5CBNA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus with chemical cross-linker ey-cbs
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cbnA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cbnA01
1JM0A 1H0TA 4DRXE 1MX2A 5FIOA 3ZDMA 4HI9A 3UXGA 1SS1A 3EHRA 3PH0A 4QQIA 2Y1LE 3V79K 4HBDA 2B87A 3DEPA 1Q2NA 2K3RA 1NVOA 4JBZA 2WMMA 2QVAA 4ZHBA 3ZNGA 5AN8A 2KS1B 5FINA 3UI2A 3QWOC 5HS0A 1EDJA 5KNGA 4RLYA 5K5GB 3B7BA 4KJMA 3V30A 3ZU7B 3RGUA 5CBOA 1UOHA 3TWVA 5KNHD 2ETCA 5CBNA 1SVXA 2XEHA 1YMPA 2P2CP 1MYOA 5JA4D 3C5RA 3D9HA 3S1KA 2M5AA 4HB5A 5CERB 4WWIA 4HRNA 3TWUA 4GOFA 4NPEA 2KBXA 5EIDA 2B89A 4TUMA 1S3JA 2SPZA 4C48B 3NOGD 3NBNB 1MJ0A 5AARA 1BDDA 3LJNA 1SW6A 4BETA 4U8YD 3IXEA 1BU9A 4K5CA 4A63B 3Q9UC 1N11A 4G8LA 4OAUC 4HLLA 5C39A 2I8DA 2OTKE 1JMBA 2UWJE 2KZJA 4JB8P 5AQ9A 1A5EA 2KIKA 1NFIE 1Y47A 1OVRA 2V4HC 1AWCB 2NYJA 4NPDA 1DCQA 2Y0BG 3MHVA 2MYOA 4O1OA 2DWZA 4YDYA 2L6BA 1K3ZD 4J7WA 3T9KA 3MZWB 1K1BA 4HNAD 1K1AA 5ENOD 1DC2A 5CEDB 5EYLA 2BKGA 3FXEA 1LP1B 2P58A 4LG6A 3V31A 4O60A 5ENTD 1EDKA 3W9FA 4B93B 5ITZF 4J8YA 3EU9A 2HE0A 4K3AA 3DEOA 1LT1A 3AAAC 2ETAA 1U7MA 3TWQA 4G8KA 3AJIA 4HI8A 1ZW0A 4ASVA 2F8XK 3TWRA 2QC9A 2XZDG 4CPGA 4MN4C 2KUBA 4ZMDA 5CEAA 2M0BA 1WG0A 3V2OA 2JABA 4HRMB 5EN5D 1BI7B 1X0TA 4DX5D 4UUCA 5DJUB 3ZKJA 1BI8B 5JMND 4DX6D 3SO8A 1OY3D 4NIKA 5EILA 5HKPA 5BXUA 5DJTB 2LXBA 5KBAA 2DZOA 1DEEG 1U7JA 5CECB 4K5BA 4DX7D 3KEAA 1TR4A 2KZIA 2LXCB 2QRXA 5BXOA 2FO1E 2B0OE 1IXVA 2KXPC 1MX4A 4ATZD 1ZXGA 5EFWB 1S70B 4HJGH 2ETBA 3JXJA 4YDWA 1QYMA 3UTMA 4F1PA 5ENQD 1YCSB 1OVVA 3FXDA 1BD8A 5AAOA 4BERA 2PNNA 2ZAEB 1FC2C 5KWDA 2V5QC 1D9SA 1WDYA 4GODA 3ZUVB 4BEPA 2VGEA 1LP1A 5EIBE 4GMRA 1IHBA 4ZNCA 5D66A 4O1PA 4DX2A 4QFVA 2XENA 3HG0D 2DZNA 3B95A 3TWSA 3F6QA 3TWWA 1H0TB 4ZFHA 4DX1A 4OAVB 4GOEA 4LNUD 2XZTG 1OT8A 5ENPD 4IOIH 4U96D 4CZ2D 1BLXB 2HR3A 4Z68A 1EDIA 1BDCA 2J8SD 2B88A 2B87B 3JUEA 2A5EA 3Q9NC 2Q1KA 4K5AB 4BESA 2JWDA 1N0RA 2RKLA 2ZGGA 3J5PA 5AQBA 2F8YA 1EC5A 4LSZE 4HKZH 3TWXA 3J5QB 5AQAA 2QYJA 4EYYQ 2ZGDA 2RFMA 5EYPF 2R44A 1MX6A 4HQDA 5ENSD 4BXLA 4U8VD 2M5AB 1AP7A 1YYHA 3HRAA 4N5QA 1G3NB 3JXIA 3NOCD 4K35A 2F37A 3EHQA 5AQ7A 2XEEA 3T8KA 4HRLA 4BSZB 4NPFX 2RFAA 4GPMA 2KI7B 1N0QA 3W9GA 4CYMD 2LR2A 4ASWA 5HRYA 3TWTA 4HB1A 5ENRD 1MFTA 4DUIA 1OVUA 4F6RD 2AJAA 2DVWA 2BKKB 1IKND 1EDLA 4U95D 3V2XA
chains in the Genus database with same CATH superfamily
1K04A 1O1RA 1T2KD 2RKKA 2O1JA 4U7EB 5KLVK 1VQPP 2EIJE 2OQQA 2QJPB 1S63A 4GTRA 1SFCA 1HS6A 3V2PA 3LIDA 2QIWA 2AW6A 4XA4A 3QJZA 3ULEG 3AG2E 3HVEB 5JJTA 4K0RA 1L0NJ 3HE5A 4MRUA 2OGUA 3Q49B 3FHEA 3V79K 3FFLA 4I1AA 2X6HA 3PRZA 5CMZA 4TRQA 4LGDE 5ANRA 5KLVE 3CX5I 5LX8A 3CVUA 3H1KE 4OVNF 4G23A 4I43A 1PPJD 3Q3DA 4B8AA 4HS2A 2FFDC 3Q1MA 4IYPA 3RRMB 1MQSA 3QARA 2PGDA 1TN6A 4DCKA 5FINA 2ZT9B 4GA0A 2ZU6B 3UI2A 1FZAA 3CPWO 1FBMA 4LC1A 1IFJA 4L2LA 1JEKA 1ELKA 3L70G 2VTBB 4RLYA 2GRQB 1S64A 4N3BA 1IZNB 3B7BA 4KJMA 3RL0D 1QEXA 1RW2A 4L9PA 4B8CB 5CBOA 3TK1A 2FBNA 1S5LH 3MJWA 3L72J 3AE3C 2VGXB 1IJDB 2FI7A 2A06G 3KPEA 3WU2E 3TJPA 2V7QJ 3CVNA 4PUCA 4JHJA 2WXJA 4HB5A 3ZVVA 2NZ2A 4HH2A 2K37A 3B7TA 3R9MA 4AEZC 3PRJA 4WWIA 2GM4A 4G26A 2IYOA 2IBZE 2NPSD 2OYHC 3OAKA 2XS8A 5AVRB 4NPEA 1LTTC 2KBXA 2P9SG 3FWNA 4TUMA 1S3JA 1RF0C 1SLQA 4U3FJ 1FVHA 5T3RA 2E74B 3NOGD 3NBNB 3HXDA 5AARA 4IL6E 4JYBA 1ZR2A 1SW6A 4G11A 2OEVA 3FUKA 1TNOA 3IXEA 2FY8A 2WSFH 2PRRA 3Q9UC 4D6TG 2HFED 3CK7A 1X8YA 3ESLA 3Q5SA 1RF1A 1EXIA 1OXZA 2HYNA 1TNBA 1KQSO 3IN6A 4HLLA 2I8DA 5C39A 3CKBA 4LERA 4R4LA 3FTVA 5AQ9A 2Y69E 2KIKA 1NFIE 1ELWA 2Q5UA 1HWTC 3CEQA 1RHZB 3NB2A 2Q6QA 4RJTA 3L75G 2CFUA 4FLBA 3ZPJA 1SQVJ 2FF4A 1L0LK 1URQA 1URQD 3MHVA 1SQPG 3Q78A 1GK6A 4YDYA 1HH8A 3PEVB 1PFIA 2YKQA 2QJKB 1K3ZD 2LAIA 3Q73A 4J7WA 4I6EA 2IOSA 1NP7A 4A7PA 1NHLA 4A3VA 1KB9H 3FUJA 1S0PA 4HNAD 1L0ND 4RG6A 4GZ3A 4XE5B 1OX3A 3L73E 5BVZA 3CD6P 4ABNA 1S2EA 1GW6A 1N9AA 3QWVA 2B6CA 1L0LE 4UWFA 4I6JA 4WB4A 3S7JA 3H1JJ 2PL2A 3RK2D 3MV2B 1O1TA 3AEEC 2P58A 4UB8H 1KV4A 3PTZA 1LNQA 3PLNA 4B93B 3JCUE 3TGUE 3VLDA 3EU9A 4K3AA 3FU5A 3RO2A 1KQGB 1WT6A 3PNLB 4WY4C 3AAAC 2POHA 3HXEA 2AXTE 4GTQA 3IEGA 3G2TA 1L0NK 4J0UA 2KSJA 3C3QA 2UY1B 5E79H 3AJIA 1TNZA 4HI8A 3OJAB 1H6KA 4Y99C 3IHYA 4K03A 2F8XK 3L72D 3BATA 2BCCG 3Q2YA 2WVIA 1SQXD 4UWKA 4ZMDA 3ASDA 3D6YA 3L16A 3S7DA 1SQQJ 3MTUE 1L0NE 3Q7FA 5KTBA 2JABA 5EN5D 1FS0E 2QE7H 3X2QE 2AEJA 5C1DA 3IKOB 2ZYGA 1WY6A 3LYAA 4PD4E 2WXKA 2BF0X 1GL2A 3CX5H 4IRUA 1GL2D 3QH9A 3SO8A 4TT3H 1GK4A 1BE3G 3UX4A 5TJHA 4TXPA 2E75D 2FFDB 1Z5SC 1X81A 3DSXA 5AW9B 4M3LA 5APYA 1SQXK 3ZHEB 4I2ZA 2P9LG 1AVOA 2XGSA 4H0LD 3MGBA 4K5BA 2ZXXA 3G2UA 3MCXA 2J9QA 1RE4A 2GUSA 3MP7B 1N95A 1JCCA 1LTJC 5APWA 2KZIA 3FDHA 3PJSK 2P67A 5BXOA 3H25A 3VTXA 4ZKPA 2GW1A 4FHJA 3PZDA 1SQVD 5CHEE 4XIFA 3KZIH 1PC2A 4F53A 4ATZD 2L5GB 3ASHA 1M1JA 4FADA 4HJGH 1VQ8P 1FDIA 4YDWA 2PQRA 3ITKA 3TXMA 4X8QA 3FU6A 2YO3A 1FZFA 1JO5A 3L36A 4LUNU 1HZ4A 2GRPB 4CDRA 3QNKA 3GG2A 1IO4A 3SHFA 4ANUA 1OVVA 4RKUJ 1U3CA 4U3FE 1DX7A 2PP6A 3FXDA 2OYHB 4UI9J 2KCKA 4C7NB 4AYCA 2ZAEB 3CVQA 5KWDA 3H1IJ 2P2UA 1A02J 1SQVK 1DIPA 2O01H 5AVYB 1IC2A 4GODA 3U9WA 5ARGA 5H2FH 3CGHA 3AE2C 1JNMA 4GMRA 1P84I 3CC2P 4ZNCA 3E32A 1LTAC 1AFOA 2QM7A 3JUIA 5AW2B 1JOCA 3WUUA 2KCVA 5FWQA 3HG0D 4WAFA 1SQVE 1AJYA 2WXGA 2IFMA 3TG5A 3QDNA 3TWWA 1N52A 4ZFHA 1PZQA 3B5NA 3A0BE 3KHUA 4BT8A 4F1SA 2NXPA 4E6HA 4JHKA 4AV7A 4GIFA 4N6JA 1HTLC 4W9RA 3E30A 1T3UA 3L08A 4OVUA 3GZ2A 2HR3A 4XKCA 3N4XA 1JTHB 1FZBA 3FTZA 2A4ZA 4RQIA 5G05C 3HD7A 2GGFA 1LTBC 3MKRA 3L6AA 3B4SA 2X6KA 4H44D 4EOTA 2B87B 1JCDA 5BV0A 1FT1A 2L0TB 3H1JE 2A5EA 1XGWA 3ZYLA 3PNTB 3AE6C 3D9MA 3Q15A 2EINE 3LY9A 3N71A 5E75A 1A17A 1JCQA 4Z1MH 5AVVB 3L17A 2JWDA 5BU8B 1BGYG 1K8KG 5AVWB 2UWJG 5TISH 3IAOA 4GA1A 2MHKA 1HVVA 2D2CC 3U64A 4A3TA 1SQQK 3NZUA 3CHSA 5KJ7A 1WRGA 1FZCB 3TWXA 3WMM0 4WY4B 4IL6X 3J5QB 2XS1A 2WSFJ 1HX8A 1FDMA 4GTOA 5G05J 2H7HA 3B7UX 4G25A 4EYYQ 2IFUA 2ZGDA 2DW3A 2IPPA 3MZLB 5EYPF 3FUEA 5CCGC 4Y99B 4BXLA 4U8VD 1SQQE 4FHKA 3PZ1A 2QEXP 4PV1C 3TL5A 1D8DA 1NKZB 5EDSA 3P8CD 1TN7A 3A0HE 5KAFE 2MKVA 3H1HJ 3ABME 4FJYA 3TNUB 3LDZA 1IFPA 2XPIA 2GROB 2OARA 4YVOA 3EHQA 3V6IA 3ASGA 5B5EH 5AQ7A 1LF8A 4AY5A 2VSYA 4HRLA 2E43A 4I9CA 4JYCA 2WXNA 1NTMG 2RFAA 1NI1A 1NU1D 3H1ID 5C2YA 4ANWA 2KI7B 2Y4UA 1ZRTE 1KYOE 4JHRA 4URKA 1UG3A 1AQTA 1N0QA 1ZOYC 1N7SA 1SVFA 4WVZA 1KTMA 2KCLA 4CYMD 2H8PD 1M1KQ 3CWBG 4HVBA 3A7OA 3M0AA 1JUNA 3Q75A 5JHBA 1T2KC 2HPCB 4EHMA 4H7XA 2K88A 1LWUA 1MFTA 4JPZB 2GRRB 1OVUA 5ENNA 4PS8A 3GZSA 1LTJB 4XKBA 4N2SA 1FJKA 3U1AA 3D9LA 3FTSA 3AE4C 3G6EP 4UI9K 2AJAA 4JQ0D 2OYIC 3SY2A 1IKND 4EZLA 1JWGA 2YIUC 1NU1K 2YKOA 1J2JB 1QVFO 2WXIA 1CZQA 3IF4A 3MD0A 3LY7A 4C0MA 3VYIA 2OTLP 4I1OB 1H0TA 1HG5A 3FU3A 1MX2A 1S4XA 3PUJA 4C46A 5AW1B 4RVBA 3UXGA 1NYHA 4TV3A 1SS1A 3PH0A 2E2EA 3FWLA 3MEKA 2ITAA 3FUDA 1HU3A 2JDIH 4N3CA 1R5SA 4HBDA 1IFMA 3D6ZA 3DEPA 2I9CA 4MLPA 1Q2NA 5L8RJ 2K3RA 3RL0C 1NVOA 3CHOA 5KJNA 2ZIRA 2K9JA 1G2CA 3QWPA 3RBZA 3M9HA 3ULQA 3UIPC 2OVFA 1DH3A 3AE5C 1QL2A 4RO0A 1P84H 3AE9C 4E85A 1L2PA 1YQ4C 4WBAA 3ZYKA 2N1TA 2N1TD 5AVTB 1PP9G 2R03A 3MKQB 2L91A 1OWPA 1OUVA 1NTKG 1K8AQ 1EF1C 1N94A 1NO4A 4N3YB 3FWVA 3O6QA 2CFZA 2WQYC 3ZXPA 2J5UA 2ILRA 3EIJA 4MBGA 1KILA 2YNQA 1KILD 1JY2O 3ZU7B 2NPSC 4PJ0H 4QMAA 3FH7A 3TWVA 4BRYA 1KFNA 4A1SA 4I7ZC 2J49A 1S5LE 4XX5A 3H1HD 3FY4A 2YXRB 2C9LY 1HXIA 1YMPA 2WXRA 2JR8A 4Y6WA 2RMZA 2J4BA 2HLOA 3BCCG 3L74D 3I4GA 3CR3A 4LRZA 2C0MA 1VF5D 3D9JA 1FT2A 2Q9IA 3H6PA 3S7FA 3H1LD 3LVRE 1ZBPA 1RF1C 3SWKA 3EFFK 5A6CA 2AEMA 2JWAA 2XU6A 3WUTA 1FOSF 3BRTB 2M63A 1MJ0A 3CHMA 3CMEP 1M7LA 1NTZG 2AXZA 2ZVOB 2P7JA 2WXOA 1BCCG 3VOPA 2D2CB 3LIEA 2RH0A 2HODB 1URQC 3HE4A 3H32B 3PE4A 2I1KA 2O01J 3UT4A 3V2NA 5CJ4A 1N11A 1H6PA 1BCCD 3Q5MA 4WNFA 4PS3A 2KZJA 3EJNA 4JB8P 1A5EA 3P32A 5CMYA 1PV3A 3CCLP 1OVRA 1X22A 3S2AA 3L82A 4N78D 3CKCA 4JD2G 4BFRA 2WMOA 3P2BA 3H1HE 3MUDC 3RK2C 3GF3A 2JO1A 3H1KG 4OWFA 2H6HA 3OAWA 5B66E 4PV1B 4RG9A 4O1OA 2QJYC 1L4AA 2YQ8A 4BSXA 2I1JA 1KFMA 4C0EA 1Q90D 3V2QA 3F89A 3UIOC 1KB9E 3SWFA 3MV3B 1OCOE 2OV8A 4U0ZA 5ENOD 2V4HA 5CEDB 4ATGA 5CCHA 3EWKA 4KYOB 3TG4A 2CHZA 3D9KA 3DSVA 1KC8Q 3Q79A 5EYLA 4JEUA 4HOQA 3FXEA 1VQ5P 1OCZE 3GZ1A 1SFCD 1LP1B 3CVPA 2CPSA 4J8FA 4LG6A 4UB8E 4EIJA 3HVEA 4XZ4A 2Z5IA 3KEZA 1EYHA 5ENTD 2FXMA 1AV1A 3CX5D 4U7JA 3SFEC 2P9PG 3OXGA 4J8YA 1PGJA 1HO8A 4GCOA 3I5CA 5G2NA 3A3YB 3M0DA 3MA5A 1LT1A 2J07A 2DYSE 3APCA 3AG1E 3CVWA 2CG3A 1U7MA 3AEGC 2X6JA 2IBZG 4ZKUA 1E8ZA 5D0OD 2W6JH 2ZT9D 4IULA 3RBXA 2M8RA 2OYIB 1K05A 2QM8A 3BU8A 2YIUB 3W67A 2VTBA 4U0SA 4Q96A 2L6JA 4MS6A 1GL2C 3GHGA 2IOLA 3CSTA 3SBTB 2KUBA 3SNXA 5KJMA 4ACKA 3D9PA 5CEAA 2E75C 3C8VA 2IBZI 5EX3A 3L70D 5BT1A 2CG2A 1BI7B 2VGXA 2WXPA 4H0LC 1SA4A 2WPRA 1O1SA 4UUCA 5AVSB 3ZRHA 2C2LA 3ZYQA 1RE4C 4RSYA 1SQXJ 2WQHA 3SD5A 4HOTA 3RL0B 2A06D 4Q94A 4L76A 3T5VA 2H6IA 1VQ9P 5HKPA 3RO3A 2EIME 2KLVA 3G9RA 2LSVA 4AXHA 4ILGA 4JA9A 5CECB 1PPJE 3G2WA 2Y9ZA 3MX3A 4YXWH 4B0ZA 1Q81Q 3VMXA 2YMKA 4DX7D 4JA7A 3KEAA 3SFXA 3L73G 4HORA 2WM9A 3UIAA 1L0LG 4FJZA 3GLMA 2JP3A 2B0OE 4JVSA 2NPSB 3VLEA 3JSVC 3Q7AA 3GW4A 2KXPC 2G3AA 3KZIE 2WTYA 4N39A 1EPUA 4I7ZB 3PE3A 2WWWA 4D6TD 2GRMA 3JXJA 3TGUG 4EDFA 3SWYA 2OVBA 1J1DB 2XCCA 3AU4A 1HF9A 3SFYA 3NZSA 1QYMA 5BV1A 3FUMA 1MHQA 3ZW3A 1QGKB 4F1PA 2O3JA 2FXOA 1DEBA 5A7DB 1FDOA 3L75D 2ZXEB 1BD8A 1DNPA 1RF1B 3CCMP 2P9IG 2YHCA 4XI9A 3TSIA 3E4BA 1SQPD 1LD7A 3RU0A 5CRVA 3NMDA 1WDYA 5DIZA 3KD7A 4AJWA 3L4FA 1CI6B 1HJBA 3S9OA 1TNUA 5H2FE 3IR9A 4WNDA 3OXLA 1URQB 5LOZA 5KLIB 5ANLA 4DLQA 3T97B 3P1UA 3SGHA 5D66A 3WG7E 1YYCA 3AEDC 4GPKA 3I55P 5ARFA 4H44C 2W90A 2DZNA 3B95A 4J6IA 1ZV8A 2DIWA 5EKQD 5FZSA 1UIXA 4KT6B 2KSEA 4OAVB 1SQPK 1SQBG 2R3CA 4BT9A 2HYZA 2CPBA 3RK2B 1OWNA 2XZTG 3GMAA 1Q7YQ 1FZGA 1OT8A 2KS1A 5ENPD 5CCMA 1CSBA 1NA0A 3DSSA 4L73A 3C3RA 2Q3EA 2JJLA 1BDCA 4J8SA 2B88A 1JY3O 1XTCC 4PD4I 4BTBA 4FP7A 1S5LX 3AS4A 3VP8A 2OEWA 3JUEA 2Q3IA 3KYQA 3FEXA 3ZGQA 1LT9C 4A1GA 4AP2A 2WSEH 1JB0J 4HOUA 2BCCD 1Y6IA 4GYOA 5FJYA 5AQBA 2RKLA 2Q7CA 1N86A 1NJIQ 5TISE 2ZYAA 4LNBA 2DCPA 1S72P 2WPSA 1QBQA 3L54A 4H13C 3UPVA 2AXCA 2FYZA 2BEDA 2K1AA 3ZXSA 3ENEA 4PDXA 3MIWA 2FFDA 5AQAA 3FEYA 4U3FG 3ZHEA 1Q86Q 2EQXA 2QYJA 5D0QD 4AOFA 4JPSA 1N4QA 2RFMA 1E8XA 1OMIA 3WU2H 1G1JA 4UI9C 1ZU2A 1BGYJ 2IFNA 1OXJA 1BE3D 3L71G 3Q47B 2WPVB 2H88C 1KZUB 2W27A 1KORA 2M5AB 3TYYA 1GL2B 3PS6A 3GYZA 3FUIA 5LCWJ 3KXDA 3K5BA 3B71A 2KATA 4GMJA 3L72E 2YKPA 1MFZA 3JXIA 3UUXA 1JUQA 5FQ7A 1SQXE 3JC22 1XNFA 3I4RB 5B5EE 4H0LB 1VQ4P 2XEEA 2Y4TA 3T8KA 3VMAA 4BSZB 3CV0A 1LJ2A 1OW6A 3CXHI 3C72A 4OH8B 4AQRD 4HFGA 2J59M 3CCUP 3HUSC 2R17C 2OYHA 2IZ0A 3G2SA 1O5MA 4C7NA 5HI7A 4KZCA 4ASWA 3NXSA 2WT7A 1S9KD 1HH0A 5KAIH 1NU1J 3APFA 2AVPA 1Y8MA 3PUKA 2XGOA 1P84D 3Q5PA 1AQ5A 1PGPA 4G1TA 3H1JG 3NFQA 4GU5A 1N4PA 1PAQA 1NTMJ 3RAUA 3IHVA 2OYOA 2F0YA 2M3BA 3SZ7A 3T5XA 1EDUA 3GW6A 3UT7A 3BASA 1EDLA 2KXPB 4AUWA 1GU5A 4APFA 1TN8A 2ONDA 2R5DA 1BSNA 3CWBJ 5AW4B 4BY6A 1N4SA 2H6GA 3B8EB 2HM8A 3MYVA 2XZRA 3C1LA 1TEZA 1K9MQ 1H0AA 4UQZA 3B5ND 2WSSH 1MUUA 3ZDMA 2Q7FA 1U57A 3QK0A 1HGZA 2N1TC 2KP8A 1RE3A 4BWNA 4EBAG 2BTDA 3HIZA 2OTJP 1JTHA 3M9QA 4Y28J 3EQ2A 3U3WA 3C3OA 3L37A 3HD7D 1FU1A 2B87A 4EBAA 1E96B 1KILC 3K9IA 3NAWA 1N4RA 1SQQG 3R7RA 2WMMA 1S9KE 3HTKA 2R3SA 4BTAA 2QVAA 1GTWA 3FGAD 2EILE 4GYYA 1GD2E 1P84E 3ZNGA 1IK7A 1N73C 5AN8A 1SP4A 2PZIA 5FQ6A 3PHLA 4JF7A 3QWOC 5AIJA 2XRYA 4FLHA 1WMKA 4BX9A 5HS0A 1EDJA 2WQ6A 3SSUA 2WXHA 3BQOA 5KNGA 4H44B 3W68A 4B86A 3Q4AB 5K5GB 1BGYD 1FZCA 1VQLP 2A5UA 5KJ7D 4GYWA 4WY4A 2X38A 4GDOA 4PJ0E 2KNCB 1UOHA 2CHXA 1E8YA 3UKUG 1YIJP 1EZVG 5CBNA 1T3JA 2IX7C 4NQ0A 3CLJA 4L75A 4UWLA 4V3IA 3DSWA 2LNIA 4UWHA 1PP9J 3HXBA 3FTYA 2P2CP 2XCBA 1NTKJ 3R7QA 2PM7A 2XNXA 3V2RA 3D9HA 3S1KA 1LGHB 3TGOA 3TWUA 4CCAA 3TNUA 4TLFA 3UT8A 3QC1A 1EZVI 4CEMA 1LT9B 5APXA 3R2PA 1IQRA 2E5YA 2SPZA 3L74J 3EDTB 2FYNC 2FO7A 2FXPA 4C48B 2V4LA 3HXFA 5AW7B 3AE7C 4N5CA 2KYVA 3E7KA 1YHQP 2IF4A 2NRGA 3LJNA 3H1LJ 1OW8A 2JLBA 4ANXA 1BU9A 1OZHA 5JJ6A 4H13B 3UM0A 5LFAA 1QLED 4IFDK 4A63B 3C9IA 1IYGA 1N7SD 3OA7A 5GTHH 3ESKA 4G8LA 5BNWA 3NQPA 1NTMD 4OAUC 4JC8A 1BGYE 3DPYA 1DVPA 2UWJE 1JY2N 4U0UA 2AEFA 1S1CX 1M90Q 3E37A 2HPCA 4AM9A 3AEFC 2V4HC 2O1KA 4L7TA 1Z3XA 2P1JA 2C0WA 1LTJA 3A2AA 3CWBD 3U59A 1BCCJ 4CDNA 4NPDA 2N9BA 1SFCC 1DCQA 3G3ZA 3T8MA 2XDJA 2Y0BG 4M3OA 5T4YA 4L23A 1NOHA 1MZCA 2WXQA 3LY8A 3V5BA 4XI0A 1ZMEC 3CC4P 4LLHA 2X3MA 3T9KA 1K1BA 2LKMA 3P8CE 2KC7A 4YXDC 3LW5H 3CCRP 4A55A 3JQ1A 1NTMK 3CLQA 1YJ9P 4U04A 3CXHH 4YNDA 2BEQD 3RSEG 2QFCA 4KT0J 1YA0A 1QL1A 2R32A 2H89C 2J58A 5BPPA 2P9NG 5BU5A 2IZ1A 3V31A 3HUSB 3I3NA 3ASOE 4JEHA 1EDKA 4DJAA 2WSEJ 1NU1E 3H1IE 4KVOA 1Z3YA 3CHRA 5CMWA 1T8ZA 1E90A 3GHGC 2HE0A 1NTME 1LTSC 2ETAA 5GTIH 3N7NA 1VQ7P 3MKQA 3L13A 4G8KA 3CWBE 3M9BA 1AVYA 4I6MC 4KBQA 5G04J 3APDA 1NH4A 2YNYA 4ASVA 2XZDG 3P8MC 4CPGA 1SA5A 1PP9D 2HG5D 4CRWA 3SFDC 4GTTA 1GZLA 2V8SE 1NTKD 3MGNA 2M0BA 3PVLA 3O8ZA 1WG0A 2IDBA 1X9VA 1X79B 3VMZA 1HBWA 1PGOA 1YJNP 5FT9A 1X0TA 4WWNA 4C9BB 5DJUB 3PZ4A 3ZKJA 4WUYA 1BI8B 5JMND 3L70J 4R4MA 1M57D 1H88A 1KILB 2FYUG 2KZTB 4NIKA 2ZXWE 3D9IA 1K73Q 2VYIA 4ACLA 2B9BA 3BCCD 2C0XA 3CMAP 3TAXA 1H19A 4UWGA 1E7VA 2LXBA 3RK3D 2MOWA 4ILHB 2DZOA 4O6FA 3VTYA 2VSOE 1DEEG 1U7JA 2J08A 1NTKK 1N73B 2FYUD 2ZYDA 2DYRE 2R5BA 4GKGA 1TR4A 1H8AA 3PZ2A 4U63A 3RKVA 1V55E 3SBSA 2LXCB 2QRXA 4KHXA 4FU3A 1E7UA 1NTZD 4OGQD 5KCMA 5IY5E 1IXVA 1PP9E 1HE8A 4YTPC 3CIAA 1KILE 2YMYA 1S70B 1NTKE 1SZAA 2R05A 1KB9I 2ZJSE 3FH8A 1Y9BA 2ETBA 5M1BA 4GMLA 2W6AA 2PFXA 1VDYA 4NURA 2E76D 1UIIA 4W7ZA 5BUZA 1JY2P 5CCGA 3ML9A 5CCGD 1L5JA 1X5BA 3URZA 5KLVG 2K9YA 4GCNA 3EU5A 3HE4B 1Q2ZA 4I17A 3UTMA 2P58C 5ENQD 3CCQP 1YCSB 1L4AD 3L74E 4L2YA 4D6TJ 1KZOA 3M91A 3L9TA 2W83C 2WVRA 3AU5A 2LXMA 3H1KD 5DBKA 5B1AE 3E34A 2PNNA 3O48A 3H1LE 5APVA 1NTZK 2FYNB 5D2MC 4I6GA 1OCCE 3ML8A 5APSA 3ZIMA 4HYTB 5AW5B 4YVQC 3L75J 5CCHD 4CGWA 4BEPA 2VGEA 1LP1A 5EIBE 2E42A 4DK5A 1VL2A 1IK9A 1SQPJ 1NAFA 2C9NY 2WB2A 3M06A 4QFVA 3ZYMA 4W80A 2XENA 4AVXA 3CQGB 1IHGA 3TWSA 1BCCE 2QSIA 1TYQG 3KS2A 4DX1A 2XQ0A 2WPQA 4GOEA 1SFCB 4N78E 3ABLE 5KJLA 2VRSA 4U96D 2OYIA 4CZ2D 4I2LC 3HE5B 5E79E 1BLXB 3AEBC 1EDIA 1PPJG 4B89A 1T6AA 2J8SD 5AYWD 2E0IA 4Q69A 1OWMA 2IBZD 2W6BA 2P10A 5FQ8A 3ABVC 2R59A 1WAO1 5CHXA 4G2VA 3I5PA 2CK3H 5APTA 3JQ0A 3Q9NC 1IFIA 4K5AB 3WXXA 1XTGB 1SQBJ 2VGYA 2XPYA 1N0RA 2ZGGA 3BG1B 2X6IA 2F8YA 1VQMP 2C0LA 4F7AA 1N54A 1ELRA 3GHGB 4RESB 1YI2P 2GUVA 2BCCJ 4BWRA 3FUHA 3CX5E 1FAVA 1HFAA 1M1JC 3UM2A 3UQ3A 4UB6H 3CVVA 2E74D 1QZ2A 2R44A 3SQVA 3V4WA 3NTNA 5ENSD 1N2DC 4FULA 2IEJA 4YPCA 1W2EA 1HG2A 3U4TA 4N3AA 1MV8A 1OW7A 1AP7A 1YYHA 5B3SE 5T8IA 5AW6B 2NPSA 1JY3N 1YQ3C 3FU0A 3HRAA 3HHMA 5LP0A 3RJVA 1G3NB 3L73D 4R7LA 1BE3J 5FZQA 1W2BO 3D3MA 2H43A 1L0LD 5JHAA 3B7RL 1KD1Q 1KPSB 3L70E 1OCRE 3L71J 4NPFX 3CHPA 2WSCH 3LW5J 1EQ7A 4L74A 1YTZI 3AEAC 2V5FA 3QB2A 3TGUD 2VSNA 1VQOP 3AG4E 3C98A 1N7LA 2FKWB 5HRYA 2A06E 4UQXA 3S7BA 2R02A 1H2TC 4YDEA 3TWTA 5KAIE 4EPZA 1GU4A 5ENRD 1M8OB 4J8DA 3B7SA 1CI6A 3VTPC 1GMJA 3G4SP 3B5NC 2Z4EA 4I2WA 1ZLLA 5B66H 3HXCA 1OWOA 3KDPB 1VPCA 3CSFA 1IQUA 3DBSA 1L0NG 1RE3C 3T97A 3QWWA 2BKKB 2KLUA 2LUHA 2XKMA 2G8YA 1LD8A 3HD7C 2BEZF 1INZA 2KK7A 4WWOA 2FBWC 4H7YA 3ZEFA 2WZ7A 1JM0A 5AW8B 4DRXE 5FIOA 1J1EC 1JMMA 3MUDA 4D6TE 1SZ9A 3BUAA 4HI9A 2VSXE 3II6A 1DCEA 3ASNE 5KJKA 5APQA 4PD4D 4MKTA 1R8EA 3EHRA 2UY1A 3NF1A 5M72A 2QJYB 4I1LA 3JCKC 4QQIA 2Y1LE 1SQBD 2KOGA 2MJZA 2DBAA 2A45G 3CCVP 1TJCA 3L75E 3KQGA 1FZCC 4DT0A 5KJ7C 3UM3A 2IO2C 1USEA 4JBZA 3VN0A 2AWIA 1KZPA 1SQPE 1USDA 2M3EA 3Q5RA 4ZHBA 4ME2A 3L72G 1NA3A 3AG3E 5LCWC 2KS1B 2LAHA 4GB9A 4CT4A 4CGVA 1PY1A 1SQXG 2GA1A 4GZDA 2O01N 3L35A 5AVZB 4KZ0A 3TDKA 4GTPA 2A45I 3D71A 1HJ0A 3CQCB 3FUFA 3DRAA 2XHEA 5J08A 3ISMC 2J09A 1SQBK 1BSHA 3V30A 3RGUA 3FULA 4G24A 4O9BA 5KNHD 3RIBA 2ETCA 4JW1A 1VQNP 1JCSA 1SVXA 4M7CA 2P9KG 2XEHA 2ZVNB 4DZOA 1GW3A 3CK8A 2NSZA 1W3BA 2WPVA 1NKNA 4XE0A 1MYOA 5JA4D 3C5RA 4U3FD 2M5AA 1KQFB 4C7RA 1FE6A 3IV0A 5CERB 4HRNA 3AS8A 1SQBE 4UQYA 4F3VA 1N7SC 4GOFA 3L71D 3UMVA 4P29A 2E75B 3CK9A 5EIDA 3TXNA 2B89A 1FJPA 1JY3P 2OCCE 1H2VC 3CXHD 4IL6H 1LWUC 1BDDA 2BCCE 4BETA 1SQVG 4APOA 4I1MA 4U8YD 4K5CA 1W5CE 4CDMA 5A23A 2LXLA 3LCAA 2RD0A 1FPPA 3DXMG 1H2UA 3O4ZA 5G55A 1E79H 2Y9YA 3QOUA 1ZR4A 1RZ4A 4U8HA 5GTHE 3IBEA 3DSUA 3SI5A 2QA4P 2OTKE 1M1JB 1JMBA 3HRNA 1RF0A 1HF8A 1Y47A 1AWCB 1V54E 3CC7P 3TF5A 2BASA 3G71P 3CCSP 3EUVA 3E33A 2IYPA 3OW2O 3FUNA 2NYJA 2FEZA 2L9BA 3CVLA 1SQMA 1LTGC 3LEWA 3ZFWA 1OIPA 2MYOA 1BE3E 2R5SA 5EX0A 5HQ8A 3PH0C 2DWZA 4L1BA 2L6BA 1ZP0C 1RQVA 5KKZC 3RRUA 3SF4A 4J8EA 4PS7A 3H1JD 3MZWB 4EI2A 4GTMA 2W8ZA 2WT7B 2QYUA 1RH5B 4DPRA 4N2QA 3LPZA 2J4DA 3L71E 2QZAA 4JZYA 4LEUA 1K1AA 2P9UG 3BRVB 1HGVA 1DC2A 1Z56A 1OFCX 3CXHE 2BKGA 3S4RA 1YBKA 1BPOA 3QAQA 1D8EA 3CL3D 5CRUA 4O60A 2KM4A 3ASFA 2Z5HA 1UJKA 3W9FA 2WXFA 5ITZF 3JCUH 1QX8A 3DEOA 3FTWA 4GZCA 1ZN5A 3CVYA 1NAYA 2AXTH 2XEVA 5APUA 3FP3A 4NRHB 3B5NB 5GTIE 2E5TA 5CJ0A 1NL4A 4GA2A 1UN9A 3TWQA 1SQQD 3FTUA 1B89A 1RQUA 3I56P 4FC8A 4EECA 3CHQA 3KAEA 1PL5A 1ZW0A 3HD7B 1M56D 1KT1A 2GRLA 3E1RA 2QC9A 3TWRA 1VF5C 2OOEA 4MN4C 3LJ3A 4GT1A 3ZN3A 5B1BE 4WY4D 2KNCA 3HTKB 3V2OA 1J1EB 4EZJA 1FZEA 3RK3C 3U1CA 1UW4B 4HRMB 1QQEA 2KB7P 3DPDA 2IQCA 1E5WA 2I2OA 3SFZA 3VLFA 3ABKE 4DX5D 3D9OA 5AJLA 5FQ4A 1ZRTD 2JEEA 1KYOD 4GAAA 1U3DA 4DLOA 1G1IA 4PD4H 3BEEA 2FULA 1EZVD 3G2VA 3PZ3A 4DX6D 1OY3D 2PQNA 1KYOI 2VQ2A 5EILA 1OWAA 4HLEA 4OGQC 4WNEA 1LT9A 2WSCJ 5BXUA 4XFJA 1CW5A 5DJTB 3R9AB 1FVFA 2XRZA 1IFNA 3DSTA 3U66A 3IFMA 3KSLA 5KBAA 2IONA 3VP9A 1RY3A 2IJGX 2E76C 2A45H 1MZ9A 4KMOA 5BW8C 2I6HA 2QY7A 3FX0A 3EHMA 2EIKE 3BCCJ 1TJFA 4H13D 1AA0A 5CCLA 5AW0B 2PAJA 1L4AC 3P7KA 2FO1E 5AENA 1U2VG 5AW3B 2FYUJ 3EHNA 3PP5A 4IFFA 1MX4A 2XGMA 1ZXGA 5EFWB 3AS5A 4D10C 2V7QH 1NU1G 3H1IG 1OWLA 2Y0EA 3RK6A 1FCHA 1UN8A 3QKYA 5CCHC 2QJPC 1NTZJ 1HUCA 5J90A 3HDXA 1UJJA 3UINC 3V4QA 3FTXA 1EZVE 4GZ6A 1N7SB 5AJDA 5AAOA 1JWFA 4IFMA 1VQ6P 1NWQA 3FH5A 2QG4A 4NACA 4BERA 1Z6TA 3PDNA 4ILIA 4DI3A 4LCTA 1FC2C 5G04C 2Y0CA 2V5QC 3M0DC 3D70A 1D9SA 2AXUA 1LWUB 4AIFA 3ZUVB 1KN7A 2N9YB 3JYSA 3ULYA 2XV5A 5KLVJ 3H1KJ 1IHBA 1D7MA 2ZT9C 3HUSA 1GDTA 3EIQC 2BUGA 4O1PA 4DX2A 2HR2A 1LTIC 3E1IA 5AVQB 4EQFA 5AVUB 1TNYA 3BG0B 4B94A 1VQKP 4WWPA 2V0PA 3F6QA 1H0TB 2WQ7A 3B13A 3A0BH 4JL0A 4GZ5A 3KSQA 1DD4A 3PREA 4GTVA 4LNUD 1YITP 4OVVA 2YO2A 1LTXA 1EXJA 1KLXA 4IOIH 3D9NA 2YHEA 3CI9A 2JEKA 3USSA 1JPLA 4Z68A 5KKZB 3A5TA 1FOSE 3AE1C 3ONLA 2NC9A 2WXMA 2IO3C 3UKRG 2K9JB 1G2CB 2WMNA 2Q1KA 3DWLG 3LXUX 1GW4A 4BESA 2XPZA 5FTPA 2N1TB 3DXKG 2E74C 3L22A 3J5PA 2H6FA 3CVXA 2IU1A 1EC5A 2LO6A 3OTNA 5E76A 2L0IA 2Y0DA 4LNGA 1JCRA 2LSUA 4LSZE 2RN0A 3AECC 2X6FA 3WUVA 1VDFA 1N8RQ 1KT0A 2MRIA 3O6QB 2ZISA 4HKZH 3H1HG 2KZTA 3ONKA 1KQLA 1QNFA 1A02F 4BRYB 1TU3F 3L74G 4Y6CA 4I9EA 5H7PA 4DJGA 2VJ8A 1N73A 2ZFCA 3CCJP 1DD3A 4HOSA 4UB6E 1P5QA 1J1DC 4U07A 2R2LA 4JXTA 3H1LG 1MX6A 4HQDA 3VMYA 2PM6A 3EFGA 2D2CD 3PEUB 2HODA 1VF5B 3H32A 2GRNB 1PGQA 3A0HH 5KAFH 4YDOA 1KB9D 2JKVA 4TUUA 1IFDA 2QJKC 2XNDH 3F5HA 4N5QA 3LS8A 4TXRA 3OXFA 1NZNA 2RG8A 1Q82Q 1PIXA 4K35A 3NOCD 4CT0A 3RK3B 2F37A 4W7YA 3CCEP 4EZKA 5FZRA 3UM1A 4DI4A 3LKUA 1R5LA 2WXLA 5JJ7A 2FYUK 4GPMA 1Y8AA 5KLIC 3L73J 4DOJA 3BVHA 1KYOH 4PV1D 4ANVA 2AXVA 4GTSA 1L0LJ 3W9GA 4OGQB 1QVGO 4AY6A 1E8WA 4TXQA 2LR2A 5KLVD 4FA6A 2Y3AA 3AE8C 2IY0C 1NGMB 1H89A 4IN3B 4KVMA 4OYSA 3BCCE 4KXKB 1KMIZ 4HB1A 1WM5A 2E76B 3TGUJ 1H6OA 3HYMB 3RK3E 4DUIA 2FYUE 2CHWA 4F6RD 3RRNB 4HXIA 3LVQE 1MKMA 1YJWP 4PH4B 2DVWA 4WNGA 2YINA 5AVXB 1L4AB 2WITA 1YTZT 2HO1A 4U95D 3GF7A 4XEIG 4BX8A 3V2XA 3R4YA 1ZB1A 3RL0g 2YXQB 1NTZE
chains in the Genus database with same CATH topology
1JM0A 1H0TA 4DRXE 1MX2A 5FIOA 3ZDMA 4HI9A 3UXGA 1SS1A 3EHRA 3PH0A 4QQIA 2Y1LE 3V79K 4HBDA 2B87A 3DEPA 1Q2NA 2K3RA 1NVOA 4JBZA 2WMMA 2QVAA 4ZHBA 3ZNGA 5AN8A 2KS1B 5FINA 3UI2A 3QWOC 5HS0A 1EDJA 5KNGA 4RLYA 5K5GB 3B7BA 4KJMA 3V30A 3ZU7B 3RGUA 5CBOA 1UOHA 3TWVA 5KNHD 2ETCA 5CBNA 1SVXA 2XEHA 1YMPA 2P2CP 1MYOA 5JA4D 3C5RA 3D9HA 3S1KA 2M5AA 4HB5A 5CERB 4WWIA 4HRNA 3TWUA 4GOFA 4NPEA 2KBXA 5EIDA 2B89A 4TUMA 1S3JA 2SPZA 4C48B 3NOGD 3NBNB 1MJ0A 5AARA 1BDDA 3LJNA 1SW6A 4BETA 4U8YD 3IXEA 1BU9A 4K5CA 4A63B 3Q9UC 1N11A 4G8LA 4OAUC 4HLLA 5C39A 2I8DA 2OTKE 1JMBA 2UWJE 2KZJA 4JB8P 5AQ9A 1A5EA 2KIKA 1NFIE 1Y47A 1OVRA 2V4HC 1AWCB 2NYJA 4NPDA 1DCQA 2Y0BG 3MHVA 2MYOA 4O1OA 2DWZA 4YDYA 2L6BA 1K3ZD 4J7WA 3T9KA 3MZWB 1K1BA 4HNAD 1K1AA 5ENOD 1DC2A 5CEDB 5EYLA 2BKGA 3FXEA 1LP1B 2P58A 4LG6A 3V31A 4O60A 5ENTD 1EDKA 3W9FA 4B93B 5ITZF 4J8YA 3EU9A 2HE0A 4K3AA 3DEOA 1LT1A 3AAAC 2ETAA 1U7MA 3TWQA 4G8KA 3AJIA 4HI8A 1ZW0A 4ASVA 2F8XK 3TWRA 2QC9A 2XZDG 4CPGA 4MN4C 2KUBA 4ZMDA 5CEAA 2M0BA 1WG0A 3V2OA 2JABA 4HRMB 5EN5D 1BI7B 1X0TA 4DX5D 4UUCA 5DJUB 3ZKJA 1BI8B 5JMND 4DX6D 3SO8A 1OY3D 4NIKA 5EILA 5HKPA 5BXUA 5DJTB 2LXBA 5KBAA 2DZOA 1DEEG 1U7JA 5CECB 4K5BA 4DX7D 3KEAA 1TR4A 2KZIA 2LXCB 2QRXA 5BXOA 2FO1E 2B0OE 1IXVA 2KXPC 1MX4A 4ATZD 1ZXGA 5EFWB 1S70B 4HJGH 2ETBA 3JXJA 4YDWA 1QYMA 3UTMA 4F1PA 5ENQD 1YCSB 1OVVA 3FXDA 1BD8A 5AAOA 4BERA 2PNNA 2ZAEB 1FC2C 5KWDA 2V5QC 1D9SA 1WDYA 4GODA 3ZUVB 4BEPA 2VGEA 1LP1A 5EIBE 4GMRA 1IHBA 4ZNCA 5D66A 4O1PA 4DX2A 4QFVA 2XENA 3HG0D 2DZNA 3B95A 3TWSA 3F6QA 3TWWA 1H0TB 4ZFHA 4DX1A 4OAVB 4GOEA 4LNUD 2XZTG 1OT8A 5ENPD 4IOIH 4U96D 4CZ2D 1BLXB 2HR3A 4Z68A 1EDIA 1BDCA 2J8SD 2B88A 2B87B 3JUEA 2A5EA 3Q9NC 2Q1KA 4K5AB 4BESA 2JWDA 1N0RA 2RKLA 2ZGGA 3J5PA 5AQBA 2F8YA 1EC5A 4LSZE 4HKZH 3TWXA 3J5QB 5AQAA 2QYJA 4EYYQ 2ZGDA 2RFMA 5EYPF 2R44A 1MX6A 4HQDA 5ENSD 4BXLA 4U8VD 2M5AB 1AP7A 1YYHA 3HRAA 4N5QA 1G3NB 3JXIA 3NOCD 4K35A 2F37A 3EHQA 5AQ7A 2XEEA 3T8KA 4HRLA 4BSZB 4NPFX 2RFAA 4GPMA 2KI7B 1N0QA 3W9GA 4CYMD 2LR2A 4ASWA 5HRYA 3TWTA 4HB1A 5ENRD 1MFTA 4DUIA 1OVUA 4F6RD 2AJAA 2DVWA 2BKKB 1IKND 1EDLA 4U95D 3V2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JM0 A;  1H0T A;  4DRX E;  1MX2 A;  5FIO A;  3ZDM A;  4HI9 A;  3UXG A;  1SS1 A;  3EHR A;  3PH0 A;  4QQI A;  2Y1L E;  3V79 K;  4HBD A;  2B87 A;  3DEP A;  1Q2N A;  2K3R A;  1NVO A;  4JBZ A;  2WMM A;  2QVA A;  4ZHB A;  3ZNG A;  5AN8 A;  2KS1 B;  5FIN A;  3UI2 A;  3QWO C;  5HS0 A;  1EDJ A;  5KNG A;  4RLY A;  5K5G B;  3B7B A;  4KJM A;  3V30 A;  3ZU7 B;  3RGU A;  5CBO A;  1UOH A;  3TWV A;  5KNH D;  2ETC A;  5CBN A;  1SVX A;  2XEH A;  1YMP A;  2P2C P;  1MYO A;  5JA4 D;  3C5R A;  3D9H A;  3S1K A;  2M5A A;  4HB5 A;  5CER B;  4WWI A;  4HRN A;  3TWU A;  4GOF A;  4NPE A;  2KBX A;  5EID A;  2B89 A;  4TUM A;  1S3J A;  2SPZ A;  4C48 B;  3NOG D;  3NBN B;  1MJ0 A;  5AAR A;  1BDD A;  3LJN A;  1SW6 A;  4BET A;  4U8Y D;  3IXE A;  1BU9 A;  4K5C A;  4A63 B;  3Q9U C;  1N11 A;  4G8L A;  4OAU C;  4HLL A;  5C39 A;  2I8D A;  2OTK E;  1JMB A;  2UWJ E;  2KZJ A;  4JB8 P;  5AQ9 A;  1A5E A;  2KIK A;  1NFI E;  1Y47 A;  1OVR A;  2V4H C;  1AWC B;  2NYJ A;  4NPD A;  1DCQ A;  2Y0B G;  3MHV A;  2MYO A;  4O1O A;  2DWZ A;  4YDY A;  2L6B A;  1K3Z D;  4J7W A;  3T9K A;  3MZW B;  1K1B A;  4HNA D;  1K1A A;  5ENO D;  1DC2 A;  5CED B;  5EYL A;  2BKG A;  3FXE A;  1LP1 B;  2P58 A;  4LG6 A;  3V31 A;  4O60 A;  5ENT D;  1EDK A;  3W9F A;  4B93 B;  5ITZ F;  4J8Y A;  3EU9 A;  2HE0 A;  4K3A A;  3DEO A;  1LT1 A;  3AAA C;  2ETA A;  1U7M A;  3TWQ A;  4G8K A;  3AJI A;  4HI8 A;  1ZW0 A;  4ASV A;  2F8X K;  3TWR A;  2QC9 A;  2XZD G;  4CPG A;  4MN4 C;  2KUB A;  4ZMD A;  5CEA A;  2M0B A;  1WG0 A;  3V2O A;  2JAB A;  4HRM B;  5EN5 D;  1BI7 B;  1X0T A;  4DX5 D;  4UUC A;  5DJU B;  3ZKJ A;  1BI8 B;  5JMN D;  4DX6 D;  3SO8 A;  1OY3 D;  4NIK A;  5EIL A;  5HKP A;  5BXU A;  5DJT B;  2LXB A;  5KBA A;  2DZO A;  1DEE G;  1U7J A;  5CEC B;  4K5B A;  4DX7 D;  3KEA A;  1TR4 A;  2KZI A;  2LXC B;  2QRX A;  5BXO A;  2FO1 E;  2B0O E;  1IXV A;  2KXP C;  1MX4 A;  4ATZ D;  1ZXG A;  5EFW B;  1S70 B;  4HJG H;  2ETB A;  3JXJ A;  4YDW A;  1QYM A;  3UTM A;  4F1P A;  5ENQ D;  1YCS B;  1OVV A;  3FXD A;  1BD8 A;  5AAO A;  4BER A;  2PNN A;  2ZAE B;  1FC2 C;  5KWD A;  2V5Q C;  1D9S A;  1WDY A;  4GOD A;  3ZUV B;  4BEP A;  2VGE A;  1LP1 A;  5EIB E;  4GMR A;  1IHB A;  4ZNC A;  5D66 A;  4O1P A;  4DX2 A;  4QFV A;  2XEN A;  3HG0 D;  2DZN A;  3B95 A;  3TWS A;  3F6Q A;  3TWW A;  1H0T B;  4ZFH A;  4DX1 A;  4OAV B;  4GOE A;  4LNU D;  2XZT G;  1OT8 A;  5ENP D;  4IOI H;  4U96 D;  4CZ2 D;  1BLX B;  2HR3 A;  4Z68 A;  1EDI A;  1BDC A;  2J8S D;  2B88 A;  2B87 B;  3JUE A;  2A5E A;  3Q9N C;  2Q1K A;  4K5A B;  4BES A;  2JWD A;  1N0R A;  2RKL A;  2ZGG A;  3J5P A;  5AQB A;  2F8Y A;  1EC5 A;  4LSZ E;  4HKZ H;  3TWX A;  3J5Q B;  5AQA A;  2QYJ A;  4EYY Q;  2ZGD A;  2RFM A;  5EYP F;  2R44 A;  1MX6 A;  4HQD A;  5ENS D;  4BXL A;  4U8V D;  2M5A B;  1AP7 A;  1YYH A;  3HRA A;  4N5Q A;  1G3N B;  3JXI A;  3NOC D;  4K35 A;  2F37 A;  3EHQ A;  5AQ7 A;  2XEE A;  3T8K A;  4HRL A;  4BSZ B;  4NPF X;  2RFA A;  4GPM A;  2KI7 B;  1N0Q A;  3W9G A;  4CYM D;  2LR2 A;  4ASW A;  5HRY A;  3TWT A;  4HB1 A;  5ENR D;  1MFT A;  4DUI A;  1OVU A;  4F6R D;  2AJA A;  2DVW A;  2BKK B;  1IKN D;  1EDL A;  4U95 D;  3V2X A; 
#chains in the Genus database with same CATH topology
 1K04 A;  1O1R A;  1T2K D;  2RKK A;  2O1J A;  4U7E B;  5KLV K;  1VQP P;  2EIJ E;  2OQQ A;  2QJP B;  1S63 A;  4GTR A;  1SFC A;  1HS6 A;  3V2P A;  3LID A;  2QIW A;  2AW6 A;  4XA4 A;  3QJZ A;  3ULE G;  3AG2 E;  3HVE B;  5JJT A;  4K0R A;  1L0N J;  3HE5 A;  4MRU A;  2OGU A;  3Q49 B;  3FHE A;  3V79 K;  3FFL A;  4I1A A;  2X6H A;  3PRZ A;  5CMZ A;  4TRQ A;  4LGD E;  5ANR A;  5KLV E;  3CX5 I;  5LX8 A;  3CVU A;  3H1K E;  4OVN F;  4G23 A;  4I43 A;  1PPJ D;  3Q3D A;  4B8A A;  4HS2 A;  2FFD C;  3Q1M A;  4IYP A;  3RRM B;  1MQS A;  3QAR A;  2PGD A;  1TN6 A;  4DCK A;  5FIN A;  2ZT9 B;  4GA0 A;  2ZU6 B;  3UI2 A;  1FZA A;  3CPW O;  1FBM A;  4LC1 A;  1IFJ A;  4L2L A;  1JEK A;  1ELK A;  3L70 G;  2VTB B;  4RLY A;  2GRQ B;  1S64 A;  4N3B A;  1IZN B;  3B7B A;  4KJM A;  3RL0 D;  1QEX A;  1RW2 A;  4L9P A;  4B8C B;  5CBO A;  3TK1 A;  2FBN A;  1S5L H;  3MJW A;  3L72 J;  3AE3 C;  2VGX B;  1IJD B;  2FI7 A;  2A06 G;  3KPE A;  3WU2 E;  3TJP A;  2V7Q J;  3CVN A;  4PUC A;  4JHJ A;  2WXJ A;  4HB5 A;  3ZVV A;  2NZ2 A;  4HH2 A;  2K37 A;  3B7T A;  3R9M A;  4AEZ C;  3PRJ A;  4WWI A;  2GM4 A;  4G26 A;  2IYO A;  2IBZ E;  2NPS D;  2OYH C;  3OAK A;  2XS8 A;  5AVR B;  4NPE A;  1LTT C;  2KBX A;  2P9S G;  3FWN A;  4TUM A;  1S3J A;  1RF0 C;  1SLQ A;  4U3F J;  1FVH A;  5T3R A;  2E74 B;  3NOG D;  3NBN B;  3HXD A;  5AAR A;  4IL6 E;  4JYB A;  1ZR2 A;  1SW6 A;  4G11 A;  2OEV A;  3FUK A;  1TNO A;  3IXE A;  2FY8 A;  2WSF H;  2PRR A;  3Q9U C;  4D6T G;  2HFE D;  3CK7 A;  1X8Y A;  3ESL A;  3Q5S A;  1RF1 A;  1EXI A;  1OXZ A;  2HYN A;  1TNB A;  1KQS O;  3IN6 A;  4HLL A;  2I8D A;  5C39 A;  3CKB A;  4LER A;  4R4L A;  3FTV A;  5AQ9 A;  2Y69 E;  2KIK A;  1NFI E;  1ELW A;  2Q5U A;  1HWT C;  3CEQ A;  1RHZ B;  3NB2 A;  2Q6Q A;  4RJT A;  3L75 G;  2CFU A;  4FLB A;  3ZPJ A;  1SQV J;  2FF4 A;  1L0L K;  1URQ A;  1URQ D;  3MHV A;  1SQP G;  3Q78 A;  1GK6 A;  4YDY A;  1HH8 A;  3PEV B;  1PFI A;  2YKQ A;  2QJK B;  1K3Z D;  2LAI A;  3Q73 A;  4J7W A;  4I6E A;  2IOS A;  1NP7 A;  4A7P A;  1NHL A;  4A3V A;  1KB9 H;  3FUJ A;  1S0P A;  4HNA D;  1L0N D;  4RG6 A;  4GZ3 A;  4XE5 B;  1OX3 A;  3L73 E;  5BVZ A;  3CD6 P;  4ABN A;  1S2E A;  1GW6 A;  1N9A A;  3QWV A;  2B6C A;  1L0L E;  4UWF A;  4I6J A;  4WB4 A;  3S7J A;  3H1J J;  2PL2 A;  3RK2 D;  3MV2 B;  1O1T A;  3AEE C;  2P58 A;  4UB8 H;  1KV4 A;  3PTZ A;  1LNQ A;  3PLN A;  4B93 B;  3JCU E;  3TGU E;  3VLD A;  3EU9 A;  4K3A A;  3FU5 A;  3RO2 A;  1KQG B;  1WT6 A;  3PNL B;  4WY4 C;  3AAA C;  2POH A;  3HXE A;  2AXT E;  4GTQ A;  3IEG A;  3G2T A;  1L0N K;  4J0U A;  2KSJ A;  3C3Q A;  2UY1 B;  5E79 H;  3AJI A;  1TNZ A;  4HI8 A;  3OJA B;  1H6K A;  4Y99 C;  3IHY A;  4K03 A;  2F8X K;  3L72 D;  3BAT A;  2BCC G;  3Q2Y A;  2WVI A;  1SQX D;  4UWK A;  4ZMD A;  3ASD A;  3D6Y A;  3L16 A;  3S7D A;  1SQQ J;  3MTU E;  1L0N E;  3Q7F A;  5KTB A;  2JAB A;  5EN5 D;  1FS0 E;  2QE7 H;  3X2Q E;  2AEJ A;  5C1D A;  3IKO B;  2ZYG A;  1WY6 A;  3LYA A;  4PD4 E;  2WXK A;  2BF0 X;  1GL2 A;  3CX5 H;  4IRU A;  1GL2 D;  3QH9 A;  3SO8 A;  4TT3 H;  1GK4 A;  1BE3 G;  3UX4 A;  5TJH A;  4TXP A;  2E75 D;  2FFD B;  1Z5S C;  1X81 A;  3DSX A;  5AW9 B;  4M3L A;  5APY A;  1SQX K;  3ZHE B;  4I2Z A;  2P9L G;  1AVO A;  2XGS A;  4H0L D;  3MGB A;  4K5B A;  2ZXX A;  3G2U A;  3MCX A;  2J9Q A;  1RE4 A;  2GUS A;  3MP7 B;  1N95 A;  1JCC A;  1LTJ C;  5APW A;  2KZI A;  3FDH A;  3PJS K;  2P67 A;  5BXO A;  3H25 A;  3VTX A;  4ZKP A;  2GW1 A;  4FHJ A;  3PZD A;  1SQV D;  5CHE E;  4XIF A;  3KZI H;  1PC2 A;  4F53 A;  4ATZ D;  2L5G B;  3ASH A;  1M1J A;  4FAD A;  4HJG H;  1VQ8 P;  1FDI A;  4YDW A;  2PQR A;  3ITK A;  3TXM A;  4X8Q A;  3FU6 A;  2YO3 A;  1FZF A;  1JO5 A;  3L36 A;  4LUN U;  1HZ4 A;  2GRP B;  4CDR A;  3QNK A;  3GG2 A;  1IO4 A;  3SHF A;  4ANU A;  1OVV A;  4RKU J;  1U3C A;  4U3F E;  1DX7 A;  2PP6 A;  3FXD A;  2OYH B;  4UI9 J;  2KCK A;  4C7N B;  4AYC A;  2ZAE B;  3CVQ A;  5KWD A;  3H1I J;  2P2U A;  1A02 J;  1SQV K;  1DIP A;  2O01 H;  5AVY B;  1IC2 A;  4GOD A;  3U9W A;  5ARG A;  5H2F H;  3CGH A;  3AE2 C;  1JNM A;  4GMR A;  1P84 I;  3CC2 P;  4ZNC A;  3E32 A;  1LTA C;  1AFO A;  2QM7 A;  3JUI A;  5AW2 B;  1JOC A;  3WUU A;  2KCV A;  5FWQ A;  3HG0 D;  4WAF A;  1SQV E;  1AJY A;  2WXG A;  2IFM A;  3TG5 A;  3QDN A;  3TWW A;  1N52 A;  4ZFH A;  1PZQ A;  3B5N A;  3A0B E;  3KHU A;  4BT8 A;  4F1S A;  2NXP A;  4E6H A;  4JHK A;  4AV7 A;  4GIF A;  4N6J A;  1HTL C;  4W9R A;  3E30 A;  1T3U A;  3L08 A;  4OVU A;  3GZ2 A;  2HR3 A;  4XKC A;  3N4X A;  1JTH B;  1FZB A;  3FTZ A;  2A4Z A;  4RQI A;  5G05 C;  3HD7 A;  2GGF A;  1LTB C;  3MKR A;  3L6A A;  3B4S A;  2X6K A;  4H44 D;  4EOT A;  2B87 B;  1JCD A;  5BV0 A;  1FT1 A;  2L0T B;  3H1J E;  2A5E A;  1XGW A;  3ZYL A;  3PNT B;  3AE6 C;  3D9M A;  3Q15 A;  2EIN E;  3LY9 A;  3N71 A;  5E75 A;  1A17 A;  1JCQ A;  4Z1M H;  5AVV B;  3L17 A;  2JWD A;  5BU8 B;  1BGY G;  1K8K G;  5AVW B;  2UWJ G;  5TIS H;  3IAO A;  4GA1 A;  2MHK A;  1HVV A;  2D2C C;  3U64 A;  4A3T A;  1SQQ K;  3NZU A;  3CHS A;  5KJ7 A;  1WRG A;  1FZC B;  3TWX A;  3WMM 0;  4WY4 B;  4IL6 X;  3J5Q B;  2XS1 A;  2WSF J;  1HX8 A;  1FDM A;  4GTO A;  5G05 J;  2H7H A;  3B7U X;  4G25 A;  4EYY Q;  2IFU A;  2ZGD A;  2DW3 A;  2IPP A;  3MZL B;  5EYP F;  3FUE A;  5CCG C;  4Y99 B;  4BXL A;  4U8V D;  1SQQ E;  4FHK A;  3PZ1 A;  2QEX P;  4PV1 C;  3TL5 A;  1D8D A;  1NKZ B;  5EDS A;  3P8C D;  1TN7 A;  3A0H E;  5KAF E;  2MKV A;  3H1H J;  3ABM E;  4FJY A;  3TNU B;  3LDZ A;  1IFP A;  2XPI A;  2GRO B;  2OAR A;  4YVO A;  3EHQ A;  3V6I A;  3ASG A;  5B5E H;  5AQ7 A;  1LF8 A;  4AY5 A;  2VSY A;  4HRL A;  2E43 A;  4I9C A;  4JYC A;  2WXN A;  1NTM G;  2RFA A;  1NI1 A;  1NU1 D;  3H1I D;  5C2Y A;  4ANW A;  2KI7 B;  2Y4U A;  1ZRT E;  1KYO E;  4JHR A;  4URK A;  1UG3 A;  1AQT A;  1N0Q A;  1ZOY C;  1N7S A;  1SVF A;  4WVZ A;  1KTM A;  2KCL A;  4CYM D;  2H8P D;  1M1K Q;  3CWB G;  4HVB A;  3A7O A;  3M0A A;  1JUN A;  3Q75 A;  5JHB A;  1T2K C;  2HPC B;  4EHM A;  4H7X A;  2K88 A;  1LWU A;  1MFT A;  4JPZ B;  2GRR B;  1OVU A;  5ENN A;  4PS8 A;  3GZS A;  1LTJ B;  4XKB A;  4N2S A;  1FJK A;  3U1A A;  3D9L A;  3FTS A;  3AE4 C;  3G6E P;  4UI9 K;  2AJA A;  4JQ0 D;  2OYI C;  3SY2 A;  1IKN D;  4EZL A;  1JWG A;  2YIU C;  1NU1 K;  2YKO A;  1J2J B;  1QVF O;  2WXI A;  1CZQ A;  3IF4 A;  3MD0 A;  3LY7 A;  4C0M A;  3VYI A;  2OTL P;  4I1O B;  1H0T A;  1HG5 A;  3FU3 A;  1MX2 A;  1S4X A;  3PUJ A;  4C46 A;  5AW1 B;  4RVB A;  3UXG A;  1NYH A;  4TV3 A;  1SS1 A;  3PH0 A;  2E2E A;  3FWL A;  3MEK A;  2ITA A;  3FUD A;  1HU3 A;  2JDI H;  4N3C A;  1R5S A;  4HBD A;  1IFM A;  3D6Z A;  3DEP A;  2I9C A;  4MLP A;  1Q2N A;  5L8R J;  2K3R A;  3RL0 C;  1NVO A;  3CHO A;  5KJN A;  2ZIR A;  2K9J A;  1G2C A;  3QWP A;  3RBZ A;  3M9H A;  3ULQ A;  3UIP C;  2OVF A;  1DH3 A;  3AE5 C;  1QL2 A;  4RO0 A;  1P84 H;  3AE9 C;  4E85 A;  1L2P A;  1YQ4 C;  4WBA A;  3ZYK A;  2N1T A;  2N1T D;  5AVT B;  1PP9 G;  2R03 A;  3MKQ B;  2L91 A;  1OWP A;  1OUV A;  1NTK G;  1K8A Q;  1EF1 C;  1N94 A;  1NO4 A;  4N3Y B;  3FWV A;  3O6Q A;  2CFZ A;  2WQY C;  3ZXP A;  2J5U A;  2ILR A;  3EIJ A;  4MBG A;  1KIL A;  2YNQ A;  1KIL D;  1JY2 O;  3ZU7 B;  2NPS C;  4PJ0 H;  4QMA A;  3FH7 A;  3TWV A;  4BRY A;  1KFN A;  4A1S A;  4I7Z C;  2J49 A;  1S5L E;  4XX5 A;  3H1H D;  3FY4 A;  2YXR B;  2C9L Y;  1HXI A;  1YMP A;  2WXR A;  2JR8 A;  4Y6W A;  2RMZ A;  2J4B A;  2HLO A;  3BCC G;  3L74 D;  3I4G A;  3CR3 A;  4LRZ A;  2C0M A;  1VF5 D;  3D9J A;  1FT2 A;  2Q9I A;  3H6P A;  3S7F A;  3H1L D;  3LVR E;  1ZBP A;  1RF1 C;  3SWK A;  3EFF K;  5A6C A;  2AEM A;  2JWA A;  2XU6 A;  3WUT A;  1FOS F;  3BRT B;  2M63 A;  1MJ0 A;  3CHM A;  3CME P;  1M7L A;  1NTZ G;  2AXZ A;  2ZVO B;  2P7J A;  2WXO A;  1BCC G;  3VOP A;  2D2C B;  3LIE A;  2RH0 A;  2HOD B;  1URQ C;  3HE4 A;  3H32 B;  3PE4 A;  2I1K A;  2O01 J;  3UT4 A;  3V2N A;  5CJ4 A;  1N11 A;  1H6P A;  1BCC D;  3Q5M A;  4WNF A;  4PS3 A;  2KZJ A;  3EJN A;  4JB8 P;  1A5E A;  3P32 A;  5CMY A;  1PV3 A;  3CCL P;  1OVR A;  1X22 A;  3S2A A;  3L82 A;  4N78 D;  3CKC A;  4JD2 G;  4BFR A;  2WMO A;  3P2B A;  3H1H E;  3MUD C;  3RK2 C;  3GF3 A;  2JO1 A;  3H1K G;  4OWF A;  2H6H A;  3OAW A;  5B66 E;  4PV1 B;  4RG9 A;  4O1O A;  2QJY C;  1L4A A;  2YQ8 A;  4BSX A;  2I1J A;  1KFM A;  4C0E A;  1Q90 D;  3V2Q A;  3F89 A;  3UIO C;  1KB9 E;  3SWF A;  3MV3 B;  1OCO E;  2OV8 A;  4U0Z A;  5ENO D;  2V4H A;  5CED B;  4ATG A;  5CCH A;  3EWK A;  4KYO B;  3TG4 A;  2CHZ A;  3D9K A;  3DSV A;  1KC8 Q;  3Q79 A;  5EYL A;  4JEU A;  4HOQ A;  3FXE A;  1VQ5 P;  1OCZ E;  3GZ1 A;  1SFC D;  1LP1 B;  3CVP A;  2CPS A;  4J8F A;  4LG6 A;  4UB8 E;  4EIJ A;  3HVE A;  4XZ4 A;  2Z5I A;  3KEZ A;  1EYH A;  5ENT D;  2FXM A;  1AV1 A;  3CX5 D;  4U7J A;  3SFE C;  2P9P G;  3OXG A;  4J8Y A;  1PGJ A;  1HO8 A;  4GCO A;  3I5C A;  5G2N A;  3A3Y B;  3M0D A;  3MA5 A;  1LT1 A;  2J07 A;  2DYS E;  3APC A;  3AG1 E;  3CVW A;  2CG3 A;  1U7M A;  3AEG C;  2X6J A;  2IBZ G;  4ZKU A;  1E8Z A;  5D0O D;  2W6J H;  2ZT9 D;  4IUL A;  3RBX A;  2M8R A;  2OYI B;  1K05 A;  2QM8 A;  3BU8 A;  2YIU B;  3W67 A;  2VTB A;  4U0S A;  4Q96 A;  2L6J A;  4MS6 A;  1GL2 C;  3GHG A;  2IOL A;  3CST A;  3SBT B;  2KUB A;  3SNX A;  5KJM A;  4ACK A;  3D9P A;  5CEA A;  2E75 C;  3C8V A;  2IBZ I;  5EX3 A;  3L70 D;  5BT1 A;  2CG2 A;  1BI7 B;  2VGX A;  2WXP A;  4H0L C;  1SA4 A;  2WPR A;  1O1S A;  4UUC A;  5AVS B;  3ZRH A;  2C2L A;  3ZYQ A;  1RE4 C;  4RSY A;  1SQX J;  2WQH A;  3SD5 A;  4HOT A;  3RL0 B;  2A06 D;  4Q94 A;  4L76 A;  3T5V A;  2H6I A;  1VQ9 P;  5HKP A;  3RO3 A;  2EIM E;  2KLV A;  3G9R A;  2LSV A;  4AXH A;  4ILG A;  4JA9 A;  5CEC B;  1PPJ E;  3G2W A;  2Y9Z A;  3MX3 A;  4YXW H;  4B0Z A;  1Q81 Q;  3VMX A;  2YMK A;  4DX7 D;  4JA7 A;  3KEA A;  3SFX A;  3L73 G;  4HOR A;  2WM9 A;  3UIA A;  1L0L G;  4FJZ A;  3GLM A;  2JP3 A;  2B0O E;  4JVS A;  2NPS B;  3VLE A;  3JSV C;  3Q7A A;  3GW4 A;  2KXP C;  2G3A A;  3KZI E;  2WTY A;  4N39 A;  1EPU A;  4I7Z B;  3PE3 A;  2WWW A;  4D6T D;  2GRM A;  3JXJ A;  3TGU G;  4EDF A;  3SWY A;  2OVB A;  1J1D B;  2XCC A;  3AU4 A;  1HF9 A;  3SFY A;  3NZS A;  1QYM A;  5BV1 A;  3FUM A;  1MHQ A;  3ZW3 A;  1QGK B;  4F1P A;  2O3J A;  2FXO A;  1DEB A;  5A7D B;  1FDO A;  3L75 D;  2ZXE B;  1BD8 A;  1DNP A;  1RF1 B;  3CCM P;  2P9I G;  2YHC A;  4XI9 A;  3TSI A;  3E4B A;  1SQP D;  1LD7 A;  3RU0 A;  5CRV A;  3NMD A;  1WDY A;  5DIZ A;  3KD7 A;  4AJW A;  3L4F A;  1CI6 B;  1HJB A;  3S9O A;  1TNU A;  5H2F E;  3IR9 A;  4WND A;  3OXL A;  1URQ B;  5LOZ A;  5KLI B;  5ANL A;  4DLQ A;  3T97 B;  3P1U A;  3SGH A;  5D66 A;  3WG7 E;  1YYC A;  3AED C;  4GPK A;  3I55 P;  5ARF A;  4H44 C;  2W90 A;  2DZN A;  3B95 A;  4J6I A;  1ZV8 A;  2DIW A;  5EKQ D;  5FZS A;  1UIX A;  4KT6 B;  2KSE A;  4OAV B;  1SQP K;  1SQB G;  2R3C A;  4BT9 A;  2HYZ A;  2CPB A;  3RK2 B;  1OWN A;  2XZT G;  3GMA A;  1Q7Y Q;  1FZG A;  1OT8 A;  2KS1 A;  5ENP D;  5CCM A;  1CSB A;  1NA0 A;  3DSS A;  4L73 A;  3C3R A;  2Q3E A;  2JJL A;  1BDC A;  4J8S A;  2B88 A;  1JY3 O;  1XTC C;  4PD4 I;  4BTB A;  4FP7 A;  1S5L X;  3AS4 A;  3VP8 A;  2OEW A;  3JUE A;  2Q3I A;  3KYQ A;  3FEX A;  3ZGQ A;  1LT9 C;  4A1G A;  4AP2 A;  2WSE H;  1JB0 J;  4HOU A;  2BCC D;  1Y6I A;  4GYO A;  5FJY A;  5AQB A;  2RKL A;  2Q7C A;  1N86 A;  1NJI Q;  5TIS E;  2ZYA A;  4LNB A;  2DCP A;  1S72 P;  2WPS A;  1QBQ A;  3L54 A;  4H13 C;  3UPV A;  2AXC A;  2FYZ A;  2BED A;  2K1A A;  3ZXS A;  3ENE A;  4PDX A;  3MIW A;  2FFD A;  5AQA A;  3FEY A;  4U3F G;  3ZHE A;  1Q86 Q;  2EQX A;  2QYJ A;  5D0Q D;  4AOF A;  4JPS A;  1N4Q A;  2RFM A;  1E8X A;  1OMI A;  3WU2 H;  1G1J A;  4UI9 C;  1ZU2 A;  1BGY J;  2IFN A;  1OXJ A;  1BE3 D;  3L71 G;  3Q47 B;  2WPV B;  2H88 C;  1KZU B;  2W27 A;  1KOR A;  2M5A B;  3TYY A;  1GL2 B;  3PS6 A;  3GYZ A;  3FUI A;  5LCW J;  3KXD A;  3K5B A;  3B71 A;  2KAT A;  4GMJ A;  3L72 E;  2YKP A;  1MFZ A;  3JXI A;  3UUX A;  1JUQ A;  5FQ7 A;  1SQX E;  3JC2 2;  1XNF A;  3I4R B;  5B5E E;  4H0L B;  1VQ4 P;  2XEE A;  2Y4T A;  3T8K A;  3VMA A;  4BSZ B;  3CV0 A;  1LJ2 A;  1OW6 A;  3CXH I;  3C72 A;  4OH8 B;  4AQR D;  4HFG A;  2J59 M;  3CCU P;  3HUS C;  2R17 C;  2OYH A;  2IZ0 A;  3G2S A;  1O5M A;  4C7N A;  5HI7 A;  4KZC A;  4ASW A;  3NXS A;  2WT7 A;  1S9K D;  1HH0 A;  5KAI H;  1NU1 J;  3APF A;  2AVP A;  1Y8M A;  3PUK A;  2XGO A;  1P84 D;  3Q5P A;  1AQ5 A;  1PGP A;  4G1T A;  3H1J G;  3NFQ A;  4GU5 A;  1N4P A;  1PAQ A;  1NTM J;  3RAU A;  3IHV A;  2OYO A;  2F0Y A;  2M3B A;  3SZ7 A;  3T5X A;  1EDU A;  3GW6 A;  3UT7 A;  3BAS A;  1EDL A;  2KXP B;  4AUW A;  1GU5 A;  4APF A;  1TN8 A;  2OND A;  2R5D A;  1BSN A;  3CWB J;  5AW4 B;  4BY6 A;  1N4S A;  2H6G A;  3B8E B;  2HM8 A;  3MYV A;  2XZR A;  3C1L A;  1TEZ A;  1K9M Q;  1H0A A;  4UQZ A;  3B5N D;  2WSS H;  1MUU A;  3ZDM A;  2Q7F A;  1U57 A;  3QK0 A;  1HGZ A;  2N1T C;  2KP8 A;  1RE3 A;  4BWN A;  4EBA G;  2BTD A;  3HIZ A;  2OTJ P;  1JTH A;  3M9Q A;  4Y28 J;  3EQ2 A;  3U3W A;  3C3O A;  3L37 A;  3HD7 D;  1FU1 A;  2B87 A;  4EBA A;  1E96 B;  1KIL C;  3K9I A;  3NAW A;  1N4R A;  1SQQ G;  3R7R A;  2WMM A;  1S9K E;  3HTK A;  2R3S A;  4BTA A;  2QVA A;  1GTW A;  3FGA D;  2EIL E;  4GYY A;  1GD2 E;  1P84 E;  3ZNG A;  1IK7 A;  1N73 C;  5AN8 A;  1SP4 A;  2PZI A;  5FQ6 A;  3PHL A;  4JF7 A;  3QWO C;  5AIJ A;  2XRY A;  4FLH A;  1WMK A;  4BX9 A;  5HS0 A;  1EDJ A;  2WQ6 A;  3SSU A;  2WXH A;  3BQO A;  5KNG A;  4H44 B;  3W68 A;  4B86 A;  3Q4A B;  5K5G B;  1BGY D;  1FZC A;  1VQL P;  2A5U A;  5KJ7 D;  4GYW A;  4WY4 A;  2X38 A;  4GDO A;  4PJ0 E;  2KNC B;  1UOH A;  2CHX A;  1E8Y A;  3UKU G;  1YIJ P;  1EZV G;  5CBN A;  1T3J A;  2IX7 C;  4NQ0 A;  3CLJ A;  4L75 A;  4UWL A;  4V3I A;  3DSW A;  2LNI A;  4UWH A;  1PP9 J;  3HXB A;  3FTY A;  2P2C P;  2XCB A;  1NTK J;  3R7Q A;  2PM7 A;  2XNX A;  3V2R A;  3D9H A;  3S1K A;  1LGH B;  3TGO A;  3TWU A;  4CCA A;  3TNU A;  4TLF A;  3UT8 A;  3QC1 A;  1EZV I;  4CEM A;  1LT9 B;  5APX A;  3R2P A;  1IQR A;  2E5Y A;  2SPZ A;  3L74 J;  3EDT B;  2FYN C;  2FO7 A;  2FXP A;  4C48 B;  2V4L A;  3HXF A;  5AW7 B;  3AE7 C;  4N5C A;  2KYV A;  3E7K A;  1YHQ P;  2IF4 A;  2NRG A;  3LJN A;  3H1L J;  1OW8 A;  2JLB A;  4ANX A;  1BU9 A;  1OZH A;  5JJ6 A;  4H13 B;  3UM0 A;  5LFA A;  1QLE D;  4IFD K;  4A63 B;  3C9I A;  1IYG A;  1N7S D;  3OA7 A;  5GTH H;  3ESK A;  4G8L A;  5BNW A;  3NQP A;  1NTM D;  4OAU C;  4JC8 A;  1BGY E;  3DPY A;  1DVP A;  2UWJ E;  1JY2 N;  4U0U A;  2AEF A;  1S1C X;  1M90 Q;  3E37 A;  2HPC A;  4AM9 A;  3AEF C;  2V4H C;  2O1K A;  4L7T A;  1Z3X A;  2P1J A;  2C0W A;  1LTJ A;  3A2A A;  3CWB D;  3U59 A;  1BCC J;  4CDN A;  4NPD A;  2N9B A;  1SFC C;  1DCQ A;  3G3Z A;  3T8M A;  2XDJ A;  2Y0B G;  4M3O A;  5T4Y A;  4L23 A;  1NOH A;  1MZC A;  2WXQ A;  3LY8 A;  3V5B A;  4XI0 A;  1ZME C;  3CC4 P;  4LLH A;  2X3M A;  3T9K A;  1K1B A;  2LKM A;  3P8C E;  2KC7 A;  4YXD C;  3LW5 H;  3CCR P;  4A55 A;  3JQ1 A;  1NTM K;  3CLQ A;  1YJ9 P;  4U04 A;  3CXH H;  4YND A;  2BEQ D;  3RSE G;  2QFC A;  4KT0 J;  1YA0 A;  1QL1 A;  2R32 A;  2H89 C;  2J58 A;  5BPP A;  2P9N G;  5BU5 A;  2IZ1 A;  3V31 A;  3HUS B;  3I3N A;  3ASO E;  4JEH A;  1EDK A;  4DJA A;  2WSE J;  1NU1 E;  3H1I E;  4KVO A;  1Z3Y A;  3CHR A;  5CMW A;  1T8Z A;  1E90 A;  3GHG C;  2HE0 A;  1NTM E;  1LTS C;  2ETA A;  5GTI H;  3N7N A;  1VQ7 P;  3MKQ A;  3L13 A;  4G8K A;  3CWB E;  3M9B A;  1AVY A;  4I6M C;  4KBQ A;  5G04 J;  3APD A;  1NH4 A;  2YNY A;  4ASV A;  2XZD G;  3P8M C;  4CPG A;  1SA5 A;  1PP9 D;  2HG5 D;  4CRW A;  3SFD C;  4GTT A;  1GZL A;  2V8S E;  1NTK D;  3MGN A;  2M0B A;  3PVL A;  3O8Z A;  1WG0 A;  2IDB A;  1X9V A;  1X79 B;  3VMZ A;  1HBW A;  1PGO A;  1YJN P;  5FT9 A;  1X0T A;  4WWN A;  4C9B B;  5DJU B;  3PZ4 A;  3ZKJ A;  4WUY A;  1BI8 B;  5JMN D;  3L70 J;  4R4M A;  1M57 D;  1H88 A;  1KIL B;  2FYU G;  2KZT B;  4NIK A;  2ZXW E;  3D9I A;  1K73 Q;  2VYI A;  4ACL A;  2B9B A;  3BCC D;  2C0X A;  3CMA P;  3TAX A;  1H19 A;  4UWG A;  1E7V A;  2LXB A;  3RK3 D;  2MOW A;  4ILH B;  2DZO A;  4O6F A;  3VTY A;  2VSO E;  1DEE G;  1U7J A;  2J08 A;  1NTK K;  1N73 B;  2FYU D;  2ZYD A;  2DYR E;  2R5B A;  4GKG A;  1TR4 A;  1H8A A;  3PZ2 A;  4U63 A;  3RKV A;  1V55 E;  3SBS A;  2LXC B;  2QRX A;  4KHX A;  4FU3 A;  1E7U A;  1NTZ D;  4OGQ D;  5KCM A;  5IY5 E;  1IXV A;  1PP9 E;  1HE8 A;  4YTP C;  3CIA A;  1KIL E;  2YMY A;  1S70 B;  1NTK E;  1SZA A;  2R05 A;  1KB9 I;  2ZJS E;  3FH8 A;  1Y9B A;  2ETB A;  5M1B A;  4GML A;  2W6A A;  2PFX A;  1VDY A;  4NUR A;  2E76 D;  1UII A;  4W7Z A;  5BUZ A;  1JY2 P;  5CCG A;  3ML9 A;  5CCG D;  1L5J A;  1X5B A;  3URZ A;  5KLV G;  2K9Y A;  4GCN A;  3EU5 A;  3HE4 B;  1Q2Z A;  4I17 A;  3UTM A;  2P58 C;  5ENQ D;  3CCQ P;  1YCS B;  1L4A D;  3L74 E;  4L2Y A;  4D6T J;  1KZO A;  3M91 A;  3L9T A;  2W83 C;  2WVR A;  3AU5 A;  2LXM A;  3H1K D;  5DBK A;  5B1A E;  3E34 A;  2PNN A;  3O48 A;  3H1L E;  5APV A;  1NTZ K;  2FYN B;  5D2M C;  4I6G A;  1OCC E;  3ML8 A;  5APS A;  3ZIM A;  4HYT B;  5AW5 B;  4YVQ C;  3L75 J;  5CCH D;  4CGW A;  4BEP A;  2VGE A;  1LP1 A;  5EIB E;  2E42 A;  4DK5 A;  1VL2 A;  1IK9 A;  1SQP J;  1NAF A;  2C9N Y;  2WB2 A;  3M06 A;  4QFV A;  3ZYM A;  4W80 A;  2XEN A;  4AVX A;  3CQG B;  1IHG A;  3TWS A;  1BCC E;  2QSI A;  1TYQ G;  3KS2 A;  4DX1 A;  2XQ0 A;  2WPQ A;  4GOE A;  1SFC B;  4N78 E;  3ABL E;  5KJL A;  2VRS A;  4U96 D;  2OYI A;  4CZ2 D;  4I2L C;  3HE5 B;  5E79 E;  1BLX B;  3AEB C;  1EDI A;  1PPJ G;  4B89 A;  1T6A A;  2J8S D;  5AYW D;  2E0I A;  4Q69 A;  1OWM A;  2IBZ D;  2W6B A;  2P10 A;  5FQ8 A;  3ABV C;  2R59 A;  1WAO 1;  5CHX A;  4G2V A;  3I5P A;  2CK3 H;  5APT A;  3JQ0 A;  3Q9N C;  1IFI A;  4K5A B;  3WXX A;  1XTG B;  1SQB J;  2VGY A;  2XPY A;  1N0R A;  2ZGG A;  3BG1 B;  2X6I A;  2F8Y A;  1VQM P;  2C0L A;  4F7A A;  1N54 A;  1ELR A;  3GHG B;  4RES B;  1YI2 P;  2GUV A;  2BCC J;  4BWR A;  3FUH A;  3CX5 E;  1FAV A;  1HFA A;  1M1J C;  3UM2 A;  3UQ3 A;  4UB6 H;  3CVV A;  2E74 D;  1QZ2 A;  2R44 A;  3SQV A;  3V4W A;  3NTN A;  5ENS D;  1N2D C;  4FUL A;  2IEJ A;  4YPC A;  1W2E A;  1HG2 A;  3U4T A;  4N3A A;  1MV8 A;  1OW7 A;  1AP7 A;  1YYH A;  5B3S E;  5T8I A;  5AW6 B;  2NPS A;  1JY3 N;  1YQ3 C;  3FU0 A;  3HRA A;  3HHM A;  5LP0 A;  3RJV A;  1G3N B;  3L73 D;  4R7L A;  1BE3 J;  5FZQ A;  1W2B O;  3D3M A;  2H43 A;  1L0L D;  5JHA A;  3B7R L;  1KD1 Q;  1KPS B;  3L70 E;  1OCR E;  3L71 J;  4NPF X;  3CHP A;  2WSC H;  3LW5 J;  1EQ7 A;  4L74 A;  1YTZ I;  3AEA C;  2V5F A;  3QB2 A;  3TGU D;  2VSN A;  1VQO P;  3AG4 E;  3C98 A;  1N7L A;  2FKW B;  5HRY A;  2A06 E;  4UQX A;  3S7B A;  2R02 A;  1H2T C;  4YDE A;  3TWT A;  5KAI E;  4EPZ A;  1GU4 A;  5ENR D;  1M8O B;  4J8D A;  3B7S A;  1CI6 A;  3VTP C;  1GMJ A;  3G4S P;  3B5N C;  2Z4E A;  4I2W A;  1ZLL A;  5B66 H;  3HXC A;  1OWO A;  3KDP B;  1VPC A;  3CSF A;  1IQU A;  3DBS A;  1L0N G;  1RE3 C;  3T97 A;  3QWW A;  2BKK B;  2KLU A;  2LUH A;  2XKM A;  2G8Y A;  1LD8 A;  3HD7 C;  2BEZ F;  1INZ A;  2KK7 A;  4WWO A;  2FBW C;  4H7Y A;  3ZEF A;  2WZ7 A;  1JM0 A;  5AW8 B;  4DRX E;  5FIO A;  1J1E C;  1JMM A;  3MUD A;  4D6T E;  1SZ9 A;  3BUA A;  4HI9 A;  2VSX E;  3II6 A;  1DCE A;  3ASN E;  5KJK A;  5APQ A;  4PD4 D;  4MKT A;  1R8E A;  3EHR A;  2UY1 A;  3NF1 A;  5M72 A;  2QJY B;  4I1L A;  3JCK C;  4QQI A;  2Y1L E;  1SQB D;  2KOG A;  2MJZ A;  2DBA A;  2A45 G;  3CCV P;  1TJC A;  3L75 E;  3KQG A;  1FZC C;  4DT0 A;  5KJ7 C;  3UM3 A;  2IO2 C;  1USE A;  4JBZ A;  3VN0 A;  2AWI A;  1KZP A;  1SQP E;  1USD A;  2M3E A;  3Q5R A;  4ZHB A;  4ME2 A;  3L72 G;  1NA3 A;  3AG3 E;  5LCW C;  2KS1 B;  2LAH A;  4GB9 A;  4CT4 A;  4CGV A;  1PY1 A;  1SQX G;  2GA1 A;  4GZD A;  2O01 N;  3L35 A;  5AVZ B;  4KZ0 A;  3TDK A;  4GTP A;  2A45 I;  3D71 A;  1HJ0 A;  3CQC B;  3FUF A;  3DRA A;  2XHE A;  5J08 A;  3ISM C;  2J09 A;  1SQB K;  1BSH A;  3V30 A;  3RGU A;  3FUL A;  4G24 A;  4O9B A;  5KNH D;  3RIB A;  2ETC A;  4JW1 A;  1VQN P;  1JCS A;  1SVX A;  4M7C A;  2P9K G;  2XEH A;  2ZVN B;  4DZO A;  1GW3 A;  3CK8 A;  2NSZ A;  1W3B A;  2WPV A;  1NKN A;  4XE0 A;  1MYO A;  5JA4 D;  3C5R A;  4U3F D;  2M5A A;  1KQF B;  4C7R A;  1FE6 A;  3IV0 A;  5CER B;  4HRN A;  3AS8 A;  1SQB E;  4UQY A;  4F3V A;  1N7S C;  4GOF A;  3L71 D;  3UMV A;  4P29 A;  2E75 B;  3CK9 A;  5EID A;  3TXN A;  2B89 A;  1FJP A;  1JY3 P;  2OCC E;  1H2V C;  3CXH D;  4IL6 H;  1LWU C;  1BDD A;  2BCC E;  4BET A;  1SQV G;  4APO A;  4I1M A;  4U8Y D;  4K5C A;  1W5C E;  4CDM A;  5A23 A;  2LXL A;  3LCA A;  2RD0 A;  1FPP A;  3DXM G;  1H2U A;  3O4Z A;  5G55 A;  1E79 H;  2Y9Y A;  3QOU A;  1ZR4 A;  1RZ4 A;  4U8H A;  5GTH E;  3IBE A;  3DSU A;  3SI5 A;  2QA4 P;  2OTK E;  1M1J B;  1JMB A;  3HRN A;  1RF0 A;  1HF8 A;  1Y47 A;  1AWC B;  1V54 E;  3CC7 P;  3TF5 A;  2BAS A;  3G71 P;  3CCS P;  3EUV A;  3E33 A;  2IYP A;  3OW2 O;  3FUN A;  2NYJ A;  2FEZ A;  2L9B A;  3CVL A;  1SQM A;  1LTG C;  3LEW A;  3ZFW A;  1OIP A;  2MYO A;  1BE3 E;  2R5S A;  5EX0 A;  5HQ8 A;  3PH0 C;  2DWZ A;  4L1B A;  2L6B A;  1ZP0 C;  1RQV A;  5KKZ C;  3RRU A;  3SF4 A;  4J8E A;  4PS7 A;  3H1J D;  3MZW B;  4EI2 A;  4GTM A;  2W8Z A;  2WT7 B;  2QYU A;  1RH5 B;  4DPR A;  4N2Q A;  3LPZ A;  2J4D A;  3L71 E;  2QZA A;  4JZY A;  4LEU A;  1K1A A;  2P9U G;  3BRV B;  1HGV A;  1DC2 A;  1Z56 A;  1OFC X;  3CXH E;  2BKG A;  3S4R A;  1YBK A;  1BPO A;  3QAQ A;  1D8E A;  3CL3 D;  5CRU A;  4O60 A;  2KM4 A;  3ASF A;  2Z5H A;  1UJK A;  3W9F A;  2WXF A;  5ITZ F;  3JCU H;  1QX8 A;  3DEO A;  3FTW A;  4GZC A;  1ZN5 A;  3CVY A;  1NAY A;  2AXT H;  2XEV A;  5APU A;  3FP3 A;  4NRH B;  3B5N B;  5GTI E;  2E5T A;  5CJ0 A;  1NL4 A;  4GA2 A;  1UN9 A;  3TWQ A;  1SQQ D;  3FTU A;  1B89 A;  1RQU A;  3I56 P;  4FC8 A;  4EEC A;  3CHQ A;  3KAE A;  1PL5 A;  1ZW0 A;  3HD7 B;  1M56 D;  1KT1 A;  2GRL A;  3E1R A;  2QC9 A;  3TWR A;  1VF5 C;  2OOE A;  4MN4 C;  3LJ3 A;  4GT1 A;  3ZN3 A;  5B1B E;  4WY4 D;  2KNC A;  3HTK B;  3V2O A;  1J1E B;  4EZJ A;  1FZE A;  3RK3 C;  3U1C A;  1UW4 B;  4HRM B;  1QQE A;  2KB7 P;  3DPD A;  2IQC A;  1E5W A;  2I2O A;  3SFZ A;  3VLF A;  3ABK E;  4DX5 D;  3D9O A;  5AJL A;  5FQ4 A;  1ZRT D;  2JEE A;  1KYO D;  4GAA A;  1U3D A;  4DLO A;  1G1I A;  4PD4 H;  3BEE A;  2FUL A;  1EZV D;  3G2V A;  3PZ3 A;  4DX6 D;  1OY3 D;  2PQN A;  1KYO I;  2VQ2 A;  5EIL A;  1OWA A;  4HLE A;  4OGQ C;  4WNE A;  1LT9 A;  2WSC J;  5BXU A;  4XFJ A;  1CW5 A;  5DJT B;  3R9A B;  1FVF A;  2XRZ A;  1IFN A;  3DST A;  3U66 A;  3IFM A;  3KSL A;  5KBA A;  2ION A;  3VP9 A;  1RY3 A;  2IJG X;  2E76 C;  2A45 H;  1MZ9 A;  4KMO A;  5BW8 C;  2I6H A;  2QY7 A;  3FX0 A;  3EHM A;  2EIK E;  3BCC J;  1TJF A;  4H13 D;  1AA0 A;  5CCL A;  5AW0 B;  2PAJ A;  1L4A C;  3P7K A;  2FO1 E;  5AEN A;  1U2V G;  5AW3 B;  2FYU J;  3EHN A;  3PP5 A;  4IFF A;  1MX4 A;  2XGM A;  1ZXG A;  5EFW B;  3AS5 A;  4D10 C;  2V7Q H;  1NU1 G;  3H1I G;  1OWL A;  2Y0E A;  3RK6 A;  1FCH A;  1UN8 A;  3QKY A;  5CCH C;  2QJP C;  1NTZ J;  1HUC A;  5J90 A;  3HDX A;  1UJJ A;  3UIN C;  3V4Q A;  3FTX A;  1EZV E;  4GZ6 A;  1N7S B;  5AJD A;  5AAO A;  1JWF A;  4IFM A;  1VQ6 P;  1NWQ A;  3FH5 A;  2QG4 A;  4NAC A;  4BER A;  1Z6T A;  3PDN A;  4ILI A;  4DI3 A;  4LCT A;  1FC2 C;  5G04 C;  2Y0C A;  2V5Q C;  3M0D C;  3D70 A;  1D9S A;  2AXU A;  1LWU B;  4AIF A;  3ZUV B;  1KN7 A;  2N9Y B;  3JYS A;  3ULY A;  2XV5 A;  5KLV J;  3H1K J;  1IHB A;  1D7M A;  2ZT9 C;  3HUS A;  1GDT A;  3EIQ C;  2BUG A;  4O1P A;  4DX2 A;  2HR2 A;  1LTI C;  3E1I A;  5AVQ B;  4EQF A;  5AVU B;  1TNY A;  3BG0 B;  4B94 A;  1VQK P;  4WWP A;  2V0P A;  3F6Q A;  1H0T B;  2WQ7 A;  3B13 A;  3A0B H;  4JL0 A;  4GZ5 A;  3KSQ A;  1DD4 A;  3PRE A;  4GTV A;  4LNU D;  1YIT P;  4OVV A;  2YO2 A;  1LTX A;  1EXJ A;  1KLX A;  4IOI H;  3D9N A;  2YHE A;  3CI9 A;  2JEK A;  3USS A;  1JPL A;  4Z68 A;  5KKZ B;  3A5T A;  1FOS E;  3AE1 C;  3ONL A;  2NC9 A;  2WXM A;  2IO3 C;  3UKR G;  2K9J B;  1G2C B;  2WMN A;  2Q1K A;  3DWL G;  3LXU X;  1GW4 A;  4BES A;  2XPZ A;  5FTP A;  2N1T B;  3DXK G;  2E74 C;  3L22 A;  3J5P A;  2H6F A;  3CVX A;  2IU1 A;  1EC5 A;  2LO6 A;  3OTN A;  5E76 A;  2L0I A;  2Y0D A;  4LNG A;  1JCR A;  2LSU A;  4LSZ E;  2RN0 A;  3AEC C;  2X6F A;  3WUV A;  1VDF A;  1N8R Q;  1KT0 A;  2MRI A;  3O6Q B;  2ZIS A;  4HKZ H;  3H1H G;  2KZT A;  3ONK A;  1KQL A;  1QNF A;  1A02 F;  4BRY B;  1TU3 F;  3L74 G;  4Y6C A;  4I9E A;  5H7P A;  4DJG A;  2VJ8 A;  1N73 A;  2ZFC A;  3CCJ P;  1DD3 A;  4HOS A;  4UB6 E;  1P5Q A;  1J1D C;  4U07 A;  2R2L A;  4JXT A;  3H1L G;  1MX6 A;  4HQD A;  3VMY A;  2PM6 A;  3EFG A;  2D2C D;  3PEU B;  2HOD A;  1VF5 B;  3H32 A;  2GRN B;  1PGQ A;  3A0H H;  5KAF H;  4YDO A;  1KB9 D;  2JKV A;  4TUU A;  1IFD A;  2QJK C;  2XND H;  3F5H A;  4N5Q A;  3LS8 A;  4TXR A;  3OXF A;  1NZN A;  2RG8 A;  1Q82 Q;  1PIX A;  4K35 A;  3NOC D;  4CT0 A;  3RK3 B;  2F37 A;  4W7Y A;  3CCE P;  4EZK A;  5FZR A;  3UM1 A;  4DI4 A;  3LKU A;  1R5L A;  2WXL A;  5JJ7 A;  2FYU K;  4GPM A;  1Y8A A;  5KLI C;  3L73 J;  4DOJ A;  3BVH A;  1KYO H;  4PV1 D;  4ANV A;  2AXV A;  4GTS A;  1L0L J;  3W9G A;  4OGQ B;  1QVG O;  4AY6 A;  1E8W A;  4TXQ A;  2LR2 A;  5KLV D;  4FA6 A;  2Y3A A;  3AE8 C;  2IY0 C;  1NGM B;  1H89 A;  4IN3 B;  4KVM A;  4OYS A;  3BCC E;  4KXK B;  1KMI Z;  4HB1 A;  1WM5 A;  2E76 B;  3TGU J;  1H6O A;  3HYM B;  3RK3 E;  4DUI A;  2FYU E;  2CHW A;  4F6R D;  3RRN B;  4HXI A;  3LVQ E;  1MKM A;  1YJW P;  4PH4 B;  2DVW A;  4WNG A;  2YIN A;  5AVX B;  1L4A B;  2WIT A;  1YTZ T;  2HO1 A;  4U95 D;  3GF7 A;  4XEI G;  4BX8 A;  3V2X A;  3R4Y A;  1ZB1 A;  3RL0 g;  2YXQ B;  1NTZ E; 
#chains in the Genus database with same CATH homology
 1JM0 A;  1H0T A;  4DRX E;  1MX2 A;  5FIO A;  3ZDM A;  4HI9 A;  3UXG A;  1SS1 A;  3EHR A;  3PH0 A;  4QQI A;  2Y1L E;  3V79 K;  4HBD A;  2B87 A;  3DEP A;  1Q2N A;  2K3R A;  1NVO A;  4JBZ A;  2WMM A;  2QVA A;  4ZHB A;  3ZNG A;  5AN8 A;  2KS1 B;  5FIN A;  3UI2 A;  3QWO C;  5HS0 A;  1EDJ A;  5KNG A;  4RLY A;  5K5G B;  3B7B A;  4KJM A;  3V30 A;  3ZU7 B;  3RGU A;  5CBO A;  1UOH A;  3TWV A;  5KNH D;  2ETC A;  5CBN A;  1SVX A;  2XEH A;  1YMP A;  2P2C P;  1MYO A;  5JA4 D;  3C5R A;  3D9H A;  3S1K A;  2M5A A;  4HB5 A;  5CER B;  4WWI A;  4HRN A;  3TWU A;  4GOF A;  4NPE A;  2KBX A;  5EID A;  2B89 A;  4TUM A;  1S3J A;  2SPZ A;  4C48 B;  3NOG D;  3NBN B;  1MJ0 A;  5AAR A;  1BDD A;  3LJN A;  1SW6 A;  4BET A;  4U8Y D;  3IXE A;  1BU9 A;  4K5C A;  4A63 B;  3Q9U C;  1N11 A;  4G8L A;  4OAU C;  4HLL A;  5C39 A;  2I8D A;  2OTK E;  1JMB A;  2UWJ E;  2KZJ A;  4JB8 P;  5AQ9 A;  1A5E A;  2KIK A;  1NFI E;  1Y47 A;  1OVR A;  2V4H C;  1AWC B;  2NYJ A;  4NPD A;  1DCQ A;  2Y0B G;  3MHV A;  2MYO A;  4O1O A;  2DWZ A;  4YDY A;  2L6B A;  1K3Z D;  4J7W A;  3T9K A;  3MZW B;  1K1B A;  4HNA D;  1K1A A;  5ENO D;  1DC2 A;  5CED B;  5EYL A;  2BKG A;  3FXE A;  1LP1 B;  2P58 A;  4LG6 A;  3V31 A;  4O60 A;  5ENT D;  1EDK A;  3W9F A;  4B93 B;  5ITZ F;  4J8Y A;  3EU9 A;  2HE0 A;  4K3A A;  3DEO A;  1LT1 A;  3AAA C;  2ETA A;  1U7M A;  3TWQ A;  4G8K A;  3AJI A;  4HI8 A;  1ZW0 A;  4ASV A;  2F8X K;  3TWR A;  2QC9 A;  2XZD G;  4CPG A;  4MN4 C;  2KUB A;  4ZMD A;  5CEA A;  2M0B A;  1WG0 A;  3V2O A;  2JAB A;  4HRM B;  5EN5 D;  1BI7 B;  1X0T A;  4DX5 D;  4UUC A;  5DJU B;  3ZKJ A;  1BI8 B;  5JMN D;  4DX6 D;  3SO8 A;  1OY3 D;  4NIK A;  5EIL A;  5HKP A;  5BXU A;  5DJT B;  2LXB A;  5KBA A;  2DZO A;  1DEE G;  1U7J A;  5CEC B;  4K5B A;  4DX7 D;  3KEA A;  1TR4 A;  2KZI A;  2LXC B;  2QRX A;  5BXO A;  2FO1 E;  2B0O E;  1IXV A;  2KXP C;  1MX4 A;  4ATZ D;  1ZXG A;  5EFW B;  1S70 B;  4HJG H;  2ETB A;  3JXJ A;  4YDW A;  1QYM A;  3UTM A;  4F1P A;  5ENQ D;  1YCS B;  1OVV A;  3FXD A;  1BD8 A;  5AAO A;  4BER A;  2PNN A;  2ZAE B;  1FC2 C;  5KWD A;  2V5Q C;  1D9S A;  1WDY A;  4GOD A;  3ZUV B;  4BEP A;  2VGE A;  1LP1 A;  5EIB E;  4GMR A;  1IHB A;  4ZNC A;  5D66 A;  4O1P A;  4DX2 A;  4QFV A;  2XEN A;  3HG0 D;  2DZN A;  3B95 A;  3TWS A;  3F6Q A;  3TWW A;  1H0T B;  4ZFH A;  4DX1 A;  4OAV B;  4GOE A;  4LNU D;  2XZT G;  1OT8 A;  5ENP D;  4IOI H;  4U96 D;  4CZ2 D;  1BLX B;  2HR3 A;  4Z68 A;  1EDI A;  1BDC A;  2J8S D;  2B88 A;  2B87 B;  3JUE A;  2A5E A;  3Q9N C;  2Q1K A;  4K5A B;  4BES A;  2JWD A;  1N0R A;  2RKL A;  2ZGG A;  3J5P A;  5AQB A;  2F8Y A;  1EC5 A;  4LSZ E;  4HKZ H;  3TWX A;  3J5Q B;  5AQA A;  2QYJ A;  4EYY Q;  2ZGD A;  2RFM A;  5EYP F;  2R44 A;  1MX6 A;  4HQD A;  5ENS D;  4BXL A;  4U8V D;  2M5A B;  1AP7 A;  1YYH A;  3HRA A;  4N5Q A;  1G3N B;  3JXI A;  3NOC D;  4K35 A;  2F37 A;  3EHQ A;  5AQ7 A;  2XEE A;  3T8K A;  4HRL A;  4BSZ B;  4NPF X;  2RFA A;  4GPM A;  2KI7 B;  1N0Q A;  3W9G A;  4CYM D;  2LR2 A;  4ASW A;  5HRY A;  3TWT A;  4HB1 A;  5ENR D;  1MFT A;  4DUI A;  1OVU A;  4F6R D;  2AJA A;  2DVW A;  2BKK B;  1IKN D;  1EDL A;  4U95 D;  3V2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...