2V5QC

Crystal structure of wild-type plk-1 kinase domain in complex with a selective darpin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
SDLGKKLLEAARAGQDDEVRILIANGADVNAVDNTGLTPLHLAAVSGHLEIVEVLLKHGADVDAADVYGFTPLHLAAMTGHLEIVEVLLKYGADVNAFDMTGSTPLHLAADEGHLEIVEVLLKYGADVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords SERINE/THREONINE-PROTEIN KINASE PLK1
publication title Structure of wild-type Plk-1 kinase domain in complex with a selective DARPin.
pubmed doi rcsb
source organism Homo sapiens
total genus 43
structure length 130
sequence length 130
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2v5qC00
1DCQA 5ENOD 5CEDB 2F8XK 1BI8B 5D66A 4CZ2D 5HS0A 3TWQA 3UXGA 3V2OA 4LSZE 3JUEA 5CECB 1WDYA 3B7BA 1S70B 3UTMA 1NFIE 5EN5D 2ZGDA 5ENQD 5JA4D 3EHRA 5CBOA 2MYOA 4OAVB 4ZHBA 1TR4A 3C5RA 5CBNA 3V2XA 3DEPA 4HRLA 3V31A 3V79K 4HI9A 3W9GA 2L6BA 2QC9A 4G8LA 5ITZF 2XZDG 5KBAA 4HBDA 4LNUD 3ZNGA 4K5BA 2ZGGA 2F8YA 3KEAA 3Q9NC 3AAAC 2KBXA 4Z68A 1MJ0A 1BU9A 1BI7B 5EYLA 1BD8A 1YYHA 1OT8A 2FO1E 2ETBA 3TWXA 2DZNA 4G8KA 5HKPA 2A5EA 2J8SD 5AQ9A 3T8KA 2JABA 5AQAA 3F6QA 3JXIA 4TUMA 4JB8P 4YDYA 3ZUVB 2XEEA 1D9SA 1IHBA 3J5QB 4F1PA 4BSZB 5AAOA 1MYOA 4U8YD 1QYMA 4O60A 4HRNA 4BESA 2ETAA 3EU9A 2XEHA 1K1BA 2XZTG 4HB5A 5EIBE 1AWCB 4K5AB 4BEPA 4HQDA 3IXEA 1K3ZD 1N0RA 3SO8A 2Y1LE 5KNGA 5JMND 5KNHD 2AJAA 5KWDA 2QYJA 3T9KA 4HNAD 2Y0BG 2DZOA 4QFVA 4CYMD 5FINA 1N11A 2HE0A 5ENPD 5AQBA 4F6RD 4HRMB 2F37A 3TWUA 4A63B 1YCSB 3HG0D 3JXJA 4GPMA 4OAUC 5AN8A 4UUCA 4O1PA 5FIOA 3W9FA 3TWSA 3TWVA 5ENTD 3TWRA 1YMPA 2P2CP 5EIDA 2DWZA 1WG0A 4U95D 1G3NB 3AJIA 2VGEA 5HRYA 4DUIA 3B95A 4DX1A 3TWTA 4ZFHA 3NOGD 4DX2A 3NOCD 4BERA 2V5QC 3DEOA 4U96D 1SW6A 4LG6A 2ETCA 5EILA 4DRXE 4DX7D 2BKKB 3NBNB 3LJNA 5ENSD 1OY3D 4RLYA 3Q9UC 4HLLA 3V30A 2KXPC 5AQ7A 1A5EA 4GMRA 1MX2A 2V4HC 4J7WA 4ATZD 5CERB 1N0QA 2B0OE 2DVWA 4U8VD 1UOHA 3UI2A 4DX5D 1MX4A 1MX6A 5BXOA 1DC2A 3D9HA 4YDWA 1IXVA 2RFAA 1BLXB 4BETA 2PNNA 4B93B 3J5PA 1AP7A 3EHQA 5AARA 1IKND 4J8YA 5EYPF 4HI8A 1K1AA 3ZU7B 5BXUA 3TWWA 2NYJA 4N5QA 2BKGA 3ZKJA 2RFMA 1SVXA 4O1OA 4C48B 4NIKA 2XENA 4QQIA 4K5CA 4DX6D 3HRAA 5CEAA 5ENRD
chains in the Genus database with same CATH superfamily
4YNDA 3B7SA 1FPPA 3APDA 4XI9A 2OEVA 5FZSA 4HOSA 2I2OA 5AJDA 4EQFA 1OWMA 3SI5A 3R7QA 4U63A 4HRLA 3Q79A 1H2TC 3GZSA 4BTBA 2QC9A 3BU8A 2XRZA 4F7AA 1FT1A 5G55A 3ZIMA 4K5BA 2KCLA 1BI7B 5EYLA 2A5EA 3FP3A 3FUEA 3F6QA 2WQHA 4ACKA 3DPDA 2H6HA 5LFAA 1SZAA 4N5CA 3P1UA 3EU9A 3KD7A 3PRZA 4RVBA 3DSSA 2ZU6B 1K3ZD 2GRRB 5E76A 3FTYA 4U7EB 2Y4TA 4EBAG 3CV0A 1N11A 5BV1A 4GPMA 2GW1A 3W9FA 4ILGA 4WAFA 3PE3A 3Q7AA 3B95A 1LTXA 4DRXE 2WXKA 3CKBA 5ANRA 4Y6CA 2H6IA 3FU0A 1S0PA 4A1SA 3I4GA 3JUIA 3PUKA 3SD5A 3PREA 3C3OA 3IEGA 3MA5A 1YA0A 2X3MA 4K5CA 2AWIA 2DYRE 3HIZA 1TJFA 2WXHA 4ANUA 1DCEA 5CBNA 3ONLA 5JJ6A 3ENEA 3ULQA 5A6CA 4CDRA 3ZHEA 3APFA 3AS5A 3SFZA 1YYHA 3PUJA 3EU5A 4G8KA 3FTZA 3LY9A 4N3AA 3MCXA 1E8WA 1IHBA 1WY6A 5FT9A 3T5VA 4I1MA 4PS3A 3B7TA 4CDNA 2KCVA 4ATGA 2C2LA 4LEUA 1H6PA 2C0LA 1YCSB 1TNYA 3HG0D 1OCRE 1X81A 3UM1A 2X38A 3AJIA 2R2LA 4GZCA 3TWTA 4ZFHA 4TRQA 2ETCA 5ENSD 2JLBA 5FTPA 2XCCA 2KXPC 5CERB 3PNLB 4JHJA 3D9HA 1UN9A 1IXVA 1AP7A 3SZ7A 1OCOE 4HI8A 3LY7A 1HH8A 4GTQA 1HX8A 3PEUB 5CEDB 1EDUA 3QOUA 4HVBA 3FUHA 2V8SE 3KSQA 2YHEA 3N71A 2IEJA 1L5JA 1Z5SC 4LERA 1P5QA 3FUFA 2P9IG 4EPZA 4J8SA 4G8LA 1PAQA 4LNUD 3ZPJA 3S7FA 3GZ1A 1MJ0A 2WXMA 2XPYA 2EQXA 2CFUA 3HYMB 4CT4A 2XEEA 3UT8A 2V0PA 5LCWC 4BESA 3CIAA 3RRNB 4JPSA 3IXEA 3JQ0A 4RQIA 2KZTB 4XE0A 4UWGA 2XCBA 3OXGA 1JWFA 3NZUA 4BT8A 4NURA 5FIOA 4XZ4A 4GU5A 4AVXA 2YNQA 2MRIA 2DWZA 4GYYA 3AG2E 3Q5MA 4U04A 4TV3A 4FP7A 4RG9A 5AJLA 5KJKA 5B1AE 4I6EA 1JCQA 2P9LG 3SY2A 1H6OA 3ONKA 1TNBA 2IY0C 1BLXB 1Y8MA 4GZDA 2X6KA 4UWHA 2BUGA 3DSXA 4GA2A 3FUMA 4HOTA 4HS2A 3CVLA 5CEAA 3LDZA 3VLEA 3E4BA 3ESLA 4CZ2D 3G2VA 3HVEB 4KVMA 2CG2A 2WXQA 3RKVA 5CECB 2XS8A 3QB2A 3BG1B 3AG1E 2J49A 2GROB 3DEPA 3HXCA 3RIBA 1IYGA 4FULA 4I2ZA 2F8YA 3MKQB 3CHQA 4UWLA 3S7BA 5ARFA 3T8MA 2LXMA 5AQAA 3ZUVB 3LJ3A 4A3TA 2WXJA 3B7RL 1HFAA 3IHYA 2XEHA 2E2EA 4BEPA 4JXTA 3I4RB 3DSUA 1OCCE 1N4SA 2UY1B 3EJNA 4GAAA 4A3VA 5AQBA 2WVIA 4CDMA 4JW1A 5HI7A 5AN8A 3SBSA 3FUIA 3FTSA 3ASHA 2VGYA 2IO3C 4TXQA 3CVWA 2L0IA 1EPUA 4OYSA 4GMRA 2WQ6A 2WXFA 3J5PA 1DNPA 2R05A 1K1AA 2P9KG 3TXNA 3DSTA 4C48B 3DXMG 3JQ1A 5BW8C 4P29A 3Q4AB 1SZ9A 3MGBA 1QBQA 4GCOA 3ZGQA 2XHEA 3L17A 4HORA 4BSXA 2YINA 3JYSA 3UTMA 1NFIE 5JA4D 1KPSB 5CRUA 1OUVA 3W9GA 3KEZA 5ITZF 3UM2A 4FHKA 4HBDA 2ZGGA 2P9UG 4AV7A 1OWLA 2ETBA 5HKPA 3IKOB 1N54A 3ASNE 3LY8A 3TGOA 4YDYA 4ACLA 4W9RA 5ENNA 1H2VC 4NACA 3GW4A 3AG3E 2X6IA 2QYUA 4U8YD 3CK8A 5BNWA 4FLHA 3ABKE 1AWCB 1TN6A 4HQDA 1UJJA 4APFA 4L9PA 3ABME 2I6HA 1H6KA 4PDXA 5FINA 3ASOE 4HRMB 2F37A 3JXJA 3EHMA 4WWOA 3ULYA 5AYWD 3TWVA 3CLJA 4O6FA 5FWQA 3JCKC 3WXXA 2XRYA 4GCNA 3ML9A 3G2TA 2LUHA 4PS8A 3NBNB 3DRAA 3FU6A 2PM7A 2J4BA 3GYZA 1N0QA 2DVWA 3UI2A 4KVOA 3FUJA 1JPLA 3FUNA 3CSTA 3U64A 3SGHA 3FUDA 3TWWA 4LNGA 4AY5A 4U07A 2EIJE 3OXFA 5CCLA 3ML8A 4H7YA 4MKTA 3PZ1A 2WXLA 4GTTA 1XNFA 4YVQC 4JEHA 3ESKA 3E30A 3MYVA 2GGFA 3C3RA 4GB9A 3D9IA 3LKUA 2LSVA 2ZGDA 4ANVA 2KATA 3E32A 2WQ7A 4G26A 1N95A 1W3BA 4DPRA 2E0IA 1Y6IA 2R59A 3G2SA 3MV3B 3AS8A 3AAAC 2XQ0A 3CHSA 3SFYA 4KMOA 2J8SD 4B94A 3ZYQA 4GA0A 2JABA 3PEVB 2XGMA 3CR3A 4OVVA 4WNEA 2FULA 3OXLA 1KZPA 5AAOA 3UKRG 4N39A 3SFXA 4EECA 2GRLA 2Y3AA 2HR2A 3QKYA 4N3CA 2F0YA 3SBTB 3SO8A 5KWDA 4YDOA 4GTVA 4XX5A 2DZOA 3LPZA 2VGXA 3FTUA 3LEWA 2EIKE 4RG6A 1LD7A 4HOQA 4O1PA 3MKRA 3TWSA 2P58C 1LD8A 3CHRA 3FTVA 3D9JA 4DX1A 3R9MA 4CGWA 4DX2A 4E85A 5EILA 3R9AB 4DLQA 2VSYA 3MZLB 3Q9UC 4D10C 1QNFA 5AQ7A 2V4HC 1KLXA 5KJLA 2BF0X 3DWLG 1MX6A 4GMJA 2IOSA 2PZIA 2HYZA 3EHQA 5AARA 4F1SA 4FJYA 1E8XA 3CQGB 4XKBA 3ASDA 4BX8A 1GW6A 3Q49B 1KZOA 4AY6A 2HM8A 3CK7A 4U0ZA 5ENQD 3C5RA 3V2XA 1Z6TA 3IV0A 3TG5A 2L6BA 3ZNGA 3Q9NC 2R17C 2B6CA 2XEVA 2DZNA 2EINE 3T8KA 3UIOC 3O48A 3FULA 3U66A 3QNKA 2ILRA 1B89A 4K5AB 2JEKA 5JMND 1JUQA 4CYMD 1K8KG 2PQNA 1IHGA 3TXMA 2OV8A 4C0MA 1U3DA 4UUCA 2QFCA 2P2CP 4DLOA 5HRYA 4M3OA 2WXPA 3DEOA 3OTNA 4CGVA 2C0MA 5G04J 1S63A 4TUUA 2B0OE 3QWVA 4GYWA 1HU3A 3B13A 4FA6A 4A1GA 4BETA 2RD0A 4G24A 4HOUA 2IF4A 5BXUA 2FBNA 1TNZA 4N5QA 3DSWA 1U2VG 2CHZA 2KC7A 1DVPA 5LX8A 4JC8A 3LS8A 1FT2A 3K9IA 5HS0A 3ZXPA 3V2OA 1N94A 1ZBPA 2LNIA 5J90A 2LO6A 1XGWA 4GZ3A 2LSUA 4CT0A 4PH4B 3CHOA 2MYOA 5E75A 3KS2A 4B0ZA 4JHRA 3TAXA 1O5MA 3L54A 1Z3YA 1INZA 2NXPA 4URKA 3Q73A 3URZA 5CMYA 1E96B 1MYOA 3UT7A 1K1BA 1V55E 2ZISA 1HXIA 3APCA 2YHCA 4U8HA 4E6HA 5ENTD 1N4RA 5G05J 2CFZA 4AM9A 2LAHA 4L7TA 1HS6A 2BKKB 5AENA 4DI3A 2AVPA 3ULEG 5AIJA 3L22A 2H6FA 3NQPA 1UOHA 4DX5D 3CVPA 2PQRA 3KSLA 4GA1A 1IKND 2AW6A 3DSVA 2J9QA 1JCSA 2WMOA 1NP7A 5JJ7A 1N52A 2UWJG 3LCAA 3FWVA 2I1KA 5LOZA 5ENRD 4JA9A 3HXBA 2VTBA 4B89A 4KZCA 4WWPA 5D66A 1OWNA 4LSZE 1H0AA 5EN5D 4ZHBA 3Q7FA 3PDNA 3G2UA 3OAWA 1N4QA 1Q2ZA 2AXUA 3C98A 5EX3A 3SNXA 3UMVA 3E37A 1IQRA 4J8EA 4J6IA 3AS4A 5FQ6A 4CEMA 2VSOE 5IY5E 2DBAA 2BEDA 2RG8A 4G11A 3FH8A 2OCCE 3AU4A 4LRZA 2KZTA 2Y1LE 3G2WA 5CMWA 3T9KA 4C0EA 2V4LA 4K0RA 2IOLA 4A63B 4V3IA 1NL4A 4GYOA 2P9NG 1LF8A 4L1BA 2CHWA 4YVOA 2WMNA 1HZ4A 4JA7A 2BTDA 2VJ8A 4DK5A 1D8EA 3LJNA 4ATZD 4J7WA 4U8VD 3HDXA 3Q78A 1NI1A 2IONA 3TJPA 4DJAA 2X6HA 1N4PA 3HXEA 5JHAA 3PNTB 3ZKJA 4GTPA 5B1BE 4O1OA 4MLPA 2Y4UA 5DBKA 4BX9A 3NZSA 2J09A 1DCQA 2IO2C 3HVEA 4R7LA 3S7DA 4HXIA 4GTMA 4F53A 2XGOA 3LYAA 3UINC 3GZ2A 3MKQA 3KEAA 1UN8A 4J8DA 4I1AA 5M72A 3TWXA 5A7DB 1PC2A 2IFUA 4FC8A 3BEEA 4BSZB 3ISMC 2ONDA 2ETAA 3CVYA 1E7UA 3TG4A 2IJGX 2R5SA 2UY1A 4HNAD 3ZVVA 4AEZC 2HE0A 4OVUA 3CVQA 2FI7A 3BQOA 3CKCA 4DUIA 2Y69E 3CVNA 3HXDA 4WUYA 2WXRA 3NOCD 2LAIA 3D9KA 4U96D 4JL0A 3UUXA 4DX7D 3C3QA 1OY3D 3FH5A 3SQVA 1SQMA 1OXJA 4JVSA 1TYQG 3IHVA 2I9CA 4B93B 4TXRA 1FVFA 1X5BA 2KCKA 4A55A 4KYOB 4XI0A 5A23A 2X6FA 5CCMA 3PE4A 3AU5A 1E8ZA 1ZU2A 3I5PA 4I6GA 3UXGA 4I9EA 3FDHA 3JUEA 4N2SA 1EF1C 4WNFA 3V31A 5CHEE 2XS1A 3E33A 5AQ9A 3FU5A 5G04C 4KZ0A 3PZ4A 4ABNA 4UWFA 3UX4A 5KJNA 2VYIA 3ZYLA 3FTXA 1N0RA 5ANLA 3UM3A 2AJAA 4BWRA 3QWPA 1IQUA 3QDNA 3ZRHA 1NA0A 1U3CA 4OAUC 3L08A 3ZN3A 3Q47B 3U9WA 1V54E 5G2NA 1MQSA 4G2VA 5D2MC 4MS6A 2LXLA 3X2QE 2XPZA 2OVBA 3ASFA 4RLYA 1A5EA 1MX2A 1O1TA 4G25A 1DC2A 1MX4A 2OVFA 2WXNA 3D9PA 3D3MA 4I2WA 3ZU7B 2PL2A 4U0UA 4GTOA 4TXPA 3FEXA 3ZYMA 4IYPA 4LNBA 1SVXA 5KCMA 2FO7A 5ARGA 4GZ6A 3ZFWA 2J07A 2P9PG 3Q75A 2CHXA 1BI8B 4WWNA 3ZXSA 4JD2G 4LCTA 3E34A 2OEWA 2YQ8A 3CVUA 5CBOA 3QWWA 3V79K 1A17A 5G05C 5C1DA 4FU3A 3ZHEB 2WXOA 3S2AA 1KT1A 4HFGA 2DIWA 4JEUA 5BPPA 3UPVA 1H2UA 1QYMA 3BG0B 5D0OD 4Q94A 2PM6A 3EDTB 2XZTG 2FEZA 1TNOA 5KNHD 4QFVA 3R7RA 3ZW3A 5T3RA 4FJZA 1SA4A 1YMPA 5EIDA 2WXGA 3FFLA 1G3NB 3CQCB 2V5QC 3L6AA 1E8YA 4FADA 3V30A 5D0QD 2WXIA 3FHEA 5DIZA 4GTRA 4Q96A 2V5FA 1FCHA 4YDWA 5T8IA 2RFAA 4J8YA 5EYPF 4UI9J 5FQ4A 1ELWA 3CGHA 3D9MA 2BKGA 4ANWA 2IU1A 2KM4A 2RFMA 2WB2A 3LVRE 4DX6D 2MHKA 2NSZA 4KT6B 5ENOD 2X6JA 3QC1A 4ILIA 3TWQA 1RW2A 4U0SA 5LP0A 1WDYA 1WAO1 4RSYA 3EHRA 4OAVB 1FVHA 1TR4A 5B3SE 5FQ8A 4HLEA 4HI9A 3UKUG 2XZDG 5FZQA 4Z68A 2KBXA 5EKQD 1VDYA 3CVVA 3UT4A 3L13A 3UM0A 4BTAA 4AP2A 4JB8P 2L0TB 2VSXE 4KXKB 4K03A 3J5QB 3MV2B 1PY1A 4O60A 4L2YA 4I43A 3RU0A 1TN8A 5KNGA 5JJTA 2L9BA 3TWUA 1MZCA 5EX0A 4C9BB 3MX3A 1QQEA 4MBGA 2QY7A 4DI4A 4BERA 4ANXA 4LG6A 3NF1A 3RAUA 1MHQA 4Q69A 2VTBB 5BXOA 2ZXWE 5FJYA 3KAEA 3CSFA 1JCRA 1O1RA 2PNNA 4J8FA 2J4DA 2WM9A 1HG2A 3D9OA 2WPVA 4H7XA 3HHMA 3PZDA 4GTSA 3QK0A 4NIKA 3FH7A 1N9AA 1HO8A 3CK9A 3ABLE 5BV0A 2L6JA 3UIPC 2GRPB 4IRUA 3B7BA 1S70B 4KBQA 4L2LA 4PS7A 3PZ3A 2Q7FA 2J08A 3Q15A 2RKKA 3EUVA 3IBEA 5EDSA 1BU9A 5T4YA 1BD8A 3FY4A 3ZEFA 2A5UA 3UQ3A 3JXIA 4TUMA 3DBSA 2A4ZA 3FTWA 1TN7A 4I9CA 1Z3XA 4UI9K 4HB5A 4B8CB 3NB2A 3QARA 3FEYA 2GRQB 3CEQA 4UQZA 3PZ2A 4F6RD 3I3NA 4XKCA 3RO3A 4GPKA 3P2BA 3L16A 2VGEA 1E7VA 4M7CA 5HQ8A 2FF4A 3RSEG 1SW6A 2EILE 5CRVA 4CRWA 1HE8A 4ME2A 4BY6A 1EYHA 4AXHA 1HF8A 4WNDA 1JWGA 1QZ2A 4N2QA 3PS6A 4Y6WA 2XGSA 2M63A 3HRAA 4UWKA 3S7JA 3O4ZA 2VSNA 4APOA 4BT9A 3VLFA 3PVLA 3L82A 3AG4E 3PH0C 2DCPA 2R02A 4XIFA 3NAWA 5KBAA 2XPIA 1OWPA 3CHPA 5C2YA 2MOWA 1RZ4A 4AIFA 3RJVA 5H7PA 3QAQA 1OT8A 4FLBA 4X8QA 4NQ0A 4JHKA 4AOFA 4B8AA 1D9SA 5J08A 3B7UX 1OCZE 4UQYA 5BT1A 1WM5A 3TL5A 3VTYA 1UG3A 4I6JA 4I17A 5FZRA 2QYJA 3HXFA 4CCAA 1E90A 2NC9A 1TJCA 4G23A 4N3BA 3ASGA 3C72A 3LVQE 1WG0A 1UW4B 2GRNB 3NOGD 3BUAA 3QJZA 4YDEA 4J0UA 1ELKA 5FQ7A 3ZYKA 3EHNA 5LCWJ 3T5XA 2VQ2A 4EBAA 2NYJA 3FUKA 5KJMA 3FU3A 2XENA 4UQXA 3MEKA 4NRHB 2F8XK 3EIQC 2AXZA 4JZYA 2R03A 2EIME 3CVXA 4PUCA 4FHJA 4GZ5A 3RRUA 5JHBA 1KT0A 4XEIG 3EIJA 1UJKA 3RO2A 3RK6A 3DXKG 3WG7E 3SF4A 1NZNA 2FO1E 3VLDA 4MRUA 2I1JA 4F1PA 1ELRA 2OOEA 3CHMA 3RRMB 1NA3A 2H6GA 3SHFA 1S64A 2IQCA 4HRNA 4UI9C 4BFRA 5EIBE 3DPYA 2Y0BG 4IN3B 4G1TA 4F3VA 5ENPD 1BPOA 4L23A 2VGXB 1ZB1A 1HG5A 1TNUA 1D8DA 3MJWA 4AJWA 5BUZA 3L9TA 3TWRA 4U95D 1TEZA 2P9SG 1H19A 3U3WA 2CG3A 2AXVA 2ZIRA 4EHMA 2GRMA 4GMLA 4HLLA 1SA5A 3D9NA 3LXUX 4LUNU 4WNGA 2HO1A 4EZJA 2QZAA 4EZLA 4I1OB 4ILHB 3D9LA 1OWOA 3U4TA 4QQIA 3VTXA 1O1SA 4EZKA 4IULA 2DYSE
chains in the Genus database with same CATH topology
1DCQA 5ENOD 5CEDB 2F8XK 1BI8B 5D66A 4CZ2D 5HS0A 3TWQA 3UXGA 3V2OA 4LSZE 3JUEA 5CECB 1WDYA 3B7BA 1S70B 3UTMA 1NFIE 5EN5D 2ZGDA 5ENQD 5JA4D 3EHRA 5CBOA 2MYOA 4OAVB 4ZHBA 1TR4A 3C5RA 5CBNA 3V2XA 3DEPA 4HRLA 3V31A 3V79K 4HI9A 3W9GA 2L6BA 2QC9A 4G8LA 5ITZF 2XZDG 5KBAA 4HBDA 4LNUD 3ZNGA 4K5BA 2ZGGA 2F8YA 3KEAA 3Q9NC 3AAAC 2KBXA 4Z68A 1MJ0A 1BU9A 1BI7B 5EYLA 1BD8A 1YYHA 1OT8A 2FO1E 2ETBA 3TWXA 2DZNA 4G8KA 5HKPA 2A5EA 2J8SD 5AQ9A 3T8KA 2JABA 5AQAA 3F6QA 3JXIA 4TUMA 4JB8P 4YDYA 3ZUVB 2XEEA 1D9SA 1IHBA 3J5QB 4F1PA 4BSZB 5AAOA 1MYOA 4U8YD 1QYMA 4O60A 4HRNA 4BESA 2ETAA 3EU9A 2XEHA 1K1BA 2XZTG 4HB5A 5EIBE 1AWCB 4K5AB 4BEPA 4HQDA 3IXEA 1K3ZD 1N0RA 3SO8A 2Y1LE 5KNGA 5JMND 5KNHD 2AJAA 5KWDA 2QYJA 3T9KA 4HNAD 2Y0BG 2DZOA 4QFVA 4CYMD 5FINA 1N11A 2HE0A 5ENPD 5AQBA 4F6RD 4HRMB 2F37A 3TWUA 4A63B 1YCSB 3HG0D 3JXJA 4GPMA 4OAUC 5AN8A 4UUCA 4O1PA 5FIOA 3W9FA 3TWSA 3TWVA 5ENTD 3TWRA 1YMPA 2P2CP 5EIDA 2DWZA 1WG0A 4U95D 1G3NB 3AJIA 2VGEA 5HRYA 4DUIA 3B95A 4DX1A 3TWTA 4ZFHA 3NOGD 4DX2A 3NOCD 4BERA 2V5QC 3DEOA 4U96D 1SW6A 4LG6A 2ETCA 5EILA 4DRXE 4DX7D 2BKKB 3NBNB 3LJNA 5ENSD 1OY3D 4RLYA 3Q9UC 4HLLA 3V30A 2KXPC 5AQ7A 1A5EA 4GMRA 1MX2A 2V4HC 4J7WA 4ATZD 5CERB 1N0QA 2B0OE 2DVWA 4U8VD 1UOHA 3UI2A 4DX5D 1MX4A 1MX6A 5BXOA 1DC2A 3D9HA 4YDWA 1IXVA 2RFAA 1BLXB 4BETA 2PNNA 4B93B 3J5PA 1AP7A 3EHQA 5AARA 1IKND 4J8YA 5EYPF 4HI8A 1K1AA 3ZU7B 5BXUA 3TWWA 2NYJA 4N5QA 2BKGA 3ZKJA 2RFMA 1SVXA 4O1OA 4C48B 4NIKA 2XENA 4QQIA 4K5CA 4DX6D 3HRAA 5CEAA 5ENRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DCQ A;  5ENO D;  5CED B;  2F8X K;  1BI8 B;  5D66 A;  4CZ2 D;  5HS0 A;  3TWQ A;  3UXG A;  3V2O A;  4LSZ E;  3JUE A;  5CEC B;  1WDY A;  3B7B A;  1S70 B;  3UTM A;  1NFI E;  5EN5 D;  2ZGD A;  5ENQ D;  5JA4 D;  3EHR A;  5CBO A;  2MYO A;  4OAV B;  4ZHB A;  1TR4 A;  3C5R A;  5CBN A;  3V2X A;  3DEP A;  4HRL A;  3V31 A;  3V79 K;  4HI9 A;  3W9G A;  2L6B A;  2QC9 A;  4G8L A;  5ITZ F;  2XZD G;  5KBA A;  4HBD A;  4LNU D;  3ZNG A;  4K5B A;  2ZGG A;  2F8Y A;  3KEA A;  3Q9N C;  3AAA C;  2KBX A;  4Z68 A;  1MJ0 A;  1BU9 A;  1BI7 B;  5EYL A;  1BD8 A;  1YYH A;  1OT8 A;  2FO1 E;  2ETB A;  3TWX A;  2DZN A;  4G8K A;  5HKP A;  2A5E A;  2J8S D;  5AQ9 A;  3T8K A;  2JAB A;  5AQA A;  3F6Q A;  3JXI A;  4TUM A;  4JB8 P;  4YDY A;  3ZUV B;  2XEE A;  1D9S A;  1IHB A;  3J5Q B;  4F1P A;  4BSZ B;  5AAO A;  1MYO A;  4U8Y D;  1QYM A;  4O60 A;  4HRN A;  4BES A;  2ETA A;  3EU9 A;  2XEH A;  1K1B A;  2XZT G;  4HB5 A;  5EIB E;  1AWC B;  4K5A B;  4BEP A;  4HQD A;  3IXE A;  1K3Z D;  1N0R A;  3SO8 A;  2Y1L E;  5KNG A;  5JMN D;  5KNH D;  2AJA A;  5KWD A;  2QYJ A;  3T9K A;  4HNA D;  2Y0B G;  2DZO A;  4QFV A;  4CYM D;  5FIN A;  1N11 A;  2HE0 A;  5ENP D;  5AQB A;  4F6R D;  4HRM B;  2F37 A;  3TWU A;  4A63 B;  1YCS B;  3HG0 D;  3JXJ A;  4GPM A;  4OAU C;  5AN8 A;  4UUC A;  4O1P A;  5FIO A;  3W9F A;  3TWS A;  3TWV A;  5ENT D;  3TWR A;  1YMP A;  2P2C P;  5EID A;  2DWZ A;  1WG0 A;  4U95 D;  1G3N B;  3AJI A;  2VGE A;  5HRY A;  4DUI A;  3B95 A;  4DX1 A;  3TWT A;  4ZFH A;  3NOG D;  4DX2 A;  3NOC D;  4BER A;  2V5Q C;  3DEO A;  4U96 D;  1SW6 A;  4LG6 A;  2ETC A;  5EIL A;  4DRX E;  4DX7 D;  2BKK B;  3NBN B;  3LJN A;  5ENS D;  1OY3 D;  4RLY A;  3Q9U C;  4HLL A;  3V30 A;  2KXP C;  5AQ7 A;  1A5E A;  4GMR A;  1MX2 A;  2V4H C;  4J7W A;  4ATZ D;  5CER B;  1N0Q A;  2B0O E;  2DVW A;  4U8V D;  1UOH A;  3UI2 A;  4DX5 D;  1MX4 A;  1MX6 A;  5BXO A;  1DC2 A;  3D9H A;  4YDW A;  1IXV A;  2RFA A;  1BLX B;  4BET A;  2PNN A;  4B93 B;  3J5P A;  1AP7 A;  3EHQ A;  5AAR A;  1IKN D;  4J8Y A;  5EYP F;  4HI8 A;  1K1A A;  3ZU7 B;  5BXU A;  3TWW A;  2NYJ A;  4N5Q A;  2BKG A;  3ZKJ A;  2RFM A;  1SVX A;  4O1O A;  4C48 B;  4NIK A;  2XEN A;  4QQI A;  4K5C A;  4DX6 D;  3HRA A;  5CEA A;  5ENR D; 
#chains in the Genus database with same CATH topology
 4YND A;  3B7S A;  1FPP A;  3APD A;  4XI9 A;  2OEV A;  5FZS A;  4HOS A;  2I2O A;  5AJD A;  4EQF A;  1OWM A;  3SI5 A;  3R7Q A;  4U63 A;  4HRL A;  3Q79 A;  1H2T C;  3GZS A;  4BTB A;  2QC9 A;  3BU8 A;  2XRZ A;  4F7A A;  1FT1 A;  5G55 A;  3ZIM A;  4K5B A;  2KCL A;  1BI7 B;  5EYL A;  2A5E A;  3FP3 A;  3FUE A;  3F6Q A;  2WQH A;  4ACK A;  3DPD A;  2H6H A;  5LFA A;  1SZA A;  4N5C A;  3P1U A;  3EU9 A;  3KD7 A;  3PRZ A;  4RVB A;  3DSS A;  2ZU6 B;  1K3Z D;  2GRR B;  5E76 A;  3FTY A;  4U7E B;  2Y4T A;  4EBA G;  3CV0 A;  1N11 A;  5BV1 A;  4GPM A;  2GW1 A;  3W9F A;  4ILG A;  4WAF A;  3PE3 A;  3Q7A A;  3B95 A;  1LTX A;  4DRX E;  2WXK A;  3CKB A;  5ANR A;  4Y6C A;  2H6I A;  3FU0 A;  1S0P A;  4A1S A;  3I4G A;  3JUI A;  3PUK A;  3SD5 A;  3PRE A;  3C3O A;  3IEG A;  3MA5 A;  1YA0 A;  2X3M A;  4K5C A;  2AWI A;  2DYR E;  3HIZ A;  1TJF A;  2WXH A;  4ANU A;  1DCE A;  5CBN A;  3ONL A;  5JJ6 A;  3ENE A;  3ULQ A;  5A6C A;  4CDR A;  3ZHE A;  3APF A;  3AS5 A;  3SFZ A;  1YYH A;  3PUJ A;  3EU5 A;  4G8K A;  3FTZ A;  3LY9 A;  4N3A A;  3MCX A;  1E8W A;  1IHB A;  1WY6 A;  5FT9 A;  3T5V A;  4I1M A;  4PS3 A;  3B7T A;  4CDN A;  2KCV A;  4ATG A;  2C2L A;  4LEU A;  1H6P A;  2C0L A;  1YCS B;  1TNY A;  3HG0 D;  1OCR E;  1X81 A;  3UM1 A;  2X38 A;  3AJI A;  2R2L A;  4GZC A;  3TWT A;  4ZFH A;  4TRQ A;  2ETC A;  5ENS D;  2JLB A;  5FTP A;  2XCC A;  2KXP C;  5CER B;  3PNL B;  4JHJ A;  3D9H A;  1UN9 A;  1IXV A;  1AP7 A;  3SZ7 A;  1OCO E;  4HI8 A;  3LY7 A;  1HH8 A;  4GTQ A;  1HX8 A;  3PEU B;  5CED B;  1EDU A;  3QOU A;  4HVB A;  3FUH A;  2V8S E;  3KSQ A;  2YHE A;  3N71 A;  2IEJ A;  1L5J A;  1Z5S C;  4LER A;  1P5Q A;  3FUF A;  2P9I G;  4EPZ A;  4J8S A;  4G8L A;  1PAQ A;  4LNU D;  3ZPJ A;  3S7F A;  3GZ1 A;  1MJ0 A;  2WXM A;  2XPY A;  2EQX A;  2CFU A;  3HYM B;  4CT4 A;  2XEE A;  3UT8 A;  2V0P A;  5LCW C;  4BES A;  3CIA A;  3RRN B;  4JPS A;  3IXE A;  3JQ0 A;  4RQI A;  2KZT B;  4XE0 A;  4UWG A;  2XCB A;  3OXG A;  1JWF A;  3NZU A;  4BT8 A;  4NUR A;  5FIO A;  4XZ4 A;  4GU5 A;  4AVX A;  2YNQ A;  2MRI A;  2DWZ A;  4GYY A;  3AG2 E;  3Q5M A;  4U04 A;  4TV3 A;  4FP7 A;  4RG9 A;  5AJL A;  5KJK A;  5B1A E;  4I6E A;  1JCQ A;  2P9L G;  3SY2 A;  1H6O A;  3ONK A;  1TNB A;  2IY0 C;  1BLX B;  1Y8M A;  4GZD A;  2X6K A;  4UWH A;  2BUG A;  3DSX A;  4GA2 A;  3FUM A;  4HOT A;  4HS2 A;  3CVL A;  5CEA A;  3LDZ A;  3VLE A;  3E4B A;  3ESL A;  4CZ2 D;  3G2V A;  3HVE B;  4KVM A;  2CG2 A;  2WXQ A;  3RKV A;  5CEC B;  2XS8 A;  3QB2 A;  3BG1 B;  3AG1 E;  2J49 A;  2GRO B;  3DEP A;  3HXC A;  3RIB A;  1IYG A;  4FUL A;  4I2Z A;  2F8Y A;  3MKQ B;  3CHQ A;  4UWL A;  3S7B A;  5ARF A;  3T8M A;  2LXM A;  5AQA A;  3ZUV B;  3LJ3 A;  4A3T A;  2WXJ A;  3B7R L;  1HFA A;  3IHY A;  2XEH A;  2E2E A;  4BEP A;  4JXT A;  3I4R B;  3DSU A;  1OCC E;  1N4S A;  2UY1 B;  3EJN A;  4GAA A;  4A3V A;  5AQB A;  2WVI A;  4CDM A;  4JW1 A;  5HI7 A;  5AN8 A;  3SBS A;  3FUI A;  3FTS A;  3ASH A;  2VGY A;  2IO3 C;  4TXQ A;  3CVW A;  2L0I A;  1EPU A;  4OYS A;  4GMR A;  2WQ6 A;  2WXF A;  3J5P A;  1DNP A;  2R05 A;  1K1A A;  2P9K G;  3TXN A;  3DST A;  4C48 B;  3DXM G;  3JQ1 A;  5BW8 C;  4P29 A;  3Q4A B;  1SZ9 A;  3MGB A;  1QBQ A;  4GCO A;  3ZGQ A;  2XHE A;  3L17 A;  4HOR A;  4BSX A;  2YIN A;  3JYS A;  3UTM A;  1NFI E;  5JA4 D;  1KPS B;  5CRU A;  1OUV A;  3W9G A;  3KEZ A;  5ITZ F;  3UM2 A;  4FHK A;  4HBD A;  2ZGG A;  2P9U G;  4AV7 A;  1OWL A;  2ETB A;  5HKP A;  3IKO B;  1N54 A;  3ASN E;  3LY8 A;  3TGO A;  4YDY A;  4ACL A;  4W9R A;  5ENN A;  1H2V C;  4NAC A;  3GW4 A;  3AG3 E;  2X6I A;  2QYU A;  4U8Y D;  3CK8 A;  5BNW A;  4FLH A;  3ABK E;  1AWC B;  1TN6 A;  4HQD A;  1UJJ A;  4APF A;  4L9P A;  3ABM E;  2I6H A;  1H6K A;  4PDX A;  5FIN A;  3ASO E;  4HRM B;  2F37 A;  3JXJ A;  3EHM A;  4WWO A;  3ULY A;  5AYW D;  3TWV A;  3CLJ A;  4O6F A;  5FWQ A;  3JCK C;  3WXX A;  2XRY A;  4GCN A;  3ML9 A;  3G2T A;  2LUH A;  4PS8 A;  3NBN B;  3DRA A;  3FU6 A;  2PM7 A;  2J4B A;  3GYZ A;  1N0Q A;  2DVW A;  3UI2 A;  4KVO A;  3FUJ A;  1JPL A;  3FUN A;  3CST A;  3U64 A;  3SGH A;  3FUD A;  3TWW A;  4LNG A;  4AY5 A;  4U07 A;  2EIJ E;  3OXF A;  5CCL A;  3ML8 A;  4H7Y A;  4MKT A;  3PZ1 A;  2WXL A;  4GTT A;  1XNF A;  4YVQ C;  4JEH A;  3ESK A;  3E30 A;  3MYV A;  2GGF A;  3C3R A;  4GB9 A;  3D9I A;  3LKU A;  2LSV A;  2ZGD A;  4ANV A;  2KAT A;  3E32 A;  2WQ7 A;  4G26 A;  1N95 A;  1W3B A;  4DPR A;  2E0I A;  1Y6I A;  2R59 A;  3G2S A;  3MV3 B;  3AS8 A;  3AAA C;  2XQ0 A;  3CHS A;  3SFY A;  4KMO A;  2J8S D;  4B94 A;  3ZYQ A;  4GA0 A;  2JAB A;  3PEV B;  2XGM A;  3CR3 A;  4OVV A;  4WNE A;  2FUL A;  3OXL A;  1KZP A;  5AAO A;  3UKR G;  4N39 A;  3SFX A;  4EEC A;  2GRL A;  2Y3A A;  2HR2 A;  3QKY A;  4N3C A;  2F0Y A;  3SBT B;  3SO8 A;  5KWD A;  4YDO A;  4GTV A;  4XX5 A;  2DZO A;  3LPZ A;  2VGX A;  3FTU A;  3LEW A;  2EIK E;  4RG6 A;  1LD7 A;  4HOQ A;  4O1P A;  3MKR A;  3TWS A;  2P58 C;  1LD8 A;  3CHR A;  3FTV A;  3D9J A;  4DX1 A;  3R9M A;  4CGW A;  4DX2 A;  4E85 A;  5EIL A;  3R9A B;  4DLQ A;  2VSY A;  3MZL B;  3Q9U C;  4D10 C;  1QNF A;  5AQ7 A;  2V4H C;  1KLX A;  5KJL A;  2BF0 X;  3DWL G;  1MX6 A;  4GMJ A;  2IOS A;  2PZI A;  2HYZ A;  3EHQ A;  5AAR A;  4F1S A;  4FJY A;  1E8X A;  3CQG B;  4XKB A;  3ASD A;  4BX8 A;  1GW6 A;  3Q49 B;  1KZO A;  4AY6 A;  2HM8 A;  3CK7 A;  4U0Z A;  5ENQ D;  3C5R A;  3V2X A;  1Z6T A;  3IV0 A;  3TG5 A;  2L6B A;  3ZNG A;  3Q9N C;  2R17 C;  2B6C A;  2XEV A;  2DZN A;  2EIN E;  3T8K A;  3UIO C;  3O48 A;  3FUL A;  3U66 A;  3QNK A;  2ILR A;  1B89 A;  4K5A B;  2JEK A;  5JMN D;  1JUQ A;  4CYM D;  1K8K G;  2PQN A;  1IHG A;  3TXM A;  2OV8 A;  4C0M A;  1U3D A;  4UUC A;  2QFC A;  2P2C P;  4DLO A;  5HRY A;  4M3O A;  2WXP A;  3DEO A;  3OTN A;  4CGV A;  2C0M A;  5G04 J;  1S63 A;  4TUU A;  2B0O E;  3QWV A;  4GYW A;  1HU3 A;  3B13 A;  4FA6 A;  4A1G A;  4BET A;  2RD0 A;  4G24 A;  4HOU A;  2IF4 A;  5BXU A;  2FBN A;  1TNZ A;  4N5Q A;  3DSW A;  1U2V G;  2CHZ A;  2KC7 A;  1DVP A;  5LX8 A;  4JC8 A;  3LS8 A;  1FT2 A;  3K9I A;  5HS0 A;  3ZXP A;  3V2O A;  1N94 A;  1ZBP A;  2LNI A;  5J90 A;  2LO6 A;  1XGW A;  4GZ3 A;  2LSU A;  4CT0 A;  4PH4 B;  3CHO A;  2MYO A;  5E75 A;  3KS2 A;  4B0Z A;  4JHR A;  3TAX A;  1O5M A;  3L54 A;  1Z3Y A;  1INZ A;  2NXP A;  4URK A;  3Q73 A;  3URZ A;  5CMY A;  1E96 B;  1MYO A;  3UT7 A;  1K1B A;  1V55 E;  2ZIS A;  1HXI A;  3APC A;  2YHC A;  4U8H A;  4E6H A;  5ENT D;  1N4R A;  5G05 J;  2CFZ A;  4AM9 A;  2LAH A;  4L7T A;  1HS6 A;  2BKK B;  5AEN A;  4DI3 A;  2AVP A;  3ULE G;  5AIJ A;  3L22 A;  2H6F A;  3NQP A;  1UOH A;  4DX5 D;  3CVP A;  2PQR A;  3KSL A;  4GA1 A;  1IKN D;  2AW6 A;  3DSV A;  2J9Q A;  1JCS A;  2WMO A;  1NP7 A;  5JJ7 A;  1N52 A;  2UWJ G;  3LCA A;  3FWV A;  2I1K A;  5LOZ A;  5ENR D;  4JA9 A;  3HXB A;  2VTB A;  4B89 A;  4KZC A;  4WWP A;  5D66 A;  1OWN A;  4LSZ E;  1H0A A;  5EN5 D;  4ZHB A;  3Q7F A;  3PDN A;  3G2U A;  3OAW A;  1N4Q A;  1Q2Z A;  2AXU A;  3C98 A;  5EX3 A;  3SNX A;  3UMV A;  3E37 A;  1IQR A;  4J8E A;  4J6I A;  3AS4 A;  5FQ6 A;  4CEM A;  2VSO E;  5IY5 E;  2DBA A;  2BED A;  2RG8 A;  4G11 A;  3FH8 A;  2OCC E;  3AU4 A;  4LRZ A;  2KZT A;  2Y1L E;  3G2W A;  5CMW A;  3T9K A;  4C0E A;  2V4L A;  4K0R A;  2IOL A;  4A63 B;  4V3I A;  1NL4 A;  4GYO A;  2P9N G;  1LF8 A;  4L1B A;  2CHW A;  4YVO A;  2WMN A;  1HZ4 A;  4JA7 A;  2BTD A;  2VJ8 A;  4DK5 A;  1D8E A;  3LJN A;  4ATZ D;  4J7W A;  4U8V D;  3HDX A;  3Q78 A;  1NI1 A;  2ION A;  3TJP A;  4DJA A;  2X6H A;  1N4P A;  3HXE A;  5JHA A;  3PNT B;  3ZKJ A;  4GTP A;  5B1B E;  4O1O A;  4MLP A;  2Y4U A;  5DBK A;  4BX9 A;  3NZS A;  2J09 A;  1DCQ A;  2IO2 C;  3HVE A;  4R7L A;  3S7D A;  4HXI A;  4GTM A;  4F53 A;  2XGO A;  3LYA A;  3UIN C;  3GZ2 A;  3MKQ A;  3KEA A;  1UN8 A;  4J8D A;  4I1A A;  5M72 A;  3TWX A;  5A7D B;  1PC2 A;  2IFU A;  4FC8 A;  3BEE A;  4BSZ B;  3ISM C;  2OND A;  2ETA A;  3CVY A;  1E7U A;  3TG4 A;  2IJG X;  2R5S A;  2UY1 A;  4HNA D;  3ZVV A;  4AEZ C;  2HE0 A;  4OVU A;  3CVQ A;  2FI7 A;  3BQO A;  3CKC A;  4DUI A;  2Y69 E;  3CVN A;  3HXD A;  4WUY A;  2WXR A;  3NOC D;  2LAI A;  3D9K A;  4U96 D;  4JL0 A;  3UUX A;  4DX7 D;  3C3Q A;  1OY3 D;  3FH5 A;  3SQV A;  1SQM A;  1OXJ A;  4JVS A;  1TYQ G;  3IHV A;  2I9C A;  4B93 B;  4TXR A;  1FVF A;  1X5B A;  2KCK A;  4A55 A;  4KYO B;  4XI0 A;  5A23 A;  2X6F A;  5CCM A;  3PE4 A;  3AU5 A;  1E8Z A;  1ZU2 A;  3I5P A;  4I6G A;  3UXG A;  4I9E A;  3FDH A;  3JUE A;  4N2S A;  1EF1 C;  4WNF A;  3V31 A;  5CHE E;  2XS1 A;  3E33 A;  5AQ9 A;  3FU5 A;  5G04 C;  4KZ0 A;  3PZ4 A;  4ABN A;  4UWF A;  3UX4 A;  5KJN A;  2VYI A;  3ZYL A;  3FTX A;  1N0R A;  5ANL A;  3UM3 A;  2AJA A;  4BWR A;  3QWP A;  1IQU A;  3QDN A;  3ZRH A;  1NA0 A;  1U3C A;  4OAU C;  3L08 A;  3ZN3 A;  3Q47 B;  3U9W A;  1V54 E;  5G2N A;  1MQS A;  4G2V A;  5D2M C;  4MS6 A;  2LXL A;  3X2Q E;  2XPZ A;  2OVB A;  3ASF A;  4RLY A;  1A5E A;  1MX2 A;  1O1T A;  4G25 A;  1DC2 A;  1MX4 A;  2OVF A;  2WXN A;  3D9P A;  3D3M A;  4I2W A;  3ZU7 B;  2PL2 A;  4U0U A;  4GTO A;  4TXP A;  3FEX A;  3ZYM A;  4IYP A;  4LNB A;  1SVX A;  5KCM A;  2FO7 A;  5ARG A;  4GZ6 A;  3ZFW A;  2J07 A;  2P9P G;  3Q75 A;  2CHX A;  1BI8 B;  4WWN A;  3ZXS A;  4JD2 G;  4LCT A;  3E34 A;  2OEW A;  2YQ8 A;  3CVU A;  5CBO A;  3QWW A;  3V79 K;  1A17 A;  5G05 C;  5C1D A;  4FU3 A;  3ZHE B;  2WXO A;  3S2A A;  1KT1 A;  4HFG A;  2DIW A;  4JEU A;  5BPP A;  3UPV A;  1H2U A;  1QYM A;  3BG0 B;  5D0O D;  4Q94 A;  2PM6 A;  3EDT B;  2XZT G;  2FEZ A;  1TNO A;  5KNH D;  4QFV A;  3R7R A;  3ZW3 A;  5T3R A;  4FJZ A;  1SA4 A;  1YMP A;  5EID A;  2WXG A;  3FFL A;  1G3N B;  3CQC B;  2V5Q C;  3L6A A;  1E8Y A;  4FAD A;  3V30 A;  5D0Q D;  2WXI A;  3FHE A;  5DIZ A;  4GTR A;  4Q96 A;  2V5F A;  1FCH A;  4YDW A;  5T8I A;  2RFA A;  4J8Y A;  5EYP F;  4UI9 J;  5FQ4 A;  1ELW A;  3CGH A;  3D9M A;  2BKG A;  4ANW A;  2IU1 A;  2KM4 A;  2RFM A;  2WB2 A;  3LVR E;  4DX6 D;  2MHK A;  2NSZ A;  4KT6 B;  5ENO D;  2X6J A;  3QC1 A;  4ILI A;  3TWQ A;  1RW2 A;  4U0S A;  5LP0 A;  1WDY A;  1WAO 1;  4RSY A;  3EHR A;  4OAV B;  1FVH A;  1TR4 A;  5B3S E;  5FQ8 A;  4HLE A;  4HI9 A;  3UKU G;  2XZD G;  5FZQ A;  4Z68 A;  2KBX A;  5EKQ D;  1VDY A;  3CVV A;  3UT4 A;  3L13 A;  3UM0 A;  4BTA A;  4AP2 A;  4JB8 P;  2L0T B;  2VSX E;  4KXK B;  4K03 A;  3J5Q B;  3MV2 B;  1PY1 A;  4O60 A;  4L2Y A;  4I43 A;  3RU0 A;  1TN8 A;  5KNG A;  5JJT A;  2L9B A;  3TWU A;  1MZC A;  5EX0 A;  4C9B B;  3MX3 A;  1QQE A;  4MBG A;  2QY7 A;  4DI4 A;  4BER A;  4ANX A;  4LG6 A;  3NF1 A;  3RAU A;  1MHQ A;  4Q69 A;  2VTB B;  5BXO A;  2ZXW E;  5FJY A;  3KAE A;  3CSF A;  1JCR A;  1O1R A;  2PNN A;  4J8F A;  2J4D A;  2WM9 A;  1HG2 A;  3D9O A;  2WPV A;  4H7X A;  3HHM A;  3PZD A;  4GTS A;  3QK0 A;  4NIK A;  3FH7 A;  1N9A A;  1HO8 A;  3CK9 A;  3ABL E;  5BV0 A;  2L6J A;  3UIP C;  2GRP B;  4IRU A;  3B7B A;  1S70 B;  4KBQ A;  4L2L A;  4PS7 A;  3PZ3 A;  2Q7F A;  2J08 A;  3Q15 A;  2RKK A;  3EUV A;  3IBE A;  5EDS A;  1BU9 A;  5T4Y A;  1BD8 A;  3FY4 A;  3ZEF A;  2A5U A;  3UQ3 A;  3JXI A;  4TUM A;  3DBS A;  2A4Z A;  3FTW A;  1TN7 A;  4I9C A;  1Z3X A;  4UI9 K;  4HB5 A;  4B8C B;  3NB2 A;  3QAR A;  3FEY A;  2GRQ B;  3CEQ A;  4UQZ A;  3PZ2 A;  4F6R D;  3I3N A;  4XKC A;  3RO3 A;  4GPK A;  3P2B A;  3L16 A;  2VGE A;  1E7V A;  4M7C A;  5HQ8 A;  2FF4 A;  3RSE G;  1SW6 A;  2EIL E;  5CRV A;  4CRW A;  1HE8 A;  4ME2 A;  4BY6 A;  1EYH A;  4AXH A;  1HF8 A;  4WND A;  1JWG A;  1QZ2 A;  4N2Q A;  3PS6 A;  4Y6W A;  2XGS A;  2M63 A;  3HRA A;  4UWK A;  3S7J A;  3O4Z A;  2VSN A;  4APO A;  4BT9 A;  3VLF A;  3PVL A;  3L82 A;  3AG4 E;  3PH0 C;  2DCP A;  2R02 A;  4XIF A;  3NAW A;  5KBA A;  2XPI A;  1OWP A;  3CHP A;  5C2Y A;  2MOW A;  1RZ4 A;  4AIF A;  3RJV A;  5H7P A;  3QAQ A;  1OT8 A;  4FLB A;  4X8Q A;  4NQ0 A;  4JHK A;  4AOF A;  4B8A A;  1D9S A;  5J08 A;  3B7U X;  1OCZ E;  4UQY A;  5BT1 A;  1WM5 A;  3TL5 A;  3VTY A;  1UG3 A;  4I6J A;  4I17 A;  5FZR A;  2QYJ A;  3HXF A;  4CCA A;  1E90 A;  2NC9 A;  1TJC A;  4G23 A;  4N3B A;  3ASG A;  3C72 A;  3LVQ E;  1WG0 A;  1UW4 B;  2GRN B;  3NOG D;  3BUA A;  3QJZ A;  4YDE A;  4J0U A;  1ELK A;  5FQ7 A;  3ZYK A;  3EHN A;  5LCW J;  3T5X A;  2VQ2 A;  4EBA A;  2NYJ A;  3FUK A;  5KJM A;  3FU3 A;  2XEN A;  4UQX A;  3MEK A;  4NRH B;  2F8X K;  3EIQ C;  2AXZ A;  4JZY A;  2R03 A;  2EIM E;  3CVX A;  4PUC A;  4FHJ A;  4GZ5 A;  3RRU A;  5JHB A;  1KT0 A;  4XEI G;  3EIJ A;  1UJK A;  3RO2 A;  3RK6 A;  3DXK G;  3WG7 E;  3SF4 A;  1NZN A;  2FO1 E;  3VLD A;  4MRU A;  2I1J A;  4F1P A;  1ELR A;  2OOE A;  3CHM A;  3RRM B;  1NA3 A;  2H6G A;  3SHF A;  1S64 A;  2IQC A;  4HRN A;  4UI9 C;  4BFR A;  5EIB E;  3DPY A;  2Y0B G;  4IN3 B;  4G1T A;  4F3V A;  5ENP D;  1BPO A;  4L23 A;  2VGX B;  1ZB1 A;  1HG5 A;  1TNU A;  1D8D A;  3MJW A;  4AJW A;  5BUZ A;  3L9T A;  3TWR A;  4U95 D;  1TEZ A;  2P9S G;  1H19 A;  3U3W A;  2CG3 A;  2AXV A;  2ZIR A;  4EHM A;  2GRM A;  4GML A;  4HLL A;  1SA5 A;  3D9N A;  3LXU X;  4LUN U;  4WNG A;  2HO1 A;  4EZJ A;  2QZA A;  4EZL A;  4I1O B;  4ILH B;  3D9L A;  1OWO A;  3U4T A;  4QQI A;  3VTX A;  1O1S A;  4EZK A;  4IUL A;  2DYS E; 
#chains in the Genus database with same CATH homology
 1DCQ A;  5ENO D;  5CED B;  2F8X K;  1BI8 B;  5D66 A;  4CZ2 D;  5HS0 A;  3TWQ A;  3UXG A;  3V2O A;  4LSZ E;  3JUE A;  5CEC B;  1WDY A;  3B7B A;  1S70 B;  3UTM A;  1NFI E;  5EN5 D;  2ZGD A;  5ENQ D;  5JA4 D;  3EHR A;  5CBO A;  2MYO A;  4OAV B;  4ZHB A;  1TR4 A;  3C5R A;  5CBN A;  3V2X A;  3DEP A;  4HRL A;  3V31 A;  3V79 K;  4HI9 A;  3W9G A;  2L6B A;  2QC9 A;  4G8L A;  5ITZ F;  2XZD G;  5KBA A;  4HBD A;  4LNU D;  3ZNG A;  4K5B A;  2ZGG A;  2F8Y A;  3KEA A;  3Q9N C;  3AAA C;  2KBX A;  4Z68 A;  1MJ0 A;  1BU9 A;  1BI7 B;  5EYL A;  1BD8 A;  1YYH A;  1OT8 A;  2FO1 E;  2ETB A;  3TWX A;  2DZN A;  4G8K A;  5HKP A;  2A5E A;  2J8S D;  5AQ9 A;  3T8K A;  2JAB A;  5AQA A;  3F6Q A;  3JXI A;  4TUM A;  4JB8 P;  4YDY A;  3ZUV B;  2XEE A;  1D9S A;  1IHB A;  3J5Q B;  4F1P A;  4BSZ B;  5AAO A;  1MYO A;  4U8Y D;  1QYM A;  4O60 A;  4HRN A;  4BES A;  2ETA A;  3EU9 A;  2XEH A;  1K1B A;  2XZT G;  4HB5 A;  5EIB E;  1AWC B;  4K5A B;  4BEP A;  4HQD A;  3IXE A;  1K3Z D;  1N0R A;  3SO8 A;  2Y1L E;  5KNG A;  5JMN D;  5KNH D;  2AJA A;  5KWD A;  2QYJ A;  3T9K A;  4HNA D;  2Y0B G;  2DZO A;  4QFV A;  4CYM D;  5FIN A;  1N11 A;  2HE0 A;  5ENP D;  5AQB A;  4F6R D;  4HRM B;  2F37 A;  3TWU A;  4A63 B;  1YCS B;  3HG0 D;  3JXJ A;  4GPM A;  4OAU C;  5AN8 A;  4UUC A;  4O1P A;  5FIO A;  3W9F A;  3TWS A;  3TWV A;  5ENT D;  3TWR A;  1YMP A;  2P2C P;  5EID A;  2DWZ A;  1WG0 A;  4U95 D;  1G3N B;  3AJI A;  2VGE A;  5HRY A;  4DUI A;  3B95 A;  4DX1 A;  3TWT A;  4ZFH A;  3NOG D;  4DX2 A;  3NOC D;  4BER A;  2V5Q C;  3DEO A;  4U96 D;  1SW6 A;  4LG6 A;  2ETC A;  5EIL A;  4DRX E;  4DX7 D;  2BKK B;  3NBN B;  3LJN A;  5ENS D;  1OY3 D;  4RLY A;  3Q9U C;  4HLL A;  3V30 A;  2KXP C;  5AQ7 A;  1A5E A;  4GMR A;  1MX2 A;  2V4H C;  4J7W A;  4ATZ D;  5CER B;  1N0Q A;  2B0O E;  2DVW A;  4U8V D;  1UOH A;  3UI2 A;  4DX5 D;  1MX4 A;  1MX6 A;  5BXO A;  1DC2 A;  3D9H A;  4YDW A;  1IXV A;  2RFA A;  1BLX B;  4BET A;  2PNN A;  4B93 B;  3J5P A;  1AP7 A;  3EHQ A;  5AAR A;  1IKN D;  4J8Y A;  5EYP F;  4HI8 A;  1K1A A;  3ZU7 B;  5BXU A;  3TWW A;  2NYJ A;  4N5Q A;  2BKG A;  3ZKJ A;  2RFM A;  1SVX A;  4O1O A;  4C48 B;  4NIK A;  2XEN A;  4QQI A;  4K5C A;  4DX6 D;  3HRA A;  5CEA A;  5ENR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...