5CBNA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus with chemical cross-linker ey-cbs
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
b'SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
molecule tags Protein binding
source organism Escherichia coli (strain k12)
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cbnA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cbnA01
1BDCA 1EDJA 3Q9UC 5ENSD 1IHBA 3TWVA 4N5QA 1TR4A 2DZNA 2L6BA 4JB8P 4K5AB 4GOEA 2B87A 2RKLA 1OT8A 1BD8A 2MYOA 2XZDG 1WG0A 2RFAA 2Y0BG 4YDWA 3V2OA 3JXIA 4WWIA 1IKND 4K5BA 1NFIE 4DX6D 5BXUA 4ZHBA 3NBNB 1QYMA 1AP7A 5FINA 1IXVA 4F6RD 4ZFHA 3W9FA 4F1PA 3MZWB 4CZ2D 3MHVA 3UXGA 2HR3A 2WMMA 4U96D 2XZTG 3RGUA 5DJUB 4OAVB 1MX2A 3IXEA 5AQAA 1WDYA 4UUCA 4GPMA 4G8LA 1G3NB 2B87B 1K1AA 4CYMD 3HRAA 4GMRA 4HRLA 1DCQA 3EU9A 5KNGA 1ZW0A 1EC5A 1Q2NA 4HB1A 1X0TA 1LT1A 3TWQA 3NOCD 3W9GA 4C48B 4U95D 2RFMA 1Y47A 2F8YA 3FXDA 1N0RA 2KIKA 2F8XK 2LXCB 5D66A 4HRMB 2ETCA 1U7MA 5FIOA 1N0QA 2ETBA 4IOIH 2XEEA 4O1PA 5ENRD 3V30A 4DX1A 4HKZH 3T8KA 5AARA 5ENQD 5CEDB 2I8DA 2A5EA 4LG6A 3V79K 1EDKA 2NYJA 2J8SD 1S3JA 5CBNA 2QYJA 5ENPD 2XENA 1N11A 1S70B 3TWRA 3TWWA 2KUBA 1FC2C 4ZNCA 1YCSB 4U8VD 5KNHD 3B7BA 3T9KA 1EDLA 1BI7B 1UOHA 3ZUVB 1H0TB 4QQIA 4HJGH 4BETA 2LR2A 4Z68A 4B93B 2LXBA 5ITZF 4ATZD 2KZJA 4KJMA 2V4HC 5EYLA 5JMND 2KBXA 3Q9NC 3ZNGA 1JMBA 1BDDA 5HS0A 4K3AA 4NPFX 3EHRA 3QWOC 3ZDMA 4HQDA 5KBAA 1MYOA 1YMPA 5KWDA 2Y1LE 2V5QC 3C5RA 4MN4C 5AQBA 3SO8A 2QRXA 5CERB 4OAUC 2B0OE 4HRNA 4BESA 5EIBE 3TWSA 2KI7B 2R44A 1BI8B 2DVWA 1OVUA 1OY3D 2AJAA 3HG0D 4HI9A 2PNNA 4O60A 1OVRA 4TUMA 1K3ZD 2M0BA 4EYYQ 4BXLA 3UI2A 2Q1KA 2FO1E 5K5GB 2SPZA 1ZXGA 1A5EA 1SW6A 3PH0A 5CEAA 5EIDA 5HRYA 3JXJA 4YDYA 3FXEA 1EDIA 2VGEA 3NOGD 5AN8A 2BKKB 3TWUA 4QFVA 4NPDA 1DEEG 2ZAEB 1BLXB 4J7WA 3TWXA 2OTKE 4HBDA 1BU9A 4BSZB 4HNAD 4RLYA 4A63B 1MX4A 1MX6A 3J5QB 3B95A 2XEHA 2ZGDA 3JUEA 1DC2A 4DRXE 3D9HA 3DEPA 4ASWA 2DWZA 4U8YD 2KXPC 2JWDA 2UWJE 3S1KA 2P58A 1LP1A 1NVOA 2KZIA 3F6QA 3LJNA 2HE0A 3ZKJA 4BEPA 5EYPF 5DJTB 4CPGA 5AQ7A 2B89A 1MFTA 5ENOD 1LP1B 5EFWB 1JM0A 3EHQA 1AWCB 4LSZE 4J8YA 5C39A 5CECB 3V31A 3V2XA 4ASVA 4K5CA 2K3RA 3DEOA 5ENTD 2JABA 2B88A 1U7JA 2M5AB 4HI8A 4DUIA 1YYHA 2BKGA 4BERA 4JBZA 4HLLA 4ZMDA 4NIKA 4GOFA 2QVAA 2KS1B 4DX7D 4NPEA 4G8KA 2QC9A 4GODA 1MJ0A 5AQ9A 5CBOA 2ETAA 5HKPA 2P2CP 2ZGGA 3UTMA 3AAAC 4LNUD 5EN5D 4DX2A 4DX5D 5AAOA 5BXOA 5EILA 4HB5A 3ZU7B 5JA4D 1H0TA 4O1OA 3J5PA 4K35A 1SVXA 2M5AA 1K1BA 3AJIA 2DZOA 3KEAA 3TWTA 1SS1A 2F37A 1OVVA 1D9SA
chains in the Genus database with same CATH superfamily
4H7XA 4JB8P 4YDWA 2RKLA 1IFJA 2WXOA 4K5BA 3BQOA 1WT6A 3EIQC 1QQEA 2Y9ZA 3G2UA 2I6HA 3CK9A 4I1MA 5KLVG 1BE3D 3CXHE 3EU5A 1P84I 3UM3A 2X6FA 2QJKB 1VQMP 1UJJA 3RK3B 4B86A 3EU9A 1KFMA 3ASOE 2H8PD 3E1RA 5FJYA 4C48B 3EHNA 4HOUA 3SFEC 2IF4A 2X38A 3HHMA 1LTIC 4F7AA 1UW4B 1SLQA 2I8DA 5BNWA 2C0MA 2QYJA 3PVLA 2HLOA 1YCSB 4ME2A 5KNHD 3ZUVB 3HRNA 1BI7B 1X79B 1WY6A 1H8AA 2Q7FA 2PQRA 1MUUA 3MKRA 3L9TA 3Q73A 1IK9A 4GTMA 2QE7H 3B7UX 4I7ZB 3LKUA 2JO1A 2OYIA 3DSXA 1VQOP 4TT3H 3E37A 1MYOA 4WBAA 3HE4A 1KB9I 3GZ1A 3G3ZA 3RO3A 4OGQD 1N9AA 1SQBK 4RKUJ 1YJNP 3FWVA 1AQ5A 3IN6A 3P32A 2ILRA 1MQSA 2OCCE 2Q1KA 1RF0A 4N2SA 2XHEA 3KD7A 1SA4A 2VYIA 2WXRA 1KQLA 2JR8A 1YTZI 4I6MC 3VLEA 4A63B 2P9LG 3J5QB 3CKBA 3L22A 2NXPA 2X6IA 4B94A 2OYHC 3Q1MA 4L74A 1N52A 1S63A 1LT9B 2YQ8A 5DJTB 4IL6H 5AJDA 1NZNA 2NC9A 5C39A 1QX8A 3LDZA 1Z56A 2J09A 1E7VA 3CVNA 4YDOA 2FYUG 4I1AA 1YJWP 3WUTA 2XGOA 3BASA 1SQQG 2H89C 1Y6IA 2FXMA 3AAAC 5CJ4A 1XTCC 3AE1C 5AW1B 3RBZA 2HPCB 1Y9BA 4DI4A 2M8RA 2R2LA 3Q2YA 1D9SA 1URQB 1H89A 1OWOA 4WNGA 2Q3IA 2ZXWE 2FYZA 3FFLA 2BEZF 3RBXA 3AECC 4WWIA 1ZRTE 3TSIA 3AEEC 4WY4A 2LXLA 5AVUB 5KAIH 3H1IJ 4F1PA 3UT4A 1ZMEC 1A02F 3M9BA 1S64A 1GU5A 1TNYA 1ZLLA 3JUIA 4EBAA 1MX2A 1WDYA 4ZKUA 3QOUA 4HRLA 4JEUA 1VQLP 3CCLP 2VSXE 1X0TA 2W90A 4XEIG 3NZUA 3H1KD 1KB9H 3L75G 2LO6A 4Q69A 5D66A 3PEVB 3TXMA 2FXOA 4UB8H 2ZT9D 2WPRA 2O3JA 4EIJA 4EZLA 3CPWO 1EZVE 4KT0J 3B13A 1ELKA 2FYNB 3HIZA 2MKVA 3RK3C 1H0TB 2J58A 5CCHD 4N2QA 1FZCB 2KCKA 3AE3C 2YKQA 4RVBA 1GK6A 1H19A 1XNFA 1M57D 3CXHI 3RSEG 3RK2B 1IJDB 4GTTA 3R7QA 1RW2A 3CHQA 1TJFA 1OXZA 3TWSA 3V6IA 3VMYA 3V4WA 2R03A 1IFNA 3CGHA 5K5GB 3DRAA 2VTBA 1K8AQ 4C7NB 3ULQA 3ASDA 1ZOYC 2OTLP 3QWWA 1EDIA 3CHMA 3EWKA 5EKQD 4A3TA 5CCHA 3SFDC 2XS8A 3D9LA 4W80A 2J4BA 4HNAD 3TDKA 4JPSA 2L9BA 3DXKG 3B7SA 1RF1A 2DWZA 4Y99B 2K37A 2HG5D 1QZ2A 1AV1A 1NTKK 3ZKJA 3ZVVA 5AQ7A 1JTHA 5ENOD 2VSNA 5BV1A 3WU2E 2Q6QA 5L8RJ 5AW5B 3E7KA 2WITA 1RE4A 4U7EB 2J9QA 1KD1Q 4TXPA 5BU5A 4NACA 3JCUH 4GODA 2E5TA 5APQA 3V2NA 2DBAA 5CBOA 4H13D 2AXCA 5FT9A 4LNUD 3H1JD 5CMWA 2Y69E 4JYCA 1KTMA 1V55E 3SBSA 3ZXPA 2M5AA 1SQVJ 2MOWA 5BT1A 3VMXA 1SA5A 1JWFA 3FP3A 1IHBA 4V3IA 2IX7C 1FZEA 4OYSA 2R32A 1IZNB 1AP7A 3SFYA 3GG2A 1UJKA 4JW1A 4HLEA 1M1JA 2LXMA 1VQKP 5TISH 1SQQD 1W2EA 1NU1K 4GPMA 2V7QJ 3HRAA 3H1JE 4I2WA 3PNLB 1ZW0A 1FT2A 3Q79A 1BPOA 5CRUA 2FYUE 2RFMA 3ABVC 4NQ0A 3MZLB 1VQ8P 5JJ7A 2QEXP 2QM7A 2CHXA 2ETBA 1PGJA 3B5NC 3MIWA 4UB6E 1KLXA 5BPPA 4GDOA 3TWWA 1BCCJ 2OTJP 1P84H 2XQ0A 2CFUA 3U3WA 2WMNA 4OGQB 2EIKE 1OCOE 3URZA 3I5PA 3RIBA 4GKGA 2C0XA 4F3VA 2KZJA 2Y4UA 4XI0A 4Y28J 4DCKA 2HM8A 4WWNA 3OTNA 4NPFX 4R4LA 4BTAA 2KXPB 3ZW3A 4NRHB 3TXNA 4JHKA 1BI8B 3SWFA 4APOA 3DPDA 1MKMA 1OVRA 3HE4B 4BWNA 4LERA 4LUNU 1EXJA 2WMOA 5APSA 3OW2O 2VGEA 4QFVA 2V4LA 1SQXE 4GTRA 1LWUA 2WVRA 4WY4B 3T5XA 1G2CB 2QG4A 1GL2B 3H32B 4DRXE 1FDIA 4U8YD 1N7SB 4UQYA 3ASFA 3H1IE 2R5DA 4J8EA 1VPCA 3Q4AB 3ZXSA 4XKBA 2WXQA 1N7SC 3CVYA 3NZSA 1NL4A 3ULYA 3ASNE 4Y6CA 5ENTD 1GL2C 1X81A 4HI8A 2M5AB 3OA7A 2LAHA 1YYHA 2PFXA 1IYGA 4GB9A 4G26A 5B5EH 1MJ0A 5AQ9A 4BRYA 3SNXA 3E1IA 5HKPA 1S0PA 2ZGGA 3APDA 4DJGA 1NU1E 4PD4H 5E79E 1FZCA 2AVPA 4I2LC 3KYQA 2P9UG 3AJIA 3SF4A 1Q90D 3T97A 1W3BA 3SFXA 4DZOA 4U3FJ 1LTTC 1NJIQ 3NTNA 1S5LE 2XPZA 2IYPA 4D10C 2WPVB 1QYMA 3Q5SA 1W5CE 3H1HJ 1KYOH 3L6AA 3Q78A 4GIFA 1N4RA 2LKMA 2BASA 1KQSO 1RE3C 2O01N 1KB9E 2IO3C 5CCGD 2WXMA 2K9JB 1N0RA 3P2BA 2H6FA 1NHLA 1BE3J 4EZJA 4GTPA 3LW5J 3BCCE 5ENNA 5FIOA 4IOIH 4O9BA 4FC8A 2I1JA 3G2TA 1NU1D 4BFRA 3MJWA 3S9OA 2R3SA 4YVOA 4N3YB 3O48A 2CG3A 3CXHH 4CDNA 1SP4A 1L0LE 1YI2P 1DX7A 4U0ZA 1JMBA 4FULA 4HQDA 4ILGA 4W7ZA 3KXDA 1YMPA 2MJZA 2KCLA 2PQNA 1J2JB 5AVQB 3SO8A 3ESKA 2XZRA 4PUCA 1JY3O 3H1JG 3BG1B 3RKVA 3L71G 4PJ0H 1KV4A 3GMAA 4URKA 5HRYA 4YDYA 2KYVA 3ASGA 3AEGC 5T4YA 2E5YA 1YJ9P 2JEEA 2WXNA 4A55A 1S4XA 3RK2C 3H25A 3CCJP 1QEXA 3PDNA 5TJHA 1VDFA 4WB4A 3IV0A 2DW3A 3HUSA 4ANWA 1CW5A 2ZIRA 4OVNF 1LP1B 4U04A 4WY4D 5T3RA 2D2CC 4LSZE 5CECB 3I4GA 4JF7A 4LGDE 3FX0A 2WSSH 2Z4EA 2B88A 1U3CA 4GPKA 4CDRA 4DX7D 4NPEA 3O6QA 4ANUA 3UM0A 4HOSA 5B66H 1A02J 4XE0A 2H7HA 3L16A 5D2MC 4CT4A 4DX2A 3DSWA 1X5BA 1K1BA 1JCDA 3TWTA 4WNEA 1OVVA 2M3EA 3H1LD 1PAQA 2DZNA 3DWLG 3TK1A 3L71J 1LWUC 1WG0A 3V2OA 2KZTB 1IXVA 2E75B 4EECA 1BE3E 3CXHD 4CRWA 1LD7A 4AYCA 1HXIA 2HYZA 4PH4B 4FLBA 4AQRD 3AG1E 1J1DC 3RK6A 1Q2NA 3H32A 1JCQA 3NOCD 2WT7A 1M8OB 1N73C 5A7DB 3L74E 3H1KG 3ML8A 3M0DA 1U7MA 5AW3B 5GTIE 2A4ZA 4DK5A 1JY2N 1KFNA 3H1HD 5ENQD 3ZHEA 1BGYG 3HXCA 3UX4A 4GCNA 4L7TA 3CC4P 3FTVA 3ABKE 4RG6A 3ZEFA 2NSZA 1INZA 3SFZA 4GT1A 5BUZA 3IAOA 3N71A 3A3YB 3LPZA 4PV1B 3QDNA 1EF1C 3QKYA 4FJZA 1FZAA 2VSYA 3C5RA 3PRJA 1LGHB 3HUSC 4XZ4A 4OAUC 1S1CX 4AUWA 1DVPA 1SQBE 1KMIZ 2BF0X 2PNNA 2VJ8A 4EYYQ 2ZXEB 4GMLA 1KYOD 3C8VA 4XI9A 1BCCG 2CK3H 2A06E 2ZAEB 1BLXB 3AEAC 5IY5E 3VP9A 4BWRA 1MX6A 3B7RL 2OYIC 3RU0A 3RRUA 3IF4A 2E74B 2VGYA 1JWGA 2EIME 3B71A 2FFDA 5G55A 1CI6B 1QGKB 5AVZB 3UIOC 4RSYA 4AVXA 2YMKA 4GZ5A 2XU6A 4UQZA 1R5LA 3CVPA 3PZ1A 1TNZA 4IULA 3H1ID 4GTOA 1E8ZA 2KSJA 3VTYA 1GD2E 1X8YA 3M0DC 4QMAA 3G71P 4I7ZC 1KQGB 1VQ6P 1OWPA 3Q5PA 2Q7CA 2GM4A 2OYIB 3J5PA 2XNDH 2OEVA 3E34A 1IC2A 3TWVA 1L4AC 1OT8A 1L0LG 2BCCD 3S7JA 1CSBA 1Y8AA 3CQGB 5FINA 2E76B 3JCKC 3MKQB 3S4RA 1Q7YQ 3UXGA 2ZISA 5CHXA 3IXEA 3Q5RA 4N3BA 4D6TG 4JD2G 1X9VA 1HFAA 2RMZA 3CX5I 3VOPA 4Z1MH 1PGQA 2W27A 1H88A 4L9PA 4CGWA 2WXIA 4HRMB 3OAKA 1OCRE 2EQXA 2XS1A 2OYHB 1OWAA 3CX5H 2NYJA 1EYHA 3TWRA 2WQ6A 5AW4B 5ENPD 1OWMA 5CCGC 3C72A 4U8VD 2WXGA 1WM5A 3KHUA 1VF5D 1E8YA 3HTKA 1N4PA 3FGAD 3EFFK 1BGYE 1J1EC 1WRGA 2WPSA 5KJNA 3MGBA 3ZNGA 3PH0C 2I9CA 1YIJP 2IEJA 3T5VA 1M1JC 1Z5SC 1L5JA 2Y1LE 4FU3A 4N3CA 1SQXG 4BESA 4PS8A 5LX8A 5M72A 1Q86Q 5KAIE 1S9KD 2DVWA 3L71D 1RHZB 4JQ0D 3RL0C 4C7NA 4H0LB 4RG9A 3BVHA 2GRQB 1T3UA 2J49A 1N73B 3UUXA 3AE7C 5AN8A 3I56P 2FULA 5B3SE 1J1DB 2OTKE 3L70E 2KK7A 2XEHA 3CMEP 4X8QA 5H2FE 3RK2D 2PP6A 1DC2A 4C7RA 4UB8E 2YIUB 3MX3A 3CLQA 4LNBA 1JY3P 1QVFO 4BEPA 1IFMA 1MFTA 1VDYA 3FUJA 3MA5A 2OVFA 1XGWA 3JQ1A 1U7JA 5AW8B 1Q2ZA 2E74D 4G8KA 1L0NG 3L08A 3VN0A 1PV3A 3ESLA 4FLHA 4PD4D 2L91A 1X22A 3CR3A 4G24A 3CVQA 4LLHA 5CCGA 4HOTA 1IFDA 2A06D 4YXDC 3UM1A 3RL0B 4CDMA 1BCCE 2Y9YA 4L75A 5AENA 1NWQA 3V2PA 2HFED 1BD8A 2QJKC 2HODB 4J8FA 5KJ7C 3PNTB 5APVA 2YXRB 3CQCB 4ZFHA 2WQHA 4JA7A 3PJSK 4DT0A 1HS6A 1NP7A 4LCTA 4U96D 4G11A 5DJUB 5AVSB 1OCZE 5AQAA 2OGUA 1LWUB 1SQBG 2KOGA 4PD4E 5H2FH 1EC5A 1NGMB 4TUUA 4G25A 4U95D 3CV0A 4GYYA 2PM7A 2R3CA 2N9YB 3FUFA 2P9KG 3KSLA 2R5SA 3LXUX 3B5ND 2WXJA 3L72G 1U2VG 1LTGC 4O1PA 3CVUA 1J1EB 2IBZG 2WPQA 1M90Q 1AWCB 3D3MA 2E42A 3AS8A 3IBEA 1IO4A 1L0NJ 3TGUE 3H1KE 3UKUG 1FJKA 3B8EB 3H6PA 3U64A 3S7BA 3L36A 2PL2A 2O1JA 2YKOA 1N73A 4I9EA 1GW6A 3QWOC 2YMYA 1SQQE 1YYCA 1JCSA 3CIAA 2KI7B 2Q3EA 3B5NA 2X6HA 3UI2A 1SQVK 3JC22 3Q3DA 3SSUA 1FE6A 2AXTH 3TWUA 5CJ0A 5E75A 5KAFE 3II6A 1TNOA 1MFZA 2BKKB 2L5GB 4NPDA 3IEGA 3CMAP 1HX8A 2Y4TA 4H13C 3ZYKA 5AW6B 3OAWA 1Q82Q 1BU9A 1ELWA 3CHPA 1FOSE 1HU3A 4KVMA 4IN3B 4H0LD 3BATA 1USDA 4ASWA 3FU3A 4GZ6A 5HQ8A 2BCCJ 3AG3E 3FU5A 2NPSC 3FY4A 2V8SE 3NFQA 3VTXA 3TGOA 2FBNA 4G23A 2XRYA 1IQUA 4BTBA 4GZCA 3KPEA 1R5SA 5AVYB 4L1BA 2XDJA 4YDEA 2IYOA 3SWKA 2J4DA 3ZIMA 5EX3A 1KZOA 4ZMDA 2WXHA 4TV3A 2J5UA 3MEKA 1LTJB 2WSFJ 5FQ4A 3CLJA 4GTVA 4JEHA 3MD0A 3QB2A 5DIZA 5KLIC 3N7NA 3M06A 2GRPB 2KZTA 3CCVP 1JCCA 1IFIA 2Z5HA 3CSTA 5APUA 2IZ1A 1OIPA 2CPSA 5ENSD 3T97B 4H44C 2HR2A 2E75C 1IKND 4UI9J 2A5UA 3LY7A 5CCMA 4RESB 3GHGC 1SZ9A 2WTYA 4ACKA 4L2YA 2E76C 2ZYGA 2KLVA 3IFMA 1YQ4C 1BSNA 1E96B 2CHWA 2CPBA 3R9MA 1D7MA 1K04A 2QJYC 3V4QA 3FUDA 4A1SA 3A0BE 1DCQA 5KNGA 4J0UA 3CD6P 3TWQA 3PUKA 2AXVA 4E85A 2R17C 2F8XK 1H6KA 3E32A 2C0LA 2KNCB 1N0QA 1GTWA 4DX1A 2QY7A 1KZUB 1Y8MA 2A5EA 4AJWA 3V79K 3WU2H 5CBNA 5GTIH 5JA4D 3ZYLA 1EZVI 2OARA 5GTHE 1UOHA 4N78D 3QNKA 3CHOA 3CWBJ 4HJGH 1FDMA 3EDTB 1JMMA 4KJMA 3GZSA 4OGQC 4JA9A 1RE3A 1DD3A 3AS4A 1YQ3C 2XCBA 5HS0A 1HBWA 1PZQA 2Y0EA 4BX8A 2B0OE 1OUVA 4HI9A 2FY8A 1NTMK 4YXWH 2RG8A 3TAXA 2FO1E 1JB0J 1NAFA 5EIDA 1BCCD 2DYRE 3PRZA 2V0PA 1NAYA 1MX4A 2MRIA 3LY8A 2XNXA 2FO7A 3LS8A 1PY1A 3NMDA 2UWJE 3LCAA 4WAFA 2YINA 2B6CA 4R4MA 1PP9D 4UB6H 3CVLA 3FHEA 3RL0D 1ZU2A 3UQ3A 4A3VA 4BT9A 3L75D 4EHMA 2ONDA 1NTZE 1E5WA 4Q94A 3NXSA 4JC8A 2O01J 3L72E 4LNGA 2W6JH 3U1CA 2M63A 5CCLA 4ACLA 4HB5A 4O1OA 3ABME 5HI7A 4I17A 4U8HA 3ZRHA 3NF1A 4LRZA 1BDCA 1SQXK 1HWTC 4GMJA 3LYAA 4UWFA 1NTKG 3JXIA 4ZHBA 1SQPK 2GUVA 4GZDA 4U63A 1NU1J 3AE8C 4FP7A 3AEDC 4HVBA 1HJ0A 2HR3A 1K05A 3CWBG 2P9NG 3ASHA 5FQ8A 3R9AB 4AY6A 5JJ6A 1K1AA 3HXFA 1OW8A 3A0HE 1Z3YA 4RO0A 1JTHB 4HB1A 4NURA 3FH8A 1S9KE 5AYWD 2FYUK 4J8DA 4EBAG 2C9NY 4PDXA 4GYOA 2WT7B 1CI6A 2O01H 4I6JA 5BU8B 2PZIA 2E0IA 3HVEB 2KS1A 4XE5B 4H44B 2P10A 2R5BA 2XENA 1S70B 4IFMA 1RF1C 1JPLA 5DBKA 1WMKA 1DCEA 4QQIA 2FYUJ 2ZYDA 2LR2A 2AW6A 3I55P 4R7LA 4D6TJ 2CHZA 1CZQA 3OXFA 4I6EA 4CEMA 3DSSA 3CCQP 1KYOI 3R4YA 1QBQA 1GMJA 3GYZA 1EXIA 4EOTA 2Q9IA 4N39A 1UIXA 1SQPG 1L0LJ 2RKKA 4GU5A 4M3OA 5B1BE 4ANVA 1T8ZA 4C9BB 2SPZA 3ZPJA 3AU4A 1KC8Q 3G2SA 3KSQA 1TN7A 3D9KA 3BUAA 3JXJA 2LSVA 1E79H 2K1AA 5CMZA 4K0RA 3FULA 1OWLA 4H13B 1OW6A 2ZGDA 3D9HA 3W68A 3H1KJ 1OMIA 5LP0A 3GHGB 1G1IA 3TGUD 1AJYA 4W7YA 4U3FD 3FU0A 2A45I 4CPGA 4I2ZA 4E6HA 1OCCE 2VRSA 1KT0A 1FZBA 3RK3E 1N8RQ 2RN0A 1KILD 3HDXA 2ZVOB 5EDSA 3Q75A 1VQ4P 2ZYAA 1TJCA 2ETAA 3BU8A 4HXIA 3UTMA 4JHRA 3PTZA 3CL3D 5AAOA 2XRZA 4AY5A 3TYYA 1H0TA 5KJMA 4WWPA 1BE3G 3CVXA 3KEAA 3ISMC 2K88A 2QFCA 4WVZA 4N5QA 1L2PA 5LCWJ 2GA1A 2Y0BG 4XA4A 1SQPJ 3DBSA 3D70A 3AS5A 4JXTA 1BGYJ 1GZLA 3R7RA 3KZIH 4D6TE 2DCPA 2JJLA 3CK8A 1KILA 4GYWA 4ILIA 4OWFA 1NTKE 1URQD 1XTGB 2B87B 3LY9A 3HE5B 5KJLA 3OXLA 3ZYMA 1MZCA 3SBTB 2X6KA 1OW7A 1LTSC 2KIKA 4B8CB 4PS7A 1LT9C 3V30A 2Y0DA 4HFGA 3OXGA 2RD0A 5CEDB 3A2AA 1KQFB 2J8SD 2JWAA 3TF5A 2WSCJ 2OYHA 1N11A 2KUBA 1FC2C 4ZNCA 1OWNA 3VYIA 2QM8A 3B7BA 3KAEA 1KT1A 4O6FA 2VSOE 3FEYA 1AFOA 5J90A 4KBQA 1USEA 3MGNA 2N1TC 1N4SA 3B5NB 2V4HA 1SQVD 3QWPA 5ITZF 3CK7A 5BW8C 3F5HA 3Q9NC 2AWIA 3QWVA 3OJAB 1FBMA 4K3AA 3EHRA 5KWDA 4F53A 4H44D 4U07A 4CT0A 4O60A 3U59A 3D9IA 4TUMA 1N7LA 3C1LA 2CFZA 1TN8A 1T2KD 5FZSA 3BCCG 3FH5A 1K73Q 2BCCG 5KKZB 1GU4A 2UY1A 2WSCH 3B95A 3G6EP 1SQBJ 1SQBD 4GCOA 4N6JA 1HG5A 4TXQA 3L75J 2IOLA 3T8MA 4M3LA 3L17A 5AVRB 3E4BA 1LP1A 4N78E 2KZIA 1VQ7P 3CKCA 1ZR2A 1IQRA 2B89A 4AOFA 2DYSE 3I3NA 4L2LA 1G2CA 4HOQA 4JZYA 4N3AA 3V31A 1H2UA 2K3RA 2GW1A 1FU1A 2NPSD 3H1JJ 4C46A 5KLVJ 4DUIA 2K9YA 4JBZA 1HE8A 4HLLA 5TISE 2KS1B 3CHRA 5A23A 5APXA 3GW6A 5AW7B 3VMZA 5EN5D 3RK3D 3FH7A 3VLFA 1GW3A 2I2OA 3L54A 1SVXA 3LJ3A 3BEEA 4Q96A 1PPJD 4AV7A 2HODA 5LOZA 3Q7FA 5EILA 3RJVA 2B87A 2IDBA 2GRNB 4KT6B 2RFAA 4UI9C 3CEQA 4GTSA 3L70D 1YITP 1P84E 3L74G 2NPSA 1YHQP 3IHVA 2WMMA 3D71A 3AEBC 3CCEP 3LVQE 1P84D 1MHQA 4A7PA 1HH8A 3A0HH 1IHGA 2Y3AA 2GRRB 1E8WA 2L0TB 3CWBD 1JCRA 1LNQA 2IBZE 1NTZJ 5KTBA 3CCMP 4JPZB 4B89A 2ITAA 3ZYQA 5ANRA 2VQ2A 2IOSA 2LNIA 2ETCA 5BV0A 4AM9A 4C0MA 2P9SG 3FUNA 3AG4E 2OVBA 3W67A 2E75D 2NRGA 3MYVA 4ILHB 1UN9A 4XKCA 1NTMJ 2C0WA 1NKNA 5AVWB 3LIDA 2HO1A 3M9HA 4BETA 3CC7P 3D6ZA 3EFGA 2WXKA 3V2QA 3GF3A 3BG0B 1BDDA 2WQ7A 1RZ4A 4PD4I 2JEKA 1MV8A 2AEJA 2ZT9B 1KB9D 4HRNA 1PP9G 2P9IG 1RQVA 1M1JB 3SY2A 3U9WA 3C3RA 2MHKA 1E8XA 2H6IA 3CHSA 1MZ9A 4XIFA 2E74C 2AXTE 4JVSA 1FCHA 1PFIA 3UKRG 4HBDA 3QH9A 4I1LA 1UN8A 1SQPE 2XPIA 3LVRE 5AVXB 4XFJA 5CRVA 4GTQA 3PP5A 3ZHEB 2JWDA 1ZP0C 4KHXA 1NVOA 1N94A 4J8SA 5EYPF 1PGPA 5EX0A 1BSHA 5KJ7D 1ELRA 1L0LD 3EIJA 4BERA 2NZ2A 1Z6TA 2RH0A 3AE4C 1QL1A 2DIWA 4DX5D 4M7CA 2JDIH 1HGVA 2N9BA 1HZ4A 2E2EA 3MV3B 4AEZC 1EDJA 1O1RA 4OVUA 3M91A 1L0NE 2Q5UA 3TGUJ 3SI5A 2XZDG 4IYPA 4YNDA 4DX6D 1HTLC 4HS2A 4APFA 1PIXA 5KJ7A 4UWHA 4U7JA 2AXZA 4CCAA 4UUCA 1G3NB 3UT7A 3G9RA 5APTA 3WG7E 1OFCX 2WQYC 3FXDA 2R59A 4F1SA 1JY3N 2KB7P 1LD8A 3AE6C 2FBWC 1NTZG 4HORA 1RF1B 2WXPA 4GAAA 1S5LH 2KNCA 4ABNA 5APYA 3HUSB 3T9KA 2YHEA 1TYQG 2IFUA 1NTZD 4U0UA 1FS0E 2YO2A 3L74D 2C2LA 2FYUD 4Z68A 1A17A 5AW0B 4RJTA 2V4HC 3ONLA 2KBXA 1SQMA 2IO2C 4BX9A 3ENEA 2O1KA 1PPJG 2H6GA 2L0IA 2H88C 3TNUA 1V54E 2V5QC 1HVVA 2P58C 3AEFC 2XPYA 2QRXA 1VF5B 4KZCA 5CERB 1QVGO 5EIBE 4GA2A 3UINC 5T8IA 1K3ZD 4XX5A 3JYSA 1D8EA 1PP9J 1T3JA 2GRMA 2YIUC 3H1LE 1PPJE 2FI7A 1LTAC 5APWA 1N2DC 3Q5MA 1DEEG 2C9LY 2UWJG 3I4RB 1KORA 1H2TC 4PS3A 3TL5A 4EQFA 2YKPA 3C9IA 2JKVA 3DEPA 3L73E 2UY1B 3I5CA 3E30A 3IKOB 5KJKA 3Q15A 3L37A 3HD7B 3DPYA 3C3OA 3EHMA 1TU3F 5FQ6A 5BVZA 1SQQJ 1Q81Q 3BCCD 2IFNA 4UWKA 1JNMA 2R05A 3EQ2A 2WXLA 2E76D 1E90A 1AQTA 1URQA 4EZKA 4UQXA 3SGHA 3AE2C 2YHCA 1QLED 2AEMA 2LAIA 3FU6A 2W6AA 2KATA 3PE4A 3LIEA 1JY2O 1VF5C 1NA3A 2IBZD 2QYUA 1TR4A 2ZVNB 2L6BA 4MLPA 3MV2B 3CVWA 4EI2A 5AIJA 2ZU6B 4CGVA 2BCCE 3O4ZA 5FTPA 3P8CE 2FXPA 5E76A 4DOJA 1JEKA 5KLVD 2Y0CA 3FTXA 2XZTG 3RGUA 2PGDA 1ZR4A 1GDTA 3UT8A 4G8LA 3SQVA 4GMRA 3NB2A 3APFA 3F89A 3DSVA 3W9GA 1NKZB 3PS6A 3U66A 1NO4A 5KCMA 4JL0A 1SFCD 3FUKA 5ENRD 2KLUA 4HKZH 4J6IA 2E43A 4P29A 3T8KA 4PV1D 4Y6WA 1L4AB 1O5MA 1FZCC 2JP3A 4ATGA 5FZQA 1OX3A 1G1JA 4W9RA 2GUSA 2KCVA 3U1AA 3D9PA 2FF4A 1P5QA 3L74J 4UI9K 5CCHC 1HH0A 4YVQC 3FTUA 5C1DA 1EZVD 1L4AD 5G04J 2G8YA 2IFMA 3A7OA 1VQPP 2F0YA 3FWLA 4L73A 3DXMG 2P1JA 3RL0g 3APCA 4I6GA 2IPPA 1SFCA 3L72J 4BXLA 3GF7A 1RF0C 2WPVA 4IL6E 1GK4A 3L70G 3PLNA 1A5EA 1S5LX 3PH0A 1DH3A 2J59M 5JMND 3FXEA 2ZFCA 3NOGD 1LTXA 1NTMG 5FWQA 1URQC 2A45H 3PREA 2WXFA 4B8AA 2B9BA 1EZVG 3RO2A 3QARA 1ZRTD 4WY4C 3CCRP 5FQ7A 4BSZB 4ANXA 2LSUA 2XKMA 2ZXXA 4U3FG 3TGUG 1T6AA 3S2AA 3IR9A 2P58A 3C3QA 1KN7A 2HE0A 1TEZA 1L0LK 3KS2A 1N7SA 2OQQA 5EFWB 1S72P 1NH4A 1NTKJ 4WWOA 5H7PA 2P7JA 2K9JA 1RQUA 4U3FE 2OYOA 4NIKA 2GRLA 4GOFA 3MUDC 2WB2A 2QC9A 1W2BO 4MS6A 2XGMA 1DD4A 2XV5A 3P8MC 2QA4P 1H6PA 4IRUA 3SD5A 1SQPD 2YNQA 1NOHA 2IBZI 1Z3XA 5G2NA 1KPSB 4K35A 4AP2A 3HD7D 4FADA 3JSVC 1DEBA 3WMM0 3Q9UC 2ZT9C 2KSEA 4BT8A 3SWYA 2AXUA 4K5AB 3FUEA 4OVVA 1FVHA 3FTZA 5BXUA 2V7QH 2KP8A 1DNPA 3W9FA 1H6OA 1DIPA 3A5TA 3GLMA 4D6TD 1FT1A 5GTHH 3RAUA 4CYMD 1JO5A 1ZB1A 4WUYA 5G05J 2FEZA 3V2RA 2F8YA 1SQVG 1UIIA 3Q7AA 2LXCB 5M1BA 5E79H 3KZIE 1ZV8A 4B0ZA 4N5CA 3WUVA 1IK7A 1HUCA 3L82A 1JUNA 1S3JA 4RQIA 1FVFA 1K8KG 3VP8A 2LUHA 1QL2A 1EDLA 3D6YA 3ZN3A 3L73J 1LTJA 3O6QB 3P7KA 3VLDA 4B93B 2LXBA 2OV8A 4ATZD 1SFCB 4BSXA 3MP7B 3PZ2A 5EYLA 5ARGA 1M1KQ 2W8ZA 1RE4C 4L23A 1ZN5A 2A45G 5AVTB 3ZDMA 2HPCA 1VQNP 1LJ2A 3UPVA 4HH2A 3CC2P 2PM6A 5JHBA 5AVVB 5AW2B 2R44A 3NAWA 3U4TA 2D2CB 2AJAA 4UWLA 1RH5B 3B7TA 3VTPC 1ZXGA 4H7YA 1AVYA 2PAJA 4Y99C 1ZBPA 3EJNA 3FUIA 3MTUE 3GZ2A 4TRQA 2Z5IA 4J7WA 2BEDA 3HE5A 2D2CD 2IZ0A 4GA1A 2KXPC 1E7UA 4BRYB 3E33A 2WSFH 2KM4A 2XCCA 3EHQA 4UWGA 2FYNC 1D8DA 3V2XA 4ASVA 4K5CA 4JHJA 4DI3A 2M3BA 3FUHA 1TNUA 1FPPA 2BKGA 3L73G 2BTDA 4YPCA 4PJ0E 2N1TD 3D9OA 2PRRA 1FAVA 1YA0A 3HXDA 1PP9E 3ZGQA 3DSUA 1WAO1 3QAQA 3H1LJ 5ANLA 2P2UA 2WWWA 4AIFA 3D9NA 1PC2A 1SS1A 1SQXJ 5AW9B 2F37A 4KXKB 1NTME 5ARFA 4TXRA 3UM2A 3P8CD 3H1HG 1H0AA 4AXHA 1RY3A 2MYOA 5KLVK 1NFIE 3NBNB 5A6CA 2QSIA 4ZKPA 3GW4A 4GA0A 1OXJA 1VQ9P 3FWNA 4CZ2D 3BCCJ 3V5BA 3FTWA 3RRNB 4IL6X 4LC1A 2QZAA 2N1TA 3H1IG 1HJBA 1JOCA 2QIWA 1FZGA 1LF8A 5LFAA 5B1AE 5D0OD 1EPUA 2WVIA 2ZJSE 4G1TA 5B66E 2OEWA 5D0QD 4DPRA 2BEQD 3CVVA 1HGZA 1QNFA 2QJPB 2XEEA 1KILE 3SZ7A 3Q47B 4FHKA 2X3MA 2XGSA 4LG6A 1EDKA 2FFDB 2GROB 3EUVA 4KMOA 3AE5C 3CCSP 2J08A 1T2KC 1TN6A 2QJYB 3USSA 2X6JA 4I1OB 1O1SA 3L75E 3PEUB 3L73D 4HYTB 1AVOA 2EIJE 4I43A 4U0SA 3D9JA 2IY0C 4IFDK 1FDOA 4FJYA 2IJGX 3MUDA 4FA6A 2IQCA 3TG5A 2BUGA 5KLVE 2V5FA 2P9PG 4BY6A 3O8ZA 4L76A 1OVUA 1OY3D 3CX5E 1HF8A 1YTZT 2JLBA 5B5EE 2KC7A 2G3AA 3P1UA 1NTKD 2NPSB 1OZHA 3MKQA 3FTSA 5JJTA 3JCUE 3QC1A 1KYOE 2POHA 4JYBA 1VL2A 3C98A 5G05C 3HVEA 3JUEA 3L71E 3IHYA 5CHEE 1BGYD 3GHGA 2GGFA 3CSFA 3L35A 1EDUA 3F6QA 1PGOA 3BRTB 1SFCC 1JM0A 1JY2P 1U57A 1B89A 3AU5A 3L13A 3B4SA 2FKWB 2JABA 3ZFWA 5FZRA 2VGXA 3K9IA 2QVAA 3VMAA 5KAFH 1LTBC 3D9MA 2L6JA 2P2CP 4I9CA 3FEXA 3TG4A 1HF9A 3ZU7B 3HXBA 3PZDA 4C0EA 3HTKB 3G4SP 1M7LA 2DZOA 3X2QE 4YTPC 4A1GA 5LCWC 2YXQB 3H1LG 1NU1G 4GOEA 3ITKA 1HO8A 3CWBE 4MKTA 1S2EA 4WNDA 3ULEG 3WUUA 3TJPA 5KLIB 1PL5A 4F6RD 1K9MQ 1GW4A 3MZWB 3K5BA 3MHVA 3PZ3A 4OAVB 2XEVA 1LTJC 3CCUP 3PE3A 3ABLE 1N95A 3HXEA 4DLOA 3N4XA 1L4AA 3JQ0A 3CX5D 1R8EA 3L72D 1LT1A 3UMVA 3CI9A 4DJAA 1Y47A 1IFPA 3RRMB 1HG2A 1SQQK 5AARA 1VQ5P 4WNFA 5CEAA 4OH8B 1O1TA 3L4FA 3FUMA 1KZPA 3BRVB 3S7DA 2YNYA 2EINE 4EDFA 3ONKA 1U3DA 1NTZK 5G04C 1H2VC 5C2YA 3A0BH 2QJPC 1FOSF 2OOEA 4MBGA 5KBAA 5KKZC 3FTYA 2AEFA 3AE9C 2P67A 3AG2E 4KYOB 4MN4C 1N7SD 5AQBA 2FFDC 2A06G 2IONA 3L70J 5CMYA 3QK0A 3ML9A 3HG0D 3UIPC 1GL2D 3M0AA 3KQGA 2M0BA 2YO3A 3HD7C 4PV1C 1FZFA 4H0LC 4DLQA 1L0ND 1JUQA 1KILB 1SW6A 1M56D 1YBKA 5AJLA 1NTMD 2H43A 3LW5H 3LEWA 2WSEJ 3FDHA 3KDPB 2R02A 3SHFA 3G2WA 3TWXA 1L0NK 4K03A 2H6HA 4RLYA 1EQ7A 4TLFA 2EILE 4FHJA 1NI1A 2I1KA 3DSTA 1NYHA 3HD7A 2CG2A 2VGXB 1KILC 3PUJA 3S1KA 2N1TB 2J07A 5JHAA 2HYNA 3R2PA 1NA0A 1N54A 3LJNA 1TNBA 1AA0A 1N86A 1N4QA 1SZAA 4G2VA 2WM9A 3S7FA 3QJZA 4LEUA 4GZ3A 3Q49B 3UIAA 4J8YA 3MCXA 4KVOA 1GL2A 1SQVE 3DEOA 1UG3A 3WXXA 4KZ0A 4MRUA 1LT9A 2W83C 4IFFA 2IU1A 3NQPA 2WZ7A 1SVFA 2W6BA 3HYMB 3KEZA 3PHLA 3H1HE 5BXOA 3G2VA 3PZ4A 5J08A 1SQXD 4EPZA 1FJPA 2WSEH 3TNUB 2VTBB 3M9QA
chains in the Genus database with same CATH topology
1BDCA 1EDJA 3Q9UC 5ENSD 1IHBA 3TWVA 4N5QA 1TR4A 2DZNA 2L6BA 4JB8P 4K5AB 4GOEA 2B87A 2RKLA 1OT8A 1BD8A 2MYOA 2XZDG 1WG0A 2RFAA 2Y0BG 4YDWA 3V2OA 3JXIA 4WWIA 1IKND 4K5BA 1NFIE 4DX6D 5BXUA 4ZHBA 3NBNB 1QYMA 1AP7A 5FINA 1IXVA 4F6RD 4ZFHA 3W9FA 4F1PA 3MZWB 4CZ2D 3MHVA 3UXGA 2HR3A 2WMMA 4U96D 2XZTG 3RGUA 5DJUB 4OAVB 1MX2A 3IXEA 5AQAA 1WDYA 4UUCA 4GPMA 4G8LA 1G3NB 2B87B 1K1AA 4CYMD 3HRAA 4GMRA 4HRLA 1DCQA 3EU9A 5KNGA 1ZW0A 1EC5A 1Q2NA 4HB1A 1X0TA 1LT1A 3TWQA 3NOCD 3W9GA 4C48B 4U95D 2RFMA 1Y47A 2F8YA 3FXDA 1N0RA 2KIKA 2F8XK 2LXCB 5D66A 4HRMB 2ETCA 1U7MA 5FIOA 1N0QA 2ETBA 4IOIH 2XEEA 4O1PA 5ENRD 3V30A 4DX1A 4HKZH 3T8KA 5AARA 5ENQD 5CEDB 2I8DA 2A5EA 4LG6A 3V79K 1EDKA 2NYJA 2J8SD 1S3JA 5CBNA 2QYJA 5ENPD 2XENA 1N11A 1S70B 3TWRA 3TWWA 2KUBA 1FC2C 4ZNCA 1YCSB 4U8VD 5KNHD 3B7BA 3T9KA 1EDLA 1BI7B 1UOHA 3ZUVB 1H0TB 4QQIA 4HJGH 4BETA 2LR2A 4Z68A 4B93B 2LXBA 5ITZF 4ATZD 2KZJA 4KJMA 2V4HC 5EYLA 5JMND 2KBXA 3Q9NC 3ZNGA 1JMBA 1BDDA 5HS0A 4K3AA 4NPFX 3EHRA 3QWOC 3ZDMA 4HQDA 5KBAA 1MYOA 1YMPA 5KWDA 2Y1LE 2V5QC 3C5RA 4MN4C 5AQBA 3SO8A 2QRXA 5CERB 4OAUC 2B0OE 4HRNA 4BESA 5EIBE 3TWSA 2KI7B 2R44A 1BI8B 2DVWA 1OVUA 1OY3D 2AJAA 3HG0D 4HI9A 2PNNA 4O60A 1OVRA 4TUMA 1K3ZD 2M0BA 4EYYQ 4BXLA 3UI2A 2Q1KA 2FO1E 5K5GB 2SPZA 1ZXGA 1A5EA 1SW6A 3PH0A 5CEAA 5EIDA 5HRYA 3JXJA 4YDYA 3FXEA 1EDIA 2VGEA 3NOGD 5AN8A 2BKKB 3TWUA 4QFVA 4NPDA 1DEEG 2ZAEB 1BLXB 4J7WA 3TWXA 2OTKE 4HBDA 1BU9A 4BSZB 4HNAD 4RLYA 4A63B 1MX4A 1MX6A 3J5QB 3B95A 2XEHA 2ZGDA 3JUEA 1DC2A 4DRXE 3D9HA 3DEPA 4ASWA 2DWZA 4U8YD 2KXPC 2JWDA 2UWJE 3S1KA 2P58A 1LP1A 1NVOA 2KZIA 3F6QA 3LJNA 2HE0A 3ZKJA 4BEPA 5EYPF 5DJTB 4CPGA 5AQ7A 2B89A 1MFTA 5ENOD 1LP1B 5EFWB 1JM0A 3EHQA 1AWCB 4LSZE 4J8YA 5C39A 5CECB 3V31A 3V2XA 4ASVA 4K5CA 2K3RA 3DEOA 5ENTD 2JABA 2B88A 1U7JA 2M5AB 4HI8A 4DUIA 1YYHA 2BKGA 4BERA 4JBZA 4HLLA 4ZMDA 4NIKA 4GOFA 2QVAA 2KS1B 4DX7D 4NPEA 4G8KA 2QC9A 4GODA 1MJ0A 5AQ9A 5CBOA 2ETAA 5HKPA 2P2CP 2ZGGA 3UTMA 3AAAC 4LNUD 5EN5D 4DX2A 4DX5D 5AAOA 5BXOA 5EILA 4HB5A 3ZU7B 5JA4D 1H0TA 4O1OA 3J5PA 4K35A 1SVXA 2M5AA 1K1BA 3AJIA 2DZOA 3KEAA 3TWTA 1SS1A 2F37A 1OVVA 1D9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDC A;  1EDJ A;  3Q9U C;  5ENS D;  1IHB A;  3TWV A;  4N5Q A;  1TR4 A;  2DZN A;  2L6B A;  4JB8 P;  4K5A B;  4GOE A;  2B87 A;  2RKL A;  1OT8 A;  1BD8 A;  2MYO A;  2XZD G;  1WG0 A;  2RFA A;  2Y0B G;  4YDW A;  3V2O A;  3JXI A;  4WWI A;  1IKN D;  4K5B A;  1NFI E;  4DX6 D;  5BXU A;  4ZHB A;  3NBN B;  1QYM A;  1AP7 A;  5FIN A;  1IXV A;  4F6R D;  4ZFH A;  3W9F A;  4F1P A;  3MZW B;  4CZ2 D;  3MHV A;  3UXG A;  2HR3 A;  2WMM A;  4U96 D;  2XZT G;  3RGU A;  5DJU B;  4OAV B;  1MX2 A;  3IXE A;  5AQA A;  1WDY A;  4UUC A;  4GPM A;  4G8L A;  1G3N B;  2B87 B;  1K1A A;  4CYM D;  3HRA A;  4GMR A;  4HRL A;  1DCQ A;  3EU9 A;  5KNG A;  1ZW0 A;  1EC5 A;  1Q2N A;  4HB1 A;  1X0T A;  1LT1 A;  3TWQ A;  3NOC D;  3W9G A;  4C48 B;  4U95 D;  2RFM A;  1Y47 A;  2F8Y A;  3FXD A;  1N0R A;  2KIK A;  2F8X K;  2LXC B;  5D66 A;  4HRM B;  2ETC A;  1U7M A;  5FIO A;  1N0Q A;  2ETB A;  4IOI H;  2XEE A;  4O1P A;  5ENR D;  3V30 A;  4DX1 A;  4HKZ H;  3T8K A;  5AAR A;  5ENQ D;  5CED B;  2I8D A;  2A5E A;  4LG6 A;  3V79 K;  1EDK A;  2NYJ A;  2J8S D;  1S3J A;  5CBN A;  2QYJ A;  5ENP D;  2XEN A;  1N11 A;  1S70 B;  3TWR A;  3TWW A;  2KUB A;  1FC2 C;  4ZNC A;  1YCS B;  4U8V D;  5KNH D;  3B7B A;  3T9K A;  1EDL A;  1BI7 B;  1UOH A;  3ZUV B;  1H0T B;  4QQI A;  4HJG H;  4BET A;  2LR2 A;  4Z68 A;  4B93 B;  2LXB A;  5ITZ F;  4ATZ D;  2KZJ A;  4KJM A;  2V4H C;  5EYL A;  5JMN D;  2KBX A;  3Q9N C;  3ZNG A;  1JMB A;  1BDD A;  5HS0 A;  4K3A A;  4NPF X;  3EHR A;  3QWO C;  3ZDM A;  4HQD A;  5KBA A;  1MYO A;  1YMP A;  5KWD A;  2Y1L E;  2V5Q C;  3C5R A;  4MN4 C;  5AQB A;  3SO8 A;  2QRX A;  5CER B;  4OAU C;  2B0O E;  4HRN A;  4BES A;  5EIB E;  3TWS A;  2KI7 B;  2R44 A;  1BI8 B;  2DVW A;  1OVU A;  1OY3 D;  2AJA A;  3HG0 D;  4HI9 A;  2PNN A;  4O60 A;  1OVR A;  4TUM A;  1K3Z D;  2M0B A;  4EYY Q;  4BXL A;  3UI2 A;  2Q1K A;  2FO1 E;  5K5G B;  2SPZ A;  1ZXG A;  1A5E A;  1SW6 A;  3PH0 A;  5CEA A;  5EID A;  5HRY A;  3JXJ A;  4YDY A;  3FXE A;  1EDI A;  2VGE A;  3NOG D;  5AN8 A;  2BKK B;  3TWU A;  4QFV A;  4NPD A;  1DEE G;  2ZAE B;  1BLX B;  4J7W A;  3TWX A;  2OTK E;  4HBD A;  1BU9 A;  4BSZ B;  4HNA D;  4RLY A;  4A63 B;  1MX4 A;  1MX6 A;  3J5Q B;  3B95 A;  2XEH A;  2ZGD A;  3JUE A;  1DC2 A;  4DRX E;  3D9H A;  3DEP A;  4ASW A;  2DWZ A;  4U8Y D;  2KXP C;  2JWD A;  2UWJ E;  3S1K A;  2P58 A;  1LP1 A;  1NVO A;  2KZI A;  3F6Q A;  3LJN A;  2HE0 A;  3ZKJ A;  4BEP A;  5EYP F;  5DJT B;  4CPG A;  5AQ7 A;  2B89 A;  1MFT A;  5ENO D;  1LP1 B;  5EFW B;  1JM0 A;  3EHQ A;  1AWC B;  4LSZ E;  4J8Y A;  5C39 A;  5CEC B;  3V31 A;  3V2X A;  4ASV A;  4K5C A;  2K3R A;  3DEO A;  5ENT D;  2JAB A;  2B88 A;  1U7J A;  2M5A B;  4HI8 A;  4DUI A;  1YYH A;  2BKG A;  4BER A;  4JBZ A;  4HLL A;  4ZMD A;  4NIK A;  4GOF A;  2QVA A;  2KS1 B;  4DX7 D;  4NPE A;  4G8K A;  2QC9 A;  4GOD A;  1MJ0 A;  5AQ9 A;  5CBO A;  2ETA A;  5HKP A;  2P2C P;  2ZGG A;  3UTM A;  3AAA C;  4LNU D;  5EN5 D;  4DX2 A;  4DX5 D;  5AAO A;  5BXO A;  5EIL A;  4HB5 A;  3ZU7 B;  5JA4 D;  1H0T A;  4O1O A;  3J5P A;  4K35 A;  1SVX A;  2M5A A;  1K1B A;  3AJI A;  2DZO A;  3KEA A;  3TWT A;  1SS1 A;  2F37 A;  1OVV A;  1D9S A; 
#chains in the Genus database with same CATH topology
 4H7X A;  4JB8 P;  4YDW A;  2RKL A;  1IFJ A;  2WXO A;  4K5B A;  3BQO A;  1WT6 A;  3EIQ C;  1QQE A;  2Y9Z A;  3G2U A;  2I6H A;  3CK9 A;  4I1M A;  5KLV G;  1BE3 D;  3CXH E;  3EU5 A;  1P84 I;  3UM3 A;  2X6F A;  2QJK B;  1VQM P;  1UJJ A;  3RK3 B;  4B86 A;  3EU9 A;  1KFM A;  3ASO E;  2H8P D;  3E1R A;  5FJY A;  4C48 B;  3EHN A;  4HOU A;  3SFE C;  2IF4 A;  2X38 A;  3HHM A;  1LTI C;  4F7A A;  1UW4 B;  1SLQ A;  2I8D A;  5BNW A;  2C0M A;  2QYJ A;  3PVL A;  2HLO A;  1YCS B;  4ME2 A;  5KNH D;  3ZUV B;  3HRN A;  1BI7 B;  1X79 B;  1WY6 A;  1H8A A;  2Q7F A;  2PQR A;  1MUU A;  3MKR A;  3L9T A;  3Q73 A;  1IK9 A;  4GTM A;  2QE7 H;  3B7U X;  4I7Z B;  3LKU A;  2JO1 A;  2OYI A;  3DSX A;  1VQO P;  4TT3 H;  3E37 A;  1MYO A;  4WBA A;  3HE4 A;  1KB9 I;  3GZ1 A;  3G3Z A;  3RO3 A;  4OGQ D;  1N9A A;  1SQB K;  4RKU J;  1YJN P;  3FWV A;  1AQ5 A;  3IN6 A;  3P32 A;  2ILR A;  1MQS A;  2OCC E;  2Q1K A;  1RF0 A;  4N2S A;  2XHE A;  3KD7 A;  1SA4 A;  2VYI A;  2WXR A;  1KQL A;  2JR8 A;  1YTZ I;  4I6M C;  3VLE A;  4A63 B;  2P9L G;  3J5Q B;  3CKB A;  3L22 A;  2NXP A;  2X6I A;  4B94 A;  2OYH C;  3Q1M A;  4L74 A;  1N52 A;  1S63 A;  1LT9 B;  2YQ8 A;  5DJT B;  4IL6 H;  5AJD A;  1NZN A;  2NC9 A;  5C39 A;  1QX8 A;  3LDZ A;  1Z56 A;  2J09 A;  1E7V A;  3CVN A;  4YDO A;  2FYU G;  4I1A A;  1YJW P;  3WUT A;  2XGO A;  3BAS A;  1SQQ G;  2H89 C;  1Y6I A;  2FXM A;  3AAA C;  5CJ4 A;  1XTC C;  3AE1 C;  5AW1 B;  3RBZ A;  2HPC B;  1Y9B A;  4DI4 A;  2M8R A;  2R2L A;  3Q2Y A;  1D9S A;  1URQ B;  1H89 A;  1OWO A;  4WNG A;  2Q3I A;  2ZXW E;  2FYZ A;  3FFL A;  2BEZ F;  3RBX A;  3AEC C;  4WWI A;  1ZRT E;  3TSI A;  3AEE C;  4WY4 A;  2LXL A;  5AVU B;  5KAI H;  3H1I J;  4F1P A;  3UT4 A;  1ZME C;  1A02 F;  3M9B A;  1S64 A;  1GU5 A;  1TNY A;  1ZLL A;  3JUI A;  4EBA A;  1MX2 A;  1WDY A;  4ZKU A;  3QOU A;  4HRL A;  4JEU A;  1VQL P;  3CCL P;  2VSX E;  1X0T A;  2W90 A;  4XEI G;  3NZU A;  3H1K D;  1KB9 H;  3L75 G;  2LO6 A;  4Q69 A;  5D66 A;  3PEV B;  3TXM A;  2FXO A;  4UB8 H;  2ZT9 D;  2WPR A;  2O3J A;  4EIJ A;  4EZL A;  3CPW O;  1EZV E;  4KT0 J;  3B13 A;  1ELK A;  2FYN B;  3HIZ A;  2MKV A;  3RK3 C;  1H0T B;  2J58 A;  5CCH D;  4N2Q A;  1FZC B;  2KCK A;  3AE3 C;  2YKQ A;  4RVB A;  1GK6 A;  1H19 A;  1XNF A;  1M57 D;  3CXH I;  3RSE G;  3RK2 B;  1IJD B;  4GTT A;  3R7Q A;  1RW2 A;  3CHQ A;  1TJF A;  1OXZ A;  3TWS A;  3V6I A;  3VMY A;  3V4W A;  2R03 A;  1IFN A;  3CGH A;  5K5G B;  3DRA A;  2VTB A;  1K8A Q;  4C7N B;  3ULQ A;  3ASD A;  1ZOY C;  2OTL P;  3QWW A;  1EDI A;  3CHM A;  3EWK A;  5EKQ D;  4A3T A;  5CCH A;  3SFD C;  2XS8 A;  3D9L A;  4W80 A;  2J4B A;  4HNA D;  3TDK A;  4JPS A;  2L9B A;  3DXK G;  3B7S A;  1RF1 A;  2DWZ A;  4Y99 B;  2K37 A;  2HG5 D;  1QZ2 A;  1AV1 A;  1NTK K;  3ZKJ A;  3ZVV A;  5AQ7 A;  1JTH A;  5ENO D;  2VSN A;  5BV1 A;  3WU2 E;  2Q6Q A;  5L8R J;  5AW5 B;  3E7K A;  2WIT A;  1RE4 A;  4U7E B;  2J9Q A;  1KD1 Q;  4TXP A;  5BU5 A;  4NAC A;  3JCU H;  4GOD A;  2E5T A;  5APQ A;  3V2N A;  2DBA A;  5CBO A;  4H13 D;  2AXC A;  5FT9 A;  4LNU D;  3H1J D;  5CMW A;  2Y69 E;  4JYC A;  1KTM A;  1V55 E;  3SBS A;  3ZXP A;  2M5A A;  1SQV J;  2MOW A;  5BT1 A;  3VMX A;  1SA5 A;  1JWF A;  3FP3 A;  1IHB A;  4V3I A;  2IX7 C;  1FZE A;  4OYS A;  2R32 A;  1IZN B;  1AP7 A;  3SFY A;  3GG2 A;  1UJK A;  4JW1 A;  4HLE A;  1M1J A;  2LXM A;  1VQK P;  5TIS H;  1SQQ D;  1W2E A;  1NU1 K;  4GPM A;  2V7Q J;  3HRA A;  3H1J E;  4I2W A;  3PNL B;  1ZW0 A;  1FT2 A;  3Q79 A;  1BPO A;  5CRU A;  2FYU E;  2RFM A;  3ABV C;  4NQ0 A;  3MZL B;  1VQ8 P;  5JJ7 A;  2QEX P;  2QM7 A;  2CHX A;  2ETB A;  1PGJ A;  3B5N C;  3MIW A;  4UB6 E;  1KLX A;  5BPP A;  4GDO A;  3TWW A;  1BCC J;  2OTJ P;  1P84 H;  2XQ0 A;  2CFU A;  3U3W A;  2WMN A;  4OGQ B;  2EIK E;  1OCO E;  3URZ A;  3I5P A;  3RIB A;  4GKG A;  2C0X A;  4F3V A;  2KZJ A;  2Y4U A;  4XI0 A;  4Y28 J;  4DCK A;  2HM8 A;  4WWN A;  3OTN A;  4NPF X;  4R4L A;  4BTA A;  2KXP B;  3ZW3 A;  4NRH B;  3TXN A;  4JHK A;  1BI8 B;  3SWF A;  4APO A;  3DPD A;  1MKM A;  1OVR A;  3HE4 B;  4BWN A;  4LER A;  4LUN U;  1EXJ A;  2WMO A;  5APS A;  3OW2 O;  2VGE A;  4QFV A;  2V4L A;  1SQX E;  4GTR A;  1LWU A;  2WVR A;  4WY4 B;  3T5X A;  1G2C B;  2QG4 A;  1GL2 B;  3H32 B;  4DRX E;  1FDI A;  4U8Y D;  1N7S B;  4UQY A;  3ASF A;  3H1I E;  2R5D A;  4J8E A;  1VPC A;  3Q4A B;  3ZXS A;  4XKB A;  2WXQ A;  1N7S C;  3CVY A;  3NZS A;  1NL4 A;  3ULY A;  3ASN E;  4Y6C A;  5ENT D;  1GL2 C;  1X81 A;  4HI8 A;  2M5A B;  3OA7 A;  2LAH A;  1YYH A;  2PFX A;  1IYG A;  4GB9 A;  4G26 A;  5B5E H;  1MJ0 A;  5AQ9 A;  4BRY A;  3SNX A;  3E1I A;  5HKP A;  1S0P A;  2ZGG A;  3APD A;  4DJG A;  1NU1 E;  4PD4 H;  5E79 E;  1FZC A;  2AVP A;  4I2L C;  3KYQ A;  2P9U G;  3AJI A;  3SF4 A;  1Q90 D;  3T97 A;  1W3B A;  3SFX A;  4DZO A;  4U3F J;  1LTT C;  1NJI Q;  3NTN A;  1S5L E;  2XPZ A;  2IYP A;  4D10 C;  2WPV B;  1QYM A;  3Q5S A;  1W5C E;  3H1H J;  1KYO H;  3L6A A;  3Q78 A;  4GIF A;  1N4R A;  2LKM A;  2BAS A;  1KQS O;  1RE3 C;  2O01 N;  1KB9 E;  2IO3 C;  5CCG D;  2WXM A;  2K9J B;  1N0R A;  3P2B A;  2H6F A;  1NHL A;  1BE3 J;  4EZJ A;  4GTP A;  3LW5 J;  3BCC E;  5ENN A;  5FIO A;  4IOI H;  4O9B A;  4FC8 A;  2I1J A;  3G2T A;  1NU1 D;  4BFR A;  3MJW A;  3S9O A;  2R3S A;  4YVO A;  4N3Y B;  3O48 A;  2CG3 A;  3CXH H;  4CDN A;  1SP4 A;  1L0L E;  1YI2 P;  1DX7 A;  4U0Z A;  1JMB A;  4FUL A;  4HQD A;  4ILG A;  4W7Z A;  3KXD A;  1YMP A;  2MJZ A;  2KCL A;  2PQN A;  1J2J B;  5AVQ B;  3SO8 A;  3ESK A;  2XZR A;  4PUC A;  1JY3 O;  3H1J G;  3BG1 B;  3RKV A;  3L71 G;  4PJ0 H;  1KV4 A;  3GMA A;  4URK A;  5HRY A;  4YDY A;  2KYV A;  3ASG A;  3AEG C;  5T4Y A;  2E5Y A;  1YJ9 P;  2JEE A;  2WXN A;  4A55 A;  1S4X A;  3RK2 C;  3H25 A;  3CCJ P;  1QEX A;  3PDN A;  5TJH A;  1VDF A;  4WB4 A;  3IV0 A;  2DW3 A;  3HUS A;  4ANW A;  1CW5 A;  2ZIR A;  4OVN F;  1LP1 B;  4U04 A;  4WY4 D;  5T3R A;  2D2C C;  4LSZ E;  5CEC B;  3I4G A;  4JF7 A;  4LGD E;  3FX0 A;  2WSS H;  2Z4E A;  2B88 A;  1U3C A;  4GPK A;  4CDR A;  4DX7 D;  4NPE A;  3O6Q A;  4ANU A;  3UM0 A;  4HOS A;  5B66 H;  1A02 J;  4XE0 A;  2H7H A;  3L16 A;  5D2M C;  4CT4 A;  4DX2 A;  3DSW A;  1X5B A;  1K1B A;  1JCD A;  3TWT A;  4WNE A;  1OVV A;  2M3E A;  3H1L D;  1PAQ A;  2DZN A;  3DWL G;  3TK1 A;  3L71 J;  1LWU C;  1WG0 A;  3V2O A;  2KZT B;  1IXV A;  2E75 B;  4EEC A;  1BE3 E;  3CXH D;  4CRW A;  1LD7 A;  4AYC A;  1HXI A;  2HYZ A;  4PH4 B;  4FLB A;  4AQR D;  3AG1 E;  1J1D C;  3RK6 A;  1Q2N A;  3H32 A;  1JCQ A;  3NOC D;  2WT7 A;  1M8O B;  1N73 C;  5A7D B;  3L74 E;  3H1K G;  3ML8 A;  3M0D A;  1U7M A;  5AW3 B;  5GTI E;  2A4Z A;  4DK5 A;  1JY2 N;  1KFN A;  3H1H D;  5ENQ D;  3ZHE A;  1BGY G;  3HXC A;  3UX4 A;  4GCN A;  4L7T A;  3CC4 P;  3FTV A;  3ABK E;  4RG6 A;  3ZEF A;  2NSZ A;  1INZ A;  3SFZ A;  4GT1 A;  5BUZ A;  3IAO A;  3N71 A;  3A3Y B;  3LPZ A;  4PV1 B;  3QDN A;  1EF1 C;  3QKY A;  4FJZ A;  1FZA A;  2VSY A;  3C5R A;  3PRJ A;  1LGH B;  3HUS C;  4XZ4 A;  4OAU C;  1S1C X;  4AUW A;  1DVP A;  1SQB E;  1KMI Z;  2BF0 X;  2PNN A;  2VJ8 A;  4EYY Q;  2ZXE B;  4GML A;  1KYO D;  3C8V A;  4XI9 A;  1BCC G;  2CK3 H;  2A06 E;  2ZAE B;  1BLX B;  3AEA C;  5IY5 E;  3VP9 A;  4BWR A;  1MX6 A;  3B7R L;  2OYI C;  3RU0 A;  3RRU A;  3IF4 A;  2E74 B;  2VGY A;  1JWG A;  2EIM E;  3B71 A;  2FFD A;  5G55 A;  1CI6 B;  1QGK B;  5AVZ B;  3UIO C;  4RSY A;  4AVX A;  2YMK A;  4GZ5 A;  2XU6 A;  4UQZ A;  1R5L A;  3CVP A;  3PZ1 A;  1TNZ A;  4IUL A;  3H1I D;  4GTO A;  1E8Z A;  2KSJ A;  3VTY A;  1GD2 E;  1X8Y A;  3M0D C;  4QMA A;  3G71 P;  4I7Z C;  1KQG B;  1VQ6 P;  1OWP A;  3Q5P A;  2Q7C A;  2GM4 A;  2OYI B;  3J5P A;  2XND H;  2OEV A;  3E34 A;  1IC2 A;  3TWV A;  1L4A C;  1OT8 A;  1L0L G;  2BCC D;  3S7J A;  1CSB A;  1Y8A A;  3CQG B;  5FIN A;  2E76 B;  3JCK C;  3MKQ B;  3S4R A;  1Q7Y Q;  3UXG A;  2ZIS A;  5CHX A;  3IXE A;  3Q5R A;  4N3B A;  4D6T G;  4JD2 G;  1X9V A;  1HFA A;  2RMZ A;  3CX5 I;  3VOP A;  4Z1M H;  1PGQ A;  2W27 A;  1H88 A;  4L9P A;  4CGW A;  2WXI A;  4HRM B;  3OAK A;  1OCR E;  2EQX A;  2XS1 A;  2OYH B;  1OWA A;  3CX5 H;  2NYJ A;  1EYH A;  3TWR A;  2WQ6 A;  5AW4 B;  5ENP D;  1OWM A;  5CCG C;  3C72 A;  4U8V D;  2WXG A;  1WM5 A;  3KHU A;  1VF5 D;  1E8Y A;  3HTK A;  1N4P A;  3FGA D;  3EFF K;  1BGY E;  1J1E C;  1WRG A;  2WPS A;  5KJN A;  3MGB A;  3ZNG A;  3PH0 C;  2I9C A;  1YIJ P;  2IEJ A;  3T5V A;  1M1J C;  1Z5S C;  1L5J A;  2Y1L E;  4FU3 A;  4N3C A;  1SQX G;  4BES A;  4PS8 A;  5LX8 A;  5M72 A;  1Q86 Q;  5KAI E;  1S9K D;  2DVW A;  3L71 D;  1RHZ B;  4JQ0 D;  3RL0 C;  4C7N A;  4H0L B;  4RG9 A;  3BVH A;  2GRQ B;  1T3U A;  2J49 A;  1N73 B;  3UUX A;  3AE7 C;  5AN8 A;  3I56 P;  2FUL A;  5B3S E;  1J1D B;  2OTK E;  3L70 E;  2KK7 A;  2XEH A;  3CME P;  4X8Q A;  5H2F E;  3RK2 D;  2PP6 A;  1DC2 A;  4C7R A;  4UB8 E;  2YIU B;  3MX3 A;  3CLQ A;  4LNB A;  1JY3 P;  1QVF O;  4BEP A;  1IFM A;  1MFT A;  1VDY A;  3FUJ A;  3MA5 A;  2OVF A;  1XGW A;  3JQ1 A;  1U7J A;  5AW8 B;  1Q2Z A;  2E74 D;  4G8K A;  1L0N G;  3L08 A;  3VN0 A;  1PV3 A;  3ESL A;  4FLH A;  4PD4 D;  2L91 A;  1X22 A;  3CR3 A;  4G24 A;  3CVQ A;  4LLH A;  5CCG A;  4HOT A;  1IFD A;  2A06 D;  4YXD C;  3UM1 A;  3RL0 B;  4CDM A;  1BCC E;  2Y9Y A;  4L75 A;  5AEN A;  1NWQ A;  3V2P A;  2HFE D;  1BD8 A;  2QJK C;  2HOD B;  4J8F A;  5KJ7 C;  3PNT B;  5APV A;  2YXR B;  3CQC B;  4ZFH A;  2WQH A;  4JA7 A;  3PJS K;  4DT0 A;  1HS6 A;  1NP7 A;  4LCT A;  4U96 D;  4G11 A;  5DJU B;  5AVS B;  1OCZ E;  5AQA A;  2OGU A;  1LWU B;  1SQB G;  2KOG A;  4PD4 E;  5H2F H;  1EC5 A;  1NGM B;  4TUU A;  4G25 A;  4U95 D;  3CV0 A;  4GYY A;  2PM7 A;  2R3C A;  2N9Y B;  3FUF A;  2P9K G;  3KSL A;  2R5S A;  3LXU X;  3B5N D;  2WXJ A;  3L72 G;  1U2V G;  1LTG C;  4O1P A;  3CVU A;  1J1E B;  2IBZ G;  2WPQ A;  1M90 Q;  1AWC B;  3D3M A;  2E42 A;  3AS8 A;  3IBE A;  1IO4 A;  1L0N J;  3TGU E;  3H1K E;  3UKU G;  1FJK A;  3B8E B;  3H6P A;  3U64 A;  3S7B A;  3L36 A;  2PL2 A;  2O1J A;  2YKO A;  1N73 A;  4I9E A;  1GW6 A;  3QWO C;  2YMY A;  1SQQ E;  1YYC A;  1JCS A;  3CIA A;  2KI7 B;  2Q3E A;  3B5N A;  2X6H A;  3UI2 A;  1SQV K;  3JC2 2;  3Q3D A;  3SSU A;  1FE6 A;  2AXT H;  3TWU A;  5CJ0 A;  5E75 A;  5KAF E;  3II6 A;  1TNO A;  1MFZ A;  2BKK B;  2L5G B;  4NPD A;  3IEG A;  3CMA P;  1HX8 A;  2Y4T A;  4H13 C;  3ZYK A;  5AW6 B;  3OAW A;  1Q82 Q;  1BU9 A;  1ELW A;  3CHP A;  1FOS E;  1HU3 A;  4KVM A;  4IN3 B;  4H0L D;  3BAT A;  1USD A;  4ASW A;  3FU3 A;  4GZ6 A;  5HQ8 A;  2BCC J;  3AG3 E;  3FU5 A;  2NPS C;  3FY4 A;  2V8S E;  3NFQ A;  3VTX A;  3TGO A;  2FBN A;  4G23 A;  2XRY A;  1IQU A;  4BTB A;  4GZC A;  3KPE A;  1R5S A;  5AVY B;  4L1B A;  2XDJ A;  4YDE A;  2IYO A;  3SWK A;  2J4D A;  3ZIM A;  5EX3 A;  1KZO A;  4ZMD A;  2WXH A;  4TV3 A;  2J5U A;  3MEK A;  1LTJ B;  2WSF J;  5FQ4 A;  3CLJ A;  4GTV A;  4JEH A;  3MD0 A;  3QB2 A;  5DIZ A;  5KLI C;  3N7N A;  3M06 A;  2GRP B;  2KZT A;  3CCV P;  1JCC A;  1IFI A;  2Z5H A;  3CST A;  5APU A;  2IZ1 A;  1OIP A;  2CPS A;  5ENS D;  3T97 B;  4H44 C;  2HR2 A;  2E75 C;  1IKN D;  4UI9 J;  2A5U A;  3LY7 A;  5CCM A;  4RES B;  3GHG C;  1SZ9 A;  2WTY A;  4ACK A;  4L2Y A;  2E76 C;  2ZYG A;  2KLV A;  3IFM A;  1YQ4 C;  1BSN A;  1E96 B;  2CHW A;  2CPB A;  3R9M A;  1D7M A;  1K04 A;  2QJY C;  3V4Q A;  3FUD A;  4A1S A;  3A0B E;  1DCQ A;  5KNG A;  4J0U A;  3CD6 P;  3TWQ A;  3PUK A;  2AXV A;  4E85 A;  2R17 C;  2F8X K;  1H6K A;  3E32 A;  2C0L A;  2KNC B;  1N0Q A;  1GTW A;  4DX1 A;  2QY7 A;  1KZU B;  1Y8M A;  2A5E A;  4AJW A;  3V79 K;  3WU2 H;  5CBN A;  5GTI H;  5JA4 D;  3ZYL A;  1EZV I;  2OAR A;  5GTH E;  1UOH A;  4N78 D;  3QNK A;  3CHO A;  3CWB J;  4HJG H;  1FDM A;  3EDT B;  1JMM A;  4KJM A;  3GZS A;  4OGQ C;  4JA9 A;  1RE3 A;  1DD3 A;  3AS4 A;  1YQ3 C;  2XCB A;  5HS0 A;  1HBW A;  1PZQ A;  2Y0E A;  4BX8 A;  2B0O E;  1OUV A;  4HI9 A;  2FY8 A;  1NTM K;  4YXW H;  2RG8 A;  3TAX A;  2FO1 E;  1JB0 J;  1NAF A;  5EID A;  1BCC D;  2DYR E;  3PRZ A;  2V0P A;  1NAY A;  1MX4 A;  2MRI A;  3LY8 A;  2XNX A;  2FO7 A;  3LS8 A;  1PY1 A;  3NMD A;  2UWJ E;  3LCA A;  4WAF A;  2YIN A;  2B6C A;  4R4M A;  1PP9 D;  4UB6 H;  3CVL A;  3FHE A;  3RL0 D;  1ZU2 A;  3UQ3 A;  4A3V A;  4BT9 A;  3L75 D;  4EHM A;  2OND A;  1NTZ E;  1E5W A;  4Q94 A;  3NXS A;  4JC8 A;  2O01 J;  3L72 E;  4LNG A;  2W6J H;  3U1C A;  2M63 A;  5CCL A;  4ACL A;  4HB5 A;  4O1O A;  3ABM E;  5HI7 A;  4I17 A;  4U8H A;  3ZRH A;  3NF1 A;  4LRZ A;  1BDC A;  1SQX K;  1HWT C;  4GMJ A;  3LYA A;  4UWF A;  1NTK G;  3JXI A;  4ZHB A;  1SQP K;  2GUV A;  4GZD A;  4U63 A;  1NU1 J;  3AE8 C;  4FP7 A;  3AED C;  4HVB A;  1HJ0 A;  2HR3 A;  1K05 A;  3CWB G;  2P9N G;  3ASH A;  5FQ8 A;  3R9A B;  4AY6 A;  5JJ6 A;  1K1A A;  3HXF A;  1OW8 A;  3A0H E;  1Z3Y A;  4RO0 A;  1JTH B;  4HB1 A;  4NUR A;  3FH8 A;  1S9K E;  5AYW D;  2FYU K;  4J8D A;  4EBA G;  2C9N Y;  4PDX A;  4GYO A;  2WT7 B;  1CI6 A;  2O01 H;  4I6J A;  5BU8 B;  2PZI A;  2E0I A;  3HVE B;  2KS1 A;  4XE5 B;  4H44 B;  2P10 A;  2R5B A;  2XEN A;  1S70 B;  4IFM A;  1RF1 C;  1JPL A;  5DBK A;  1WMK A;  1DCE A;  4QQI A;  2FYU J;  2ZYD A;  2LR2 A;  2AW6 A;  3I55 P;  4R7L A;  4D6T J;  2CHZ A;  1CZQ A;  3OXF A;  4I6E A;  4CEM A;  3DSS A;  3CCQ P;  1KYO I;  3R4Y A;  1QBQ A;  1GMJ A;  3GYZ A;  1EXI A;  4EOT A;  2Q9I A;  4N39 A;  1UIX A;  1SQP G;  1L0L J;  2RKK A;  4GU5 A;  4M3O A;  5B1B E;  4ANV A;  1T8Z A;  4C9B B;  2SPZ A;  3ZPJ A;  3AU4 A;  1KC8 Q;  3G2S A;  3KSQ A;  1TN7 A;  3D9K A;  3BUA A;  3JXJ A;  2LSV A;  1E79 H;  2K1A A;  5CMZ A;  4K0R A;  3FUL A;  1OWL A;  4H13 B;  1OW6 A;  2ZGD A;  3D9H A;  3W68 A;  3H1K J;  1OMI A;  5LP0 A;  3GHG B;  1G1I A;  3TGU D;  1AJY A;  4W7Y A;  4U3F D;  3FU0 A;  2A45 I;  4CPG A;  4I2Z A;  4E6H A;  1OCC E;  2VRS A;  1KT0 A;  1FZB A;  3RK3 E;  1N8R Q;  2RN0 A;  1KIL D;  3HDX A;  2ZVO B;  5EDS A;  3Q75 A;  1VQ4 P;  2ZYA A;  1TJC A;  2ETA A;  3BU8 A;  4HXI A;  3UTM A;  4JHR A;  3PTZ A;  3CL3 D;  5AAO A;  2XRZ A;  4AY5 A;  3TYY A;  1H0T A;  5KJM A;  4WWP A;  1BE3 G;  3CVX A;  3KEA A;  3ISM C;  2K88 A;  2QFC A;  4WVZ A;  4N5Q A;  1L2P A;  5LCW J;  2GA1 A;  2Y0B G;  4XA4 A;  1SQP J;  3DBS A;  3D70 A;  3AS5 A;  4JXT A;  1BGY J;  1GZL A;  3R7R A;  3KZI H;  4D6T E;  2DCP A;  2JJL A;  3CK8 A;  1KIL A;  4GYW A;  4ILI A;  4OWF A;  1NTK E;  1URQ D;  1XTG B;  2B87 B;  3LY9 A;  3HE5 B;  5KJL A;  3OXL A;  3ZYM A;  1MZC A;  3SBT B;  2X6K A;  1OW7 A;  1LTS C;  2KIK A;  4B8C B;  4PS7 A;  1LT9 C;  3V30 A;  2Y0D A;  4HFG A;  3OXG A;  2RD0 A;  5CED B;  3A2A A;  1KQF B;  2J8S D;  2JWA A;  3TF5 A;  2WSC J;  2OYH A;  1N11 A;  2KUB A;  1FC2 C;  4ZNC A;  1OWN A;  3VYI A;  2QM8 A;  3B7B A;  3KAE A;  1KT1 A;  4O6F A;  2VSO E;  3FEY A;  1AFO A;  5J90 A;  4KBQ A;  1USE A;  3MGN A;  2N1T C;  1N4S A;  3B5N B;  2V4H A;  1SQV D;  3QWP A;  5ITZ F;  3CK7 A;  5BW8 C;  3F5H A;  3Q9N C;  2AWI A;  3QWV A;  3OJA B;  1FBM A;  4K3A A;  3EHR A;  5KWD A;  4F53 A;  4H44 D;  4U07 A;  4CT0 A;  4O60 A;  3U59 A;  3D9I A;  4TUM A;  1N7L A;  3C1L A;  2CFZ A;  1TN8 A;  1T2K D;  5FZS A;  3BCC G;  3FH5 A;  1K73 Q;  2BCC G;  5KKZ B;  1GU4 A;  2UY1 A;  2WSC H;  3B95 A;  3G6E P;  1SQB J;  1SQB D;  4GCO A;  4N6J A;  1HG5 A;  4TXQ A;  3L75 J;  2IOL A;  3T8M A;  4M3L A;  3L17 A;  5AVR B;  3E4B A;  1LP1 A;  4N78 E;  2KZI A;  1VQ7 P;  3CKC A;  1ZR2 A;  1IQR A;  2B89 A;  4AOF A;  2DYS E;  3I3N A;  4L2L A;  1G2C A;  4HOQ A;  4JZY A;  4N3A A;  3V31 A;  1H2U A;  2K3R A;  2GW1 A;  1FU1 A;  2NPS D;  3H1J J;  4C46 A;  5KLV J;  4DUI A;  2K9Y A;  4JBZ A;  1HE8 A;  4HLL A;  5TIS E;  2KS1 B;  3CHR A;  5A23 A;  5APX A;  3GW6 A;  5AW7 B;  3VMZ A;  5EN5 D;  3RK3 D;  3FH7 A;  3VLF A;  1GW3 A;  2I2O A;  3L54 A;  1SVX A;  3LJ3 A;  3BEE A;  4Q96 A;  1PPJ D;  4AV7 A;  2HOD A;  5LOZ A;  3Q7F A;  5EIL A;  3RJV A;  2B87 A;  2IDB A;  2GRN B;  4KT6 B;  2RFA A;  4UI9 C;  3CEQ A;  4GTS A;  3L70 D;  1YIT P;  1P84 E;  3L74 G;  2NPS A;  1YHQ P;  3IHV A;  2WMM A;  3D71 A;  3AEB C;  3CCE P;  3LVQ E;  1P84 D;  1MHQ A;  4A7P A;  1HH8 A;  3A0H H;  1IHG A;  2Y3A A;  2GRR B;  1E8W A;  2L0T B;  3CWB D;  1JCR A;  1LNQ A;  2IBZ E;  1NTZ J;  5KTB A;  3CCM P;  4JPZ B;  4B89 A;  2ITA A;  3ZYQ A;  5ANR A;  2VQ2 A;  2IOS A;  2LNI A;  2ETC A;  5BV0 A;  4AM9 A;  4C0M A;  2P9S G;  3FUN A;  3AG4 E;  2OVB A;  3W67 A;  2E75 D;  2NRG A;  3MYV A;  4ILH B;  1UN9 A;  4XKC A;  1NTM J;  2C0W A;  1NKN A;  5AVW B;  3LID A;  2HO1 A;  3M9H A;  4BET A;  3CC7 P;  3D6Z A;  3EFG A;  2WXK A;  3V2Q A;  3GF3 A;  3BG0 B;  1BDD A;  2WQ7 A;  1RZ4 A;  4PD4 I;  2JEK A;  1MV8 A;  2AEJ A;  2ZT9 B;  1KB9 D;  4HRN A;  1PP9 G;  2P9I G;  1RQV A;  1M1J B;  3SY2 A;  3U9W A;  3C3R A;  2MHK A;  1E8X A;  2H6I A;  3CHS A;  1MZ9 A;  4XIF A;  2E74 C;  2AXT E;  4JVS A;  1FCH A;  1PFI A;  3UKR G;  4HBD A;  3QH9 A;  4I1L A;  1UN8 A;  1SQP E;  2XPI A;  3LVR E;  5AVX B;  4XFJ A;  5CRV A;  4GTQ A;  3PP5 A;  3ZHE B;  2JWD A;  1ZP0 C;  4KHX A;  1NVO A;  1N94 A;  4J8S A;  5EYP F;  1PGP A;  5EX0 A;  1BSH A;  5KJ7 D;  1ELR A;  1L0L D;  3EIJ A;  4BER A;  2NZ2 A;  1Z6T A;  2RH0 A;  3AE4 C;  1QL1 A;  2DIW A;  4DX5 D;  4M7C A;  2JDI H;  1HGV A;  2N9B A;  1HZ4 A;  2E2E A;  3MV3 B;  4AEZ C;  1EDJ A;  1O1R A;  4OVU A;  3M91 A;  1L0N E;  2Q5U A;  3TGU J;  3SI5 A;  2XZD G;  4IYP A;  4YND A;  4DX6 D;  1HTL C;  4HS2 A;  4APF A;  1PIX A;  5KJ7 A;  4UWH A;  4U7J A;  2AXZ A;  4CCA A;  4UUC A;  1G3N B;  3UT7 A;  3G9R A;  5APT A;  3WG7 E;  1OFC X;  2WQY C;  3FXD A;  2R59 A;  4F1S A;  1JY3 N;  2KB7 P;  1LD8 A;  3AE6 C;  2FBW C;  1NTZ G;  4HOR A;  1RF1 B;  2WXP A;  4GAA A;  1S5L H;  2KNC A;  4ABN A;  5APY A;  3HUS B;  3T9K A;  2YHE A;  1TYQ G;  2IFU A;  1NTZ D;  4U0U A;  1FS0 E;  2YO2 A;  3L74 D;  2C2L A;  2FYU D;  4Z68 A;  1A17 A;  5AW0 B;  4RJT A;  2V4H C;  3ONL A;  2KBX A;  1SQM A;  2IO2 C;  4BX9 A;  3ENE A;  2O1K A;  1PPJ G;  2H6G A;  2L0I A;  2H88 C;  3TNU A;  1V54 E;  2V5Q C;  1HVV A;  2P58 C;  3AEF C;  2XPY A;  2QRX A;  1VF5 B;  4KZC A;  5CER B;  1QVG O;  5EIB E;  4GA2 A;  3UIN C;  5T8I A;  1K3Z D;  4XX5 A;  3JYS A;  1D8E A;  1PP9 J;  1T3J A;  2GRM A;  2YIU C;  3H1L E;  1PPJ E;  2FI7 A;  1LTA C;  5APW A;  1N2D C;  3Q5M A;  1DEE G;  2C9L Y;  2UWJ G;  3I4R B;  1KOR A;  1H2T C;  4PS3 A;  3TL5 A;  4EQF A;  2YKP A;  3C9I A;  2JKV A;  3DEP A;  3L73 E;  2UY1 B;  3I5C A;  3E30 A;  3IKO B;  5KJK A;  3Q15 A;  3L37 A;  3HD7 B;  3DPY A;  3C3O A;  3EHM A;  1TU3 F;  5FQ6 A;  5BVZ A;  1SQQ J;  1Q81 Q;  3BCC D;  2IFN A;  4UWK A;  1JNM A;  2R05 A;  3EQ2 A;  2WXL A;  2E76 D;  1E90 A;  1AQT A;  1URQ A;  4EZK A;  4UQX A;  3SGH A;  3AE2 C;  2YHC A;  1QLE D;  2AEM A;  2LAI A;  3FU6 A;  2W6A A;  2KAT A;  3PE4 A;  3LIE A;  1JY2 O;  1VF5 C;  1NA3 A;  2IBZ D;  2QYU A;  1TR4 A;  2ZVN B;  2L6B A;  4MLP A;  3MV2 B;  3CVW A;  4EI2 A;  5AIJ A;  2ZU6 B;  4CGV A;  2BCC E;  3O4Z A;  5FTP A;  3P8C E;  2FXP A;  5E76 A;  4DOJ A;  1JEK A;  5KLV D;  2Y0C A;  3FTX A;  2XZT G;  3RGU A;  2PGD A;  1ZR4 A;  1GDT A;  3UT8 A;  4G8L A;  3SQV A;  4GMR A;  3NB2 A;  3APF A;  3F89 A;  3DSV A;  3W9G A;  1NKZ B;  3PS6 A;  3U66 A;  1NO4 A;  5KCM A;  4JL0 A;  1SFC D;  3FUK A;  5ENR D;  2KLU A;  4HKZ H;  4J6I A;  2E43 A;  4P29 A;  3T8K A;  4PV1 D;  4Y6W A;  1L4A B;  1O5M A;  1FZC C;  2JP3 A;  4ATG A;  5FZQ A;  1OX3 A;  1G1J A;  4W9R A;  2GUS A;  2KCV A;  3U1A A;  3D9P A;  2FF4 A;  1P5Q A;  3L74 J;  4UI9 K;  5CCH C;  1HH0 A;  4YVQ C;  3FTU A;  5C1D A;  1EZV D;  1L4A D;  5G04 J;  2G8Y A;  2IFM A;  3A7O A;  1VQP P;  2F0Y A;  3FWL A;  4L73 A;  3DXM G;  2P1J A;  3RL0 g;  3APC A;  4I6G A;  2IPP A;  1SFC A;  3L72 J;  4BXL A;  3GF7 A;  1RF0 C;  2WPV A;  4IL6 E;  1GK4 A;  3L70 G;  3PLN A;  1A5E A;  1S5L X;  3PH0 A;  1DH3 A;  2J59 M;  5JMN D;  3FXE A;  2ZFC A;  3NOG D;  1LTX A;  1NTM G;  5FWQ A;  1URQ C;  2A45 H;  3PRE A;  2WXF A;  4B8A A;  2B9B A;  1EZV G;  3RO2 A;  3QAR A;  1ZRT D;  4WY4 C;  3CCR P;  5FQ7 A;  4BSZ B;  4ANX A;  2LSU A;  2XKM A;  2ZXX A;  4U3F G;  3TGU G;  1T6A A;  3S2A A;  3IR9 A;  2P58 A;  3C3Q A;  1KN7 A;  2HE0 A;  1TEZ A;  1L0L K;  3KS2 A;  1N7S A;  2OQQ A;  5EFW B;  1S72 P;  1NH4 A;  1NTK J;  4WWO A;  5H7P A;  2P7J A;  2K9J A;  1RQU A;  4U3F E;  2OYO A;  4NIK A;  2GRL A;  4GOF A;  3MUD C;  2WB2 A;  2QC9 A;  1W2B O;  4MS6 A;  2XGM A;  1DD4 A;  2XV5 A;  3P8M C;  2QA4 P;  1H6P A;  4IRU A;  3SD5 A;  1SQP D;  2YNQ A;  1NOH A;  2IBZ I;  1Z3X A;  5G2N A;  1KPS B;  4K35 A;  4AP2 A;  3HD7 D;  4FAD A;  3JSV C;  1DEB A;  3WMM 0;  3Q9U C;  2ZT9 C;  2KSE A;  4BT8 A;  3SWY A;  2AXU A;  4K5A B;  3FUE A;  4OVV A;  1FVH A;  3FTZ A;  5BXU A;  2V7Q H;  2KP8 A;  1DNP A;  3W9F A;  1H6O A;  1DIP A;  3A5T A;  3GLM A;  4D6T D;  1FT1 A;  5GTH H;  3RAU A;  4CYM D;  1JO5 A;  1ZB1 A;  4WUY A;  5G05 J;  2FEZ A;  3V2R A;  2F8Y A;  1SQV G;  1UII A;  3Q7A A;  2LXC B;  5M1B A;  5E79 H;  3KZI E;  1ZV8 A;  4B0Z A;  4N5C A;  3WUV A;  1IK7 A;  1HUC A;  3L82 A;  1JUN A;  1S3J A;  4RQI A;  1FVF A;  1K8K G;  3VP8 A;  2LUH A;  1QL2 A;  1EDL A;  3D6Y A;  3ZN3 A;  3L73 J;  1LTJ A;  3O6Q B;  3P7K A;  3VLD A;  4B93 B;  2LXB A;  2OV8 A;  4ATZ D;  1SFC B;  4BSX A;  3MP7 B;  3PZ2 A;  5EYL A;  5ARG A;  1M1K Q;  2W8Z A;  1RE4 C;  4L23 A;  1ZN5 A;  2A45 G;  5AVT B;  3ZDM A;  2HPC A;  1VQN P;  1LJ2 A;  3UPV A;  4HH2 A;  3CC2 P;  2PM6 A;  5JHB A;  5AVV B;  5AW2 B;  2R44 A;  3NAW A;  3U4T A;  2D2C B;  2AJA A;  4UWL A;  1RH5 B;  3B7T A;  3VTP C;  1ZXG A;  4H7Y A;  1AVY A;  2PAJ A;  4Y99 C;  1ZBP A;  3EJN A;  3FUI A;  3MTU E;  3GZ2 A;  4TRQ A;  2Z5I A;  4J7W A;  2BED A;  3HE5 A;  2D2C D;  2IZ0 A;  4GA1 A;  2KXP C;  1E7U A;  4BRY B;  3E33 A;  2WSF H;  2KM4 A;  2XCC A;  3EHQ A;  4UWG A;  2FYN C;  1D8D A;  3V2X A;  4ASV A;  4K5C A;  4JHJ A;  4DI3 A;  2M3B A;  3FUH A;  1TNU A;  1FPP A;  2BKG A;  3L73 G;  2BTD A;  4YPC A;  4PJ0 E;  2N1T D;  3D9O A;  2PRR A;  1FAV A;  1YA0 A;  3HXD A;  1PP9 E;  3ZGQ A;  3DSU A;  1WAO 1;  3QAQ A;  3H1L J;  5ANL A;  2P2U A;  2WWW A;  4AIF A;  3D9N A;  1PC2 A;  1SS1 A;  1SQX J;  5AW9 B;  2F37 A;  4KXK B;  1NTM E;  5ARF A;  4TXR A;  3UM2 A;  3P8C D;  3H1H G;  1H0A A;  4AXH A;  1RY3 A;  2MYO A;  5KLV K;  1NFI E;  3NBN B;  5A6C A;  2QSI A;  4ZKP A;  3GW4 A;  4GA0 A;  1OXJ A;  1VQ9 P;  3FWN A;  4CZ2 D;  3BCC J;  3V5B A;  3FTW A;  3RRN B;  4IL6 X;  4LC1 A;  2QZA A;  2N1T A;  3H1I G;  1HJB A;  1JOC A;  2QIW A;  1FZG A;  1LF8 A;  5LFA A;  5B1A E;  5D0O D;  1EPU A;  2WVI A;  2ZJS E;  4G1T A;  5B66 E;  2OEW A;  5D0Q D;  4DPR A;  2BEQ D;  3CVV A;  1HGZ A;  1QNF A;  2QJP B;  2XEE A;  1KIL E;  3SZ7 A;  3Q47 B;  4FHK A;  2X3M A;  2XGS A;  4LG6 A;  1EDK A;  2FFD B;  2GRO B;  3EUV A;  4KMO A;  3AE5 C;  3CCS P;  2J08 A;  1T2K C;  1TN6 A;  2QJY B;  3USS A;  2X6J A;  4I1O B;  1O1S A;  3L75 E;  3PEU B;  3L73 D;  4HYT B;  1AVO A;  2EIJ E;  4I43 A;  4U0S A;  3D9J A;  2IY0 C;  4IFD K;  1FDO A;  4FJY A;  2IJG X;  3MUD A;  4FA6 A;  2IQC A;  3TG5 A;  2BUG A;  5KLV E;  2V5F A;  2P9P G;  4BY6 A;  3O8Z A;  4L76 A;  1OVU A;  1OY3 D;  3CX5 E;  1HF8 A;  1YTZ T;  2JLB A;  5B5E E;  2KC7 A;  2G3A A;  3P1U A;  1NTK D;  2NPS B;  1OZH A;  3MKQ A;  3FTS A;  5JJT A;  3JCU E;  3QC1 A;  1KYO E;  2POH A;  4JYB A;  1VL2 A;  3C98 A;  5G05 C;  3HVE A;  3JUE A;  3L71 E;  3IHY A;  5CHE E;  1BGY D;  3GHG A;  2GGF A;  3CSF A;  3L35 A;  1EDU A;  3F6Q A;  1PGO A;  3BRT B;  1SFC C;  1JM0 A;  1JY2 P;  1U57 A;  1B89 A;  3AU5 A;  3L13 A;  3B4S A;  2FKW B;  2JAB A;  3ZFW A;  5FZR A;  2VGX A;  3K9I A;  2QVA A;  3VMA A;  5KAF H;  1LTB C;  3D9M A;  2L6J A;  2P2C P;  4I9C A;  3FEX A;  3TG4 A;  1HF9 A;  3ZU7 B;  3HXB A;  3PZD A;  4C0E A;  3HTK B;  3G4S P;  1M7L A;  2DZO A;  3X2Q E;  4YTP C;  4A1G A;  5LCW C;  2YXQ B;  3H1L G;  1NU1 G;  4GOE A;  3ITK A;  1HO8 A;  3CWB E;  4MKT A;  1S2E A;  4WND A;  3ULE G;  3WUU A;  3TJP A;  5KLI B;  1PL5 A;  4F6R D;  1K9M Q;  1GW4 A;  3MZW B;  3K5B A;  3MHV A;  3PZ3 A;  4OAV B;  2XEV A;  1LTJ C;  3CCU P;  3PE3 A;  3ABL E;  1N95 A;  3HXE A;  4DLO A;  3N4X A;  1L4A A;  3JQ0 A;  3CX5 D;  1R8E A;  3L72 D;  1LT1 A;  3UMV A;  3CI9 A;  4DJA A;  1Y47 A;  1IFP A;  3RRM B;  1HG2 A;  1SQQ K;  5AAR A;  1VQ5 P;  4WNF A;  5CEA A;  4OH8 B;  1O1T A;  3L4F A;  3FUM A;  1KZP A;  3BRV B;  3S7D A;  2YNY A;  2EIN E;  4EDF A;  3ONK A;  1U3D A;  1NTZ K;  5G04 C;  1H2V C;  5C2Y A;  3A0B H;  2QJP C;  1FOS F;  2OOE A;  4MBG A;  5KBA A;  5KKZ C;  3FTY A;  2AEF A;  3AE9 C;  2P67 A;  3AG2 E;  4KYO B;  4MN4 C;  1N7S D;  5AQB A;  2FFD C;  2A06 G;  2ION A;  3L70 J;  5CMY A;  3QK0 A;  3ML9 A;  3HG0 D;  3UIP C;  1GL2 D;  3M0A A;  3KQG A;  2M0B A;  2YO3 A;  3HD7 C;  4PV1 C;  1FZF A;  4H0L C;  4DLQ A;  1L0N D;  1JUQ A;  1KIL B;  1SW6 A;  1M56 D;  1YBK A;  5AJL A;  1NTM D;  2H43 A;  3LW5 H;  3LEW A;  2WSE J;  3FDH A;  3KDP B;  2R02 A;  3SHF A;  3G2W A;  3TWX A;  1L0N K;  4K03 A;  2H6H A;  4RLY A;  1EQ7 A;  4TLF A;  2EIL E;  4FHJ A;  1NI1 A;  2I1K A;  3DST A;  1NYH A;  3HD7 A;  2CG2 A;  2VGX B;  1KIL C;  3PUJ A;  3S1K A;  2N1T B;  2J07 A;  5JHA A;  2HYN A;  3R2P A;  1NA0 A;  1N54 A;  3LJN A;  1TNB A;  1AA0 A;  1N86 A;  1N4Q A;  1SZA A;  4G2V A;  2WM9 A;  3S7F A;  3QJZ A;  4LEU A;  4GZ3 A;  3Q49 B;  3UIA A;  4J8Y A;  3MCX A;  4KVO A;  1GL2 A;  1SQV E;  3DEO A;  1UG3 A;  3WXX A;  4KZ0 A;  4MRU A;  1LT9 A;  2W83 C;  4IFF A;  2IU1 A;  3NQP A;  2WZ7 A;  1SVF A;  2W6B A;  3HYM B;  3KEZ A;  3PHL A;  3H1H E;  5BXO A;  3G2V A;  3PZ4 A;  5J08 A;  1SQX D;  4EPZ A;  1FJP A;  2WSE H;  3TNU B;  2VTB B;  3M9Q A; 
#chains in the Genus database with same CATH homology
 1BDC A;  1EDJ A;  3Q9U C;  5ENS D;  1IHB A;  3TWV A;  4N5Q A;  1TR4 A;  2DZN A;  2L6B A;  4JB8 P;  4K5A B;  4GOE A;  2B87 A;  2RKL A;  1OT8 A;  1BD8 A;  2MYO A;  2XZD G;  1WG0 A;  2RFA A;  2Y0B G;  4YDW A;  3V2O A;  3JXI A;  4WWI A;  1IKN D;  4K5B A;  1NFI E;  4DX6 D;  5BXU A;  4ZHB A;  3NBN B;  1QYM A;  1AP7 A;  5FIN A;  1IXV A;  4F6R D;  4ZFH A;  3W9F A;  4F1P A;  3MZW B;  4CZ2 D;  3MHV A;  3UXG A;  2HR3 A;  2WMM A;  4U96 D;  2XZT G;  3RGU A;  5DJU B;  4OAV B;  1MX2 A;  3IXE A;  5AQA A;  1WDY A;  4UUC A;  4GPM A;  4G8L A;  1G3N B;  2B87 B;  1K1A A;  4CYM D;  3HRA A;  4GMR A;  4HRL A;  1DCQ A;  3EU9 A;  5KNG A;  1ZW0 A;  1EC5 A;  1Q2N A;  4HB1 A;  1X0T A;  1LT1 A;  3TWQ A;  3NOC D;  3W9G A;  4C48 B;  4U95 D;  2RFM A;  1Y47 A;  2F8Y A;  3FXD A;  1N0R A;  2KIK A;  2F8X K;  2LXC B;  5D66 A;  4HRM B;  2ETC A;  1U7M A;  5FIO A;  1N0Q A;  2ETB A;  4IOI H;  2XEE A;  4O1P A;  5ENR D;  3V30 A;  4DX1 A;  4HKZ H;  3T8K A;  5AAR A;  5ENQ D;  5CED B;  2I8D A;  2A5E A;  4LG6 A;  3V79 K;  1EDK A;  2NYJ A;  2J8S D;  1S3J A;  5CBN A;  2QYJ A;  5ENP D;  2XEN A;  1N11 A;  1S70 B;  3TWR A;  3TWW A;  2KUB A;  1FC2 C;  4ZNC A;  1YCS B;  4U8V D;  5KNH D;  3B7B A;  3T9K A;  1EDL A;  1BI7 B;  1UOH A;  3ZUV B;  1H0T B;  4QQI A;  4HJG H;  4BET A;  2LR2 A;  4Z68 A;  4B93 B;  2LXB A;  5ITZ F;  4ATZ D;  2KZJ A;  4KJM A;  2V4H C;  5EYL A;  5JMN D;  2KBX A;  3Q9N C;  3ZNG A;  1JMB A;  1BDD A;  5HS0 A;  4K3A A;  4NPF X;  3EHR A;  3QWO C;  3ZDM A;  4HQD A;  5KBA A;  1MYO A;  1YMP A;  5KWD A;  2Y1L E;  2V5Q C;  3C5R A;  4MN4 C;  5AQB A;  3SO8 A;  2QRX A;  5CER B;  4OAU C;  2B0O E;  4HRN A;  4BES A;  5EIB E;  3TWS A;  2KI7 B;  2R44 A;  1BI8 B;  2DVW A;  1OVU A;  1OY3 D;  2AJA A;  3HG0 D;  4HI9 A;  2PNN A;  4O60 A;  1OVR A;  4TUM A;  1K3Z D;  2M0B A;  4EYY Q;  4BXL A;  3UI2 A;  2Q1K A;  2FO1 E;  5K5G B;  2SPZ A;  1ZXG A;  1A5E A;  1SW6 A;  3PH0 A;  5CEA A;  5EID A;  5HRY A;  3JXJ A;  4YDY A;  3FXE A;  1EDI A;  2VGE A;  3NOG D;  5AN8 A;  2BKK B;  3TWU A;  4QFV A;  4NPD A;  1DEE G;  2ZAE B;  1BLX B;  4J7W A;  3TWX A;  2OTK E;  4HBD A;  1BU9 A;  4BSZ B;  4HNA D;  4RLY A;  4A63 B;  1MX4 A;  1MX6 A;  3J5Q B;  3B95 A;  2XEH A;  2ZGD A;  3JUE A;  1DC2 A;  4DRX E;  3D9H A;  3DEP A;  4ASW A;  2DWZ A;  4U8Y D;  2KXP C;  2JWD A;  2UWJ E;  3S1K A;  2P58 A;  1LP1 A;  1NVO A;  2KZI A;  3F6Q A;  3LJN A;  2HE0 A;  3ZKJ A;  4BEP A;  5EYP F;  5DJT B;  4CPG A;  5AQ7 A;  2B89 A;  1MFT A;  5ENO D;  1LP1 B;  5EFW B;  1JM0 A;  3EHQ A;  1AWC B;  4LSZ E;  4J8Y A;  5C39 A;  5CEC B;  3V31 A;  3V2X A;  4ASV A;  4K5C A;  2K3R A;  3DEO A;  5ENT D;  2JAB A;  2B88 A;  1U7J A;  2M5A B;  4HI8 A;  4DUI A;  1YYH A;  2BKG A;  4BER A;  4JBZ A;  4HLL A;  4ZMD A;  4NIK A;  4GOF A;  2QVA A;  2KS1 B;  4DX7 D;  4NPE A;  4G8K A;  2QC9 A;  4GOD A;  1MJ0 A;  5AQ9 A;  5CBO A;  2ETA A;  5HKP A;  2P2C P;  2ZGG A;  3UTM A;  3AAA C;  4LNU D;  5EN5 D;  4DX2 A;  4DX5 D;  5AAO A;  5BXO A;  5EIL A;  4HB5 A;  3ZU7 B;  5JA4 D;  1H0T A;  4O1O A;  3J5P A;  4K35 A;  1SVX A;  2M5A A;  1K1B A;  3AJI A;  2DZO A;  3KEA A;  3TWT A;  1SS1 A;  2F37 A;  1OVV A;  1D9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...