5CBNA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus with chemical cross-linker ey-cbs
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
molecule keywords Maltose-binding periplasmic protein
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cbnA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cbnA01
4MN4C 3T9KA 5CBOA 4BETA 4NPFX 2DWZA 4LG6A 3ZU7B 2RFAA 2XENA 1SS1A 3NOCD 3TWXA 4CPGA 4ATZD 2B87B 2LXBA 1A5EA 2M5AA 3C5RA 4OAUC 1UOHA 2KXPC 2R44A 2VGEA 2Y1LE 3B95A 5HS0A 3TWWA 4HB5A 1OVRA 2BKKB 5KWDA 2KUBA 1MFTA 5KNGA 2I8DA 2F37A 2ETBA 4K5BA 2B89A 3J5QB 3TWSA 2Q1KA 2QVAA 5ENTD 4HI9A 3T8KA 2WMMA 1QYMA 3DEPA 2DVWA 4EYYQ 3AAAC 2SPZA 3ZNGA 4U8YD 2PNNA 1BLXB 4ZFHA 2ETCA 4HI8A 4ZMDA 4HRMB 3RGUA 2OTKE 4GOFA 1OT8A 3TWUA 3EHRA 1WG0A 4ASWA 5DJTB 4JB8P 1N0QA 4QFVA 4GOEA 1DCQA 2KIKA 5AQ9A 5FIOA 3V31A 4DX2A 4WWIA 2V4HC 5JMND 3TWQA 3UXGA 5DJUB 1H0TA 5CEDB 3F6QA 5JA4D 4K5AB 3FXDA 3LJNA 1G3NB 5ENPD 4YDWA 3Q9UC 5HKPA 4HBDA 5EYPF 2K3RA 2F8XK 2KS1B 4B93B 2KZJA 2DZOA 1OVUA 3AJIA 1YCSB 2Y0BG 1MJ0A 4HKZH 2NYJA 5EN5D 4ZNCA 3ZUVB 4F6RD 2LR2A 2HE0A 2KBXA 1LP1B 1SVXA 1MX2A 3JXIA 3PH0A 2HR3A 5AAOA 2KI7B 2L6BA 1LP1A 4BEPA 4DRXE 2LXCB 1BI8B 3TWRA 3SO8A 4C48B 3MZWB 3NBNB 1IXVA 5D66A 4GMRA 2UWJE 4ASVA 2M0BA 4U96D 4F1PA 4IOIH 1YYHA 2XZTG 4LSZE 5ENRD 4DX7D 5EIBE 1DC2A 2A5EA 1BDDA 1JM0A 1EC5A 1H0TB 2MYOA 2QC9A 1ZXGA 4K5CA 2V5QC 4TUMA 5AQBA 4J7WA 2ZAEB 4HLLA 1U7JA 5AARA 2P58A 5HRYA 2ZGDA 2AJAA 2JWDA 2KZIA 2XEEA 3V30A 2P2CP 4Z68A 3W9FA 5CERB 5KBAA 4K3AA 5KNHD 4DUIA 1SW6A 1N0RA 1BI7B 5C39A 4N5QA 1AWCB 3QWOC 3HG0D 4JBZA 1LT1A 4J8YA 4UUCA 4NPEA 5AN8A 4A63B 4QQIA 5ITZF 1WDYA 2DZNA 1EDIA 3UI2A 5CEAA 1Y47A 2M5AB 3V2XA 5EIDA 2ZGGA 3EU9A 4O60A 1BD8A 4U95D 4G8LA 4BERA 1N11A 2F8YA 4CYMD 2BKGA 3ZKJA 3EHQA 5CBNA 5EILA 4HJGH 3DEOA 4CZ2D 4OAVB 3ZDMA 2ETAA 2QYJA 4HNAD 4GPMA 3B7BA 1EDLA 1FC2C 1Q2NA 1MYOA 3KEAA 4NIKA 1IKND 4BSZB 1EDJA 5ENOD 2JABA 3UTMA 1ZW0A 4K35A 5FINA 2XZDG 2B0OE 5BXOA 3W9GA 1EDKA 4GODA 3IXEA 1S70B 3J5PA 3FXEA 3HRAA 4G8KA 1MX4A 5EFWB 3D9HA 1YMPA 1MX6A 3V79K 4LNUD 3JUEA 2B87A 1IHBA 1X0TA 4RLYA 4U8VD 4KJMA 1DEEG 3V2OA 2B88A 2QRXA 5AQAA 1D9SA 2RFMA 4HQDA 3TWTA 3S1KA 3NOGD 3MHVA 1S3JA 4DX5D 1AP7A 5BXUA 2RKLA 5AQ7A 4HRNA 2XEHA 4O1PA 5ENQD 4O1OA 4ZHBA 1U7MA 5CECB 4DX1A 1BU9A 1K3ZD 4BXLA 3Q9NC 5K5GB 1BDCA 1OY3D 4HRLA 5ENSD 2FO1E 4NPDA 3TWVA 5EYLA 4BESA 1K1BA 1NFIE 4YDYA 2J8SD 3JXJA 4DX6D 1K1AA 1NVOA 4HB1A 1JMBA 1TR4A 1OVVA
chains in the Genus database with same CATH superfamily
2PM6A 3CEQA 4XZ4A 1SS1A 3FU3A 1FDIA 1QX8A 2VJ8A 2LNIA 3PTZA 4OAUC 4MBGA 2VGEA 3B95A 3TWWA 1OVRA 2A06D 1MFTA 2E76D 4WY4D 3DSXA 3SFYA 1GTWA 1JEKA 2H6IA 1PAQA 2IY0C 4MRUA 3APCA 3CHQA 4PJ0H 2PNNA 1N7SD 1RE3C 1HS6A 4L76A 3CV0A 4H44B 1KPSB 4WWPA 2WSEH 1T3UA 2NRGA 5C2YA 3USSA 2WPVA 3F6QA 4AV7A 2ZT9D 2FI7A 3LW5J 3B7UX 3Q1MA 2DZOA 1OVUA 2NSZA 1WMKA 1X79B 3LPZA 5AW2B 4BSXA 3RK3D 5FQ8A 4I1LA 1YQ4C 3H1KG 4WBAA 3CX5E 1NZNA 4OH8B 4WVZA 5AAOA 5CMYA 2KLUA 1JY3P 3A2AA 1Q2ZA 3L9TA 3U4TA 4N3AA 1NKNA 4M3OA 3MIWA 2M3BA 2VSNA 3RL0D 2Y0CA 2UWJE 2M0BA 3APFA 1E96B 4ZKUA 2XZTG 3H1HJ 5ENRD 1M1JB 4U8HA 3KS2A 1FZAA 1U7JA 3V30A 3LKUA 3V2PA 1EXJA 3JQ0A 3UUXA 4K3AA 1S64A 3B7RL 3H1KD 3BATA 3RO3A 1JWFA 4Q96A 3PE4A 3LEWA 1YYCA 4U95D 4G8LA 2IX7C 1WT6A 1N7SC 3DEOA 1FS0E 4HNAD 1WAO1 4V3IA 3CX5I 3D71A 1MYOA 4N2QA 4I2WA 5BNWA 1EDKA 3BRVB 3HRAA 3I5CA 4U3FJ 3NF1A 3QNKA 5KAIH 1DEEG 5APVA 5B1AE 4OVNF 1ELKA 2RD0A 5HI7A 4J8DA 1KILD 2YIUB 4HRNA 1XTCC 2KNCA 2YXRB 4EZKA 1ZRTE 1L0LD 1BDCA 1S0PA 4IL6H 2H7HA 4BESA 3TGUD 3DBSA 2J8SD 3H1JG 3SFDC 5AVTB 3L71D 3TG4A 3R7QA 1BCCD 5HQ8A 1QZ2A 3H1KE 3T8MA 1VQ5P 2KC7A 3LJ3A 5JHBA 2V5FA 4NRHB 1LTJB 2FY8A 3V5BA 1H0AA 1OCRE 5KNGA 1VQMP 1QBQA 3MD0A 3VTPC 2NPSC 2VYIA 4G1TA 5AJLA 4UI9K 4U8YD 3E33A 1RZ4A 3L74E 3TL5A 2FYUD 3AS8A 2NPSA 1DH3A 3E37A 3QOUA 4KT0J 5IY5E 2WWWA 2J4BA 3E30A 4DX2A 4RKUJ 4DCKA 3FXDA 1S1CX 1CI6A 2E75D 1EF1C 2QJKC 1OWMA 3ZHEB 5APWA 1SZAA 1MJ0A 4HKZH 1D7MA 4ZNCA 2J49A 1KILC 3JXIA 5KLVE 4DPRA 1R8EA 2KOGA 1O1TA 1BCCJ 5ENNA 4I6EA 4U96D 4Y28J 1YYHA 3HD7D 2D2CD 2RMZA 2BUGA 3SSUA 2A06E 1DX7A 2YKOA 4HS2A 3SWYA 2XPIA 2R3SA 4PV1B 5KTBA 2XS1A 4N39A 3RK2D 2WXFA 1R5LA 1S4XA 4K0RA 3A0BE 2GUSA 4UUCA 2PAJA 4A63B 4PD4I 1YTZI 2K1AA 2Q3IA 3Q79A 2V4LA 5TJHA 4I1AA 1TYQG 4W80A 1N9AA 2LKMA 1UIIA 4JC8A 1SQQG 1CI6B 3AE5C 3TYYA 1EZVG 1V55E 2ZU6B 1SQPG 3B13A 4PUCA 1JCRA 3S9OA 1N4QA 4K35A 2IO2C 1H2UA 3BG0B 4GZCA 4I2LC 4G8KA 2ZXWE 4LEUA 5LP0A 2OOEA 1SQVK 3TJPA 3V2OA 1NTZK 4FA6A 3CC4P 5EX0A 2KZTA 2RKLA 1SQQD 1VQ7P 1K3ZD 3L6AA 4APOA 1G2CA 3CXHE 1J1EC 4YVOA 5D0QD 3JXJA 1U2VG 3AE4C 3T9KA 4PD4D 3L54A 1GDTA 1MZCA 3DSUA 3G2WA 2PQRA 3FUEA 1NGMB 4H0LB 4RO0A 3LY9A 2PM7A 2IFNA 1AJYA 2JKVA 2KXPC 1JY3N 4L75A 5D0OD 3AS4A 2WXOA 1O5MA 1KYOE 1SZ9A 4OGQB 2GA1A 2YHEA 4L9PA 1IZNB 5AJDA 2WPQA 2WQ7A 2QVAA 4J0UA 5BU8B 1KQSO 1HH8A 1HGVA 2YIUC 3L71J 3ZN3A 3T97A 5H2FE 3RO2A 3RBXA 3PZ3A 4ZMDA 1FVHA 2KXPB 3SNXA 3D70A 2KIKA 1QGKB 4APFA 4WWIA 2B9BA 3CCLP 2KP8A 3RL0B 4WAFA 3CXHI 2ZT9C 2R02A 5D2MC 3M91A 2P9PG 1Q90D 2KS1B 1P84H 3L74G 2WXIA 2WXNA 2FFDC 4FLHA 4JHKA 4U0SA 3HD7B 3II6A 4AM9A 2Z5IA 2IOLA 4GIFA 1LTJC 2POHA 5CRUA 2HR3A 3OJAB 1N7SB 2FFDA 4WNEA 2LXCB 2MOWA 3X2QE 3RL0C 1KC8Q 2K9YA 3L70E 1KB9D 4ASVA 2A5UA 1SFCD 2HO1A 3QWWA 1ZMEC 1KYOH 4HOSA 1JM0A 2KK7A 2PL2A 3L74D 2XGMA 3D3MA 2AXTE 2WSFJ 2JWDA 2XEEA 3M06A 3D9IA 1IK7A 2WSEJ 1AWCB 2WQ6A 2ZYDA 5AW1B 3AEGC 1J1EB 1WDYA 2MJZA 5CEAA 2IFUA 2M8RA 3L72E 3RJVA 4GTTA 5FZRA 4FADA 4DZOA 1IJDB 1E8ZA 1Z3XA 4XE0A 2AWIA 1LT9B 4OAVB 4K5BA 1OWNA 2V8SE 1K04A 1BCCE 4DT0A 4KT6B 1FZGA 1SQBG 2FKWB 3Q5RA 3L70D 1RF1C 4U07A 3MGNA 4GODA 1U3CA 1L0LE 3W67A 1ZRTD 3F89A 4C0MA 1IC2A 2ILRA 1X9VA 1YJNP 3A0HH 3QKYA 1VQ9P 2QSIA 2G8YA 3U66A 3CHMA 3SHFA 2PRRA 2WXHA 2Y9ZA 1YHQP 5AQ7A 3U1CA 2XEHA 4DX1A 2EIJE 4A55A 1SFCC 1GU4A 4LLHA 1K1AA 3C1LA 5CCGD 3QB2A 4JW1A 3RIBA 1DEBA 2FBWC 3ML8A 1NL4A 2R5BA 3ZYLA 4GAAA 4CPGA 3LIEA 4IL6E 3EFGA 1GL2A 4UI9J 4ACKA 4FU3A 1KZUB 2P9UG 3FTVA 2BKKB 5JJTA 2FF4A 1MQSA 5JJ7A 1N4SA 1KFMA 2CG3A 3TNUA 3L72J 4GCNA 2XEVA 3RK6A 1Z56A 3EHMA 4U3FG 4EIJA 2XPZA 3EIQC 3RRNB 4ZKPA 2FULA 4PD4E 3JCUE 1N0QA 3N4XA 1CW5A 3RL0g 3CCVP 4C7NA 1NO4A 3MJWA 2XV5A 1G3NB 3RBZA 1VDYA 3G9RA 1UIXA 2KZJA 1VL2A 3MEKA 3H1LD 2WXJA 2KSEA 3M0DA 1AVOA 4P29A 3H6PA 3DSSA 2Q3EA 1Y8MA 2F0YA 2AEJA 2QJYC 1YTZT 5APXA 5KLVJ 4C48B 3MZWB 2L0IA 2GRQB 2W8ZA 1TN6A 5CCGC 3FUKA 1FZCA 3TNUB 3JCUH 2P9KG 3CCMP 5AARA 1JTHA 1SVFA 4Z68A 2WM9A 2WXQA 4JL0A 4I7ZB 1J1DB 1HG2A 3PVLA 1L4AB 3SD5A 1DD3A 3GF7A 4NPEA 2W6BA 3AEDC 3G6EP 2KSJA 5KAFH 1OXZA 4YTPC 2H89C 3SWFA 2EIME 5AVWB 3H32A 1OCOE 3NZSA 1SQVJ 2QYJA 1S5LX 3CVYA 5FTPA 4ACLA 2L91A 4IFDK 5LCWC 1PP9E 3IXEA 1GU5A 1MV8A 3P2BA 4CGWA 1HE8A 2DBAA 4ANXA 1FDOA 3OA7A 2XGOA 3NB2A 2K9JA 5KLVD 3JC22 3CVQA 2L0TB 3Q47B 1BE3J 2HG5D 2M63A 4N6JA 4CDNA 4UQZA 2OEVA 1N52A 3UPVA 4ANUA 1RE4A 3ZIMA 3H1KJ 4LG6A 4YPCA 3KPEA 3FTWA 4HORA 4B86A 3CGHA 1PGOA 1DIPA 1FOSF 1JWGA 4HB5A 3ABVC 1P5QA 1SQPJ 3CCQP 1L0LG 1NTKJ 2ETBA 4FJZA 2WXLA 1VPCA 2JO1A 3CLJA 5FQ6A 3ZNGA 4HH2A 5FZQA 2O1KA 1LF8A 1LTGC 5C1DA 2J4DA 1SQVE 4XKBA 2DIWA 5KJ7C 2IBZD 1YITP 3TWUA 2ONDA 5EX3A 1N7SA 3L71E 2FFDB 2IF4A 2HODA 3D6YA 2H6FA 5CEDB 1M7LA 2QEXP 5KJ7A 3GG2A 1T8ZA 1U3DA 3E1RA 1MUUA 1KILE 4R4MA 2UWJG 1O1RA 2Y0BG 1VQ8P 5EN5D 2L6JA 3UQ3A 2BCCG 1X8YA 1MX2A 3ZEFA 3FUFA 2L6BA 3A0BH 2PGDA 1NU1D 1O1SA 3SO8A 1NTMJ 3APDA 2JWAA 5D66A 2WXKA 3NAWA 1YQ3C 2E76B 3WUUA 3FU5A 3Q2YA 4GU5A 3A0HE 1AQ5A 2QC9A 3BCCD 2OYIC 1H2VC 5B1BE 1JOCA 4ZFHA 1V54E 1PP9G 5AW9B 5HRYA 2IO3C 4RVBA 2GRMA 4DUIA 1SW6A 1N0RA 3ONKA 5E79E 3ENEA 3H1JJ 1LTBC 1OFCX 3ZW3A 4B8CB 4L23A 4IN3B 3L75D 1NH4A 1GL2D 3NFQA 1HWTC 4MLPA 4DK5A 4JEHA 3EFFK 2BKGA 4TXPA 4IYPA 4QMAA 1NHLA 2VSXE 5KJ7D 1E8XA 2N1TA 5G04C 4AP2A 4ANVA 1Q7YQ 3CXHH 1YIJP 2FXPA 1E8WA 1MX4A 1TU3F 4XFJA 5KCMA 1JUQA 1VQ4P 4KXKB 2MKVA 2XS8A 4UB6H 5FT9A 2HODB 1SQXD 2QRXA 2IEJA 4A7PA 4PD4H 2Y4TA 1LTTC 3CHPA 3UX4A 2ZFCA 1ELRA 3RSEG 1FE6A 2W6JH 1KB9H 4BTAA 1E5WA 2H43A 2XENA 2V7QJ 3MKQA 1VQKP 5BV0A 2W27A 5AW7B 4KVMA 2N1TB 2WT7B 2X3MA 4HOTA 2IYOA 4A3TA 4XEIG 4G2VA 2Q1KA 3QARA 3BEEA 4HI9A 5CRVA 2HM8A 3B8EB 1NTKE 2IZ1A 2I9CA 2CHXA 3FTUA 5LFAA 4ME2A 1LT9A 4G23A 2XGSA 3FH7A 3ULYA 3GZSA 1SQXJ 1TN8A 4JD2G 5DJUB 5CHXA 3LJNA 2Y0EA 1D8DA 3SZ7A 4H13B 1VDFA 2WSSH 2CHWA 3AJIA 4DJAA 2NXPA 5DBKA 2UY1B 2BEQD 3ONLA 4L7TA 1FDMA 4NQ0A 2EQXA 1HTLC 2WMNA 1X5BA 1B89A 2AXTH 3ESLA 3LDZA 2XQ0A 5FQ4A 2WSCJ 3CHOA 3E4BA 4DX7D 1RF1B 3VYIA 1ZR4A 1H0TB 1RE4C 3ITKA 2GW1A 1EZVI 5FQ7A 2VGXA 3W9FA 3TK1A 2WB2A 1TN7A 4ANWA 4DJGA 4JF7A 4F7AA 4J8YA 3KSLA 3TXNA 3LW5H 3CWBG 2GROB 3CVNA 2VQ2A 3FY4A 2P7JA 3M0AA 3QJZA 1KZOA 5AVQB 4L1BA 3V2NA 4TRQA 2JLBA 3QC1A 1S5LE 4Y99B 4RG6A 4GTQA 4GPMA 2CPSA 5BU5A 2JABA 1HX8A 3QDNA 3UTMA 3L73E 1TNUA 3TGUG 4ATGA 3H1JD 3FXEA 1SQMA 1BCCG 4PS3A 3FP3A 4CGVA 3CWBD 4N2SA 2CFUA 4F1SA 1Z5SC 2X6HA 4M7CA 1D9SA 3P1UA 4BY6A 3I3NA 3FWVA 1SA5A 1JCSA 5AW4B 1S3JA 3OW2O 3FEYA 1OWOA 5ENQD 1YJ9P 2H6HA 3RK2B 5K5GB 4HRLA 3CVUA 3JCKC 3O8ZA 2X6KA 1KQFB 3GHGA 2C9LY 2OTLP 3G2UA 3Q78A 2V0PA 3FWLA 3CVVA 2KZTB 3AE1C 4PDXA 1P84D 2ZXEB 1P84I 1E7UA 4GTOA 2QZAA 4UB8H 3H1HG 3BRTB 2QA4P 1QL2A 1H6KA 3M9BA 3V2RA 1BGYE 2XRYA 4GYOA 3ULEG 4AJWA 1FT2A 1JCQA 1IQRA 5KLIC 3HE4A 2AVPA 2HFED 2H88C 2OTKE 2QJKB 3G2TA 3I5PA 4GTSA 4EECA 1AP7A 4GOEA 1HF8A 3TWQA 3L73J 3L37A 1J1DC 3VP9A 4LNBA 5ENPD 3D9PA 1RF0C 2DCPA 2L5GB 3ISMC 3FH8A 2WPVB 4KYOB 3CCSP 1JPLA 2LR2A 1AVYA 3HRNA 3KSQA 4RESB 1Y6IA 1N4PA 1DVPA 1OMIA 4I7ZC 2A45G 3TF5A 1S2EA 1RHZB 1IFDA 3LY7A 4WWNA 5T8IA 3TSIA 5KLIB 1EQ7A 5AQBA 1ZXGA 5JA4D 3KXDA 4HLLA 2Y9YA 1VQNP 5CJ0A 4Q94A 2ZYAA 5ARGA 2ZXXA 3EQ2A 3IF4A 4AQRD 3LVQE 3L4FA 4U3FE 5G2NA 4NACA 1GL2C 1Z3YA 1ZLLA 4WUYA 4AOFA 2P10A 4BERA 3PZ2A 4AY6A 1MKMA 4Z1MH 3CD6P 3CK7A 4GCOA 4YDEA 3HXCA 1NU1K 2CG2A 2R03A 3FU6A 3W9GA 2N1TC 4C0EA 1IFNA 1SQPE 4GDOA 2FYNC 1LTJA 5JJ6A 4KJMA 5GTHH 3BASA 4YVQC 3WG7E 3DXMG 1NTZG 3TGOA 3S1KA 2OTJP 4AIFA 3SFXA 4EBAG 1EYHA 4O1PA 4LRZA 3AECC 1NKZB 2E43A 1K1BA 3L70J 4UQXA 3BVHA 1TNBA 1PIXA 3NQPA 4HB1A 4MN4C 3ASHA 5CCGA 3MUDC 2OYHB 1IQUA 2B87B 2LXBA 1NTZD 5KLVG 2M5AA 2YHCA 3QWPA 4FHKA 4GA1A 4JPZB 2YNQA 2J58A 3GLMA 2R44A 3BCCJ 1M56D 4XI9A 5KWDA 1WY6A 4ABNA 1SQBJ 3TWSA 5H7PA 2W83C 1G1JA 4G25A 1EDUA 2OV8A 3FUDA 2E5YA 2P1JA 2ZT9B 2J9QA 1KZPA 4KMOA 4GZ3A 3PRJA 2KCKA 5DJTB 3R9MA 1MFZA 1DCQA 4FJYA 2QJYB 4KBQA 3WU2E 5APSA 2QJPC 1BE3D 4BRYA 3CSFA 4TLFA 5KLVK 1KILA 2G3AA 2K3RA 1SQVG 1U57A 2CFZA 3NMDA 3V4WA 3H1HE 2YMKA 1ELWA 2QFCA 1YCSB 5B3SE 3TDKA 1IFMA 3KDPB 5CCHA 5LCWJ 2JEKA 1SVXA 4EI2A 3PH0A 1N86A 1YBKA 1H89A 1QVFO 1VF5C 1HBWA 1QQEA 3V6IA 3HD7A 1GD2E 1FZFA 1UN8A 3PH0C 4HOUA 2LUHA 4EQFA 2R3CA 1LJ2A 2FYNB 3U64A 1BE3G 4LUNU 3C3QA 3LVRE 2ZGDA 1N73A 4W7ZA 1OW6A 2BCCD 3IN6A 4E85A 3T97B 2H8PD 2JDIH 1N73C 4LERA 5ITZF 2I1JA 2DZNA 1QEXA 1S9KD 1X81A 2N9YB 2M5AB 3M9QA 5EIDA 2ZGGA 1K8KG 5EKQD 3KAEA 4CCAA 1JB0J 5CMZA 2J5UA 2ETAA 5LX8A 4GT1A 2AEMA 4I6GA 4N78D 2K37A 2KB7P 1LGHB 5BXOA 3AEEC 1MZ9A 1H8AA 1AFOA 4XE5B 1VQ6P 3Q75A 3ULQA 4BT8A 1Q86Q 5AVZB 2GRPB 3ASOE 4LNUD 3CQCB 2B88A 1IYGA 3H32B 1NTMD 4GMLA 1ZN5A 1VF5D 3IBEA 4A1SA 2NC9A 2R5SA 3IEGA 3E7KA 3B5NB 1JY2O 1G1IA 1OCCE 3R2PA 3Q9NC 4O9BA 3Q5SA 2FO1E 4AUWA 1Q82Q 3HDXA 3FFLA 4CYMD 1BLXB 4CDRA 2WXGA 1K9MQ 2D2CB 1KLXA 1UJKA 1NTMG 3ABKE 3C5RA 3PNLB 4LCTA 5ANRA 1HU3A 3S7FA 2F37A 3GZ1A 2EINE 2ZVNB 2QM7A 2WMMA 3D9OA 2K88A 3ZVVA 5AENA 3WXXA 5AVSB 4JXTA 4JB8P 1SQPK 4QFVA 3T5XA 3N71A 2V4HC 5JMND 3HIZA 3EIJA 2XRZA 5E75A 5B5EH 3Q9UC 4TUUA 1NTMK 1EZVE 4I43A 2V4HA 1PGPA 3S7DA 3MA5A 2WQYC 1OW8A 4EHMA 4ILHB 3H1IE 3MKQB 5GTHE 4GTMA 2O1JA 3QH9A 1S63A 4I2ZA 4PS8A 3ZYKA 2KCLA 3B7TA 5EIBE 1S9KE 3NXSA 4W7YA 3Q15A 1BDDA 2MYOA 3OTNA 3UMVA 4J7WA 1H88A 2BCCE 4JVSA 5KBAA 4MKTA 4FP7A 4FC8A 3I4GA 3UIPC 2R32A 1BI7B 3U1AA 2WPSA 3Q5PA 3CL3D 2BF0X 1NU1J 4WY4B 4FLBA 4U04A 2WVIA 5APYA 2Y4UA 3L73G 3MYVA 2VSYA 3ASDA 4GB9A 4IRUA 1NOHA 4J8FA 3EJNA 2IYPA 3CVLA 3R9AB 5CHEE 1PPJE 3HE5A 3CLQA 1FCHA 1FJKA 4EBAA 2X6JA 3C9IA 2HPCB 4XX5A 2N1TD 2FYUK 2B0OE 2BCCJ 3H1IJ 4GTRA 3NZUA 1S70B 3P8CD 5EFWB 3HXEA 4YNDA 2GRLA 1H2TC 2B87A 3WU2H 3IHYA 2Q5UA 4R4LA 1GW3A 3ESKA 2Z4EA 1DD4A 3PZ4A 4DX5D 1PPJD 3R4YA 1E90A 4WNDA 4ZHBA 1BU9A 1PP9J 3KEZA 3QAQA 2VTBA 3C3OA 4BXLA 3EDTB 3WUVA 3FUHA 1M1JC 2IBZI 1KT0A 4GMJA 5KAIE 1KN7A 3Q49B 3SWKA 5KJNA 5APQA 2FYUG 2C2LA 2YQ8A 2C9NY 3SFEC 2P2UA 2Y1LE 3M9HA 1HZ4A 4HOQA 2KUBA 3D9MA 1NYHA 3AU4A 2Y3AA 1H6OA 3ASNE 3H1LJ 3T8KA 1QYMA 3DEPA 4UQYA 3UM3A 1SQBE 3GZ2A 2YNYA 1N54A 1KORA 3PUJA 2J59M 4HI8A 1RF1A 2VRSA 2WXRA 1K05A 4UWKA 4OGQC 1KYOI 1W2EA 1WG0A 3CWBJ 4GYWA 1SQBK 3ZXSA 3EHNA 2QIWA 5A7DB 1ZP0C 2R05A 3M0DC 1M1KQ 1HJ0A 5J08A 4YDWA 4B93B 3ABLE 1TJCA 2WMOA 4AEZC 2LSVA 5BPPA 3LCAA 1M90Q 3PHLA 5BUZA 4UWLA 4GTVA 3MX3A 4BX8A 5AVYB 4XI0A 2E75B 2X6FA 4JEUA 1L0NJ 4LSZE 4EZLA 2W90A 1EC5A 4DI4A 3O48A 1SLQA 1BPOA 3LXUX 2FXOA 4N3BA 3C72A 3WMM0 5AVUB 4TT3H 5C39A 1W2BO 3PZ1A 3UINC 3FH5A 1YA0A 1LT1A 4TXQA 3UI2A 4PJ0E 3V2XA 1NA0A 1SQXG 5M72A 3VMXA 2XU6A 3EHQA 2XNXA 5CBNA 3I55P 1YJWP 2FO7A 3ML9A 2WVRA 4OGQD 4WY4A 2OCCE 2RKKA 1EDLA 4HXIA 4CT0A 1LTSC 3ABME 1NTME 2QE7H 1L0LJ 1NTKG 2E42A 2C0LA 3JUIA 1RE3A 3AU5A 4OWFA 3HYMB 3Q4AB 1S5LH 2YO2A 4HYTB 4N5CA 1IHBA 5B5EE 5ARFA 1KILB 3FUJA 4I1MA 1L0NE 4GYYA 2RFMA 1KMIZ 3UM2A 1L0ND 1RF0A 2FYZA 3PS6A 3L16A 1FJPA 1KFNA 2AW6A 2XCBA 4K03A 1N94A 3SY2A 2WTYA 2GM4A 1E8YA 1FT1A 4RQIA 5EYLA 2C0MA 1ZBPA 5FWQA 4GTPA 3G2VA 1KQGB 3W68A 1OVVA 1TR4A 2RN0A 4BETA 4OVUA 3MTUE 4NPFX 2HLOA 2DWZA 4Y6CA 4L74A 4Y6WA 1LTAC 2HYZA 3S7BA 4JHJA 1KD1Q 1HGZA 4W9RA 1KV4A 2P58C 2OARA 3UKUG 3VLFA 2BTDA 2LO6A 3BU8A 4AVXA 3ZGQA 2B89A 3J5QB 4D6TD 3FTSA 3GW6A 2IU1A 2DYRE 3RU0A 3B5NC 2LXLA 3LYAA 1N4RA 3A3YB 1QLED 4H13C 1OT8A 4HRMB 4BFRA 4F53A 5AQ9A 2JJLA 3L35A 2I1KA 1Y8AA 2YKPA 1PY1A 3CWBE 1BGYG 4K5AB 3CCUP 1G2CB 3SBSA 5HKPA 4JPSA 4HBDA 2NPSB 2XPYA 3CVPA 3A7OA 2LAIA 4OVVA 5E76A 4H44D 3RK3B 2XZRA 1FAVA 4YDOA 1LP1B 3CK8A 2AXCA 3AE8C 1ZB1A 3FHEA 4BEPA 2ZIRA 3CCJP 3L75J 3TWRA 3RAUA 2LXMA 1M57D 3JYSA 5CCMA 1NTZJ 3HTKB 1T3JA 1L5JA 4CDMA 2ZAEB 2CPBA 4U0UA 1TNOA 3AEBC 1SQBD 4H0LD 3Q3DA 4D6TJ 3L17A 3GHGB 3L70G 3MUDA 1LD8A 1ZR2A 4I6MC 4QQIA 1UJJA 1IK9A 3I56P 3DWLG 2JP3A 3EU9A 3VTXA 5AW0B 2EILE 3SF4A 1PL5A 3B5ND 3ZKJA 3FUMA 1UG3A 1DCEA 3G71P 3B7BA 3KEAA 1N7LA 1SQQK 4PH4B 4A3VA 2I2OA 2L9BA 1Q81Q 3AE6C 3A5TA 3CK9A 3B4SA 3EWKA 3MZLB 2WT7A 4TV3A 3O6QA 3HVEA 3EUVA 4ILIA 4PS7A 4R7LA 3VLDA 4G11A 2R2LA 4KVOA 3Q7AA 5LOZA 2N9BA 3CVXA 4HQDA 4IL6X 3NOGD 3GYZA 4J8EA 3HUSA 5TISE 5CCHC 3SGHA 2Y0DA 3L82A 3P8CE 3N7NA 2OYIA 1JY3O 3HUSC 3HTKA 3OXGA 1NVOA 3FTZA 1JY2N 3HXBA 4U3FD 1T2KC 2VGXB 1TNZA 1USEA 1M1JA 3E32A 1LWUC 3Q5MA 4C9BB 1UOHA 4D6TE 2KS1A 3AEAC 4LGDE 4AXHA 1RY3A 4H7YA 2I8DA 3FX0A 3KQGA 2AXVA 4EDFA 3H1IG 4E6HA 1CZQA 2SPZA 4XKCA 1FZCB 4GOFA 3EHRA 4EOTA 4ASWA 2B6CA 1A02F 3DSTA 3UXGA 4C46A 3UKRG 5AIJA 4OYSA 3UM1A 5APTA 3PREA 3PDNA 3TG5A 2V7QH 3GF3A 2NYJA 4LNGA 1JUNA 3H1ID 2XKMA 2R5DA 5B66H 4F6RD 1ZOYC 2KBXA 1JY2P 3TGUJ 5CCHD 2AXUA 3BUAA 4DRXE 1IXVA 5J90A 1N73B 4F1PA 3PJSK 3L75E 3DRAA 5AW6B 2A5EA 4M3LA 3WUTA 3CKBA 1VQPP 1NTKK 4K5CA 4TUMA 4EPZA 2HYNA 3H1LG 1PV3A 4WWOA 5KNHD 1LD7A 5KKZC 3FGAD 3BCCE 1JNMA 5A6CA 4XA4A 1EDIA 4GKGA 3AE3C 4O60A 1UN9A 4FULA 2F8YA 3O4ZA 2AXZA 2OQQA 2XNDH 5BVZA 1KTMA 3VN0A 1XNFA 3ZDMA 3UT8A 2ITAA 4G26A 3CC2P 5FINA 1RW2A 2BASA 3CMEP 1SA4A 4FHJA 4JYCA 3P8MC 3D9HA 1YMPA 3FTYA 4D10C 1MX6A 3KHUA 3SFZA 3FEXA 3L73D 5T4YA 3GW4A 4N3CA 1HVVA 1IFJA 4JQ0D 3FTXA 1RH5B 3C8VA 2WPRA 3ZPJA 5FZSA 1VF5B 1OY3D 3RRUA 3LY8A 3TXMA 2P67A 1ZU2A 3ZRHA 4YDYA 1L2PA 1LNQA 3PLNA 2JEEA 1HFAA 3QWVA 2K9JB 4UB8E 2HPCA 4HFGA 4B0ZA 3AS5A 4JA7A 4O6FA 4MS6A 5HS0A 1PPJG 1SQQJ 1HUCA 4IFFA 2Q7FA 3FUIA 3CR3A 2IONA 2DVWA 2Y69E 2QJPB 4JZYA 1OIPA 1USDA 4H13D 1OWLA 2E2EA 3JSVC 3PRZA 1NU1G 2WITA 5DIZA 2OVBA 5GTIH 3F5HA 3D9JA 4U63A 1N2DC 5G55A 3B5NA 2PFXA 4IFMA 3T5VA 2AEFA 2KYVA 3S4RA 3PE3A 5EYPF 2YKQA 1N95A 3PEVB 4H44C 1PP9D 3ZUVB 1M8OB 1AQTA 2RG8A 3MCXA 1E79H 2KI7B 2IBZG 1KT1A 2Z5HA 4JA9A 4BTBA 1H6PA 4J6IA 1HF9A 3BQOA 3IV0A 2YMYA 2PZIA 2ZISA 5EDSA 1SFCA 4L2LA 5AYWD 3FU0A 4H0LC 1A5EA 3S2AA 3VTYA 2AJAA 1EXIA 2KZIA 2PQNA 2O01N 1HXIA 5TISH 4N5QA 4U0ZA 2O01J 2ZJSE 1Y47A 2E5TA 4I17A 4KZCA 1N11A 4UWFA 1IHGA 3IHVA 1NTZE 3VMYA 4HJGH 3BCCG 3L74J 4NIKA 3DXKG 4XIFA 3S7JA 1IKND 1DNPA 4G24A 3HE5B 5E79H 3H1LE 1SQXE 2C0XA 5AVVB 3BG1B 1T6AA 4HVBA 3HE4B 3KZIH 3L75G 1X0TA 2P9SG 2YINA 4U8VD 3G2SA 3HXDA 3AG2E 3U59A 1K73Q 2XHEA 4URKA 3ZXPA 3MHVA 4BRYB 3URZA 2WZ7A 4I6JA 1EZVD 2GUVA 1D8EA 2A06G 1SQPD 1U7MA 3OAWA 2I6HA 2QG4A 2IOSA 1LWUB 3MGBA 5G04J 2VSOE 5L8RJ 1NFIE 3G3ZA 2OYIB 3ASFA 3ZYMA 1T2KD 3AEFC 5AW3B 1JCDA 1HG5A 2MRIA 3ZU7B 3TWXA 5H2FH 4NURA 4UWGA 2IDBA 3RRMB 1FU1A 2FBNA 1L0NG 3HHMA 3DSVA 2Q9IA 1PGJA 2OYOA 1IFIA 2QYUA 1OWAA 3L08A 1L4AD 4WB4A 3MV3B 5KJLA 2R17C 5G05J 3CHSA 4WNFA 3ASGA 2M3EA 2WSFH 2KM4A 2WQHA 5FIOA 1HJBA 1Y9BA 4X8QA 3VLEA 3DPDA 2W6AA 3B71A 4UWHA 4A1GA 3FWNA 2RH0A 2OEWA 2OVFA 3AE9C 3UIAA 5BT1A 3FULA 1J2JB 1BI8B 2P9NG 2GGFA 3CX5H 4L73A 4GA2A 4YXDC 1OWPA 1PC2A 1GZLA 5FJYA 4N78E 2GRRB 3CPWO 3ZFWA 2X6IA 3E1IA 2V5QC 2O3JA 4BWNA 5KJKA 3PP5A 1FPPA 2P2CP 1FZCC 3SQVA 1L4AA 1OW7A 4DI3A 1NJIQ 5BV1A 3H25A 3HG0D 4JBZA 5JHAA 2JR8A 1JTHB 2IZ0A 3JQ1A 4B94A 2A4ZA 1BD8A 4RJTA 3PUKA 1P84E 4GZDA 1TJFA 4ILGA 1UW4B 2IFMA 5EILA 4KZ0A 2VTBB 3IFMA 2PP6A 3V4QA 1EDJA 1JO5A 5ENOD 4BSZB 4CRWA 1XTGB 1GK4A 3CKCA 1ZW0A 1X22A 3OAKA 3UM0A 3D6ZA 4N3YB 4Y99C 3AG1E 2KATA 3L71G 3JUEA 1KQLA 4RLYA 1ZV8A 2QY7A 1URQD 3D9KA 5AVRB 2Q7CA 1PFIA 1RQUA 2X38A 1EPUA 1A02J 1BGYJ 3H1HD 3CCEP 1JCCA 1R5SA 2E74C 5CECB 1K8AQ 1BE3E 1IO4A 4BT9A 5ENSD 1KYOD 1GK6A 5CBOA 2RFAA 5CMWA 3I4RB 1HO8A 4ATZD 2BEDA 3D9LA 3SI5A 3GHGC 1PZQA 3UT4A 1TEZA 2DYSE 1GL2B 1S72P 1OXJA 2BEZF 1AV1A 3L36A 3C98A 5ANLA 3CI9A 4WY4C 2E76C 4C7RA 3AG3E 5AVXB 1W3BA 4EYYQ 3AAAC 3PEUB 1OCZE 2WXMA 5CCLA 2E74B 1IFPA 3OXLA 3DSWA 1SP4A 4AYCA 3V31A 3FUNA 3LS8A 3O6QB 3HVEB 2F8XK 3IR9A 1FVFA 1OUVA 2E0IA 4TXRA 5APUA 2P9LG 4UB6E 1CSBA 2E74D 4UI9C 3CCRP 1YI2P 3AG4E 4GMRA 1GW4A 1QVGO 4I9EA 4IOIH 4BWRA 1DC2A 5M1BA 4B89A 3VMZA 5AW8B 5CERB 2P58A 2MHKA 4KHXA 5KJMA 3U9WA 1NTKD 1H19A 2IJGX 3SBTB 3PNTB 2XCCA 3NTNA 2H6GA 4DLQA 1LWUA 4H7XA 2FXMA 2FYUJ 1VQLP 4RSYA 3DPYA 1OZHA 4CZ2D 2ZVOB 1KB9I 1OX3A 4PV1C 4JYBA 4HLEA 1FC2C 1Q2NA 3MP7B 4JHRA 5A23A 5AW5B 2XZDG 3L72G 3P7KA 4EZJA 3R7RA 1LT9C 2WSCH 2UY1A 1QNFA 2WXPA 3V79K 1L0NK 2J09A 2CHZA 3CQGB 1TNYA 4GA0A 5AQAA 1AA0A 1NAYA 3MV2B 3IKOB 3HUSB 2FYUE 5BXUA 4O1OA 3AE2C 1FBMA 3MKRA 4F3VA 4Q69A 2KNCB 2O01H 4NPDA 3TWVA 4D6TG 3L72D 2J07A 2LSUA 1E7VA 3PZDA 1VQOP 4DX6D 3D9NA 5KAFE 2A45I 2KLVA 2KCVA 1N8RQ 5BW8C 3IAOA 3KZIE 4AY5A 3NOCD 1SFCB 2C0WA 4C7NB 1NA3A 2FEZA 3CMAP 4RG9A 1FZEA 3RKVA 4CT4A 1BGYD 5CJ4A 2J08A 3VOPA 2Q6QA 4GZ6A 1FOSE 1L0LK 1L4AC 4BX9A 3VP8A 3TGUE 1SQXK 1GMJA 1KB9E 1FZBA 3Q73A 5ENTD 1INZA 3VMAA 1NAFA 3CIAA 3OXFA 3FDHA 1Z6TA 4PV1D 3KYQA 2NPSD 4LC1A 1LTXA 2ETCA 2HR2A 3RGUA 4B8AA 3ZHEA 1LTIC 1QL1A 1NI1A 2IPPA 1H0TA 2ZYGA 3HXFA 1NP7A 3G4SP 1NU1E 1MHQA 2E75C 4GPKA 3CHRA 5B66E 2HE0A 2LAHA 1RQVA 2CK3H 4U7EB 4I9CA 1LP1A 1XGWA 3KD7A 3NBNB 3CVWA 3H1JE 1BSHA 2NZ2A 3TAXA 4DOJA 4L2YA 3CSTA 5KKZB 3HD7C 2D2CC 2A45H 2IBZE 2P9IG 1SQVD 4WNGA 2R59A 2OYHC 1WM5A 3UT7A 1PGQA 4J8SA 3ZYQA 5G05C 1NWQA 1A17A 3QWOC 3RK2C 5GTIE 3V2QA 5AN8A 2OYHA 3K5BA 4DLOA 3CXHD 2YO3A 3L22A 2YXQB 1JMMA 3Q7FA 3UIOC 4YXWH 2GRNB 2XDJA 4CEMA 1SQQE 1W5CE 2IQCA 3EU5A 1HH0A 1WRGA 3CC7P 3CX5D 3C3RA 3RK3E 4U7JA 2OGUA 3L13A 4IULA 3J5PA 3E34A 2VGYA 4I1OB 3K9IA 3AE7C 2EIKE 3GMAA 1URQC 3LIDA 2DW3A 3TWTA 5T3RA 1URQA 3RK3C 3P32A 3U3WA 1BSNA 3B7SA 3QK0A 1URQB 2QM8A 4GZ5A 1JMBA 1GW6A
chains in the Genus database with same CATH topology
4MN4C 3T9KA 5CBOA 4BETA 4NPFX 2DWZA 4LG6A 3ZU7B 2RFAA 2XENA 1SS1A 3NOCD 3TWXA 4CPGA 4ATZD 2B87B 2LXBA 1A5EA 2M5AA 3C5RA 4OAUC 1UOHA 2KXPC 2R44A 2VGEA 2Y1LE 3B95A 5HS0A 3TWWA 4HB5A 1OVRA 2BKKB 5KWDA 2KUBA 1MFTA 5KNGA 2I8DA 2F37A 2ETBA 4K5BA 2B89A 3J5QB 3TWSA 2Q1KA 2QVAA 5ENTD 4HI9A 3T8KA 2WMMA 1QYMA 3DEPA 2DVWA 4EYYQ 3AAAC 2SPZA 3ZNGA 4U8YD 2PNNA 1BLXB 4ZFHA 2ETCA 4HI8A 4ZMDA 4HRMB 3RGUA 2OTKE 4GOFA 1OT8A 3TWUA 3EHRA 1WG0A 4ASWA 5DJTB 4JB8P 1N0QA 4QFVA 4GOEA 1DCQA 2KIKA 5AQ9A 5FIOA 3V31A 4DX2A 4WWIA 2V4HC 5JMND 3TWQA 3UXGA 5DJUB 1H0TA 5CEDB 3F6QA 5JA4D 4K5AB 3FXDA 3LJNA 1G3NB 5ENPD 4YDWA 3Q9UC 5HKPA 4HBDA 5EYPF 2K3RA 2F8XK 2KS1B 4B93B 2KZJA 2DZOA 1OVUA 3AJIA 1YCSB 2Y0BG 1MJ0A 4HKZH 2NYJA 5EN5D 4ZNCA 3ZUVB 4F6RD 2LR2A 2HE0A 2KBXA 1LP1B 1SVXA 1MX2A 3JXIA 3PH0A 2HR3A 5AAOA 2KI7B 2L6BA 1LP1A 4BEPA 4DRXE 2LXCB 1BI8B 3TWRA 3SO8A 4C48B 3MZWB 3NBNB 1IXVA 5D66A 4GMRA 2UWJE 4ASVA 2M0BA 4U96D 4F1PA 4IOIH 1YYHA 2XZTG 4LSZE 5ENRD 4DX7D 5EIBE 1DC2A 2A5EA 1BDDA 1JM0A 1EC5A 1H0TB 2MYOA 2QC9A 1ZXGA 4K5CA 2V5QC 4TUMA 5AQBA 4J7WA 2ZAEB 4HLLA 1U7JA 5AARA 2P58A 5HRYA 2ZGDA 2AJAA 2JWDA 2KZIA 2XEEA 3V30A 2P2CP 4Z68A 3W9FA 5CERB 5KBAA 4K3AA 5KNHD 4DUIA 1SW6A 1N0RA 1BI7B 5C39A 4N5QA 1AWCB 3QWOC 3HG0D 4JBZA 1LT1A 4J8YA 4UUCA 4NPEA 5AN8A 4A63B 4QQIA 5ITZF 1WDYA 2DZNA 1EDIA 3UI2A 5CEAA 1Y47A 2M5AB 3V2XA 5EIDA 2ZGGA 3EU9A 4O60A 1BD8A 4U95D 4G8LA 4BERA 1N11A 2F8YA 4CYMD 2BKGA 3ZKJA 3EHQA 5CBNA 5EILA 4HJGH 3DEOA 4CZ2D 4OAVB 3ZDMA 2ETAA 2QYJA 4HNAD 4GPMA 3B7BA 1EDLA 1FC2C 1Q2NA 1MYOA 3KEAA 4NIKA 1IKND 4BSZB 1EDJA 5ENOD 2JABA 3UTMA 1ZW0A 4K35A 5FINA 2XZDG 2B0OE 5BXOA 3W9GA 1EDKA 4GODA 3IXEA 1S70B 3J5PA 3FXEA 3HRAA 4G8KA 1MX4A 5EFWB 3D9HA 1YMPA 1MX6A 3V79K 4LNUD 3JUEA 2B87A 1IHBA 1X0TA 4RLYA 4U8VD 4KJMA 1DEEG 3V2OA 2B88A 2QRXA 5AQAA 1D9SA 2RFMA 4HQDA 3TWTA 3S1KA 3NOGD 3MHVA 1S3JA 4DX5D 1AP7A 5BXUA 2RKLA 5AQ7A 4HRNA 2XEHA 4O1PA 5ENQD 4O1OA 4ZHBA 1U7MA 5CECB 4DX1A 1BU9A 1K3ZD 4BXLA 3Q9NC 5K5GB 1BDCA 1OY3D 4HRLA 5ENSD 2FO1E 4NPDA 3TWVA 5EYLA 4BESA 1K1BA 1NFIE 4YDYA 2J8SD 3JXJA 4DX6D 1K1AA 1NVOA 4HB1A 1JMBA 1TR4A 1OVVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MN4 C;  3T9K A;  5CBO A;  4BET A;  4NPF X;  2DWZ A;  4LG6 A;  3ZU7 B;  2RFA A;  2XEN A;  1SS1 A;  3NOC D;  3TWX A;  4CPG A;  4ATZ D;  2B87 B;  2LXB A;  1A5E A;  2M5A A;  3C5R A;  4OAU C;  1UOH A;  2KXP C;  2R44 A;  2VGE A;  2Y1L E;  3B95 A;  5HS0 A;  3TWW A;  4HB5 A;  1OVR A;  2BKK B;  5KWD A;  2KUB A;  1MFT A;  5KNG A;  2I8D A;  2F37 A;  2ETB A;  4K5B A;  2B89 A;  3J5Q B;  3TWS A;  2Q1K A;  2QVA A;  5ENT D;  4HI9 A;  3T8K A;  2WMM A;  1QYM A;  3DEP A;  2DVW A;  4EYY Q;  3AAA C;  2SPZ A;  3ZNG A;  4U8Y D;  2PNN A;  1BLX B;  4ZFH A;  2ETC A;  4HI8 A;  4ZMD A;  4HRM B;  3RGU A;  2OTK E;  4GOF A;  1OT8 A;  3TWU A;  3EHR A;  1WG0 A;  4ASW A;  5DJT B;  4JB8 P;  1N0Q A;  4QFV A;  4GOE A;  1DCQ A;  2KIK A;  5AQ9 A;  5FIO A;  3V31 A;  4DX2 A;  4WWI A;  2V4H C;  5JMN D;  3TWQ A;  3UXG A;  5DJU B;  1H0T A;  5CED B;  3F6Q A;  5JA4 D;  4K5A B;  3FXD A;  3LJN A;  1G3N B;  5ENP D;  4YDW A;  3Q9U C;  5HKP A;  4HBD A;  5EYP F;  2K3R A;  2F8X K;  2KS1 B;  4B93 B;  2KZJ A;  2DZO A;  1OVU A;  3AJI A;  1YCS B;  2Y0B G;  1MJ0 A;  4HKZ H;  2NYJ A;  5EN5 D;  4ZNC A;  3ZUV B;  4F6R D;  2LR2 A;  2HE0 A;  2KBX A;  1LP1 B;  1SVX A;  1MX2 A;  3JXI A;  3PH0 A;  2HR3 A;  5AAO A;  2KI7 B;  2L6B A;  1LP1 A;  4BEP A;  4DRX E;  2LXC B;  1BI8 B;  3TWR A;  3SO8 A;  4C48 B;  3MZW B;  3NBN B;  1IXV A;  5D66 A;  4GMR A;  2UWJ E;  4ASV A;  2M0B A;  4U96 D;  4F1P A;  4IOI H;  1YYH A;  2XZT G;  4LSZ E;  5ENR D;  4DX7 D;  5EIB E;  1DC2 A;  2A5E A;  1BDD A;  1JM0 A;  1EC5 A;  1H0T B;  2MYO A;  2QC9 A;  1ZXG A;  4K5C A;  2V5Q C;  4TUM A;  5AQB A;  4J7W A;  2ZAE B;  4HLL A;  1U7J A;  5AAR A;  2P58 A;  5HRY A;  2ZGD A;  2AJA A;  2JWD A;  2KZI A;  2XEE A;  3V30 A;  2P2C P;  4Z68 A;  3W9F A;  5CER B;  5KBA A;  4K3A A;  5KNH D;  4DUI A;  1SW6 A;  1N0R A;  1BI7 B;  5C39 A;  4N5Q A;  1AWC B;  3QWO C;  3HG0 D;  4JBZ A;  1LT1 A;  4J8Y A;  4UUC A;  4NPE A;  5AN8 A;  4A63 B;  4QQI A;  5ITZ F;  1WDY A;  2DZN A;  1EDI A;  3UI2 A;  5CEA A;  1Y47 A;  2M5A B;  3V2X A;  5EID A;  2ZGG A;  3EU9 A;  4O60 A;  1BD8 A;  4U95 D;  4G8L A;  4BER A;  1N11 A;  2F8Y A;  4CYM D;  2BKG A;  3ZKJ A;  3EHQ A;  5CBN A;  5EIL A;  4HJG H;  3DEO A;  4CZ2 D;  4OAV B;  3ZDM A;  2ETA A;  2QYJ A;  4HNA D;  4GPM A;  3B7B A;  1EDL A;  1FC2 C;  1Q2N A;  1MYO A;  3KEA A;  4NIK A;  1IKN D;  4BSZ B;  1EDJ A;  5ENO D;  2JAB A;  3UTM A;  1ZW0 A;  4K35 A;  5FIN A;  2XZD G;  2B0O E;  5BXO A;  3W9G A;  1EDK A;  4GOD A;  3IXE A;  1S70 B;  3J5P A;  3FXE A;  3HRA A;  4G8K A;  1MX4 A;  5EFW B;  3D9H A;  1YMP A;  1MX6 A;  3V79 K;  4LNU D;  3JUE A;  2B87 A;  1IHB A;  1X0T A;  4RLY A;  4U8V D;  4KJM A;  1DEE G;  3V2O A;  2B88 A;  2QRX A;  5AQA A;  1D9S A;  2RFM A;  4HQD A;  3TWT A;  3S1K A;  3NOG D;  3MHV A;  1S3J A;  4DX5 D;  1AP7 A;  5BXU A;  2RKL A;  5AQ7 A;  4HRN A;  2XEH A;  4O1P A;  5ENQ D;  4O1O A;  4ZHB A;  1U7M A;  5CEC B;  4DX1 A;  1BU9 A;  1K3Z D;  4BXL A;  3Q9N C;  5K5G B;  1BDC A;  1OY3 D;  4HRL A;  5ENS D;  2FO1 E;  4NPD A;  3TWV A;  5EYL A;  4BES A;  1K1B A;  1NFI E;  4YDY A;  2J8S D;  3JXJ A;  4DX6 D;  1K1A A;  1NVO A;  4HB1 A;  1JMB A;  1TR4 A;  1OVV A; 
#chains in the Genus database with same CATH topology
 2PM6 A;  3CEQ A;  4XZ4 A;  1SS1 A;  3FU3 A;  1FDI A;  1QX8 A;  2VJ8 A;  2LNI A;  3PTZ A;  4OAU C;  4MBG A;  2VGE A;  3B95 A;  3TWW A;  1OVR A;  2A06 D;  1MFT A;  2E76 D;  4WY4 D;  3DSX A;  3SFY A;  1GTW A;  1JEK A;  2H6I A;  1PAQ A;  2IY0 C;  4MRU A;  3APC A;  3CHQ A;  4PJ0 H;  2PNN A;  1N7S D;  1RE3 C;  1HS6 A;  4L76 A;  3CV0 A;  4H44 B;  1KPS B;  4WWP A;  2WSE H;  1T3U A;  2NRG A;  5C2Y A;  3USS A;  2WPV A;  3F6Q A;  4AV7 A;  2ZT9 D;  2FI7 A;  3LW5 J;  3B7U X;  3Q1M A;  2DZO A;  1OVU A;  2NSZ A;  1WMK A;  1X79 B;  3LPZ A;  5AW2 B;  4BSX A;  3RK3 D;  5FQ8 A;  4I1L A;  1YQ4 C;  3H1K G;  4WBA A;  3CX5 E;  1NZN A;  4OH8 B;  4WVZ A;  5AAO A;  5CMY A;  2KLU A;  1JY3 P;  3A2A A;  1Q2Z A;  3L9T A;  3U4T A;  4N3A A;  1NKN A;  4M3O A;  3MIW A;  2M3B A;  2VSN A;  3RL0 D;  2Y0C A;  2UWJ E;  2M0B A;  3APF A;  1E96 B;  4ZKU A;  2XZT G;  3H1H J;  5ENR D;  1M1J B;  4U8H A;  3KS2 A;  1FZA A;  1U7J A;  3V30 A;  3LKU A;  3V2P A;  1EXJ A;  3JQ0 A;  3UUX A;  4K3A A;  1S64 A;  3B7R L;  3H1K D;  3BAT A;  3RO3 A;  1JWF A;  4Q96 A;  3PE4 A;  3LEW A;  1YYC A;  4U95 D;  4G8L A;  2IX7 C;  1WT6 A;  1N7S C;  3DEO A;  1FS0 E;  4HNA D;  1WAO 1;  4V3I A;  3CX5 I;  3D71 A;  1MYO A;  4N2Q A;  4I2W A;  5BNW A;  1EDK A;  3BRV B;  3HRA A;  3I5C A;  4U3F J;  3NF1 A;  3QNK A;  5KAI H;  1DEE G;  5APV A;  5B1A E;  4OVN F;  1ELK A;  2RD0 A;  5HI7 A;  4J8D A;  1KIL D;  2YIU B;  4HRN A;  1XTC C;  2KNC A;  2YXR B;  4EZK A;  1ZRT E;  1L0L D;  1BDC A;  1S0P A;  4IL6 H;  2H7H A;  4BES A;  3TGU D;  3DBS A;  2J8S D;  3H1J G;  3SFD C;  5AVT B;  3L71 D;  3TG4 A;  3R7Q A;  1BCC D;  5HQ8 A;  1QZ2 A;  3H1K E;  3T8M A;  1VQ5 P;  2KC7 A;  3LJ3 A;  5JHB A;  2V5F A;  4NRH B;  1LTJ B;  2FY8 A;  3V5B A;  1H0A A;  1OCR E;  5KNG A;  1VQM P;  1QBQ A;  3MD0 A;  3VTP C;  2NPS C;  2VYI A;  4G1T A;  5AJL A;  4UI9 K;  4U8Y D;  3E33 A;  1RZ4 A;  3L74 E;  3TL5 A;  2FYU D;  3AS8 A;  2NPS A;  1DH3 A;  3E37 A;  3QOU A;  4KT0 J;  5IY5 E;  2WWW A;  2J4B A;  3E30 A;  4DX2 A;  4RKU J;  4DCK A;  3FXD A;  1S1C X;  1CI6 A;  2E75 D;  1EF1 C;  2QJK C;  1OWM A;  3ZHE B;  5APW A;  1SZA A;  1MJ0 A;  4HKZ H;  1D7M A;  4ZNC A;  2J49 A;  1KIL C;  3JXI A;  5KLV E;  4DPR A;  1R8E A;  2KOG A;  1O1T A;  1BCC J;  5ENN A;  4I6E A;  4U96 D;  4Y28 J;  1YYH A;  3HD7 D;  2D2C D;  2RMZ A;  2BUG A;  3SSU A;  2A06 E;  1DX7 A;  2YKO A;  4HS2 A;  3SWY A;  2XPI A;  2R3S A;  4PV1 B;  5KTB A;  2XS1 A;  4N39 A;  3RK2 D;  2WXF A;  1R5L A;  1S4X A;  4K0R A;  3A0B E;  2GUS A;  4UUC A;  2PAJ A;  4A63 B;  4PD4 I;  1YTZ I;  2K1A A;  2Q3I A;  3Q79 A;  2V4L A;  5TJH A;  4I1A A;  1TYQ G;  4W80 A;  1N9A A;  2LKM A;  1UII A;  4JC8 A;  1SQQ G;  1CI6 B;  3AE5 C;  3TYY A;  1EZV G;  1V55 E;  2ZU6 B;  1SQP G;  3B13 A;  4PUC A;  1JCR A;  3S9O A;  1N4Q A;  4K35 A;  2IO2 C;  1H2U A;  3BG0 B;  4GZC A;  4I2L C;  4G8K A;  2ZXW E;  4LEU A;  5LP0 A;  2OOE A;  1SQV K;  3TJP A;  3V2O A;  1NTZ K;  4FA6 A;  3CC4 P;  5EX0 A;  2KZT A;  2RKL A;  1SQQ D;  1VQ7 P;  1K3Z D;  3L6A A;  4APO A;  1G2C A;  3CXH E;  1J1E C;  4YVO A;  5D0Q D;  3JXJ A;  1U2V G;  3AE4 C;  3T9K A;  4PD4 D;  3L54 A;  1GDT A;  1MZC A;  3DSU A;  3G2W A;  2PQR A;  3FUE A;  1NGM B;  4H0L B;  4RO0 A;  3LY9 A;  2PM7 A;  2IFN A;  1AJY A;  2JKV A;  2KXP C;  1JY3 N;  4L75 A;  5D0O D;  3AS4 A;  2WXO A;  1O5M A;  1KYO E;  1SZ9 A;  4OGQ B;  2GA1 A;  2YHE A;  4L9P A;  1IZN B;  5AJD A;  2WPQ A;  2WQ7 A;  2QVA A;  4J0U A;  5BU8 B;  1KQS O;  1HH8 A;  1HGV A;  2YIU C;  3L71 J;  3ZN3 A;  3T97 A;  5H2F E;  3RO2 A;  3RBX A;  3PZ3 A;  4ZMD A;  1FVH A;  2KXP B;  3SNX A;  3D70 A;  2KIK A;  1QGK B;  4APF A;  4WWI A;  2B9B A;  3CCL P;  2KP8 A;  3RL0 B;  4WAF A;  3CXH I;  2ZT9 C;  2R02 A;  5D2M C;  3M91 A;  2P9P G;  1Q90 D;  2KS1 B;  1P84 H;  3L74 G;  2WXI A;  2WXN A;  2FFD C;  4FLH A;  4JHK A;  4U0S A;  3HD7 B;  3II6 A;  4AM9 A;  2Z5I A;  2IOL A;  4GIF A;  1LTJ C;  2POH A;  5CRU A;  2HR3 A;  3OJA B;  1N7S B;  2FFD A;  4WNE A;  2LXC B;  2MOW A;  3X2Q E;  3RL0 C;  1KC8 Q;  2K9Y A;  3L70 E;  1KB9 D;  4ASV A;  2A5U A;  1SFC D;  2HO1 A;  3QWW A;  1ZME C;  1KYO H;  4HOS A;  1JM0 A;  2KK7 A;  2PL2 A;  3L74 D;  2XGM A;  3D3M A;  2AXT E;  2WSF J;  2JWD A;  2XEE A;  3M06 A;  3D9I A;  1IK7 A;  2WSE J;  1AWC B;  2WQ6 A;  2ZYD A;  5AW1 B;  3AEG C;  1J1E B;  1WDY A;  2MJZ A;  5CEA A;  2IFU A;  2M8R A;  3L72 E;  3RJV A;  4GTT A;  5FZR A;  4FAD A;  4DZO A;  1IJD B;  1E8Z A;  1Z3X A;  4XE0 A;  2AWI A;  1LT9 B;  4OAV B;  4K5B A;  1OWN A;  2V8S E;  1K04 A;  1BCC E;  4DT0 A;  4KT6 B;  1FZG A;  1SQB G;  2FKW B;  3Q5R A;  3L70 D;  1RF1 C;  4U07 A;  3MGN A;  4GOD A;  1U3C A;  1L0L E;  3W67 A;  1ZRT D;  3F89 A;  4C0M A;  1IC2 A;  2ILR A;  1X9V A;  1YJN P;  3A0H H;  3QKY A;  1VQ9 P;  2QSI A;  2G8Y A;  3U66 A;  3CHM A;  3SHF A;  2PRR A;  2WXH A;  2Y9Z A;  1YHQ P;  5AQ7 A;  3U1C A;  2XEH A;  4DX1 A;  2EIJ E;  4A55 A;  1SFC C;  1GU4 A;  4LLH A;  1K1A A;  3C1L A;  5CCG D;  3QB2 A;  4JW1 A;  3RIB A;  1DEB A;  2FBW C;  3ML8 A;  1NL4 A;  2R5B A;  3ZYL A;  4GAA A;  4CPG A;  3LIE A;  4IL6 E;  3EFG A;  1GL2 A;  4UI9 J;  4ACK A;  4FU3 A;  1KZU B;  2P9U G;  3FTV A;  2BKK B;  5JJT A;  2FF4 A;  1MQS A;  5JJ7 A;  1N4S A;  1KFM A;  2CG3 A;  3TNU A;  3L72 J;  4GCN A;  2XEV A;  3RK6 A;  1Z56 A;  3EHM A;  4U3F G;  4EIJ A;  2XPZ A;  3EIQ C;  3RRN B;  4ZKP A;  2FUL A;  4PD4 E;  3JCU E;  1N0Q A;  3N4X A;  1CW5 A;  3RL0 g;  3CCV P;  4C7N A;  1NO4 A;  3MJW A;  2XV5 A;  1G3N B;  3RBZ A;  1VDY A;  3G9R A;  1UIX A;  2KZJ A;  1VL2 A;  3MEK A;  3H1L D;  2WXJ A;  2KSE A;  3M0D A;  1AVO A;  4P29 A;  3H6P A;  3DSS A;  2Q3E A;  1Y8M A;  2F0Y A;  2AEJ A;  2QJY C;  1YTZ T;  5APX A;  5KLV J;  4C48 B;  3MZW B;  2L0I A;  2GRQ B;  2W8Z A;  1TN6 A;  5CCG C;  3FUK A;  1FZC A;  3TNU B;  3JCU H;  2P9K G;  3CCM P;  5AAR A;  1JTH A;  1SVF A;  4Z68 A;  2WM9 A;  2WXQ A;  4JL0 A;  4I7Z B;  1J1D B;  1HG2 A;  3PVL A;  1L4A B;  3SD5 A;  1DD3 A;  3GF7 A;  4NPE A;  2W6B A;  3AED C;  3G6E P;  2KSJ A;  5KAF H;  1OXZ A;  4YTP C;  2H89 C;  3SWF A;  2EIM E;  5AVW B;  3H32 A;  1OCO E;  3NZS A;  1SQV J;  2QYJ A;  1S5L X;  3CVY A;  5FTP A;  4ACL A;  2L91 A;  4IFD K;  5LCW C;  1PP9 E;  3IXE A;  1GU5 A;  1MV8 A;  3P2B A;  4CGW A;  1HE8 A;  2DBA A;  4ANX A;  1FDO A;  3OA7 A;  2XGO A;  3NB2 A;  2K9J A;  5KLV D;  3JC2 2;  3CVQ A;  2L0T B;  3Q47 B;  1BE3 J;  2HG5 D;  2M63 A;  4N6J A;  4CDN A;  4UQZ A;  2OEV A;  1N52 A;  3UPV A;  4ANU A;  1RE4 A;  3ZIM A;  3H1K J;  4LG6 A;  4YPC A;  3KPE A;  3FTW A;  4HOR A;  4B86 A;  3CGH A;  1PGO A;  1DIP A;  1FOS F;  1JWG A;  4HB5 A;  3ABV C;  1P5Q A;  1SQP J;  3CCQ P;  1L0L G;  1NTK J;  2ETB A;  4FJZ A;  2WXL A;  1VPC A;  2JO1 A;  3CLJ A;  5FQ6 A;  3ZNG A;  4HH2 A;  5FZQ A;  2O1K A;  1LF8 A;  1LTG C;  5C1D A;  2J4D A;  1SQV E;  4XKB A;  2DIW A;  5KJ7 C;  2IBZ D;  1YIT P;  3TWU A;  2OND A;  5EX3 A;  1N7S A;  3L71 E;  2FFD B;  2IF4 A;  2HOD A;  3D6Y A;  2H6F A;  5CED B;  1M7L A;  2QEX P;  5KJ7 A;  3GG2 A;  1T8Z A;  1U3D A;  3E1R A;  1MUU A;  1KIL E;  4R4M A;  2UWJ G;  1O1R A;  2Y0B G;  1VQ8 P;  5EN5 D;  2L6J A;  3UQ3 A;  2BCC G;  1X8Y A;  1MX2 A;  3ZEF A;  3FUF A;  2L6B A;  3A0B H;  2PGD A;  1NU1 D;  1O1S A;  3SO8 A;  1NTM J;  3APD A;  2JWA A;  5D66 A;  2WXK A;  3NAW A;  1YQ3 C;  2E76 B;  3WUU A;  3FU5 A;  3Q2Y A;  4GU5 A;  3A0H E;  1AQ5 A;  2QC9 A;  3BCC D;  2OYI C;  1H2V C;  5B1B E;  1JOC A;  4ZFH A;  1V54 E;  1PP9 G;  5AW9 B;  5HRY A;  2IO3 C;  4RVB A;  2GRM A;  4DUI A;  1SW6 A;  1N0R A;  3ONK A;  5E79 E;  3ENE A;  3H1J J;  1LTB C;  1OFC X;  3ZW3 A;  4B8C B;  4L23 A;  4IN3 B;  3L75 D;  1NH4 A;  1GL2 D;  3NFQ A;  1HWT C;  4MLP A;  4DK5 A;  4JEH A;  3EFF K;  2BKG A;  4TXP A;  4IYP A;  4QMA A;  1NHL A;  2VSX E;  5KJ7 D;  1E8X A;  2N1T A;  5G04 C;  4AP2 A;  4ANV A;  1Q7Y Q;  3CXH H;  1YIJ P;  2FXP A;  1E8W A;  1MX4 A;  1TU3 F;  4XFJ A;  5KCM A;  1JUQ A;  1VQ4 P;  4KXK B;  2MKV A;  2XS8 A;  4UB6 H;  5FT9 A;  2HOD B;  1SQX D;  2QRX A;  2IEJ A;  4A7P A;  4PD4 H;  2Y4T A;  1LTT C;  3CHP A;  3UX4 A;  2ZFC A;  1ELR A;  3RSE G;  1FE6 A;  2W6J H;  1KB9 H;  4BTA A;  1E5W A;  2H43 A;  2XEN A;  2V7Q J;  3MKQ A;  1VQK P;  5BV0 A;  2W27 A;  5AW7 B;  4KVM A;  2N1T B;  2WT7 B;  2X3M A;  4HOT A;  2IYO A;  4A3T A;  4XEI G;  4G2V A;  2Q1K A;  3QAR A;  3BEE A;  4HI9 A;  5CRV A;  2HM8 A;  3B8E B;  1NTK E;  2IZ1 A;  2I9C A;  2CHX A;  3FTU A;  5LFA A;  4ME2 A;  1LT9 A;  4G23 A;  2XGS A;  3FH7 A;  3ULY A;  3GZS A;  1SQX J;  1TN8 A;  4JD2 G;  5DJU B;  5CHX A;  3LJN A;  2Y0E A;  1D8D A;  3SZ7 A;  4H13 B;  1VDF A;  2WSS H;  2CHW A;  3AJI A;  4DJA A;  2NXP A;  5DBK A;  2UY1 B;  2BEQ D;  3ONL A;  4L7T A;  1FDM A;  4NQ0 A;  2EQX A;  1HTL C;  2WMN A;  1X5B A;  1B89 A;  2AXT H;  3ESL A;  3LDZ A;  2XQ0 A;  5FQ4 A;  2WSC J;  3CHO A;  3E4B A;  4DX7 D;  1RF1 B;  3VYI A;  1ZR4 A;  1H0T B;  1RE4 C;  3ITK A;  2GW1 A;  1EZV I;  5FQ7 A;  2VGX A;  3W9F A;  3TK1 A;  2WB2 A;  1TN7 A;  4ANW A;  4DJG A;  4JF7 A;  4F7A A;  4J8Y A;  3KSL A;  3TXN A;  3LW5 H;  3CWB G;  2GRO B;  3CVN A;  2VQ2 A;  3FY4 A;  2P7J A;  3M0A A;  3QJZ A;  1KZO A;  5AVQ B;  4L1B A;  3V2N A;  4TRQ A;  2JLB A;  3QC1 A;  1S5L E;  4Y99 B;  4RG6 A;  4GTQ A;  4GPM A;  2CPS A;  5BU5 A;  2JAB A;  1HX8 A;  3QDN A;  3UTM A;  3L73 E;  1TNU A;  3TGU G;  4ATG A;  3H1J D;  3FXE A;  1SQM A;  1BCC G;  4PS3 A;  3FP3 A;  4CGV A;  3CWB D;  4N2S A;  2CFU A;  4F1S A;  1Z5S C;  2X6H A;  4M7C A;  1D9S A;  3P1U A;  4BY6 A;  3I3N A;  3FWV A;  1SA5 A;  1JCS A;  5AW4 B;  1S3J A;  3OW2 O;  3FEY A;  1OWO A;  5ENQ D;  1YJ9 P;  2H6H A;  3RK2 B;  5K5G B;  4HRL A;  3CVU A;  3JCK C;  3O8Z A;  2X6K A;  1KQF B;  3GHG A;  2C9L Y;  2OTL P;  3G2U A;  3Q78 A;  2V0P A;  3FWL A;  3CVV A;  2KZT B;  3AE1 C;  4PDX A;  1P84 D;  2ZXE B;  1P84 I;  1E7U A;  4GTO A;  2QZA A;  4UB8 H;  3H1H G;  3BRT B;  2QA4 P;  1QL2 A;  1H6K A;  3M9B A;  3V2R A;  1BGY E;  2XRY A;  4GYO A;  3ULE G;  4AJW A;  1FT2 A;  1JCQ A;  1IQR A;  5KLI C;  3HE4 A;  2AVP A;  2HFE D;  2H88 C;  2OTK E;  2QJK B;  3G2T A;  3I5P A;  4GTS A;  4EEC A;  1AP7 A;  4GOE A;  1HF8 A;  3TWQ A;  3L73 J;  3L37 A;  1J1D C;  3VP9 A;  4LNB A;  5ENP D;  3D9P A;  1RF0 C;  2DCP A;  2L5G B;  3ISM C;  3FH8 A;  2WPV B;  4KYO B;  3CCS P;  1JPL A;  2LR2 A;  1AVY A;  3HRN A;  3KSQ A;  4RES B;  1Y6I A;  1N4P A;  1DVP A;  1OMI A;  4I7Z C;  2A45 G;  3TF5 A;  1S2E A;  1RHZ B;  1IFD A;  3LY7 A;  4WWN A;  5T8I A;  3TSI A;  5KLI B;  1EQ7 A;  5AQB A;  1ZXG A;  5JA4 D;  3KXD A;  4HLL A;  2Y9Y A;  1VQN P;  5CJ0 A;  4Q94 A;  2ZYA A;  5ARG A;  2ZXX A;  3EQ2 A;  3IF4 A;  4AQR D;  3LVQ E;  3L4F A;  4U3F E;  5G2N A;  4NAC A;  1GL2 C;  1Z3Y A;  1ZLL A;  4WUY A;  4AOF A;  2P10 A;  4BER A;  3PZ2 A;  4AY6 A;  1MKM A;  4Z1M H;  3CD6 P;  3CK7 A;  4GCO A;  4YDE A;  3HXC A;  1NU1 K;  2CG2 A;  2R03 A;  3FU6 A;  3W9G A;  2N1T C;  4C0E A;  1IFN A;  1SQP E;  4GDO A;  2FYN C;  1LTJ A;  5JJ6 A;  4KJM A;  5GTH H;  3BAS A;  4YVQ C;  3WG7 E;  3DXM G;  1NTZ G;  3TGO A;  3S1K A;  2OTJ P;  4AIF A;  3SFX A;  4EBA G;  1EYH A;  4O1P A;  4LRZ A;  3AEC C;  1NKZ B;  2E43 A;  1K1B A;  3L70 J;  4UQX A;  3BVH A;  1TNB A;  1PIX A;  3NQP A;  4HB1 A;  4MN4 C;  3ASH A;  5CCG A;  3MUD C;  2OYH B;  1IQU A;  2B87 B;  2LXB A;  1NTZ D;  5KLV G;  2M5A A;  2YHC A;  3QWP A;  4FHK A;  4GA1 A;  4JPZ B;  2YNQ A;  2J58 A;  3GLM A;  2R44 A;  3BCC J;  1M56 D;  4XI9 A;  5KWD A;  1WY6 A;  4ABN A;  1SQB J;  3TWS A;  5H7P A;  2W83 C;  1G1J A;  4G25 A;  1EDU A;  2OV8 A;  3FUD A;  2E5Y A;  2P1J A;  2ZT9 B;  2J9Q A;  1KZP A;  4KMO A;  4GZ3 A;  3PRJ A;  2KCK A;  5DJT B;  3R9M A;  1MFZ A;  1DCQ A;  4FJY A;  2QJY B;  4KBQ A;  3WU2 E;  5APS A;  2QJP C;  1BE3 D;  4BRY A;  3CSF A;  4TLF A;  5KLV K;  1KIL A;  2G3A A;  2K3R A;  1SQV G;  1U57 A;  2CFZ A;  3NMD A;  3V4W A;  3H1H E;  2YMK A;  1ELW A;  2QFC A;  1YCS B;  5B3S E;  3TDK A;  1IFM A;  3KDP B;  5CCH A;  5LCW J;  2JEK A;  1SVX A;  4EI2 A;  3PH0 A;  1N86 A;  1YBK A;  1H89 A;  1QVF O;  1VF5 C;  1HBW A;  1QQE A;  3V6I A;  3HD7 A;  1GD2 E;  1FZF A;  1UN8 A;  3PH0 C;  4HOU A;  2LUH A;  4EQF A;  2R3C A;  1LJ2 A;  2FYN B;  3U64 A;  1BE3 G;  4LUN U;  3C3Q A;  3LVR E;  2ZGD A;  1N73 A;  4W7Z A;  1OW6 A;  2BCC D;  3IN6 A;  4E85 A;  3T97 B;  2H8P D;  2JDI H;  1N73 C;  4LER A;  5ITZ F;  2I1J A;  2DZN A;  1QEX A;  1S9K D;  1X81 A;  2N9Y B;  2M5A B;  3M9Q A;  5EID A;  2ZGG A;  1K8K G;  5EKQ D;  3KAE A;  4CCA A;  1JB0 J;  5CMZ A;  2J5U A;  2ETA A;  5LX8 A;  4GT1 A;  2AEM A;  4I6G A;  4N78 D;  2K37 A;  2KB7 P;  1LGH B;  5BXO A;  3AEE C;  1MZ9 A;  1H8A A;  1AFO A;  4XE5 B;  1VQ6 P;  3Q75 A;  3ULQ A;  4BT8 A;  1Q86 Q;  5AVZ B;  2GRP B;  3ASO E;  4LNU D;  3CQC B;  2B88 A;  1IYG A;  3H32 B;  1NTM D;  4GML A;  1ZN5 A;  1VF5 D;  3IBE A;  4A1S A;  2NC9 A;  2R5S A;  3IEG A;  3E7K A;  3B5N B;  1JY2 O;  1G1I A;  1OCC E;  3R2P A;  3Q9N C;  4O9B A;  3Q5S A;  2FO1 E;  4AUW A;  1Q82 Q;  3HDX A;  3FFL A;  4CYM D;  1BLX B;  4CDR A;  2WXG A;  1K9M Q;  2D2C B;  1KLX A;  1UJK A;  1NTM G;  3ABK E;  3C5R A;  3PNL B;  4LCT A;  5ANR A;  1HU3 A;  3S7F A;  2F37 A;  3GZ1 A;  2EIN E;  2ZVN B;  2QM7 A;  2WMM A;  3D9O A;  2K88 A;  3ZVV A;  5AEN A;  3WXX A;  5AVS B;  4JXT A;  4JB8 P;  1SQP K;  4QFV A;  3T5X A;  3N71 A;  2V4H C;  5JMN D;  3HIZ A;  3EIJ A;  2XRZ A;  5E75 A;  5B5E H;  3Q9U C;  4TUU A;  1NTM K;  1EZV E;  4I43 A;  2V4H A;  1PGP A;  3S7D A;  3MA5 A;  2WQY C;  1OW8 A;  4EHM A;  4ILH B;  3H1I E;  3MKQ B;  5GTH E;  4GTM A;  2O1J A;  3QH9 A;  1S63 A;  4I2Z A;  4PS8 A;  3ZYK A;  2KCL A;  3B7T A;  5EIB E;  1S9K E;  3NXS A;  4W7Y A;  3Q15 A;  1BDD A;  2MYO A;  3OTN A;  3UMV A;  4J7W A;  1H88 A;  2BCC E;  4JVS A;  5KBA A;  4MKT A;  4FP7 A;  4FC8 A;  3I4G A;  3UIP C;  2R32 A;  1BI7 B;  3U1A A;  2WPS A;  3Q5P A;  3CL3 D;  2BF0 X;  1NU1 J;  4WY4 B;  4FLB A;  4U04 A;  2WVI A;  5APY A;  2Y4U A;  3L73 G;  3MYV A;  2VSY A;  3ASD A;  4GB9 A;  4IRU A;  1NOH A;  4J8F A;  3EJN A;  2IYP A;  3CVL A;  3R9A B;  5CHE E;  1PPJ E;  3HE5 A;  3CLQ A;  1FCH A;  1FJK A;  4EBA A;  2X6J A;  3C9I A;  2HPC B;  4XX5 A;  2N1T D;  2FYU K;  2B0O E;  2BCC J;  3H1I J;  4GTR A;  3NZU A;  1S70 B;  3P8C D;  5EFW B;  3HXE A;  4YND A;  2GRL A;  1H2T C;  2B87 A;  3WU2 H;  3IHY A;  2Q5U A;  4R4L A;  1GW3 A;  3ESK A;  2Z4E A;  1DD4 A;  3PZ4 A;  4DX5 D;  1PPJ D;  3R4Y A;  1E90 A;  4WND A;  4ZHB A;  1BU9 A;  1PP9 J;  3KEZ A;  3QAQ A;  2VTB A;  3C3O A;  4BXL A;  3EDT B;  3WUV A;  3FUH A;  1M1J C;  2IBZ I;  1KT0 A;  4GMJ A;  5KAI E;  1KN7 A;  3Q49 B;  3SWK A;  5KJN A;  5APQ A;  2FYU G;  2C2L A;  2YQ8 A;  2C9N Y;  3SFE C;  2P2U A;  2Y1L E;  3M9H A;  1HZ4 A;  4HOQ A;  2KUB A;  3D9M A;  1NYH A;  3AU4 A;  2Y3A A;  1H6O A;  3ASN E;  3H1L J;  3T8K A;  1QYM A;  3DEP A;  4UQY A;  3UM3 A;  1SQB E;  3GZ2 A;  2YNY A;  1N54 A;  1KOR A;  3PUJ A;  2J59 M;  4HI8 A;  1RF1 A;  2VRS A;  2WXR A;  1K05 A;  4UWK A;  4OGQ C;  1KYO I;  1W2E A;  1WG0 A;  3CWB J;  4GYW A;  1SQB K;  3ZXS A;  3EHN A;  2QIW A;  5A7D B;  1ZP0 C;  2R05 A;  3M0D C;  1M1K Q;  1HJ0 A;  5J08 A;  4YDW A;  4B93 B;  3ABL E;  1TJC A;  2WMO A;  4AEZ C;  2LSV A;  5BPP A;  3LCA A;  1M90 Q;  3PHL A;  5BUZ A;  4UWL A;  4GTV A;  3MX3 A;  4BX8 A;  5AVY B;  4XI0 A;  2E75 B;  2X6F A;  4JEU A;  1L0N J;  4LSZ E;  4EZL A;  2W90 A;  1EC5 A;  4DI4 A;  3O48 A;  1SLQ A;  1BPO A;  3LXU X;  2FXO A;  4N3B A;  3C72 A;  3WMM 0;  5AVU B;  4TT3 H;  5C39 A;  1W2B O;  3PZ1 A;  3UIN C;  3FH5 A;  1YA0 A;  1LT1 A;  4TXQ A;  3UI2 A;  4PJ0 E;  3V2X A;  1NA0 A;  1SQX G;  5M72 A;  3VMX A;  2XU6 A;  3EHQ A;  2XNX A;  5CBN A;  3I55 P;  1YJW P;  2FO7 A;  3ML9 A;  2WVR A;  4OGQ D;  4WY4 A;  2OCC E;  2RKK A;  1EDL A;  4HXI A;  4CT0 A;  1LTS C;  3ABM E;  1NTM E;  2QE7 H;  1L0L J;  1NTK G;  2E42 A;  2C0L A;  3JUI A;  1RE3 A;  3AU5 A;  4OWF A;  3HYM B;  3Q4A B;  1S5L H;  2YO2 A;  4HYT B;  4N5C A;  1IHB A;  5B5E E;  5ARF A;  1KIL B;  3FUJ A;  4I1M A;  1L0N E;  4GYY A;  2RFM A;  1KMI Z;  3UM2 A;  1L0N D;  1RF0 A;  2FYZ A;  3PS6 A;  3L16 A;  1FJP A;  1KFN A;  2AW6 A;  2XCB A;  4K03 A;  1N94 A;  3SY2 A;  2WTY A;  2GM4 A;  1E8Y A;  1FT1 A;  4RQI A;  5EYL A;  2C0M A;  1ZBP A;  5FWQ A;  4GTP A;  3G2V A;  1KQG B;  3W68 A;  1OVV A;  1TR4 A;  2RN0 A;  4BET A;  4OVU A;  3MTU E;  4NPF X;  2HLO A;  2DWZ A;  4Y6C A;  4L74 A;  4Y6W A;  1LTA C;  2HYZ A;  3S7B A;  4JHJ A;  1KD1 Q;  1HGZ A;  4W9R A;  1KV4 A;  2P58 C;  2OAR A;  3UKU G;  3VLF A;  2BTD A;  2LO6 A;  3BU8 A;  4AVX A;  3ZGQ A;  2B89 A;  3J5Q B;  4D6T D;  3FTS A;  3GW6 A;  2IU1 A;  2DYR E;  3RU0 A;  3B5N C;  2LXL A;  3LYA A;  1N4R A;  3A3Y B;  1QLE D;  4H13 C;  1OT8 A;  4HRM B;  4BFR A;  4F53 A;  5AQ9 A;  2JJL A;  3L35 A;  2I1K A;  1Y8A A;  2YKP A;  1PY1 A;  3CWB E;  1BGY G;  4K5A B;  3CCU P;  1G2C B;  3SBS A;  5HKP A;  4JPS A;  4HBD A;  2NPS B;  2XPY A;  3CVP A;  3A7O A;  2LAI A;  4OVV A;  5E76 A;  4H44 D;  3RK3 B;  2XZR A;  1FAV A;  4YDO A;  1LP1 B;  3CK8 A;  2AXC A;  3AE8 C;  1ZB1 A;  3FHE A;  4BEP A;  2ZIR A;  3CCJ P;  3L75 J;  3TWR A;  3RAU A;  2LXM A;  1M57 D;  3JYS A;  5CCM A;  1NTZ J;  3HTK B;  1T3J A;  1L5J A;  4CDM A;  2ZAE B;  2CPB A;  4U0U A;  1TNO A;  3AEB C;  1SQB D;  4H0L D;  3Q3D A;  4D6T J;  3L17 A;  3GHG B;  3L70 G;  3MUD A;  1LD8 A;  1ZR2 A;  4I6M C;  4QQI A;  1UJJ A;  1IK9 A;  3I56 P;  3DWL G;  2JP3 A;  3EU9 A;  3VTX A;  5AW0 B;  2EIL E;  3SF4 A;  1PL5 A;  3B5N D;  3ZKJ A;  3FUM A;  1UG3 A;  1DCE A;  3G71 P;  3B7B A;  3KEA A;  1N7L A;  1SQQ K;  4PH4 B;  4A3V A;  2I2O A;  2L9B A;  1Q81 Q;  3AE6 C;  3A5T A;  3CK9 A;  3B4S A;  3EWK A;  3MZL B;  2WT7 A;  4TV3 A;  3O6Q A;  3HVE A;  3EUV A;  4ILI A;  4PS7 A;  4R7L A;  3VLD A;  4G11 A;  2R2L A;  4KVO A;  3Q7A A;  5LOZ A;  2N9B A;  3CVX A;  4HQD A;  4IL6 X;  3NOG D;  3GYZ A;  4J8E A;  3HUS A;  5TIS E;  5CCH C;  3SGH A;  2Y0D A;  3L82 A;  3P8C E;  3N7N A;  2OYI A;  1JY3 O;  3HUS C;  3HTK A;  3OXG A;  1NVO A;  3FTZ A;  1JY2 N;  3HXB A;  4U3F D;  1T2K C;  2VGX B;  1TNZ A;  1USE A;  1M1J A;  3E32 A;  1LWU C;  3Q5M A;  4C9B B;  1UOH A;  4D6T E;  2KS1 A;  3AEA C;  4LGD E;  4AXH A;  1RY3 A;  4H7Y A;  2I8D A;  3FX0 A;  3KQG A;  2AXV A;  4EDF A;  3H1I G;  4E6H A;  1CZQ A;  2SPZ A;  4XKC A;  1FZC B;  4GOF A;  3EHR A;  4EOT A;  4ASW A;  2B6C A;  1A02 F;  3DST A;  3UXG A;  4C46 A;  3UKR G;  5AIJ A;  4OYS A;  3UM1 A;  5APT A;  3PRE A;  3PDN A;  3TG5 A;  2V7Q H;  3GF3 A;  2NYJ A;  4LNG A;  1JUN A;  3H1I D;  2XKM A;  2R5D A;  5B66 H;  4F6R D;  1ZOY C;  2KBX A;  1JY2 P;  3TGU J;  5CCH D;  2AXU A;  3BUA A;  4DRX E;  1IXV A;  5J90 A;  1N73 B;  4F1P A;  3PJS K;  3L75 E;  3DRA A;  5AW6 B;  2A5E A;  4M3L A;  3WUT A;  3CKB A;  1VQP P;  1NTK K;  4K5C A;  4TUM A;  4EPZ A;  2HYN A;  3H1L G;  1PV3 A;  4WWO A;  5KNH D;  1LD7 A;  5KKZ C;  3FGA D;  3BCC E;  1JNM A;  5A6C A;  4XA4 A;  1EDI A;  4GKG A;  3AE3 C;  4O60 A;  1UN9 A;  4FUL A;  2F8Y A;  3O4Z A;  2AXZ A;  2OQQ A;  2XND H;  5BVZ A;  1KTM A;  3VN0 A;  1XNF A;  3ZDM A;  3UT8 A;  2ITA A;  4G26 A;  3CC2 P;  5FIN A;  1RW2 A;  2BAS A;  3CME P;  1SA4 A;  4FHJ A;  4JYC A;  3P8M C;  3D9H A;  1YMP A;  3FTY A;  4D10 C;  1MX6 A;  3KHU A;  3SFZ A;  3FEX A;  3L73 D;  5T4Y A;  3GW4 A;  4N3C A;  1HVV A;  1IFJ A;  4JQ0 D;  3FTX A;  1RH5 B;  3C8V A;  2WPR A;  3ZPJ A;  5FZS A;  1VF5 B;  1OY3 D;  3RRU A;  3LY8 A;  3TXM A;  2P67 A;  1ZU2 A;  3ZRH A;  4YDY A;  1L2P A;  1LNQ A;  3PLN A;  2JEE A;  1HFA A;  3QWV A;  2K9J B;  4UB8 E;  2HPC A;  4HFG A;  4B0Z A;  3AS5 A;  4JA7 A;  4O6F A;  4MS6 A;  5HS0 A;  1PPJ G;  1SQQ J;  1HUC A;  4IFF A;  2Q7F A;  3FUI A;  3CR3 A;  2ION A;  2DVW A;  2Y69 E;  2QJP B;  4JZY A;  1OIP A;  1USD A;  4H13 D;  1OWL A;  2E2E A;  3JSV C;  3PRZ A;  1NU1 G;  2WIT A;  5DIZ A;  2OVB A;  5GTI H;  3F5H A;  3D9J A;  4U63 A;  1N2D C;  5G55 A;  3B5N A;  2PFX A;  4IFM A;  3T5V A;  2AEF A;  2KYV A;  3S4R A;  3PE3 A;  5EYP F;  2YKQ A;  1N95 A;  3PEV B;  4H44 C;  1PP9 D;  3ZUV B;  1M8O B;  1AQT A;  2RG8 A;  3MCX A;  1E79 H;  2KI7 B;  2IBZ G;  1KT1 A;  2Z5H A;  4JA9 A;  4BTB A;  1H6P A;  4J6I A;  1HF9 A;  3BQO A;  3IV0 A;  2YMY A;  2PZI A;  2ZIS A;  5EDS A;  1SFC A;  4L2L A;  5AYW D;  3FU0 A;  4H0L C;  1A5E A;  3S2A A;  3VTY A;  2AJA A;  1EXI A;  2KZI A;  2PQN A;  2O01 N;  1HXI A;  5TIS H;  4N5Q A;  4U0Z A;  2O01 J;  2ZJS E;  1Y47 A;  2E5T A;  4I17 A;  4KZC A;  1N11 A;  4UWF A;  1IHG A;  3IHV A;  1NTZ E;  3VMY A;  4HJG H;  3BCC G;  3L74 J;  4NIK A;  3DXK G;  4XIF A;  3S7J A;  1IKN D;  1DNP A;  4G24 A;  3HE5 B;  5E79 H;  3H1L E;  1SQX E;  2C0X A;  5AVV B;  3BG1 B;  1T6A A;  4HVB A;  3HE4 B;  3KZI H;  3L75 G;  1X0T A;  2P9S G;  2YIN A;  4U8V D;  3G2S A;  3HXD A;  3AG2 E;  3U59 A;  1K73 Q;  2XHE A;  4URK A;  3ZXP A;  3MHV A;  4BRY B;  3URZ A;  2WZ7 A;  4I6J A;  1EZV D;  2GUV A;  1D8E A;  2A06 G;  1SQP D;  1U7M A;  3OAW A;  2I6H A;  2QG4 A;  2IOS A;  1LWU B;  3MGB A;  5G04 J;  2VSO E;  5L8R J;  1NFI E;  3G3Z A;  2OYI B;  3ASF A;  3ZYM A;  1T2K D;  3AEF C;  5AW3 B;  1JCD A;  1HG5 A;  2MRI A;  3ZU7 B;  3TWX A;  5H2F H;  4NUR A;  4UWG A;  2IDB A;  3RRM B;  1FU1 A;  2FBN A;  1L0N G;  3HHM A;  3DSV A;  2Q9I A;  1PGJ A;  2OYO A;  1IFI A;  2QYU A;  1OWA A;  3L08 A;  1L4A D;  4WB4 A;  3MV3 B;  5KJL A;  2R17 C;  5G05 J;  3CHS A;  4WNF A;  3ASG A;  2M3E A;  2WSF H;  2KM4 A;  2WQH A;  5FIO A;  1HJB A;  1Y9B A;  4X8Q A;  3VLE A;  3DPD A;  2W6A A;  3B71 A;  4UWH A;  4A1G A;  3FWN A;  2RH0 A;  2OEW A;  2OVF A;  3AE9 C;  3UIA A;  5BT1 A;  3FUL A;  1J2J B;  1BI8 B;  2P9N G;  2GGF A;  3CX5 H;  4L73 A;  4GA2 A;  4YXD C;  1OWP A;  1PC2 A;  1GZL A;  5FJY A;  4N78 E;  2GRR B;  3CPW O;  3ZFW A;  2X6I A;  3E1I A;  2V5Q C;  2O3J A;  4BWN A;  5KJK A;  3PP5 A;  1FPP A;  2P2C P;  1FZC C;  3SQV A;  1L4A A;  1OW7 A;  4DI3 A;  1NJI Q;  5BV1 A;  3H25 A;  3HG0 D;  4JBZ A;  5JHA A;  2JR8 A;  1JTH B;  2IZ0 A;  3JQ1 A;  4B94 A;  2A4Z A;  1BD8 A;  4RJT A;  3PUK A;  1P84 E;  4GZD A;  1TJF A;  4ILG A;  1UW4 B;  2IFM A;  5EIL A;  4KZ0 A;  2VTB B;  3IFM A;  2PP6 A;  3V4Q A;  1EDJ A;  1JO5 A;  5ENO D;  4BSZ B;  4CRW A;  1XTG B;  1GK4 A;  3CKC A;  1ZW0 A;  1X22 A;  3OAK A;  3UM0 A;  3D6Z A;  4N3Y B;  4Y99 C;  3AG1 E;  2KAT A;  3L71 G;  3JUE A;  1KQL A;  4RLY A;  1ZV8 A;  2QY7 A;  1URQ D;  3D9K A;  5AVR B;  2Q7C A;  1PFI A;  1RQU A;  2X38 A;  1EPU A;  1A02 J;  1BGY J;  3H1H D;  3CCE P;  1JCC A;  1R5S A;  2E74 C;  5CEC B;  1K8A Q;  1BE3 E;  1IO4 A;  4BT9 A;  5ENS D;  1KYO D;  1GK6 A;  5CBO A;  2RFA A;  5CMW A;  3I4R B;  1HO8 A;  4ATZ D;  2BED A;  3D9L A;  3SI5 A;  3GHG C;  1PZQ A;  3UT4 A;  1TEZ A;  2DYS E;  1GL2 B;  1S72 P;  1OXJ A;  2BEZ F;  1AV1 A;  3L36 A;  3C98 A;  5ANL A;  3CI9 A;  4WY4 C;  2E76 C;  4C7R A;  3AG3 E;  5AVX B;  1W3B A;  4EYY Q;  3AAA C;  3PEU B;  1OCZ E;  2WXM A;  5CCL A;  2E74 B;  1IFP A;  3OXL A;  3DSW A;  1SP4 A;  4AYC A;  3V31 A;  3FUN A;  3LS8 A;  3O6Q B;  3HVE B;  2F8X K;  3IR9 A;  1FVF A;  1OUV A;  2E0I A;  4TXR A;  5APU A;  2P9L G;  4UB6 E;  1CSB A;  2E74 D;  4UI9 C;  3CCR P;  1YI2 P;  3AG4 E;  4GMR A;  1GW4 A;  1QVG O;  4I9E A;  4IOI H;  4BWR A;  1DC2 A;  5M1B A;  4B89 A;  3VMZ A;  5AW8 B;  5CER B;  2P58 A;  2MHK A;  4KHX A;  5KJM A;  3U9W A;  1NTK D;  1H19 A;  2IJG X;  3SBT B;  3PNT B;  2XCC A;  3NTN A;  2H6G A;  4DLQ A;  1LWU A;  4H7X A;  2FXM A;  2FYU J;  1VQL P;  4RSY A;  3DPY A;  1OZH A;  4CZ2 D;  2ZVO B;  1KB9 I;  1OX3 A;  4PV1 C;  4JYB A;  4HLE A;  1FC2 C;  1Q2N A;  3MP7 B;  4JHR A;  5A23 A;  5AW5 B;  2XZD G;  3L72 G;  3P7K A;  4EZJ A;  3R7R A;  1LT9 C;  2WSC H;  2UY1 A;  1QNF A;  2WXP A;  3V79 K;  1L0N K;  2J09 A;  2CHZ A;  3CQG B;  1TNY A;  4GA0 A;  5AQA A;  1AA0 A;  1NAY A;  3MV2 B;  3IKO B;  3HUS B;  2FYU E;  5BXU A;  4O1O A;  3AE2 C;  1FBM A;  3MKR A;  4F3V A;  4Q69 A;  2KNC B;  2O01 H;  4NPD A;  3TWV A;  4D6T G;  3L72 D;  2J07 A;  2LSU A;  1E7V A;  3PZD A;  1VQO P;  4DX6 D;  3D9N A;  5KAF E;  2A45 I;  2KLV A;  2KCV A;  1N8R Q;  5BW8 C;  3IAO A;  3KZI E;  4AY5 A;  3NOC D;  1SFC B;  2C0W A;  4C7N B;  1NA3 A;  2FEZ A;  3CMA P;  4RG9 A;  1FZE A;  3RKV A;  4CT4 A;  1BGY D;  5CJ4 A;  2J08 A;  3VOP A;  2Q6Q A;  4GZ6 A;  1FOS E;  1L0L K;  1L4A C;  4BX9 A;  3VP8 A;  3TGU E;  1SQX K;  1GMJ A;  1KB9 E;  1FZB A;  3Q73 A;  5ENT D;  1INZ A;  3VMA A;  1NAF A;  3CIA A;  3OXF A;  3FDH A;  1Z6T A;  4PV1 D;  3KYQ A;  2NPS D;  4LC1 A;  1LTX A;  2ETC A;  2HR2 A;  3RGU A;  4B8A A;  3ZHE A;  1LTI C;  1QL1 A;  1NI1 A;  2IPP A;  1H0T A;  2ZYG A;  3HXF A;  1NP7 A;  3G4S P;  1NU1 E;  1MHQ A;  2E75 C;  4GPK A;  3CHR A;  5B66 E;  2HE0 A;  2LAH A;  1RQV A;  2CK3 H;  4U7E B;  4I9C A;  1LP1 A;  1XGW A;  3KD7 A;  3NBN B;  3CVW A;  3H1J E;  1BSH A;  2NZ2 A;  3TAX A;  4DOJ A;  4L2Y A;  3CST A;  5KKZ B;  3HD7 C;  2D2C C;  2A45 H;  2IBZ E;  2P9I G;  1SQV D;  4WNG A;  2R59 A;  2OYH C;  1WM5 A;  3UT7 A;  1PGQ A;  4J8S A;  3ZYQ A;  5G05 C;  1NWQ A;  1A17 A;  3QWO C;  3RK2 C;  5GTI E;  3V2Q A;  5AN8 A;  2OYH A;  3K5B A;  4DLO A;  3CXH D;  2YO3 A;  3L22 A;  2YXQ B;  1JMM A;  3Q7F A;  3UIO C;  4YXW H;  2GRN B;  2XDJ A;  4CEM A;  1SQQ E;  1W5C E;  2IQC A;  3EU5 A;  1HH0 A;  1WRG A;  3CC7 P;  3CX5 D;  3C3R A;  3RK3 E;  4U7J A;  2OGU A;  3L13 A;  4IUL A;  3J5P A;  3E34 A;  2VGY A;  4I1O B;  3K9I A;  3AE7 C;  2EIK E;  3GMA A;  1URQ C;  3LID A;  2DW3 A;  3TWT A;  5T3R A;  1URQ A;  3RK3 C;  3P32 A;  3U3W A;  1BSN A;  3B7S A;  3QK0 A;  1URQ B;  2QM8 A;  4GZ5 A;  1JMB A;  1GW6 A; 
#chains in the Genus database with same CATH homology
 4MN4 C;  3T9K A;  5CBO A;  4BET A;  4NPF X;  2DWZ A;  4LG6 A;  3ZU7 B;  2RFA A;  2XEN A;  1SS1 A;  3NOC D;  3TWX A;  4CPG A;  4ATZ D;  2B87 B;  2LXB A;  1A5E A;  2M5A A;  3C5R A;  4OAU C;  1UOH A;  2KXP C;  2R44 A;  2VGE A;  2Y1L E;  3B95 A;  5HS0 A;  3TWW A;  4HB5 A;  1OVR A;  2BKK B;  5KWD A;  2KUB A;  1MFT A;  5KNG A;  2I8D A;  2F37 A;  2ETB A;  4K5B A;  2B89 A;  3J5Q B;  3TWS A;  2Q1K A;  2QVA A;  5ENT D;  4HI9 A;  3T8K A;  2WMM A;  1QYM A;  3DEP A;  2DVW A;  4EYY Q;  3AAA C;  2SPZ A;  3ZNG A;  4U8Y D;  2PNN A;  1BLX B;  4ZFH A;  2ETC A;  4HI8 A;  4ZMD A;  4HRM B;  3RGU A;  2OTK E;  4GOF A;  1OT8 A;  3TWU A;  3EHR A;  1WG0 A;  4ASW A;  5DJT B;  4JB8 P;  1N0Q A;  4QFV A;  4GOE A;  1DCQ A;  2KIK A;  5AQ9 A;  5FIO A;  3V31 A;  4DX2 A;  4WWI A;  2V4H C;  5JMN D;  3TWQ A;  3UXG A;  5DJU B;  1H0T A;  5CED B;  3F6Q A;  5JA4 D;  4K5A B;  3FXD A;  3LJN A;  1G3N B;  5ENP D;  4YDW A;  3Q9U C;  5HKP A;  4HBD A;  5EYP F;  2K3R A;  2F8X K;  2KS1 B;  4B93 B;  2KZJ A;  2DZO A;  1OVU A;  3AJI A;  1YCS B;  2Y0B G;  1MJ0 A;  4HKZ H;  2NYJ A;  5EN5 D;  4ZNC A;  3ZUV B;  4F6R D;  2LR2 A;  2HE0 A;  2KBX A;  1LP1 B;  1SVX A;  1MX2 A;  3JXI A;  3PH0 A;  2HR3 A;  5AAO A;  2KI7 B;  2L6B A;  1LP1 A;  4BEP A;  4DRX E;  2LXC B;  1BI8 B;  3TWR A;  3SO8 A;  4C48 B;  3MZW B;  3NBN B;  1IXV A;  5D66 A;  4GMR A;  2UWJ E;  4ASV A;  2M0B A;  4U96 D;  4F1P A;  4IOI H;  1YYH A;  2XZT G;  4LSZ E;  5ENR D;  4DX7 D;  5EIB E;  1DC2 A;  2A5E A;  1BDD A;  1JM0 A;  1EC5 A;  1H0T B;  2MYO A;  2QC9 A;  1ZXG A;  4K5C A;  2V5Q C;  4TUM A;  5AQB A;  4J7W A;  2ZAE B;  4HLL A;  1U7J A;  5AAR A;  2P58 A;  5HRY A;  2ZGD A;  2AJA A;  2JWD A;  2KZI A;  2XEE A;  3V30 A;  2P2C P;  4Z68 A;  3W9F A;  5CER B;  5KBA A;  4K3A A;  5KNH D;  4DUI A;  1SW6 A;  1N0R A;  1BI7 B;  5C39 A;  4N5Q A;  1AWC B;  3QWO C;  3HG0 D;  4JBZ A;  1LT1 A;  4J8Y A;  4UUC A;  4NPE A;  5AN8 A;  4A63 B;  4QQI A;  5ITZ F;  1WDY A;  2DZN A;  1EDI A;  3UI2 A;  5CEA A;  1Y47 A;  2M5A B;  3V2X A;  5EID A;  2ZGG A;  3EU9 A;  4O60 A;  1BD8 A;  4U95 D;  4G8L A;  4BER A;  1N11 A;  2F8Y A;  4CYM D;  2BKG A;  3ZKJ A;  3EHQ A;  5CBN A;  5EIL A;  4HJG H;  3DEO A;  4CZ2 D;  4OAV B;  3ZDM A;  2ETA A;  2QYJ A;  4HNA D;  4GPM A;  3B7B A;  1EDL A;  1FC2 C;  1Q2N A;  1MYO A;  3KEA A;  4NIK A;  1IKN D;  4BSZ B;  1EDJ A;  5ENO D;  2JAB A;  3UTM A;  1ZW0 A;  4K35 A;  5FIN A;  2XZD G;  2B0O E;  5BXO A;  3W9G A;  1EDK A;  4GOD A;  3IXE A;  1S70 B;  3J5P A;  3FXE A;  3HRA A;  4G8K A;  1MX4 A;  5EFW B;  3D9H A;  1YMP A;  1MX6 A;  3V79 K;  4LNU D;  3JUE A;  2B87 A;  1IHB A;  1X0T A;  4RLY A;  4U8V D;  4KJM A;  1DEE G;  3V2O A;  2B88 A;  2QRX A;  5AQA A;  1D9S A;  2RFM A;  4HQD A;  3TWT A;  3S1K A;  3NOG D;  3MHV A;  1S3J A;  4DX5 D;  1AP7 A;  5BXU A;  2RKL A;  5AQ7 A;  4HRN A;  2XEH A;  4O1P A;  5ENQ D;  4O1O A;  4ZHB A;  1U7M A;  5CEC B;  4DX1 A;  1BU9 A;  1K3Z D;  4BXL A;  3Q9N C;  5K5G B;  1BDC A;  1OY3 D;  4HRL A;  5ENS D;  2FO1 E;  4NPD A;  3TWV A;  5EYL A;  4BES A;  1K1B A;  1NFI E;  4YDY A;  2J8S D;  3JXJ A;  4DX6 D;  1K1A A;  1NVO A;  4HB1 A;  1JMB A;  1TR4 A;  1OVV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...