;  3MV3 B;  3DSU A;  3PEU B;  2AXZ A;  4LG6 A;  2V4H C;  2EIN E;  4C9B B;  1TN8 A;  3PZ1 A;  3FP3 A;  3D9K A;  3E34 A;  3DEO A;  3UUX A;  3CVV A;  5HI7 A;  4UUC A;  4BFR A;  3FDH A;  4KVM A;  4I9E A;  3UIP C;  5AAO A;  1KLX A;  2H6I A;  1RZ4 A;  4E85 A;  2QZA A;  3LVQ E;  2OVF A;  3FU5 A;  5A7D B;  1MZC A;  2WQ6 A;  3FUF A;  2FUL A;  5CED B;  2Y4U A;  2VSX E;  4DJA A;  4MRU A;  3ZHE A;  5BXU A;  4ANU A;  1SQM A;  5CBO A;  2ZU6 B;  4HB5 A;  2WQ7 A;  4J7W A;  2XCC A;  2ILR A;  5ANR A;  2V8S E;  4I6E A;  5AJL A;  4DPR A;  1TR4 A;  2M63 A;  1ZU2 A;  3L54 A;  3Q78 A;  4DLO A;  4JPS A;  5CRV A;  5FT9 A;  5D2M C;  4YVQ C;  3B7B A;  1JWF A;  3IV0 A;  5G2N A;  3BQO A;  2WXG A;  4I6G A;  2WVI A;  3C3R A;  4HRN A;  3FTW A;  4DX7 D;  3I4R B;  1EF1 C;  1QBQ A;  1SA4 A;  2GRR B;  4PUC A;  3Q49 B;  3Q73 A;  3RO3 A;  4GYO A;  4GTM A;  3HRA A;  3UTM A;  3B95 A;  5AJD A;  2AXV A;  4KZC A;  4BSX A;  1BI7 B;  4I43 A;  2BKG A;  3UX4 A;  4LER A;  1MQS A;  2X6H A;  2GRM A;  2J08 A;  3R7Q A;  5EKQ D;  2ZGD A;  2VSO E;  5CHE E;  2WB2 A;  3KEA A;  3G2T A;  4X8Q A;  1HG2 A;  2I1J A;  1HX8 A;  1JUQ A;  1UN9 A;  5ENP D;  5M72 A;  1N4R A;  2HR2 A;  4N3A A;  4AOF A;  5EX0 A;  5HKP A;  2F8X K;  1RW2 A;  3MX3 A;  3QDN A;  2P9K G;  3PZ3 A;  5EN5 D;  3JUI A;  3R9M A;  4DX5 D;  4AJW A;  4KYO B;  4FP7 A;  5AN8 A;  3ULY A;  4HOR A;  2PZI A;  2ETC A;  2PM7 A;  4MKT A;  5H7P A;  3RAU A;  4A63 B;  4XI9 A;  4BER A;  2IQC A;  4QFV A;  4B8A A;  1U2V G;  1Z5S C;  2BKK B;  1OCZ E;  3Q9U C;  2BF0 X;  2I9C A;  3AG3 E;  3ASO E;  4J8D A;  5FIN A;  3S2A A;  3SFX A;  2RD0 A;  5BNW A;  3ESK A;  1EDU A;  5D66 A;  2VJ8 A;  3ZYK A;  2FBN A;  2XEH A;  1LTX A;  5FIO A;  3AS5 A;  3V79 K;  4WUY A;  3UMV A;  4BX8 A;  2BUG A;  1K8K G;  1IHG A;  2P2C P;  5ENT D;  1IQR A;  4GCO A;  1N95 A;  3TGO A;  1U3D A;  4FHJ A;  5A6C A;  4PDX A;  2HYZ A;  1OCR E;  4WAF A;  3CVN A;  4HI9 A;  1K1B A;  3UIN C;  1E7V A;  3DST A;  4F7A A;  1FVF A;  4K5A B;  4CDM A;  1SVX A;  2WM9 A;  2X6K A;  3K9I A;  1QQE A;  1LD7 A;  3MCX A;  1YCS B;  4RVB A;  1MX2 A;  3QKY A;  2OEV A;  5ENR D;  2DYS E;  1OWM A;  1OWL A;  1O1T A;  3KAE A;  4F1S A;  3SD5 A;  4YVO A;  3FU0 A;  5D0O D;  2WXF A;  4GA0 A;  4GZD A;  3FTS A;  1TEZ A;  4GA1 A;  4GTP A;  3RRM B;  1YMP A;  2IOL A;  2I2O A;  1IHB A;  4JHK A;  2JAB A;  4JL0 A;  4RLY A;  3PZD A;  5AQ7 A;  2WXQ A;  3LCA A;  3LPZ A;  4HQD A;  4PS8 A;  3SBT B;  4XKB A;  5BW8 C;  1OCO E;  1TJC A;  3ASF A;  3IKO B;  4UWH A;  4O1O A;  2WXN A;  3FTY A;  4URK A;  4NIK A;  4N3B A;  3IEG A;  1UJK A;  4J8Y A;  3ABM E;  4GYY A;  4MS6 A;  1EPU A;  3CKB A;  5A23 A;  5JJ7 A;  4GTR A;  1NA0 A;  5G04 C;  3D9O A;  2CG2 A;  3QB2 A;  5FZS A;  2VSY A;  3OXG A;  2AVP A;  3QNK A;  3NQP A;  1LF8 A;  3ZVV A;  3MV2 B;  5BUZ A;  3NAW A;  4YND A;  3UI2 A;  5ENN A;  3ASG A;  2IF4 A;  3AU4 A;  3TWS A;  1PAQ A;  1IXV A;  2WQH A;  3E30 A;  1JCQ A;  3RK6 A;  2WMN A;  2LXM A;  3AJI A;  4DX2 A;  2YQ8 A;  3U9W A;  1NP7 A;  3VLD A;  2IEJ A;  3ESL A;  5CMY A;  3KSQ A;  3Q75 A;  3UT4 A;  3B13 A;  2LAH A;  2QC9 A;  3TWV A;  2C0L A;  3S7D A;  4YDY A;  4CYM D;  1LD8 A;  1N4S A;  3PVL A;  3L08 A;  1TNY A;  5G05 C;  5JA4 D;  3I3N A;  3PRE A;  4U7E B;  4G26 A;  2GRP B;  5CER B;  1PY1 A;  4JVS A;  2LXL A;  2QFC A;  4L7T A;  5KNH D;  1O1S A;  1DCE A;  1NFI E;  3U66 A;  4ABN A;  3D9N A;  4HOS A;  2LO6 A;  5KNG A;  4TXP A;  5B1A E;  5T8I A;  3S7B A;  3KS2 A;  2B0O E;  4HLE A;  4L2L A;  3UM1 A;  4FC8 A;  1IYG A;  3EIQ C;  2XGO A;  4APO A;  3PH0 C;  3T5X A;  3W9G A;  4N5Q A;  4IN3 B;  1G3N B;  2J49 A;  3WXX A;  4I1M A;  1ELK A;  4A1G A;  3G2W A;  2RFM A;  3O4Z A;  3MZL B;  3MKQ B;  4WNF A;  5CRU A;  3Q47 B;  3UKU G;  1TNB A;  3E32 A;  3HXE A;  1BLX B;  1OCC E;  4DLQ A;  2R17 C;  1NZN A;  2KZT B;  1E90 A;  2X6F A;  2L6J A;  3CHM A;  3EIJ A;  3CVU A;  2AJA A;  3DRA A;  1KPS B;  3Q7A A;  4EHM A;  2BTD A;  2CG3 A;  1KZO A;  1FPP A;  2WPV A;  5T4Y A;  3LS8 A;  2F8Y A;  3TAX A;  2FF4 A;  4GTS A;  4UWL A;  4ANX A;  1W3B A;  3SY2 A;  4WWN A;  5G05 J;  4A55 A;  2WXI A;  2WMO A;  4TXR A;  1O5M A;  1E8Y A;  1BU9 A;  5JJT A;  2LAI A;  5ITZ F;  2R5S A;  3CK9 A;  4G25 A;  3UM0 A;  1UW4 B;  5CCM A;  2FO7 A;  3PNT B;  2E2E A;  2V4L A;  2NSZ A;  2AW6 A;  1ELW A;  3EJN A;  2DBA A;  3ASN E;  4TXQ A;  1FCH A;  3C98 A;  4U0S A;  4AIF A;  3DSS A;  4J0U A;  3O48 A;  2XRZ A;  4C48 B;  3SO8 A;  3HXB A;  4BWR A;  4I6J A;  3ZW3 A;  5BPP A;  4AVX A;  4I2W A;  3UPV A;  3MGB A;  3MYV A;  3OXL A;  2ZXW E;  4A3T A;  2PQN A;  3V2X A;  4HRL A;  5ENO D;  1YA0 A;  3AG4 E;  2LSV A;  3SNX A;  1N11 A;  5LCW J;  3FUH A;  1PC2 A;  1H6K A;  3S7F A;  3TL5 A;  2XEN A;  4I2Z A;  3ZRH A;  4PS3 A;  1V54 E;  3UM3 A;  3TWX A;  3LKU A;  1B89 A;  3FUN A;  2WXK A;  2DVW A;  3MA5 A;  4HOU A;  3FU3 A;  4N39 A;  2P58 C;  5HRY A;  4F3V A;  4IYP A;  3AS4 A;  4BT8 A;  4XX5 A;  4O1P A;  2KBX A;  3GZS A;  4RQI A;  1UJJ A;  3URZ A;  3CQG B;  3IHY A;  4U95 D;  4XE0 A;  2HE0 A;  1HS6 A;  4YDW A;  1E8Z A;  4UI9 J;  4GAA A;  3PUJ A;  2CHW A;  4A1S A;  5CCL A;  4IUL A;  4GPK A;  2J09 A;  4LNG A;  1JWG A;  2KM4 A;  2XHE A;  3ASD A;  2RG8 A;  5BV1 A;  4BEP A;  4KT6 B;  4WNG A;  3ZHE B;  3Q15 A;  3FH8 A;  3TWT A;  4KMO A;  3LJN A;  3TXM A;  2NC9 A;  1UOH A;  4CDN A;  5LX8 A;  5AQA A;  4LUN U;  1BD8 A;  5LP0 A;  2X6I A;  3DEP A;  3FH5 A;  3LY9 A;  2ZIS A;  3JXJ A;  4OVU A;  4Z68 A;  1WG0 A;  3SGH A;  4KXK B;  5LOZ A;  3CR3 A;  3ULE G;  1K3Z D;  4B93 B;  3APD A;  4B0Z A;  3CHQ A;  3CVQ A;  1TYQ G;  2KCL A;  4K0R A;  3U4T A;  2YNQ A;  3SBS A;  3RIB A;  1N4Q A;  3DSV A;  3D9M A;  3BEE A;  3MJW A;  3SFZ A;  3GZ2 A;  3BG0 B;  3U64 A;  4GMR A;  3HXF A;  4U8Y D;  3FY4 A;  3ZYM A;  4G23 A;  3ASH A;  2J4B A;  4AM9 A;  5CEA A;  3W9F A;  2IO2 C;  3E33 A;  3SZ7 A;  3RRU A;  2DZN A;  3FEY A;  1DC2 A;  2IOS A;  2DIW A;  3EHN A;  3FTZ A;  5EIB E;  3MEK A;  5EID A;  5B3S E;  4UI9 K;  3CIA A;  5EYL A;  3R9A B;  3L82 A;  2OCC E;  4D10 C;  2F37 A;  5FQ4 A;  3RRN B;  1N54 A;  1JCS A;  2ETB A;  4J6I A;  3SI5 A;  3SHF A;  3U3W A;  4UQY A;  4B89 A;  3QOU A;  3FUD A;  2Y69 E;  4NRH B;  2WXO A;  2X38 A;  1OWP A;  2DCP A;  4ANW A;  5KJN A;  1DNP A;  1IQU A;  1TNU A;  1Z3X A;  1H6O A;  4G8L A;  2IFU A;  1BPO A;  4CZ2 D;  4R7L A;  1AWC B;  3CST A;  3ONL A;  1TN7 A;  3X2Q E;  4Y6W A;  4UQX A;  4HI8 A;  4K03 A;  3GYZ A;  3T8M A;  4ACL A;  4PS7 A;  5IY5 E;  4HRM B;  3HVE A;  2WXR A;  3Q7F A;  3TWU A;  4GYW A;  2J4D A;  5BV0 A;  5J08 A;  1S64 A;  3I4G A;  4NAC A;  2P9U G;  4O60 A;  4O6F A;  3QWP A;  1MJ0 A;  4XEI G;  4DK5 A;  3VLF A;  3OTN A;  3J5P A;  3ML8 A;  5FZQ A;  2KXP C;  2VTB A;  5JMN D;  3D9J A;  4GZC A;  4GMJ A;  2IO3 C;  2QY7 A;  2J07 A;  4ZHB A;  3TJP A;  3G2V A;  2B6C A;  4GTV A;  2H6H A;  1KT1 A;  1NL4 A;  4L23 A;  3TWW A;  4ATG A;  3HXC A;  4L2Y A;  5CBN A;  3JCK C;  2XRY A;  3EHM A;  4JC8 A;  1E8W A;  2P9I G;  1E7U A;  1VDY A;  4IRU A;  2XS8 A;  3SF4 A;  5KJK A;  2H6G A;  5HQ8 A;  1X81 A;  3HVE B;  3L13 A;  4GB9 A;  1N52 A;  1XNF A;  3HIZ A;  2A4Z A;  3LXU X;  1FT2 A;  3N71 A;  1Z3Y A;  4HVB A;  3R7R A;  1KT0 A;  3C72 A;  4JA9 A;  5AQ9 A;  3AAA C;  5AEN A;  1N94 A;  4XZ4 A;  4C0E A;  3KSL A;  3EDT B;  3T9K A;  4BTA A;  4WNE A;  5LFA A;  1K1A A;  1H0A A;  3L16 A;  2JEK A;  3FUE A;  1DCQ A;  3ISM C;  3C5R A;  5DBK A;  3C3O A;  1OT8 A;  4N2Q A;  4I1A A;  5T3R A;  1MYO A;  3G2U A;  5FQ6 A;  3NBN B;  2R03 A;  1WDY A;  2Y0B G;  3TXN A;  3ML9 A;  3FUM A;  1SA5 A;  3Q79 A;  3GZ1 A;  4UWG A;  3LYA A;  3I5P A;  4J8S A;  5AIJ A;  5EX3 A;  4BES A;  3T5V A;  2V0P A;  4RG6 A;  4LNU D;  4G2V A;  4GA2 A;  4APF A;  3E4B A;  4I17 A;  2YIN A;  3CHO A;  4ATZ D;  3CVX A;  5KBA A;  1SW6 A;  4EZJ A;  4DI4 A;  3CK7 A;  5LCW C;  3FFL A;  2WXP A;  4CT4 A;  2C2L A;  3CHS A;  1V55 E;  2OOE A;  3ZXS A;  4U8H A;  1QNF A;  2QYJ A;  1XGW A;  2P9S G;  4Y6C A;  2AXU A;  4XKC A;  4V3I A;  1E8X A;  4ME2 A;  4EBA A;  3PNL B;  2UY1 A;  3VTX A;  4JXT A;  3UKR G;  1QYM A;  4FJY A;  4WWO A;  5FQ7 A;  3APC A;  4BSZ B;  4OAV B;  2NXP A;  4GPM A;  3EUV A;  4N5C A;  4FJZ A;  1KZP A;  4HLL A;  3QAR A;  3NOC D;  3PE4 A;  2LUH A;  3FUI A;  4UI9 C;  5HS0 A;  1N0Q A;  3PDN A;  2HM8 A;  2WXJ A;  4GZ5 A;  5AAR A;  1MX6 A;  3FH7 A;  1JCR A;  4YDO A;  1P5Q A;  4U8V D;  5ANL A;  3DPD A;  4FU3 A;  1JPL A;  2EIJ E;  4FA6 A;  5B1B E;  3ZYL A;  4HOT A;  2WXM A;  4LNB A;  1ZB1 A;  2XGM A;  3PUK A;  4UWK A;  2KAT A;  4F53 A;  3DWL G;  1NA3 A;  2DZO A;  2VQ2 A;  3B7S A;  3IHV A;  2UY1 B;  4JB8 P;  4CRW A;  3JYS A;  2P9L G;  3DPY A;  1L5J A;  1WM5 A;  4RG9 A;  1HZ4 A;  3CHR A;  2VSN A;  3CKC A;  3EU5 A;  3WG7 E;  3FU6 A;  2NYJ A;  5BXO A;  5FQ8 A;  3NZS A;  3FHE A;  5C2Y A;  3D9I A;  3ABK E;  3LY7 A;  3F6Q A;  1OXJ A;  5KJM A;  2KC7 A;  4EBA G;  3L22 A;  4U63 A;  3FEX A;  3CVP A;  3UXG A;  4AV7 A;  2XS1 A;  3ZFW A;  4GU5 A;  2KCK A;  1H2U A;  5J90 A;  3VTY A;  2Y3A A;  3FUK A;  1N0R A;  2CHZ A;  4LEU A;  1UN8 A;  3CVL A;  3FUL A;  5DIZ A;  4CGW A;  2WXL A;  4TUM A;  3ABL E;  3HXD A;  4B94 A;  4HNA D;  3HHM A;  1MHQ A;  3DXK G;  2IY0 C;  1A17 A;  1WY6 A;  3ZUV B;  4GML A;  2XQ0 A;  1D9S A;  5AQB A;  2GRQ B;  3QC1 A;  3LVR E;  2X6J A;  2ION A;  1SZA A;  3ZIM A;  4LRZ A;  4UWF A;  3CEQ A;  2E0I A;  4JW1 A;  4L1B A;  1ZBP A;  3ULQ A;  3TWR A;  4DX6 D;  4EZK A;  4M7C A;  5CMW A;  1QZ2 A;  1DVP A;  1OY3 D;  2VGY A;  4FLH A;  4LCT A;  3TWQ A;  4WND A;  3PS6 A;  5JJ6 A;  4FAD A;  1S70 B;  4N3C A;  3FUJ A;  2AWI A;  4K5B A;  2ZIR A;  4J8F A;  3QWW A;  3Q5M A;  2A5E A;  3CVW A;  2EIL E;  2Y1L E;  3DSW A;  5JHA A;  4JEU A;  2PM6 A;  4G1T A;  4U0Z A;  3LY8 A;  3D9H A;  3KEZ A;  2C0M A;  3LEW A;  4DI3 A;  3NZU A;  4JEH A;  4I1O B;  5EYP F;  1E96 B;  3E37 A;  4HBD A;  1A5E A;  4ACK A;  4AP2 A;  1Y8M A;  4ILG A;  4KZ0 A;  3CK8 A;  4U96 D;  3V30 A;  2R2L A;  3ZU7 B;  2Y4T A;  3HYM B;  4Q94 A;  1HXI A;  1S0P A;  3JQ1 A;  2MHK A;  3QJZ A;  3FWV A;  4H7X A;  4JA7 A;  3G2S A;  3JUE A;  1D8E A;  2OVB A;  1TN6 A;  2XPI A;  1AP7 A;  3B7R L;  2DWZ A;  3QWV A;  3RKV A;  5ARF A;  3VLE A;  3ZKJ A;  2EIM E;  4CGV A;  1SZ9 A;  1HU3 A;  4OVV A;  3B7U X;  4CCA A;  3NB2 A;  4WWP A;  3IBE A;  1HO8 A;  1OWN A;  1FVH A;  2FI7 A;  4ZFH A;  2LSU A; 
#chains in the Genus database with same CATH homology
 3SFX A;  1S63 A;  3C72 A;  4GTO A;  3HXF A;  4GTS A;  1O1S A;  1QBQ A;  1SA4 A;  1DCE A;  3DSU A;  3Q7F A;  3Q73 A;  1LTX A;  1N94 A;  1O5M A;  2ZIR A;  1TN8 A;  4GTM A;  3PZ1 A;  4GTQ A;  3KSL A;  3E34 A;  1S64 A;  3EUV A;  3E33 A;  1KZP A;  1D8D A;  1NI1 A;  3DSW A;  3PZ4 A;  4GTR A;  1N95 A;  4MBG A;  3DSX A;  4LNG A;  2H6I A;  3HXD A;  3SFY A;  1FT1 A;  3E37 A;  3DST A;  2H6F A;  1JCR A;  4YDO A;  1MZC A;  4GTT A;  1SA5 A;  1JCS A;  3Q79 A;  2BED A;  2R2L A;  3DSS A;  1N4R A;  4GTV A;  2H6H A;  3HXB A;  1NL4 A;  1LD7 A;  3HXC A;  4LNB A;  2F0Y A;  3PZ2 A;  1TNZ A;  3E30 A;  4YDE A;  1JCQ A;  2ZIS A;  1O1T A;  1TNO A;  3PZ3 A;  1TNB A;  1D8E A;  1O1R A;  2H6G A;  1X81 A;  3E32 A;  1TN6 A;  1N4P A;  2IEJ A;  3KSQ A;  3Q75 A;  3HXE A;  4GTP A;  4L9P A;  3DPY A;  1TNU A;  1LD8 A;  3Q78 A;  1N4S A;  3EU5 A;  3DRA A;  1TNY A;  3Q7A A;  1FT2 A;  4EHM A;  1TN7 A;  1KZO A;  1N9A A;  1N4Q A;  1FPP A;  3DSV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...