2V5QC

Crystal structure of wild-type plk-1 kinase domain in complex with a selective darpin
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
130
structure length
130
Chain Sequence
SDLGKKLLEAARAGQDDEVRILIANGADVNAVDNTGLTPLHLAAVSGHLEIVEVLLKHGADVDAADVYGFTPLHLAAMTGHLEIVEVLLKYGADVNAFDMTGSTPLHLAADEGHLEIVEVLLKYGADVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE PLK1
publication title Structure of wild-type Plk-1 kinase domain in complex with a selective DARPin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 43
structure length 130
sequence length 130
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-07-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 2v5qC00
4ZFHA 1S70B 1BI8B 5EYPF 2DVWA 3LJNA 4J7WA 3TWUA 4BERA 4DUIA 1BLXB 1MX6A 3TWTA 4NIKA 4CZ2D 2XEHA 4O60A 5AQ9A 4K5BA 3IXEA 4O1PA 2XZDG 3UI2A 4OAVB 3EHQA 5HKPA 3T9KA 4HLLA 4HQDA 4U95D 4G8LA 2NYJA 4HRMB 1D9SA 4DX1A 1IHBA 4HRLA 2J8SD 3UTMA 4GMRA 5AQBA 5KNGA 2F8XK 5HS0A 3DEOA 5BXOA 3EHRA 4DX2A 5AQAA 2KXPC 2XENA 2Y0BG 4U8YD 3SO8A 4DX7D 4UUCA 5JA4D 3NOCD 1A5EA 3TWXA 2QC9A 3KEAA 4A63B 2RFAA 4F1PA 2BKGA 1WDYA 1AWCB 1DCQA 4HNAD 3AJIA 4DX5D 4HRNA 1K3ZD 4CYMD 1YYHA 2F8YA 1N0RA 1BI7B 2ZGDA 1IXVA 5JMND 2P2CP 2XZTG 2ETAA 5CEAA 4QQIA 5ENSD 5KNHD 5EIDA 5EN5D 1SW6A 3TWRA 1MX4A 4F6RD 2XEEA 5FINA 3JXJA 5ITZF 3T8KA 1OT8A 3TWSA 2MYOA 2V4HC 2Y1LE 2FO1E 3J5PA 3NBNB 3V2OA 1MYOA 4G8KA 3Q9UC 4BSZB 3V30A 1BD8A 4U96D 2ETBA 5CBOA 3HRAA 2F37A 3EU9A 3TWVA 1OY3D 1K1BA 5ENOD 4OAUC 1QYMA 5CERB 5AARA 4YDWA 5ENTD 4HBDA 2QYJA 4N5QA 1MJ0A 4HI8A 2BKKB 3TWWA 4O1OA 3ZNGA 3B7BA 4J8YA 3B95A 4QFVA 3TWQA 2AJAA 5FIOA 4C48B 3AAAC 3ZKJA 1NFIE 4HB5A 4RLYA 1DC2A 2ETCA 2A5EA 5EYLA 5EILA 4DX6D 5AAOA 2DZNA 5CBNA 1TR4A 5ENRD 5AQ7A 4ZHBA 5EIBE 1MX2A 1IKND 1WG0A 5ENPD 4K5AB 2DWZA 1K1AA 3NOGD 3UXGA 4TUMA 2ZGGA 1YCSB 3ZUVB 1YMPA 4ATZD 4LSZE 3V79K 2JABA 1N11A 1SVXA 5HRYA 3JXIA 4LG6A 4BEPA 4Z68A 4BESA 4DRXE 4B93B 3C5RA 3W9FA 4BETA 5KBAA 4K5CA 2VGEA 3F6QA 2V5QC 5D66A 5BXUA 1AP7A 3V2XA 5CEDB 4YDYA 5KWDA 1N0QA 2KBXA 5AN8A 1UOHA 2B0OE 2DZOA 4GPMA 4U8VD 4HI9A 3HG0D 3D9HA 1BU9A 3W9GA 5ENQD 5CECB 3V31A 4LNUD 2PNNA 3ZU7B 1G3NB 2L6BA 2RFMA 3J5QB 3JUEA 3Q9NC 4JB8P 2HE0A 3DEPA
chains in the Genus database with same CATH superfamily
3T5VA 3UT4A 3I5PA 1U3DA 4J7WA 3AS8A 2DCPA 2XEHA 5DIZA 3R7RA 1OXJA 1Q2ZA 1N4QA 3FUMA 2EQXA 1PAQA 4XZ4A 5BXOA 2NXPA 3ENEA 3KEZA 3TJPA 2YNQA 4Q94A 1ELWA 2KCLA 4WNDA 3APCA 4W9RA 1EF1C 5LOZA 1O1SA 3D9PA 4FLHA 3SFXA 3UM0A 3CVNA 2HM8A 1BD8A 1IQRA 5BW8C 3CHOA 3TWVA 1UW4B 4KXKB 1MQSA 2A5UA 3TWWA 3CKBA 2ZU6B 4LEUA 3RAUA 5ENRD 3SZ7A 1JPLA 1E8XA 5KJLA 3C3OA 3ZHEB 2I1JA 5E76A 4Q96A 4G25A 1UN9A 2I9CA 3C5RA 4X8QA 1TN6A 3ZYMA 2WMNA 4EQFA 4HS2A 4TXQA 4LNBA 5AN8A 5FQ8A 1QQEA 2H6FA 3HG0D 3D9HA 1OWLA 2IOLA 3IHVA 2GRRB 5CECB 2H6HA 5FZRA 3HXBA 4FA6A 1BI8B 3TG4A 1O1TA 2XGSA 4GYWA 2YINA 3L6AA 4AV7A 4HXIA 2XRYA 2FO7A 3ASGA 3OXLA 4U95D 3E33A 3PUKA 3RSEG 1KZOA 4U63A 3DSXA 3BG1B 4YDEA 4FHKA 4HORA 4I9CA 1LD7A 3CQGB 2WQ6A 4B94A 2QC9A 2RFAA 1KPSB 3OXGA 3ASFA 1HG2A 4F6RD 5KJMA 4J6IA 3QWPA 1QNFA 3RU0A 2MYOA 3J5PA 5CBOA 2WXMA 2FI7A 1E8ZA 1W3BA 3B7BA 3LPZA 3CHPA 1N9AA 4G26A 1X81A 3BUAA 2CG2A 2Q7FA 4F53A 5EIBE 5BV1A 1P5QA 3DPYA 1YCSB 3UKUG 4LSZE 1HZ4A 3G2UA 1KLXA 4HLEA 2X3MA 3F6QA 1AP7A 1N0QA 4I6JA 3PREA 1B89A 4BFRA 3UIOC 2OEVA 4IYPA 4WWPA 3CVXA 1ELRA 3CHQA 3QARA 4PH4B 3Q7AA 2QYUA 3Q75A 4AY6A 1EDUA 4J8SA 4O1PA 3D3MA 3OTNA 3Q78A 3UT7A 4FC8A 4DX1A 2QY7A 3Q7FA 3BU8A 3E34A 3KD7A 2J07A 2VSXE 3EHRA 1SQMA 3QB2A 4L2YA 3R7QA 2Y3AA 2WXFA 5KNHD 5EN5D 3TWRA 1MX4A 4U7EB 2PM7A 2PQRA 4AY5A 1JCQA 5ITZF 1OT8A 4L9PA 2Y1LE 2X6JA 4WUYA 3FULA 3SQVA 4OAUC 4LUNU 1S0PA 1Z3YA 3JQ0A 3MKRA 5BPPA 4JHKA 1DNPA 4GA1A 2VSOE 4DLOA 2E2EA 3JYSA 2DWZA 5J90A 1TNOA 2KM4A 3QKYA 2Y69E 3SBSA 1N52A 4BEPA 3GZSA 5JHBA 5BXUA 2R05A 3FTWA 4GZCA 5E75A 2LUHA 4AM9A 1U2VG 2EIKE 1O5MA 3HXFA 2RFMA 2HO1A 4CT0A 4AOFA 3DEPA 3LY9A 3RRNB 4KYOB 4C9BB 3DSWA 4U0ZA 4BERA 2WXGA 1Y8MA 2VGYA 3S7DA 4AJWA 1WM5A 2KATA 4BTAA 4BX9A 4HLLA 4GTTA 3VLEA 4H7YA 4UQXA 2XGOA 4DJAA 2XHEA 1FVHA 2OCCE 4TUUA 4UUCA 3PS6A 4CCAA 2F8YA 3S7FA 2ZGDA 2P2CP 3PE3A 3TAXA 4ILGA 2P9IG 1E8YA 1XNFA 2WQ7A 2V4HC 5ANRA 4HOQA 2F37A 1OCOE 3IKOB 1JWGA 4O1OA 2PQNA 2AJAA 1H6KA 1NZNA 4UWGA 4PDXA 3D9OA 4JD2G 3ZIMA 2FULA 1BPOA 4ATZD 1N4RA 1NI1A 4AXHA 2YQ8A 4YNDA 3DXKG 3FU6A 2LAIA 4DLQA 2R59A 2GW1A 3Q73A 2KBXA 1TJCA 2GROB 4JZYA 2DZOA 3LXUX 4ACLA 2HE0A 2VGXB 4BY6A 2XGMA 5CMYA 2F0YA 3X2QE 1Z3XA 3ONKA 3LEWA 3CIAA 4G8LA 4ANXA 2X38A 4JXTA 4B8AA 4GZ6A 3UM1A 4BT8A 2I6HA 3G2VA 3ZHEA 3L17A 3BEEA 4DX5D 1K3ZD 4GTQA 3MEKA 3FTYA 1OWPA 3FTXA 4L1BA 1NA3A 1TJFA 3MKQB 3ULQA 4E85A 4WNFA 4U96D 3FUHA 4JHJA 5ARGA 2IOSA 1L5JA 4GTMA 2IO2C 3DSTA 2AXUA 3MA5A 4N2SA 4XI0A 2V4LA 3HIZA 2R2LA 4L7TA 2P9UG 4GTPA 4KMOA 1H0AA 4G24A 3ZUVB 3P2BA 3HHMA 3V79K 3ISMC 1N11A 3PVLA 1SZAA 4Z68A 4B93B 1ZU2A 5KBAA 5BT1A 1LTXA 2A4ZA 4HI9A 3W9GA 3FY4A 4MS6A 4L2LA 3MYVA 2LXMA 2Y4TA 3SD5A 2KC7A 3LJNA 3CSTA 2FEZA 5FJYA 4GPKA 2WXNA 3N71A 1IQUA 1LD8A 4IN3B 4GYOA 4WNEA 2NYJA 1HF8A 5KNGA 3L22A 4MLPA 2KCVA 2AXVA 5AJLA 4F7AA 3I3NA 1TNUA 4DX7D 3UUXA 1D8EA 4ILHB 3UIPC 4CT4A 1PC2A 3VTYA 4FADA 5KCMA 4GTSA 1WY6A 4I1MA 3QJZA 4EECA 5HQ8A 2P9SG 3DSUA 4K0RA 2XPIA 5ENOD 2WXHA 2PM6A 4JPSA 4N5QA 1FPPA 4FULA 4GYYA 5DBKA 3RO3A 4C48B 1JUQA 3Q79A 1JWFA 4GZ5A 4K5AB 4TUMA 1N95A 3CVLA 4XX5A 3FUEA 3P1UA 2OV8A 3EUVA 3FUKA 3VTXA 5FZSA 3JUIA 3E4BA 2AXZA 4FJYA 4IULA 2J9QA 2HYZA 3RO2A 2JLBA 2Y4UA 4GB9A 1Z5SC 3U64A 5EYPF 3FTZA 4DUIA 4JEHA 3IXEA 2R03A 4MBGA 4YDOA 4G1TA 2J8SD 4H7XA 3ZVVA 4KZCA 1HG5A 3C98A 2XCCA 5ARFA 3PNLB 3S2AA 4A55A 2I2OA 4HVBA 1HH8A 4HNAD 3ASNE 4LRZA 4GAAA 4EBAA 3K9IA 2ILRA 3SHFA 4U04A 4EZKA 4CGVA 3MX3A 2ZISA 3UPVA 3EU9A 3HYMB 5EKQD 5ENNA 5FTPA 3SI5A 3RJVA 4WAFA 2LSUA 4HBDA 3ZXSA 3PRZA 2J4BA 1NFIE 2KZTB 4HB5A 3SNXA 2ETCA 2A5EA 5G04J 4IRUA 3SFZA 3LS8A 4ME2A 2WVIA 5KJNA 1EPUA 5G04C 3Q47B 4LERA 2LO6A 1TN7A 3AG1E 3C3RA 4ABNA 5CCMA 3S7BA 3GYZA 4U0UA 5ENQD 4UI9K 1OWNA 4NACA 3MGBA 2XQ0A 1QBQA 1TNYA 4LNGA 4CZ2D 1E8WA 4O60A 4K5BA 3PEVB 5HKPA 5J08A 3OAWA 5EDSA 3B7RL 3LVQE 3FTVA 5HI7A 1Z6TA 3UM3A 2WXJA 4WWNA 2KXPC 3UMVA 3ABME 3B13A 1FCHA 4V3IA 4EZLA 1VDYA 5JA4D 1N94A 1Y6IA 3FTSA 2NSZA 2BKGA 1E7VA 3Q4AB 1FVFA 3OXFA 1HU3A 4QQIA 1N4SA 4LCTA 4JA9A 4XI9A 4KZ0A 3TWSA 3SBTB 2YHCA 4BWRA 5IY5E 4I6GA 3V30A 3FHEA 4OVUA 3AS4A 3ZFWA 3FEXA 4YDWA 2VGXA 2BKKB 4PS8A 5FIOA 4GTOA 2X6KA 4KBQA 4ZHBA 5CCLA 2XCBA 4APOA 4GCNA 2IJGX 3D9IA 2JABA 3C72A 3B7TA 4DRXE 3KS2A 3T8MA 4R7LA 1EYHA 4BETA 2WMOA 3SY2A 5CEDB 5KWDA 3CVYA 3ZEFA 2UY1B 3MZLB 4GTVA 3ZXPA 2VTBB 3PE4A 1UN8A 5FQ4A 3B7SA 3CHRA 3MKQA 4AVXA 1BLXB 3Q5MA 5EX3A 3TWTA 3MCXA 4NIKA 1S64A 4ILIA 5FT9A 2RG8A 3L54A 1HO8A 4HRMB 2XPYA 4P29A 5B1AE 5FQ6A 3KSLA 4CEMA 1KZPA 4CDNA 3R9AB 4UWFA 2B6CA 2P58C 4J8EA 3FEYA 3GW4A 2X6FA 1MZCA 3QWVA 4URKA 2PZIA 3QAQA 4GZ3A 3ZYQA 3EU5A 2FO1E 4AEZC 3V2OA 3PH0C 4BSZB 2J09A 3PZDA 5AIJA 3LY8A 1HX8A 4RG9A 2H6GA 4RLYA 1DC2A 3VLFA 4DX6D 1OWOA 4XEIG 4CGWA 3E32A 3FUIA 1K1AA 3PEUB 3AU4A 1JCSA 2EINE 4BTBA 3ZW3A 3LY7A 4HOSA 5D66A 5JJ7A 2IEJA 3CK8A 4G23A 1X5BA 4I2ZA 4I17A 2X6IA 4ATGA 4B89A 2MRIA 5BUZA 1HE8A 3ZU7B 3J5QB 4UWLA 1HFAA 1FT1A 1NL4A 3ONLA 2DVWA 3TWUA 2BTDA 4JVSA 4TV3A 3DRAA 5LP0A 2XZDG 1NA0A 4ACKA 1PY1A 4N3CA 2BUGA 3D9MA 4CRWA 4FJZA 2J08A 4F3VA 2VSYA 3TXNA 4HFGA 2Y0BG 1SA5A 4A63B 3HXEA 1H19A 5EX0A 5B1BE 3TG5A 4HRNA 3FUDA 2XZTG 5CEAA 2AW6A 4RSYA 2J4DA 3JXJA 1QZ2A 2XPZA 3L13A 5CRVA 1OY3D 4JC8A 4TXRA 2GRLA 2M63A 1LF8A 2BF0X 3FUFA 5M72A 4FHJA 3SGHA 4DPRA 2CHXA 4FU3A 3ML8A 2VQ2A 3DXMG 2P9LG 5BNWA 3LKUA 4F1SA 4ANVA 3LYAA 4UWHA 2CFUA 2E0IA 3GZ2A 3TGOA 1RW2A 1HXIA 2WXQA 3FUJA 3LJ3A 2PNNA 1D8DA 4ZFHA 1S70B 3S7JA 2OEWA 3CEQA 5T8IA 3CSFA 2KZTA 2GGFA 3AG2E 2WXLA 4AP2A 3PZ4A 3CVWA 4A1GA 1DCEA 3NOCD 4BX8A 2DYSE 4DI4A 1A5EA 5JHAA 1AWCB 3ZN3A 3DPDA 4CYMD 4PS7A 1BI7B 5JMND 1IXVA 3VLDA 1E7UA 3BG0B 5FINA 2EIJE 4N3AA 3T8KA 3BQOA 1H6OA 2IQCA 3EHNA 3IHYA 3PNTB 2FF4A 2VJ8A 3CVQA 3WXXA 5CERB 5A6CA 3U4TA 1TNZA 3ABLE 1MJ0A 4J8YA 2IY0C 4N5CA 1N4PA 3TWQA 5C2YA 4JW1A 3O4ZA 3U9WA 2X6HA 2IONA 3HVEB 4KT6B 2L9BA 2MHKA 5D0OD 4JL0A 3FU5A 2XRZA 4I1OB 1UG3A 3T5XA 3APDA 2JEKA 2YHEA 2HR2A 4I43A 4LG6A 4RG6A 2I1KA 2OOEA 4JA7A 3ASDA 4KVMA 3TL5A 3NZUA 1GW6A 2IU1A 3G2TA 3IBEA 1UOHA 4A3VA 4ANUA 3SFYA 3G2SA 4XKBA 5FQ7A 2LAHA 3E30A 2PL2A 5CMWA 4LNUD 1G3NB 3PZ1A 3FU3A 3RRMB 3KSQA 2CG3A 5B3SE 1MX6A 1OCZE 4XIFA 2VYIA 2GRQB 4UI9J 3AG4E 3U66A 4FLBA 1K8KG 2V5FA 4J8DA 1SZ9A 3DWLG 3UTMA 5AJDA 5H7PA 5AQBA 3DEOA 4MKTA 1E90A 3CQCB 4UQYA 2XENA 3SO8A 4UI9C 2QFCA 4M3OA 3CHSA 1IYGA 3G2WA 5JJTA 4YVQC 1N0RA 3FH8A 1H2TC 2ETAA 4CDMA 2IF4A 1TNBA 2WPVA 3LDZA 3ASHA 2UY1A 3URZA 3CLJA 1S63A 2WQHA 2ETBA 3HRAA 4NURA 2VTBA 3O48A 2CHWA 5ENTD 4OVVA 3ZNGA 2V8SE 4Q69A 3ZKJA 3MV2B 4XE0A 3UINC 5ENPD 3CK9A 2L0TB 3CV0A 2RD0A 3KAEA 3CK7A 4OYSA 2IFUA 4I1AA 3LCAA 5HRYA 2L6JA 4BESA 3QDNA 3AG3E 3DSSA 2VGEA 3L9TA 1YA0A 2V5QC 2J49A 3FTUA 5G05J 3FFLA 3FP3A 4NRHB 3MJWA 4HOUA 2P9NG 3RRUA 2OVFA 1KT1A 4OAVB 3UI2A 5G05C 3T9KA 3HXDA 3L16A 2QZAA 2ZIRA 4J0UA 4C0MA 1IHBA 2F8XK 3UT8A 4B8CB 2AWIA 4FP7A 4GZDA 2C0MA 4DX2A 1OCRE 3Q15A 3RIBA 2ZXWE 3TWXA 3SF4A 1DCQA 3AJIA 4HOTA 3DSVA 5A23A 2BEDA 4GTRA 3LVRE 2WXPA 5AENA 4N2QA 4EZJA 3CKCA 2DBAA 3ABKE 4G8KA 4PS3A 3CVVA 3ASOE 1K1BA 3L08A 4D10C 5AARA 2QYJA 3NB2A 4BT9A 3ZYLA 4A3TA 3PZ2A 3AAAC 4WNGA 3D9KA 5EYLA 5AAOA 2GRNB 1A17A 3APFA 3FUNA 1U3CA 4I9EA 4GA0A 3MV3B 1SVXA 3L82A 1OWMA 4A1SA 5D2MC 1V55E 5A7DB 4UWKA 3NZSA 3I4GA 2B0OE 1OUVA 3ZRHA 1V54E 4DK5A 4U8VD 3D9JA 4KVOA 1WAO1 2DIWA 5T3RA 2XS1A 2XS8A 2L6BA 5G2NA 4XKCA 3QWWA 1DVPA 1N54A 3ESLA 2P9PG 4U07A 1TN8A 4TRQA 4HRLA 3I4RB 5HS0A 4GMJA 4F1PA 1WDYA 1JCRA 2LSVA 3C3QA 4RVBA 3UX4A 2R5SA 2WXKA 3PUJA 3UQ3A 4GA2A 2IO3C 3IEGA 3NF1A 1QYMA 5D0QD 3ULYA 2WB2A 4WWOA 3EHMA 3EJNA 3B95A 4QFVA 4UQZA 2V0PA 5CBNA 1TR4A 1UJJA 5FZQA 3FH7A 4BSXA 4Y6WA 1SA4A 4U0SA 3ZYKA 4EPZA 3ZGQA 1TYQG 1BU9A 5CHEE 5LCWJ 3V31A 3CHMA 4JB8P 3AU5A 4GU5A 3ULEG 1OCCE 3NQPA 1O1RA 5AQ9A 3FWVA 3ML9A 3RK6A 5LCWC 4JEUA 4HQDA 3ESKA 4RQIA 5T4YA 4AIFA 3UKRG 3HVEA 4GMRA 2XEVA 4GCOA 2GRPB 4JHRA 4NQ0A 3KEAA 4MRUA 5C1DA 1RZ4A 5LX8A 1FT2A 2H6IA 2WXOA 4N39A 4E6HA 5ENSD 2XEEA 3FH5A 4PUCA 4N3BA 3UM2A 5AYWD 2CHZA 3NBNB 1MYOA 5FWQA 3Q9UC 3ZPJA 1ZB1A 2KCKA 3FU0A 2GRMA 4G11A 4J8FA 4I2WA 4YVOA 5EILA 2DZNA 2R02A 1UJKA 5AQ7A 3D9NA 2C0LA 3B7UX 3NOGD 4I6EA 4K03A 5G55A 3QC1A 1YMPA 2WXRA 3Q49B 2RKKA 3QK0A 1ELKA 3GZ1A 3JXIA 3AS5A 3W9FA 2DYRE 3V2XA 1XGWA 1ZBPA 4EHMA 4G2VA 5KJKA 5LFAA 1MHQA 2P9KG 3Q9NC 2VSNA 3E37A 3CR3A 2UWJG 2LNIA 3PDNA 2WM9A 1TEZA 4M7CA 3CVPA 3WG7E 3EHQA 4U8HA 3CGHA 1H6PA 3EIQC 4L23A 1D9SA 5CRUA 3HDXA 2AVPA 5BV0A 3DBSA 3TXMA 2WXIA 2FBNA 2L0IA 5AQAA 4U8YD 3QOUA 3HXCA 4C0EA 2OVBA 5JJ6A 1YYHA 3EIJA 5EIDA 1SW6A 4APFA 4B0ZA 3PZ3A 4EBAG 4CDRA 2R17C 4Y6CA 3CVUA 1KT0A 2ONDA 4HI8A 3IV0A 1H2UA 2NC9A 2EILE 3U3WA 1IHGA 3NAWA 1MX2A 1IKND 1WG0A 3UXGA 1H2VC 2ZGGA 2C2LA 4DI3A 3FDHA 1NP7A 4ANWA 2MOWA 4GMLA 3EDTB 1HS6A 4K5CA 4YDYA 3JCKC 1E96B 4TXPA 2CFZA 3QNKA 4O6FA 5ANLA 3JQ1A 4GPMA 3R9MA 3RKVA 1INZA 2LXLA 3D9LA 2EIME 3JUEA
chains in the Genus database with same CATH topology
4ZFHA 1S70B 1BI8B 5EYPF 2DVWA 3LJNA 4J7WA 3TWUA 4BERA 4DUIA 1BLXB 1MX6A 3TWTA 4NIKA 4CZ2D 2XEHA 4O60A 5AQ9A 4K5BA 3IXEA 4O1PA 2XZDG 3UI2A 4OAVB 3EHQA 5HKPA 3T9KA 4HLLA 4HQDA 4U95D 4G8LA 2NYJA 4HRMB 1D9SA 4DX1A 1IHBA 4HRLA 2J8SD 3UTMA 4GMRA 5AQBA 5KNGA 2F8XK 5HS0A 3DEOA 5BXOA 3EHRA 4DX2A 5AQAA 2KXPC 2XENA 2Y0BG 4U8YD 3SO8A 4DX7D 4UUCA 5JA4D 3NOCD 1A5EA 3TWXA 2QC9A 3KEAA 4A63B 2RFAA 4F1PA 2BKGA 1WDYA 1AWCB 1DCQA 4HNAD 3AJIA 4DX5D 4HRNA 1K3ZD 4CYMD 1YYHA 2F8YA 1N0RA 1BI7B 2ZGDA 1IXVA 5JMND 2P2CP 2XZTG 2ETAA 5CEAA 4QQIA 5ENSD 5KNHD 5EIDA 5EN5D 1SW6A 3TWRA 1MX4A 4F6RD 2XEEA 5FINA 3JXJA 5ITZF 3T8KA 1OT8A 3TWSA 2MYOA 2V4HC 2Y1LE 2FO1E 3J5PA 3NBNB 3V2OA 1MYOA 4G8KA 3Q9UC 4BSZB 3V30A 1BD8A 4U96D 2ETBA 5CBOA 3HRAA 2F37A 3EU9A 3TWVA 1OY3D 1K1BA 5ENOD 4OAUC 1QYMA 5CERB 5AARA 4YDWA 5ENTD 4HBDA 2QYJA 4N5QA 1MJ0A 4HI8A 2BKKB 3TWWA 4O1OA 3ZNGA 3B7BA 4J8YA 3B95A 4QFVA 3TWQA 2AJAA 5FIOA 4C48B 3AAAC 3ZKJA 1NFIE 4HB5A 4RLYA 1DC2A 2ETCA 2A5EA 5EYLA 5EILA 4DX6D 5AAOA 2DZNA 5CBNA 1TR4A 5ENRD 5AQ7A 4ZHBA 5EIBE 1MX2A 1IKND 1WG0A 5ENPD 4K5AB 2DWZA 1K1AA 3NOGD 3UXGA 4TUMA 2ZGGA 1YCSB 3ZUVB 1YMPA 4ATZD 4LSZE 3V79K 2JABA 1N11A 1SVXA 5HRYA 3JXIA 4LG6A 4BEPA 4Z68A 4BESA 4DRXE 4B93B 3C5RA 3W9FA 4BETA 5KBAA 4K5CA 2VGEA 3F6QA 2V5QC 5D66A 5BXUA 1AP7A 3V2XA 5CEDB 4YDYA 5KWDA 1N0QA 2KBXA 5AN8A 1UOHA 2B0OE 2DZOA 4GPMA 4U8VD 4HI9A 3HG0D 3D9HA 1BU9A 3W9GA 5ENQD 5CECB 3V31A 4LNUD 2PNNA 3ZU7B 1G3NB 2L6BA 2RFMA 3J5QB 3JUEA 3Q9NC 4JB8P 2HE0A 3DEPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZFH A;  1S70 B;  1BI8 B;  5EYP F;  2DVW A;  3LJN A;  4J7W A;  3TWU A;  4BER A;  4DUI A;  1BLX B;  1MX6 A;  3TWT A;  4NIK A;  4CZ2 D;  2XEH A;  4O60 A;  5AQ9 A;  4K5B A;  3IXE A;  4O1P A;  2XZD G;  3UI2 A;  4OAV B;  3EHQ A;  5HKP A;  3T9K A;  4HLL A;  4HQD A;  4U95 D;  4G8L A;  2NYJ A;  4HRM B;  1D9S A;  4DX1 A;  1IHB A;  4HRL A;  2J8S D;  3UTM A;  4GMR A;  5AQB A;  5KNG A;  2F8X K;  5HS0 A;  3DEO A;  5BXO A;  3EHR A;  4DX2 A;  5AQA A;  2KXP C;  2XEN A;  2Y0B G;  4U8Y D;  3SO8 A;  4DX7 D;  4UUC A;  5JA4 D;  3NOC D;  1A5E A;  3TWX A;  2QC9 A;  3KEA A;  4A63 B;  2RFA A;  4F1P A;  2BKG A;  1WDY A;  1AWC B;  1DCQ A;  4HNA D;  3AJI A;  4DX5 D;  4HRN A;  1K3Z D;  4CYM D;  1YYH A;  2F8Y A;  1N0R A;  1BI7 B;  2ZGD A;  1IXV A;  5JMN D;  2P2C P;  2XZT G;  2ETA A;  5CEA A;  4QQI A;  5ENS D;  5KNH D;  5EID A;  5EN5 D;  1SW6 A;  3TWR A;  1MX4 A;  4F6R D;  2XEE A;  5FIN A;  3JXJ A;  5ITZ F;  3T8K A;  1OT8 A;  3TWS A;  2MYO A;  2V4H C;  2Y1L E;  2FO1 E;  3J5P A;  3NBN B;  3V2O A;  1MYO A;  4G8K A;  3Q9U C;  4BSZ B;  3V30 A;  1BD8 A;  4U96 D;  2ETB A;  5CBO A;  3HRA A;  2F37 A;  3EU9 A;  3TWV A;  1OY3 D;  1K1B A;  5ENO D;  4OAU C;  1QYM A;  5CER B;  5AAR A;  4YDW A;  5ENT D;  4HBD A;  2QYJ A;  4N5Q A;  1MJ0 A;  4HI8 A;  2BKK B;  3TWW A;  4O1O A;  3ZNG A;  3B7B A;  4J8Y A;  3B95 A;  4QFV A;  3TWQ A;  2AJA A;  5FIO A;  4C48 B;  3AAA C;  3ZKJ A;  1NFI E;  4HB5 A;  4RLY A;  1DC2 A;  2ETC A;  2A5E A;  5EYL A;  5EIL A;  4DX6 D;  5AAO A;  2DZN A;  5CBN A;  1TR4 A;  5ENR D;  5AQ7 A;  4ZHB A;  5EIB E;  1MX2 A;  1IKN D;  1WG0 A;  5ENP D;  4K5A B;  2DWZ A;  1K1A A;  3NOG D;  3UXG A;  4TUM A;  2ZGG A;  1YCS B;  3ZUV B;  1YMP A;  4ATZ D;  4LSZ E;  3V79 K;  2JAB A;  1N11 A;  1SVX A;  5HRY A;  3JXI A;  4LG6 A;  4BEP A;  4Z68 A;  4BES A;  4DRX E;  4B93 B;  3C5R A;  3W9F A;  4BET A;  5KBA A;  4K5C A;  2VGE A;  3F6Q A;  2V5Q C;  5D66 A;  5BXU A;  1AP7 A;  3V2X A;  5CED B;  4YDY A;  5KWD A;  1N0Q A;  2KBX A;  5AN8 A;  1UOH A;  2B0O E;  2DZO A;  4GPM A;  4U8V D;  4HI9 A;  3HG0 D;  3D9H A;  1BU9 A;  3W9G A;  5ENQ D;  5CEC B;  3V31 A;  4LNU D;  2PNN A;  3ZU7 B;  1G3N B;  2L6B A;  2RFM A;  3J5Q B;  3JUE A;  3Q9N C;  4JB8 P;  2HE0 A;  3DEP A; 
#chains in the Genus database with same CATH topology
 3T5V A;  3UT4 A;  3I5P A;  1U3D A;  4J7W A;  3AS8 A;  2DCP A;  2XEH A;  5DIZ A;  3R7R A;  1OXJ A;  1Q2Z A;  1N4Q A;  3FUM A;  2EQX A;  1PAQ A;  4XZ4 A;  5BXO A;  2NXP A;  3ENE A;  3KEZ A;  3TJP A;  2YNQ A;  4Q94 A;  1ELW A;  2KCL A;  4WND A;  3APC A;  4W9R A;  1EF1 C;  5LOZ A;  1O1S A;  3D9P A;  4FLH A;  3SFX A;  3UM0 A;  3CVN A;  2HM8 A;  1BD8 A;  1IQR A;  5BW8 C;  3CHO A;  3TWV A;  1UW4 B;  4KXK B;  1MQS A;  2A5U A;  3TWW A;  3CKB A;  2ZU6 B;  4LEU A;  3RAU A;  5ENR D;  3SZ7 A;  1JPL A;  1E8X A;  5KJL A;  3C3O A;  3ZHE B;  2I1J A;  5E76 A;  4Q96 A;  4G25 A;  1UN9 A;  2I9C A;  3C5R A;  4X8Q A;  1TN6 A;  3ZYM A;  2WMN A;  4EQF A;  4HS2 A;  4TXQ A;  4LNB A;  5AN8 A;  5FQ8 A;  1QQE A;  2H6F A;  3HG0 D;  3D9H A;  1OWL A;  2IOL A;  3IHV A;  2GRR B;  5CEC B;  2H6H A;  5FZR A;  3HXB A;  4FA6 A;  1BI8 B;  3TG4 A;  1O1T A;  2XGS A;  4GYW A;  2YIN A;  3L6A A;  4AV7 A;  4HXI A;  2XRY A;  2FO7 A;  3ASG A;  3OXL A;  4U95 D;  3E33 A;  3PUK A;  3RSE G;  1KZO A;  4U63 A;  3DSX A;  3BG1 B;  4YDE A;  4FHK A;  4HOR A;  4I9C A;  1LD7 A;  3CQG B;  2WQ6 A;  4B94 A;  2QC9 A;  2RFA A;  1KPS B;  3OXG A;  3ASF A;  1HG2 A;  4F6R D;  5KJM A;  4J6I A;  3QWP A;  1QNF A;  3RU0 A;  2MYO A;  3J5P A;  5CBO A;  2WXM A;  2FI7 A;  1E8Z A;  1W3B A;  3B7B A;  3LPZ A;  3CHP A;  1N9A A;  4G26 A;  1X81 A;  3BUA A;  2CG2 A;  2Q7F A;  4F53 A;  5EIB E;  5BV1 A;  1P5Q A;  3DPY A;  1YCS B;  3UKU G;  4LSZ E;  1HZ4 A;  3G2U A;  1KLX A;  4HLE A;  2X3M A;  3F6Q A;  1AP7 A;  1N0Q A;  4I6J A;  3PRE A;  1B89 A;  4BFR A;  3UIO C;  2OEV A;  4IYP A;  4WWP A;  3CVX A;  1ELR A;  3CHQ A;  3QAR A;  4PH4 B;  3Q7A A;  2QYU A;  3Q75 A;  4AY6 A;  1EDU A;  4J8S A;  4O1P A;  3D3M A;  3OTN A;  3Q78 A;  3UT7 A;  4FC8 A;  4DX1 A;  2QY7 A;  3Q7F A;  3BU8 A;  3E34 A;  3KD7 A;  2J07 A;  2VSX E;  3EHR A;  1SQM A;  3QB2 A;  4L2Y A;  3R7Q A;  2Y3A A;  2WXF A;  5KNH D;  5EN5 D;  3TWR A;  1MX4 A;  4U7E B;  2PM7 A;  2PQR A;  4AY5 A;  1JCQ A;  5ITZ F;  1OT8 A;  4L9P A;  2Y1L E;  2X6J A;  4WUY A;  3FUL A;  3SQV A;  4OAU C;  4LUN U;  1S0P A;  1Z3Y A;  3JQ0 A;  3MKR A;  5BPP A;  4JHK A;  1DNP A;  4GA1 A;  2VSO E;  4DLO A;  2E2E A;  3JYS A;  2DWZ A;  5J90 A;  1TNO A;  2KM4 A;  3QKY A;  2Y69 E;  3SBS A;  1N52 A;  4BEP A;  3GZS A;  5JHB A;  5BXU A;  2R05 A;  3FTW A;  4GZC A;  5E75 A;  2LUH A;  4AM9 A;  1U2V G;  2EIK E;  1O5M A;  3HXF A;  2RFM A;  2HO1 A;  4CT0 A;  4AOF A;  3DEP A;  3LY9 A;  3RRN B;  4KYO B;  4C9B B;  3DSW A;  4U0Z A;  4BER A;  2WXG A;  1Y8M A;  2VGY A;  3S7D A;  4AJW A;  1WM5 A;  2KAT A;  4BTA A;  4BX9 A;  4HLL A;  4GTT A;  3VLE A;  4H7Y A;  4UQX A;  2XGO A;  4DJA A;  2XHE A;  1FVH A;  2OCC E;  4TUU A;  4UUC A;  3PS6 A;  4CCA A;  2F8Y A;  3S7F A;  2ZGD A;  2P2C P;  3PE3 A;  3TAX A;  4ILG A;  2P9I G;  1E8Y A;  1XNF A;  2WQ7 A;  2V4H C;  5ANR A;  4HOQ A;  2F37 A;  1OCO E;  3IKO B;  1JWG A;  4O1O A;  2PQN A;  2AJA A;  1H6K A;  1NZN A;  4UWG A;  4PDX A;  3D9O A;  4JD2 G;  3ZIM A;  2FUL A;  1BPO A;  4ATZ D;  1N4R A;  1NI1 A;  4AXH A;  2YQ8 A;  4YND A;  3DXK G;  3FU6 A;  2LAI A;  4DLQ A;  2R59 A;  2GW1 A;  3Q73 A;  2KBX A;  1TJC A;  2GRO B;  4JZY A;  2DZO A;  3LXU X;  4ACL A;  2HE0 A;  2VGX B;  4BY6 A;  2XGM A;  5CMY A;  2F0Y A;  3X2Q E;  1Z3X A;  3ONK A;  3LEW A;  3CIA A;  4G8L A;  4ANX A;  2X38 A;  4JXT A;  4B8A A;  4GZ6 A;  3UM1 A;  4BT8 A;  2I6H A;  3G2V A;  3ZHE A;  3L17 A;  3BEE A;  4DX5 D;  1K3Z D;  4GTQ A;  3MEK A;  3FTY A;  1OWP A;  3FTX A;  4L1B A;  1NA3 A;  1TJF A;  3MKQ B;  3ULQ A;  4E85 A;  4WNF A;  4U96 D;  3FUH A;  4JHJ A;  5ARG A;  2IOS A;  1L5J A;  4GTM A;  2IO2 C;  3DST A;  2AXU A;  3MA5 A;  4N2S A;  4XI0 A;  2V4L A;  3HIZ A;  2R2L A;  4L7T A;  2P9U G;  4GTP A;  4KMO A;  1H0A A;  4G24 A;  3ZUV B;  3P2B A;  3HHM A;  3V79 K;  3ISM C;  1N11 A;  3PVL A;  1SZA A;  4Z68 A;  4B93 B;  1ZU2 A;  5KBA A;  5BT1 A;  1LTX A;  2A4Z A;  4HI9 A;  3W9G A;  3FY4 A;  4MS6 A;  4L2L A;  3MYV A;  2LXM A;  2Y4T A;  3SD5 A;  2KC7 A;  3LJN A;  3CST A;  2FEZ A;  5FJY A;  4GPK A;  2WXN A;  3N71 A;  1IQU A;  1LD8 A;  4IN3 B;  4GYO A;  4WNE A;  2NYJ A;  1HF8 A;  5KNG A;  3L22 A;  4MLP A;  2KCV A;  2AXV A;  5AJL A;  4F7A A;  3I3N A;  1TNU A;  4DX7 D;  3UUX A;  1D8E A;  4ILH B;  3UIP C;  4CT4 A;  1PC2 A;  3VTY A;  4FAD A;  5KCM A;  4GTS A;  1WY6 A;  4I1M A;  3QJZ A;  4EEC A;  5HQ8 A;  2P9S G;  3DSU A;  4K0R A;  2XPI A;  5ENO D;  2WXH A;  2PM6 A;  4JPS A;  4N5Q A;  1FPP A;  4FUL A;  4GYY A;  5DBK A;  3RO3 A;  4C48 B;  1JUQ A;  3Q79 A;  1JWF A;  4GZ5 A;  4K5A B;  4TUM A;  1N95 A;  3CVL A;  4XX5 A;  3FUE A;  3P1U A;  2OV8 A;  3EUV A;  3FUK A;  3VTX A;  5FZS A;  3JUI A;  3E4B A;  2AXZ A;  4FJY A;  4IUL A;  2J9Q A;  2HYZ A;  3RO2 A;  2JLB A;  2Y4U A;  4GB9 A;  1Z5S C;  3U64 A;  5EYP F;  3FTZ A;  4DUI A;  4JEH A;  3IXE A;  2R03 A;  4MBG A;  4YDO A;  4G1T A;  2J8S D;  4H7X A;  3ZVV A;  4KZC A;  1HG5 A;  3C98 A;  2XCC A;  5ARF A;  3PNL B;  3S2A A;  4A55 A;  2I2O A;  4HVB A;  1HH8 A;  4HNA D;  3ASN E;  4LRZ A;  4GAA A;  4EBA A;  3K9I A;  2ILR A;  3SHF A;  4U04 A;  4EZK A;  4CGV A;  3MX3 A;  2ZIS A;  3UPV A;  3EU9 A;  3HYM B;  5EKQ D;  5ENN A;  5FTP A;  3SI5 A;  3RJV A;  4WAF A;  2LSU A;  4HBD A;  3ZXS A;  3PRZ A;  2J4B A;  1NFI E;  2KZT B;  4HB5 A;  3SNX A;  2ETC A;  2A5E A;  5G04 J;  4IRU A;  3SFZ A;  3LS8 A;  4ME2 A;  2WVI A;  5KJN A;  1EPU A;  5G04 C;  3Q47 B;  4LER A;  2LO6 A;  1TN7 A;  3AG1 E;  3C3R A;  4ABN A;  5CCM A;  3S7B A;  3GYZ A;  4U0U A;  5ENQ D;  4UI9 K;  1OWN A;  4NAC A;  3MGB A;  2XQ0 A;  1QBQ A;  1TNY A;  4LNG A;  4CZ2 D;  1E8W A;  4O60 A;  4K5B A;  3PEV B;  5HKP A;  5J08 A;  3OAW A;  5EDS A;  3B7R L;  3LVQ E;  3FTV A;  5HI7 A;  1Z6T A;  3UM3 A;  2WXJ A;  4WWN A;  2KXP C;  3UMV A;  3ABM E;  3B13 A;  1FCH A;  4V3I A;  4EZL A;  1VDY A;  5JA4 D;  1N94 A;  1Y6I A;  3FTS A;  2NSZ A;  2BKG A;  1E7V A;  3Q4A B;  1FVF A;  3OXF A;  1HU3 A;  4QQI A;  1N4S A;  4LCT A;  4JA9 A;  4XI9 A;  4KZ0 A;  3TWS A;  3SBT B;  2YHC A;  4BWR A;  5IY5 E;  4I6G A;  3V30 A;  3FHE A;  4OVU A;  3AS4 A;  3ZFW A;  3FEX A;  4YDW A;  2VGX A;  2BKK B;  4PS8 A;  5FIO A;  4GTO A;  2X6K A;  4KBQ A;  4ZHB A;  5CCL A;  2XCB A;  4APO A;  4GCN A;  2IJG X;  3D9I A;  2JAB A;  3C72 A;  3B7T A;  4DRX E;  3KS2 A;  3T8M A;  4R7L A;  1EYH A;  4BET A;  2WMO A;  3SY2 A;  5CED B;  5KWD A;  3CVY A;  3ZEF A;  2UY1 B;  3MZL B;  4GTV A;  3ZXP A;  2VTB B;  3PE4 A;  1UN8 A;  5FQ4 A;  3B7S A;  3CHR A;  3MKQ A;  4AVX A;  1BLX B;  3Q5M A;  5EX3 A;  3TWT A;  3MCX A;  4NIK A;  1S64 A;  4ILI A;  5FT9 A;  2RG8 A;  3L54 A;  1HO8 A;  4HRM B;  2XPY A;  4P29 A;  5B1A E;  5FQ6 A;  3KSL A;  4CEM A;  1KZP A;  4CDN A;  3R9A B;  4UWF A;  2B6C A;  2P58 C;  4J8E A;  3FEY A;  3GW4 A;  2X6F A;  1MZC A;  3QWV A;  4URK A;  2PZI A;  3QAQ A;  4GZ3 A;  3ZYQ A;  3EU5 A;  2FO1 E;  4AEZ C;  3V2O A;  3PH0 C;  4BSZ B;  2J09 A;  3PZD A;  5AIJ A;  3LY8 A;  1HX8 A;  4RG9 A;  2H6G A;  4RLY A;  1DC2 A;  3VLF A;  4DX6 D;  1OWO A;  4XEI G;  4CGW A;  3E32 A;  3FUI A;  1K1A A;  3PEU B;  3AU4 A;  1JCS A;  2EIN E;  4BTB A;  3ZW3 A;  3LY7 A;  4HOS A;  5D66 A;  5JJ7 A;  2IEJ A;  3CK8 A;  4G23 A;  1X5B A;  4I2Z A;  4I17 A;  2X6I A;  4ATG A;  4B89 A;  2MRI A;  5BUZ A;  1HE8 A;  3ZU7 B;  3J5Q B;  4UWL A;  1HFA A;  1FT1 A;  1NL4 A;  3ONL A;  2DVW A;  3TWU A;  2BTD A;  4JVS A;  4TV3 A;  3DRA A;  5LP0 A;  2XZD G;  1NA0 A;  4ACK A;  1PY1 A;  4N3C A;  2BUG A;  3D9M A;  4CRW A;  4FJZ A;  2J08 A;  4F3V A;  2VSY A;  3TXN A;  4HFG A;  2Y0B G;  1SA5 A;  4A63 B;  3HXE A;  1H19 A;  5EX0 A;  5B1B E;  3TG5 A;  4HRN A;  3FUD A;  2XZT G;  5CEA A;  2AW6 A;  4RSY A;  2J4D A;  3JXJ A;  1QZ2 A;  2XPZ A;  3L13 A;  5CRV A;  1OY3 D;  4JC8 A;  4TXR A;  2GRL A;  2M63 A;  1LF8 A;  2BF0 X;  3FUF A;  5M72 A;  4FHJ A;  3SGH A;  4DPR A;  2CHX A;  4FU3 A;  3ML8 A;  2VQ2 A;  3DXM G;  2P9L G;  5BNW A;  3LKU A;  4F1S A;  4ANV A;  3LYA A;  4UWH A;  2CFU A;  2E0I A;  3GZ2 A;  3TGO A;  1RW2 A;  1HXI A;  2WXQ A;  3FUJ A;  3LJ3 A;  2PNN A;  1D8D A;  4ZFH A;  1S70 B;  3S7J A;  2OEW A;  3CEQ A;  5T8I A;  3CSF A;  2KZT A;  2GGF A;  3AG2 E;  2WXL A;  4AP2 A;  3PZ4 A;  3CVW A;  4A1G A;  1DCE A;  3NOC D;  4BX8 A;  2DYS E;  4DI4 A;  1A5E A;  5JHA A;  1AWC B;  3ZN3 A;  3DPD A;  4CYM D;  4PS7 A;  1BI7 B;  5JMN D;  1IXV A;  3VLD A;  1E7U A;  3BG0 B;  5FIN A;  2EIJ E;  4N3A A;  3T8K A;  3BQO A;  1H6O A;  2IQC A;  3EHN A;  3IHY A;  3PNT B;  2FF4 A;  2VJ8 A;  3CVQ A;  3WXX A;  5CER B;  5A6C A;  3U4T A;  1TNZ A;  3ABL E;  1MJ0 A;  4J8Y A;  2IY0 C;  4N5C A;  1N4P A;  3TWQ A;  5C2Y A;  4JW1 A;  3O4Z A;  3U9W A;  2X6H A;  2ION A;  3HVE B;  4KT6 B;  2L9B A;  2MHK A;  5D0O D;  4JL0 A;  3FU5 A;  2XRZ A;  4I1O B;  1UG3 A;  3T5X A;  3APD A;  2JEK A;  2YHE A;  2HR2 A;  4I43 A;  4LG6 A;  4RG6 A;  2I1K A;  2OOE A;  4JA7 A;  3ASD A;  4KVM A;  3TL5 A;  3NZU A;  1GW6 A;  2IU1 A;  3G2T A;  3IBE A;  1UOH A;  4A3V A;  4ANU A;  3SFY A;  3G2S A;  4XKB A;  5FQ7 A;  2LAH A;  3E30 A;  2PL2 A;  5CMW A;  4LNU D;  1G3N B;  3PZ1 A;  3FU3 A;  3RRM B;  3KSQ A;  2CG3 A;  5B3S E;  1MX6 A;  1OCZ E;  4XIF A;  2VYI A;  2GRQ B;  4UI9 J;  3AG4 E;  3U66 A;  4FLB A;  1K8K G;  2V5F A;  4J8D A;  1SZ9 A;  3DWL G;  3UTM A;  5AJD A;  5H7P A;  5AQB A;  3DEO A;  4MKT A;  1E90 A;  3CQC B;  4UQY A;  2XEN A;  3SO8 A;  4UI9 C;  2QFC A;  4M3O A;  3CHS A;  1IYG A;  3G2W A;  5JJT A;  4YVQ C;  1N0R A;  3FH8 A;  1H2T C;  2ETA A;  4CDM A;  2IF4 A;  1TNB A;  2WPV A;  3LDZ A;  3ASH A;  2UY1 A;  3URZ A;  3CLJ A;  1S63 A;  2WQH A;  2ETB A;  3HRA A;  4NUR A;  2VTB A;  3O48 A;  2CHW A;  5ENT D;  4OVV A;  3ZNG A;  2V8S E;  4Q69 A;  3ZKJ A;  3MV2 B;  4XE0 A;  3UIN C;  5ENP D;  3CK9 A;  2L0T B;  3CV0 A;  2RD0 A;  3KAE A;  3CK7 A;  4OYS A;  2IFU A;  4I1A A;  3LCA A;  5HRY A;  2L6J A;  4BES A;  3QDN A;  3AG3 E;  3DSS A;  2VGE A;  3L9T A;  1YA0 A;  2V5Q C;  2J49 A;  3FTU A;  5G05 J;  3FFL A;  3FP3 A;  4NRH B;  3MJW A;  4HOU A;  2P9N G;  3RRU A;  2OVF A;  1KT1 A;  4OAV B;  3UI2 A;  5G05 C;  3T9K A;  3HXD A;  3L16 A;  2QZA A;  2ZIR A;  4J0U A;  4C0M A;  1IHB A;  2F8X K;  3UT8 A;  4B8C B;  2AWI A;  4FP7 A;  4GZD A;  2C0M A;  4DX2 A;  1OCR E;  3Q15 A;  3RIB A;  2ZXW E;  3TWX A;  3SF4 A;  1DCQ A;  3AJI A;  4HOT A;  3DSV A;  5A23 A;  2BED A;  4GTR A;  3LVR E;  2WXP A;  5AEN A;  4N2Q A;  4EZJ A;  3CKC A;  2DBA A;  3ABK E;  4G8K A;  4PS3 A;  3CVV A;  3ASO E;  1K1B A;  3L08 A;  4D10 C;  5AAR A;  2QYJ A;  3NB2 A;  4BT9 A;  3ZYL A;  4A3T A;  3PZ2 A;  3AAA C;  4WNG A;  3D9K A;  5EYL A;  5AAO A;  2GRN B;  1A17 A;  3APF A;  3FUN A;  1U3C A;  4I9E A;  4GA0 A;  3MV3 B;  1SVX A;  3L82 A;  1OWM A;  4A1S A;  5D2M C;  1V55 E;  5A7D B;  4UWK A;  3NZS A;  3I4G A;  2B0O E;  1OUV A;  3ZRH A;  1V54 E;  4DK5 A;  4U8V D;  3D9J A;  4KVO A;  1WAO 1;  2DIW A;  5T3R A;  2XS1 A;  2XS8 A;  2L6B A;  5G2N A;  4XKC A;  3QWW A;  1DVP A;  1N54 A;  3ESL A;  2P9P G;  4U07 A;  1TN8 A;  4TRQ A;  4HRL A;  3I4R B;  5HS0 A;  4GMJ A;  4F1P A;  1WDY A;  1JCR A;  2LSV A;  3C3Q A;  4RVB A;  3UX4 A;  2R5S A;  2WXK A;  3PUJ A;  3UQ3 A;  4GA2 A;  2IO3 C;  3IEG A;  3NF1 A;  1QYM A;  5D0Q D;  3ULY A;  2WB2 A;  4WWO A;  3EHM A;  3EJN A;  3B95 A;  4QFV A;  4UQZ A;  2V0P A;  5CBN A;  1TR4 A;  1UJJ A;  5FZQ A;  3FH7 A;  4BSX A;  4Y6W A;  1SA4 A;  4U0S A;  3ZYK A;  4EPZ A;  3ZGQ A;  1TYQ G;  1BU9 A;  5CHE E;  5LCW J;  3V31 A;  3CHM A;  4JB8 P;  3AU5 A;  4GU5 A;  3ULE G;  1OCC E;  3NQP A;  1O1R A;  5AQ9 A;  3FWV A;  3ML9 A;  3RK6 A;  5LCW C;  4JEU A;  4HQD A;  3ESK A;  4RQI A;  5T4Y A;  4AIF A;  3UKR G;  3HVE A;  4GMR A;  2XEV A;  4GCO A;  2GRP B;  4JHR A;  4NQ0 A;  3KEA A;  4MRU A;  5C1D A;  1RZ4 A;  5LX8 A;  1FT2 A;  2H6I A;  2WXO A;  4N39 A;  4E6H A;  5ENS D;  2XEE A;  3FH5 A;  4PUC A;  4N3B A;  3UM2 A;  5AYW D;  2CHZ A;  3NBN B;  1MYO A;  5FWQ A;  3Q9U C;  3ZPJ A;  1ZB1 A;  2KCK A;  3FU0 A;  2GRM A;  4G11 A;  4J8F A;  4I2W A;  4YVO A;  5EIL A;  2DZN A;  2R02 A;  1UJK A;  5AQ7 A;  3D9N A;  2C0L A;  3B7U X;  3NOG D;  4I6E A;  4K03 A;  5G55 A;  3QC1 A;  1YMP A;  2WXR A;  3Q49 B;  2RKK A;  3QK0 A;  1ELK A;  3GZ1 A;  3JXI A;  3AS5 A;  3W9F A;  2DYR E;  3V2X A;  1XGW A;  1ZBP A;  4EHM A;  4G2V A;  5KJK A;  5LFA A;  1MHQ A;  2P9K G;  3Q9N C;  2VSN A;  3E37 A;  3CR3 A;  2UWJ G;  2LNI A;  3PDN A;  2WM9 A;  1TEZ A;  4M7C A;  3CVP A;  3WG7 E;  3EHQ A;  4U8H A;  3CGH A;  1H6P A;  3EIQ C;  4L23 A;  1D9S A;  5CRU A;  3HDX A;  2AVP A;  5BV0 A;  3DBS A;  3TXM A;  2WXI A;  2FBN A;  2L0I A;  5AQA A;  4U8Y D;  3QOU A;  3HXC A;  4C0E A;  2OVB A;  5JJ6 A;  1YYH A;  3EIJ A;  5EID A;  1SW6 A;  4APF A;  4B0Z A;  3PZ3 A;  4EBA G;  4CDR A;  2R17 C;  4Y6C A;  3CVU A;  1KT0 A;  2OND A;  4HI8 A;  3IV0 A;  1H2U A;  2NC9 A;  2EIL E;  3U3W A;  1IHG A;  3NAW A;  1MX2 A;  1IKN D;  1WG0 A;  3UXG A;  1H2V C;  2ZGG A;  2C2L A;  4DI3 A;  3FDH A;  1NP7 A;  4ANW A;  2MOW A;  4GML A;  3EDT B;  1HS6 A;  4K5C A;  4YDY A;  3JCK C;  1E96 B;  4TXP A;  2CFZ A;  3QNK A;  4O6F A;  5ANL A;  3JQ1 A;  4GPM A;  3R9M A;  3RKV A;  1INZ A;  2LXL A;  3D9L A;  2EIM E;  3JUE A; 
#chains in the Genus database with same CATH homology
 4ZFH A;  1S70 B;  1BI8 B;  5EYP F;  2DVW A;  3LJN A;  4J7W A;  3TWU A;  4BER A;  4DUI A;  1BLX B;  1MX6 A;  3TWT A;  4NIK A;  4CZ2 D;  2XEH A;  4O60 A;  5AQ9 A;  4K5B A;  3IXE A;  4O1P A;  2XZD G;  3UI2 A;  4OAV B;  3EHQ A;  5HKP A;  3T9K A;  4HLL A;  4HQD A;  4U95 D;  4G8L A;  2NYJ A;  4HRM B;  1D9S A;  4DX1 A;  1IHB A;  4HRL A;  2J8S D;  3UTM A;  4GMR A;  5AQB A;  5KNG A;  2F8X K;  5HS0 A;  3DEO A;  5BXO A;  3EHR A;  4DX2 A;  5AQA A;  2KXP C;  2XEN A;  2Y0B G;  4U8Y D;  3SO8 A;  4DX7 D;  4UUC A;  5JA4 D;  3NOC D;  1A5E A;  3TWX A;  2QC9 A;  3KEA A;  4A63 B;  2RFA A;  4F1P A;  2BKG A;  1WDY A;  1AWC B;  1DCQ A;  4HNA D;  3AJI A;  4DX5 D;  4HRN A;  1K3Z D;  4CYM D;  1YYH A;  2F8Y A;  1N0R A;  1BI7 B;  2ZGD A;  1IXV A;  5JMN D;  2P2C P;  2XZT G;  2ETA A;  5CEA A;  4QQI A;  5ENS D;  5KNH D;  5EID A;  5EN5 D;  1SW6 A;  3TWR A;  1MX4 A;  4F6R D;  2XEE A;  5FIN A;  3JXJ A;  5ITZ F;  3T8K A;  1OT8 A;  3TWS A;  2MYO A;  2V4H C;  2Y1L E;  2FO1 E;  3J5P A;  3NBN B;  3V2O A;  1MYO A;  4G8K A;  3Q9U C;  4BSZ B;  3V30 A;  1BD8 A;  4U96 D;  2ETB A;  5CBO A;  3HRA A;  2F37 A;  3EU9 A;  3TWV A;  1OY3 D;  1K1B A;  5ENO D;  4OAU C;  1QYM A;  5CER B;  5AAR A;  4YDW A;  5ENT D;  4HBD A;  2QYJ A;  4N5Q A;  1MJ0 A;  4HI8 A;  2BKK B;  3TWW A;  4O1O A;  3ZNG A;  3B7B A;  4J8Y A;  3B95 A;  4QFV A;  3TWQ A;  2AJA A;  5FIO A;  4C48 B;  3AAA C;  3ZKJ A;  1NFI E;  4HB5 A;  4RLY A;  1DC2 A;  2ETC A;  2A5E A;  5EYL A;  5EIL A;  4DX6 D;  5AAO A;  2DZN A;  5CBN A;  1TR4 A;  5ENR D;  5AQ7 A;  4ZHB A;  5EIB E;  1MX2 A;  1IKN D;  1WG0 A;  5ENP D;  4K5A B;  2DWZ A;  1K1A A;  3NOG D;  3UXG A;  4TUM A;  2ZGG A;  1YCS B;  3ZUV B;  1YMP A;  4ATZ D;  4LSZ E;  3V79 K;  2JAB A;  1N11 A;  1SVX A;  5HRY A;  3JXI A;  4LG6 A;  4BEP A;  4Z68 A;  4BES A;  4DRX E;  4B93 B;  3C5R A;  3W9F A;  4BET A;  5KBA A;  4K5C A;  2VGE A;  3F6Q A;  2V5Q C;  5D66 A;  5BXU A;  1AP7 A;  3V2X A;  5CED B;  4YDY A;  5KWD A;  1N0Q A;  2KBX A;  5AN8 A;  1UOH A;  2B0O E;  2DZO A;  4GPM A;  4U8V D;  4HI9 A;  3HG0 D;  3D9H A;  1BU9 A;  3W9G A;  5ENQ D;  5CEC B;  3V31 A;  4LNU D;  2PNN A;  3ZU7 B;  1G3N B;  2L6B A;  2RFM A;  3J5Q B;  3JUE A;  3Q9N C;  4JB8 P;  2HE0 A;  3DEP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...