5CBNA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus with chemical cross-linker ey-cbs
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
molecule keywords Maltose-binding periplasmic protein
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cbnA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cbnA01
4LG6A 1H0TB 3TWQA 5ENTD 2UWJE 2A5EA 1EDLA 5ENQD 1FC2C 4OAUC 3ZNGA 2B87A 4U8YD 2ETCA 1S3JA 2AJAA 2JABA 3NOCD 4HRMB 2ZGDA 4QQIA 3FXEA 1Y47A 4ZNCA 2DZOA 2BKGA 1MJ0A 2ETBA 1BI7B 5EN5D 4HJGH 2P58A 3NOGD 4NIKA 5AQ9A 5AQBA 3UXGA 1YYHA 1EDIA 3JXJA 2F8XK 2QYJA 5ITZF 2BKKB 1JMBA 3EHRA 1MFTA 1MX6A 3MZWB 4K5AB 2KZIA 4BXLA 1S70B 2V5QC 3DEPA 4WWIA 4QFVA 3V30A 4BSZB 3FXDA 2ETAA 1A5EA 5DJUB 3JUEA 4ASWA 5CEAA 3RGUA 2VGEA 3AJIA 5JMND 5AQAA 4K5CA 5BXUA 5ENPD 2WMMA 1MYOA 1YCSB 3J5PA 4BERA 2LXBA 5CERB 1NVOA 1OVVA 2J8SD 2XZTG 5ENRD 4IOIH 4F6RD 2K3RA 4HKZH 4HBDA 5C39A 3JXIA 4LNUD 2LR2A 2RKLA 3AAAC 4GMRA 4CYMD 1SW6A 4BETA 2DWZA 4ASVA 5EIDA 4GPMA 4TUMA 4Z68A 4U95D 4O1PA 1BU9A 2B88A 3PH0A 4GOFA 2XZDG 4JBZA 4F1PA 3TWXA 5AQ7A 1DC2A 4HB1A 4RLYA 5KBAA 5CBOA 3ZU7B 3TWRA 1EDKA 1WG0A 3F6QA 1OVRA 2I8DA 4NPEA 4C48B 4GOEA 1BD8A 2R44A 2RFAA 4G8LA 4OAVB 3EHQA 3ZKJA 2PNNA 4HRLA 3KEAA 1YMPA 1U7JA 1LP1B 2M5AB 3QWOC 2XEEA 2SPZA 4N5QA 3NBNB 1IKND 3W9FA 5JA4D 1AP7A 1LT1A 4DX6D 4UUCA 3HRAA 4DX5D 4LSZE 5AAOA 4GODA 3TWVA 1OY3D 5KNGA 2KI7B 1IXVA 4KJMA 2NYJA 5HS0A 1N0RA 4HRNA 4O1OA 5K5GB 3Q9UC 4YDYA 3V79K 1D9SA 2P2CP 1QYMA 4DX7D 2KUBA 2QRXA 5EILA 5FINA 1AWCB 1K1AA 2B87B 3J5QB 4HI8A 2M0BA 4K35A 5HKPA 4DUIA 4ZHBA 4J8YA 3UI2A 1IHBA 2ZGGA 5HRYA 2KBXA 1EDJA 4MN4C 4ATZD 2OTKE 4BEPA 3EU9A 4A63B 4HLLA 2L6BA 1LP1A 2M5AA 1ZXGA 2KXPC 2V4HC 5EYLA 3TWSA 3UTMA 4CZ2D 3HG0D 5EYPF 2MYOA 2HR3A 2XEHA 1ZW0A 3V31A 2Q1KA 5CBNA 2HE0A 3DEOA 1EC5A 5BXOA 5CEDB 4NPFX 3TWUA 2F37A 3B95A 5D66A 3T8KA 2JWDA 4DX1A 1K3ZD 2KZJA 1BDCA 3TWWA 1JM0A 3MHVA 2DVWA 5KNHD 1SS1A 4ZMDA 4YDWA 1TR4A 4HB5A 2B0OE 1UOHA 3IXEA 3T9KA 1Q2NA 1NFIE 3V2XA 1G3NB 3ZUVB 4O60A 5DJTB 1BI8B 4DX2A 5EIBE 1DCQA 1WDYA 2Y0BG 5KWDA 2Y1LE 2LXCB 1H0TA 3SO8A 4EYYQ 4NPDA 2QC9A 3B7BA 3LJNA 4JB8P 3W9GA 1N0QA 2ZAEB 1SVXA 3D9HA 3C5RA 2XENA 5AN8A 5CECB 1DEEG 3Q9NC 3ZDMA 2RFMA 2B89A 2F8YA 2QVAA 1U7MA 4HQDA 5ENOD 5AARA 5EFWB 4CPGA 1OT8A 4G8KA 1N11A 2KS1B 1OVUA 2KIKA 4B93B 1K1BA 4U96D 1MX2A 4J7WA 4HNAD 3V2OA 3S1KA 1MX4A 5FIOA 4BESA 4K5BA 4U8VD 4DRXE 4K3AA 2DZNA 1BLXB 1BDDA 2FO1E 5ENSD 4ZFHA 3TWTA 4HI9A 1X0TA
chains in the Genus database with same CATH superfamily
5B5EH 2GUSA 2A5EA 4B0ZA 4B89A 3EFGA 2WT7B 1LTGC 2WPSA 4DPRA 3W67A 4I6EA 2YXQB 3A5TA 1KYOI 1L4AB 3HD7C 2K88A 1JY2P 2P2UA 1AA0A 4GB9A 4DK5A 1KQGB 3LY9A 1L0LG 3UKUG 3VTYA 3ZPJA 3CKBA 1EZVG 1BPOA 2RKLA 2YHCA 3SFZA 4M3LA 3AS5A 4HOSA 1SQXJ 3E34A 1H19A 3CHPA 2LSVA 2AXTE 3SWKA 2L5GB 2FYZA 1RF1B 2WPVB 1KFNA 3ESLA 2G3AA 1EYHA 3UM1A 1TNBA 2ZT9B 1WRGA 1UN9A 1HUCA 1D8EA 5CCHD 3GW4A 4PS3A 2Y9ZA 1HH0A 4N5QA 3RRUA 1YJNP 2Y4UA 3FUMA 5KLIC 2C0XA 2KI7B 1OXJA 5HS0A 3TXNA 3MP7B 1HE8A 2L0TB 3FU6A 3V79K 1FZAA 2FXPA 1NTKK 3I5PA 2QJKC 4DUIA 2WXLA 2ZGGA 5HRYA 1Q2ZA 4U3FE 2FYUD 1X79B 2V4HC 1MFZA 4GAAA 2XCCA 3U3WA 1LTXA 3FULA 4EECA 3SY2A 4GZ6A 4IRUA 2YINA 3HXBA 3TWUA 4C7NB 5KAIH 2JWDA 2ZXEB 3PH0C 3H1KE 3CWBE 1SQQJ 3PLNA 4FHKA 1R5LA 1SQVJ 3CCRP 3JYSA 3Q7AA 3T9KA 3C8VA 4V3IA 1GZLA 2QE7H 4C7RA 3MKQA 2OGUA 3O4ZA 2Q7CA 1N7SA 3ZXSA 2KIKA 4ZKPA 1MX2A 4J7WA 3V2PA 4Z1MH 3V2OA 4XFJA 4K3AA 2GRMA 2KSJA 1KYOE 4LG6A 3RO3A 2NPSB 3V6IA 1CI6A 1TNUA 4TT3H 1S64A 5EX0A 4BFRA 1Z5SC 3CX5E 1HZ4A 2R32A 2R5BA 1H6KA 5FQ8A 3LVQE 3VLFA 3IV0A 1PP9D 1MFTA 2BUGA 3B71A 2VGYA 4GTTA 3L71E 5DJUB 1A5EA 4K03A 4K5CA 1R8EA 1MYOA 3R7QA 4YVQC 1VF5D 5ENRD 3IHYA 3CVUA 4B8AA 2CFUA 4KVOA 4A55A 1CI6B 1FZBA 2H88C 1EXIA 1MZ9A 2B88A 3PH0A 2DW3A 2WSCH 4HB1A 5KBAA 2KB7P 5FZSA 1Y6IA 1AVYA 3PNTB 2WXFA 3AE5C 1V55E 1GMJA 3WUUA 3PDNA 1NA3A 4AXHA 3PUJA 1AP7A 1VQPP 1LT1A 2IO3C 3HRAA 5GTHE 5AW4B 1JTHA 1H2UA 2A5UA 2M3BA 3BCCD 1M57D 2KC7A 3PVLA 3Q9UC 1IFNA 3MV3B 3D9PA 2W6JH 4URKA 2WSFJ 3ZHEB 3L17A 2DBAA 2B87B 2FI7A 3KD7A 4E85A 2O1KA 4I2LC 4WNGA 3UI2A 2YMKA 4J8DA 4C7NA 1IHGA 4PJ0E 3EU9A 2YKOA 3NZSA 2RMZA 4RO0A 3NFQA 2Y4TA 3PZ2A 2HR3A 1P5QA 1E7VA 3ZVVA 2KM4A 2X6KA 4C0EA 1SLQA 3D9MA 3II6A 3S9OA 1FVFA 5KTBA 3KS2A 3E37A 1JM0A 1Y9BA 1OWNA 2IFUA 4ZMDA 2WPRA 4W7YA 3FUFA 2WQYC 2BEQD 3H1JD 3L71G 4AVXA 1FZCA 2UY1B 2CHWA 4CDRA 3PNLB 3N71A 5AN8A 2AEMA 3KZIH 4PD4H 4MLPA 4TLFA 3ABLE 2QVAA 1ZRTE 2YNYA 3VTXA 2Q7FA 3CCLP 3T97B 3E1IA 3S1KA 1EZVI 4GTVA 2IX7C 3N4XA 3HHMA 1FZCC 3A0BH 2PZIA 4HI9A 5CCGA 1MQSA 4YNDA 1L0NG 2E43A 2UWJE 4AQRD 2E74D 3V5BA 1FC2C 2FO7A 3CCQP 4H13C 3TJPA 1IJDB 2Z4EA 2ZISA 4FHJA 2ETBA 1N7SB 1UJJA 2IDBA 2VSXE 1ZBPA 3FTZA 4RVBA 2IJGX 3TG4A 4CGVA 3DSTA 4IL6X 3GZ2A 3OW2O 2Y0DA 4IL6H 1NU1D 5ANLA 4QMAA 1B89A 1NKNA 1EXJA 4A7PA 1SFCB 3CK9A 1BCCG 1L4AA 3RK6A 4BERA 5APXA 3LJ3A 4LNUD 4C0MA 1V54E 4KT6B 3IKOB 1URQD 1FOSF 5G04C 3HD7D 1SFCA 2AEJA 1SQQE 3PE3A 2W8ZA 3H1LE 3KHUA 2QM7A 1Z6TA 3VP8A 2WXPA 2YNQA 3HDXA 3L74D 4JW1A 3H1JG 4RLYA 3FUDA 4WY4A 3KYQA 4D6TD 1EDKA 4N2SA 1PPJD 2FBNA 1T3UA 2R44A 4UB6E 1N73A 1SQPG 5AVZB 1NTZE 1KFMA 1JCSA 3KEAA 4HRLA 1LP1B 5FT9A 3DSXA 4AOFA 2IFMA 1OY3D 3CHRA 2J4BA 3AEEC 2IBZD 2A4ZA 2P1JA 2IPPA 1OCRE 3OXGA 5CCHC 5M1BA 1QLED 3H32B 4W7ZA 4L74A 1LTBC 5BW8C 4CDNA 4MN4C 3ASHA 3CC2P 2L6BA 2N9BA 2P9NG 1E90A 3MGBA 4CZ2D 3P2BA 4OGQD 1JCCA 1K8KG 4D10C 1EZVE 3T8KA 2XEVA 1E8YA 2V7QH 4EOTA 4GZ5A 2GRNB 2P9SG 4JEUA 2J4DA 4HB5A 3ZXPA 1UOHA 1Q2NA 4U7JA 1E8ZA 4KZ0A 3M0AA 3K5BA 3Q3DA 2H6GA 2IF4A 1DIPA 3L22A 2X3MA 4EYYQ 2VYIA 3BG0B 1M90Q 3UT8A 3G9RA 1X22A 3M91A 2WSEH 3CVWA 3PZ3A 1GW6A 4CPGA 3VMZA 4RQIA 2JP3A 1NJIQ 3H1IG 5KAFH 1KZPA 3LPZA 3ZHEA 5AW1B 4B93B 3FHEA 3BCCJ 3APFA 4ZFHA 3L72E 4G23A 3HE4B 2IOSA 3CHOA 3URZA 1EDLA 1U2VG 3NZUA 4U8YD 2AJAA 2GUVA 3MIWA 1X81A 1S2EA 4HJGH 1SVFA 2P58A 5AQBA 5FQ6A 1QX8A 3JXJA 1KILC 1T2KD 1PZQA 1GL2C 2XRYA 1YTZI 3FUJA 2O1JA 4F1SA 3AE6C 2GROB 4MKTA 3SFDC 3DBSA 3RGUA 1ZR2A 2BTDA 1SQBE 2XZTG 4N3BA 4WWNA 3PS6A 1PPJE 2AW6A 4JZYA 3FTSA 3RBZA 1AV1A 1Z56A 1GU4A 3CSFA 3ZRHA 4TUMA 1INZA 1BU9A 2FYUG 3H1LD 3AEAC 3LW5J 3FWVA 1N9AA 1BGYD 3UKRG 3TNUB 4BWRA 1NYHA 2OYOA 1YQ3C 4RKUJ 2C0LA 2RFAA 3FTWA 2PQRA 1U7JA 5CJ4A 2NPSA 3D3MA 2O01J 1W5CE 5HQ8A 1N8RQ 4GZ3A 4YDOA 1OWPA 1PL5A 3QDNA 2KUBA 3P8MC 1O5MA 3WMM0 4DCKA 1NTKJ 1LTAC 2J9QA 3L72G 3G6EP 3HVEB 3MKQB 4TUUA 3FUHA 3JUIA 3D9IA 2WSCJ 1FPPA 2LXLA 3ZYQA 4G26A 1HGZA 3HG0D 3CVLA 1A17A 5KKZC 3V31A 1EC5A 4ACKA 2KNCA 4HYTB 2KZTB 3FH7A 4WUYA 2WPQA 4AY5A 2YHEA 1OIPA 2Q5UA 3L70D 4PUCA 2JJLA 2EILE 1GL2D 4BTAA 1GK6A 4XIFA 3JCUE 1NU1J 1SA5A 2ZU6B 3SO8A 2FYUJ 1H0TA 4JB8P 1SA4A 1DNPA 3C5RA 5BU8B 2J07A 5T4YA 4APOA 5G55A 2KZTA 4GU5A 5TISE 2KS1B 1N7LA 1ELKA 1NTMG 1FS0E 2LAIA 4MBGA 3SBSA 3B5NB 3K9IA 3JCKC 4NRHB 3WUTA 1YHQP 3JSVC 1OFCX 3DWLG 1HJ0A 2Q6QA 3MA5A 3GZ1A 4GA2A 2E76B 3OAWA 3SWYA 1ZU2A 5AIJA 2E74B 4FC8A 3P7KA 1BI7B 4YDEA 4JHRA 2XZRA 1YYHA 3D6ZA 3O48A 5FZQA 3BCCE 1WY6A 4U07A 2XS8A 2R02A 4I2WA 3EQ2A 3FXDA 3L73J 2CG3A 4WNFA 1HG5A 2IFNA 1PP9G 3CK8A 3EHMA 3Q1MA 2GM4A 2WITA 1PV3A 1L0LE 1BSNA 3CVXA 3BATA 4F3VA 2AEFA 5GTIE 4W80A 3FTYA 1A02J 3U66A 2X6HA 1KQLA 4M7CA 2BCCJ 1SZAA 4AY6A 3W68A 5KLVK 2WXGA 3L74G 3OXLA 1KB9E 3UIPC 1PGJA 5AVTB 3FDHA 2HR2A 3B7UX 2R5DA 3ULQA 4BTBA 1SQVE 2E42A 4J8SA 2PQNA 1LT9B 1NTKD 2P67A 4U04A 4KJMA 3CXHD 3TL5A 1PP9E 4BWNA 3AG4E 1QQEA 2QRXA 3PEUB 2E75B 4RG6A 3S4RA 3SFXA 1L5JA 1BE3E 1PFIA 5AW2B 5LP0A 2PAJA 3TWSA 3UTMA 3WUVA 1JWFA 3CMAP 1HG2A 1JOCA 5D2MC 3AE4C 2KCKA 1S5LX 1Y8AA 3H1LJ 5LCWJ 4WB4A 2XDJA 3DXKG 3AU4A 4GTSA 3ZUVB 1L2PA 1JY3N 2ZXWE 3QB2A 4OVNF 4UB6H 2ZAEB 1HBWA 3V2NA 4HOUA 2H6FA 4J0UA 3ISMC 5CECB 3EIQC 3L13A 3G71P 3RK2B 2XV5A 2E74C 3SFEC 4DT0A 3CGHA 3G2UA 2WB2A 1LJ2A 4L75A 4K5BA 2OYIB 1USEA 3TGOA 3SQVA 2JDIH 4LGDE 4H7YA 4PD4D 1OUVA 2QJPB 1VQ4P 3HXCA 4OAUC 3H32A 4GIFA 4WBAA 2FYNC 5BUZA 1BE3D 2LAHA 4QQIA 3R4YA 4UI9J 3UQ3A 1HWTC 2R5SA 4HORA 1LTJC 5E76A 5JHAA 2FULA 3B5NA 3CXHE 1KTMA 2B9BA 5CMWA 1KYOH 4FADA 2H7HA 1JNMA 2ETAA 3FWLA 5CEAA 1SQVD 5ARFA 3ONKA 1EF1C 4UWGA 1XNFA 3FEYA 1LF8A 1LD8A 2XPYA 4LNBA 4H0LD 2IO2C 4I6GA 3H6PA 2I9CA 4XEIG 2IZ0A 3UM0A 4L9PA 2ZJSE 4O1PA 2M63A 1SQXK 3KXDA 3UT7A 3IR9A 3WG7E 1MKMA 4ACLA 4AYCA 4GOEA 5CRVA 2HYNA 1L0LD 4I9EA 1UG3A 5AW0B 1YMPA 2A06D 2ITAA 2YO2A 2CHXA 1FOSE 1RE3A 1LTIC 4I1LA 2KCVA 2JKVA 3TWVA 2E75D 1IXVA 2NYJA 4AJWA 1D9SA 2D2CC 2P2CP 3O6QA 5FINA 4M3OA 4A1GA 3RO2A 1AQTA 2KXPB 4J8YA 2VGXB 4H7XA 4PJ0H 3B7SA 5EYLA 1ZXGA 3UMVA 3PJSK 3T97A 3Q79A 1UIIA 2GRPB 1M1JC 1JMMA 2Q1KA 2WM9A 3PRZA 2F37A 3LDZA 2MKVA 4BY6A 2KZJA 3L74J 4U63A 3SZ7A 2Q3EA 3TWWA 1IK7A 2EIKE 2UY1A 3A3YB 4OGQB 4BSXA 3AE9C 3F5HA 4GTMA 2BCCG 3WXXA 1DCQA 3TDKA 2QC9A 2H8PD 5AYWD 4GTOA 2R3CA 3ZDMA 2VJ8A 4HQDA 2CFZA 5EFWB 2W83C 3CXHH 2QJKB 5B66E 1N11A 2HM8A 1X9VA 4DRXE 1NHLA 5ENSD 3RRMB 3ZYKA 5ENTD 1JCQA 2VTBA 2N1TD 2OQQA 4EZKA 4Y99B 5ANRA 3UIAA 2EINE 2B87A 1N95A 4HRMB 2C0MA 3Q5MA 1WMKA 1HU3A 1KMIZ 3SFYA 3HE4A 1SQMA 2IONA 4BX9A 1FZFA 2KATA 5DBKA 3L75E 3AEFC 4O9BA 1U3CA 1IC2A 1N7SD 1OCCE 4UQZA 4JF7A 2JEKA 2W6AA 5AQAA 1L0NK 3M0DC 5DIZA 4KZCA 3ZW3A 3V2RA 3J5PA 4CT0A 3MCXA 3D9OA 3FUNA 1IYGA 1RQUA 2KLUA 4CGWA 3PTZA 1BGYE 1IFMA 2WZ7A 3LYAA 4GOFA 3AU5A 1N86A 2K9YA 1HFAA 2R05A 4XI0A 3H1HE 3TGUG 3FH5A 3S7FA 4F7AA 1JY3P 2C0WA 3CC7P 1IFIA 2OOEA 5D0OD 3ZGQA 4AM9A 3SSUA 2H43A 3RRNB 3FP3A 5JA4D 4JXTA 5LX8A 1OCZE 3VOPA 3MGNA 1BCCE 2LO6A 2H6HA 5CMZA 3H25A 3R7RA 1Z3YA 3L72J 4Y28J 1DX7A 2CHZA 4E6HA 1DD4A 4KT0J 2VSOE 3NXSA 2VGXA 4I9CA 4LCTA 1SQPD 3HUSA 2V5FA 1LP1A 3NQPA 3L72D 4UI9C 5CEDB 2E5YA 4N3CA 3HXEA 2ZFCA 3CV0A 2K1AA 4P29A 4WY4B 1H88A 2R59A 1AFOA 4ILGA 3L37A 3ASGA 1G3NB 4L1BA 1KORA 2QM8A 1M7LA 2ZYGA 3LCAA 5BU5A 3BQOA 1NU1K 2GGFA 3Q9NC 2PL2A 5ENOD 3M06A 3OA7A 3UPVA 2AXUA 1EZVD 1NGMB 3R9MA 2JEEA 3CCVP 3I56P 2UWJG 2ZXXA 1BDDA 1PP9J 2VRSA 1T2KC 4APFA 4C46A 4BT9A 2OYHA 3L73G 1VF5B 4Q96A 1N73C 1GK4A 2ZGDA 1U57A 3KDPB 1MHQA 1S72P 3SNXA 1N4PA 1MJ0A 4CEMA 3G3ZA 1M1JA 3ASFA 2WXQA 3V4WA 3HTKA 1FZEA 2P9KG 3AEGC 3CHMA 4U7EB 2BKKB 4H13D 1NTKE 3EU5A 5CCHA 3EWKA 4U8HA 1WAO1 2CK3H 3AJIA 2QG4A 2MJZA 1IK9A 1NTMJ 4ZKUA 3B7TA 2NPSD 1RF1A 5CERB 5CCGD 1HS6A 1XTGB 4OH8B 4F6RD 2WXJA 3AE2C 2YMYA 3Q75A 1FZCB 1SW6A 1VQKP 4GYYA 3ABME 2I1KA 2MHKA 3U1CA 3MKRA 5AQ7A 1NU1G 1SQQD 3CCEP 3LEWA 1NL4A 4UWKA 3Q2YA 3QWWA 2BASA 2I8DA 1KQSO 3E7KA 2DIWA 4EBAG 2JLBA 4HXIA 1TN7A 3LY8A 3B4SA 3P8CE 1M8OB 3GLMA 1K04A 3HD7A 3IAOA 3NAWA 2FXOA 1PC2A 1IQUA 3L73D 3IF4A 5AW7B 2KSEA 3FFLA 3J5QB 1E8WA 1OCOE 1PIXA 4XKCA 4ILIA 2X38A 1JTHB 3ML8A 2LSUA 5E79E 1S5LE 2HODB 1WT6A 3CVPA 2Y9YA 4L2LA 1TU3F 2BEDA 1LTJA 2P7JA 4I6JA 4ANVA 3GHGA 1RW2A 4LRZA 3A0HH 2OYIC 1OW7A 2YIUC 2DYSE 1K3ZD 3LXUX 3RL0C 3TGUJ 2DVWA 2HYZA 4YDWA 4C9BB 2PGDA 1GW4A 4JPZB 1CSBA 2OTLP 3H1JJ 2FYNB 4FJYA 3PRJA 3PREA 1W3BA 1J2JB 4DI4A 3QH9A 1S63A 3H1JE 1Q81Q 3RAUA 3HRNA 3IN6A 5CJ0A 3KZIE 3VN0A 1LTTC 1ZV8A 2B89A 5AVRB 3L70E 4G8KA 3VLDA 1OVUA 4FULA 3C3QA 2OV8A 3G2SA 5FZRA 2ZVOB 1JY2O 2HO1A 4AP2A 1FDIA 4MS6A 1J1EC 1IFDA 4AV7A 4HH2A 3ZNGA 3BUAA 3AEDC 4ZNCA 2NPSC 4B86A 2ZT9C 1HVVA 1YJ9P 2J5UA 3Q15A 3P32A 3EJNA 3D9KA 1URQC 2JR8A 2LKMA 2J09A 4TV3A 4BXLA 3APDA 4LERA 2QYUA 3JUEA 2XU6A 1UW4B 1SZ9A 3AG3E 2WQHA 4G1TA 2HFED 4RESB 3G2WA 5GTIH 1W2EA 1W2BO 1QVGO 2KS1A 3TK1A 3OXFA 5D0QD 2D2CB 3U9WA 1OW8A 3MJWA 1NH4A 3L71J 3OAKA 1S0PA 1Q90D 3HE5B 4FP7A 3SGHA 2H6IA 3BG1B 1BD8A 3TXMA 4I7ZB 2FYUK 2IYOA 4TXPA 1SQPK 4FLHA 2XEEA 1GL2B 1H6OA 1PPJG 2PP6A 4DOJA 3MYVA 4U0UA 3L71D 3USSA 2AVPA 2ZYDA 4LSZE 2L9BA 2V4HA 2FXMA 2WXOA 3ESKA 3M9QA 1K9MQ 2XKMA 4XE5B 1P84I 4OGQC 2KLVA 5A7DB 3B8EB 1JO5A 5AW8B 4K35A 2YIUB 4LNGA 4N5CA 4PDXA 1FDOA 2Z5IA 3NTNA 1K8AQ 3ASDA 3RBXA 4HFGA 2WTYA 2I6HA 2HPCA 1KYOD 3VP9A 1LGHB 2QEXP 2V8SE 5EYPF 1IQRA 2HE0A 2YXRB 3SD5A 3A0BE 1TJFA 1SQPJ 2CG2A 5EX3A 1P84H 2WMNA 1RQVA 2XCBA 2FKWB 3NB2A 2ZYAA 1NFIE 3QWVA 4O60A 1NWQA 3MUDA 4GMLA 2OARA 1ZR4A 3CI9A 3TNUA 2WSSH 1XGWA 1HF8A 3MEKA 4GPKA 2NC9A 3B5ND 1OT8A 1UJKA 2JWAA 2AXCA 1QL2A 4U96D 3LVRE 4IULA 1BCCJ 3MX3A 1KZUB 1L4AD 1QGKB 1YIJP 1URQB 1E79H 4U3FD 3ASNE 2XRZA 1LWUC 1SFCD 1S3JA 5APWA 4UB8H 2WWWA 4I17A 1T8ZA 4G11A 2HLOA 2KP8A 3ZFWA 2PFXA 2R3SA 5AQ9A 1EDIA 3FEXA 5AVQB 4EHMA 2IBZE 5JJ7A 3CIAA 1MX6A 1LTJB 4QFVA 2KZIA 2V5QC 5AVSB 2D2CD 1L0NJ 4WWIA 4XA4A 1ZLLA 3CWBJ 4ASWA 1YYCA 2HODA 2P9UG 5ENPD 3RL0g 1LT9A 1N4RA 1OVVA 3H1ID 1LD7A 3QWPA 1Z3XA 5AW3B 1JB0J 3AE8C 4D6TE 3CD6P 5AENA 1IFJA 3FGAD 2VSYA 1MV8A 3G2VA 3L82A 5KAIE 3VYIA 1DC2A 3QNKA 3AE7C 1SQVG 3RJVA 1FU1A 3H1LG 4C48B 1VQMP 4CDMA 1SQQG 1VDFA 3CQCB 3CEQA 3EHQA 5G2NA 4Q94A 1N4QA 3QAQA 1JY2N 1IKND 2WVRA 3CVYA 5AAOA 2ZVNB 1NU1E 4Q69A 4NACA 2EIME 3N7NA 1JUNA 4IFDK 4WAFA 2WXNA 4X8QA 4Y6CA 1FE6A 2KCLA 3ML9A 2OTKE 5APUA 4A63B 1Q82Q 2KXPC 5ARGA 3RL0D 3D70A 1H89A 1BGYG 2P58C 1KD1Q 3DEOA 1NA0A 1KILA 4H13B 3B95A 3CCSP 3HTKB 5KJKA 3FTXA 3B5NC 1M1JB 5CMYA 4WVZA 4U0SA 1TNZA 1TR4A 3C3RA 3CX5I 4IN3B 5KJMA 1N73B 4UWLA 4A3TA 2A45G 3DXMG 3BASA 5ENNA 1LT9C 2IY0C 3CQGB 2N1TB 1KB9H 3BVHA 3LJNA 2W6BA 3T8MA 3LKUA 1DH3A 3LS8A 2RFMA 2Y3AA 3CMEP 1L0LJ 3GF3A 1N94A 1ZP0C 3Q4AB 4JA9A 3JQ1A 4A1SA 2NXPA 3JQ0A 3DPYA 1KLXA 2FO1E 1HO8A 5H2FH 1NP7A 4IL6E 4EBAA 3MV2B 2I2OA 3U64A 1Y47A 4PV1D 1H8AA 1NO4A 1RE3C 3BRTB 3VMAA 1GTWA 3C98A 5KLVG 2J08A 4BRYA 2P9PG 2FFDC 5ITZF 4WY4D 1RF0C 4K5AB 4BSZB 1S70B 4A3VA 4GZCA 3CCMP 3CLQA 4TRQA 2P9IG 4JYBA 4N39A 2RD0A 4GMJA 3DSUA 2A06E 1YCSB 2LXBA 1NVOA 3ENEA 3VTPC 4IOIH 3DSWA 4GTPA 4I2ZA 2YO3A 3JCUH 1FJPA 1NTMK 4JQ0D 4GMRA 2AWIA 1VPCA 3BRVB 5KJ7A 4GPMA 5AVWB 1L0NE 3M0DA 1L4AC 5CBOA 5L8RJ 3T5VA 4BX8A 3F6QA 4PV1B 4NPEA 1QL1A 4U0ZA 4G8LA 5JJ6A 4AEZC 3QWOC 3NBNB 4N2QA 4DX6D 1T3JA 4DX5D 4GODA 1MZCA 3HXDA 3VMXA 2QFCA 1GL2A 2L0IA 2E2EA 2Q3IA 5JHBA 3GF7A 2EQXA 1NTKG 5EILA 2R2LA 5KJLA 2M0BA 4H0LB 3RK3C 3D71A 4UB8E 1IHBA 2R03A 5TJHA 1RF1C 5C1DA 2PM6A 4Y6WA 2WXMA 4G24A 3DSSA 1DVPA 1K05A 4PD4E 3RK2C 3H1KJ 3L9TA 3X2QE 4CCAA 1AVOA 4ANWA 1TYQG 3CR3A 5D66A 4UWHA 4H44B 1KZOA 2FEZA 4H44D 4JYCA 1KILB 2MRIA 1FBMA 3IXEA 3FWNA 3U4TA 3FU3A 3HD7B 4IFFA 5DJTB 3V4QA 2OCCE 2Y0BG 1YQ4C 1VQ8P 2Y1LE 4XZ4A 4R7LA 1N4SA 4GA1A 4PS8A 3UIOC 3CVQA 4LUNU 4BESA 5FIOA 5CRUA 3F89A 2HG5D 1QVFO 1X0TA 3NF1A 4UQYA 4DX2A 5KLVE 2XGOA 4GYOA 5AVXB 5ENQD 4KHXA 2QY7A 4CRWA 3G4SP 2RN0A 5GTHH 3OTNA 1SQVK 3AG1E 3AG2E 3KQGA 5APVA 3KSQA 3ULYA 3AS4A 2QJYC 2OYHC 4N3AA 4NURA 1IFPA 3ZIMA 1LWUB 5LOZA 4EDFA 2WMMA 4OAVB 3BCCG 3SWFA 4FLBA 5EKQD 1KB9D 3IHVA 4KVMA 3H1IJ 2CPSA 4G25A 4OVUA 4HBDA 1H2TC 2LR2A 3PE4A 4JA7A 5TISH 2L6JA 4BETA 4EIJA 5EIDA 3KAEA 5KCMA 1HJBA 4ATGA 1L0ND 4L76A 3L75G 3S7DA 2QZAA 5KAFE 3TWXA 1BE3G 1O1TA 3TWRA 3HIZA 5CCGC 4PD4I 1H6PA 1HH8A 2Y0CA 3Q47B 3CHSA 5AJDA 1KB9I 1G2CB 4U3FJ 1OX3A 3E1RA 1VQ6P 2SPZA 3CL3D 2QA4P 3W9FA 3FUKA 2CPBA 3CX5H 1FT2A 1OZHA 1SQBG 2W90A 5KNGA 2XGMA 3DPDA 3QK0A 1URQA 2G8YA 5C2YA 1N0RA 2RH0A 4YDYA 2L91A 2OVBA 1RE4A 1HGVA 1QYMA 3APCA 1UN8A 2FF4A 3P1UA 4H44C 3L70J 3HYMB 2E75C 3A2AA 4LLHA 1X5BA 2GW1A 4GA0A 2M5AA 4LC1A 1NTZG 1SQBJ 1N52A 5FQ4A 4DI3A 2XEHA 2J59M 4JHKA 3L4FA 1RE4C 3Q7FA 4UI9K 3GYZA 2E76C 4U3FG 1SQQK 2K9JB 4ILHB 1G1IA 1WM5A 4JD2G 4IFMA 2A06G 4OWFA 4F1PA 1BE3J 3G2TA 1E5WA 3RL0B 1Q86Q 2E76D 4YXWH 3EHNA 3UT4A 4AUWA 2WPVA 3W9GA 1NTZK 3GHGC 3D9HA 2XENA 2OYIA 1E96B 3UM3A 1JPLA 3CLJA 4GKGA 1MX4A 1VDYA 5CHEE 2DZNA 2A45H 3MTUE 2QJYB 2OYHB 4L7TA 4I43A 1BSHA 3I4RB 4R4LA 2JO1A 1J1EB 2A45I 2DZOA 5AVUB 5H7PA 5B3SE 1OWMA 2C9NY 3HE5A 2XPIA 3UINC 2C9LY 1PGQA 1JCDA 1S9KE 1D8DA 1G2CA 5B5EE 1OWLA 5JJTA 5AVYB 4ME2A 4DZOA 4L23A 1AJYA 5B66H 4JVSA 1D7MA 4DJGA 1J1DC 1PGPA 4HKZH 1Y8MA 3AAAC 4ABNA 4JEHA 1S4XA 3SF4A 2OEVA 1OWAA 2DWZA 4ASVA 2WXKA 1EPUA 4U95D 4JBZA 1KQFB 3IEGA 4WWPA 2POHA 2QIWA 3Q5PA 4PH4B 3HUSB 4O6FA 1WG0A 1KV4A 1KN7A 1S1CX 3H1IE 1LWUA 2FBWC 5IY5E 1SFCC 1SQBD 3PHLA 2V4LA 4XE0A 4N78E 3H1HJ 1FJKA 3CPWO 2NSZA 3I55P 2BCCD 2IQCA 4KXKB 2O01N 1TN8A 3AE3C 4EI2A 1ELWA 3KSLA 4HRNA 2WVIA 4WNEA 2XHEA 3DRAA 4WWOA 2M8RA 4IYPA 4EPZA 3RK2D 1K1AA 4HI8A 4YPCA 4GCOA 1VQLP 1JUQA 2KBXA 1EDJA 1YTZT 4N6JA 4CT4A 3AS8A 4W9RA 2B6CA 1CZQA 2ZT9D 1ZW0A 5APQA 2WXRA 4L73A 4I6MC 3U59A 3AE1C 4B8CB 1GDTA 1BDCA 3RIBA 1N7SC 3MHVA 4KBQA 3TG5A 3E32A 3E4BA 4JHJA 4OYSA 3V2XA 5G05J 5EIBE 1O1RA 1FCHA 2RG8A 4NQ0A 2QSIA 3B7BA 1SVXA 5AW6B 3QKYA 3GMAA 5AARA 1SQXD 4GT1A 5HI7A 3LY7A 2XS1A 4YVOA 5APTA 3RK3D 3CVVA 4D6TJ 3SBTB 2K37A 3E30A 1H0TB 2YKQA 1VQOP 1IZNB 1X8YA 5T8IA 5KLVJ 4Y99C 4DJAA 5EN5D 2ILRA 4FU3A 4NIKA 1RY3A 2F8XK 1EQ7A 2LUHA 4XX5A 2AXZA 3EHRA 1IO4A 5FQ7A 5EDSA 3DEPA 3AEBC 3ZYMA 1PY1A 4PV1C 3QC1A 2BCCE 1HF9A 1OWOA 1KT1A 3TF5A 3ULEG 3M9BA 4N78D 1XTCC 3T5XA 1NTZD 2PRRA 3HUSC 2X6JA 3U1AA 2PM7A 1MUUA 3FH8A 4JPSA 5H2FE 1NTMD 4L2YA 3WU2E 2J49A 3EIJA 5APYA 3L74E 4FA6A 3KEZA 1OMIA 3A7OA 4GTRA 3GZSA 2QJPC 2BEZF 1P84D 3VLEA 1O1SA 3MZLB 2K9JA 5BV1A 1OVRA 3WU2H 3D9LA 1YJWP 1JCRA 3EFFK 1H0AA 3GW6A 3TGUE 2M5AB 1KILD 2P9LG 4K0RA 1OW6A 4I1OB 4ANUA 1BGYJ 3UX4A 4BRYB 1S9KD 5B1BE 1G1JA 3FY4A 2V0PA 3ABVC 2IBZI 3B13A 1NAFA 3DSVA 3FX0A 4GYWA 5T3RA 1NOHA 4HOTA 1DD3A 2J58A 1FDMA 3RKVA 3O8ZA 1N54A 5CCLA 2O3JA 2Y69E 4UWFA 1ZMEC 1FT1A 3OJAB 2XQ0A 5AVVB 2DYRE 4ATZD 1L0LK 4HLLA 4WNDA 2DCPA 2IOLA 4EZJA 2C2LA 3I3NA 4HOQA 2WT7A 2WSFH 1T6AA 5BXOA 5CBNA 3MD0A 3L16A 5BV0A 4DX1A 1N2DC 5APSA 4YTPC 3NMDA 1ZRTD 5KNHD 2N1TA 1SS1A 3PZDA 5AJLA 4WY4C 2B0OE 4PS7A 5AW9B 3GG2A 3ASOE 3CCJP 3I4GA 4MRUA 5LCWC 1BI8B 3C1LA 1HTLC 4I1AA 1WDYA 2EIJE 2GA1A 1DCEA 1AQ5A 1SQXG 4NPDA 2IU1A 3BEEA 3L54A 2IYPA 1EDUA 1RHZB 1YITP 2OTJP 3LIEA 4J8EA 1U7MA 3L08A 4BT8A 3JC22 5KKZB 2IZ1A 1ELRA 2XNDH 3FU5A 1PGOA 3CWBG 3CVNA 3E33A 3TSIA 2W27A 4J8FA 1GW3A 4G2VA 2JABA 1TN6A 3NOCD 1E7UA 3RSEG 2BKGA 4RG9A 3NOGD 1H2VC 3UXGA 3L73E 3CK7A 4HLEA 2WXIA 2OEWA 3CXHI 3MZWB 3V30A 3P8CD 1VQNP 5KJ7C 1RH5B 2FY8A 4RJTA 3B7RL 4J6IA 4ANXA 5KJNA 1LNQA 4D6TG 2VGEA 1KILE 1JY3O 5A23A 3TGUD 3QJZA 3V2QA 3PZ4A 4TXRA 1GU5A 3CKCA 3JXIA 4GTQA 2FFDA 1KT0A 1CW5A 2Q9IA 3FU0A 1FVHA 3L6AA 1NKZB 1P84E 1DEBA 3I5CA 5J08A 2AXTH 4B94A 2IBZG 3IFMA 1NZNA 5KLIB 3ZU7B 1J1DB 3KPEA 1NTME 3L35A 2PNNA 4XKBA 1ZOYC 3AECC 2VTBB 5BPPA 2OVFA 2BF0X 1HX8A 3R2PA 3CC4P 1NTZJ 3QOUA 4O1OA 5E75A 1OXZA 3SI5A 3BU8A 3CX5D 2KNCB 3D6YA 4XI9A 4HS2A 5B1AE 2GRQB 5KLVD 2MYOA 4HVBA 2I1JA 3H1HG 2X6FA 3EDTB 4EZLA 3HVEA 1R5SA 4N3YB 3RK3E 1VQ7P 2Y0EA 3Q5SA 1SQXE 1FZGA 4KYOB 1RZ4A 2NRGA 3R9AB 4GDOA 1SP4A 2LXCB 2NZ2A 3Q49B 1PAQA 1TJCA 1N0QA 1YA0A 1DEEG 2MOWA 3ZKJA 2R17C 5BT1A 3CWBD 3ZYLA 1K1BA 3H1KD 2GRLA 3A0HE 3O6QB 2HPCB 1NAYA 4HNAD 2VSNA 5FJYA 3C9IA 3D9NA 1E8XA 4JC8A 1QBQA 3Q73A 2LNIA 3C72A 3TWQA 1S5LH 2E0IA 2FYUE 2IEJA 2WQ7A 1TEZA 1UIXA 1SQPE 2WMOA 2ETCA 3PZ1A 3Q78A 3TYYA 3FXEA 3S2AA 4F53A 1M56D 3M9HA 3CSTA 1SQBK 3FTUA 4FJZA 5FWQA 2QYJA 1K73Q 1JMBA 3Q5RA 3LIDA 1KC8Q 2ZIRA 3ABKE 1BCCD 4DLOA 3D9JA 2N1TC 3ZN3A 2ONDA 5JMND 3CHQA 1KPSB 1USDA 5BXUA 2J8SD 4AIFA 2K3RA 5C39A 4EQFA 2YQ8A 1JEKA 3H1HD 3UUXA 1YBKA 5BVZA 1Q7YQ 4CYMD 5G04J 1VQ9P 4Z68A 5CHXA 2XZDG 1VF5C 1VQ5P 1TNYA 2YKPA 3ONLA 4RSYA 3TAXA 2WSEJ 1U3DA 2KOGA 5CCMA 3SHFA 4I1MA 2P10A 4TXQA 2RKKA 2X6IA 2WXHA 3MUDC 1JWGA 1GD2E 3L36A 2FFDB 3ITKA 3FUIA 2XNXA 4I7ZC 1TNOA 3FTVA 3PEVB 2KYVA 4UUCA 2XPZA 3H1KG 5J90A 2V7QJ 2WQ6A 1A02F 1LTSC 3L75D 5K5GB 1RF0A 1QNFA 2Z5HA 5KJ7D 4DX7D 1QEXA 3IBEA 3PP5A 3L70G 1M1KQ 4GCNA 1AWCB 2KK7A 5HKPA 4ZHBA 5BNWA 2E5TA 2O01H 3PUKA 3QARA 3S7BA 4BEPA 1NI1A 5E79H 3VMYA 3C3OA 3UM2A 4NPFX 3CCUP 4JL0A 3LW5H 1FAVA 5FTPA 1HXIA 5G05C 3EUVA 3RU0A 1VL2A 3FUEA 3L75J 2LXMA 5A6CA 5KWDA 4YXDC 4KMOA 1QZ2A 4DLQA 3ZEFA 2AXVA 5AW5B 2N9YB 1YI2P 2F0YA 4R4MA 2F8YA 3S7JA 3GHGB 2XGSA 4UQXA 2H89C 4OVVA 4LEUA 4H0LC 3RK3B 1ZN5A 1ZB1A 5LFAA 2GRRB 4U8VD 2VQ2A 5M72A 1BLXB 4GZDA 3TWTA 3HXFA 2M3EA
chains in the Genus database with same CATH topology
4LG6A 1H0TB 3TWQA 5ENTD 2UWJE 2A5EA 1EDLA 5ENQD 1FC2C 4OAUC 3ZNGA 2B87A 4U8YD 2ETCA 1S3JA 2AJAA 2JABA 3NOCD 4HRMB 2ZGDA 4QQIA 3FXEA 1Y47A 4ZNCA 2DZOA 2BKGA 1MJ0A 2ETBA 1BI7B 5EN5D 4HJGH 2P58A 3NOGD 4NIKA 5AQ9A 5AQBA 3UXGA 1YYHA 1EDIA 3JXJA 2F8XK 2QYJA 5ITZF 2BKKB 1JMBA 3EHRA 1MFTA 1MX6A 3MZWB 4K5AB 2KZIA 4BXLA 1S70B 2V5QC 3DEPA 4WWIA 4QFVA 3V30A 4BSZB 3FXDA 2ETAA 1A5EA 5DJUB 3JUEA 4ASWA 5CEAA 3RGUA 2VGEA 3AJIA 5JMND 5AQAA 4K5CA 5BXUA 5ENPD 2WMMA 1MYOA 1YCSB 3J5PA 4BERA 2LXBA 5CERB 1NVOA 1OVVA 2J8SD 2XZTG 5ENRD 4IOIH 4F6RD 2K3RA 4HKZH 4HBDA 5C39A 3JXIA 4LNUD 2LR2A 2RKLA 3AAAC 4GMRA 4CYMD 1SW6A 4BETA 2DWZA 4ASVA 5EIDA 4GPMA 4TUMA 4Z68A 4U95D 4O1PA 1BU9A 2B88A 3PH0A 4GOFA 2XZDG 4JBZA 4F1PA 3TWXA 5AQ7A 1DC2A 4HB1A 4RLYA 5KBAA 5CBOA 3ZU7B 3TWRA 1EDKA 1WG0A 3F6QA 1OVRA 2I8DA 4NPEA 4C48B 4GOEA 1BD8A 2R44A 2RFAA 4G8LA 4OAVB 3EHQA 3ZKJA 2PNNA 4HRLA 3KEAA 1YMPA 1U7JA 1LP1B 2M5AB 3QWOC 2XEEA 2SPZA 4N5QA 3NBNB 1IKND 3W9FA 5JA4D 1AP7A 1LT1A 4DX6D 4UUCA 3HRAA 4DX5D 4LSZE 5AAOA 4GODA 3TWVA 1OY3D 5KNGA 2KI7B 1IXVA 4KJMA 2NYJA 5HS0A 1N0RA 4HRNA 4O1OA 5K5GB 3Q9UC 4YDYA 3V79K 1D9SA 2P2CP 1QYMA 4DX7D 2KUBA 2QRXA 5EILA 5FINA 1AWCB 1K1AA 2B87B 3J5QB 4HI8A 2M0BA 4K35A 5HKPA 4DUIA 4ZHBA 4J8YA 3UI2A 1IHBA 2ZGGA 5HRYA 2KBXA 1EDJA 4MN4C 4ATZD 2OTKE 4BEPA 3EU9A 4A63B 4HLLA 2L6BA 1LP1A 2M5AA 1ZXGA 2KXPC 2V4HC 5EYLA 3TWSA 3UTMA 4CZ2D 3HG0D 5EYPF 2MYOA 2HR3A 2XEHA 1ZW0A 3V31A 2Q1KA 5CBNA 2HE0A 3DEOA 1EC5A 5BXOA 5CEDB 4NPFX 3TWUA 2F37A 3B95A 5D66A 3T8KA 2JWDA 4DX1A 1K3ZD 2KZJA 1BDCA 3TWWA 1JM0A 3MHVA 2DVWA 5KNHD 1SS1A 4ZMDA 4YDWA 1TR4A 4HB5A 2B0OE 1UOHA 3IXEA 3T9KA 1Q2NA 1NFIE 3V2XA 1G3NB 3ZUVB 4O60A 5DJTB 1BI8B 4DX2A 5EIBE 1DCQA 1WDYA 2Y0BG 5KWDA 2Y1LE 2LXCB 1H0TA 3SO8A 4EYYQ 4NPDA 2QC9A 3B7BA 3LJNA 4JB8P 3W9GA 1N0QA 2ZAEB 1SVXA 3D9HA 3C5RA 2XENA 5AN8A 5CECB 1DEEG 3Q9NC 3ZDMA 2RFMA 2B89A 2F8YA 2QVAA 1U7MA 4HQDA 5ENOD 5AARA 5EFWB 4CPGA 1OT8A 4G8KA 1N11A 2KS1B 1OVUA 2KIKA 4B93B 1K1BA 4U96D 1MX2A 4J7WA 4HNAD 3V2OA 3S1KA 1MX4A 5FIOA 4BESA 4K5BA 4U8VD 4DRXE 4K3AA 2DZNA 1BLXB 1BDDA 2FO1E 5ENSD 4ZFHA 3TWTA 4HI9A 1X0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG6 A;  1H0T B;  3TWQ A;  5ENT D;  2UWJ E;  2A5E A;  1EDL A;  5ENQ D;  1FC2 C;  4OAU C;  3ZNG A;  2B87 A;  4U8Y D;  2ETC A;  1S3J A;  2AJA A;  2JAB A;  3NOC D;  4HRM B;  2ZGD A;  4QQI A;  3FXE A;  1Y47 A;  4ZNC A;  2DZO A;  2BKG A;  1MJ0 A;  2ETB A;  1BI7 B;  5EN5 D;  4HJG H;  2P58 A;  3NOG D;  4NIK A;  5AQ9 A;  5AQB A;  3UXG A;  1YYH A;  1EDI A;  3JXJ A;  2F8X K;  2QYJ A;  5ITZ F;  2BKK B;  1JMB A;  3EHR A;  1MFT A;  1MX6 A;  3MZW B;  4K5A B;  2KZI A;  4BXL A;  1S70 B;  2V5Q C;  3DEP A;  4WWI A;  4QFV A;  3V30 A;  4BSZ B;  3FXD A;  2ETA A;  1A5E A;  5DJU B;  3JUE A;  4ASW A;  5CEA A;  3RGU A;  2VGE A;  3AJI A;  5JMN D;  5AQA A;  4K5C A;  5BXU A;  5ENP D;  2WMM A;  1MYO A;  1YCS B;  3J5P A;  4BER A;  2LXB A;  5CER B;  1NVO A;  1OVV A;  2J8S D;  2XZT G;  5ENR D;  4IOI H;  4F6R D;  2K3R A;  4HKZ H;  4HBD A;  5C39 A;  3JXI A;  4LNU D;  2LR2 A;  2RKL A;  3AAA C;  4GMR A;  4CYM D;  1SW6 A;  4BET A;  2DWZ A;  4ASV A;  5EID A;  4GPM A;  4TUM A;  4Z68 A;  4U95 D;  4O1P A;  1BU9 A;  2B88 A;  3PH0 A;  4GOF A;  2XZD G;  4JBZ A;  4F1P A;  3TWX A;  5AQ7 A;  1DC2 A;  4HB1 A;  4RLY A;  5KBA A;  5CBO A;  3ZU7 B;  3TWR A;  1EDK A;  1WG0 A;  3F6Q A;  1OVR A;  2I8D A;  4NPE A;  4C48 B;  4GOE A;  1BD8 A;  2R44 A;  2RFA A;  4G8L A;  4OAV B;  3EHQ A;  3ZKJ A;  2PNN A;  4HRL A;  3KEA A;  1YMP A;  1U7J A;  1LP1 B;  2M5A B;  3QWO C;  2XEE A;  2SPZ A;  4N5Q A;  3NBN B;  1IKN D;  3W9F A;  5JA4 D;  1AP7 A;  1LT1 A;  4DX6 D;  4UUC A;  3HRA A;  4DX5 D;  4LSZ E;  5AAO A;  4GOD A;  3TWV A;  1OY3 D;  5KNG A;  2KI7 B;  1IXV A;  4KJM A;  2NYJ A;  5HS0 A;  1N0R A;  4HRN A;  4O1O A;  5K5G B;  3Q9U C;  4YDY A;  3V79 K;  1D9S A;  2P2C P;  1QYM A;  4DX7 D;  2KUB A;  2QRX A;  5EIL A;  5FIN A;  1AWC B;  1K1A A;  2B87 B;  3J5Q B;  4HI8 A;  2M0B A;  4K35 A;  5HKP A;  4DUI A;  4ZHB A;  4J8Y A;  3UI2 A;  1IHB A;  2ZGG A;  5HRY A;  2KBX A;  1EDJ A;  4MN4 C;  4ATZ D;  2OTK E;  4BEP A;  3EU9 A;  4A63 B;  4HLL A;  2L6B A;  1LP1 A;  2M5A A;  1ZXG A;  2KXP C;  2V4H C;  5EYL A;  3TWS A;  3UTM A;  4CZ2 D;  3HG0 D;  5EYP F;  2MYO A;  2HR3 A;  2XEH A;  1ZW0 A;  3V31 A;  2Q1K A;  5CBN A;  2HE0 A;  3DEO A;  1EC5 A;  5BXO A;  5CED B;  4NPF X;  3TWU A;  2F37 A;  3B95 A;  5D66 A;  3T8K A;  2JWD A;  4DX1 A;  1K3Z D;  2KZJ A;  1BDC A;  3TWW A;  1JM0 A;  3MHV A;  2DVW A;  5KNH D;  1SS1 A;  4ZMD A;  4YDW A;  1TR4 A;  4HB5 A;  2B0O E;  1UOH A;  3IXE A;  3T9K A;  1Q2N A;  1NFI E;  3V2X A;  1G3N B;  3ZUV B;  4O60 A;  5DJT B;  1BI8 B;  4DX2 A;  5EIB E;  1DCQ A;  1WDY A;  2Y0B G;  5KWD A;  2Y1L E;  2LXC B;  1H0T A;  3SO8 A;  4EYY Q;  4NPD A;  2QC9 A;  3B7B A;  3LJN A;  4JB8 P;  3W9G A;  1N0Q A;  2ZAE B;  1SVX A;  3D9H A;  3C5R A;  2XEN A;  5AN8 A;  5CEC B;  1DEE G;  3Q9N C;  3ZDM A;  2RFM A;  2B89 A;  2F8Y A;  2QVA A;  1U7M A;  4HQD A;  5ENO D;  5AAR A;  5EFW B;  4CPG A;  1OT8 A;  4G8K A;  1N11 A;  2KS1 B;  1OVU A;  2KIK A;  4B93 B;  1K1B A;  4U96 D;  1MX2 A;  4J7W A;  4HNA D;  3V2O A;  3S1K A;  1MX4 A;  5FIO A;  4BES A;  4K5B A;  4U8V D;  4DRX E;  4K3A A;  2DZN A;  1BLX B;  1BDD A;  2FO1 E;  5ENS D;  4ZFH A;  3TWT A;  4HI9 A;  1X0T A; 
#chains in the Genus database with same CATH topology
 5B5E H;  2GUS A;  2A5E A;  4B0Z A;  4B89 A;  3EFG A;  2WT7 B;  1LTG C;  2WPS A;  4DPR A;  3W67 A;  4I6E A;  2YXQ B;  3A5T A;  1KYO I;  1L4A B;  3HD7 C;  2K88 A;  1JY2 P;  2P2U A;  1AA0 A;  4GB9 A;  4DK5 A;  1KQG B;  3LY9 A;  1L0L G;  3UKU G;  3VTY A;  3ZPJ A;  3CKB A;  1EZV G;  1BPO A;  2RKL A;  2YHC A;  3SFZ A;  4M3L A;  3AS5 A;  4HOS A;  1SQX J;  3E34 A;  1H19 A;  3CHP A;  2LSV A;  2AXT E;  3SWK A;  2L5G B;  2FYZ A;  1RF1 B;  2WPV B;  1KFN A;  3ESL A;  2G3A A;  1EYH A;  3UM1 A;  1TNB A;  2ZT9 B;  1WRG A;  1UN9 A;  1HUC A;  1D8E A;  5CCH D;  3GW4 A;  4PS3 A;  2Y9Z A;  1HH0 A;  4N5Q A;  3RRU A;  1YJN P;  2Y4U A;  3FUM A;  5KLI C;  2C0X A;  2KI7 B;  1OXJ A;  5HS0 A;  3TXN A;  3MP7 B;  1HE8 A;  2L0T B;  3FU6 A;  3V79 K;  1FZA A;  2FXP A;  1NTK K;  3I5P A;  2QJK C;  4DUI A;  2WXL A;  2ZGG A;  5HRY A;  1Q2Z A;  4U3F E;  2FYU D;  1X79 B;  2V4H C;  1MFZ A;  4GAA A;  2XCC A;  3U3W A;  1LTX A;  3FUL A;  4EEC A;  3SY2 A;  4GZ6 A;  4IRU A;  2YIN A;  3HXB A;  3TWU A;  4C7N B;  5KAI H;  2JWD A;  2ZXE B;  3PH0 C;  3H1K E;  3CWB E;  1SQQ J;  3PLN A;  4FHK A;  1R5L A;  1SQV J;  3CCR P;  3JYS A;  3Q7A A;  3T9K A;  3C8V A;  4V3I A;  1GZL A;  2QE7 H;  4C7R A;  3MKQ A;  2OGU A;  3O4Z A;  2Q7C A;  1N7S A;  3ZXS A;  2KIK A;  4ZKP A;  1MX2 A;  4J7W A;  3V2P A;  4Z1M H;  3V2O A;  4XFJ A;  4K3A A;  2GRM A;  2KSJ A;  1KYO E;  4LG6 A;  3RO3 A;  2NPS B;  3V6I A;  1CI6 A;  1TNU A;  4TT3 H;  1S64 A;  5EX0 A;  4BFR A;  1Z5S C;  3CX5 E;  1HZ4 A;  2R32 A;  2R5B A;  1H6K A;  5FQ8 A;  3LVQ E;  3VLF A;  3IV0 A;  1PP9 D;  1MFT A;  2BUG A;  3B71 A;  2VGY A;  4GTT A;  3L71 E;  5DJU B;  1A5E A;  4K03 A;  4K5C A;  1R8E A;  1MYO A;  3R7Q A;  4YVQ C;  1VF5 D;  5ENR D;  3IHY A;  3CVU A;  4B8A A;  2CFU A;  4KVO A;  4A55 A;  1CI6 B;  1FZB A;  2H88 C;  1EXI A;  1MZ9 A;  2B88 A;  3PH0 A;  2DW3 A;  2WSC H;  4HB1 A;  5KBA A;  2KB7 P;  5FZS A;  1Y6I A;  1AVY A;  3PNT B;  2WXF A;  3AE5 C;  1V55 E;  1GMJ A;  3WUU A;  3PDN A;  1NA3 A;  4AXH A;  3PUJ A;  1AP7 A;  1VQP P;  1LT1 A;  2IO3 C;  3HRA A;  5GTH E;  5AW4 B;  1JTH A;  1H2U A;  2A5U A;  2M3B A;  3BCC D;  1M57 D;  2KC7 A;  3PVL A;  3Q9U C;  1IFN A;  3MV3 B;  3D9P A;  2W6J H;  4URK A;  2WSF J;  3ZHE B;  3L17 A;  2DBA A;  2B87 B;  2FI7 A;  3KD7 A;  4E85 A;  2O1K A;  4I2L C;  4WNG A;  3UI2 A;  2YMK A;  4J8D A;  4C7N A;  1IHG A;  4PJ0 E;  3EU9 A;  2YKO A;  3NZS A;  2RMZ A;  4RO0 A;  3NFQ A;  2Y4T A;  3PZ2 A;  2HR3 A;  1P5Q A;  1E7V A;  3ZVV A;  2KM4 A;  2X6K A;  4C0E A;  1SLQ A;  3D9M A;  3II6 A;  3S9O A;  1FVF A;  5KTB A;  3KS2 A;  3E37 A;  1JM0 A;  1Y9B A;  1OWN A;  2IFU A;  4ZMD A;  2WPR A;  4W7Y A;  3FUF A;  2WQY C;  2BEQ D;  3H1J D;  3L71 G;  4AVX A;  1FZC A;  2UY1 B;  2CHW A;  4CDR A;  3PNL B;  3N71 A;  5AN8 A;  2AEM A;  3KZI H;  4PD4 H;  4MLP A;  4TLF A;  3ABL E;  2QVA A;  1ZRT E;  2YNY A;  3VTX A;  2Q7F A;  3CCL P;  3T97 B;  3E1I A;  3S1K A;  1EZV I;  4GTV A;  2IX7 C;  3N4X A;  3HHM A;  1FZC C;  3A0B H;  2PZI A;  4HI9 A;  5CCG A;  1MQS A;  4YND A;  1L0N G;  2E43 A;  2UWJ E;  4AQR D;  2E74 D;  3V5B A;  1FC2 C;  2FO7 A;  3CCQ P;  4H13 C;  3TJP A;  1IJD B;  2Z4E A;  2ZIS A;  4FHJ A;  2ETB A;  1N7S B;  1UJJ A;  2IDB A;  2VSX E;  1ZBP A;  3FTZ A;  4RVB A;  2IJG X;  3TG4 A;  4CGV A;  3DST A;  4IL6 X;  3GZ2 A;  3OW2 O;  2Y0D A;  4IL6 H;  1NU1 D;  5ANL A;  4QMA A;  1B89 A;  1NKN A;  1EXJ A;  4A7P A;  1SFC B;  3CK9 A;  1BCC G;  1L4A A;  3RK6 A;  4BER A;  5APX A;  3LJ3 A;  4LNU D;  4C0M A;  1V54 E;  4KT6 B;  3IKO B;  1URQ D;  1FOS F;  5G04 C;  3HD7 D;  1SFC A;  2AEJ A;  1SQQ E;  3PE3 A;  2W8Z A;  3H1L E;  3KHU A;  2QM7 A;  1Z6T A;  3VP8 A;  2WXP A;  2YNQ A;  3HDX A;  3L74 D;  4JW1 A;  3H1J G;  4RLY A;  3FUD A;  4WY4 A;  3KYQ A;  4D6T D;  1EDK A;  4N2S A;  1PPJ D;  2FBN A;  1T3U A;  2R44 A;  4UB6 E;  1N73 A;  1SQP G;  5AVZ B;  1NTZ E;  1KFM A;  1JCS A;  3KEA A;  4HRL A;  1LP1 B;  5FT9 A;  3DSX A;  4AOF A;  2IFM A;  1OY3 D;  3CHR A;  2J4B A;  3AEE C;  2IBZ D;  2A4Z A;  2P1J A;  2IPP A;  1OCR E;  3OXG A;  5CCH C;  5M1B A;  1QLE D;  3H32 B;  4W7Z A;  4L74 A;  1LTB C;  5BW8 C;  4CDN A;  4MN4 C;  3ASH A;  3CC2 P;  2L6B A;  2N9B A;  2P9N G;  1E90 A;  3MGB A;  4CZ2 D;  3P2B A;  4OGQ D;  1JCC A;  1K8K G;  4D10 C;  1EZV E;  3T8K A;  2XEV A;  1E8Y A;  2V7Q H;  4EOT A;  4GZ5 A;  2GRN B;  2P9S G;  4JEU A;  2J4D A;  4HB5 A;  3ZXP A;  1UOH A;  1Q2N A;  4U7J A;  1E8Z A;  4KZ0 A;  3M0A A;  3K5B A;  3Q3D A;  2H6G A;  2IF4 A;  1DIP A;  3L22 A;  2X3M A;  4EYY Q;  2VYI A;  3BG0 B;  1M90 Q;  3UT8 A;  3G9R A;  1X22 A;  3M91 A;  2WSE H;  3CVW A;  3PZ3 A;  1GW6 A;  4CPG A;  3VMZ A;  4RQI A;  2JP3 A;  1NJI Q;  3H1I G;  5KAF H;  1KZP A;  3LPZ A;  3ZHE A;  5AW1 B;  4B93 B;  3FHE A;  3BCC J;  3APF A;  4ZFH A;  3L72 E;  4G23 A;  3HE4 B;  2IOS A;  3CHO A;  3URZ A;  1EDL A;  1U2V G;  3NZU A;  4U8Y D;  2AJA A;  2GUV A;  3MIW A;  1X81 A;  1S2E A;  4HJG H;  1SVF A;  2P58 A;  5AQB A;  5FQ6 A;  1QX8 A;  3JXJ A;  1KIL C;  1T2K D;  1PZQ A;  1GL2 C;  2XRY A;  1YTZ I;  3FUJ A;  2O1J A;  4F1S A;  3AE6 C;  2GRO B;  4MKT A;  3SFD C;  3DBS A;  3RGU A;  1ZR2 A;  2BTD A;  1SQB E;  2XZT G;  4N3B A;  4WWN A;  3PS6 A;  1PPJ E;  2AW6 A;  4JZY A;  3FTS A;  3RBZ A;  1AV1 A;  1Z56 A;  1GU4 A;  3CSF A;  3ZRH A;  4TUM A;  1INZ A;  1BU9 A;  2FYU G;  3H1L D;  3AEA C;  3LW5 J;  3FWV A;  1N9A A;  1BGY D;  3UKR G;  3TNU B;  4BWR A;  1NYH A;  2OYO A;  1YQ3 C;  4RKU J;  2C0L A;  2RFA A;  3FTW A;  2PQR A;  1U7J A;  5CJ4 A;  2NPS A;  3D3M A;  2O01 J;  1W5C E;  5HQ8 A;  1N8R Q;  4GZ3 A;  4YDO A;  1OWP A;  1PL5 A;  3QDN A;  2KUB A;  3P8M C;  1O5M A;  3WMM 0;  4DCK A;  1NTK J;  1LTA C;  2J9Q A;  3L72 G;  3G6E P;  3HVE B;  3MKQ B;  4TUU A;  3FUH A;  3JUI A;  3D9I A;  2WSC J;  1FPP A;  2LXL A;  3ZYQ A;  4G26 A;  1HGZ A;  3HG0 D;  3CVL A;  1A17 A;  5KKZ C;  3V31 A;  1EC5 A;  4ACK A;  2KNC A;  4HYT B;  2KZT B;  3FH7 A;  4WUY A;  2WPQ A;  4AY5 A;  2YHE A;  1OIP A;  2Q5U A;  3L70 D;  4PUC A;  2JJL A;  2EIL E;  1GL2 D;  4BTA A;  1GK6 A;  4XIF A;  3JCU E;  1NU1 J;  1SA5 A;  2ZU6 B;  3SO8 A;  2FYU J;  1H0T A;  4JB8 P;  1SA4 A;  1DNP A;  3C5R A;  5BU8 B;  2J07 A;  5T4Y A;  4APO A;  5G55 A;  2KZT A;  4GU5 A;  5TIS E;  2KS1 B;  1N7L A;  1ELK A;  1NTM G;  1FS0 E;  2LAI A;  4MBG A;  3SBS A;  3B5N B;  3K9I A;  3JCK C;  4NRH B;  3WUT A;  1YHQ P;  3JSV C;  1OFC X;  3DWL G;  1HJ0 A;  2Q6Q A;  3MA5 A;  3GZ1 A;  4GA2 A;  2E76 B;  3OAW A;  3SWY A;  1ZU2 A;  5AIJ A;  2E74 B;  4FC8 A;  3P7K A;  1BI7 B;  4YDE A;  4JHR A;  2XZR A;  1YYH A;  3D6Z A;  3O48 A;  5FZQ A;  3BCC E;  1WY6 A;  4U07 A;  2XS8 A;  2R02 A;  4I2W A;  3EQ2 A;  3FXD A;  3L73 J;  2CG3 A;  4WNF A;  1HG5 A;  2IFN A;  1PP9 G;  3CK8 A;  3EHM A;  3Q1M A;  2GM4 A;  2WIT A;  1PV3 A;  1L0L E;  1BSN A;  3CVX A;  3BAT A;  4F3V A;  2AEF A;  5GTI E;  4W80 A;  3FTY A;  1A02 J;  3U66 A;  2X6H A;  1KQL A;  4M7C A;  2BCC J;  1SZA A;  4AY6 A;  3W68 A;  5KLV K;  2WXG A;  3L74 G;  3OXL A;  1KB9 E;  3UIP C;  1PGJ A;  5AVT B;  3FDH A;  2HR2 A;  3B7U X;  2R5D A;  3ULQ A;  4BTB A;  1SQV E;  2E42 A;  4J8S A;  2PQN A;  1LT9 B;  1NTK D;  2P67 A;  4U04 A;  4KJM A;  3CXH D;  3TL5 A;  1PP9 E;  4BWN A;  3AG4 E;  1QQE A;  2QRX A;  3PEU B;  2E75 B;  4RG6 A;  3S4R A;  3SFX A;  1L5J A;  1BE3 E;  1PFI A;  5AW2 B;  5LP0 A;  2PAJ A;  3TWS A;  3UTM A;  3WUV A;  1JWF A;  3CMA P;  1HG2 A;  1JOC A;  5D2M C;  3AE4 C;  2KCK A;  1S5L X;  1Y8A A;  3H1L J;  5LCW J;  4WB4 A;  2XDJ A;  3DXK G;  3AU4 A;  4GTS A;  3ZUV B;  1L2P A;  1JY3 N;  2ZXW E;  3QB2 A;  4OVN F;  4UB6 H;  2ZAE B;  1HBW A;  3V2N A;  4HOU A;  2H6F A;  4J0U A;  3ISM C;  5CEC B;  3EIQ C;  3L13 A;  3G71 P;  3RK2 B;  2XV5 A;  2E74 C;  3SFE C;  4DT0 A;  3CGH A;  3G2U A;  2WB2 A;  1LJ2 A;  4L75 A;  4K5B A;  2OYI B;  1USE A;  3TGO A;  3SQV A;  2JDI H;  4LGD E;  4H7Y A;  4PD4 D;  1OUV A;  2QJP B;  1VQ4 P;  3HXC A;  4OAU C;  3H32 A;  4GIF A;  4WBA A;  2FYN C;  5BUZ A;  1BE3 D;  2LAH A;  4QQI A;  3R4Y A;  4UI9 J;  3UQ3 A;  1HWT C;  2R5S A;  4HOR A;  1LTJ C;  5E76 A;  5JHA A;  2FUL A;  3B5N A;  3CXH E;  1KTM A;  2B9B A;  5CMW A;  1KYO H;  4FAD A;  2H7H A;  1JNM A;  2ETA A;  3FWL A;  5CEA A;  1SQV D;  5ARF A;  3ONK A;  1EF1 C;  4UWG A;  1XNF A;  3FEY A;  1LF8 A;  1LD8 A;  2XPY A;  4LNB A;  4H0L D;  2IO2 C;  4I6G A;  3H6P A;  2I9C A;  4XEI G;  2IZ0 A;  3UM0 A;  4L9P A;  2ZJS E;  4O1P A;  2M63 A;  1SQX K;  3KXD A;  3UT7 A;  3IR9 A;  3WG7 E;  1MKM A;  4ACL A;  4AYC A;  4GOE A;  5CRV A;  2HYN A;  1L0L D;  4I9E A;  1UG3 A;  5AW0 B;  1YMP A;  2A06 D;  2ITA A;  2YO2 A;  2CHX A;  1FOS E;  1RE3 A;  1LTI C;  4I1L A;  2KCV A;  2JKV A;  3TWV A;  2E75 D;  1IXV A;  2NYJ A;  4AJW A;  1D9S A;  2D2C C;  2P2C P;  3O6Q A;  5FIN A;  4M3O A;  4A1G A;  3RO2 A;  1AQT A;  2KXP B;  4J8Y A;  2VGX B;  4H7X A;  4PJ0 H;  3B7S A;  5EYL A;  1ZXG A;  3UMV A;  3PJS K;  3T97 A;  3Q79 A;  1UII A;  2GRP B;  1M1J C;  1JMM A;  2Q1K A;  2WM9 A;  3PRZ A;  2F37 A;  3LDZ A;  2MKV A;  4BY6 A;  2KZJ A;  3L74 J;  4U63 A;  3SZ7 A;  2Q3E A;  3TWW A;  1IK7 A;  2EIK E;  2UY1 A;  3A3Y B;  4OGQ B;  4BSX A;  3AE9 C;  3F5H A;  4GTM A;  2BCC G;  3WXX A;  1DCQ A;  3TDK A;  2QC9 A;  2H8P D;  5AYW D;  4GTO A;  2R3C A;  3ZDM A;  2VJ8 A;  4HQD A;  2CFZ A;  5EFW B;  2W83 C;  3CXH H;  2QJK B;  5B66 E;  1N11 A;  2HM8 A;  1X9V A;  4DRX E;  1NHL A;  5ENS D;  3RRM B;  3ZYK A;  5ENT D;  1JCQ A;  2VTB A;  2N1T D;  2OQQ A;  4EZK A;  4Y99 B;  5ANR A;  3UIA A;  2EIN E;  2B87 A;  1N95 A;  4HRM B;  2C0M A;  3Q5M A;  1WMK A;  1HU3 A;  1KMI Z;  3SFY A;  3HE4 A;  1SQM A;  2ION A;  4BX9 A;  1FZF A;  2KAT A;  5DBK A;  3L75 E;  3AEF C;  4O9B A;  1U3C A;  1IC2 A;  1N7S D;  1OCC E;  4UQZ A;  4JF7 A;  2JEK A;  2W6A A;  5AQA A;  1L0N K;  3M0D C;  5DIZ A;  4KZC A;  3ZW3 A;  3V2R A;  3J5P A;  4CT0 A;  3MCX A;  3D9O A;  3FUN A;  1IYG A;  1RQU A;  2KLU A;  4CGW A;  3PTZ A;  1BGY E;  1IFM A;  2WZ7 A;  3LYA A;  4GOF A;  3AU5 A;  1N86 A;  2K9Y A;  1HFA A;  2R05 A;  4XI0 A;  3H1H E;  3TGU G;  3FH5 A;  3S7F A;  4F7A A;  1JY3 P;  2C0W A;  3CC7 P;  1IFI A;  2OOE A;  5D0O D;  3ZGQ A;  4AM9 A;  3SSU A;  2H43 A;  3RRN B;  3FP3 A;  5JA4 D;  4JXT A;  5LX8 A;  1OCZ E;  3VOP A;  3MGN A;  1BCC E;  2LO6 A;  2H6H A;  5CMZ A;  3H25 A;  3R7R A;  1Z3Y A;  3L72 J;  4Y28 J;  1DX7 A;  2CHZ A;  4E6H A;  1DD4 A;  4KT0 J;  2VSO E;  3NXS A;  2VGX A;  4I9C A;  4LCT A;  1SQP D;  3HUS A;  2V5F A;  1LP1 A;  3NQP A;  3L72 D;  4UI9 C;  5CED B;  2E5Y A;  4N3C A;  3HXE A;  2ZFC A;  3CV0 A;  2K1A A;  4P29 A;  4WY4 B;  1H88 A;  2R59 A;  1AFO A;  4ILG A;  3L37 A;  3ASG A;  1G3N B;  4L1B A;  1KOR A;  2QM8 A;  1M7L A;  2ZYG A;  3LCA A;  5BU5 A;  3BQO A;  1NU1 K;  2GGF A;  3Q9N C;  2PL2 A;  5ENO D;  3M06 A;  3OA7 A;  3UPV A;  2AXU A;  1EZV D;  1NGM B;  3R9M A;  2JEE A;  3CCV P;  3I56 P;  2UWJ G;  2ZXX A;  1BDD A;  1PP9 J;  2VRS A;  1T2K C;  4APF A;  4C46 A;  4BT9 A;  2OYH A;  3L73 G;  1VF5 B;  4Q96 A;  1N73 C;  1GK4 A;  2ZGD A;  1U57 A;  3KDP B;  1MHQ A;  1S72 P;  3SNX A;  1N4P A;  1MJ0 A;  4CEM A;  3G3Z A;  1M1J A;  3ASF A;  2WXQ A;  3V4W A;  3HTK A;  1FZE A;  2P9K G;  3AEG C;  3CHM A;  4U7E B;  2BKK B;  4H13 D;  1NTK E;  3EU5 A;  5CCH A;  3EWK A;  4U8H A;  1WAO 1;  2CK3 H;  3AJI A;  2QG4 A;  2MJZ A;  1IK9 A;  1NTM J;  4ZKU A;  3B7T A;  2NPS D;  1RF1 A;  5CER B;  5CCG D;  1HS6 A;  1XTG B;  4OH8 B;  4F6R D;  2WXJ A;  3AE2 C;  2YMY A;  3Q75 A;  1FZC B;  1SW6 A;  1VQK P;  4GYY A;  3ABM E;  2I1K A;  2MHK A;  3U1C A;  3MKR A;  5AQ7 A;  1NU1 G;  1SQQ D;  3CCE P;  3LEW A;  1NL4 A;  4UWK A;  3Q2Y A;  3QWW A;  2BAS A;  2I8D A;  1KQS O;  3E7K A;  2DIW A;  4EBA G;  2JLB A;  4HXI A;  1TN7 A;  3LY8 A;  3B4S A;  3P8C E;  1M8O B;  3GLM A;  1K04 A;  3HD7 A;  3IAO A;  3NAW A;  2FXO A;  1PC2 A;  1IQU A;  3L73 D;  3IF4 A;  5AW7 B;  2KSE A;  3FFL A;  3J5Q B;  1E8W A;  1OCO E;  1PIX A;  4XKC A;  4ILI A;  2X38 A;  1JTH B;  3ML8 A;  2LSU A;  5E79 E;  1S5L E;  2HOD B;  1WT6 A;  3CVP A;  2Y9Y A;  4L2L A;  1TU3 F;  2BED A;  1LTJ A;  2P7J A;  4I6J A;  4ANV A;  3GHG A;  1RW2 A;  4LRZ A;  3A0H H;  2OYI C;  1OW7 A;  2YIU C;  2DYS E;  1K3Z D;  3LXU X;  3RL0 C;  3TGU J;  2DVW A;  2HYZ A;  4YDW A;  4C9B B;  2PGD A;  1GW4 A;  4JPZ B;  1CSB A;  2OTL P;  3H1J J;  2FYN B;  4FJY A;  3PRJ A;  3PRE A;  1W3B A;  1J2J B;  4DI4 A;  3QH9 A;  1S63 A;  3H1J E;  1Q81 Q;  3RAU A;  3HRN A;  3IN6 A;  5CJ0 A;  3KZI E;  3VN0 A;  1LTT C;  1ZV8 A;  2B89 A;  5AVR B;  3L70 E;  4G8K A;  3VLD A;  1OVU A;  4FUL A;  3C3Q A;  2OV8 A;  3G2S A;  5FZR A;  2ZVO B;  1JY2 O;  2HO1 A;  4AP2 A;  1FDI A;  4MS6 A;  1J1E C;  1IFD A;  4AV7 A;  4HH2 A;  3ZNG A;  3BUA A;  3AED C;  4ZNC A;  2NPS C;  4B86 A;  2ZT9 C;  1HVV A;  1YJ9 P;  2J5U A;  3Q15 A;  3P32 A;  3EJN A;  3D9K A;  1URQ C;  2JR8 A;  2LKM A;  2J09 A;  4TV3 A;  4BXL A;  3APD A;  4LER A;  2QYU A;  3JUE A;  2XU6 A;  1UW4 B;  1SZ9 A;  3AG3 E;  2WQH A;  4G1T A;  2HFE D;  4RES B;  3G2W A;  5GTI H;  1W2E A;  1W2B O;  1QVG O;  2KS1 A;  3TK1 A;  3OXF A;  5D0Q D;  2D2C B;  3U9W A;  1OW8 A;  3MJW A;  1NH4 A;  3L71 J;  3OAK A;  1S0P A;  1Q90 D;  3HE5 B;  4FP7 A;  3SGH A;  2H6I A;  3BG1 B;  1BD8 A;  3TXM A;  4I7Z B;  2FYU K;  2IYO A;  4TXP A;  1SQP K;  4FLH A;  2XEE A;  1GL2 B;  1H6O A;  1PPJ G;  2PP6 A;  4DOJ A;  3MYV A;  4U0U A;  3L71 D;  3USS A;  2AVP A;  2ZYD A;  4LSZ E;  2L9B A;  2V4H A;  2FXM A;  2WXO A;  3ESK A;  3M9Q A;  1K9M Q;  2XKM A;  4XE5 B;  1P84 I;  4OGQ C;  2KLV A;  5A7D B;  3B8E B;  1JO5 A;  5AW8 B;  4K35 A;  2YIU B;  4LNG A;  4N5C A;  4PDX A;  1FDO A;  2Z5I A;  3NTN A;  1K8A Q;  3ASD A;  3RBX A;  4HFG A;  2WTY A;  2I6H A;  2HPC A;  1KYO D;  3VP9 A;  1LGH B;  2QEX P;  2V8S E;  5EYP F;  1IQR A;  2HE0 A;  2YXR B;  3SD5 A;  3A0B E;  1TJF A;  1SQP J;  2CG2 A;  5EX3 A;  1P84 H;  2WMN A;  1RQV A;  2XCB A;  2FKW B;  3NB2 A;  2ZYA A;  1NFI E;  3QWV A;  4O60 A;  1NWQ A;  3MUD A;  4GML A;  2OAR A;  1ZR4 A;  3CI9 A;  3TNU A;  2WSS H;  1XGW A;  1HF8 A;  3MEK A;  4GPK A;  2NC9 A;  3B5N D;  1OT8 A;  1UJK A;  2JWA A;  2AXC A;  1QL2 A;  4U96 D;  3LVR E;  4IUL A;  1BCC J;  3MX3 A;  1KZU B;  1L4A D;  1QGK B;  1YIJ P;  1URQ B;  1E79 H;  4U3F D;  3ASN E;  2XRZ A;  1LWU C;  1SFC D;  1S3J A;  5APW A;  4UB8 H;  2WWW A;  4I17 A;  1T8Z A;  4G11 A;  2HLO A;  2KP8 A;  3ZFW A;  2PFX A;  2R3S A;  5AQ9 A;  1EDI A;  3FEX A;  5AVQ B;  4EHM A;  2IBZ E;  5JJ7 A;  3CIA A;  1MX6 A;  1LTJ B;  4QFV A;  2KZI A;  2V5Q C;  5AVS B;  2D2C D;  1L0N J;  4WWI A;  4XA4 A;  1ZLL A;  3CWB J;  4ASW A;  1YYC A;  2HOD A;  2P9U G;  5ENP D;  3RL0 g;  1LT9 A;  1N4R A;  1OVV A;  3H1I D;  1LD7 A;  3QWP A;  1Z3X A;  5AW3 B;  1JB0 J;  3AE8 C;  4D6T E;  3CD6 P;  5AEN A;  1IFJ A;  3FGA D;  2VSY A;  1MV8 A;  3G2V A;  3L82 A;  5KAI E;  3VYI A;  1DC2 A;  3QNK A;  3AE7 C;  1SQV G;  3RJV A;  1FU1 A;  3H1L G;  4C48 B;  1VQM P;  4CDM A;  1SQQ G;  1VDF A;  3CQC B;  3CEQ A;  3EHQ A;  5G2N A;  4Q94 A;  1N4Q A;  3QAQ A;  1JY2 N;  1IKN D;  2WVR A;  3CVY A;  5AAO A;  2ZVN B;  1NU1 E;  4Q69 A;  4NAC A;  2EIM E;  3N7N A;  1JUN A;  4IFD K;  4WAF A;  2WXN A;  4X8Q A;  4Y6C A;  1FE6 A;  2KCL A;  3ML9 A;  2OTK E;  5APU A;  4A63 B;  1Q82 Q;  2KXP C;  5ARG A;  3RL0 D;  3D70 A;  1H89 A;  1BGY G;  2P58 C;  1KD1 Q;  3DEO A;  1NA0 A;  1KIL A;  4H13 B;  3B95 A;  3CCS P;  3HTK B;  5KJK A;  3FTX A;  3B5N C;  1M1J B;  5CMY A;  4WVZ A;  4U0S A;  1TNZ A;  1TR4 A;  3C3R A;  3CX5 I;  4IN3 B;  5KJM A;  1N73 B;  4UWL A;  4A3T A;  2A45 G;  3DXM G;  3BAS A;  5ENN A;  1LT9 C;  2IY0 C;  3CQG B;  2N1T B;  1KB9 H;  3BVH A;  3LJN A;  2W6B A;  3T8M A;  3LKU A;  1DH3 A;  3LS8 A;  2RFM A;  2Y3A A;  3CME P;  1L0L J;  3GF3 A;  1N94 A;  1ZP0 C;  3Q4A B;  4JA9 A;  3JQ1 A;  4A1S A;  2NXP A;  3JQ0 A;  3DPY A;  1KLX A;  2FO1 E;  1HO8 A;  5H2F H;  1NP7 A;  4IL6 E;  4EBA A;  3MV2 B;  2I2O A;  3U64 A;  1Y47 A;  4PV1 D;  1H8A A;  1NO4 A;  1RE3 C;  3BRT B;  3VMA A;  1GTW A;  3C98 A;  5KLV G;  2J08 A;  4BRY A;  2P9P G;  2FFD C;  5ITZ F;  4WY4 D;  1RF0 C;  4K5A B;  4BSZ B;  1S70 B;  4A3V A;  4GZC A;  3CCM P;  3CLQ A;  4TRQ A;  2P9I G;  4JYB A;  4N39 A;  2RD0 A;  4GMJ A;  3DSU A;  2A06 E;  1YCS B;  2LXB A;  1NVO A;  3ENE A;  3VTP C;  4IOI H;  3DSW A;  4GTP A;  4I2Z A;  2YO3 A;  3JCU H;  1FJP A;  1NTM K;  4JQ0 D;  4GMR A;  2AWI A;  1VPC A;  3BRV B;  5KJ7 A;  4GPM A;  5AVW B;  1L0N E;  3M0D A;  1L4A C;  5CBO A;  5L8R J;  3T5V A;  4BX8 A;  3F6Q A;  4PV1 B;  4NPE A;  1QL1 A;  4U0Z A;  4G8L A;  5JJ6 A;  4AEZ C;  3QWO C;  3NBN B;  4N2Q A;  4DX6 D;  1T3J A;  4DX5 D;  4GOD A;  1MZC A;  3HXD A;  3VMX A;  2QFC A;  1GL2 A;  2L0I A;  2E2E A;  2Q3I A;  5JHB A;  3GF7 A;  2EQX A;  1NTK G;  5EIL A;  2R2L A;  5KJL A;  2M0B A;  4H0L B;  3RK3 C;  3D71 A;  4UB8 E;  1IHB A;  2R03 A;  5TJH A;  1RF1 C;  5C1D A;  2PM6 A;  4Y6W A;  2WXM A;  4G24 A;  3DSS A;  1DVP A;  1K05 A;  4PD4 E;  3RK2 C;  3H1K J;  3L9T A;  3X2Q E;  4CCA A;  1AVO A;  4ANW A;  1TYQ G;  3CR3 A;  5D66 A;  4UWH A;  4H44 B;  1KZO A;  2FEZ A;  4H44 D;  4JYC A;  1KIL B;  2MRI A;  1FBM A;  3IXE A;  3FWN A;  3U4T A;  3FU3 A;  3HD7 B;  4IFF A;  5DJT B;  3V4Q A;  2OCC E;  2Y0B G;  1YQ4 C;  1VQ8 P;  2Y1L E;  4XZ4 A;  4R7L A;  1N4S A;  4GA1 A;  4PS8 A;  3UIO C;  3CVQ A;  4LUN U;  4BES A;  5FIO A;  5CRU A;  3F89 A;  2HG5 D;  1QVF O;  1X0T A;  3NF1 A;  4UQY A;  4DX2 A;  5KLV E;  2XGO A;  4GYO A;  5AVX B;  5ENQ D;  4KHX A;  2QY7 A;  4CRW A;  3G4S P;  2RN0 A;  5GTH H;  3OTN A;  1SQV K;  3AG1 E;  3AG2 E;  3KQG A;  5APV A;  3KSQ A;  3ULY A;  3AS4 A;  2QJY C;  2OYH C;  4N3A A;  4NUR A;  1IFP A;  3ZIM A;  1LWU B;  5LOZ A;  4EDF A;  2WMM A;  4OAV B;  3BCC G;  3SWF A;  4FLB A;  5EKQ D;  1KB9 D;  3IHV A;  4KVM A;  3H1I J;  2CPS A;  4G25 A;  4OVU A;  4HBD A;  1H2T C;  2LR2 A;  3PE4 A;  4JA7 A;  5TIS H;  2L6J A;  4BET A;  4EIJ A;  5EID A;  3KAE A;  5KCM A;  1HJB A;  4ATG A;  1L0N D;  4L76 A;  3L75 G;  3S7D A;  2QZA A;  5KAF E;  3TWX A;  1BE3 G;  1O1T A;  3TWR A;  3HIZ A;  5CCG C;  4PD4 I;  1H6P A;  1HH8 A;  2Y0C A;  3Q47 B;  3CHS A;  5AJD A;  1KB9 I;  1G2C B;  4U3F J;  1OX3 A;  3E1R A;  1VQ6 P;  2SPZ A;  3CL3 D;  2QA4 P;  3W9F A;  3FUK A;  2CPB A;  3CX5 H;  1FT2 A;  1OZH A;  1SQB G;  2W90 A;  5KNG A;  2XGM A;  3DPD A;  3QK0 A;  1URQ A;  2G8Y A;  5C2Y A;  1N0R A;  2RH0 A;  4YDY A;  2L91 A;  2OVB A;  1RE4 A;  1HGV A;  1QYM A;  3APC A;  1UN8 A;  2FF4 A;  3P1U A;  4H44 C;  3L70 J;  3HYM B;  2E75 C;  3A2A A;  4LLH A;  1X5B A;  2GW1 A;  4GA0 A;  2M5A A;  4LC1 A;  1NTZ G;  1SQB J;  1N52 A;  5FQ4 A;  4DI3 A;  2XEH A;  2J59 M;  4JHK A;  3L4F A;  1RE4 C;  3Q7F A;  4UI9 K;  3GYZ A;  2E76 C;  4U3F G;  1SQQ K;  2K9J B;  4ILH B;  1G1I A;  1WM5 A;  4JD2 G;  4IFM A;  2A06 G;  4OWF A;  4F1P A;  1BE3 J;  3G2T A;  1E5W A;  3RL0 B;  1Q86 Q;  2E76 D;  4YXW H;  3EHN A;  3UT4 A;  4AUW A;  2WPV A;  3W9G A;  1NTZ K;  3GHG C;  3D9H A;  2XEN A;  2OYI A;  1E96 B;  3UM3 A;  1JPL A;  3CLJ A;  4GKG A;  1MX4 A;  1VDY A;  5CHE E;  2DZN A;  2A45 H;  3MTU E;  2QJY B;  2OYH B;  4L7T A;  4I43 A;  1BSH A;  3I4R B;  4R4L A;  2JO1 A;  1J1E B;  2A45 I;  2DZO A;  5AVU B;  5H7P A;  5B3S E;  1OWM A;  2C9N Y;  3HE5 A;  2XPI A;  3UIN C;  2C9L Y;  1PGQ A;  1JCD A;  1S9K E;  1D8D A;  1G2C A;  5B5E E;  1OWL A;  5JJT A;  5AVY B;  4ME2 A;  4DZO A;  4L23 A;  1AJY A;  5B66 H;  4JVS A;  1D7M A;  4DJG A;  1J1D C;  1PGP A;  4HKZ H;  1Y8M A;  3AAA C;  4ABN A;  4JEH A;  1S4X A;  3SF4 A;  2OEV A;  1OWA A;  2DWZ A;  4ASV A;  2WXK A;  1EPU A;  4U95 D;  4JBZ A;  1KQF B;  3IEG A;  4WWP A;  2POH A;  2QIW A;  3Q5P A;  4PH4 B;  3HUS B;  4O6F A;  1WG0 A;  1KV4 A;  1KN7 A;  1S1C X;  3H1I E;  1LWU A;  2FBW C;  5IY5 E;  1SFC C;  1SQB D;  3PHL A;  2V4L A;  4XE0 A;  4N78 E;  3H1H J;  1FJK A;  3CPW O;  2NSZ A;  3I55 P;  2BCC D;  2IQC A;  4KXK B;  2O01 N;  1TN8 A;  3AE3 C;  4EI2 A;  1ELW A;  3KSL A;  4HRN A;  2WVI A;  4WNE A;  2XHE A;  3DRA A;  4WWO A;  2M8R A;  4IYP A;  4EPZ A;  3RK2 D;  1K1A A;  4HI8 A;  4YPC A;  4GCO A;  1VQL P;  1JUQ A;  2KBX A;  1EDJ A;  1YTZ T;  4N6J A;  4CT4 A;  3AS8 A;  4W9R A;  2B6C A;  1CZQ A;  2ZT9 D;  1ZW0 A;  5APQ A;  2WXR A;  4L73 A;  4I6M C;  3U59 A;  3AE1 C;  4B8C B;  1GDT A;  1BDC A;  3RIB A;  1N7S C;  3MHV A;  4KBQ A;  3TG5 A;  3E32 A;  3E4B A;  4JHJ A;  4OYS A;  3V2X A;  5G05 J;  5EIB E;  1O1R A;  1FCH A;  2RG8 A;  4NQ0 A;  2QSI A;  3B7B A;  1SVX A;  5AW6 B;  3QKY A;  3GMA A;  5AAR A;  1SQX D;  4GT1 A;  5HI7 A;  3LY7 A;  2XS1 A;  4YVO A;  5APT A;  3RK3 D;  3CVV A;  4D6T J;  3SBT B;  2K37 A;  3E30 A;  1H0T B;  2YKQ A;  1VQO P;  1IZN B;  1X8Y A;  5T8I A;  5KLV J;  4Y99 C;  4DJA A;  5EN5 D;  2ILR A;  4FU3 A;  4NIK A;  1RY3 A;  2F8X K;  1EQ7 A;  2LUH A;  4XX5 A;  2AXZ A;  3EHR A;  1IO4 A;  5FQ7 A;  5EDS A;  3DEP A;  3AEB C;  3ZYM A;  1PY1 A;  4PV1 C;  3QC1 A;  2BCC E;  1HF9 A;  1OWO A;  1KT1 A;  3TF5 A;  3ULE G;  3M9B A;  4N78 D;  1XTC C;  3T5X A;  1NTZ D;  2PRR A;  3HUS C;  2X6J A;  3U1A A;  2PM7 A;  1MUU A;  3FH8 A;  4JPS A;  5H2F E;  1NTM D;  4L2Y A;  3WU2 E;  2J49 A;  3EIJ A;  5APY A;  3L74 E;  4FA6 A;  3KEZ A;  1OMI A;  3A7O A;  4GTR A;  3GZS A;  2QJP C;  2BEZ F;  1P84 D;  3VLE A;  1O1S A;  3MZL B;  2K9J A;  5BV1 A;  1OVR A;  3WU2 H;  3D9L A;  1YJW P;  1JCR A;  3EFF K;  1H0A A;  3GW6 A;  3TGU E;  2M5A B;  1KIL D;  2P9L G;  4K0R A;  1OW6 A;  4I1O B;  4ANU A;  1BGY J;  3UX4 A;  4BRY B;  1S9K D;  5B1B E;  1G1J A;  3FY4 A;  2V0P A;  3ABV C;  2IBZ I;  3B13 A;  1NAF A;  3DSV A;  3FX0 A;  4GYW A;  5T3R A;  1NOH A;  4HOT A;  1DD3 A;  2J58 A;  1FDM A;  3RKV A;  3O8Z A;  1N54 A;  5CCL A;  2O3J A;  2Y69 E;  4UWF A;  1ZME C;  1FT1 A;  3OJA B;  2XQ0 A;  5AVV B;  2DYR E;  4ATZ D;  1L0L K;  4HLL A;  4WND A;  2DCP A;  2IOL A;  4EZJ A;  2C2L A;  3I3N A;  4HOQ A;  2WT7 A;  2WSF H;  1T6A A;  5BXO A;  5CBN A;  3MD0 A;  3L16 A;  5BV0 A;  4DX1 A;  1N2D C;  5APS A;  4YTP C;  3NMD A;  1ZRT D;  5KNH D;  2N1T A;  1SS1 A;  3PZD A;  5AJL A;  4WY4 C;  2B0O E;  4PS7 A;  5AW9 B;  3GG2 A;  3ASO E;  3CCJ P;  3I4G A;  4MRU A;  5LCW C;  1BI8 B;  3C1L A;  1HTL C;  4I1A A;  1WDY A;  2EIJ E;  2GA1 A;  1DCE A;  1AQ5 A;  1SQX G;  4NPD A;  2IU1 A;  3BEE A;  3L54 A;  2IYP A;  1EDU A;  1RHZ B;  1YIT P;  2OTJ P;  3LIE A;  4J8E A;  1U7M A;  3L08 A;  4BT8 A;  3JC2 2;  5KKZ B;  2IZ1 A;  1ELR A;  2XND H;  3FU5 A;  1PGO A;  3CWB G;  3CVN A;  3E33 A;  3TSI A;  2W27 A;  4J8F A;  1GW3 A;  4G2V A;  2JAB A;  1TN6 A;  3NOC D;  1E7U A;  3RSE G;  2BKG A;  4RG9 A;  3NOG D;  1H2V C;  3UXG A;  3L73 E;  3CK7 A;  4HLE A;  2WXI A;  2OEW A;  3CXH I;  3MZW B;  3V30 A;  3P8C D;  1VQN P;  5KJ7 C;  1RH5 B;  2FY8 A;  4RJT A;  3B7R L;  4J6I A;  4ANX A;  5KJN A;  1LNQ A;  4D6T G;  2VGE A;  1KIL E;  1JY3 O;  5A23 A;  3TGU D;  3QJZ A;  3V2Q A;  3PZ4 A;  4TXR A;  1GU5 A;  3CKC A;  3JXI A;  4GTQ A;  2FFD A;  1KT0 A;  1CW5 A;  2Q9I A;  3FU0 A;  1FVH A;  3L6A A;  1NKZ B;  1P84 E;  1DEB A;  3I5C A;  5J08 A;  2AXT H;  4B94 A;  2IBZ G;  3IFM A;  1NZN A;  5KLI B;  3ZU7 B;  1J1D B;  3KPE A;  1NTM E;  3L35 A;  2PNN A;  4XKB A;  1ZOY C;  3AEC C;  2VTB B;  5BPP A;  2OVF A;  2BF0 X;  1HX8 A;  3R2P A;  3CC4 P;  1NTZ J;  3QOU A;  4O1O A;  5E75 A;  1OXZ A;  3SI5 A;  3BU8 A;  3CX5 D;  2KNC B;  3D6Y A;  4XI9 A;  4HS2 A;  5B1A E;  2GRQ B;  5KLV D;  2MYO A;  4HVB A;  2I1J A;  3H1H G;  2X6F A;  3EDT B;  4EZL A;  3HVE A;  1R5S A;  4N3Y B;  3RK3 E;  1VQ7 P;  2Y0E A;  3Q5S A;  1SQX E;  1FZG A;  4KYO B;  1RZ4 A;  2NRG A;  3R9A B;  4GDO A;  1SP4 A;  2LXC B;  2NZ2 A;  3Q49 B;  1PAQ A;  1TJC A;  1N0Q A;  1YA0 A;  1DEE G;  2MOW A;  3ZKJ A;  2R17 C;  5BT1 A;  3CWB D;  3ZYL A;  1K1B A;  3H1K D;  2GRL A;  3A0H E;  3O6Q B;  2HPC B;  1NAY A;  4HNA D;  2VSN A;  5FJY A;  3C9I A;  3D9N A;  1E8X A;  4JC8 A;  1QBQ A;  3Q73 A;  2LNI A;  3C72 A;  3TWQ A;  1S5L H;  2E0I A;  2FYU E;  2IEJ A;  2WQ7 A;  1TEZ A;  1UIX A;  1SQP E;  2WMO A;  2ETC A;  3PZ1 A;  3Q78 A;  3TYY A;  3FXE A;  3S2A A;  4F53 A;  1M56 D;  3M9H A;  3CST A;  1SQB K;  3FTU A;  4FJZ A;  5FWQ A;  2QYJ A;  1K73 Q;  1JMB A;  3Q5R A;  3LID A;  1KC8 Q;  2ZIR A;  3ABK E;  1BCC D;  4DLO A;  3D9J A;  2N1T C;  3ZN3 A;  2OND A;  5JMN D;  3CHQ A;  1KPS B;  1USD A;  5BXU A;  2J8S D;  4AIF A;  2K3R A;  5C39 A;  4EQF A;  2YQ8 A;  1JEK A;  3H1H D;  3UUX A;  1YBK A;  5BVZ A;  1Q7Y Q;  4CYM D;  5G04 J;  1VQ9 P;  4Z68 A;  5CHX A;  2XZD G;  1VF5 C;  1VQ5 P;  1TNY A;  2YKP A;  3ONL A;  4RSY A;  3TAX A;  2WSE J;  1U3D A;  2KOG A;  5CCM A;  3SHF A;  4I1M A;  2P10 A;  4TXQ A;  2RKK A;  2X6I A;  2WXH A;  3MUD C;  1JWG A;  1GD2 E;  3L36 A;  2FFD B;  3ITK A;  3FUI A;  2XNX A;  4I7Z C;  1TNO A;  3FTV A;  3PEV B;  2KYV A;  4UUC A;  2XPZ A;  3H1K G;  5J90 A;  2V7Q J;  2WQ6 A;  1A02 F;  1LTS C;  3L75 D;  5K5G B;  1RF0 A;  1QNF A;  2Z5H A;  5KJ7 D;  4DX7 D;  1QEX A;  3IBE A;  3PP5 A;  3L70 G;  1M1K Q;  4GCN A;  1AWC B;  2KK7 A;  5HKP A;  4ZHB A;  5BNW A;  2E5T A;  2O01 H;  3PUK A;  3QAR A;  3S7B A;  4BEP A;  1NI1 A;  5E79 H;  3VMY A;  3C3O A;  3UM2 A;  4NPF X;  3CCU P;  4JL0 A;  3LW5 H;  1FAV A;  5FTP A;  1HXI A;  5G05 C;  3EUV A;  3RU0 A;  1VL2 A;  3FUE A;  3L75 J;  2LXM A;  5A6C A;  5KWD A;  4YXD C;  4KMO A;  1QZ2 A;  4DLQ A;  3ZEF A;  2AXV A;  5AW5 B;  2N9Y B;  1YI2 P;  2F0Y A;  4R4M A;  2F8Y A;  3S7J A;  3GHG B;  2XGS A;  4UQX A;  2H89 C;  4OVV A;  4LEU A;  4H0L C;  3RK3 B;  1ZN5 A;  1ZB1 A;  5LFA A;  2GRR B;  4U8V D;  2VQ2 A;  5M72 A;  1BLX B;  4GZD A;  3TWT A;  3HXF A;  2M3E A; 
#chains in the Genus database with same CATH homology
 4LG6 A;  1H0T B;  3TWQ A;  5ENT D;  2UWJ E;  2A5E A;  1EDL A;  5ENQ D;  1FC2 C;  4OAU C;  3ZNG A;  2B87 A;  4U8Y D;  2ETC A;  1S3J A;  2AJA A;  2JAB A;  3NOC D;  4HRM B;  2ZGD A;  4QQI A;  3FXE A;  1Y47 A;  4ZNC A;  2DZO A;  2BKG A;  1MJ0 A;  2ETB A;  1BI7 B;  5EN5 D;  4HJG H;  2P58 A;  3NOG D;  4NIK A;  5AQ9 A;  5AQB A;  3UXG A;  1YYH A;  1EDI A;  3JXJ A;  2F8X K;  2QYJ A;  5ITZ F;  2BKK B;  1JMB A;  3EHR A;  1MFT A;  1MX6 A;  3MZW B;  4K5A B;  2KZI A;  4BXL A;  1S70 B;  2V5Q C;  3DEP A;  4WWI A;  4QFV A;  3V30 A;  4BSZ B;  3FXD A;  2ETA A;  1A5E A;  5DJU B;  3JUE A;  4ASW A;  5CEA A;  3RGU A;  2VGE A;  3AJI A;  5JMN D;  5AQA A;  4K5C A;  5BXU A;  5ENP D;  2WMM A;  1MYO A;  1YCS B;  3J5P A;  4BER A;  2LXB A;  5CER B;  1NVO A;  1OVV A;  2J8S D;  2XZT G;  5ENR D;  4IOI H;  4F6R D;  2K3R A;  4HKZ H;  4HBD A;  5C39 A;  3JXI A;  4LNU D;  2LR2 A;  2RKL A;  3AAA C;  4GMR A;  4CYM D;  1SW6 A;  4BET A;  2DWZ A;  4ASV A;  5EID A;  4GPM A;  4TUM A;  4Z68 A;  4U95 D;  4O1P A;  1BU9 A;  2B88 A;  3PH0 A;  4GOF A;  2XZD G;  4JBZ A;  4F1P A;  3TWX A;  5AQ7 A;  1DC2 A;  4HB1 A;  4RLY A;  5KBA A;  5CBO A;  3ZU7 B;  3TWR A;  1EDK A;  1WG0 A;  3F6Q A;  1OVR A;  2I8D A;  4NPE A;  4C48 B;  4GOE A;  1BD8 A;  2R44 A;  2RFA A;  4G8L A;  4OAV B;  3EHQ A;  3ZKJ A;  2PNN A;  4HRL A;  3KEA A;  1YMP A;  1U7J A;  1LP1 B;  2M5A B;  3QWO C;  2XEE A;  2SPZ A;  4N5Q A;  3NBN B;  1IKN D;  3W9F A;  5JA4 D;  1AP7 A;  1LT1 A;  4DX6 D;  4UUC A;  3HRA A;  4DX5 D;  4LSZ E;  5AAO A;  4GOD A;  3TWV A;  1OY3 D;  5KNG A;  2KI7 B;  1IXV A;  4KJM A;  2NYJ A;  5HS0 A;  1N0R A;  4HRN A;  4O1O A;  5K5G B;  3Q9U C;  4YDY A;  3V79 K;  1D9S A;  2P2C P;  1QYM A;  4DX7 D;  2KUB A;  2QRX A;  5EIL A;  5FIN A;  1AWC B;  1K1A A;  2B87 B;  3J5Q B;  4HI8 A;  2M0B A;  4K35 A;  5HKP A;  4DUI A;  4ZHB A;  4J8Y A;  3UI2 A;  1IHB A;  2ZGG A;  5HRY A;  2KBX A;  1EDJ A;  4MN4 C;  4ATZ D;  2OTK E;  4BEP A;  3EU9 A;  4A63 B;  4HLL A;  2L6B A;  1LP1 A;  2M5A A;  1ZXG A;  2KXP C;  2V4H C;  5EYL A;  3TWS A;  3UTM A;  4CZ2 D;  3HG0 D;  5EYP F;  2MYO A;  2HR3 A;  2XEH A;  1ZW0 A;  3V31 A;  2Q1K A;  5CBN A;  2HE0 A;  3DEO A;  1EC5 A;  5BXO A;  5CED B;  4NPF X;  3TWU A;  2F37 A;  3B95 A;  5D66 A;  3T8K A;  2JWD A;  4DX1 A;  1K3Z D;  2KZJ A;  1BDC A;  3TWW A;  1JM0 A;  3MHV A;  2DVW A;  5KNH D;  1SS1 A;  4ZMD A;  4YDW A;  1TR4 A;  4HB5 A;  2B0O E;  1UOH A;  3IXE A;  3T9K A;  1Q2N A;  1NFI E;  3V2X A;  1G3N B;  3ZUV B;  4O60 A;  5DJT B;  1BI8 B;  4DX2 A;  5EIB E;  1DCQ A;  1WDY A;  2Y0B G;  5KWD A;  2Y1L E;  2LXC B;  1H0T A;  3SO8 A;  4EYY Q;  4NPD A;  2QC9 A;  3B7B A;  3LJN A;  4JB8 P;  3W9G A;  1N0Q A;  2ZAE B;  1SVX A;  3D9H A;  3C5R A;  2XEN A;  5AN8 A;  5CEC B;  1DEE G;  3Q9N C;  3ZDM A;  2RFM A;  2B89 A;  2F8Y A;  2QVA A;  1U7M A;  4HQD A;  5ENO D;  5AAR A;  5EFW B;  4CPG A;  1OT8 A;  4G8K A;  1N11 A;  2KS1 B;  1OVU A;  2KIK A;  4B93 B;  1K1B A;  4U96 D;  1MX2 A;  4J7W A;  4HNA D;  3V2O A;  3S1K A;  1MX4 A;  5FIO A;  4BES A;  4K5B A;  4U8V D;  4DRX E;  4K3A A;  2DZN A;  1BLX B;  1BDD A;  2FO1 E;  5ENS D;  4ZFH A;  3TWT A;  4HI9 A;  1X0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...