3EU5A

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10) in complex with biotingpp
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Analysis of the eukaryotic prenylome by isoprenoid affinity tagging
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3eu5A00
3E32A 3HXDA 1N9AA 3PZ1A 1JCQA 4LNGA 1N4QA 1SA5A 1N4PA 3EU5A 3E37A 3E33A 3Q75A 4LNBA 2IEJA 1O5MA 1KZOA 4MBGA 3DSVA 1DCEA 3Q79A 1FT2A 3KSLA 4GTSA 2H6GA 3PZ4A 3DRAA 4GTQA 1JCSA 1QBQA 3Q7FA 4EHMA 3PZ3A 4L9PA 1TNBA 2H6HA 3E34A 4GTRA 1MZCA 1SA4A 2R2LA 4YDOA 2H6FA 3KSQA 1FPPA 1O1TA 1LD7A 1D8EA 4GTVA 4GTPA 3SFYA 1TNYA 3DSTA 3DSXA 1FT1A 3HXFA 1NI1A 1O1SA 3EUVA 1S64A 3DSUA 1TNUA 3PZ2A 1TN8A 1JCRA 3HXCA 3Q78A 2ZIRA 3C72A 1LTXA 1N4SA 1D8DA 1NL4A 1TNOA 3Q7AA 1N94A 3Q73A 2F0YA 1N4RA 3E30A 3HXBA 4GTMA 3DSWA 1TN6A 4YDEA 1O1RA 3DSSA 2BEDA 3SFXA 2ZISA 1TNZA 3DPYA 1N95A 1S63A 4GTOA 2H6IA 1LD8A 1X81A 1KZPA 3HXEA 1TN7A 4GTTA
chains in the Genus database with same CATH superfamily
2WVIA 4AV7A 2Y4UA 4EZKA 4G24A 1MX2A 3ZYLA 4U0ZA 3J5PA 3TG4A 3ML8A 1BI7B 3ULYA 4RVBA 3LEWA 3CHSA 1OCOE 1N4PA 3QK0A 1TYQG 2GGFA 3C3RA 2J09A 2XGOA 2VYIA 4LNBA 3TAXA 5FQ8A 3QOUA 2AWIA 5C1DA 4A1SA 1E8ZA 3ZXPA 3Q7FA 3UT8A 2OEVA 3B13A 4HXIA 5EYPF 4GTRA 5ENQD 2RKKA 3V31A 3G2UA 3RRMB 1E8XA 3CVQA 1K1BA 2KCVA 3OAWA 4J0UA 2QZAA 4EZJA 1N4SA 3JQ0A 5C2YA 5A6CA 3P1UA 5AQAA 2EIME 2ONDA 5JJ6A 4DX1A 3D9MA 2WXPA 2BEDA 2ZISA 2QYJA 4V3IA 1TJFA 3DPYA 4B0ZA 4ANUA 3ASHA 3TWUA 4G11A 4U0SA 2F8YA 1H6OA 4ILHB 1HXIA 2DZNA 1Y8MA 1E90A 3CEQA 4EBAA 4FJZA 5KWDA 2KZTB 2XGSA 2R03A 4Q96A 1OWPA 2I9CA 3CSFA 4JHKA 3CHOA 4A63B 2V5QC 2GRMA 1PC2A 5G05J 3V79K 2V4HC 4P29A 2WMOA 4MBGA 4ANWA 3JXIA 2NYJA 3PVLA 5H7PA 4FHJA 5EILA 4RQIA 3HVEA 3QJZA 3QDNA 2JLBA 2P9UG 1K1AA 1K8KG 3TWSA 2XEHA 2JABA 3DSTA 2IOLA 4N2SA 1JCRA 1JWFA 2OEWA 3UTMA 2FO7A 3QWWA 3IV0A 3B7RL 4XI9A 2J4BA 2P9KG 2KXPC 4QQIA 4GYWA 3SFXA 4AOFA 4H7YA 1TNZA 2PQNA 3L22A 1H2TC 2KBXA 3JQ1A 4R7LA 3AG4E 2J49A 3PE4A 3HXEA 5KJKA 4O1OA 2XPIA 4BESA 1HU3A 3SQVA 2P9PG 4GCOA 4U8HA 1BPOA 3LJNA 4U8YD 1U2VG 1H2VC 1ELWA 3EHNA 3E33A 5ARFA 1KLXA 4YVOA 4GZ3A 4IULA 1HF8A 2MOWA 2WXNA 3LCAA 2AXVA 3DRAA 1QYMA 4WNDA 3FUIA 3RAUA 3FUMA 2VJ8A 3RO3A 5EKQD 3ULEG 5BT1A 2Y1LE 3CVWA 5JHAA 1KPSB 3FH5A 1O1TA 2DBAA 4XIFA 3SFYA 1FT1A 4G26A 1MYOA 3UI2A 1NI1A 4F3VA 2BUGA 3MV2B 3FHEA 3DEOA 4FLHA 3FFLA 3C3OA 2XQ0A 4IRUA 4O1PA 4UWGA 1XGWA 2F0YA 1K3ZD 1TN6A 3DSWA 5A23A 3LJ3A 3RRUA 4J8DA 4J8EA 4NRHB 3EHMA 3R7RA 2VSNA 1FCHA 3FWVA 4YDWA 4N3BA 3SZ7A 3PE3A 3CVNA 2C2LA 3L82A 1SZ9A 1N0QA 2IFUA 2VSXE 2IQCA 4AJWA 3ZYMA 3T5XA 4CDNA 4L7TA 2DCPA 4K5BA 4BX9A 1U3CA 5DIZA 4JC8A 3PS6A 3QKYA 2X6FA 1BLXB 1MX6A 2OVBA 2YHEA 2Y0BG 3TWRA 3CLJA 4BETA 2UY1B 3PREA 2WXQA 3TXMA 4GCNA 3Q9UC 1ZB1A 5HKPA 1DCQA 3HRAA 2VSOE 3ML9A 3SHFA 1V54E 2DZOA 5LCWJ 3CVYA 2XPZA 3AS8A 1H6KA 3L9TA 5JJ7A 3LVQE 3UIPC 2ZIRA 3C72A 3IXEA 5ENRD 5G55A 2BF0X 1TNOA 1NA3A 3ZHEA 5AARA 2J08A 3LY9A 1Z3YA 2IF4A 4FJYA 1AP7A 3BG0B 4HRMB 4J8SA 2WXMA 3C3QA 3JXJA 4ILGA 3DSSA 3W9FA 4BWRA 1QZ2A 2L0TB 2J8SD 2R59A 2F8XK 2PM6A 4KMOA 3SY2A 1KZPA 3T9KA 1TN7A 3AS5A 3SD5A 4FADA 2CHXA 4MRUA 4UWFA 3FUDA 1E96B 2NSZA 3I3NA 2VGXA 2LXLA 4NIKA 4I2WA 2IONA 3CVUA 4O6FA 3AG3E 4BTBA 2VGYA 2WPVA 2CG2A 3ESKA 4KT6B 4KBQA 2J9QA 1FT2A 3KSLA 2ZU6B 5HQ8A 4F7AA 4U95D 2ZGGA 4DLQA 1ZU2A 3JUIA 5CCLA 2CFUA 4N3CA 2XGMA 3X2QE 3V2OA 3I4RB 3TXNA 2E0IA 1E7UA 5KNGA 3ASNE 3R9AB 3MZLB 5FJYA 5IY5E 3ZYKA 4HOSA 3LYAA 4LERA 5CMYA 5LX8A 3PZ2A 2LXMA 3FUJA 5ANLA 1N94A 3VTXA 4GZ5A 4DRXE 3ASGA 4TXPA 2QYUA 3KAEA 3R9MA 4RG6A 1EDUA 2X3MA 3IEGA 1JPLA 4KZCA 2XS8A 2ZGDA 3WG7E 3IHYA 2WXIA 3O4ZA 3Q49B 2R17C 5HS0A 1INZA 1L5JA 5JJTA 1IYGA 4BT8A 2PNNA 2X6JA 2L6BA 2QY7A 5FT9A 3HIZA 4AEZC 3L13A 2J07A 3EHRA 1IQUA 5EIBE 5D66A 3Q15A 4MLPA 1WM5A 1OY3D 4OYSA 1Z3XA 4LUNU 1WG0A 2GROB 4RG9A 2OV8A 3Q79A 4WNEA 1S70B 4HLEA 4CDMA 3CSTA 2J4DA 4UI9C 4HBDA 1BU9A 2R2LA 2BTDA 4L2YA 3TL5A 3ABME 3ONKA 4M7CA 3U64A 1HZ4A 4JB8P 5BV1A 3Q78A 3UPVA 4JEHA 2XHEA 4HLLA 3ASOE 3LXUX 1NZNA 5KJNA 3RSEG 1SW6A 4K03A 2ZXWE 3HXBA 4GTMA 1OWMA 3RRNB 4EZLA 2A4ZA 4ATGA 2IU1A 3GZ1A 3I5PA 4LEUA 2DYSE 4UI9J 3CK7A 1X81A 3RK6A 4GPKA 4AY5A 2MYOA 4K5CA 1UG3A 3FUHA 2Y3AA 3JUEA 4AXHA 5AIJA 2QFCA 3ZPJA 4ZHBA 5AYWD 4I9EA 4YVQC 2EILE 3HG0D 5D0QD 3FUNA 3UT4A 3QWPA 4EBAG 3PUKA 3LKUA 3CIAA 5FQ7A 1JWGA 2GRRB 2FEZA 1S0PA 1OXJA 2RG8A 3SI5A 4OAVB 3I4GA 3NAWA 1MZCA 3TWTA 1IHGA 1WAO1 5FZSA 2L9BA 3CK9A 1TNYA 4XE0A 2C0LA 1S64A 3TWQA 5BV0A 3RKVA 2XPYA 1ELKA 4YNDA 4G8KA 1MQSA 3SO8A 1N0RA 1FVHA 2LSUA 3UKRG 4KYOB 3BU8A 3G2TA 1MJ0A 4BY6A 4DJAA 4ANVA 3CR3A 4ANXA 5ENSD 4XKBA 2EINE 1OWLA 2A5EA 3APCA 5AN8A 4APOA 2RFMA 5CRUA 4M3OA 4GMRA 4PS8A 3PEUB 2WMNA 4J8YA 4QFVA 1OWNA 3R7QA 3MEKA 4HI8A 4EECA 3CK8A 3G2SA 1N4QA 4YDYA 1SA5A 1X5BA 3EU5A 4BFRA 5CRVA 3CHRA 4U7EB 3Q5MA 4OAUC 1O5MA 1V55E 3ABKE 1N52A 4B8AA 3PZ3A 3ZRHA 3NBNB 3FTZA 3APDA 3PUJA 2FBNA 1FPPA 2HYZA 1SQMA 4N39A 3DWLG 1IQRA 1HS6A 4UQXA 2GRQB 1LTXA 5EYLA 4L23A 5CERB 5AQBA 3D9NA 2AJAA 2IO2C 4U96D 2YNQA 3B7SA 4CGVA 3LVRE 4Q69A 1PAQA 2V0PA 3UMVA 2X38A 4I2ZA 2HO1A 3DBSA 1NFIE 2I2OA 4B8CB 4ATZD 3FEXA 3RU0A 3BG1B 1Z6TA 1Z5SC 3Q47B 3MGBA 4TUMA 4RSYA 2R5SA 2UY1A 2ILRA 3PZ1A 2ETAA 1HG2A 5FQ6A 3EIJA 4N5CA 3UXGA 2WXRA 1UW4B 3URZA 1YA0A 1D9SA 4LG6A 2R05A 5D2MC 1E7VA 1OCCE 5AENA 2WXHA 4G1TA 1E8WA 3ZHEB 5BUZA 3V30A 3BUAA 4B89A 2GRLA 1JCSA 1QBQA 4EHMA 1VDYA 5G05C 5CMWA 3E34A 1HG5A 4PH4B 5BW8C 3CGHA 3ONLA 5B3SE 1KT0A 2XRZA 1D8EA 1HE8A 3DSXA 1XNFA 2HM8A 5JHBA 1TN8A 2Q7FA 3FUKA 2HR2A 1N11A 3WXXA 1H6PA 3VTYA 4F1SA 2VGXB 5FZQA 3CVVA 3UM1A 3SBSA 5ENTD 4DUIA 4FU3A 1O1RA 2WXKA 3N71A 3L54A 3HYMB 3ZFWA 4LCTA 5T4YA 1N95A 4ACKA 4JXTA 1S63A 1IXVA 5CBNA 1HX8A 1RW2A 4Q94A 4GZCA 4AIFA 3RIBA 4KVOA 3OXFA 2PM7A 1OT8A 1DNPA 4G25A 4J8FA 4CZ2D 5KBAA 2LNIA 3DXKG 1JCQA 2JEKA 3NB2A 3PEVB 3CKBA 2V5FA 3QC1A 4I6EA 4G23A 2MHKA 3FTWA 3AAAC 3TGOA 4BT9A 3CQCB 1BI8B 1KZOA 2AW6A 2EIJE 4ZFHA 3BQOA 4HQDA 2X6KA 2IJGX 2WXGA 4TV3A 2L0IA 2WXJA 3NQPA 1B89A 4DX6D 1TR4A 4I6GA 2C0MA 3CKCA 2F37A 2H6FA 1NP7A 3SFZA 2EIKE 3KEAA 3UT7A 1O1SA 1SVXA 4GB9A 4BSXA 4U0UA 1D8DA 2CFZA 3AU5A 4GA1A 3LY8A 5FINA 3U9WA 5LFAA 4HFGA 3IKOB 4F1PA 2B6CA 3FTXA 4CRWA 3JCKC 5HRYA 3E30A 5E75A 5FQ4A 3ASFA 3LY7A 2AVPA 4E6HA 3D9KA 2H6IA 5EIDA 3FU5A 4A3TA 3L16A 2P9LG 1NA0A 2XS1A 5G04C 4DK5A 3RJVA 3OTNA 5LCWC 3FTUA 5B1AE 3UM3A 2XRYA 4BX8A 4FP7A 2EQXA 2PL2A 3C98A 3PZDA 5EX0A 4UWKA 4CGWA 5T8IA 3PDNA 1WY6A 3E37A 3ZYQA 4FLBA 5AQ7A 1ELRA 5BXUA 4IYPA 4JEUA 3DSVA 1DCEA 1Q2ZA 3L6AA 2WQ6A 2DIWA 5FZRA 3S7FA 3NZUA 4AM9A 3APFA 3DXMG 5KJLA 2LAHA 2WXOA 5FIOA 4A1GA 2NC9A 3NZSA 3FU0A 3NF1A 4LNUD 4BSZB 1YCSB 3OXLA 3GZ2A 3ZNGA 4ME2A 1TNUA 4DPRA 3U4TA 4ABNA 1EPUA 3AS4A 2B0OE 4TXQA 3D9OA 4I6JA 2GRNB 3MV3B 4CYMD 3Q7AA 2XZDG 5AJLA 4L1BA 2KCLA 1SZAA 4I17A 5G2NA 4GAAA 2GRPB 3D9LA 1OCRE 3CVXA 3O48A 1WDYA 3ESLA 1TEZA 3KEZA 4FHKA 4EPZA 3PNTB 5CEDB 1LD8A 5J90A 4EQFA 4GTTA 3Q4AB 4XI0A 5ENPD 4BTAA 4C0EA 2IY0C 3TJPA 1OWOA 4KVMA 4U8VD 3FU6A 4I1AA 4LNGA 3ZUVB 3TWXA 3IBEA 2FF4A 4WWNA 1TJCA 2QC9A 3ZEFA 3Q75A 2XCCA 5ARGA 2VTBA 1QQEA 3T5VA 3MKQB 3ZW3A 3ISMC 2FI7A 3DPDA 4G2VA 4DX7D 1IHBA 5EN5D 4L9PA 3CQGB 3F6QA 5AJDA 3MCXA 3SGHA 1UN9A 2WQHA 3UIOC 1LD7A 4U63A 4GTPA 2R02A 3HXFA 2KM4A 4MKTA 4NURA 1A17A 4F53A 3CHQA 1HH8A 2KATA 3HHMA 3EU9A 3AG2E 3AU4A 2RD0A 3B7TA 1KT1A 3SBTB 5ITZF 3BEEA 3P2BA 1A5EA 2XEVA 4BEPA 4URKA 5CBOA 3UINC 3GYZA 2VGEA 4WWPA 3FUFA 2FULA 1HO8A 3UUXA 4CDRA 3C5RA 1DC2A 3D3MA 4BERA 3CHPA 4CEMA 4FA6A 2WB2A 2DYRE 1DVPA 5KJMA 5KCMA 3MX3A 5AQ9A 3NOGD 3ZU7B 3ULQA 4C9BB 3NOCD 3ZVVA 1H2UA 4I43A 3UM2A 3B7BA 4WAFA 2OCCE 4HOQA 5D0OD 3ZIMA 1PY1A 3FTSA 5BXOA 2IEJA 3UX4A 2LO6A 1QNFA 4DX5D 5JMND 1E8YA 2DWZA 5ENOD 4GTQA 2XCBA 4TXRA 2CHWA 4A3VA 1EF1C 2KZTA 3FU3A 3ABLE 3PRZA 2WXFA 4OVUA 4UUCA 3MYVA 4KZ0A 4PS3A 2WQ7A 4ACLA 3CV0A 3EDTB 3DSUA 3TWVA 2IOSA 3FTYA 1YMPA 3S7JA 3EIQC 2XENA 2CHZA 4RLYA 3UQ3A 2CG3A 1NL4A 4GZ6A 1FVFA 4DX2A 3SF4A 4WNFA 4FC8A 5ENNA 3UM0A 3HDXA 4LRZA 4TRQA 1H19A 4Y6CA 4JHJA 1N4RA 1EYHA 5KNHD 3FH7A 1JUQA 4MS6A 2V4LA 4LSZE 3HVEB 2YQ8A 4GYOA 4AVXA 4GA0A 3D9IA 5EX3A 4JHRA 4AY6A 3OXGA 4HB5A 3FH8A 3S2AA 4JL0A 4JZYA 5ANRA 4NQ0A 4PDXA 3E32A 3HXDA 2V8SE 4OVVA 3S7BA 4NACA 2I1KA 4A55A 3LDZA 2WXLA 2OVFA 5M72A 4U07A 3VLEA 3IHVA 3G2VA 5AAOA 3MKRA 4G8LA 3GZSA 3JYSA 1LF8A 4JW1A 5J08A 4UQZA 3EJNA 4XX5A 3ZGQA 4CT0A 4HI9A 3FEYA 1RZ4A 5CEAA 1GW6A 1UN8A 2H6GA 3W9GA 1YYHA 2LSVA 2YINA 4DI4A 5B1BE 2NXPA 4GA2A 4W9RA 1TNBA 5E76A 4HVBA 3G2WA 1W3BA 3MJWA 1SA4A 2Y4TA 4YDOA 3EHQA 2P9SG 4JD2G 1IKND 2YHCA 4HS2A 4HORA 3DEPA 3D9PA 4HOTA 4KXKB 3FP3A 4UI9K 4WNGA 4HRNA 4TUUA 3D9JA 4CT4A 2A5UA 3Q73A 2X6IA 2LUHA 4JPSA 5CHEE 5T3RA 2KC7A 4WWOA 2BKKB 3AJIA 4U04A 3S7DA 3UKUG 3TG5A 1OCZE 2WM9A 4N3AA 2KCKA 3PH0C 2ETBA 1ZBPA 5BNWA 4J7WA 4E85A 3U66A 2I1JA 4C48B 4B93B 4I1OB 4N5QA 3V2XA 4CCAA 1N9AA 2XEEA 4K5AB 2PZIA 3FDHA 4JA7A 3AG1E 3QB2A 1Y6IA 3LPZA 3D9HA 1UJJA 3ZXSA 1U3DA 3ENEA 4B94A 3B95A 4O60A 1UJKA 4GPMA 4WUYA 3TWWA 4K0RA 3KD7A 1G3NB 4UWLA 4GTSA 3PZ4A 4DI3A 3L08A 4D10C 2H6HA 2M63A 5G04J 3B7UX 2OOEA 4UQYA 3VLDA 4L2LA 3LS8A 4HNAD 4GTVA 2E2EA 4GZDA 1H0AA 5EDSA 3CHMA 4XEIG 2P2CP 2RFAA 4GMJA 3J5QB 4AP2A 3FY4A 5DBKA 4H7XA 3Q9NC 1P5QA 4YDEA 1AWCB 2FO1E 4GYYA 4UWHA 5FWQA 4APFA 2GW1A 4GTOA 2AXUA 4N2QA 3QWVA 5FTPA 3CVPA 2ETCA 4J6IA 3T8MA 4GU5A 4I9CA 1UOHA 3KS2A 4DLOA 3FULA 3QNKA 3U3WA 3ASDA 2VSYA 2PQRA 1MX4A 3SNXA 2HE0A 4F6RD 2I6HA 4JA9A 3FUEA 4XZ4A 2L6JA 3RO2A 2LAIA 2MRIA 4ILIA 2BKGA 5A7DB 2AXZA 3FTVA 2Y69E 3QAQA 5BPPA 2VQ2A 4HOUA 3MA5A 1N54A 4IN3B 1OUVA 4C0MA 5CCMA 2IO3C 2UWJG 4JVSA 5JA4D 3KSQA 3PNLB 3ZKJA 3VLFA 3GW4A 2P9NG 3EUVA 3E4BA 3HXCA 2P9IG 5HI7A 4PS7A 3T8KA 4GMLA 5CECB 2X6HA 4Z68A 4X8QA 4FULA 1MHQA 3K9IA 4XKCA 5LOZA 5LP0A 4HRLA 2XZTG 4Y6WA 3ZN3A 2DVWA 1HFAA 2P58C 4PUCA 1BD8A 3CVLA 3QARA 2VTBB 3MKQA 4I1MA 3L17A
chains in the Genus database with same CATH topology
3E32A 3HXDA 1N9AA 3PZ1A 1JCQA 4LNGA 1N4QA 1SA5A 1N4PA 3EU5A 3E37A 3E33A 3Q75A 4LNBA 2IEJA 1O5MA 1KZOA 4MBGA 3DSVA 1DCEA 3Q79A 1FT2A 3KSLA 4GTSA 2H6GA 3PZ4A 3DRAA 4GTQA 1JCSA 1QBQA 3Q7FA 4EHMA 3PZ3A 4L9PA 1TNBA 2H6HA 3E34A 4GTRA 1MZCA 1SA4A 2R2LA 4YDOA 2H6FA 3KSQA 1FPPA 1O1TA 1LD7A 1D8EA 4GTVA 4GTPA 3SFYA 1TNYA 3DSTA 3DSXA 1FT1A 3HXFA 1NI1A 1O1SA 3EUVA 1S64A 3DSUA 1TNUA 3PZ2A 1TN8A 1JCRA 3HXCA 3Q78A 2ZIRA 3C72A 1LTXA 1N4SA 1D8DA 1NL4A 1TNOA 3Q7AA 1N94A 3Q73A 2F0YA 1N4RA 3E30A 3HXBA 4GTMA 3DSWA 1TN6A 4YDEA 1O1RA 3DSSA 2BEDA 3SFXA 2ZISA 1TNZA 3DPYA 1N95A 1S63A 4GTOA 2H6IA 1LD8A 1X81A 1KZPA 3HXEA 1TN7A 4GTTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E32 A;  3HXD A;  1N9A A;  3PZ1 A;  1JCQ A;  4LNG A;  1N4Q A;  1SA5 A;  1N4P A;  3EU5 A;  3E37 A;  3E33 A;  3Q75 A;  4LNB A;  2IEJ A;  1O5M A;  1KZO A;  4MBG A;  3DSV A;  1DCE A;  3Q79 A;  1FT2 A;  3KSL A;  4GTS A;  2H6G A;  3PZ4 A;  3DRA A;  4GTQ A;  1JCS A;  1QBQ A;  3Q7F A;  4EHM A;  3PZ3 A;  4L9P A;  1TNB A;  2H6H A;  3E34 A;  4GTR A;  1MZC A;  1SA4 A;  2R2L A;  4YDO A;  2H6F A;  3KSQ A;  1FPP A;  1O1T A;  1LD7 A;  1D8E A;  4GTV A;  4GTP A;  3SFY A;  1TNY A;  3DST A;  3DSX A;  1FT1 A;  3HXF A;  1NI1 A;  1O1S A;  3EUV A;  1S64 A;  3DSU A;  1TNU A;  3PZ2 A;  1TN8 A;  1JCR A;  3HXC A;  3Q78 A;  2ZIR A;  3C72 A;  1LTX A;  1N4S A;  1D8D A;  1NL4 A;  1TNO A;  3Q7A A;  1N94 A;  3Q73 A;  2F0Y A;  1N4R A;  3E30 A;  3HXB A;  4GTM A;  3DSW A;  1TN6 A;  4YDE A;  1O1R A;  3DSS A;  2BED A;  3SFX A;  2ZIS A;  1TNZ A;  3DPY A;  1N95 A;  1S63 A;  4GTO A;  2H6I A;  1LD8 A;  1X81 A;  1KZP A;  3HXE A;  1TN7 A;  4GTT A; 
#chains in the Genus database with same CATH topology
 2WVI A;  4AV7 A;  2Y4U A;  4EZK A;  4G24 A;  1MX2 A;  3ZYL A;  4U0Z A;  3J5P A;  3TG4 A;  3ML8 A;  1BI7 B;  3ULY A;  4RVB A;  3LEW A;  3CHS A;  1OCO E;  1N4P A;  3QK0 A;  1TYQ G;  2GGF A;  3C3R A;  2J09 A;  2XGO A;  2VYI A;  4LNB A;  3TAX A;  5FQ8 A;  3QOU A;  2AWI A;  5C1D A;  4A1S A;  1E8Z A;  3ZXP A;  3Q7F A;  3UT8 A;  2OEV A;  3B13 A;  4HXI A;  5EYP F;  4GTR A;  5ENQ D;  2RKK A;  3V31 A;  3G2U A;  3RRM B;  1E8X A;  3CVQ A;  1K1B A;  2KCV A;  3OAW A;  4J0U A;  2QZA A;  4EZJ A;  1N4S A;  3JQ0 A;  5C2Y A;  5A6C A;  3P1U A;  5AQA A;  2EIM E;  2OND A;  5JJ6 A;  4DX1 A;  3D9M A;  2WXP A;  2BED A;  2ZIS A;  2QYJ A;  4V3I A;  1TJF A;  3DPY A;  4B0Z A;  4ANU A;  3ASH A;  3TWU A;  4G11 A;  4U0S A;  2F8Y A;  1H6O A;  4ILH B;  1HXI A;  2DZN A;  1Y8M A;  1E90 A;  3CEQ A;  4EBA A;  4FJZ A;  5KWD A;  2KZT B;  2XGS A;  2R03 A;  4Q96 A;  1OWP A;  2I9C A;  3CSF A;  4JHK A;  3CHO A;  4A63 B;  2V5Q C;  2GRM A;  1PC2 A;  5G05 J;  3V79 K;  2V4H C;  4P29 A;  2WMO A;  4MBG A;  4ANW A;  3JXI A;  2NYJ A;  3PVL A;  5H7P A;  4FHJ A;  5EIL A;  4RQI A;  3HVE A;  3QJZ A;  3QDN A;  2JLB A;  2P9U G;  1K1A A;  1K8K G;  3TWS A;  2XEH A;  2JAB A;  3DST A;  2IOL A;  4N2S A;  1JCR A;  1JWF A;  2OEW A;  3UTM A;  2FO7 A;  3QWW A;  3IV0 A;  3B7R L;  4XI9 A;  2J4B A;  2P9K G;  2KXP C;  4QQI A;  4GYW A;  3SFX A;  4AOF A;  4H7Y A;  1TNZ A;  2PQN A;  3L22 A;  1H2T C;  2KBX A;  3JQ1 A;  4R7L A;  3AG4 E;  2J49 A;  3PE4 A;  3HXE A;  5KJK A;  4O1O A;  2XPI A;  4BES A;  1HU3 A;  3SQV A;  2P9P G;  4GCO A;  4U8H A;  1BPO A;  3LJN A;  4U8Y D;  1U2V G;  1H2V C;  1ELW A;  3EHN A;  3E33 A;  5ARF A;  1KLX A;  4YVO A;  4GZ3 A;  4IUL A;  1HF8 A;  2MOW A;  2WXN A;  3LCA A;  2AXV A;  3DRA A;  1QYM A;  4WND A;  3FUI A;  3RAU A;  3FUM A;  2VJ8 A;  3RO3 A;  5EKQ D;  3ULE G;  5BT1 A;  2Y1L E;  3CVW A;  5JHA A;  1KPS B;  3FH5 A;  1O1T A;  2DBA A;  4XIF A;  3SFY A;  1FT1 A;  4G26 A;  1MYO A;  3UI2 A;  1NI1 A;  4F3V A;  2BUG A;  3MV2 B;  3FHE A;  3DEO A;  4FLH A;  3FFL A;  3C3O A;  2XQ0 A;  4IRU A;  4O1P A;  4UWG A;  1XGW A;  2F0Y A;  1K3Z D;  1TN6 A;  3DSW A;  5A23 A;  3LJ3 A;  3RRU A;  4J8D A;  4J8E A;  4NRH B;  3EHM A;  3R7R A;  2VSN A;  1FCH A;  3FWV A;  4YDW A;  4N3B A;  3SZ7 A;  3PE3 A;  3CVN A;  2C2L A;  3L82 A;  1SZ9 A;  1N0Q A;  2IFU A;  2VSX E;  2IQC A;  4AJW A;  3ZYM A;  3T5X A;  4CDN A;  4L7T A;  2DCP A;  4K5B A;  4BX9 A;  1U3C A;  5DIZ A;  4JC8 A;  3PS6 A;  3QKY A;  2X6F A;  1BLX B;  1MX6 A;  2OVB A;  2YHE A;  2Y0B G;  3TWR A;  3CLJ A;  4BET A;  2UY1 B;  3PRE A;  2WXQ A;  3TXM A;  4GCN A;  3Q9U C;  1ZB1 A;  5HKP A;  1DCQ A;  3HRA A;  2VSO E;  3ML9 A;  3SHF A;  1V54 E;  2DZO A;  5LCW J;  3CVY A;  2XPZ A;  3AS8 A;  1H6K A;  3L9T A;  5JJ7 A;  3LVQ E;  3UIP C;  2ZIR A;  3C72 A;  3IXE A;  5ENR D;  5G55 A;  2BF0 X;  1TNO A;  1NA3 A;  3ZHE A;  5AAR A;  2J08 A;  3LY9 A;  1Z3Y A;  2IF4 A;  4FJY A;  1AP7 A;  3BG0 B;  4HRM B;  4J8S A;  2WXM A;  3C3Q A;  3JXJ A;  4ILG A;  3DSS A;  3W9F A;  4BWR A;  1QZ2 A;  2L0T B;  2J8S D;  2R59 A;  2F8X K;  2PM6 A;  4KMO A;  3SY2 A;  1KZP A;  3T9K A;  1TN7 A;  3AS5 A;  3SD5 A;  4FAD A;  2CHX A;  4MRU A;  4UWF A;  3FUD A;  1E96 B;  2NSZ A;  3I3N A;  2VGX A;  2LXL A;  4NIK A;  4I2W A;  2ION A;  3CVU A;  4O6F A;  3AG3 E;  4BTB A;  2VGY A;  2WPV A;  2CG2 A;  3ESK A;  4KT6 B;  4KBQ A;  2J9Q A;  1FT2 A;  3KSL A;  2ZU6 B;  5HQ8 A;  4F7A A;  4U95 D;  2ZGG A;  4DLQ A;  1ZU2 A;  3JUI A;  5CCL A;  2CFU A;  4N3C A;  2XGM A;  3X2Q E;  3V2O A;  3I4R B;  3TXN A;  2E0I A;  1E7U A;  5KNG A;  3ASN E;  3R9A B;  3MZL B;  5FJY A;  5IY5 E;  3ZYK A;  4HOS A;  3LYA A;  4LER A;  5CMY A;  5LX8 A;  3PZ2 A;  2LXM A;  3FUJ A;  5ANL A;  1N94 A;  3VTX A;  4GZ5 A;  4DRX E;  3ASG A;  4TXP A;  2QYU A;  3KAE A;  3R9M A;  4RG6 A;  1EDU A;  2X3M A;  3IEG A;  1JPL A;  4KZC A;  2XS8 A;  2ZGD A;  3WG7 E;  3IHY A;  2WXI A;  3O4Z A;  3Q49 B;  2R17 C;  5HS0 A;  1INZ A;  1L5J A;  5JJT A;  1IYG A;  4BT8 A;  2PNN A;  2X6J A;  2L6B A;  2QY7 A;  5FT9 A;  3HIZ A;  4AEZ C;  3L13 A;  2J07 A;  3EHR A;  1IQU A;  5EIB E;  5D66 A;  3Q15 A;  4MLP A;  1WM5 A;  1OY3 D;  4OYS A;  1Z3X A;  4LUN U;  1WG0 A;  2GRO B;  4RG9 A;  2OV8 A;  3Q79 A;  4WNE A;  1S70 B;  4HLE A;  4CDM A;  3CST A;  2J4D A;  4UI9 C;  4HBD A;  1BU9 A;  2R2L A;  2BTD A;  4L2Y A;  3TL5 A;  3ABM E;  3ONK A;  4M7C A;  3U64 A;  1HZ4 A;  4JB8 P;  5BV1 A;  3Q78 A;  3UPV A;  4JEH A;  2XHE A;  4HLL A;  3ASO E;  3LXU X;  1NZN A;  5KJN A;  3RSE G;  1SW6 A;  4K03 A;  2ZXW E;  3HXB A;  4GTM A;  1OWM A;  3RRN B;  4EZL A;  2A4Z A;  4ATG A;  2IU1 A;  3GZ1 A;  3I5P A;  4LEU A;  2DYS E;  4UI9 J;  3CK7 A;  1X81 A;  3RK6 A;  4GPK A;  4AY5 A;  2MYO A;  4K5C A;  1UG3 A;  3FUH A;  2Y3A A;  3JUE A;  4AXH A;  5AIJ A;  2QFC A;  3ZPJ A;  4ZHB A;  5AYW D;  4I9E A;  4YVQ C;  2EIL E;  3HG0 D;  5D0Q D;  3FUN A;  3UT4 A;  3QWP A;  4EBA G;  3PUK A;  3LKU A;  3CIA A;  5FQ7 A;  1JWG A;  2GRR B;  2FEZ A;  1S0P A;  1OXJ A;  2RG8 A;  3SI5 A;  4OAV B;  3I4G A;  3NAW A;  1MZC A;  3TWT A;  1IHG A;  1WAO 1;  5FZS A;  2L9B A;  3CK9 A;  1TNY A;  4XE0 A;  2C0L A;  1S64 A;  3TWQ A;  5BV0 A;  3RKV A;  2XPY A;  1ELK A;  4YND A;  4G8K A;  1MQS A;  3SO8 A;  1N0R A;  1FVH A;  2LSU A;  3UKR G;  4KYO B;  3BU8 A;  3G2T A;  1MJ0 A;  4BY6 A;  4DJA A;  4ANV A;  3CR3 A;  4ANX A;  5ENS D;  4XKB A;  2EIN E;  1OWL A;  2A5E A;  3APC A;  5AN8 A;  4APO A;  2RFM A;  5CRU A;  4M3O A;  4GMR A;  4PS8 A;  3PEU B;  2WMN A;  4J8Y A;  4QFV A;  1OWN A;  3R7Q A;  3MEK A;  4HI8 A;  4EEC A;  3CK8 A;  3G2S A;  1N4Q A;  4YDY A;  1SA5 A;  1X5B A;  3EU5 A;  4BFR A;  5CRV A;  3CHR A;  4U7E B;  3Q5M A;  4OAU C;  1O5M A;  1V55 E;  3ABK E;  1N52 A;  4B8A A;  3PZ3 A;  3ZRH A;  3NBN B;  3FTZ A;  3APD A;  3PUJ A;  2FBN A;  1FPP A;  2HYZ A;  1SQM A;  4N39 A;  3DWL G;  1IQR A;  1HS6 A;  4UQX A;  2GRQ B;  1LTX A;  5EYL A;  4L23 A;  5CER B;  5AQB A;  3D9N A;  2AJA A;  2IO2 C;  4U96 D;  2YNQ A;  3B7S A;  4CGV A;  3LVR E;  4Q69 A;  1PAQ A;  2V0P A;  3UMV A;  2X38 A;  4I2Z A;  2HO1 A;  3DBS A;  1NFI E;  2I2O A;  4B8C B;  4ATZ D;  3FEX A;  3RU0 A;  3BG1 B;  1Z6T A;  1Z5S C;  3Q47 B;  3MGB A;  4TUM A;  4RSY A;  2R5S A;  2UY1 A;  2ILR A;  3PZ1 A;  2ETA A;  1HG2 A;  5FQ6 A;  3EIJ A;  4N5C A;  3UXG A;  2WXR A;  1UW4 B;  3URZ A;  1YA0 A;  1D9S A;  4LG6 A;  2R05 A;  5D2M C;  1E7V A;  1OCC E;  5AEN A;  2WXH A;  4G1T A;  1E8W A;  3ZHE B;  5BUZ A;  3V30 A;  3BUA A;  4B89 A;  2GRL A;  1JCS A;  1QBQ A;  4EHM A;  1VDY A;  5G05 C;  5CMW A;  3E34 A;  1HG5 A;  4PH4 B;  5BW8 C;  3CGH A;  3ONL A;  5B3S E;  1KT0 A;  2XRZ A;  1D8E A;  1HE8 A;  3DSX A;  1XNF A;  2HM8 A;  5JHB A;  1TN8 A;  2Q7F A;  3FUK A;  2HR2 A;  1N11 A;  3WXX A;  1H6P A;  3VTY A;  4F1S A;  2VGX B;  5FZQ A;  3CVV A;  3UM1 A;  3SBS A;  5ENT D;  4DUI A;  4FU3 A;  1O1R A;  2WXK A;  3N71 A;  3L54 A;  3HYM B;  3ZFW A;  4LCT A;  5T4Y A;  1N95 A;  4ACK A;  4JXT A;  1S63 A;  1IXV A;  5CBN A;  1HX8 A;  1RW2 A;  4Q94 A;  4GZC A;  4AIF A;  3RIB A;  4KVO A;  3OXF A;  2PM7 A;  1OT8 A;  1DNP A;  4G25 A;  4J8F A;  4CZ2 D;  5KBA A;  2LNI A;  3DXK G;  1JCQ A;  2JEK A;  3NB2 A;  3PEV B;  3CKB A;  2V5F A;  3QC1 A;  4I6E A;  4G23 A;  2MHK A;  3FTW A;  3AAA C;  3TGO A;  4BT9 A;  3CQC B;  1BI8 B;  1KZO A;  2AW6 A;  2EIJ E;  4ZFH A;  3BQO A;  4HQD A;  2X6K A;  2IJG X;  2WXG A;  4TV3 A;  2L0I A;  2WXJ A;  3NQP A;  1B89 A;  4DX6 D;  1TR4 A;  4I6G A;  2C0M A;  3CKC A;  2F37 A;  2H6F A;  1NP7 A;  3SFZ A;  2EIK E;  3KEA A;  3UT7 A;  1O1S A;  1SVX A;  4GB9 A;  4BSX A;  4U0U A;  1D8D A;  2CFZ A;  3AU5 A;  4GA1 A;  3LY8 A;  5FIN A;  3U9W A;  5LFA A;  4HFG A;  3IKO B;  4F1P A;  2B6C A;  3FTX A;  4CRW A;  3JCK C;  5HRY A;  3E30 A;  5E75 A;  5FQ4 A;  3ASF A;  3LY7 A;  2AVP A;  4E6H A;  3D9K A;  2H6I A;  5EID A;  3FU5 A;  4A3T A;  3L16 A;  2P9L G;  1NA0 A;  2XS1 A;  5G04 C;  4DK5 A;  3RJV A;  3OTN A;  5LCW C;  3FTU A;  5B1A E;  3UM3 A;  2XRY A;  4BX8 A;  4FP7 A;  2EQX A;  2PL2 A;  3C98 A;  3PZD A;  5EX0 A;  4UWK A;  4CGW A;  5T8I A;  3PDN A;  1WY6 A;  3E37 A;  3ZYQ A;  4FLB A;  5AQ7 A;  1ELR A;  5BXU A;  4IYP A;  4JEU A;  3DSV A;  1DCE A;  1Q2Z A;  3L6A A;  2WQ6 A;  2DIW A;  5FZR A;  3S7F A;  3NZU A;  4AM9 A;  3APF A;  3DXM G;  5KJL A;  2LAH A;  2WXO A;  5FIO A;  4A1G A;  2NC9 A;  3NZS A;  3FU0 A;  3NF1 A;  4LNU D;  4BSZ B;  1YCS B;  3OXL A;  3GZ2 A;  3ZNG A;  4ME2 A;  1TNU A;  4DPR A;  3U4T A;  4ABN A;  1EPU A;  3AS4 A;  2B0O E;  4TXQ A;  3D9O A;  4I6J A;  2GRN B;  3MV3 B;  4CYM D;  3Q7A A;  2XZD G;  5AJL A;  4L1B A;  2KCL A;  1SZA A;  4I17 A;  5G2N A;  4GAA A;  2GRP B;  3D9L A;  1OCR E;  3CVX A;  3O48 A;  1WDY A;  3ESL A;  1TEZ A;  3KEZ A;  4FHK A;  4EPZ A;  3PNT B;  5CED B;  1LD8 A;  5J90 A;  4EQF A;  4GTT A;  3Q4A B;  4XI0 A;  5ENP D;  4BTA A;  4C0E A;  2IY0 C;  3TJP A;  1OWO A;  4KVM A;  4U8V D;  3FU6 A;  4I1A A;  4LNG A;  3ZUV B;  3TWX A;  3IBE A;  2FF4 A;  4WWN A;  1TJC A;  2QC9 A;  3ZEF A;  3Q75 A;  2XCC A;  5ARG A;  2VTB A;  1QQE A;  3T5V A;  3MKQ B;  3ZW3 A;  3ISM C;  2FI7 A;  3DPD A;  4G2V A;  4DX7 D;  1IHB A;  5EN5 D;  4L9P A;  3CQG B;  3F6Q A;  5AJD A;  3MCX A;  3SGH A;  1UN9 A;  2WQH A;  3UIO C;  1LD7 A;  4U63 A;  4GTP A;  2R02 A;  3HXF A;  2KM4 A;  4MKT A;  4NUR A;  1A17 A;  4F53 A;  3CHQ A;  1HH8 A;  2KAT A;  3HHM A;  3EU9 A;  3AG2 E;  3AU4 A;  2RD0 A;  3B7T A;  1KT1 A;  3SBT B;  5ITZ F;  3BEE A;  3P2B A;  1A5E A;  2XEV A;  4BEP A;  4URK A;  5CBO A;  3UIN C;  3GYZ A;  2VGE A;  4WWP A;  3FUF A;  2FUL A;  1HO8 A;  3UUX A;  4CDR A;  3C5R A;  1DC2 A;  3D3M A;  4BER A;  3CHP A;  4CEM A;  4FA6 A;  2WB2 A;  2DYR E;  1DVP A;  5KJM A;  5KCM A;  3MX3 A;  5AQ9 A;  3NOG D;  3ZU7 B;  3ULQ A;  4C9B B;  3NOC D;  3ZVV A;  1H2U A;  4I43 A;  3UM2 A;  3B7B A;  4WAF A;  2OCC E;  4HOQ A;  5D0O D;  3ZIM A;  1PY1 A;  3FTS A;  5BXO A;  2IEJ A;  3UX4 A;  2LO6 A;  1QNF A;  4DX5 D;  5JMN D;  1E8Y A;  2DWZ A;  5ENO D;  4GTQ A;  2XCB A;  4TXR A;  2CHW A;  4A3V A;  1EF1 C;  2KZT A;  3FU3 A;  3ABL E;  3PRZ A;  2WXF A;  4OVU A;  4UUC A;  3MYV A;  4KZ0 A;  4PS3 A;  2WQ7 A;  4ACL A;  3CV0 A;  3EDT B;  3DSU A;  3TWV A;  2IOS A;  3FTY A;  1YMP A;  3S7J A;  3EIQ C;  2XEN A;  2CHZ A;  4RLY A;  3UQ3 A;  2CG3 A;  1NL4 A;  4GZ6 A;  1FVF A;  4DX2 A;  3SF4 A;  4WNF A;  4FC8 A;  5ENN A;  3UM0 A;  3HDX A;  4LRZ A;  4TRQ A;  1H19 A;  4Y6C A;  4JHJ A;  1N4R A;  1EYH A;  5KNH D;  3FH7 A;  1JUQ A;  4MS6 A;  2V4L A;  4LSZ E;  3HVE B;  2YQ8 A;  4GYO A;  4AVX A;  4GA0 A;  3D9I A;  5EX3 A;  4JHR A;  4AY6 A;  3OXG A;  4HB5 A;  3FH8 A;  3S2A A;  4JL0 A;  4JZY A;  5ANR A;  4NQ0 A;  4PDX A;  3E32 A;  3HXD A;  2V8S E;  4OVV A;  3S7B A;  4NAC A;  2I1K A;  4A55 A;  3LDZ A;  2WXL A;  2OVF A;  5M72 A;  4U07 A;  3VLE A;  3IHV A;  3G2V A;  5AAO A;  3MKR A;  4G8L A;  3GZS A;  3JYS A;  1LF8 A;  4JW1 A;  5J08 A;  4UQZ A;  3EJN A;  4XX5 A;  3ZGQ A;  4CT0 A;  4HI9 A;  3FEY A;  1RZ4 A;  5CEA A;  1GW6 A;  1UN8 A;  2H6G A;  3W9G A;  1YYH A;  2LSV A;  2YIN A;  4DI4 A;  5B1B E;  2NXP A;  4GA2 A;  4W9R A;  1TNB A;  5E76 A;  4HVB A;  3G2W A;  1W3B A;  3MJW A;  1SA4 A;  2Y4T A;  4YDO A;  3EHQ A;  2P9S G;  4JD2 G;  1IKN D;  2YHC A;  4HS2 A;  4HOR A;  3DEP A;  3D9P A;  4HOT A;  4KXK B;  3FP3 A;  4UI9 K;  4WNG A;  4HRN A;  4TUU A;  3D9J A;  4CT4 A;  2A5U A;  3Q73 A;  2X6I A;  2LUH A;  4JPS A;  5CHE E;  5T3R A;  2KC7 A;  4WWO A;  2BKK B;  3AJI A;  4U04 A;  3S7D A;  3UKU G;  3TG5 A;  1OCZ E;  2WM9 A;  4N3A A;  2KCK A;  3PH0 C;  2ETB A;  1ZBP A;  5BNW A;  4J7W A;  4E85 A;  3U66 A;  2I1J A;  4C48 B;  4B93 B;  4I1O B;  4N5Q A;  3V2X A;  4CCA A;  1N9A A;  2XEE A;  4K5A B;  2PZI A;  3FDH A;  4JA7 A;  3AG1 E;  3QB2 A;  1Y6I A;  3LPZ A;  3D9H A;  1UJJ A;  3ZXS A;  1U3D A;  3ENE A;  4B94 A;  3B95 A;  4O60 A;  1UJK A;  4GPM A;  4WUY A;  3TWW A;  4K0R A;  3KD7 A;  1G3N B;  4UWL A;  4GTS A;  3PZ4 A;  4DI3 A;  3L08 A;  4D10 C;  2H6H A;  2M63 A;  5G04 J;  3B7U X;  2OOE A;  4UQY A;  3VLD A;  4L2L A;  3LS8 A;  4HNA D;  4GTV A;  2E2E A;  4GZD A;  1H0A A;  5EDS A;  3CHM A;  4XEI G;  2P2C P;  2RFA A;  4GMJ A;  3J5Q B;  4AP2 A;  3FY4 A;  5DBK A;  4H7X A;  3Q9N C;  1P5Q A;  4YDE A;  1AWC B;  2FO1 E;  4GYY A;  4UWH A;  5FWQ A;  4APF A;  2GW1 A;  4GTO A;  2AXU A;  4N2Q A;  3QWV A;  5FTP A;  3CVP A;  2ETC A;  4J6I A;  3T8M A;  4GU5 A;  4I9C A;  1UOH A;  3KS2 A;  4DLO A;  3FUL A;  3QNK A;  3U3W A;  3ASD A;  2VSY A;  2PQR A;  1MX4 A;  3SNX A;  2HE0 A;  4F6R D;  2I6H A;  4JA9 A;  3FUE A;  4XZ4 A;  2L6J A;  3RO2 A;  2LAI A;  2MRI A;  4ILI A;  2BKG A;  5A7D B;  2AXZ A;  3FTV A;  2Y69 E;  3QAQ A;  5BPP A;  2VQ2 A;  4HOU A;  3MA5 A;  1N54 A;  4IN3 B;  1OUV A;  4C0M A;  5CCM A;  2IO3 C;  2UWJ G;  4JVS A;  5JA4 D;  3KSQ A;  3PNL B;  3ZKJ A;  3VLF A;  3GW4 A;  2P9N G;  3EUV A;  3E4B A;  3HXC A;  2P9I G;  5HI7 A;  4PS7 A;  3T8K A;  4GML A;  5CEC B;  2X6H A;  4Z68 A;  4X8Q A;  4FUL A;  1MHQ A;  3K9I A;  4XKC A;  5LOZ A;  5LP0 A;  4HRL A;  2XZT G;  4Y6W A;  3ZN3 A;  2DVW A;  1HFA A;  2P58 C;  4PUC A;  1BD8 A;  3CVL A;  3QAR A;  2VTB B;  3MKQ A;  4I1M A;  3L17 A; 
#chains in the Genus database with same CATH homology
 3E32 A;  3HXD A;  1N9A A;  3PZ1 A;  1JCQ A;  4LNG A;  1N4Q A;  1SA5 A;  1N4P A;  3EU5 A;  3E37 A;  3E33 A;  3Q75 A;  4LNB A;  2IEJ A;  1O5M A;  1KZO A;  4MBG A;  3DSV A;  1DCE A;  3Q79 A;  1FT2 A;  3KSL A;  4GTS A;  2H6G A;  3PZ4 A;  3DRA A;  4GTQ A;  1JCS A;  1QBQ A;  3Q7F A;  4EHM A;  3PZ3 A;  4L9P A;  1TNB A;  2H6H A;  3E34 A;  4GTR A;  1MZC A;  1SA4 A;  2R2L A;  4YDO A;  2H6F A;  3KSQ A;  1FPP A;  1O1T A;  1LD7 A;  1D8E A;  4GTV A;  4GTP A;  3SFY A;  1TNY A;  3DST A;  3DSX A;  1FT1 A;  3HXF A;  1NI1 A;  1O1S A;  3EUV A;  1S64 A;  3DSU A;  1TNU A;  3PZ2 A;  1TN8 A;  1JCR A;  3HXC A;  3Q78 A;  2ZIR A;  3C72 A;  1LTX A;  1N4S A;  1D8D A;  1NL4 A;  1TNO A;  3Q7A A;  1N94 A;  3Q73 A;  2F0Y A;  1N4R A;  3E30 A;  3HXB A;  4GTM A;  3DSW A;  1TN6 A;  4YDE A;  1O1R A;  3DSS A;  2BED A;  3SFX A;  2ZIS A;  1TNZ A;  3DPY A;  1N95 A;  1S63 A;  4GTO A;  2H6I A;  1LD8 A;  1X81 A;  1KZP A;  3HXE A;  1TN7 A;  4GTT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...