5CBNA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus with chemical cross-linker ey-cbs
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Maltose-binding periplasmic protein
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cbnA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cbnA01
2RFMA 4U8VD 1MX4A 4K5CA 4F1PA 1FC2C 4DUIA 2V5QC 4UUCA 2KUBA 3UXGA 2FO1E 3TWVA 3JUEA 1U7JA 5ENRD 4F6RD 4GPMA 4O1OA 2M5AA 2B89A 4LSZE 2KIKA 1X0TA 3AJIA 1NFIE 1EC5A 4QFVA 3KEAA 4ZNCA 4DX6D 3AAAC 2BKGA 5ENTD 1IXVA 4ZMDA 2ETCA 4TUMA 1MX6A 2I8DA 4U95D 3V2XA 2XZDG 2ETAA 1BLXB 3V79K 2KZIA 2P58A 2ZGDA 1BI8B 2F8YA 5DJTB 5AQAA 2KS1B 4EYYQ 4J7WA 2KBXA 3UI2A 4K35A 4K3AA 2XENA 2Y0BG 4ATZD 3TWQA 1EDIA 5EIBE 5CBNA 4CYMD 3ZUVB 5EFWB 3ZKJA 3W9GA 1MJ0A 4K5AB 1DEEG 3ZDMA 4YDWA 4YDYA 4GODA 1Q2NA 4NPFX 5DJUB 3T8KA 3J5PA 5AQBA 4A63B 3S1KA 5ENOD 5D66A 4HI9A 4O60A 2QYJA 4MN4C 2JABA 2RFAA 1LT1A 4HRNA 5BXOA 4WWIA 1BDDA 4O1PA 3HRAA 2LR2A 4BXLA 4RLYA 1SS1A 1UOHA 2XEHA 4HLLA 3UTMA 3TWXA 1S3JA 2KI7B 3RGUA 5EYLA 4GOFA 1G3NB 4GMRA 3W9FA 4K5BA 2DZOA 2V4HC 3TWUA 2M5AB 3J5QB 3JXJA 2L6BA 1BD8A 4ZHBA 4G8KA 1N11A 5ITZF 1Y47A 5BXUA 5JA4D 1TR4A 4NPDA 5C39A 4HRMB 5ENSD 3NOCD 5KNHD 4IOIH 3T9KA 2J8SD 1LP1A 2M0BA 3MZWB 3PH0A 2K3RA 5EILA 1BU9A 4JB8P 4C48B 1QYMA 4DRXE 2SPZA 5KNGA 1YMPA 3FXEA 1YCSB 4DX2A 4HBDA 5CBOA 3DEOA 1MX2A 1DCQA 1K3ZD 2B87A 5EYPF 1OT8A 1H0TA 1YYHA 4OAVB 4U8YD 1MYOA 4LNUD 2XEEA 5KWDA 5KBAA 1MFTA 5K5GB 1JMBA 5AN8A 3NOGD 5HS0A 3TWSA 2NYJA 3B7BA 2LXCB 2LXBA 1OY3D 5JMND 1OVVA 3ZU7B 1EDLA 4HKZH 3D9HA 2MYOA 1S70B 3EHRA 3V31A 2QRXA 2VGEA 5AARA 4ZFHA 2Q1KA 3V2OA 4HQDA 5HRYA 4DX1A 4LG6A 3FXDA 2DZNA 4HJGH 1EDJA 4HRLA 1OVRA 4NPEA 2KZJA 2ZAEB 3LJNA 1DC2A 5AQ9A 4N5QA 2QVAA 4J8YA 3TWRA 5HKPA 4BESA 4B93B 2PNNA 2DVWA 5ENQD 3EHQA 1AWCB 2HR3A 1AP7A 4BEPA 4DX7D 5AQ7A 1ZXGA 4HB1A 1N0RA 1NVOA 2KXPC 1OVUA 3TWTA 5ENPD 1IHBA 1LP1B 2P2CP 3SO8A 2ZGGA 4QQIA 3ZNGA 5CERB 1IKND 1BDCA 3TWWA 5CEDB 4OAUC 3DEPA 4KJMA 2Y1LE 1SVXA 3MHVA 3Q9UC 1ZW0A 5CEAA 5EIDA 2B87B 2F37A 4DX5D 3QWOC 2BKKB 1H0TB 3JXIA 1N0QA 4Z68A 2JWDA 3EU9A 1EDKA 4ASVA 2B0OE 4BSZB 3B95A 2DWZA 2HE0A 3C5RA 3HG0D 4JBZA 1K1BA 2XZTG 4HB5A 1WG0A 2QC9A 2AJAA 5FIOA 1SW6A 4BERA 2R44A 2WMMA 4NIKA 2ETBA 1JM0A 1BI7B 4GOEA 2UWJE 4HI8A 1D9SA 1K1AA 4G8LA 3F6QA 2F8XK 5CECB 2OTKE 4CZ2D 2B88A 4U96D 1WDYA 4ASWA 2RKLA 3Q9NC 4CPGA 2A5EA 4HNAD 1U7MA 3IXEA 5AAOA 5EN5D 4BETA 3NBNB 3V30A 1A5EA 5FINA
chains in the Genus database with same CATH superfamily
5FQ7A 2RFMA 1TN7A 3UM3A 1Q81Q 1LT9B 4U8VD 3I5PA 1URQB 3GZ2A 4EBAA 5FJYA 2C0XA 3NXSA 5FZQA 3W68A 1OWLA 4UUCA 2WSFH 3Q5MA 1KB9I 3PE3A 3TWVA 3JUEA 3AG1E 3OAKA 3U59A 4KVOA 1HG2A 3V2PA 2GUSA 4F6RD 4O1OA 3B71A 2KB7P 2B6CA 4TXRA 4C7NA 4A7PA 2B89A 3ULYA 1HVVA 4I6GA 3AEGC 2KIKA 5FZRA 2IOLA 4AV7A 1KYOI 3APFA 4YNDA 5LOZA 1WT6A 1EDUA 5JJ7A 3CHSA 5EKQD 4U3FE 4KZ0A 1OCOE 1ZLLA 4GTVA 4LCTA 1FDOA 4AP2A 1RE4C 5ENTD 1S5LX 1IYGA 1E96B 3A3YB 2Q9IA 4ZMDA 4GZ5A 4TUMA 3ZRHA 3S7BA 2YKPA 3ZYKA 3WUTA 2P2UA 4U95D 4RQIA 1SQPJ 4LC1A 2AVPA 5KJ7C 3L36A 3KSLA 3L72J 3CHPA 4K0RA 2WXGA 2N1TB 1SQQJ 1TNYA 1IC2A 2H6GA 2L6JA 4N2SA 5KKZC 4OH8B 1HF8A 2I9CA 4F53A 3Q5SA 2AXUA 2YNYA 5BV0A 5G2NA 4FHJA 3A5TA 2YINA 1LTJC 1MUUA 1INZA 1U3CA 4GB9A 1WMKA 5APSA 1LTBC 2ZGDA 2P9LG 1BI8B 3HRNA 3EFFK 5DJTB 5AQAA 2A06G 4EYYQ 2GGFA 4WUYA 4J7WA 4UWGA 2UY1A 3UI2A 4K35A 3LEWA 4F7AA 3Q79A 1VF5C 4H13D 1LWUB 2KM4A 2FY8A 2AEMA 4ATZD 4ACLA 3TWQA 3H1HG 1EDIA 5EIBE 1VQMP 4XFJA 1CSBA 4GA1A 4R7LA 3V2RA 5KTBA 2VYIA 1JO5A 4U8HA 3ZKJA 1VQ7P 2CHXA 5KLVD 3NAWA 4WBAA 4UB8H 2EILE 3ZYMA 1L0LG 3TGUD 3U4TA 3LS8A 4WNDA 2KCVA 4FC8A 1IK9A 2FYNB 3L70D 4YDWA 2J09A 2WMOA 2AXTH 3ZGQA 4GODA 3FUKA 2Y3AA 3FEXA 3RL0B 2Y9YA 3AE9C 5AVRB 3UKUG 1SQVJ 2YMKA 3TJPA 2A45I 3HE5A 2R2LA 3UT7A 3MA5A 4B89A 3D9NA 2R5SA 3L70E 4IFDK 2JWAA 4MN4C 2RFAA 3K5BA 2PQRA 2WXLA 3LY9A 4HRNA 1NTMJ 3EHMA 4GT1A 3IEGA 3UIAA 1V54E 2LR2A 1G1JA 3CC4P 3H32B 3Q78A 3A0BH 3D9PA 5BNWA 1YI2P 5IY5E 3E1IA 2XEHA 4W7ZA 3URZA 2ZFCA 4FHKA 4ZKPA 3FWVA 2ZT9B 3N4XA 3TWXA 3AE5C 1KTMA 3FH8A 1S3JA 2FBWC 2KI7B 1SLQA 4DCKA 3RGUA 4LERA 2EQXA 5AVTB 3KPEA 1Y8MA 4B8CB 4GYWA 1FZBA 2W6BA 2LUHA 2R3SA 1Q90D 2J4BA 1RF1B 1AQ5A 1K04A 3E4BA 3P1UA 3W9FA 2R05A 1JY3O 2QJPC 2DZOA 4DK5A 4EDFA 2CHZA 4GZ6A 2HLOA 3FEYA 3J5QB 4GTRA 1X81A 3JXJA 3KSQA 3MGNA 3H25A 2W90A 3JQ0A 4IYPA 1U2VG 2V4HA 2FXOA 5AVXB 2E75C 4G8KA 3C3OA 4ABNA 3Q75A 3L73E 1Y47A 1IFNA 4TUUA 2WPVB 3PDNA 3P8CE 4JA9A 2HO1A 2KZTA 1KILC 2PQNA 3LY7A 2WXQA 2P9UG 4ME2A 1PGJA 5BVZA 3B7TA 3H1HJ 1EYHA 2LO6A 2X6KA 2K3RA 2NPSA 3E7KA 5GTHE 2KK7A 1QYMA 2D2CB 4W7YA 1BCCD 5FTPA 4JHRA 3HE4B 3A0HH 3FUHA 1ZR2A 1CI6A 1JWFA 3L22A 4B8AA 2XHEA 2KATA 1Y6IA 3CMAP 2XPZA 3Q5PA 3GF7A 1CW5A 4TLFA 1L0ND 3LW5H 4BSXA 1MX2A 1OXJA 1N7LA 2K9JB 1AJYA 4D10C 2FI7A 1N7SB 2B9BA 3H6PA 1H2UA 1NTKK 4EOTA 2B87A 2J5UA 3S9OA 4N3AA 3RBZA 1PPJD 2Y0EA 4I7ZC 2P9NG 1KPSB 2IBZD 4I2WA 2XEEA 3QAQA 1LTIC 3V5BA 1RZ4A 3USSA 2L0IA 1MFTA 2XGMA 1L2PA 3TNUA 1AVYA 2W8ZA 3BRVB 3H1KJ 1SZAA 2WXRA 3F89A 1BE3D 4H44B 3DSSA 1DEBA 1SQXE 3T97A 1PGPA 2XNXA 3E37A 4XI9A 1SA4A 3TWSA 2QJYB 3B7BA 3DPYA 4A3VA 3HD7A 1HUCA 1Q82Q 2R5BA 2OQQA 4KT0J 2I6HA 1GD2E 4IN3B 2XDJA 3H1JG 2WQYC 5ANRA 3D9HA 3CXHD 1NU1G 3RL0C 2K37A 3V31A 4NACA 4FULA 2KSJA 5EDSA 5A23A 1J1EC 4ZFHA 3IBEA 4BT9A 1QL1A 2JP3A 4GTPA 3L75D 2IBZI 1K73Q 2E42A 1ELWA 2Q1KA 3M0DC 4OGQC 2V4LA 4WAFA 4H0LB 1HE8A 3CXHE 2OYHB 3SWFA 4JPZB 5G05C 1W2BO 3VOPA 4PV1B 1HF9A 5HRYA 4LG6A 2DZNA 4PDXA 2JEEA 2J59M 3H1LE 3TXNA 4N5CA 1UN8A 2BASA 3SY2A 1GW3A 3AEEC 2VRSA 2IJGX 1LT9A 3BEEA 1OVRA 3BQOA 4ANXA 3AE3C 1URQA 3CVWA 1EZVG 1J2JB 3HXBA 3BVHA 3DSXA 2Y69E 4J8EA 3GYZA 4JZYA 4J8YA 3EWKA 4BESA 1LGHB 2E5YA 3JCUE 3M9BA 3SQVA 4C7NB 2YQ8A 2POHA 3S7DA 3EHQA 3TK1A 1X5BA 1AWCB 5LP0A 2X6IA 1SQXG 2L5GB 2HR3A 4ANWA 4Q96A 2P7JA 1OW6A 5D2MC 4UQYA 3JCKC 5KJMA 3R9AB 3CLQA 3HTKB 1VQOP 1ZN5A 3PZ3A 2OGUA 2X6HA 4UQZA 3SZ7A 1FJPA 5ENPD 4BX9A 5APUA 2PM7A 3BUAA 1U57A 5AJLA 1LP1B 3AE4C 2NPSD 5ANLA 3IHYA 1L5JA 2OVBA 1R5LA 2X38A 3O8ZA 5KJ7D 3R7QA 2WSCH 3NB2A 3II6A 1HU3A 1KLXA 5CEDB 4GTSA 2N1TA 5KLVK 3DSUA 3Q9UC 3H1JJ 1M90Q 5CHEE 5CEAA 3BCCE 3RO3A 1O1SA 3B8EB 4EZKA 1N7SC 1SP4A 2N9YB 3FWLA 2ZIRA 3ULQA 4AIFA 3H1LG 2OYIB 2R3CA 3DSWA 1NP7A 3I4GA 3CCUP 4H13C 4HOSA 1KFNA 3L74G 3HXFA 1FBMA 4MKTA 3Q2YA 1SQBJ 4EIJA 2YO2A 1NAFA 1TJFA 4NURA 1H6KA 5AENA 1LWUA 3ASOE 1FU1A 3AG2E 3FUMA 2WQHA 2XCBA 1NL4A 1XTCC 3D9OA 3QOUA 4BTAA 2XPYA 4J8FA 2WQ7A 2FYUG 2QJYC 2YMYA 4JEHA 4L1BA 4OVNF 1OXZA 3L71G 3HD7D 4FU3A 4XX5A 2XNDH 4HB5A 1WG0A 3FTVA 5FIOA 3CCLP 1KT1A 1PP9D 1RQUA 1NI1A 4I1LA 4BERA 3KEZA 3O4ZA 2WMMA 4I43A 1NH4A 3SSUA 5T8IA 1DD3A 1VQ9P 3QNKA 2GM4A 5TISE 5L8RJ 3FP3A 2XRYA 4BWNA 1S63A 3Q7AA 4HI8A 1D9SA 2JEKA 1FOSE 2IO3C 2A4ZA 3FTXA 3TDKA 4A3TA 2HFED 4GMLA 5DBKA 4CDRA 5KJKA 1KFMA 1GL2B 1HO8A 1WDYA 1XGWA 2OYHC 3ESKA 2VQ2A 3C8VA 1GW4A 2O01N 4CPGA 1P84H 1GDTA 1EF1C 2QM7A 4HNAD 1U7MA 1ZR4A 3H32A 4RVBA 1M7LA 4WB4A 3MP7B 1JCSA 3ONKA 1N86A 2VGXB 1URQD 3GLMA 1USEA 4PD4D 3D9MA 3RBXA 1FC2C 4HH2A 3L13A 4DUIA 4HYTB 4EI2A 1SFCB 4LGDE 1RH5B 2FULA 3UXGA 1LTTC 2FO1E 2IYOA 3HUSB 3CMEP 4BX8A 3VP9A 1DIPA 1JTHB 2PZIA 2IO2C 1RF1A 4I2ZA 2PFXA 1KQSO 3ASNE 3PZ2A 1L0NK 1SQPD 4Y99C 4EQFA 1M1KQ 3L72D 3BATA 4GAAA 4HOUA 1BGYG 2IU1A 2LNIA 3R4YA 1SQQD 4D6TJ 5CRUA 4KYOB 1X79B 1O5MA 3HIZA 1IK7A 3Q7FA 4FP7A 3L74J 3AJIA 4YXDC 4G25A 2WPVA 2O01H 5LCWJ 4WY4B 3I55P 3B7RL 4UWLA 1YITP 3KEAA 2OARA 4R4MA 2Y4TA 3IHVA 1K05A 4LUNU 3Q47B 4HOQA 4PD4I 1FAVA 1T3UA 3PJSK 4JC8A 3L71J 3V2XA 3HE4A 1OX3A 1KILE 5CMYA 2CFUA 4FLBA 2N1TD 4N78D 4G11A 1H88A 4LNGA 2KLUA 2R5DA 3Q49B 1TN8A 4IL6E 2WMNA 1QL2A 3SBTB 3V79K 4GTTA 2GRMA 2K9JA 2V5FA 3IR9A 2P58A 3CLJA 1N7SA 1JB0J 1VQ6P 5J90A 1DH3A 3FDHA 2F8YA 3DRAA 3FUIA 1VDFA 1R8EA 2G3AA 4RJTA 2R17C 3ZIMA 1RF0A 3PRZA 1QNFA 1SQVD 3C1LA 4FJYA 4N3YB 3CSFA 5KAIH 2AWIA 2VSYA 1BSNA 2HYNA 3JCUH 1KV4A 3HHMA 3ZUVB 4DT0A 3FULA 2O1JA 3MEKA 2BCCG 2NSZA 3FUJA 2WSFJ 3D9IA 5ARGA 1NTMD 1MJ0A 5APWA 4GU5A 3UX4A 3SFZA 5C1DA 1KT0A 3CL3D 1V55E 3MV3B 3WMM0 1FE6A 3OA7A 3CHQA 3VP8A 3RK2B 3D9JA 1GK4A 1Q2NA 4RSYA 3RL0D 4NPFX 3CWBE 2WXKA 3H1IG 3J5PA 1NTME 3R2PA 4KZCA 3P32A 1UN9A 2FKWB 4EECA 5ENOD 5BW8C 3RRMB 1KB9E 2JLBA 1FT2A 2QYJA 3RO2A 2CHWA 2JABA 1OMIA 1LT1A 1SA5A 3Q3DA 4AQRD 3FTUA 1W2EA 5BXOA 2AXZA 4WWIA 5FQ4A 2XCCA 2H6IA 3D70A 3FU5A 2GUVA 1H2VC 3MKQB 4J0UA 5M72A 3FX0A 3EHNA 3CCVP 3UT8A 2OVFA 4Y6WA 3FTYA 1SS1A 2ZT9D 2WXJA 4HLLA 3L35A 3UTMA 1KQFB 1QVFO 1NZNA 1KYOE 1S5LE 2CPSA 1NKNA 3ML8A 5LCWC 1NTZJ 3LJ3A 4I1OB 1VQ5P 2ZVNB 1LTGC 3HUSC 4YXWH 3H1HD 1W3BA 5D0OD 3TG5A 2CG3A 4U63A 3FY4A 1FZEA 3PEVB 1OWOA 3G2WA 3CC7P 3DSTA 2V4HC 2H7HA 3AU4A 2M5AB 4O6FA 1USDA 3EIJA 4FLHA 1D7MA 1TNUA 4JPSA 3LIDA 1PC2A 3RRUA 2E0IA 2H6FA 4ZHBA 3E30A 3FUNA 3IF4A 5BXUA 5JA4D 5CJ4A 1TR4A 3HTKA 1JY3N 2NPSC 5C39A 3FUDA 3LKUA 5ENSD 5JJ6A 1FZAA 3FUEA 3CWBG 2YHCA 5KNHD 3CVNA 3T9KA 3P8MC 2J8SD 1LP1A 1A17A 3PH0A 1NTKG 1AA0A 3QARA 2D2CD 1LTSC 2I1JA 4GIFA 2XS8A 3KQGA 2IOSA 2ONDA 3MX3A 4AVXA 1YCSB 4DX2A 1KZPA 4BFRA 5HQ8A 2IDBA 3FHEA 2L9BA 5CBOA 3H1KD 2GROB 2GRNB 4L74A 1NAYA 1VQKP 2L91A 4UWFA 2E5TA 1IJDB 2XKMA 1M56D 1N7SD 1KQLA 5E79E 3MKRA 3H1IJ 3I56P 4OYSA 2LSUA 2OYIA 1HGVA 5EYPF 1OFCX 3H1KE 1Z3XA 4GDOA 1N52A 2CK3H 2OOEA 5KBAA 1S0PA 2AXCA 1T8ZA 2BEDA 2AEJA 2WXIA 1KMIZ 1EQ7A 3GZ1A 3EQ2A 4H44D 1JMBA 2M3BA 1ZP0C 2Z5IA 4XKBA 5AN8A 1XTGB 3HD7C 3RKVA 3ESLA 2YNQA 2W83C 3BG1B 2PM6A 4HLEA 2CG2A 5CCMA 1TNZA 5AVSB 1X9VA 2WZ7A 2GA1A 3CKBA 2LXBA 1N4SA 1OY3D 2Q6QA 4U3FG 5KLVE 3DBSA 2YXRB 4WWOA 5BPPA 3FWNA 1IZNB 1PIXA 3TGUE 3MTUE 3EHRA 4PS7A 5AARA 3G2VA 2WSEH 3FTSA 1N73B 1JUQA 3RK3B 1QBQA 1NHLA 3C3RA 2KP8A 3KXDA 3VLDA 3K9IA 4H0LD 1Z6TA 1ELKA 4I9EA 2IZ0A 1QLED 1GL2A 4J8DA 5B66E 2E74B 1SQPK 3VN0A 4PV1D 5AW6B 4BRYB 1M8OB 1QQEA 2ILRA 4L23A 3UUXA 1SQQK 1LT9C 3B13A 1URQC 4HJGH 2ZYDA 3PREA 3MCXA 1NTKJ 3GF3A 4HRLA 2W27A 3ULEG 3W67A 1Z56A 2VGXA 3SHFA 3OJAB 4NPEA 3LW5J 1NO4A 4HVBA 5B3SE 1SFCA 3PE4A 1AFOA 1UJJA 2QVAA 3HUSA 4WNGA 4WNEA 3R9MA 3TWRA 4YDEA 1MQSA 1JTHA 1Y9BA 5EX0A 3EDTB 5ENQD 3OW2O 3JC22 1VQ8P 2RD0A 2XS1A 4KVMA 5JJTA 4DX7D 1T2KC 1FZCB 1S2EA 3U1AA 3AG3E 5AQ7A 3CVXA 2KSEA 3H1JD 1GU5A 4WY4A 4I17A 1NGMB 3PP5A 3CX5H 5A7DB 1IHBA 2R32A 3OTNA 3QWPA 4GA0A 3APCA 3L70G 3SO8A 3ENEA 1L0LJ 1SQVK 2GRRB 4FA6A 2N1TC 1IFMA 4EHMA 3ZNGA 3F5HA 1SQBD 1BDCA 1KB9H 5AVVB 1H19A 4UB6E 1HH8A 1N4QA 3ASDA 3APDA 2GRPB 3TWWA 1SVXA 1MFZA 2M8RA 1BCCE 4U3FJ 1NTMK 3QWVA 2RKKA 2HODB 3NFQA 2KYVA 3ZXSA 4J6IA 1E8YA 4DZOA 5APYA 4L7TA 1HWTC 4L2YA 1SQBE 3D71A 1L0NE 1Z5SC 4JHJA 4DX5D 1Q2ZA 3BU8A 4YDOA 3QWOC 1UG3A 4C9BB 2ZYAA 2P9IG 3JXIA 4MLPA 3M06A 1LWUC 2KLVA 2NRGA 1JCQA 1N0QA 1KYOH 1S72P 1S5LH 3IAOA 3G2TA 3LDZA 1KC8Q 3PVLA 1PPJE 4EBAG 2IBZE 4UI9J 2B0OE 2R02A 5LFAA 1S4XA 2WVIA 4XE0A 2C9NY 4CT0A 1O1RA 3HG0D 3PRJA 3VLEA 1P84I 4IULA 2FYNC 1BE3E 2LXLA 1K1BA 1NA0A 3L73G 4FADA 1ZRTD 1RE3A 2AJAA 1FOSF 3Q15A 3B5NB 3DXMG 2C0MA 3PZ4A 3PS6A 3PNLB 2XEVA 2JO1A 3OXFA 5C2YA 4C0MA 2Y0CA 3WG7E 4NIKA 3SFXA 4DI4A 1OCCE 4GOEA 5CJ0A 2C9LY 3FU6A 2UWJE 3IN6A 1NA3A 3B4SA 1EZVI 3AE7C 3F6QA 5M1BA 3KD7A 4JHKA 3AEFC 1GL2D 4OWFA 4L2LA 3M9QA 3CVYA 2Z4EA 1YQ4C 3KZIE 2IFUA 3L75E 2HR2A 1NOHA 3Q9NC 4L76A 4JVSA 2A5EA 3MKQA 3IXEA 3G2SA 1S1CX 2ZT9C 2MRIA 4BETA 2I1KA 4AY5A 5FINA 1VPCA 2WSCJ 3LYAA 5AW2B 1N8RQ 5E79H 1OWAA 4D6TD 2IPPA 1ZU2A 1LJ2A 1UJKA 3L74D 3VTPC 4K5CA 2QIWA 5FT9A 2YIUB 1A02J 4GCNA 1SFCD 1RF1C 2V5QC 1JY3P 4Q69A 3TF5A 3ZVVA 3VMAA 1U7JA 2IBZG 1H89A 2A45H 4D6TE 1N4PA 2LXMA 3L71D 5AW8B 2M5AA 2H88C 1HXIA 2X6JA 1QVGO 3PHLA 1BE3G 4LSZE 1NJIQ 4ACKA 2V0PA 3SBSA 5T3RA 1X0TA 3D9LA 4TXQA 2KNCA 1N4RA 1WM5A 2O3JA 1LD7A 2BUGA 1NFIE 1UW4B 2ZISA 1EC5A 2MJZA 2N9BA 4QFVA 2HPCB 2KXPB 3RL0g 2D2CC 3LPZA 3AAAC 2BKGA 4R4LA 5G04J 3AE2C 1IXVA 2ETCA 1KQGB 1MX6A 4XEIG 3MJWA 3GZSA 3TXMA 2I8DA 4GMJA 3L73J 2XZDG 3U3WA 3D6YA 2NC9A 3GW6A 2FFDB 1NU1J 2P58C 1E90A 4LEUA 3L75G 4GA2A 5B66H 3CD6P 4Q94A 1HJ0A 2KZIA 5G55A 1OCZE 2XGSA 2E76B 3CK7A 3Q4AB 1RF0C 2Q5UA 2YKQA 3DXKG 2V7QJ 1K9MQ 2FO7A 3A2AA 3ITKA 2ZXEB 3WXXA 4K3AA 2XENA 1YJ9P 4H44C 3AE1C 3D3MA 1S64A 1FDIA 1LF8A 4JA7A 4ATGA 3TGOA 1IFIA 1PGQA 2YKOA 2QFCA 3O48A 1OUVA 2JKVA 4IFFA 4N3CA 2YO3A 2FBNA 2FF4A 4CGWA 2FEZA 1H6OA 1IFPA 2FXPA 5AW7B 2EIME 1DEEG 4JD2G 3S7FA 2IY0C 3T5XA 2IZ1A 3ZYLA 4M3LA 2CFZA 3ZW3A 3RK2D 3FUFA 4YDYA 1J1DB 3AEAC 3U9WA 3DPDA 5DJUB 1PP9E 2VSOE 1IQUA 1SQXJ 1HG5A 3HYMB 4H0LC 2IQCA 4I9CA 5GTHH 4Y6CA 3MIWA 1N73A 4KT6B 4O60A 2WM9A 3GHGA 1NTZD 2O01J 4O9BA 3M91A 3ABVC 4L75A 4PV1C 2V7QH 1VL2A 1H2TC 4U04A 1BDDA 4F3VA 2E43A 3BCCG 1M1JB 5AVZB 2KCLA 3HRAA 1N2DC 4UB6H 4BXLA 4BRYA 4I6JA 1N54A 4ANUA 2IEJA 4GZDA 4URKA 1NTZE 1EXIA 3CVUA 1UOHA 2KCKA 3CVQA 3QH9A 5CCHA 4AJWA 4G23A 1PAQA 2KC7A 3FH7A 5EYLA 2YIUC 4GOFA 2PGDA 3UIPC 1G3NB 2P10A 1JCRA 4EPZA 1KZOA 4PD4E 1KZUB 5E75A 1H8AA 1SQBK 1AV1A 3H1LJ 5CCGA 3IKOB 1AVOA 1DCEA 3CIAA 3TWUA 4RKUJ 3U1CA 1ZMEC 2WPRA 3ZEFA 2QSIA 1IQRA 1T2KD 3ABKE 1BD8A 2C2LA 4XKCA 1FZCA 4B94A 1CZQA 1SQPE 3L72E 4YVOA 4B86A 3PH0C 4GYOA 3PLNA 4TXPA 3H1ID 1SQQE 1S9KD 1TN6A 4IOIH 1OIPA 2FYUJ 5DIZA 5KCMA 2VTBB 1YBKA 2M0BA 1OWPA 4HXIA 4LNBA 5EILA 1YTZI 4C48B 5BUZA 5KNGA 3C72A 4UQXA 5FWQA 4PS8A 3CXHH 4G26A 1K8KG 2LAIA 4HBDA 3VMYA 3IFMA 3CCQP 4LLHA 3RIBA 1FPPA 1ZOYC 3KZIH 3DEOA 3G6EP 2J9QA 2OYIC 1RW2A 2HODA 4GCOA 2ZXWE 4N78E 3UINC 5KKZB 2NXPA 3CVPA 1YQ3C 1YYHA 4U8YD 1LTJB 1MYOA 1OW8A 3KHUA 4LNUD 4FJZA 4RG6A 3HVEB 2Y4UA 3BCCJ 1TJCA 3VTXA 3SI5A 4NQ0A 4A55A 2H6HA 1T6AA 1VF5B 4HORA 2MKVA 4CEMA 5AW1B 3B7SA 1SQVE 5HS0A 4KXKB 1FZFA 1YIJP 3R7RA 3L08A 2NYJA 4Z1MH 2LXCB 1Y8AA 1TNOA 3ZPJA 2P1JA 3B5NA 4B0ZA 3E34A 1SQPG 2Q7FA 3I3NA 3S7JA 3L72G 4HKZH 2RMZA 3V2NA 3SF4A 3ZYQA 2WXFA 2GRLA 2J07A 1S70B 1SQQG 5GTIE 2QRXA 2VGEA 3G71P 1NTKD 3M0AA 4EZJA 1UIXA 3CVVA 1GL2C 1E8XA 1BGYJ 4YTPC 1Q7YQ 2OCCE 5AJDA 3VMZA 2RH0A 1BSHA 5FQ6A 2E74D 3A0HE 2LAHA 3OAWA 1M1JC 1YTZT 4XA4A 3UQ3A 4DLQA 4HOTA 3TAXA 2A06D 2QM8A 3FXDA 3UPVA 4ANVA 2XV5A 1X22A 4WWNA 1SFCC 2IFMA 3NMDA 2KZJA 3X2QE 3CX5I 3QKYA 2XPIA 2Q7CA 4W9RA 3AECC 3UMVA 2AEFA 1RY3A 3PUKA 4AY6A 5ARFA 2A06E 3LIEA 4GTMA 3N7NA 4JQ0D 4HFGA 4V3IA 5HKPA 1MKMA 5CCGD 2QZAA 3EJNA 4APFA 1L0LD 3FTWA 4MS6A 4C46A 2WTYA 3JUIA 4RG9A 4JYBA 3H1HE 1G2CB 3S4RA 3ONLA 4KBQA 1SQVG 5APVA 2KNCB 2QJPB 4IFMA 2IFNA 4APOA 1E7VA 1JY2N 1L4AB 4WY4C 2CPBA 4HB1A 4U3FD 2P9PG 1N0RA 2J08A 1TEZA 3QDNA 2OV8A 2DIWA 5TISH 2H43A 1L0LE 5H7PA 2XQ0A 4AEZC 1NTMG 2E75B 3TWTA 1JWGA 1FDMA 5B5EE 3MV2B 3OXGA 2BCCJ 2HPCA 3KDPB 2WWWA 1VQNP 1EPUA 4OVUA 5H2FE 4AYCA 3VMXA 1KILB 2XZRA 2X6FA 3MD0A 2Y0DA 3AEDC 4QQIA 3UM0A 5AW0B 2A5UA 5TJHA 3G4SP 2EINE 4KJMA 3QC1A 2Q3IA 2FFDA 2Y1LE 5E76A 2WSEJ 1JMMA 1MZCA 3O6QB 2WT7B 5EIDA 4UWKA 4GTQA 1JNMA 2JJLA 3U66A 3LVRE 1GW6A 3L54A 1R5SA 5ENNA 1H0TB 1VQLP 5KJLA 1YA0A 3LXUX 3E1RA 1PV3A 4M3OA 5AVWB 4Z68A 2QE7H 3PTZA 2OEWA 3MZLB 4GKGA 2J4DA 2WXPA 1YYCA 1IHGA 1OWMA 1EDKA 3EU9A 4I7ZB 1NTZK 1P5QA 3VYIA 4WVZA 4RO0A 3E33A 4GZCA 4PD4H 4PUCA 3V6IA 1RE3C 2DWZA 1ELRA 3RRNB 3C5RA 4JBZA 4U0UA 4U7EB 2WB2A 5KLIB 3RK2C 4HS2A 3B5ND 4ILGA 2R44A 1ZBPA 3HXDA 2ZXXA 4Y28J 2AXVA 4I6MC 2V8SE 3GHGB 4AUWA 1K1AA 2NZ2A 5AW4B 4G8LA 3ZHEB 4I1MA 2WXHA 2OYOA 3HXEA 5CECB 4JL0A 2IYPA 2WQ6A 1J1EB 1QEXA 5B1AE 4U96D 2QG4A 3KS2A 3CCMP 2AW6A 1NYHA 2RKLA 4ASWA 3PZDA 4A1SA 3MUDA 3C9IA 3S2AA 4OGQB 1M1JA 3CWBJ 4IL6H 3LCAA 3ASGA 3GMAA 5EN5D 1MHQA 3NBNB 1A5EA 3PEUB 3PZ1A 3H1KG 5AVYB 3V2QA 1HBWA 2F0YA 4N39A 4GTOA 2K9YA 4C0EA 3CCSP 1GTWA 1JY2O 1MX4A 4KHXA 4F1PA 2A45G 1G1IA 1HX8A 3L16A 3C98A 2WPSA 3SNXA 2VJ8A 5CMWA 2KUBA 4K03A 1E8WA 5KAFE 2DCPA 2H89C 3NZSA 2OTJP 2PP6A 1K8AQ 3CV0A 5ENRD 4GPMA 3L73D 5G05J 3KAEA 5AVUB 3P8CD 3CHRA 1JOCA 1NU1D 1L4AC 2FYZA 5KLVG 1OW7A 3B7UX 3QJZA 5T4YA 3VTYA 1DVPA 3TGUG 3AG4E 2FXMA 1GU4A 1YJNP 2GRQB 3E32A 1HS6A 1JCCA 3NZUA 1SVFA 1GK6A 1KORA 3H1JE 4ZNCA 1KN7A 1LNQA 1E7UA 4DX6D 1E8ZA 1NU1E 3ML9A 2VTBA 1P84D 2K88A 5GTIH 5BT1A 1TNBA 3CC2P 2VSXE 3HXCA 4A1GA 1RE4A 4QMAA 3AE6C 1ZB1A 2QJKB 4PJ0E 2LKMA 4ILHB 1HZ4A 3EIQC 2ETAA 1SQMA 1BLXB 4H7XA 4WWPA 3ABME 1P84E 3EUVA 5KJ7A 3T5VA 2E76D 1EZVD 2ITAA 3SFDC 3LVQE 3M9HA 4AXHA 4U0ZA 2DBAA 1X8YA 1OCRE 1PY1A 1PGOA 2KS1B 3UM2A 4DPRA 4JF7A 1LTJA 5AW3B 3L6AA 2ZYGA 2KBXA 3WU2E 1RHZB 3HVEA 2Y0BG 1EZVE 3TSIA 1SQXD 4H13B 1TU3F 1FT1A 3PNTB 3MYVA 3QK0A 1XNFA 2ZU6B 3CCRP 1ZV8A 4ZKUA 2IF4A 3BRTB 4P29A 1VQPP 1IFJA 5AW9B 5CBNA 4CYMD 5EFWB 2M63A 3W9GA 5JHBA 5KLIC 1JPLA 4K5AB 5CHXA 3ZDMA 3NQPA 3KYQA 4ILIA 2QYUA 1ZRTE 4DJAA 1N73C 3EFGA 3RK3C 3GHGC 2VSNA 3T8KA 5AQBA 5BU5A 5AVQB 3UM1A 3CK8A 2XU6A 3S1KA 5B5EH 5APQA 4A63B 3L9TA 1KD1Q 2E74C 5D66A 4HI9A 1N95A 2IX7C 5H2FH 1L0LK 1PZQA 2M3EA 4L73A 1BCCG 5KLVJ 3IV0A 4O1PA 1NKZB 3TGUJ 2E2EA 4U07A 3H1LD 1WY6A 1LTAC 4X8QA 4F1SA 1MZ9A 5CCHC 1VQ4P 1SQBG 4J8SA 1QGKB 3L70J 1L0NG 3MGBA 4RLYA 3N71A 2KOGA 3CEQA 1YHQP 3V4QA 4AOFA 3LY8A 1SZ9A 5LX8A 3RU0A 3GG2A 1GZLA 1JY2P 1AQTA 4BWRA 1PPJG 4I6EA 5CCGC 1W5CE 3A7OA 1HFAA 4XZ4A 2FYUD 3L74E 1HH0A 3TL5A 3D9KA 3JSVC 4GMRA 2DYRE 1O1TA 4N6JA 3CXHI 4K5BA 3FTZA 4UI9K 1QX8A 5KAIE 3CHMA 3CQGB 1FZCC 4I1AA 1G2CA 2QEXP 1PL5A 2L6BA 4WY4D 4NRHB 2FYUE 1L4AA 1N11A 1IFDA 5D0QD 4Y99B 5ITZF 3L71E 5JHAA 4GZ3A 2P9KG 4UWHA 1HJBA 4NPDA 2UWJG 4AM9A 3TYYA 4HRMB 5AW5B 4DLOA 3CI9A 2WXOA 2RN0A 2IONA 3NOCD 4L9PA 1E79H 3AS4A 3Q5RA 2MHKA 3MZWB 3L17A 1PFIA 1BU9A 4JB8P 1KILA 1IO4A 1FCHA 2SPZA 3ZN3A 4DRXE 1YMPA 4UI9C 3FXEA 4XI0A 2RG8A 2QJKC 3BCCD 1LTXA 2Z5HA 4TRQA 5HI7A 2P9SG 3O6QA 3G2UA 2WT7A 1DD4A 5CRVA 3SWYA 1DCQA 1K3ZD 5CCLA 2GW1A 1OT8A 1H0TA 3WUUA 2HYZA 4OAVB 2X3MA 3DWLG 2UY1B 2WPQA 1H6PA 2L0TB 4MRUA 1BCCJ 5KWDA 2BEQD 1DX7A 3FU3A 3CHOA 2WITA 4D6TG 5K5GB 2QY7A 3Q1MA 1B89A 1T3JA 4M7CA 1BGYD 1RQVA 1VF5D 5KAFH 1L0NJ 1FVHA 3ABLE 4DI3A 3NOGD 3B5NC 1NWQA 3UT4A 5B1BE 2DYSE 3SD5A 4OVVA 4G24A 2K1AA 4BY6A 1UIIA 5JMND 1BGYE 1OVVA 2PRRA 3ZU7B 1EDLA 4DOJA 2YHEA 2EIJE 2HG5D 2MYOA 4H7YA 3HE5B 4CDMA 3FH5A 1M57D 1BE3J 2WSSH 3RK6A 3ZHEA 1HTLC 3HDXA 4PS3A 5EX3A 1FS0E 1Q86Q 3P2BA 4U0SA 4MBGA 1GMJA 3NTNA 3V2OA 2G8YA 4GPKA 3ZFWA 2C0WA 3L37A 3M0DA 4PJ0H 4HQDA 1NU1K 3G3ZA 3UIOC 2J58A 4DX1A 5J08A 3ASHA 3SGHA 2R03A 4CT4A 4E6HA 3FGAD 3AE8C 2W6JH 2OTLP 4YPCA 1EDJA 2QA4P 4RESB 1FZGA 2BEZF 2PAJA 4JYCA 1EXJA 3L75J 2XGOA 2ZAEB 3LJNA 2BTDA 1DC2A 5G04C 3UKRG 5AQ9A 4CGVA 4N5QA 3WU2H 2C0LA 4PH4B 2BCCD 1D8EA 5KJNA 3FU0A 4G2VA 4B93B 3OXLA 2PNNA 2EIKE 1MV8A 2DVWA 2XRZA 5AYWD 2ZJSE 4UB8E 3SFEC 3BG0B 1VDYA 1AP7A 5APTA 4LRZA 4JEUA 4BEPA 1L4AD 1OWNA 1JEKA 2BCCE 1ZXGA 2AXTE 2O1KA 1NVOA 2KXPC 1PP9G 1OVUA 2W6AA 2E75D 5BU8B 2WXNA 2KZTB 3T8MA 3L82A 2VGYA 5A6CA 3I4RB 3L4FA 1KILD 2NPSB 2P2CP 1SQXK 4CCAA 3H1IE 2ZGGA 5BV1A 4TT3H 1S9KE 1FJKA 2FFDC 2J49A 3U64A 2JR8A 5APXA 1WRGA 5CERB 3JQ1A 1IKND 1CI6B 3ISMC 3SWKA 1QZ2A 2ZVOB 2H8PD 4OAUC 3DEPA 3G9RA 1OZHA 1U3DA 3A0BE 2E76C 4CRWA 3MHVA 1NTZG 1ZW0A 2LSVA 1BPOA 2WVRA 4N2QA 1LD8A 3GW4A 2JDIH 3CCEP 4GYYA 3FFLA 3CVLA 5CMZA 2B87B 2F37A 1HGZA 3Q73A 2BKKB 4YVQC 1H0AA 3CQCB 2YXQB 2KS1A 2JWDA 3RJVA 3P7KA 3QB2A 3CCJP 5AIJA 3V4WA 2HM8A 3CSTA 3TG4A 3DSVA 4ASVA 3TNUB 1D8DA 2Q3EA 4BSZB 4XE5B 3AS8A 3B95A 3NF1A 4DJGA 2HE0A 3T97B 3EU5A 4WNFA 3CK9A 5FQ8A 3RAUA 3CX5D 1JUNA 4IRUA 4G1TA 2XZTG 4BTBA 3HD7B 1J1DC 2WXMA 2QC9A 3ZXPA 4E85A 1SW6A 3CWBD 4IL6X 2BF0X 4I2LC 2R59A 3SFYA 3AEBC 1JCDA 4C7RA 3RSEG 3BASA 3VLFA 4BT8A 1WAO1 3I5CA 1YJWP 2ETBA 4CDNA 1JM0A 3RK3D 1BI7B 4W80A 3QWWA 1KB9D 4N3BA 1TYQG 3CX5E 3AS5A 3MUDC 2F8XK 2FYUK 2OEVA 2OTKE 4CZ2D 3JYSA 2I2OA 1N9AA 3WUVA 2B88A 1NTKE 1A02F 2MOWA 2DW3A 2Y9ZA 3CGHA 1Z3YA 1N94A 3RK3E 5FZSA 1E5WA 4OGQD 3CPWO 3AU5A 4JXTA 4TV3A 4KMOA 3PUJA 1PP9J 1FVFA 5CCHD 3D6ZA 4XIFA 4EZLA 5AAOA 2PL2A 2OYHA 3ASFA 3CR3A 1KYOD 4JW1A 3V30A 4U7JA 3C3QA 2P67A 3CKCA 1DNPA
chains in the Genus database with same CATH topology
2RFMA 4U8VD 1MX4A 4K5CA 4F1PA 1FC2C 4DUIA 2V5QC 4UUCA 2KUBA 3UXGA 2FO1E 3TWVA 3JUEA 1U7JA 5ENRD 4F6RD 4GPMA 4O1OA 2M5AA 2B89A 4LSZE 2KIKA 1X0TA 3AJIA 1NFIE 1EC5A 4QFVA 3KEAA 4ZNCA 4DX6D 3AAAC 2BKGA 5ENTD 1IXVA 4ZMDA 2ETCA 4TUMA 1MX6A 2I8DA 4U95D 3V2XA 2XZDG 2ETAA 1BLXB 3V79K 2KZIA 2P58A 2ZGDA 1BI8B 2F8YA 5DJTB 5AQAA 2KS1B 4EYYQ 4J7WA 2KBXA 3UI2A 4K35A 4K3AA 2XENA 2Y0BG 4ATZD 3TWQA 1EDIA 5EIBE 5CBNA 4CYMD 3ZUVB 5EFWB 3ZKJA 3W9GA 1MJ0A 4K5AB 1DEEG 3ZDMA 4YDWA 4YDYA 4GODA 1Q2NA 4NPFX 5DJUB 3T8KA 3J5PA 5AQBA 4A63B 3S1KA 5ENOD 5D66A 4HI9A 4O60A 2QYJA 4MN4C 2JABA 2RFAA 1LT1A 4HRNA 5BXOA 4WWIA 1BDDA 4O1PA 3HRAA 2LR2A 4BXLA 4RLYA 1SS1A 1UOHA 2XEHA 4HLLA 3UTMA 3TWXA 1S3JA 2KI7B 3RGUA 5EYLA 4GOFA 1G3NB 4GMRA 3W9FA 4K5BA 2DZOA 2V4HC 3TWUA 2M5AB 3J5QB 3JXJA 2L6BA 1BD8A 4ZHBA 4G8KA 1N11A 5ITZF 1Y47A 5BXUA 5JA4D 1TR4A 4NPDA 5C39A 4HRMB 5ENSD 3NOCD 5KNHD 4IOIH 3T9KA 2J8SD 1LP1A 2M0BA 3MZWB 3PH0A 2K3RA 5EILA 1BU9A 4JB8P 4C48B 1QYMA 4DRXE 2SPZA 5KNGA 1YMPA 3FXEA 1YCSB 4DX2A 4HBDA 5CBOA 3DEOA 1MX2A 1DCQA 1K3ZD 2B87A 5EYPF 1OT8A 1H0TA 1YYHA 4OAVB 4U8YD 1MYOA 4LNUD 2XEEA 5KWDA 5KBAA 1MFTA 5K5GB 1JMBA 5AN8A 3NOGD 5HS0A 3TWSA 2NYJA 3B7BA 2LXCB 2LXBA 1OY3D 5JMND 1OVVA 3ZU7B 1EDLA 4HKZH 3D9HA 2MYOA 1S70B 3EHRA 3V31A 2QRXA 2VGEA 5AARA 4ZFHA 2Q1KA 3V2OA 4HQDA 5HRYA 4DX1A 4LG6A 3FXDA 2DZNA 4HJGH 1EDJA 4HRLA 1OVRA 4NPEA 2KZJA 2ZAEB 3LJNA 1DC2A 5AQ9A 4N5QA 2QVAA 4J8YA 3TWRA 5HKPA 4BESA 4B93B 2PNNA 2DVWA 5ENQD 3EHQA 1AWCB 2HR3A 1AP7A 4BEPA 4DX7D 5AQ7A 1ZXGA 4HB1A 1N0RA 1NVOA 2KXPC 1OVUA 3TWTA 5ENPD 1IHBA 1LP1B 2P2CP 3SO8A 2ZGGA 4QQIA 3ZNGA 5CERB 1IKND 1BDCA 3TWWA 5CEDB 4OAUC 3DEPA 4KJMA 2Y1LE 1SVXA 3MHVA 3Q9UC 1ZW0A 5CEAA 5EIDA 2B87B 2F37A 4DX5D 3QWOC 2BKKB 1H0TB 3JXIA 1N0QA 4Z68A 2JWDA 3EU9A 1EDKA 4ASVA 2B0OE 4BSZB 3B95A 2DWZA 2HE0A 3C5RA 3HG0D 4JBZA 1K1BA 2XZTG 4HB5A 1WG0A 2QC9A 2AJAA 5FIOA 1SW6A 4BERA 2R44A 2WMMA 4NIKA 2ETBA 1JM0A 1BI7B 4GOEA 2UWJE 4HI8A 1D9SA 1K1AA 4G8LA 3F6QA 2F8XK 5CECB 2OTKE 4CZ2D 2B88A 4U96D 1WDYA 4ASWA 2RKLA 3Q9NC 4CPGA 2A5EA 4HNAD 1U7MA 3IXEA 5AAOA 5EN5D 4BETA 3NBNB 3V30A 1A5EA 5FINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RFM A;  4U8V D;  1MX4 A;  4K5C A;  4F1P A;  1FC2 C;  4DUI A;  2V5Q C;  4UUC A;  2KUB A;  3UXG A;  2FO1 E;  3TWV A;  3JUE A;  1U7J A;  5ENR D;  4F6R D;  4GPM A;  4O1O A;  2M5A A;  2B89 A;  4LSZ E;  2KIK A;  1X0T A;  3AJI A;  1NFI E;  1EC5 A;  4QFV A;  3KEA A;  4ZNC A;  4DX6 D;  3AAA C;  2BKG A;  5ENT D;  1IXV A;  4ZMD A;  2ETC A;  4TUM A;  1MX6 A;  2I8D A;  4U95 D;  3V2X A;  2XZD G;  2ETA A;  1BLX B;  3V79 K;  2KZI A;  2P58 A;  2ZGD A;  1BI8 B;  2F8Y A;  5DJT B;  5AQA A;  2KS1 B;  4EYY Q;  4J7W A;  2KBX A;  3UI2 A;  4K35 A;  4K3A A;  2XEN A;  2Y0B G;  4ATZ D;  3TWQ A;  1EDI A;  5EIB E;  5CBN A;  4CYM D;  3ZUV B;  5EFW B;  3ZKJ A;  3W9G A;  1MJ0 A;  4K5A B;  1DEE G;  3ZDM A;  4YDW A;  4YDY A;  4GOD A;  1Q2N A;  4NPF X;  5DJU B;  3T8K A;  3J5P A;  5AQB A;  4A63 B;  3S1K A;  5ENO D;  5D66 A;  4HI9 A;  4O60 A;  2QYJ A;  4MN4 C;  2JAB A;  2RFA A;  1LT1 A;  4HRN A;  5BXO A;  4WWI A;  1BDD A;  4O1P A;  3HRA A;  2LR2 A;  4BXL A;  4RLY A;  1SS1 A;  1UOH A;  2XEH A;  4HLL A;  3UTM A;  3TWX A;  1S3J A;  2KI7 B;  3RGU A;  5EYL A;  4GOF A;  1G3N B;  4GMR A;  3W9F A;  4K5B A;  2DZO A;  2V4H C;  3TWU A;  2M5A B;  3J5Q B;  3JXJ A;  2L6B A;  1BD8 A;  4ZHB A;  4G8K A;  1N11 A;  5ITZ F;  1Y47 A;  5BXU A;  5JA4 D;  1TR4 A;  4NPD A;  5C39 A;  4HRM B;  5ENS D;  3NOC D;  5KNH D;  4IOI H;  3T9K A;  2J8S D;  1LP1 A;  2M0B A;  3MZW B;  3PH0 A;  2K3R A;  5EIL A;  1BU9 A;  4JB8 P;  4C48 B;  1QYM A;  4DRX E;  2SPZ A;  5KNG A;  1YMP A;  3FXE A;  1YCS B;  4DX2 A;  4HBD A;  5CBO A;  3DEO A;  1MX2 A;  1DCQ A;  1K3Z D;  2B87 A;  5EYP F;  1OT8 A;  1H0T A;  1YYH A;  4OAV B;  4U8Y D;  1MYO A;  4LNU D;  2XEE A;  5KWD A;  5KBA A;  1MFT A;  5K5G B;  1JMB A;  5AN8 A;  3NOG D;  5HS0 A;  3TWS A;  2NYJ A;  3B7B A;  2LXC B;  2LXB A;  1OY3 D;  5JMN D;  1OVV A;  3ZU7 B;  1EDL A;  4HKZ H;  3D9H A;  2MYO A;  1S70 B;  3EHR A;  3V31 A;  2QRX A;  2VGE A;  5AAR A;  4ZFH A;  2Q1K A;  3V2O A;  4HQD A;  5HRY A;  4DX1 A;  4LG6 A;  3FXD A;  2DZN A;  4HJG H;  1EDJ A;  4HRL A;  1OVR A;  4NPE A;  2KZJ A;  2ZAE B;  3LJN A;  1DC2 A;  5AQ9 A;  4N5Q A;  2QVA A;  4J8Y A;  3TWR A;  5HKP A;  4BES A;  4B93 B;  2PNN A;  2DVW A;  5ENQ D;  3EHQ A;  1AWC B;  2HR3 A;  1AP7 A;  4BEP A;  4DX7 D;  5AQ7 A;  1ZXG A;  4HB1 A;  1N0R A;  1NVO A;  2KXP C;  1OVU A;  3TWT A;  5ENP D;  1IHB A;  1LP1 B;  2P2C P;  3SO8 A;  2ZGG A;  4QQI A;  3ZNG A;  5CER B;  1IKN D;  1BDC A;  3TWW A;  5CED B;  4OAU C;  3DEP A;  4KJM A;  2Y1L E;  1SVX A;  3MHV A;  3Q9U C;  1ZW0 A;  5CEA A;  5EID A;  2B87 B;  2F37 A;  4DX5 D;  3QWO C;  2BKK B;  1H0T B;  3JXI A;  1N0Q A;  4Z68 A;  2JWD A;  3EU9 A;  1EDK A;  4ASV A;  2B0O E;  4BSZ B;  3B95 A;  2DWZ A;  2HE0 A;  3C5R A;  3HG0 D;  4JBZ A;  1K1B A;  2XZT G;  4HB5 A;  1WG0 A;  2QC9 A;  2AJA A;  5FIO A;  1SW6 A;  4BER A;  2R44 A;  2WMM A;  4NIK A;  2ETB A;  1JM0 A;  1BI7 B;  4GOE A;  2UWJ E;  4HI8 A;  1D9S A;  1K1A A;  4G8L A;  3F6Q A;  2F8X K;  5CEC B;  2OTK E;  4CZ2 D;  2B88 A;  4U96 D;  1WDY A;  4ASW A;  2RKL A;  3Q9N C;  4CPG A;  2A5E A;  4HNA D;  1U7M A;  3IXE A;  5AAO A;  5EN5 D;  4BET A;  3NBN B;  3V30 A;  1A5E A;  5FIN A; 
#chains in the Genus database with same CATH topology
 5FQ7 A;  2RFM A;  1TN7 A;  3UM3 A;  1Q81 Q;  1LT9 B;  4U8V D;  3I5P A;  1URQ B;  3GZ2 A;  4EBA A;  5FJY A;  2C0X A;  3NXS A;  5FZQ A;  3W68 A;  1OWL A;  4UUC A;  2WSF H;  3Q5M A;  1KB9 I;  3PE3 A;  3TWV A;  3JUE A;  3AG1 E;  3OAK A;  3U59 A;  4KVO A;  1HG2 A;  3V2P A;  2GUS A;  4F6R D;  4O1O A;  3B71 A;  2KB7 P;  2B6C A;  4TXR A;  4C7N A;  4A7P A;  2B89 A;  3ULY A;  1HVV A;  4I6G A;  3AEG C;  2KIK A;  5FZR A;  2IOL A;  4AV7 A;  1KYO I;  3APF A;  4YND A;  5LOZ A;  1WT6 A;  1EDU A;  5JJ7 A;  3CHS A;  5EKQ D;  4U3F E;  4KZ0 A;  1OCO E;  1ZLL A;  4GTV A;  4LCT A;  1FDO A;  4AP2 A;  1RE4 C;  5ENT D;  1S5L X;  1IYG A;  1E96 B;  3A3Y B;  2Q9I A;  4ZMD A;  4GZ5 A;  4TUM A;  3ZRH A;  3S7B A;  2YKP A;  3ZYK A;  3WUT A;  2P2U A;  4U95 D;  4RQI A;  1SQP J;  4LC1 A;  2AVP A;  5KJ7 C;  3L36 A;  3KSL A;  3L72 J;  3CHP A;  4K0R A;  2WXG A;  2N1T B;  1SQQ J;  1TNY A;  1IC2 A;  2H6G A;  2L6J A;  4N2S A;  5KKZ C;  4OH8 B;  1HF8 A;  2I9C A;  4F53 A;  3Q5S A;  2AXU A;  2YNY A;  5BV0 A;  5G2N A;  4FHJ A;  3A5T A;  2YIN A;  1LTJ C;  1MUU A;  1INZ A;  1U3C A;  4GB9 A;  1WMK A;  5APS A;  1LTB C;  2ZGD A;  2P9L G;  1BI8 B;  3HRN A;  3EFF K;  5DJT B;  5AQA A;  2A06 G;  4EYY Q;  2GGF A;  4WUY A;  4J7W A;  4UWG A;  2UY1 A;  3UI2 A;  4K35 A;  3LEW A;  4F7A A;  3Q79 A;  1VF5 C;  4H13 D;  1LWU B;  2KM4 A;  2FY8 A;  2AEM A;  4ATZ D;  4ACL A;  3TWQ A;  3H1H G;  1EDI A;  5EIB E;  1VQM P;  4XFJ A;  1CSB A;  4GA1 A;  4R7L A;  3V2R A;  5KTB A;  2VYI A;  1JO5 A;  4U8H A;  3ZKJ A;  1VQ7 P;  2CHX A;  5KLV D;  3NAW A;  4WBA A;  4UB8 H;  2EIL E;  3ZYM A;  1L0L G;  3TGU D;  3U4T A;  3LS8 A;  4WND A;  2KCV A;  4FC8 A;  1IK9 A;  2FYN B;  3L70 D;  4YDW A;  2J09 A;  2WMO A;  2AXT H;  3ZGQ A;  4GOD A;  3FUK A;  2Y3A A;  3FEX A;  3RL0 B;  2Y9Y A;  3AE9 C;  5AVR B;  3UKU G;  1SQV J;  2YMK A;  3TJP A;  2A45 I;  3HE5 A;  2R2L A;  3UT7 A;  3MA5 A;  4B89 A;  3D9N A;  2R5S A;  3L70 E;  4IFD K;  2JWA A;  4MN4 C;  2RFA A;  3K5B A;  2PQR A;  2WXL A;  3LY9 A;  4HRN A;  1NTM J;  3EHM A;  4GT1 A;  3IEG A;  3UIA A;  1V54 E;  2LR2 A;  1G1J A;  3CC4 P;  3H32 B;  3Q78 A;  3A0B H;  3D9P A;  5BNW A;  1YI2 P;  5IY5 E;  3E1I A;  2XEH A;  4W7Z A;  3URZ A;  2ZFC A;  4FHK A;  4ZKP A;  3FWV A;  2ZT9 B;  3N4X A;  3TWX A;  3AE5 C;  1KTM A;  3FH8 A;  1S3J A;  2FBW C;  2KI7 B;  1SLQ A;  4DCK A;  3RGU A;  4LER A;  2EQX A;  5AVT B;  3KPE A;  1Y8M A;  4B8C B;  4GYW A;  1FZB A;  2W6B A;  2LUH A;  2R3S A;  1Q90 D;  2J4B A;  1RF1 B;  1AQ5 A;  1K04 A;  3E4B A;  3P1U A;  3W9F A;  2R05 A;  1JY3 O;  2QJP C;  2DZO A;  4DK5 A;  4EDF A;  2CHZ A;  4GZ6 A;  2HLO A;  3FEY A;  3J5Q B;  4GTR A;  1X81 A;  3JXJ A;  3KSQ A;  3MGN A;  3H25 A;  2W90 A;  3JQ0 A;  4IYP A;  1U2V G;  2V4H A;  2FXO A;  5AVX B;  2E75 C;  4G8K A;  3C3O A;  4ABN A;  3Q75 A;  3L73 E;  1Y47 A;  1IFN A;  4TUU A;  2WPV B;  3PDN A;  3P8C E;  4JA9 A;  2HO1 A;  2KZT A;  1KIL C;  2PQN A;  3LY7 A;  2WXQ A;  2P9U G;  4ME2 A;  1PGJ A;  5BVZ A;  3B7T A;  3H1H J;  1EYH A;  2LO6 A;  2X6K A;  2K3R A;  2NPS A;  3E7K A;  5GTH E;  2KK7 A;  1QYM A;  2D2C B;  4W7Y A;  1BCC D;  5FTP A;  4JHR A;  3HE4 B;  3A0H H;  3FUH A;  1ZR2 A;  1CI6 A;  1JWF A;  3L22 A;  4B8A A;  2XHE A;  2KAT A;  1Y6I A;  3CMA P;  2XPZ A;  3Q5P A;  3GF7 A;  1CW5 A;  4TLF A;  1L0N D;  3LW5 H;  4BSX A;  1MX2 A;  1OXJ A;  1N7L A;  2K9J B;  1AJY A;  4D10 C;  2FI7 A;  1N7S B;  2B9B A;  3H6P A;  1H2U A;  1NTK K;  4EOT A;  2B87 A;  2J5U A;  3S9O A;  4N3A A;  3RBZ A;  1PPJ D;  2Y0E A;  4I7Z C;  2P9N G;  1KPS B;  2IBZ D;  4I2W A;  2XEE A;  3QAQ A;  1LTI C;  3V5B A;  1RZ4 A;  3USS A;  2L0I A;  1MFT A;  2XGM A;  1L2P A;  3TNU A;  1AVY A;  2W8Z A;  3BRV B;  3H1K J;  1SZA A;  2WXR A;  3F89 A;  1BE3 D;  4H44 B;  3DSS A;  1DEB A;  1SQX E;  3T97 A;  1PGP A;  2XNX A;  3E37 A;  4XI9 A;  1SA4 A;  3TWS A;  2QJY B;  3B7B A;  3DPY A;  4A3V A;  3HD7 A;  1HUC A;  1Q82 Q;  2R5B A;  2OQQ A;  4KT0 J;  2I6H A;  1GD2 E;  4IN3 B;  2XDJ A;  3H1J G;  2WQY C;  5ANR A;  3D9H A;  3CXH D;  1NU1 G;  3RL0 C;  2K37 A;  3V31 A;  4NAC A;  4FUL A;  2KSJ A;  5EDS A;  5A23 A;  1J1E C;  4ZFH A;  3IBE A;  4BT9 A;  1QL1 A;  2JP3 A;  4GTP A;  3L75 D;  2IBZ I;  1K73 Q;  2E42 A;  1ELW A;  2Q1K A;  3M0D C;  4OGQ C;  2V4L A;  4WAF A;  4H0L B;  1HE8 A;  3CXH E;  2OYH B;  3SWF A;  4JPZ B;  5G05 C;  1W2B O;  3VOP A;  4PV1 B;  1HF9 A;  5HRY A;  4LG6 A;  2DZN A;  4PDX A;  2JEE A;  2J59 M;  3H1L E;  3TXN A;  4N5C A;  1UN8 A;  2BAS A;  3SY2 A;  1GW3 A;  3AEE C;  2VRS A;  2IJG X;  1LT9 A;  3BEE A;  1OVR A;  3BQO A;  4ANX A;  3AE3 C;  1URQ A;  3CVW A;  1EZV G;  1J2J B;  3HXB A;  3BVH A;  3DSX A;  2Y69 E;  4J8E A;  3GYZ A;  4JZY A;  4J8Y A;  3EWK A;  4BES A;  1LGH B;  2E5Y A;  3JCU E;  3M9B A;  3SQV A;  4C7N B;  2YQ8 A;  2POH A;  3S7D A;  3EHQ A;  3TK1 A;  1X5B A;  1AWC B;  5LP0 A;  2X6I A;  1SQX G;  2L5G B;  2HR3 A;  4ANW A;  4Q96 A;  2P7J A;  1OW6 A;  5D2M C;  4UQY A;  3JCK C;  5KJM A;  3R9A B;  3CLQ A;  3HTK B;  1VQO P;  1ZN5 A;  3PZ3 A;  2OGU A;  2X6H A;  4UQZ A;  3SZ7 A;  1FJP A;  5ENP D;  4BX9 A;  5APU A;  2PM7 A;  3BUA A;  1U57 A;  5AJL A;  1LP1 B;  3AE4 C;  2NPS D;  5ANL A;  3IHY A;  1L5J A;  2OVB A;  1R5L A;  2X38 A;  3O8Z A;  5KJ7 D;  3R7Q A;  2WSC H;  3NB2 A;  3II6 A;  1HU3 A;  1KLX A;  5CED B;  4GTS A;  2N1T A;  5KLV K;  3DSU A;  3Q9U C;  3H1J J;  1M90 Q;  5CHE E;  5CEA A;  3BCC E;  3RO3 A;  1O1S A;  3B8E B;  4EZK A;  1N7S C;  1SP4 A;  2N9Y B;  3FWL A;  2ZIR A;  3ULQ A;  4AIF A;  3H1L G;  2OYI B;  2R3C A;  3DSW A;  1NP7 A;  3I4G A;  3CCU P;  4H13 C;  4HOS A;  1KFN A;  3L74 G;  3HXF A;  1FBM A;  4MKT A;  3Q2Y A;  1SQB J;  4EIJ A;  2YO2 A;  1NAF A;  1TJF A;  4NUR A;  1H6K A;  5AEN A;  1LWU A;  3ASO E;  1FU1 A;  3AG2 E;  3FUM A;  2WQH A;  2XCB A;  1NL4 A;  1XTC C;  3D9O A;  3QOU A;  4BTA A;  2XPY A;  4J8F A;  2WQ7 A;  2FYU G;  2QJY C;  2YMY A;  4JEH A;  4L1B A;  4OVN F;  1OXZ A;  3L71 G;  3HD7 D;  4FU3 A;  4XX5 A;  2XND H;  4HB5 A;  1WG0 A;  3FTV A;  5FIO A;  3CCL P;  1KT1 A;  1PP9 D;  1RQU A;  1NI1 A;  4I1L A;  4BER A;  3KEZ A;  3O4Z A;  2WMM A;  4I43 A;  1NH4 A;  3SSU A;  5T8I A;  1DD3 A;  1VQ9 P;  3QNK A;  2GM4 A;  5TIS E;  5L8R J;  3FP3 A;  2XRY A;  4BWN A;  1S63 A;  3Q7A A;  4HI8 A;  1D9S A;  2JEK A;  1FOS E;  2IO3 C;  2A4Z A;  3FTX A;  3TDK A;  4A3T A;  2HFE D;  4GML A;  5DBK A;  4CDR A;  5KJK A;  1KFM A;  1GL2 B;  1HO8 A;  1WDY A;  1XGW A;  2OYH C;  3ESK A;  2VQ2 A;  3C8V A;  1GW4 A;  2O01 N;  4CPG A;  1P84 H;  1GDT A;  1EF1 C;  2QM7 A;  4HNA D;  1U7M A;  1ZR4 A;  3H32 A;  4RVB A;  1M7L A;  4WB4 A;  3MP7 B;  1JCS A;  3ONK A;  1N86 A;  2VGX B;  1URQ D;  3GLM A;  1USE A;  4PD4 D;  3D9M A;  3RBX A;  1FC2 C;  4HH2 A;  3L13 A;  4DUI A;  4HYT B;  4EI2 A;  1SFC B;  4LGD E;  1RH5 B;  2FUL A;  3UXG A;  1LTT C;  2FO1 E;  2IYO A;  3HUS B;  3CME P;  4BX8 A;  3VP9 A;  1DIP A;  1JTH B;  2PZI A;  2IO2 C;  1RF1 A;  4I2Z A;  2PFX A;  1KQS O;  3ASN E;  3PZ2 A;  1L0N K;  1SQP D;  4Y99 C;  4EQF A;  1M1K Q;  3L72 D;  3BAT A;  4GAA A;  4HOU A;  1BGY G;  2IU1 A;  2LNI A;  3R4Y A;  1SQQ D;  4D6T J;  5CRU A;  4KYO B;  1X79 B;  1O5M A;  3HIZ A;  1IK7 A;  3Q7F A;  4FP7 A;  3L74 J;  3AJI A;  4YXD C;  4G25 A;  2WPV A;  2O01 H;  5LCW J;  4WY4 B;  3I55 P;  3B7R L;  4UWL A;  1YIT P;  3KEA A;  2OAR A;  4R4M A;  2Y4T A;  3IHV A;  1K05 A;  4LUN U;  3Q47 B;  4HOQ A;  4PD4 I;  1FAV A;  1T3U A;  3PJS K;  4JC8 A;  3L71 J;  3V2X A;  3HE4 A;  1OX3 A;  1KIL E;  5CMY A;  2CFU A;  4FLB A;  2N1T D;  4N78 D;  4G11 A;  1H88 A;  4LNG A;  2KLU A;  2R5D A;  3Q49 B;  1TN8 A;  4IL6 E;  2WMN A;  1QL2 A;  3SBT B;  3V79 K;  4GTT A;  2GRM A;  2K9J A;  2V5F A;  3IR9 A;  2P58 A;  3CLJ A;  1N7S A;  1JB0 J;  1VQ6 P;  5J90 A;  1DH3 A;  3FDH A;  2F8Y A;  3DRA A;  3FUI A;  1VDF A;  1R8E A;  2G3A A;  4RJT A;  2R17 C;  3ZIM A;  1RF0 A;  3PRZ A;  1QNF A;  1SQV D;  3C1L A;  4FJY A;  4N3Y B;  3CSF A;  5KAI H;  2AWI A;  2VSY A;  1BSN A;  2HYN A;  3JCU H;  1KV4 A;  3HHM A;  3ZUV B;  4DT0 A;  3FUL A;  2O1J A;  3MEK A;  2BCC G;  2NSZ A;  3FUJ A;  2WSF J;  3D9I A;  5ARG A;  1NTM D;  1MJ0 A;  5APW A;  4GU5 A;  3UX4 A;  3SFZ A;  5C1D A;  1KT0 A;  3CL3 D;  1V55 E;  3MV3 B;  3WMM 0;  1FE6 A;  3OA7 A;  3CHQ A;  3VP8 A;  3RK2 B;  3D9J A;  1GK4 A;  1Q2N A;  4RSY A;  3RL0 D;  4NPF X;  3CWB E;  2WXK A;  3H1I G;  3J5P A;  1NTM E;  3R2P A;  4KZC A;  3P32 A;  1UN9 A;  2FKW B;  4EEC A;  5ENO D;  5BW8 C;  3RRM B;  1KB9 E;  2JLB A;  1FT2 A;  2QYJ A;  3RO2 A;  2CHW A;  2JAB A;  1OMI A;  1LT1 A;  1SA5 A;  3Q3D A;  4AQR D;  3FTU A;  1W2E A;  5BXO A;  2AXZ A;  4WWI A;  5FQ4 A;  2XCC A;  2H6I A;  3D70 A;  3FU5 A;  2GUV A;  1H2V C;  3MKQ B;  4J0U A;  5M72 A;  3FX0 A;  3EHN A;  3CCV P;  3UT8 A;  2OVF A;  4Y6W A;  3FTY A;  1SS1 A;  2ZT9 D;  2WXJ A;  4HLL A;  3L35 A;  3UTM A;  1KQF B;  1QVF O;  1NZN A;  1KYO E;  1S5L E;  2CPS A;  1NKN A;  3ML8 A;  5LCW C;  1NTZ J;  3LJ3 A;  4I1O B;  1VQ5 P;  2ZVN B;  1LTG C;  3HUS C;  4YXW H;  3H1H D;  1W3B A;  5D0O D;  3TG5 A;  2CG3 A;  4U63 A;  3FY4 A;  1FZE A;  3PEV B;  1OWO A;  3G2W A;  3CC7 P;  3DST A;  2V4H C;  2H7H A;  3AU4 A;  2M5A B;  4O6F A;  1USD A;  3EIJ A;  4FLH A;  1D7M A;  1TNU A;  4JPS A;  3LID A;  1PC2 A;  3RRU A;  2E0I A;  2H6F A;  4ZHB A;  3E30 A;  3FUN A;  3IF4 A;  5BXU A;  5JA4 D;  5CJ4 A;  1TR4 A;  3HTK A;  1JY3 N;  2NPS C;  5C39 A;  3FUD A;  3LKU A;  5ENS D;  5JJ6 A;  1FZA A;  3FUE A;  3CWB G;  2YHC A;  5KNH D;  3CVN A;  3T9K A;  3P8M C;  2J8S D;  1LP1 A;  1A17 A;  3PH0 A;  1NTK G;  1AA0 A;  3QAR A;  2D2C D;  1LTS C;  2I1J A;  4GIF A;  2XS8 A;  3KQG A;  2IOS A;  2OND A;  3MX3 A;  4AVX A;  1YCS B;  4DX2 A;  1KZP A;  4BFR A;  5HQ8 A;  2IDB A;  3FHE A;  2L9B A;  5CBO A;  3H1K D;  2GRO B;  2GRN B;  4L74 A;  1NAY A;  1VQK P;  2L91 A;  4UWF A;  2E5T A;  1IJD B;  2XKM A;  1M56 D;  1N7S D;  1KQL A;  5E79 E;  3MKR A;  3H1I J;  3I56 P;  4OYS A;  2LSU A;  2OYI A;  1HGV A;  5EYP F;  1OFC X;  3H1K E;  1Z3X A;  4GDO A;  1N52 A;  2CK3 H;  2OOE A;  5KBA A;  1S0P A;  2AXC A;  1T8Z A;  2BED A;  2AEJ A;  2WXI A;  1KMI Z;  1EQ7 A;  3GZ1 A;  3EQ2 A;  4H44 D;  1JMB A;  2M3B A;  1ZP0 C;  2Z5I A;  4XKB A;  5AN8 A;  1XTG B;  3HD7 C;  3RKV A;  3ESL A;  2YNQ A;  2W83 C;  3BG1 B;  2PM6 A;  4HLE A;  2CG2 A;  5CCM A;  1TNZ A;  5AVS B;  1X9V A;  2WZ7 A;  2GA1 A;  3CKB A;  2LXB A;  1N4S A;  1OY3 D;  2Q6Q A;  4U3F G;  5KLV E;  3DBS A;  2YXR B;  4WWO A;  5BPP A;  3FWN A;  1IZN B;  1PIX A;  3TGU E;  3MTU E;  3EHR A;  4PS7 A;  5AAR A;  3G2V A;  2WSE H;  3FTS A;  1N73 B;  1JUQ A;  3RK3 B;  1QBQ A;  1NHL A;  3C3R A;  2KP8 A;  3KXD A;  3VLD A;  3K9I A;  4H0L D;  1Z6T A;  1ELK A;  4I9E A;  2IZ0 A;  1QLE D;  1GL2 A;  4J8D A;  5B66 E;  2E74 B;  1SQP K;  3VN0 A;  4PV1 D;  5AW6 B;  4BRY B;  1M8O B;  1QQE A;  2ILR A;  4L23 A;  3UUX A;  1SQQ K;  1LT9 C;  3B13 A;  1URQ C;  4HJG H;  2ZYD A;  3PRE A;  3MCX A;  1NTK J;  3GF3 A;  4HRL A;  2W27 A;  3ULE G;  3W67 A;  1Z56 A;  2VGX A;  3SHF A;  3OJA B;  4NPE A;  3LW5 J;  1NO4 A;  4HVB A;  5B3S E;  1SFC A;  3PE4 A;  1AFO A;  1UJJ A;  2QVA A;  3HUS A;  4WNG A;  4WNE A;  3R9M A;  3TWR A;  4YDE A;  1MQS A;  1JTH A;  1Y9B A;  5EX0 A;  3EDT B;  5ENQ D;  3OW2 O;  3JC2 2;  1VQ8 P;  2RD0 A;  2XS1 A;  4KVM A;  5JJT A;  4DX7 D;  1T2K C;  1FZC B;  1S2E A;  3U1A A;  3AG3 E;  5AQ7 A;  3CVX A;  2KSE A;  3H1J D;  1GU5 A;  4WY4 A;  4I17 A;  1NGM B;  3PP5 A;  3CX5 H;  5A7D B;  1IHB A;  2R32 A;  3OTN A;  3QWP A;  4GA0 A;  3APC A;  3L70 G;  3SO8 A;  3ENE A;  1L0L J;  1SQV K;  2GRR B;  4FA6 A;  2N1T C;  1IFM A;  4EHM A;  3ZNG A;  3F5H A;  1SQB D;  1BDC A;  1KB9 H;  5AVV B;  1H19 A;  4UB6 E;  1HH8 A;  1N4Q A;  3ASD A;  3APD A;  2GRP B;  3TWW A;  1SVX A;  1MFZ A;  2M8R A;  1BCC E;  4U3F J;  1NTM K;  3QWV A;  2RKK A;  2HOD B;  3NFQ A;  2KYV A;  3ZXS A;  4J6I A;  1E8Y A;  4DZO A;  5APY A;  4L7T A;  1HWT C;  4L2Y A;  1SQB E;  3D71 A;  1L0N E;  1Z5S C;  4JHJ A;  4DX5 D;  1Q2Z A;  3BU8 A;  4YDO A;  3QWO C;  1UG3 A;  4C9B B;  2ZYA A;  2P9I G;  3JXI A;  4MLP A;  3M06 A;  1LWU C;  2KLV A;  2NRG A;  1JCQ A;  1N0Q A;  1KYO H;  1S72 P;  1S5L H;  3IAO A;  3G2T A;  3LDZ A;  1KC8 Q;  3PVL A;  1PPJ E;  4EBA G;  2IBZ E;  4UI9 J;  2B0O E;  2R02 A;  5LFA A;  1S4X A;  2WVI A;  4XE0 A;  2C9N Y;  4CT0 A;  1O1R A;  3HG0 D;  3PRJ A;  3VLE A;  1P84 I;  4IUL A;  2FYN C;  1BE3 E;  2LXL A;  1K1B A;  1NA0 A;  3L73 G;  4FAD A;  1ZRT D;  1RE3 A;  2AJA A;  1FOS F;  3Q15 A;  3B5N B;  3DXM G;  2C0M A;  3PZ4 A;  3PS6 A;  3PNL B;  2XEV A;  2JO1 A;  3OXF A;  5C2Y A;  4C0M A;  2Y0C A;  3WG7 E;  4NIK A;  3SFX A;  4DI4 A;  1OCC E;  4GOE A;  5CJ0 A;  2C9L Y;  3FU6 A;  2UWJ E;  3IN6 A;  1NA3 A;  3B4S A;  1EZV I;  3AE7 C;  3F6Q A;  5M1B A;  3KD7 A;  4JHK A;  3AEF C;  1GL2 D;  4OWF A;  4L2L A;  3M9Q A;  3CVY A;  2Z4E A;  1YQ4 C;  3KZI E;  2IFU A;  3L75 E;  2HR2 A;  1NOH A;  3Q9N C;  4L76 A;  4JVS A;  2A5E A;  3MKQ A;  3IXE A;  3G2S A;  1S1C X;  2ZT9 C;  2MRI A;  4BET A;  2I1K A;  4AY5 A;  5FIN A;  1VPC A;  2WSC J;  3LYA A;  5AW2 B;  1N8R Q;  5E79 H;  1OWA A;  4D6T D;  2IPP A;  1ZU2 A;  1LJ2 A;  1UJK A;  3L74 D;  3VTP C;  4K5C A;  2QIW A;  5FT9 A;  2YIU B;  1A02 J;  4GCN A;  1SFC D;  1RF1 C;  2V5Q C;  1JY3 P;  4Q69 A;  3TF5 A;  3ZVV A;  3VMA A;  1U7J A;  2IBZ G;  1H89 A;  2A45 H;  4D6T E;  1N4P A;  2LXM A;  3L71 D;  5AW8 B;  2M5A A;  2H88 C;  1HXI A;  2X6J A;  1QVG O;  3PHL A;  1BE3 G;  4LSZ E;  1NJI Q;  4ACK A;  2V0P A;  3SBS A;  5T3R A;  1X0T A;  3D9L A;  4TXQ A;  2KNC A;  1N4R A;  1WM5 A;  2O3J A;  1LD7 A;  2BUG A;  1NFI E;  1UW4 B;  2ZIS A;  1EC5 A;  2MJZ A;  2N9B A;  4QFV A;  2HPC B;  2KXP B;  3RL0 g;  2D2C C;  3LPZ A;  3AAA C;  2BKG A;  4R4L A;  5G04 J;  3AE2 C;  1IXV A;  2ETC A;  1KQG B;  1MX6 A;  4XEI G;  3MJW A;  3GZS A;  3TXM A;  2I8D A;  4GMJ A;  3L73 J;  2XZD G;  3U3W A;  3D6Y A;  2NC9 A;  3GW6 A;  2FFD B;  1NU1 J;  2P58 C;  1E90 A;  4LEU A;  3L75 G;  4GA2 A;  5B66 H;  3CD6 P;  4Q94 A;  1HJ0 A;  2KZI A;  5G55 A;  1OCZ E;  2XGS A;  2E76 B;  3CK7 A;  3Q4A B;  1RF0 C;  2Q5U A;  2YKQ A;  3DXK G;  2V7Q J;  1K9M Q;  2FO7 A;  3A2A A;  3ITK A;  2ZXE B;  3WXX A;  4K3A A;  2XEN A;  1YJ9 P;  4H44 C;  3AE1 C;  3D3M A;  1S64 A;  1FDI A;  1LF8 A;  4JA7 A;  4ATG A;  3TGO A;  1IFI A;  1PGQ A;  2YKO A;  2QFC A;  3O48 A;  1OUV A;  2JKV A;  4IFF A;  4N3C A;  2YO3 A;  2FBN A;  2FF4 A;  4CGW A;  2FEZ A;  1H6O A;  1IFP A;  2FXP A;  5AW7 B;  2EIM E;  1DEE G;  4JD2 G;  3S7F A;  2IY0 C;  3T5X A;  2IZ1 A;  3ZYL A;  4M3L A;  2CFZ A;  3ZW3 A;  3RK2 D;  3FUF A;  4YDY A;  1J1D B;  3AEA C;  3U9W A;  3DPD A;  5DJU B;  1PP9 E;  2VSO E;  1IQU A;  1SQX J;  1HG5 A;  3HYM B;  4H0L C;  2IQC A;  4I9C A;  5GTH H;  4Y6C A;  3MIW A;  1N73 A;  4KT6 B;  4O60 A;  2WM9 A;  3GHG A;  1NTZ D;  2O01 J;  4O9B A;  3M91 A;  3ABV C;  4L75 A;  4PV1 C;  2V7Q H;  1VL2 A;  1H2T C;  4U04 A;  1BDD A;  4F3V A;  2E43 A;  3BCC G;  1M1J B;  5AVZ B;  2KCL A;  3HRA A;  1N2D C;  4UB6 H;  4BXL A;  4BRY A;  4I6J A;  1N54 A;  4ANU A;  2IEJ A;  4GZD A;  4URK A;  1NTZ E;  1EXI A;  3CVU A;  1UOH A;  2KCK A;  3CVQ A;  3QH9 A;  5CCH A;  4AJW A;  4G23 A;  1PAQ A;  2KC7 A;  3FH7 A;  5EYL A;  2YIU C;  4GOF A;  2PGD A;  3UIP C;  1G3N B;  2P10 A;  1JCR A;  4EPZ A;  1KZO A;  4PD4 E;  1KZU B;  5E75 A;  1H8A A;  1SQB K;  1AV1 A;  3H1L J;  5CCG A;  3IKO B;  1AVO A;  1DCE A;  3CIA A;  3TWU A;  4RKU J;  3U1C A;  1ZME C;  2WPR A;  3ZEF A;  2QSI A;  1IQR A;  1T2K D;  3ABK E;  1BD8 A;  2C2L A;  4XKC A;  1FZC A;  4B94 A;  1CZQ A;  1SQP E;  3L72 E;  4YVO A;  4B86 A;  3PH0 C;  4GYO A;  3PLN A;  4TXP A;  3H1I D;  1SQQ E;  1S9K D;  1TN6 A;  4IOI H;  1OIP A;  2FYU J;  5DIZ A;  5KCM A;  2VTB B;  1YBK A;  2M0B A;  1OWP A;  4HXI A;  4LNB A;  5EIL A;  1YTZ I;  4C48 B;  5BUZ A;  5KNG A;  3C72 A;  4UQX A;  5FWQ A;  4PS8 A;  3CXH H;  4G26 A;  1K8K G;  2LAI A;  4HBD A;  3VMY A;  3IFM A;  3CCQ P;  4LLH A;  3RIB A;  1FPP A;  1ZOY C;  3KZI H;  3DEO A;  3G6E P;  2J9Q A;  2OYI C;  1RW2 A;  2HOD A;  4GCO A;  2ZXW E;  4N78 E;  3UIN C;  5KKZ B;  2NXP A;  3CVP A;  1YQ3 C;  1YYH A;  4U8Y D;  1LTJ B;  1MYO A;  1OW8 A;  3KHU A;  4LNU D;  4FJZ A;  4RG6 A;  3HVE B;  2Y4U A;  3BCC J;  1TJC A;  3VTX A;  3SI5 A;  4NQ0 A;  4A55 A;  2H6H A;  1T6A A;  1VF5 B;  4HOR A;  2MKV A;  4CEM A;  5AW1 B;  3B7S A;  1SQV E;  5HS0 A;  4KXK B;  1FZF A;  1YIJ P;  3R7R A;  3L08 A;  2NYJ A;  4Z1M H;  2LXC B;  1Y8A A;  1TNO A;  3ZPJ A;  2P1J A;  3B5N A;  4B0Z A;  3E34 A;  1SQP G;  2Q7F A;  3I3N A;  3S7J A;  3L72 G;  4HKZ H;  2RMZ A;  3V2N A;  3SF4 A;  3ZYQ A;  2WXF A;  2GRL A;  2J07 A;  1S70 B;  1SQQ G;  5GTI E;  2QRX A;  2VGE A;  3G71 P;  1NTK D;  3M0A A;  4EZJ A;  1UIX A;  3CVV A;  1GL2 C;  1E8X A;  1BGY J;  4YTP C;  1Q7Y Q;  2OCC E;  5AJD A;  3VMZ A;  2RH0 A;  1BSH A;  5FQ6 A;  2E74 D;  3A0H E;  2LAH A;  3OAW A;  1M1J C;  1YTZ T;  4XA4 A;  3UQ3 A;  4DLQ A;  4HOT A;  3TAX A;  2A06 D;  2QM8 A;  3FXD A;  3UPV A;  4ANV A;  2XV5 A;  1X22 A;  4WWN A;  1SFC C;  2IFM A;  3NMD A;  2KZJ A;  3X2Q E;  3CX5 I;  3QKY A;  2XPI A;  2Q7C A;  4W9R A;  3AEC C;  3UMV A;  2AEF A;  1RY3 A;  3PUK A;  4AY6 A;  5ARF A;  2A06 E;  3LIE A;  4GTM A;  3N7N A;  4JQ0 D;  4HFG A;  4V3I A;  5HKP A;  1MKM A;  5CCG D;  2QZA A;  3EJN A;  4APF A;  1L0L D;  3FTW A;  4MS6 A;  4C46 A;  2WTY A;  3JUI A;  4RG9 A;  4JYB A;  3H1H E;  1G2C B;  3S4R A;  3ONL A;  4KBQ A;  1SQV G;  5APV A;  2KNC B;  2QJP B;  4IFM A;  2IFN A;  4APO A;  1E7V A;  1JY2 N;  1L4A B;  4WY4 C;  2CPB A;  4HB1 A;  4U3F D;  2P9P G;  1N0R A;  2J08 A;  1TEZ A;  3QDN A;  2OV8 A;  2DIW A;  5TIS H;  2H43 A;  1L0L E;  5H7P A;  2XQ0 A;  4AEZ C;  1NTM G;  2E75 B;  3TWT A;  1JWG A;  1FDM A;  5B5E E;  3MV2 B;  3OXG A;  2BCC J;  2HPC A;  3KDP B;  2WWW A;  1VQN P;  1EPU A;  4OVU A;  5H2F E;  4AYC A;  3VMX A;  1KIL B;  2XZR A;  2X6F A;  3MD0 A;  2Y0D A;  3AED C;  4QQI A;  3UM0 A;  5AW0 B;  2A5U A;  5TJH A;  3G4S P;  2EIN E;  4KJM A;  3QC1 A;  2Q3I A;  2FFD A;  2Y1L E;  5E76 A;  2WSE J;  1JMM A;  1MZC A;  3O6Q B;  2WT7 B;  5EID A;  4UWK A;  4GTQ A;  1JNM A;  2JJL A;  3U66 A;  3LVR E;  1GW6 A;  3L54 A;  1R5S A;  5ENN A;  1H0T B;  1VQL P;  5KJL A;  1YA0 A;  3LXU X;  3E1R A;  1PV3 A;  4M3O A;  5AVW B;  4Z68 A;  2QE7 H;  3PTZ A;  2OEW A;  3MZL B;  4GKG A;  2J4D A;  2WXP A;  1YYC A;  1IHG A;  1OWM A;  1EDK A;  3EU9 A;  4I7Z B;  1NTZ K;  1P5Q A;  3VYI A;  4WVZ A;  4RO0 A;  3E33 A;  4GZC A;  4PD4 H;  4PUC A;  3V6I A;  1RE3 C;  2DWZ A;  1ELR A;  3RRN B;  3C5R A;  4JBZ A;  4U0U A;  4U7E B;  2WB2 A;  5KLI B;  3RK2 C;  4HS2 A;  3B5N D;  4ILG A;  2R44 A;  1ZBP A;  3HXD A;  2ZXX A;  4Y28 J;  2AXV A;  4I6M C;  2V8S E;  3GHG B;  4AUW A;  1K1A A;  2NZ2 A;  5AW4 B;  4G8L A;  3ZHE B;  4I1M A;  2WXH A;  2OYO A;  3HXE A;  5CEC B;  4JL0 A;  2IYP A;  2WQ6 A;  1J1E B;  1QEX A;  5B1A E;  4U96 D;  2QG4 A;  3KS2 A;  3CCM P;  2AW6 A;  1NYH A;  2RKL A;  4ASW A;  3PZD A;  4A1S A;  3MUD A;  3C9I A;  3S2A A;  4OGQ B;  1M1J A;  3CWB J;  4IL6 H;  3LCA A;  3ASG A;  3GMA A;  5EN5 D;  1MHQ A;  3NBN B;  1A5E A;  3PEU B;  3PZ1 A;  3H1K G;  5AVY B;  3V2Q A;  1HBW A;  2F0Y A;  4N39 A;  4GTO A;  2K9Y A;  4C0E A;  3CCS P;  1GTW A;  1JY2 O;  1MX4 A;  4KHX A;  4F1P A;  2A45 G;  1G1I A;  1HX8 A;  3L16 A;  3C98 A;  2WPS A;  3SNX A;  2VJ8 A;  5CMW A;  2KUB A;  4K03 A;  1E8W A;  5KAF E;  2DCP A;  2H89 C;  3NZS A;  2OTJ P;  2PP6 A;  1K8A Q;  3CV0 A;  5ENR D;  4GPM A;  3L73 D;  5G05 J;  3KAE A;  5AVU B;  3P8C D;  3CHR A;  1JOC A;  1NU1 D;  1L4A C;  2FYZ A;  5KLV G;  1OW7 A;  3B7U X;  3QJZ A;  5T4Y A;  3VTY A;  1DVP A;  3TGU G;  3AG4 E;  2FXM A;  1GU4 A;  1YJN P;  2GRQ B;  3E32 A;  1HS6 A;  1JCC A;  3NZU A;  1SVF A;  1GK6 A;  1KOR A;  3H1J E;  4ZNC A;  1KN7 A;  1LNQ A;  1E7U A;  4DX6 D;  1E8Z A;  1NU1 E;  3ML9 A;  2VTB A;  1P84 D;  2K88 A;  5GTI H;  5BT1 A;  1TNB A;  3CC2 P;  2VSX E;  3HXC A;  4A1G A;  1RE4 A;  4QMA A;  3AE6 C;  1ZB1 A;  2QJK B;  4PJ0 E;  2LKM A;  4ILH B;  1HZ4 A;  3EIQ C;  2ETA A;  1SQM A;  1BLX B;  4H7X A;  4WWP A;  3ABM E;  1P84 E;  3EUV A;  5KJ7 A;  3T5V A;  2E76 D;  1EZV D;  2ITA A;  3SFD C;  3LVQ E;  3M9H A;  4AXH A;  4U0Z A;  2DBA A;  1X8Y A;  1OCR E;  1PY1 A;  1PGO A;  2KS1 B;  3UM2 A;  4DPR A;  4JF7 A;  1LTJ A;  5AW3 B;  3L6A A;  2ZYG A;  2KBX A;  3WU2 E;  1RHZ B;  3HVE A;  2Y0B G;  1EZV E;  3TSI A;  1SQX D;  4H13 B;  1TU3 F;  1FT1 A;  3PNT B;  3MYV A;  3QK0 A;  1XNF A;  2ZU6 B;  3CCR P;  1ZV8 A;  4ZKU A;  2IF4 A;  3BRT B;  4P29 A;  1VQP P;  1IFJ A;  5AW9 B;  5CBN A;  4CYM D;  5EFW B;  2M63 A;  3W9G A;  5JHB A;  5KLI C;  1JPL A;  4K5A B;  5CHX A;  3ZDM A;  3NQP A;  3KYQ A;  4ILI A;  2QYU A;  1ZRT E;  4DJA A;  1N73 C;  3EFG A;  3RK3 C;  3GHG C;  2VSN A;  3T8K A;  5AQB A;  5BU5 A;  5AVQ B;  3UM1 A;  3CK8 A;  2XU6 A;  3S1K A;  5B5E H;  5APQ A;  4A63 B;  3L9T A;  1KD1 Q;  2E74 C;  5D66 A;  4HI9 A;  1N95 A;  2IX7 C;  5H2F H;  1L0L K;  1PZQ A;  2M3E A;  4L73 A;  1BCC G;  5KLV J;  3IV0 A;  4O1P A;  1NKZ B;  3TGU J;  2E2E A;  4U07 A;  3H1L D;  1WY6 A;  1LTA C;  4X8Q A;  4F1S A;  1MZ9 A;  5CCH C;  1VQ4 P;  1SQB G;  4J8S A;  1QGK B;  3L70 J;  1L0N G;  3MGB A;  4RLY A;  3N71 A;  2KOG A;  3CEQ A;  1YHQ P;  3V4Q A;  4AOF A;  3LY8 A;  1SZ9 A;  5LX8 A;  3RU0 A;  3GG2 A;  1GZL A;  1JY2 P;  1AQT A;  4BWR A;  1PPJ G;  4I6E A;  5CCG C;  1W5C E;  3A7O A;  1HFA A;  4XZ4 A;  2FYU D;  3L74 E;  1HH0 A;  3TL5 A;  3D9K A;  3JSV C;  4GMR A;  2DYR E;  1O1T A;  4N6J A;  3CXH I;  4K5B A;  3FTZ A;  4UI9 K;  1QX8 A;  5KAI E;  3CHM A;  3CQG B;  1FZC C;  4I1A A;  1G2C A;  2QEX P;  1PL5 A;  2L6B A;  4WY4 D;  4NRH B;  2FYU E;  1L4A A;  1N11 A;  1IFD A;  5D0Q D;  4Y99 B;  5ITZ F;  3L71 E;  5JHA A;  4GZ3 A;  2P9K G;  4UWH A;  1HJB A;  4NPD A;  2UWJ G;  4AM9 A;  3TYY A;  4HRM B;  5AW5 B;  4DLO A;  3CI9 A;  2WXO A;  2RN0 A;  2ION A;  3NOC D;  4L9P A;  1E79 H;  3AS4 A;  3Q5R A;  2MHK A;  3MZW B;  3L17 A;  1PFI A;  1BU9 A;  4JB8 P;  1KIL A;  1IO4 A;  1FCH A;  2SPZ A;  3ZN3 A;  4DRX E;  1YMP A;  4UI9 C;  3FXE A;  4XI0 A;  2RG8 A;  2QJK C;  3BCC D;  1LTX A;  2Z5H A;  4TRQ A;  5HI7 A;  2P9S G;  3O6Q A;  3G2U A;  2WT7 A;  1DD4 A;  5CRV A;  3SWY A;  1DCQ A;  1K3Z D;  5CCL A;  2GW1 A;  1OT8 A;  1H0T A;  3WUU A;  2HYZ A;  4OAV B;  2X3M A;  3DWL G;  2UY1 B;  2WPQ A;  1H6P A;  2L0T B;  4MRU A;  1BCC J;  5KWD A;  2BEQ D;  1DX7 A;  3FU3 A;  3CHO A;  2WIT A;  4D6T G;  5K5G B;  2QY7 A;  3Q1M A;  1B89 A;  1T3J A;  4M7C A;  1BGY D;  1RQV A;  1VF5 D;  5KAF H;  1L0N J;  1FVH A;  3ABL E;  4DI3 A;  3NOG D;  3B5N C;  1NWQ A;  3UT4 A;  5B1B E;  2DYS E;  3SD5 A;  4OVV A;  4G24 A;  2K1A A;  4BY6 A;  1UII A;  5JMN D;  1BGY E;  1OVV A;  2PRR A;  3ZU7 B;  1EDL A;  4DOJ A;  2YHE A;  2EIJ E;  2HG5 D;  2MYO A;  4H7Y A;  3HE5 B;  4CDM A;  3FH5 A;  1M57 D;  1BE3 J;  2WSS H;  3RK6 A;  3ZHE A;  1HTL C;  3HDX A;  4PS3 A;  5EX3 A;  1FS0 E;  1Q86 Q;  3P2B A;  4U0S A;  4MBG A;  1GMJ A;  3NTN A;  3V2O A;  2G8Y A;  4GPK A;  3ZFW A;  2C0W A;  3L37 A;  3M0D A;  4PJ0 H;  4HQD A;  1NU1 K;  3G3Z A;  3UIO C;  2J58 A;  4DX1 A;  5J08 A;  3ASH A;  3SGH A;  2R03 A;  4CT4 A;  4E6H A;  3FGA D;  3AE8 C;  2W6J H;  2OTL P;  4YPC A;  1EDJ A;  2QA4 P;  4RES B;  1FZG A;  2BEZ F;  2PAJ A;  4JYC A;  1EXJ A;  3L75 J;  2XGO A;  2ZAE B;  3LJN A;  2BTD A;  1DC2 A;  5G04 C;  3UKR G;  5AQ9 A;  4CGV A;  4N5Q A;  3WU2 H;  2C0L A;  4PH4 B;  2BCC D;  1D8E A;  5KJN A;  3FU0 A;  4G2V A;  4B93 B;  3OXL A;  2PNN A;  2EIK E;  1MV8 A;  2DVW A;  2XRZ A;  5AYW D;  2ZJS E;  4UB8 E;  3SFE C;  3BG0 B;  1VDY A;  1AP7 A;  5APT A;  4LRZ A;  4JEU A;  4BEP A;  1L4A D;  1OWN A;  1JEK A;  2BCC E;  1ZXG A;  2AXT E;  2O1K A;  1NVO A;  2KXP C;  1PP9 G;  1OVU A;  2W6A A;  2E75 D;  5BU8 B;  2WXN A;  2KZT B;  3T8M A;  3L82 A;  2VGY A;  5A6C A;  3I4R B;  3L4F A;  1KIL D;  2NPS B;  2P2C P;  1SQX K;  4CCA A;  3H1I E;  2ZGG A;  5BV1 A;  4TT3 H;  1S9K E;  1FJK A;  2FFD C;  2J49 A;  3U64 A;  2JR8 A;  5APX A;  1WRG A;  5CER B;  3JQ1 A;  1IKN D;  1CI6 B;  3ISM C;  3SWK A;  1QZ2 A;  2ZVO B;  2H8P D;  4OAU C;  3DEP A;  3G9R A;  1OZH A;  1U3D A;  3A0B E;  2E76 C;  4CRW A;  3MHV A;  1NTZ G;  1ZW0 A;  2LSV A;  1BPO A;  2WVR A;  4N2Q A;  1LD8 A;  3GW4 A;  2JDI H;  3CCE P;  4GYY A;  3FFL A;  3CVL A;  5CMZ A;  2B87 B;  2F37 A;  1HGZ A;  3Q73 A;  2BKK B;  4YVQ C;  1H0A A;  3CQC B;  2YXQ B;  2KS1 A;  2JWD A;  3RJV A;  3P7K A;  3QB2 A;  3CCJ P;  5AIJ A;  3V4W A;  2HM8 A;  3CST A;  3TG4 A;  3DSV A;  4ASV A;  3TNU B;  1D8D A;  2Q3E A;  4BSZ B;  4XE5 B;  3AS8 A;  3B95 A;  3NF1 A;  4DJG A;  2HE0 A;  3T97 B;  3EU5 A;  4WNF A;  3CK9 A;  5FQ8 A;  3RAU A;  3CX5 D;  1JUN A;  4IRU A;  4G1T A;  2XZT G;  4BTB A;  3HD7 B;  1J1D C;  2WXM A;  2QC9 A;  3ZXP A;  4E85 A;  1SW6 A;  3CWB D;  4IL6 X;  2BF0 X;  4I2L C;  2R59 A;  3SFY A;  3AEB C;  1JCD A;  4C7R A;  3RSE G;  3BAS A;  3VLF A;  4BT8 A;  1WAO 1;  3I5C A;  1YJW P;  2ETB A;  4CDN A;  1JM0 A;  3RK3 D;  1BI7 B;  4W80 A;  3QWW A;  1KB9 D;  4N3B A;  1TYQ G;  3CX5 E;  3AS5 A;  3MUD C;  2F8X K;  2FYU K;  2OEV A;  2OTK E;  4CZ2 D;  3JYS A;  2I2O A;  1N9A A;  3WUV A;  2B88 A;  1NTK E;  1A02 F;  2MOW A;  2DW3 A;  2Y9Z A;  3CGH A;  1Z3Y A;  1N94 A;  3RK3 E;  5FZS A;  1E5W A;  4OGQ D;  3CPW O;  3AU5 A;  4JXT A;  4TV3 A;  4KMO A;  3PUJ A;  1PP9 J;  1FVF A;  5CCH D;  3D6Z A;  4XIF A;  4EZL A;  5AAO A;  2PL2 A;  2OYH A;  3ASF A;  3CR3 A;  1KYO D;  4JW1 A;  3V30 A;  4U7J A;  3C3Q A;  2P67 A;  3CKC A;  1DNP A; 
#chains in the Genus database with same CATH homology
 2RFM A;  4U8V D;  1MX4 A;  4K5C A;  4F1P A;  1FC2 C;  4DUI A;  2V5Q C;  4UUC A;  2KUB A;  3UXG A;  2FO1 E;  3TWV A;  3JUE A;  1U7J A;  5ENR D;  4F6R D;  4GPM A;  4O1O A;  2M5A A;  2B89 A;  4LSZ E;  2KIK A;  1X0T A;  3AJI A;  1NFI E;  1EC5 A;  4QFV A;  3KEA A;  4ZNC A;  4DX6 D;  3AAA C;  2BKG A;  5ENT D;  1IXV A;  4ZMD A;  2ETC A;  4TUM A;  1MX6 A;  2I8D A;  4U95 D;  3V2X A;  2XZD G;  2ETA A;  1BLX B;  3V79 K;  2KZI A;  2P58 A;  2ZGD A;  1BI8 B;  2F8Y A;  5DJT B;  5AQA A;  2KS1 B;  4EYY Q;  4J7W A;  2KBX A;  3UI2 A;  4K35 A;  4K3A A;  2XEN A;  2Y0B G;  4ATZ D;  3TWQ A;  1EDI A;  5EIB E;  5CBN A;  4CYM D;  3ZUV B;  5EFW B;  3ZKJ A;  3W9G A;  1MJ0 A;  4K5A B;  1DEE G;  3ZDM A;  4YDW A;  4YDY A;  4GOD A;  1Q2N A;  4NPF X;  5DJU B;  3T8K A;  3J5P A;  5AQB A;  4A63 B;  3S1K A;  5ENO D;  5D66 A;  4HI9 A;  4O60 A;  2QYJ A;  4MN4 C;  2JAB A;  2RFA A;  1LT1 A;  4HRN A;  5BXO A;  4WWI A;  1BDD A;  4O1P A;  3HRA A;  2LR2 A;  4BXL A;  4RLY A;  1SS1 A;  1UOH A;  2XEH A;  4HLL A;  3UTM A;  3TWX A;  1S3J A;  2KI7 B;  3RGU A;  5EYL A;  4GOF A;  1G3N B;  4GMR A;  3W9F A;  4K5B A;  2DZO A;  2V4H C;  3TWU A;  2M5A B;  3J5Q B;  3JXJ A;  2L6B A;  1BD8 A;  4ZHB A;  4G8K A;  1N11 A;  5ITZ F;  1Y47 A;  5BXU A;  5JA4 D;  1TR4 A;  4NPD A;  5C39 A;  4HRM B;  5ENS D;  3NOC D;  5KNH D;  4IOI H;  3T9K A;  2J8S D;  1LP1 A;  2M0B A;  3MZW B;  3PH0 A;  2K3R A;  5EIL A;  1BU9 A;  4JB8 P;  4C48 B;  1QYM A;  4DRX E;  2SPZ A;  5KNG A;  1YMP A;  3FXE A;  1YCS B;  4DX2 A;  4HBD A;  5CBO A;  3DEO A;  1MX2 A;  1DCQ A;  1K3Z D;  2B87 A;  5EYP F;  1OT8 A;  1H0T A;  1YYH A;  4OAV B;  4U8Y D;  1MYO A;  4LNU D;  2XEE A;  5KWD A;  5KBA A;  1MFT A;  5K5G B;  1JMB A;  5AN8 A;  3NOG D;  5HS0 A;  3TWS A;  2NYJ A;  3B7B A;  2LXC B;  2LXB A;  1OY3 D;  5JMN D;  1OVV A;  3ZU7 B;  1EDL A;  4HKZ H;  3D9H A;  2MYO A;  1S70 B;  3EHR A;  3V31 A;  2QRX A;  2VGE A;  5AAR A;  4ZFH A;  2Q1K A;  3V2O A;  4HQD A;  5HRY A;  4DX1 A;  4LG6 A;  3FXD A;  2DZN A;  4HJG H;  1EDJ A;  4HRL A;  1OVR A;  4NPE A;  2KZJ A;  2ZAE B;  3LJN A;  1DC2 A;  5AQ9 A;  4N5Q A;  2QVA A;  4J8Y A;  3TWR A;  5HKP A;  4BES A;  4B93 B;  2PNN A;  2DVW A;  5ENQ D;  3EHQ A;  1AWC B;  2HR3 A;  1AP7 A;  4BEP A;  4DX7 D;  5AQ7 A;  1ZXG A;  4HB1 A;  1N0R A;  1NVO A;  2KXP C;  1OVU A;  3TWT A;  5ENP D;  1IHB A;  1LP1 B;  2P2C P;  3SO8 A;  2ZGG A;  4QQI A;  3ZNG A;  5CER B;  1IKN D;  1BDC A;  3TWW A;  5CED B;  4OAU C;  3DEP A;  4KJM A;  2Y1L E;  1SVX A;  3MHV A;  3Q9U C;  1ZW0 A;  5CEA A;  5EID A;  2B87 B;  2F37 A;  4DX5 D;  3QWO C;  2BKK B;  1H0T B;  3JXI A;  1N0Q A;  4Z68 A;  2JWD A;  3EU9 A;  1EDK A;  4ASV A;  2B0O E;  4BSZ B;  3B95 A;  2DWZ A;  2HE0 A;  3C5R A;  3HG0 D;  4JBZ A;  1K1B A;  2XZT G;  4HB5 A;  1WG0 A;  2QC9 A;  2AJA A;  5FIO A;  1SW6 A;  4BER A;  2R44 A;  2WMM A;  4NIK A;  2ETB A;  1JM0 A;  1BI7 B;  4GOE A;  2UWJ E;  4HI8 A;  1D9S A;  1K1A A;  4G8L A;  3F6Q A;  2F8X K;  5CEC B;  2OTK E;  4CZ2 D;  2B88 A;  4U96 D;  1WDY A;  4ASW A;  2RKL A;  3Q9N C;  4CPG A;  2A5E A;  4HNA D;  1U7M A;  3IXE A;  5AAO A;  5EN5 D;  4BET A;  3NBN B;  3V30 A;  1A5E A;  5FIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...