3EU5A

Crystal structure of ftase(alpha-subunit; beta-subunit delta c10) in complex with biotingpp
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
315
structure length
315
Chain Sequence
FLSLDSPTYVLYRDRAEWADIDPVPQNDGPSPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYIIAIIEEQPKNYQVWHHRRVLVEWLKDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQRHFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLLDLQPSHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQSKHSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein farnesyltransferase/geranylgeranyltransferase type-1
publication title Analysis of the eukaryotic prenylome by isoprenoid affinity tagging
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Transferase
total genus 125
structure length 315
sequence length 315
ec nomenclature ec 2.5.1.58: Protein farnesyltransferase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01239 PPTA Protein prenyltransferase alpha subunit repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.120 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Protein prenylyltransferase 3eu5A00
2ZISA 1JCSA 4LNBA 3E32A 1S64A 1TNZA 3DSSA 1FPPA 1N9AA 1X81A 1N4PA 2H6GA 3C72A 3Q75A 2F0YA 3E34A 4GTMA 1O1SA 1TN6A 1N94A 3SFXA 3EU5A 4MBGA 1KZPA 2IEJA 3E37A 2BEDA 2H6IA 1N4RA 1QBQA 1SA5A 1JCQA 1O1TA 3DSXA 4GTSA 4GTOA 3DSTA 1KZOA 4YDEA 3DPYA 3Q7FA 3Q7AA 1N95A 3HXCA 3KSQA 3PZ1A 4GTQA 1NL4A 1LTXA 1JCRA 1FT1A 1D8DA 2ZIRA 1D8EA 3HXEA 4GTTA 1MZCA 1O5MA 3HXBA 3PZ2A 3E33A 3Q78A 3PZ3A 3HXFA 3HXDA 3Q79A 4GTPA 3DRAA 4EHMA 1S63A 4LNGA 3DSVA 1DCEA 1SA4A 1TNUA 1LD7A 3Q73A 1TN8A 1TNBA 1N4SA 3E30A 1O1RA 1TN7A 1N4QA 2R2LA 4GTRA 3DSWA 1TNYA 3SFYA 1NI1A 2H6HA 4GTVA 3DSUA 3PZ4A 4YDOA 1FT2A 3EUVA 4L9PA 2H6FA 1TNOA 1LD8A 3KSLA
chains in the Genus database with same CATH superfamily
3HG0D 4BWRA 4G1TA 4BT8A 3AU5A 4W9RA 2X6FA 1XGWA 1N94A 5EIBE 3DPDA 3EU5A 1KZPA 1NA3A 4FC8A 4FLHA 5J90A 3CHMA 3L13A 1H2TC 3ZNGA 4U7EB 1SW6A 4O60A 2P58C 4HFGA 3S2AA 1P5QA 1S0PA 3RRUA 4AVXA 1LTXA 4Z68A 3FUDA 4N5CA 3LKUA 5B1BE 3BU8A 4GA1A 1H2VC 4DPRA 3OTNA 2YHEA 5AQ9A 3RRNB 4EHMA 4U96D 2OV8A 3L16A 4PH4B 4F6RD 1V54E 4RLYA 3NOGD 3VLFA 2A5EA 3EDTB 1YMPA 4G24A 2XPIA 2HR2A 4J8SA 4DX6D 4APOA 4AV7A 3CHQA 2PQNA 3RJVA 4B8AA 4GA2A 4MS6A 4GTVA 5H7PA 5LOZA 5HQ8A 3EUVA 1OWLA 3ULEG 1U2VG 3CVLA 4UWKA 1RW2A 3FH7A 3MKRA 1IQRA 4YVOA 3C5RA 4U8YD 2XZTG 4AY6A 3I3NA 4TXPA 4GCNA 3Q75A 5BNWA 3C3QA 1O1SA 3TXNA 3RKVA 4L7TA 3V79K 3ZGQA 3Q9UC 1H0AA 5BXUA 4HLLA 3FTXA 2XCBA 3FU3A 3D9JA 4UI9K 2F37A 4XX5A 1N95A 3TWUA 1K8KG 3TWTA 4U0SA 1NL4A 4EECA 5KJNA 1K1BA 2GRRB 2XQ0A 1JWFA 5JJTA 4BX9A 3SFZA 3PZ2A 3ISMC 3UI2A 4JEUA 1HG5A 3IV0A 4UWHA 4AY5A 4GTPA 4JEHA 2LXLA 1MJ0A 3ULQA 2ZGGA 2AWIA 3MX3A 4WAFA 5HRYA 2WPVA 2J4BA 4GZCA 3HVEB 4B0ZA 4DI3A 4LSZE 4CT4A 3D9IA 4MKTA 4O6FA 1TEZA 3GW4A 2RKKA 2KCKA 4AXHA 5AENA 1LD8A 5FZSA 3FUJA 1HX8A 1BI8B 3DEOA 4O1PA 3PUKA 4R7LA 1QYMA 2FEZA 1IQUA 1KPSB 2J8SD 2VJ8A 3B7SA 4BX8A 3NOCD 4KVMA 4FU3A 2GROB 1K1AA 4UQYA 1WAO1 4OVUA 4JA7A 2IEJA 1H6PA 1LF8A 4XI0A 4GPMA 4HBDA 2FF4A 3NZUA 3UKRG 4TUMA 4UI9J 2CG2A 2RFMA 1WDYA 4FULA 3PZ1A 3RRMB 3ZEFA 3FU5A 1JPLA 2ONDA 3PREA 4GMJA 2KCVA 3T9KA 1G3NB 1ELWA 4DRXE 2AXZA 4UI9C 3ZW3A 2WXOA 3E33A 3OAWA 5ANLA 3DXKG 2KXPC 3FTSA 3NB2A 2VTBA 3RAUA 3C3RA 3ZHEB 5CBOA 5G04C 2VSYA 2WXLA 2LAIA 3MKQB 3T5XA 2BTDA 3S7JA 2IO3C 5EYPF 5J08A 3KAEA 4A1GA 3CHSA 4U8HA 4LNUD 1HU3A 2R03A 3BQOA 2DZOA 5JMND 3GZ1A 3EHRA 1S64A 3L17A 2WXQA 2WXGA 2WB2A 3FU6A 1HFAA 2X3MA 4WWOA 3JYSA 3Q5MA 4OAUC 3SHFA 4FP7A 4CRWA 1OXJA 4HRLA 2VGXB 2DIWA 2PM7A 4HORA 3L9TA 4YDEA 5ARFA 3V31A 3TG5A 4GAAA 4N3AA 2ZIRA 4ABNA 3FTWA 1SVXA 5T8IA 1MZCA 3FWVA 3B7UX 3Q49B 4U63A 4H7XA 3PZ3A 4J8FA 2UWJG 4FJYA 4XI9A 2WXIA 5FQ6A 5KBAA 4HS2A 5FJYA 3LXUX 5C2YA 3TGOA 4J8YA 3LDZA 4GZ5A 5ENQD 1TNBA 3ENEA 3RO2A 3QJZA 1UN9A 3UX4A 5EYLA 4L9PA 4NURA 3QB2A 2OVBA 4J6IA 4AIFA 5EDSA 3EIJA 3LS8A 3BUAA 2Y4TA 3E32A 1KLXA 4XEIG 1N4PA 2IFUA 2CHXA 3DEPA 3W9FA 4L2LA 4KZCA 4UQXA 4Y6WA 3SGHA 3ZYLA 4AEZC 3CVNA 4MBGA 4KVOA 2KCLA 3E37A 4EPZA 3AG3E 3AJIA 3QC1A 2WXFA 1TR4A 2PQRA 5LX8A 4DI4A 3HXCA 2PNNA 2EQXA 3LVQE 4PS3A 3FUEA 2EIME 5FQ8A 2X6KA 4PS8A 3NAWA 2NSZA 4LG6A 3B7TA 3CGHA 3LPZA 1Z6TA 2XRYA 3CQGB 3FH5A 3QNKA 2AXUA 3QK0A 4PUCA 4J0UA 2WQ7A 3ML9A 2R5SA 5AIJA 4M7CA 4TUUA 3D9NA 1OY3D 3SY2A 3UTMA 2NC9A 5ENTD 3FULA 2V4LA 3KD7A 4DX1A 2V4HC 2LSVA 3U66A 1TN8A 2GRNB 3ONLA 1DCQA 3GYZA 4DLQA 4G8LA 4K5CA 2J08A 1E96B 1E8ZA 5AN8A 2AVPA 4XE0A 3CHOA 3FUKA 3CVQA 3UQ3A 3O48A 3CVXA 4JC8A 4FADA 2WMNA 3CEQA 1S70B 2J49A 5EN5D 2LNIA 3FEYA 1FPPA 1N9AA 3C72A 5D2MC 2F0YA 2DWZA 3G2WA 3GZ2A 3HYMB 5IY5E 3D9LA 3SO8A 1HZ4A 4JD2G 4UWGA 2C2LA 4GYOA 1JCQA 3TG4A 2VGEA 2V8SE 4OYSA 2P9IG 5B1AE 1ELRA 4ILGA 3IBEA 2CG3A 5DIZA 4GTQA 3PEUB 4RQIA 3ZYKA 4EZJA 1BPOA 3RIBA 1JWGA 3PDNA 3Q47B 5FZQA 3O4ZA 2HO1A 3HXDA 4HOQA 2AJAA 3CR3A 5AQAA 1SZ9A 2HE0A 3TL5A 3QDNA 2ZGDA 4K03A 2VSOE 2KATA 1OWNA 1H19A 1E8XA 5C1DA 2WM9A 5EIDA 4AOFA 3NBNB 4M3OA 5EILA 4WWNA 1YYHA 1UOHA 1HG2A 3PEVB 3TJPA 2ZISA 5HI7A 3UINC 2WXNA 3LVRE 4LNBA 1D9SA 2X6HA 2VTBB 1TNZA 5T3RA 1OCRE 3L82A 3V2OA 3FUMA 4J7WA 1TJCA 3Q4AB 3SFXA 2AW6A 3TWWA 1TJFA 4DUIA 3C98A 3ASGA 4XIFA 4ANUA 3AG4E 2P9UG 2LXMA 4C48B 1UG3A 3ZU7B 3FUIA 4C0MA 4HVBA 4HOUA 3Q7AA 1HE8A 2WMOA 3BG1B 3UMVA 2LSUA 4HB5A 4C0EA 2FULA 1OCCE 3ZIMA 3MZLB 4KT6B 1HO8A 3FTZA 3ASHA 3EU9A 4IYPA 1NA0A 3Q78A 5ENNA 5KJLA 3HXFA 3ZXPA 3VLDA 3DWLG 5ARGA 1NP7A 4NRHB 4BY6A 5ENOD 4LNGA 3NF1A 2XGMA 3R9MA 4A1SA 3VTXA 4N39A 1TNUA 5HS0A 4JPSA 4BEPA 4ANWA 3AS4A 3JCKC 3E30A 1EYHA 4O1OA 1TNYA 2XCCA 1OWPA 3LCAA 5FQ4A 5FINA 2WXJA 4I43A 1FT2A 1OWOA 3FDHA 3CK8A 1MX6A 5ANRA 2FI7A 4CGVA 5KNHD 4L2YA 2UY1B 3SD5A 3FUHA 4BFRA 4GZ6A 4NIKA 2H6GA 2WXMA 3ZYQA 2XS8A 1OCOE 3CKCA 3KEZA 2QYUA 3QWWA 2Y69E 3VTYA 4I1OB 2DCPA 2CFZA 4E6HA 3JUIA 3QWVA 3G2UA 5KNGA 1BLXB 2KC7A 5G05C 3J5PA 3MA5A 1N54A 4KBQA 5A6CA 2I9CA 3GZSA 3PNTB 3EJNA 1Y8MA 4CCAA 3PZDA 3ZUVB 4DJAA 3S7BA 2LAHA 1UW4B 4Y6CA 2GRQB 3D9HA 1UN8A 3CVWA 1BU9A 2KM4A 1B89A 1ELKA 2XGOA 2DBAA 4BESA 3U3WA 2Y0BG 5EKQD 1H2UA 3TXMA 4ATZD 3L6AA 3FTVA 1N0RA 5G04J 5AQ7A 4N5QA 4G25A 3SQVA 5CECB 3RSEG 1EPUA 2AXVA 4BSXA 5D0QD 4C9BB 1QNFA 4NQ0A 2OVFA 3IXEA 2DVWA 4I1AA 2DZNA 4YDWA 4FHKA 4ANVA 4Q94A 4F1SA 5DBKA 5BXOA 4U07A 5A23A 1YCSB 1PC2A 3U4TA 4FLBA 4I6EA 3W9GA 1MX2A 3C3OA 2PZIA 3TWXA 2LO6A 4MLPA 3K9IA 3U64A 3ESLA 3KSQA 3OXFA 2P9NG 4JA9A 2L0IA 3HXBA 4I2ZA 4DX5D 1IKND 3UPVA 1NFIE 4ZHBA 4GZ3A 4F3VA 3ZXSA 4X8QA 3CKBA 5FTPA 1AP7A 2XZDG 2I2OA 4A3TA 4ACLA 2V0PA 3ZRHA 4JZYA 2YINA 3HHMA 4LCTA 4CYMD 1WY6A 3SI5A 2R2LA 4GTRA 1EDUA 2XRZA 4I6GA 3EHNA 3UM1A 4H7YA 2ETCA 3CVUA 3FUFA 3ABKE 1NZNA 2I1JA 4Q96A 1OWMA 1PAQA 5T4YA 4U04A 3FY4A 1HS6A 1INZA 1E90A 3HVEA 1MYOA 3IEGA 4B89A 4GTMA 4U0ZA 2WVIA 3JXIA 4I9CA 4XZ4A 4HI9A 2J9QA 5AYWD 4EBAA 4U0UA 1Q2ZA 2GRMA 4U8VD 1N4RA 2WXRA 3FP3A 2L0TB 2LUHA 4GTSA 3UKUG 2IJGX 3DSTA 2B6CA 3S7FA 2EILE 4DLOA 3Q7FA 2HYZA 4I17A 4EZLA 1SZAA 2DYSE 3UT4A 3LEWA 4GTTA 1MHQA 1IXVA 2KZTA 2MOWA 3ZFWA 4RVBA 3MEKA 3CK7A 1Z5SC 2RG8A 1BD8A 4YVQC 2QZAA 2MHKA 3NZSA 2GW1A 5CEDB 1LD7A 3APDA 5E76A 1O1RA 2E0IA 5CRUA 2BKGA 2VGYA 1DNPA 2GRLA 2V5FA 3AS8A 1NI1A 2KBXA 5AQBA 3MYVA 3FHEA 4BTAA 2WQHA 2WXHA 4JHKA 3ZHEA 3APCA 4J8DA 3FEXA 4UUCA 3ULYA 2WXKA 2FO7A 1KT1A 3WG7E 5LFAA 1IHGA 1ZB1A 3DSSA 3IKOB 3ASNE 4K5AB 1KT0A 1X81A 2CHWA 5BPPA 4CZ2D 4FHJA 4WWPA 1HH8A 4URKA 4TXRA 3J5QB 5EX3A 3LYAA 2IU1A 3N71A 2IY0C 4I2WA 5ENRD 3DPYA 5CBNA 2IQCA 5A7DB 2F8XK 3SNXA 5E75A 2CHZA 1JCRA 3CK9A 3B7RL 4A55A 5FWQA 1IYGA 5FT9A 3G2SA 4ANXA 3ZVVA 3ESKA 2IONA 2QYJA 4AJWA 4GU5A 5D66A 5FIOA 4F1PA 5LP0A 1DCEA 1OUVA 2A4ZA 5ITZF 3NQPA 3JQ0A 4MRUA 3FTUA 4HI8A 2P9PG 5FQ7A 3ABLE 3LY9A 3Q15A 5JHBA 1N0QA 2OCCE 4A3VA 4LRZA 4GYYA 4U95D 3D9PA 2VQ2A 4CDMA 3T5VA 1XNFA 3KSLA 3QAQA 4K5BA 2FO1E 3G2VA 2OEWA 3SF4A 5AAOA 4TRQA 2DYRE 2NXPA 2WQ6A 4B8CB 1E7VA 2R17C 5AJLA 4RSYA 1A5EA 4GCOA 1QQEA 4JL0A 4GMLA 3BEEA 3QWPA 2L6BA 1HXIA 2A5UA 3KEAA 4N2SA 1DC2A 3UUXA 3DSXA 4GTOA 2XS1A 2XGSA 3AS5A 2X38A 2XPZA 1U3CA 1E7UA 3FH8A 4CDRA 4ATGA 4G26A 2IOSA 5CMWA 5KJKA 2BUGA 4P29A 2EIKE 4LERA 3U9WA 2XPYA 5BW8C 3Q79A 4G8KA 4EBAG 3JUEA 3CHPA 4ZFHA 1H6OA 4KMOA 4HQDA 1S63A 4KZ0A 2XEVA 3PS6A 2IO2C 4RG6A 3MV3B 5CRVA 3IHYA 3D9OA 3PRZA 3WXXA 4HRMB 5JHAA 3R7RA 2QY7A 2GRPB 1N4SA 4UWLA 2E2EA 3TWQA 4KYOB 4JXTA 1SQMA 4YDOA 4L23A 2EIJE 2J4DA 3APFA 5G2NA 4E85A 3SBSA 4GA0A 2L9BA 4IN3B 2VYIA 2V5QC 1ZU2A 4LEUA 1EF1C 3Q9NC 2RFAA 3E34A 2X6IA 1TN6A 3PH0C 5JJ6A 3RK6A 5CERB 4HXIA 2P9LG 5JA4D 1WM5A 3FU0A 2R05A 3LJ3A 1FVHA 1QBQA 1SA5A 3MV2B 5HKPA 4GMRA 3CQCB 3D3MA 4B93B 5M72A 4GB9A 4N3BA 3EHQA 4YDYA 4G23A 1UJJA 4K0RA 1FT1A 2YQ8A 2MYOA 4ILIA 4L1BA 4EZKA 4UQZA 4FA6A 3DBSA 1O5MA 1V55E 5LCWJ 5G05J 3V2XA 3UT7A 3VLEA 2X6JA 2R59A 3PNLB 3QKYA 4BERA 3P1UA 4APFA 1FVFA 2VSXE 5LCWC 4D10C 3DSVA 5BUZA 3ASDA 3CSFA 1Y6IA 3BG0B 3PVLA 3Q73A 3R9AB 2Q7FA 3L54A 1H6KA 4GZDA 5CCLA 4WNDA 2I6HA 2KZTB 2Y3AA 3HIZA 2L6JA 4GYWA 4J8EA 4HNAD 3URZA 3JXJA 3EIQC 3CVPA 5CHEE 3G2TA 4I9EA 2QC9A 3JQ1A 3ML8A 3MCXA 3UM3A 2IOLA 2BEDA 2I1KA 3T8KA 4B94A 1AWCB 3ZYMA 2F8YA 4XKCA 2EINE 3FTYA 2BKKB 2HM8A 4CEMA 3UIPC 3HRAA 1DVPA 3LJNA 4CT0A 1GW6A 2XENA 3V30A 2ZU6B 2CFUA 2Y1LE 4CGWA 2C0LA 2M63A 3TAXA 2JEKA 3I4GA 4F7AA 3AAAC 3KS2A 4I6JA 3E4BA 1BI7B 4DX2A 4G2VA 1N11A 3RO3A 1N52A 5EX0A 4GPKA 4Q69A 5CEAA 4RG9A 4WNEA 4OAVB 3TWRA 3F6QA 1A17A 2YNQA 5ENPD 2P2CP 1E8YA 4HLEA 4ME2A 1ZBPA 3AG2E 3DSWA 4BT9A 3QOUA 3DSUA 3PZ4A 4UWFA 5B3SE 1E8WA 4BTBA 3AG1E 1TNOA 4LUNU 2VSNA 3CIAA 1JCSA 3TWVA 3LY7A 1MX4A 2ETBA 4DK5A 5KWDA 3S7DA 4DX7D 3L22A 2MRIA 3CLJA 2J07A 4TXQA 2P9SG 5AARA 5G55A 3ABME 3B95A 4WNGA 2OOEA 2PM6A 5KCMA 4PS7A 3CVVA 3FUNA 1TYQG 4BETA 1KZOA 2UY1A 4FJZA 4WNFA 2XEHA 4PDXA 3D9KA 2OEVA 2ETAA 5ENSD 3OXGA 1D8DA 3SBTB 1D8EA 3EHMA 2IF4A 1K3ZD 4YNDA 4HOTA 2XEEA 3AU4A 4N2QA 1RZ4A 4V3IA 3MGBA 1Z3XA 3HDXA 1VDYA 4AM9A 3I4RB 2GGFA 3DXMG 1JUQA 1HF8A 3UT8A 5BT1A 1SA4A 2BF0X 3UXGA 4QQIA 4JVSA 3LY8A 2PL2A 4I1MA 5BV0A 3UM0A 5D0OD 1N4QA 4WUYA 3SFYA 2ILRA 2XHEA 4JW1A 3TWSA 4HOSA 1WG0A 3B7BA 2JABA 1W3BA 5CMYA 3OXLA 2H6FA 4G11A 3CHRA 3CV0A 4EQFA 4NACA 2C0MA 2ZXWE 5BV1A 3UM2A 3RU0A 4HRNA 3PE4A 5FZRA 3QARA 4ILHB 2P9KG 5JJ7A 3ONKA 3P2BA 3ASFA 3T8MA 3MJWA 4JB8P 4KXKB 3CVYA 1X5BA 3IHVA 1OCZE 4JHJA 3X2QE 2H6IA 4A63B 1OT8A 1Z3YA 1O1TA 4JHRA 3MKQA 1FCHA 4QFVA 3ZKJA 3B13A 4N3CA 3HXEA 3ZPJA 5KJMA 3PE3A 2NYJA 3SZ7A 5CCMA 1QZ2A 2FBNA 3DRAA 1U3DA 3L08A 2WXPA 3ZN3A 2QFCA 3ASOE 2RD0A 3R7QA 3D9MA 2Y4UA 2J09A 2YHCA 4BSZB 1YA0A 2JLBA 4XKBA 2B0OE 3PUJA 4OVVA 1TN7A 3UIOC 4IRUA 4TV3A 4CDNA 2R02A 3CSTA 4ACKA 4F53A 5AJDA 2H6HA 4AP2A 4IULA 3FFLA 2VGXA 3I5PA 1L5JA 1PY1A 1MQSA 1IHBA 1UJKA
chains in the Genus database with same CATH topology
2ZISA 1JCSA 4LNBA 3E32A 1S64A 1TNZA 3DSSA 1FPPA 1N9AA 1X81A 1N4PA 2H6GA 3C72A 3Q75A 2F0YA 3E34A 4GTMA 1O1SA 1TN6A 1N94A 3SFXA 3EU5A 4MBGA 1KZPA 2IEJA 3E37A 2BEDA 2H6IA 1N4RA 1QBQA 1SA5A 1JCQA 1O1TA 3DSXA 4GTSA 4GTOA 3DSTA 1KZOA 4YDEA 3DPYA 3Q7FA 3Q7AA 1N95A 3HXCA 3KSQA 3PZ1A 4GTQA 1NL4A 1LTXA 1JCRA 1FT1A 1D8DA 2ZIRA 1D8EA 3HXEA 4GTTA 1MZCA 1O5MA 3HXBA 3PZ2A 3E33A 3Q78A 3PZ3A 3HXFA 3HXDA 3Q79A 4GTPA 3DRAA 4EHMA 1S63A 4LNGA 3DSVA 1DCEA 1SA4A 1TNUA 1LD7A 3Q73A 1TN8A 1TNBA 1N4SA 3E30A 1O1RA 1TN7A 1N4QA 2R2LA 4GTRA 3DSWA 1TNYA 3SFYA 1NI1A 2H6HA 4GTVA 3DSUA 3PZ4A 4YDOA 1FT2A 3EUVA 4L9PA 2H6FA 1TNOA 1LD8A 3KSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZIS A;  1JCS A;  4LNB A;  3E32 A;  1S64 A;  1TNZ A;  3DSS A;  1FPP A;  1N9A A;  1X81 A;  1N4P A;  2H6G A;  3C72 A;  3Q75 A;  2F0Y A;  3E34 A;  4GTM A;  1O1S A;  1TN6 A;  1N94 A;  3SFX A;  3EU5 A;  4MBG A;  1KZP A;  2IEJ A;  3E37 A;  2BED A;  2H6I A;  1N4R A;  1QBQ A;  1SA5 A;  1JCQ A;  1O1T A;  3DSX A;  4GTS A;  4GTO A;  3DST A;  1KZO A;  4YDE A;  3DPY A;  3Q7F A;  3Q7A A;  1N95 A;  3HXC A;  3KSQ A;  3PZ1 A;  4GTQ A;  1NL4 A;  1LTX A;  1JCR A;  1FT1 A;  1D8D A;  2ZIR A;  1D8E A;  3HXE A;  4GTT A;  1MZC A;  1O5M A;  3HXB A;  3PZ2 A;  3E33 A;  3Q78 A;  3PZ3 A;  3HXF A;  3HXD A;  3Q79 A;  4GTP A;  3DRA A;  4EHM A;  1S63 A;  4LNG A;  3DSV A;  1DCE A;  1SA4 A;  1TNU A;  1LD7 A;  3Q73 A;  1TN8 A;  1TNB A;  1N4S A;  3E30 A;  1O1R A;  1TN7 A;  1N4Q A;  2R2L A;  4GTR A;  3DSW A;  1TNY A;  3SFY A;  1NI1 A;  2H6H A;  4GTV A;  3DSU A;  3PZ4 A;  4YDO A;  1FT2 A;  3EUV A;  4L9P A;  2H6F A;  1TNO A;  1LD8 A;  3KSL A; 
#chains in the Genus database with same CATH topology
 3HG0 D;  4BWR A;  4G1T A;  4BT8 A;  3AU5 A;  4W9R A;  2X6F A;  1XGW A;  1N94 A;  5EIB E;  3DPD A;  3EU5 A;  1KZP A;  1NA3 A;  4FC8 A;  4FLH A;  5J90 A;  3CHM A;  3L13 A;  1H2T C;  3ZNG A;  4U7E B;  1SW6 A;  4O60 A;  2P58 C;  4HFG A;  3S2A A;  1P5Q A;  1S0P A;  3RRU A;  4AVX A;  1LTX A;  4Z68 A;  3FUD A;  4N5C A;  3LKU A;  5B1B E;  3BU8 A;  4GA1 A;  1H2V C;  4DPR A;  3OTN A;  2YHE A;  5AQ9 A;  3RRN B;  4EHM A;  4U96 D;  2OV8 A;  3L16 A;  4PH4 B;  4F6R D;  1V54 E;  4RLY A;  3NOG D;  3VLF A;  2A5E A;  3EDT B;  1YMP A;  4G24 A;  2XPI A;  2HR2 A;  4J8S A;  4DX6 D;  4APO A;  4AV7 A;  3CHQ A;  2PQN A;  3RJV A;  4B8A A;  4GA2 A;  4MS6 A;  4GTV A;  5H7P A;  5LOZ A;  5HQ8 A;  3EUV A;  1OWL A;  3ULE G;  1U2V G;  3CVL A;  4UWK A;  1RW2 A;  3FH7 A;  3MKR A;  1IQR A;  4YVO A;  3C5R A;  4U8Y D;  2XZT G;  4AY6 A;  3I3N A;  4TXP A;  4GCN A;  3Q75 A;  5BNW A;  3C3Q A;  1O1S A;  3TXN A;  3RKV A;  4L7T A;  3V79 K;  3ZGQ A;  3Q9U C;  1H0A A;  5BXU A;  4HLL A;  3FTX A;  2XCB A;  3FU3 A;  3D9J A;  4UI9 K;  2F37 A;  4XX5 A;  1N95 A;  3TWU A;  1K8K G;  3TWT A;  4U0S A;  1NL4 A;  4EEC A;  5KJN A;  1K1B A;  2GRR B;  2XQ0 A;  1JWF A;  5JJT A;  4BX9 A;  3SFZ A;  3PZ2 A;  3ISM C;  3UI2 A;  4JEU A;  1HG5 A;  3IV0 A;  4UWH A;  4AY5 A;  4GTP A;  4JEH A;  2LXL A;  1MJ0 A;  3ULQ A;  2ZGG A;  2AWI A;  3MX3 A;  4WAF A;  5HRY A;  2WPV A;  2J4B A;  4GZC A;  3HVE B;  4B0Z A;  4DI3 A;  4LSZ E;  4CT4 A;  3D9I A;  4MKT A;  4O6F A;  1TEZ A;  3GW4 A;  2RKK A;  2KCK A;  4AXH A;  5AEN A;  1LD8 A;  5FZS A;  3FUJ A;  1HX8 A;  1BI8 B;  3DEO A;  4O1P A;  3PUK A;  4R7L A;  1QYM A;  2FEZ A;  1IQU A;  1KPS B;  2J8S D;  2VJ8 A;  3B7S A;  4BX8 A;  3NOC D;  4KVM A;  4FU3 A;  2GRO B;  1K1A A;  4UQY A;  1WAO 1;  4OVU A;  4JA7 A;  2IEJ A;  1H6P A;  1LF8 A;  4XI0 A;  4GPM A;  4HBD A;  2FF4 A;  3NZU A;  3UKR G;  4TUM A;  4UI9 J;  2CG2 A;  2RFM A;  1WDY A;  4FUL A;  3PZ1 A;  3RRM B;  3ZEF A;  3FU5 A;  1JPL A;  2OND A;  3PRE A;  4GMJ A;  2KCV A;  3T9K A;  1G3N B;  1ELW A;  4DRX E;  2AXZ A;  4UI9 C;  3ZW3 A;  2WXO A;  3E33 A;  3OAW A;  5ANL A;  3DXK G;  2KXP C;  3FTS A;  3NB2 A;  2VTB A;  3RAU A;  3C3R A;  3ZHE B;  5CBO A;  5G04 C;  2VSY A;  2WXL A;  2LAI A;  3MKQ B;  3T5X A;  2BTD A;  3S7J A;  2IO3 C;  5EYP F;  5J08 A;  3KAE A;  4A1G A;  3CHS A;  4U8H A;  4LNU D;  1HU3 A;  2R03 A;  3BQO A;  2DZO A;  5JMN D;  3GZ1 A;  3EHR A;  1S64 A;  3L17 A;  2WXQ A;  2WXG A;  2WB2 A;  3FU6 A;  1HFA A;  2X3M A;  4WWO A;  3JYS A;  3Q5M A;  4OAU C;  3SHF A;  4FP7 A;  4CRW A;  1OXJ A;  4HRL A;  2VGX B;  2DIW A;  2PM7 A;  4HOR A;  3L9T A;  4YDE A;  5ARF A;  3V31 A;  3TG5 A;  4GAA A;  4N3A A;  2ZIR A;  4ABN A;  3FTW A;  1SVX A;  5T8I A;  1MZC A;  3FWV A;  3B7U X;  3Q49 B;  4U63 A;  4H7X A;  3PZ3 A;  4J8F A;  2UWJ G;  4FJY A;  4XI9 A;  2WXI A;  5FQ6 A;  5KBA A;  4HS2 A;  5FJY A;  3LXU X;  5C2Y A;  3TGO A;  4J8Y A;  3LDZ A;  4GZ5 A;  5ENQ D;  1TNB A;  3ENE A;  3RO2 A;  3QJZ A;  1UN9 A;  3UX4 A;  5EYL A;  4L9P A;  4NUR A;  3QB2 A;  2OVB A;  4J6I A;  4AIF A;  5EDS A;  3EIJ A;  3LS8 A;  3BUA A;  2Y4T A;  3E32 A;  1KLX A;  4XEI G;  1N4P A;  2IFU A;  2CHX A;  3DEP A;  3W9F A;  4L2L A;  4KZC A;  4UQX A;  4Y6W A;  3SGH A;  3ZYL A;  4AEZ C;  3CVN A;  4MBG A;  4KVO A;  2KCL A;  3E37 A;  4EPZ A;  3AG3 E;  3AJI A;  3QC1 A;  2WXF A;  1TR4 A;  2PQR A;  5LX8 A;  4DI4 A;  3HXC A;  2PNN A;  2EQX A;  3LVQ E;  4PS3 A;  3FUE A;  2EIM E;  5FQ8 A;  2X6K A;  4PS8 A;  3NAW A;  2NSZ A;  4LG6 A;  3B7T A;  3CGH A;  3LPZ A;  1Z6T A;  2XRY A;  3CQG B;  3FH5 A;  3QNK A;  2AXU A;  3QK0 A;  4PUC A;  4J0U A;  2WQ7 A;  3ML9 A;  2R5S A;  5AIJ A;  4M7C A;  4TUU A;  3D9N A;  1OY3 D;  3SY2 A;  3UTM A;  2NC9 A;  5ENT D;  3FUL A;  2V4L A;  3KD7 A;  4DX1 A;  2V4H C;  2LSV A;  3U66 A;  1TN8 A;  2GRN B;  3ONL A;  1DCQ A;  3GYZ A;  4DLQ A;  4G8L A;  4K5C A;  2J08 A;  1E96 B;  1E8Z A;  5AN8 A;  2AVP A;  4XE0 A;  3CHO A;  3FUK A;  3CVQ A;  3UQ3 A;  3O48 A;  3CVX A;  4JC8 A;  4FAD A;  2WMN A;  3CEQ A;  1S70 B;  2J49 A;  5EN5 D;  2LNI A;  3FEY A;  1FPP A;  1N9A A;  3C72 A;  5D2M C;  2F0Y A;  2DWZ A;  3G2W A;  3GZ2 A;  3HYM B;  5IY5 E;  3D9L A;  3SO8 A;  1HZ4 A;  4JD2 G;  4UWG A;  2C2L A;  4GYO A;  1JCQ A;  3TG4 A;  2VGE A;  2V8S E;  4OYS A;  2P9I G;  5B1A E;  1ELR A;  4ILG A;  3IBE A;  2CG3 A;  5DIZ A;  4GTQ A;  3PEU B;  4RQI A;  3ZYK A;  4EZJ A;  1BPO A;  3RIB A;  1JWG A;  3PDN A;  3Q47 B;  5FZQ A;  3O4Z A;  2HO1 A;  3HXD A;  4HOQ A;  2AJA A;  3CR3 A;  5AQA A;  1SZ9 A;  2HE0 A;  3TL5 A;  3QDN A;  2ZGD A;  4K03 A;  2VSO E;  2KAT A;  1OWN A;  1H19 A;  1E8X A;  5C1D A;  2WM9 A;  5EID A;  4AOF A;  3NBN B;  4M3O A;  5EIL A;  4WWN A;  1YYH A;  1UOH A;  1HG2 A;  3PEV B;  3TJP A;  2ZIS A;  5HI7 A;  3UIN C;  2WXN A;  3LVR E;  4LNB A;  1D9S A;  2X6H A;  2VTB B;  1TNZ A;  5T3R A;  1OCR E;  3L82 A;  3V2O A;  3FUM A;  4J7W A;  1TJC A;  3Q4A B;  3SFX A;  2AW6 A;  3TWW A;  1TJF A;  4DUI A;  3C98 A;  3ASG A;  4XIF A;  4ANU A;  3AG4 E;  2P9U G;  2LXM A;  4C48 B;  1UG3 A;  3ZU7 B;  3FUI A;  4C0M A;  4HVB A;  4HOU A;  3Q7A A;  1HE8 A;  2WMO A;  3BG1 B;  3UMV A;  2LSU A;  4HB5 A;  4C0E A;  2FUL A;  1OCC E;  3ZIM A;  3MZL B;  4KT6 B;  1HO8 A;  3FTZ A;  3ASH A;  3EU9 A;  4IYP A;  1NA0 A;  3Q78 A;  5ENN A;  5KJL A;  3HXF A;  3ZXP A;  3VLD A;  3DWL G;  5ARG A;  1NP7 A;  4NRH B;  4BY6 A;  5ENO D;  4LNG A;  3NF1 A;  2XGM A;  3R9M A;  4A1S A;  3VTX A;  4N39 A;  1TNU A;  5HS0 A;  4JPS A;  4BEP A;  4ANW A;  3AS4 A;  3JCK C;  3E30 A;  1EYH A;  4O1O A;  1TNY A;  2XCC A;  1OWP A;  3LCA A;  5FQ4 A;  5FIN A;  2WXJ A;  4I43 A;  1FT2 A;  1OWO A;  3FDH A;  3CK8 A;  1MX6 A;  5ANR A;  2FI7 A;  4CGV A;  5KNH D;  4L2Y A;  2UY1 B;  3SD5 A;  3FUH A;  4BFR A;  4GZ6 A;  4NIK A;  2H6G A;  2WXM A;  3ZYQ A;  2XS8 A;  1OCO E;  3CKC A;  3KEZ A;  2QYU A;  3QWW A;  2Y69 E;  3VTY A;  4I1O B;  2DCP A;  2CFZ A;  4E6H A;  3JUI A;  3QWV A;  3G2U A;  5KNG A;  1BLX B;  2KC7 A;  5G05 C;  3J5P A;  3MA5 A;  1N54 A;  4KBQ A;  5A6C A;  2I9C A;  3GZS A;  3PNT B;  3EJN A;  1Y8M A;  4CCA A;  3PZD A;  3ZUV B;  4DJA A;  3S7B A;  2LAH A;  1UW4 B;  4Y6C A;  2GRQ B;  3D9H A;  1UN8 A;  3CVW A;  1BU9 A;  2KM4 A;  1B89 A;  1ELK A;  2XGO A;  2DBA A;  4BES A;  3U3W A;  2Y0B G;  5EKQ D;  1H2U A;  3TXM A;  4ATZ D;  3L6A A;  3FTV A;  1N0R A;  5G04 J;  5AQ7 A;  4N5Q A;  4G25 A;  3SQV A;  5CEC B;  3RSE G;  1EPU A;  2AXV A;  4BSX A;  5D0Q D;  4C9B B;  1QNF A;  4NQ0 A;  2OVF A;  3IXE A;  2DVW A;  4I1A A;  2DZN A;  4YDW A;  4FHK A;  4ANV A;  4Q94 A;  4F1S A;  5DBK A;  5BXO A;  4U07 A;  5A23 A;  1YCS B;  1PC2 A;  3U4T A;  4FLB A;  4I6E A;  3W9G A;  1MX2 A;  3C3O A;  2PZI A;  3TWX A;  2LO6 A;  4MLP A;  3K9I A;  3U64 A;  3ESL A;  3KSQ A;  3OXF A;  2P9N G;  4JA9 A;  2L0I A;  3HXB A;  4I2Z A;  4DX5 D;  1IKN D;  3UPV A;  1NFI E;  4ZHB A;  4GZ3 A;  4F3V A;  3ZXS A;  4X8Q A;  3CKB A;  5FTP A;  1AP7 A;  2XZD G;  2I2O A;  4A3T A;  4ACL A;  2V0P A;  3ZRH A;  4JZY A;  2YIN A;  3HHM A;  4LCT A;  4CYM D;  1WY6 A;  3SI5 A;  2R2L A;  4GTR A;  1EDU A;  2XRZ A;  4I6G A;  3EHN A;  3UM1 A;  4H7Y A;  2ETC A;  3CVU A;  3FUF A;  3ABK E;  1NZN A;  2I1J A;  4Q96 A;  1OWM A;  1PAQ A;  5T4Y A;  4U04 A;  3FY4 A;  1HS6 A;  1INZ A;  1E90 A;  3HVE A;  1MYO A;  3IEG A;  4B89 A;  4GTM A;  4U0Z A;  2WVI A;  3JXI A;  4I9C A;  4XZ4 A;  4HI9 A;  2J9Q A;  5AYW D;  4EBA A;  4U0U A;  1Q2Z A;  2GRM A;  4U8V D;  1N4R A;  2WXR A;  3FP3 A;  2L0T B;  2LUH A;  4GTS A;  3UKU G;  2IJG X;  3DST A;  2B6C A;  3S7F A;  2EIL E;  4DLO A;  3Q7F A;  2HYZ A;  4I17 A;  4EZL A;  1SZA A;  2DYS E;  3UT4 A;  3LEW A;  4GTT A;  1MHQ A;  1IXV A;  2KZT A;  2MOW A;  3ZFW A;  4RVB A;  3MEK A;  3CK7 A;  1Z5S C;  2RG8 A;  1BD8 A;  4YVQ C;  2QZA A;  2MHK A;  3NZS A;  2GW1 A;  5CED B;  1LD7 A;  3APD A;  5E76 A;  1O1R A;  2E0I A;  5CRU A;  2BKG A;  2VGY A;  1DNP A;  2GRL A;  2V5F A;  3AS8 A;  1NI1 A;  2KBX A;  5AQB A;  3MYV A;  3FHE A;  4BTA A;  2WQH A;  2WXH A;  4JHK A;  3ZHE A;  3APC A;  4J8D A;  3FEX A;  4UUC A;  3ULY A;  2WXK A;  2FO7 A;  1KT1 A;  3WG7 E;  5LFA A;  1IHG A;  1ZB1 A;  3DSS A;  3IKO B;  3ASN E;  4K5A B;  1KT0 A;  1X81 A;  2CHW A;  5BPP A;  4CZ2 D;  4FHJ A;  4WWP A;  1HH8 A;  4URK A;  4TXR A;  3J5Q B;  5EX3 A;  3LYA A;  2IU1 A;  3N71 A;  2IY0 C;  4I2W A;  5ENR D;  3DPY A;  5CBN A;  2IQC A;  5A7D B;  2F8X K;  3SNX A;  5E75 A;  2CHZ A;  1JCR A;  3CK9 A;  3B7R L;  4A55 A;  5FWQ A;  1IYG A;  5FT9 A;  3G2S A;  4ANX A;  3ZVV A;  3ESK A;  2ION A;  2QYJ A;  4AJW A;  4GU5 A;  5D66 A;  5FIO A;  4F1P A;  5LP0 A;  1DCE A;  1OUV A;  2A4Z A;  5ITZ F;  3NQP A;  3JQ0 A;  4MRU A;  3FTU A;  4HI8 A;  2P9P G;  5FQ7 A;  3ABL E;  3LY9 A;  3Q15 A;  5JHB A;  1N0Q A;  2OCC E;  4A3V A;  4LRZ A;  4GYY A;  4U95 D;  3D9P A;  2VQ2 A;  4CDM A;  3T5V A;  1XNF A;  3KSL A;  3QAQ A;  4K5B A;  2FO1 E;  3G2V A;  2OEW A;  3SF4 A;  5AAO A;  4TRQ A;  2DYR E;  2NXP A;  2WQ6 A;  4B8C B;  1E7V A;  2R17 C;  5AJL A;  4RSY A;  1A5E A;  4GCO A;  1QQE A;  4JL0 A;  4GML A;  3BEE A;  3QWP A;  2L6B A;  1HXI A;  2A5U A;  3KEA A;  4N2S A;  1DC2 A;  3UUX A;  3DSX A;  4GTO A;  2XS1 A;  2XGS A;  3AS5 A;  2X38 A;  2XPZ A;  1U3C A;  1E7U A;  3FH8 A;  4CDR A;  4ATG A;  4G26 A;  2IOS A;  5CMW A;  5KJK A;  2BUG A;  4P29 A;  2EIK E;  4LER A;  3U9W A;  2XPY A;  5BW8 C;  3Q79 A;  4G8K A;  4EBA G;  3JUE A;  3CHP A;  4ZFH A;  1H6O A;  4KMO A;  4HQD A;  1S63 A;  4KZ0 A;  2XEV A;  3PS6 A;  2IO2 C;  4RG6 A;  3MV3 B;  5CRV A;  3IHY A;  3D9O A;  3PRZ A;  3WXX A;  4HRM B;  5JHA A;  3R7R A;  2QY7 A;  2GRP B;  1N4S A;  4UWL A;  2E2E A;  3TWQ A;  4KYO B;  4JXT A;  1SQM A;  4YDO A;  4L23 A;  2EIJ E;  2J4D A;  3APF A;  5G2N A;  4E85 A;  3SBS A;  4GA0 A;  2L9B A;  4IN3 B;  2VYI A;  2V5Q C;  1ZU2 A;  4LEU A;  1EF1 C;  3Q9N C;  2RFA A;  3E34 A;  2X6I A;  1TN6 A;  3PH0 C;  5JJ6 A;  3RK6 A;  5CER B;  4HXI A;  2P9L G;  5JA4 D;  1WM5 A;  3FU0 A;  2R05 A;  3LJ3 A;  1FVH A;  1QBQ A;  1SA5 A;  3MV2 B;  5HKP A;  4GMR A;  3CQC B;  3D3M A;  4B93 B;  5M72 A;  4GB9 A;  4N3B A;  3EHQ A;  4YDY A;  4G23 A;  1UJJ A;  4K0R A;  1FT1 A;  2YQ8 A;  2MYO A;  4ILI A;  4L1B A;  4EZK A;  4UQZ A;  4FA6 A;  3DBS A;  1O5M A;  1V55 E;  5LCW J;  5G05 J;  3V2X A;  3UT7 A;  3VLE A;  2X6J A;  2R59 A;  3PNL B;  3QKY A;  4BER A;  3P1U A;  4APF A;  1FVF A;  2VSX E;  5LCW C;  4D10 C;  3DSV A;  5BUZ A;  3ASD A;  3CSF A;  1Y6I A;  3BG0 B;  3PVL A;  3Q73 A;  3R9A B;  2Q7F A;  3L54 A;  1H6K A;  4GZD A;  5CCL A;  4WND A;  2I6H A;  2KZT B;  2Y3A A;  3HIZ A;  2L6J A;  4GYW A;  4J8E A;  4HNA D;  3URZ A;  3JXJ A;  3EIQ C;  3CVP A;  5CHE E;  3G2T A;  4I9E A;  2QC9 A;  3JQ1 A;  3ML8 A;  3MCX A;  3UM3 A;  2IOL A;  2BED A;  2I1K A;  3T8K A;  4B94 A;  1AWC B;  3ZYM A;  2F8Y A;  4XKC A;  2EIN E;  3FTY A;  2BKK B;  2HM8 A;  4CEM A;  3UIP C;  3HRA A;  1DVP A;  3LJN A;  4CT0 A;  1GW6 A;  2XEN A;  3V30 A;  2ZU6 B;  2CFU A;  2Y1L E;  4CGW A;  2C0L A;  2M63 A;  3TAX A;  2JEK A;  3I4G A;  4F7A A;  3AAA C;  3KS2 A;  4I6J A;  3E4B A;  1BI7 B;  4DX2 A;  4G2V A;  1N11 A;  3RO3 A;  1N52 A;  5EX0 A;  4GPK A;  4Q69 A;  5CEA A;  4RG9 A;  4WNE A;  4OAV B;  3TWR A;  3F6Q A;  1A17 A;  2YNQ A;  5ENP D;  2P2C P;  1E8Y A;  4HLE A;  4ME2 A;  1ZBP A;  3AG2 E;  3DSW A;  4BT9 A;  3QOU A;  3DSU A;  3PZ4 A;  4UWF A;  5B3S E;  1E8W A;  4BTB A;  3AG1 E;  1TNO A;  4LUN U;  2VSN A;  3CIA A;  1JCS A;  3TWV A;  3LY7 A;  1MX4 A;  2ETB A;  4DK5 A;  5KWD A;  3S7D A;  4DX7 D;  3L22 A;  2MRI A;  3CLJ A;  2J07 A;  4TXQ A;  2P9S G;  5AAR A;  5G55 A;  3ABM E;  3B95 A;  4WNG A;  2OOE A;  2PM6 A;  5KCM A;  4PS7 A;  3CVV A;  3FUN A;  1TYQ G;  4BET A;  1KZO A;  2UY1 A;  4FJZ A;  4WNF A;  2XEH A;  4PDX A;  3D9K A;  2OEV A;  2ETA A;  5ENS D;  3OXG A;  1D8D A;  3SBT B;  1D8E A;  3EHM A;  2IF4 A;  1K3Z D;  4YND A;  4HOT A;  2XEE A;  3AU4 A;  4N2Q A;  1RZ4 A;  4V3I A;  3MGB A;  1Z3X A;  3HDX A;  1VDY A;  4AM9 A;  3I4R B;  2GGF A;  3DXM G;  1JUQ A;  1HF8 A;  3UT8 A;  5BT1 A;  1SA4 A;  2BF0 X;  3UXG A;  4QQI A;  4JVS A;  3LY8 A;  2PL2 A;  4I1M A;  5BV0 A;  3UM0 A;  5D0O D;  1N4Q A;  4WUY A;  3SFY A;  2ILR A;  2XHE A;  4JW1 A;  3TWS A;  4HOS A;  1WG0 A;  3B7B A;  2JAB A;  1W3B A;  5CMY A;  3OXL A;  2H6F A;  4G11 A;  3CHR A;  3CV0 A;  4EQF A;  4NAC A;  2C0M A;  2ZXW E;  5BV1 A;  3UM2 A;  3RU0 A;  4HRN A;  3PE4 A;  5FZR A;  3QAR A;  4ILH B;  2P9K G;  5JJ7 A;  3ONK A;  3P2B A;  3ASF A;  3T8M A;  3MJW A;  4JB8 P;  4KXK B;  3CVY A;  1X5B A;  3IHV A;  1OCZ E;  4JHJ A;  3X2Q E;  2H6I A;  4A63 B;  1OT8 A;  1Z3Y A;  1O1T A;  4JHR A;  3MKQ A;  1FCH A;  4QFV A;  3ZKJ A;  3B13 A;  4N3C A;  3HXE A;  3ZPJ A;  5KJM A;  3PE3 A;  2NYJ A;  3SZ7 A;  5CCM A;  1QZ2 A;  2FBN A;  3DRA A;  1U3D A;  3L08 A;  2WXP A;  3ZN3 A;  2QFC A;  3ASO E;  2RD0 A;  3R7Q A;  3D9M A;  2Y4U A;  2J09 A;  2YHC A;  4BSZ B;  1YA0 A;  2JLB A;  4XKB A;  2B0O E;  3PUJ A;  4OVV A;  1TN7 A;  3UIO C;  4IRU A;  4TV3 A;  4CDN A;  2R02 A;  3CST A;  4ACK A;  4F53 A;  5AJD A;  2H6H A;  4AP2 A;  4IUL A;  3FFL A;  2VGX A;  3I5P A;  1L5J A;  1PY1 A;  1MQS A;  1IHB A;  1UJK A; 
#chains in the Genus database with same CATH homology
 2ZIS A;  1JCS A;  4LNB A;  3E32 A;  1S64 A;  1TNZ A;  3DSS A;  1FPP A;  1N9A A;  1X81 A;  1N4P A;  2H6G A;  3C72 A;  3Q75 A;  2F0Y A;  3E34 A;  4GTM A;  1O1S A;  1TN6 A;  1N94 A;  3SFX A;  3EU5 A;  4MBG A;  1KZP A;  2IEJ A;  3E37 A;  2BED A;  2H6I A;  1N4R A;  1QBQ A;  1SA5 A;  1JCQ A;  1O1T A;  3DSX A;  4GTS A;  4GTO A;  3DST A;  1KZO A;  4YDE A;  3DPY A;  3Q7F A;  3Q7A A;  1N95 A;  3HXC A;  3KSQ A;  3PZ1 A;  4GTQ A;  1NL4 A;  1LTX A;  1JCR A;  1FT1 A;  1D8D A;  2ZIR A;  1D8E A;  3HXE A;  4GTT A;  1MZC A;  1O5M A;  3HXB A;  3PZ2 A;  3E33 A;  3Q78 A;  3PZ3 A;  3HXF A;  3HXD A;  3Q79 A;  4GTP A;  3DRA A;  4EHM A;  1S63 A;  4LNG A;  3DSV A;  1DCE A;  1SA4 A;  1TNU A;  1LD7 A;  3Q73 A;  1TN8 A;  1TNB A;  1N4S A;  3E30 A;  1O1R A;  1TN7 A;  1N4Q A;  2R2L A;  4GTR A;  3DSW A;  1TNY A;  3SFY A;  1NI1 A;  2H6H A;  4GTV A;  3DSU A;  3PZ4 A;  4YDO A;  1FT2 A;  3EUV A;  4L9P A;  2H6F A;  1TNO A;  1LD8 A;  3KSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...