5CBNA

Fusion protein of mbp3-16 and b4 domain of protein a from staphylococcal aureus with chemical cross-linker ey-cbs
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
176
structure length
176
Chain Sequence
b'SDLGKKLLEAAHAGQDDEVRILMANGADVNAMDNFGVTPLHLAAYWGHFEIVEVLLKYGADVNASDATGDTPLHLAAKWGYLGIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILCKNKAQQAAFYCILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title Connecting two proteins using a fusion alpha helix stabilized by a chemical cross linker.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Protein binding
total genus 61
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2015-07-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5cbnA02
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 5cbnA01
2PNNA 2BKGA 5JMND 4HBDA 2KZJA 3DEOA 2XEHA 3EHQA 1Q2NA 3B95A 3J5QB 4HRNA 3NOCD 3V2XA 3T8KA 1OVRA 2J8SD 2BKKB 4HB1A 2JABA 2B0OE 2AJAA 2FO1E 1LT1A 4K35A 4HI8A 3UTMA 2L6BA 3V79K 2XEEA 2K3RA 3RGUA 5ENSD 3B7BA 3EHRA 5CERB 1MYOA 2F8XK 5K5GB 5CEAA 1JM0A 2DVWA 5C39A 4DX6D 3ZNGA 1OY3D 3TWWA 3F6QA 5EIDA 5AARA 1LP1A 4U96D 4BERA 5JA4D 4QQIA 2B88A 3LJNA 1LP1B 5HKPA 3T9KA 3TWVA 5CEDB 5KNHD 3D9HA 4A63B 5CBOA 3MZWB 1H0TA 3TWTA 2P2CP 2LXCB 4DUIA 2JWDA 1H0TB 5AQ9A 1NFIE 5FINA 1U7MA 2P58A 4BEPA 2RKLA 5EN5D 3TWUA 5CECB 4G8KA 4N5QA 1TR4A 1BDCA 4CZ2D 4TUMA 1DCQA 1N0QA 4NPFX 2F8YA 2KZIA 2DZNA 4DX2A 4NPEA 4B93B 4G8LA 1OVUA 3Q9UC 3SO8A 1MJ0A 1EDJA 4HI9A 2NYJA 2LR2A 4K3AA 5KNGA 2OTKE 4MN4C 2HE0A 3JUEA 2QRXA 4J8YA 2RFAA 1EDKA 1AWCB 2F37A 4DX1A 1EDLA 1Y47A 1BDDA 2ZGDA 3FXEA 2B89A 4NIKA 5EFWB 1G3NB 4F6RD 3S1KA 4WWIA 4KJMA 5BXUA 1OVVA 3HRAA 2VGEA 3V31A 2Q1KA 2HR3A 3Q9NC 1YYHA 1IKND 5ENRD 5DJTB 4GODA 3AJIA 3W9GA 2Y0BG 4QFVA 5AQ7A 5AN8A 4U8VD 1JMBA 1NVOA 3TWRA 5CBNA 3NBNB 5EYLA 3UXGA 1K1AA 2ZAEB 4UUCA 2KS1B 4ASVA 4HRMB 1IHBA 3FXDA 2KUBA 5KBAA 1X0TA 4DRXE 1S3JA 4K5AB 4U95D 3EU9A 5FIOA 1ZW0A 1BI7B 4BXLA 4O1OA 2R44A 4O1PA 4YDYA 4K5CA 2XZDG 2A5EA 2ETAA 1ZXGA 1BI8B 2QYJA 1EC5A 5ENTD 5EILA 1WDYA 4HLLA 2XENA 4CPGA 3C5RA 2KIKA 4HNAD 4ZMDA 5ENQD 1BLXB 3NOGD 3IXEA 3UI2A 1U7JA 4HRLA 3V2OA 2M5AA 4RLYA 4HJGH 3V30A 4EYYQ 2UWJE 5D66A 2KXPC 2WMMA 4J7WA 2M5AB 1SS1A 2XZTG 3PH0A 4LG6A 1SVXA 4Z68A 1EDIA 5DJUB 1N0RA 1YMPA 4HKZH 1SW6A 4C48B 4OAUC 4BSZB 4GPMA 5HRYA 3HG0D 4CYMD 4GMRA 4ZFHA 4F1PA 1MFTA 1S70B 3JXJA 3KEAA 2MYOA 4OAVB 4DX7D 4NPDA 4DX5D 5EIBE 4ZNCA 3J5PA 4LNUD 4ATZD 4ASWA 2ZGGA 3ZUVB 4U8YD 5AQAA 4IOIH 2V4HC 3MHVA 4LSZE 2DZOA 2B87A 2M0BA 2KI7B 4BETA 2B87B 4ZHBA 4HB5A 1DC2A 3ZDMA 2V5QC 1AP7A 4GOFA 5BXOA 4K5BA 4JBZA 1UOHA 2KBXA 3JXIA 4HQDA 3QWOC 3DEPA 1BD8A 4O60A 5ENOD 1DEEG 2I8DA 1WG0A 1D9SA 1A5EA 2Y1LE 3W9FA 4GOEA 5HS0A 3ZU7B 1N11A 5ENPD 2SPZA 2RFMA 5AAOA 4BESA 1K3ZD 1OT8A 5ITZF 5EYPF 1BU9A 3TWSA 4JB8P 2ETCA 3TWXA 2QVAA 1K1BA 2QC9A 4YDWA 3AAAC 1IXVA 1FC2C 1MX6A 2ETBA 3ZKJA 1MX2A 1YCSB 5KWDA 1QYMA 2DWZA 2LXBA 3TWQA 5AQBA 1MX4A
chains in the Genus database with same CATH superfamily
2G3AA 3HUSA 2PNNA 1FZCC 4CT4A 3SFEC 3NXSA 4HBDA 2KZJA 4RJTA 4YPCA 1SZ9A 2H6FA 3LEWA 4ZKPA 3TXNA 3HUSB 3EHQA 1ZP0C 3E1RA 1OXZA 1SQMA 4WVZA 2WT7A 3V2XA 3L9TA 4HXIA 1YBKA 3RAUA 5AENA 2WT7B 1OW7A 4HB1A 4IFDK 3PUJA 3U64A 2OYIC 4OGQB 3UIOC 5APWA 2B0OE 3ZVVA 1M7LA 1NTZK 2AJAA 1H2TC 5G05J 3B5NA 3HTKA 5CCHA 4JL0A 1S1CX 2PRRA 4PUCA 5KAFE 1N95A 1LT1A 3VLDA 1N94A 2OV8A 3B5NB 3HTKB 1URQC 1KILB 1OWOA 3CXHE 3MGNA 2DBAA 4R7LA 1SQVD 3EU5A 3QJZA 1RQVA 3RGUA 1EPUA 1JCRA 1FT1A 4EHMA 4HOSA 1XTCC 1SVFA 5AW5B 2Y3AA 1VQNP 3MV3B 1GD2E 3H1JJ 4WUYA 2IYPA 2VJ8A 4B94A 3ZNGA 2VGXB 2KK7A 1BGYG 5G55A 1NTMJ 3CHMA 3NZSA 2H6IA 3PZ2A 2E75C 3R9AB 1VQ9P 4JZYA 2B88A 3FUJA 4FADA 4TXRA 4Y6CA 5CEDB 4K03A 3ABKE 1X22A 2GRLA 3D9HA 3LCAA 4A63B 5CBOA 1HO8A 2WXOA 3H1LE 3R2PA 1YI2P 1SQPK 3I5CA 3CHRA 3EHMA 2KSEA 1N73A 3L73D 4EIJA 1HE8A 1TN6A 3L13A 1VQLP 3PE3A 5ARFA 4HFGA 1HGZA 5FT9A 4DUIA 3APDA 2KSJA 4HS2A 3MTUE 3L72D 1ZMEC 1NFIE 1USEA 3PZ4A 4GTPA 5EN5D 3UT7A 3U4TA 4DI3A 1KFMA 1YTZT 4J8DA 1N2DC 1A02J 3RK3D 3CXHI 4M3LA 3CHOA 1GU5A 3ULEG 4NPFX 4TUMA 1SQBE 4DX2A 2WXNA 1EXIA 1YTZI 4G8LA 2XCCA 3CSTA 2Y4UA 1E8XA 1MZ9A 3Q9UC 4XIFA 4N78D 1LGHB 2ONDA 1JCCA 1ZOYC 3OAWA 2LR2A 4CDNA 5JHBA 1PGJA 3H1JG 1Y9BA 3UQ3A 4RESB 2OTJP 1KT0A 3MKRA 1IC2A 3UINC 2QRXA 3FULA 2WXHA 4GTOA 1AWCB 3ABLE 1NTMG 3BCCJ 3PUKA 3D9NA 1YA0A 5A7DB 2VYIA 3GZ1A 1BDDA 1LTBC 4WY4A 4XE0A 3GHGC 3R4YA 3M9QA 1Z3XA 2C0WA 3A2AA 4GMLA 2FXOA 4NIKA 1HJ0A 1VQ7P 3GZSA 3BU8A 1NAFA 3TYYA 2BCCE 1BPOA 1FZFA 4JF7A 1DVPA 5AVTB 1U2VG 3APCA 3ZXPA 2IZ1A 1GW3A 4GTRA 4TXPA 2AXZA 2FYNB 5AVQB 1OWAA 4AJWA 1M57D 4KJMA 3X2QE 1LTSC 1BCCJ 1SQVK 1SP4A 4GB9A 4I43A 2OEWA 3L70E 3H1HJ 4Q69A 1OVVA 3HRAA 3QARA 1FDOA 1VQ6P 2KP8A 5EKQD 3BQOA 3ZIMA 1YYHA 4BRYB 2F0YA 5ENRD 4O9BA 2W6AA 2Q3EA 4GIFA 2EIME 2R2LA 3CK9A 4I9EA 3NTNA 4ACLA 1V54E 4U63A 4A1SA 3HVEA 3C98A 4QFVA 5AW0B 2VGYA 3B7UX 2VSNA 5B5EE 2FYUJ 4U8VD 2MOWA 2LXLA 2ZU6B 3TWRA 3HVEB 3OXGA 2XGSA 3AEAC 1SFCB 5JJ6A 3AE4C 5BU8B 1E8WA 5FTPA 4XX5A 3E32A 3CWBD 3FWLA 3MKQB 1S2EA 3UM3A 4A1GA 5KLVG 3S7DA 4UUCA 1RHZB 2Y69E 2XCBA 1N4PA 3DPDA 5CCGD 5KBAA 1TEZA 4OVNF 1NI1A 1JB0J 5KJ7D 3EU9A 5FIOA 1ZW0A 3BG1B 4PS7A 3EHNA 1BI7B 1BE3E 1OWMA 1GTWA 1TNOA 5LP0A 1H0AA 2FI7A 2YXQB 1MKMA 4O1OA 4UB6E 2R44A 4FA6A 4O1PA 3TGUE 3QH9A 3O48A 4YDEA 3AE6C 2A45G 4YXDC 1BCCG 1MV8A 2IFMA 3B71A 1ZLLA 3CX5H 2OVBA 4TUUA 4WNDA 3V5BA 1N7SB 3H1HG 2A06D 4GYYA 1MUUA 5E79H 3S2AA 1FCHA 2KXPB 1LD8A 3FTXA 1BSNA 2OYOA 2KNCA 2OCCE 4ZMDA 1PPJD 1BLXB 4N2QA 2NPSB 3H6PA 4AQRD 1O5MA 2J5UA 3BATA 4RLYA 3V30A 3Q3DA 3UIPC 2FYUG 4EOTA 3PZ3A 3DSUA 4BFRA 5KJNA 3RK2B 2XZTG 5AVZB 3IHVA 2K9YA 3I3NA 3RK3C 1O1RA 1EDIA 1PL5A 1RF0A 2WQ7A 3ZGQA 2I9CA 4MS6A 2EIKE 2Z4EA 3CHSA 1L4AC 4GMJA 2Q6QA 2YKPA 4Y6WA 1QL1A 3FUHA 1FZAA 2LAIA 1N4SA 3ZFWA 1GW4A 3V4QA 2E74B 2R32A 3CGHA 3A0HH 1SQQD 3M06A 4XE5B 2VQ2A 3DSVA 3CI9A 4FHKA 1JO5A 3L6AA 1H6KA 1UN8A 1PY1A 3P7KA 4UWGA 1M8OB 3CCQP 2R17C 1UW4B 3PH0C 2PFXA 4OGQD 1H2UA 3FHEA 2R3SA 4F1PA 3IV0A 3QWWA 3JXJA 4O6FA 3HD7D 2QY7A 2W27A 4NPDA 4DX5D 4CT0A 1LF8A 3D6ZA 3VMZA 1KILD 2ZJSE 3EFGA 3E33A 1SQPG 3I4RB 4OWFA 2J58A 4U8YD 1HH8A 2NZ2A 3LXUX 2M3BA 2P2UA 5LCWC 2V4HC 3EFFK 4LSZE 2ZT9B 3CX5I 1SQVJ 2WM9A 3D9OA 1ELWA 4EZKA 4E85A 2W83C 5C1DA 1LJ2A 4B86A 5ANRA 4U04A 2J08A 3G2UA 2E5TA 1M1JC 3JQ0A 3C3OA 2QJKC 1BGYE 3R9MA 1DH3A 1ELKA 1WM5A 1WT6A 2AXTE 3CCLP 1AP7A 1PP9D 2JWAA 1KC8Q 3AEBC 3AU5A 4A3TA 1VL2A 1KQSO 4GZ5A 2YKQA 2P9KG 4JBZA 1UN9A 2HR2A 4C46A 2OQQA 1VDFA 4Q96A 2HG5D 3PREA 4L75A 3WG7E 2BEZF 3DSTA 4G23A 3CHQA 1VPCA 4O60A 5D0QD 3OAKA 1ZV8A 2EINE 1W3BA 2R05A 1AQTA 3KQGA 3MV2B 1HF8A 1YITP 2PQRA 2WQHA 3ZU7B 2IY0C 1IQUA 1Z6TA 3E1IA 4OVUA 2CPSA 1OCZE 2R59A 3AECC 3L72J 5CCGC 3Q5MA 2ZIRA 1YJWP 4L2YA 5KJ7C 2WPRA 3URZA 2C9NY 4DT0A 2QE7H 3C1LA 1QEXA 4YXWH 2KLVA 1S9KD 4JYCA 2H6GA 4C9BB 1UIIA 1K1BA 2ZYDA 4Y99B 3BRVB 2QC9A 3NAWA 5FZRA 1SQVG 1WMKA 3L74D 1IXVA 3E37A 1HG2A 4GA1A 4E6HA 1MX6A 2A5UA 4L73A 5AW9B 4GYWA 4J6IA 3M91A 3H1JE 5H2FH 4W7ZA 5APVA 5KWDA 4DLOA 5B66H 1NTME 1NYHA 2E0IA 2P58C 4F1SA 3Q79A 3KZIH 4RQIA 2DWZA 2LXBA 3FTWA 3NZUA 2QSIA 4XKBA 4FP7A 3FUNA 2WXMA 2OYHA 3IHYA 2AXVA 3CQCB 4URKA 2BKGA 3BRTB 2J9QA 3BG0B 3SF4A 2X6JA 4PV1B 5FQ6A 4WBAA 5EDSA 3PLNA 1CW5A 1SA5A 4BT8A 1XGWA 1J1EC 4PD4E 3LY9A 4UQYA 2OYHB 1JCQA 2J59M 3FUEA 2DYRE 1OIPA 1Q2NA 5AVXB 2IFUA 3GZ2A 2WVRA 1LTAC 5KKZB 4GKGA 1OVRA 2R5DA 2J8SD 5LCWJ 2IPPA 3L73G 3E34A 3FU0A 2O01J 3CCRP 3D70A 2YMKA 1K04A 2YKOA 3OA7A 3L72G 3PNLB 5LFAA 3VTXA 4HOQA 4A55A 3L75J 3HUSC 3ASDA 1A17A 4I7ZB 4HI8A 3QWPA 1X79B 3FUKA 4I2WA 3CVWA 1EDUA 4NACA 1FZEA 1QNFA 1N7LA 1UJKA 4B0ZA 1HXIA 2Q3IA 3B7BA 2JEKA 4OGQC 3EDTB 3LVQE 5CERB 1KQGB 3MA5A 1JY3N 4H44B 1FJKA 2VSYA 3V2QA 3QB2A 4JXTA 5CEAA 1SFCD 2OVFA 1JM0A 1TU3F 1WRGA 3LIDA 3L37A 3M9BA 2DVWA 3L16A 5C39A 4JQ0D 1Y6IA 2N1TA 3EWKA 2XQ0A 3RRMB 3B5NC 5CCHC 1KZUB 2I2OA 3TWWA 1OCOE 2MJZA 3UT4A 3H1KD 3RBXA 1OFCX 1Q90D 5KLVE 4QMAA 2Z5HA 4TV3A 5CCLA 1X8YA 2N1TB 4GCNA 2IBZI 5JA4D 3ONKA 4C7RA 4QQIA 3CWBJ 2GRPB 3DSXA 1TN7A 4PD4I 2Y0CA 2FBNA 3LJNA 4J0UA 1KORA 2ITAA 5HKPA 3SFDC 3T9KA 1OW8A 3AG1E 1W5CE 3Q5SA 1UIXA 4IN3B 3O4ZA 3FH5A 1OX3A 1KD1Q 4L2LA 5FQ8A 2LXCB 1PV3A 1NOHA 3QKYA 1JCDA 2CK3H 1K9MQ 2JWDA 1LTJA 3SNXA 5BUZA 2H8PD 1N7SD 5L8RJ 1KFNA 3ABVC 3WU2E 4U3FD 1BCCE 2GUSA 1AFOA 3G71P 2O01N 2AXUA 2P58A 2CFZA 5FINA 4F53A 2FXPA 4WWPA 3H1HE 3PEUB 5CECB 4L7TA 4CDMA 3Q73A 3A5TA 3L75G 1TR4A 2NPSD 2WXIA 2IU1A 3JCUH 4WNGA 1KB9H 4LNGA 2KZIA 4HH2A 3DXMG 2DZNA 2HO1A 2YMYA 3CXHD 4B93B 3PP5A 4CDRA 1N73C 2AXCA 3HXEA 1S63A 4IULA 4IL6X 3LYAA 3P8CE 1FU1A 2FYUE 5CHEE 4PDXA 2VRSA 3AEEC 4UB8E 1TYQG 3ZYMA 3HHMA 3UPVA 3M0AA 4B8AA 1NTKD 3CCJP 2OTKE 1AVYA 2HE0A 5AW7B 4H0LC 3JUEA 4J8YA 2DCPA 1PGOA 3VN0A 4U7EB 3K9IA 2YIUC 2EIJE 2ZGDA 5KAFH 2H6HA 3PEVB 2B89A 2E74D 3CWBG 1HZ4A 1N8RQ 1M1KQ 1JY2N 3SQVA 3D9JA 3MGBA 3CXHH 2EILE 1E8ZA 4J8EA 3JC22 4BT9A 3PE4A 2VTBA 3G9RA 3H1LD 1G3NB 5M72A 1L2PA 4LC1A 4F6RD 2W6JH 1SQQJ 2A45I 3HD7A 1RE4A 4HVBA 4WWIA 3UMVA 2VTBB 3VMAA 2Y9YA 3H1ID 2ZYAA 1KYOE 1KILA 4HOUA 3HD7B 1EYHA 2C0LA 1ZR4A 3MD0A 4UWHA 3L71D 4CCAA 2ZVOB 2FFDA 4WY4C 3L22A 3QDNA 3APFA 4AUWA 4GYOA 1OCCE 5DJTB 3GG2A 1SQPE 2A06G 3WUVA 5D0OD 4IFMA 3LW5J 3GF7A 2FFDB 3G4SP 1FZBA 1MHQA 4H7XA 1SQBD 3MYVA 2IO2C 5HI7A 2FYNC 2ZT9D 1T2KD 3QNKA 1O1TA 1X81A 3A3YB 2VGXA 3BUAA 3TAXA 3NMDA 4I1MA 5AQ7A 4U0SA 3RBZA 3PHLA 5FQ7A 3DBSA 1E90A 4L74A 1ZB1A 3VLFA 3NFQA 5CBNA 2Y4TA 1KB9I 1RZ4A 4A7PA 3MCXA 3ZN3A 5EYLA 1LWUB 2RN0A 2ZXWE 1H6OA 3S7FA 4YNDA 3G3ZA 4LEUA 4NURA 3ITKA 2OARA 3AE9C 1Q86Q 2P9NG 3CVLA 4BY6A 1YQ4C 5HQ8A 5B1BE 4DRXE 4GTMA 3T5XA 3U9WA 2FULA 4K5AB 4U95D 3KHUA 1FZGA 4GZ6A 1R8EA 3MEKA 1EZVG 3GYZA 2FO7A 3IN6A 2H7HA 5JJ7A 1SQQG 1KYOI 2K1AA 3RRNB 1IO4A 3QAQA 4YDYA 4K5CA 5CRVA 1S5LE 3JQ1A 2A5EA 2ETAA 4ILIA 3ASHA 1KQFB 1DCEA 1L5JA 3FTYA 1JY3P 5CHXA 2M8RA 4JC8A 4CPGA 1QVGO 1LTTC 3SBSA 1NTKK 3C5RA 2WXPA 1SZAA 4JPSA 4AY5A 1DD4A 2EQXA 3NOGD 4GU5A 3UI2A 1VQKP 1U7JA 3TF5A 3PS6A 5FQ4A 2IO3C 2WSEJ 2JEEA 1SQVE 3LVRE 1Q82Q 5GTHE 2IJGX 2KXPC 5APXA 4J7WA 4GPKA 2I6HA 4U0ZA 3D6YA 4I6GA 5KLVJ 2YINA 3Q5RA 3PZDA 4Z68A 4U07A 1ZBPA 1L0LD 2Y9ZA 2CPBA 3L82A 3LDZA 4BWRA 3SSUA 1W2EA 1N0RA 1ZR2A 3A0BE 1OW6A 4PV1D 1YIJP 3CIAA 4K0RA 1PP9G 4NQ0A 3C9IA 4OAUC 4WNFA 3FUMA 3RK2C 3ULYA 3TNUB 4ANWA 1OWPA 3CVPA 2B6CA 5B5EH 2PP6A 2V8SE 1MZCA 4L76A 2HFED 4BRYA 3FU3A 4GMRA 4ZFHA 1RF1A 2YXRB 1SQBK 3L73E 2O3JA 1SQXD 1LTIC 1RF0C 1VDYA 3KEAA 2KLUA 5JHAA 4DX7D 1H88A 2E74C 5BU5A 1RF1B 3Q7AA 3L72E 2WVIA 2J4DA 4ATZD 4I6JA 4ASWA 3T8MA 4EECA 5KJLA 3CLQA 3HRNA 3UKRG 3HE5B 2L9BA 2K88A 3RK3E 1M90Q 4N3AA 2XS8A 3QC1A 2ZYGA 5AQAA 4H44D 4I6MC 3FEYA 1NTZJ 1SFCA 2C0XA 5BPPA 2LSUA 1Z56A 2WPVB 1JOCA 3P2BA 3HDXA 3MKQA 2DZOA 1ELRA 3ZHEA 5A6CA 4LGDE 4UB6H 3ISMC 3PJSK 5B1AE 1JY2P 4KHXA 3L36A 3CX5D 3FFLA 4WNEA 3RL0B 4D6TD 3ZHEB 2N1TD 4HB5A 1PFIA 2V5QC 4R4MA 3GMAA 4UI9K 2AEMA 4GOFA 3QWVA 5EX0A 3Q7FA 1GL2D 5H7PA 2ZT9C 3H1KJ 3VTYA 4KVMA 2V7QH 4PS3A 1NO4A 1UOHA 4HQDA 3JSVC 3AU4A 3QWOC 5KLIB 4G1TA 2L0IA 3OXLA 1N7SA 2WQ6A 2I8DA 2QJYB 3UIAA 2ILRA 1ZRTD 2IOLA 3SZ7A 1VQ4P 2Y1LE 1UG3A 3AE5C 2GA1A 3W9FA 3L17A 3LY8A 1YJNP 3F5HA 4GOEA 5HS0A 2NPSA 4FJZA 3FWVA 1QGKB 1SQPJ 2G8YA 2XPIA 4U3FJ 2WSFH 1K3ZD 5ITZF 5BT1A 1USDA 3L75E 3MUDA 1KLXA 3FTZA 4RVBA 2CFUA 4HLEA 1EF1C 1J1DB 1H19A 4UI9C 3TWXA 1L0LK 3D9PA 2QVAA 1NTZG 5AYWD 5APUA 1HF9A 4CRWA 3FX0A 4JD2G 3UM2A 2P9IG 4N3BA 2IEJA 1HJBA 5T4YA 1HS6A 3M9HA 3S7BA 3L08A 4P29A 2XGOA 4XEIG 1AJYA 3T97A 3KS2A 1YCSB 2Q7FA 2Q5UA 3KDPB 4GZ3A 1FS0E 1QYMA 3HE4A 4GTTA 1BGYD 1X9VA 3HYMB 4W7YA 3T97B 3TWQA 3LKUA 3SFYA 1H8AA 4Y99C 3V2PA 4TXQA 2HYNA 2KC7A 3CWBE 3H1KG 2GROB 3HE4B 2WSCH 2HPCA 3AE3C 1SQXK 4U0UA 5JMND 2Y0DA 1L0ND 3HIZA 4DJGA 2Z5IA 2XEHA 2HPCB 1LT9A 3ML8A 1E8YA 4HRNA 5KAIE 3NOCD 3TK1A 1E7VA 3T8KA 4ANVA 1S72P 4G11A 1LT9B 3OJAB 2L91A 5ENNA 5AVWB 3ESLA 2AXTH 4UWFA 1PGQA 1OWLA 3H1IJ 4U3FG 2LAHA 2FO1E 1VF5D 2OYHC 3RU0A 4AY6A 2A06E 2IDBA 3B7SA 4MBGA 2L6BA 3G2WA 3AS5A 2WXKA 1NH4A 4DLQA 4I17A 4EDFA 5ENSD 4G24A 2GGFA 1KZPA 2F8XK 1CI6A 1U3DA 5DIZA 4U8HA 2FEZA 3KEZA 1U57A 4R4LA 2WITA 4I7ZC 3H1JD 4DX6D 1CI6B 1FOSF 4LNBA 3F6QA 1NTKG 5AVVB 2K9JA 2XKMA 2H89C 1N4QA 1NTMD 1LP1A 3CVUA 4BERA 5AW1B 1E7UA 1KV4A 3F89A 4H44C 1AQ5A 2K9JB 3CV0A 3RO2A 4RKUJ 1LP1B 3FTVA 3RKVA 2KCKA 4X8QA 4H13B 2IBZD 1JPLA 1T8ZA 2HM8A 3PTZA 1EQ7A 3FTUA 4PD4D 3MZLB 3OTNA 1EZVE 1HVVA 3MZWB 2VSXE 3SHFA 1H0TA 3L73J 2E5YA 1HGVA 5AW3B 1SQQE 1H2VC 5FJYA 4UI9J 3WUTA 2N1TC 4DOJA 3PDNA 3FUDA 3BASA 1RH5B 1H0TB 4ILGA 4JA7A 5CMWA 4BEPA 1U7MA 4EI2A 2J4BA 4APFA 3TWUA 3H1IG 1GU4A 1OWNA 4EZJA 1NU1D 3L71G 3IKOB 3GW6A 4CZ2D 3OXFA 1KILE 2CHWA 4UWLA 3V6IA 1NKNA 2WWWA 4Z1MH 3N71A 4FJYA 4PD4H 4A3VA 3SO8A 1W2BO 2E2EA 4JA9A 1NZNA 5E75A 3ASOE 4FU3A 4HORA 1LTJC 1EDJA 3FP3A 3UUXA 2CHZA 2X6FA 3DRAA 1L4AB 2NYJA 3ZYLA 4EQFA 4K3AA 1LTGC 4WWNA 4Q94A 1VQ5P 3FTSA 3CK7A 1L0NK 2E43A 1FVHA 3M0DA 2WMNA 2OTLP 3Q1MA 4WWOA 4PJ0E 1VQPP 3TDKA 2F37A 4B8CB 3BCCD 3G6EP 2P9SG 1Y47A 3FXEA 1P84E 2E76B 1QQEA 1PP9E 3L35A 2R5BA 3PRJA 1EZVI 3P8MC 2WMOA 3T5VA 4EBAA 5GTIE 2BF0X 3CVYA 1HH0A 2JDIH 4GA0A 3GLMA 3S1KA 2WSEH 1H6PA 1IFJA 1D8EA 2WSSH 3EQ2A 3KYQA 3B13A 3MP7B 1OXJA 2RD0A 2K37A 1NA3A 5BXUA 3L54A 1SQXJ 3H32A 5TISE 3H1HD 1FAVA 3CCSP 3AS4A 1QX8A 2HR3A 1LTXA 2GW1A 3Q9NC 2OGUA 1IKND 1FT2A 3H32B 4GODA 3FWNA 2RMZA 4DK5A 3U3WA 1NA0A 3OW2O 3JUIA 3O6QA 4LUNU 1NTMK 3HD7C 5APTA 2Y0BG 4BTBA 2QJKB 1RE4C 1S9KE 5AN8A 3P8CD 3TSIA 4KT0J 3RL0D 3O6QB 1KILC 4IL6E 1VQOP 2O1JA 1FDMA 1X5BA 2A4ZA 3CVXA 2A45H 3WU2H 3AEDC 2KS1A 3V2NA 1GL2A 2FFDC 2ZISA 3CKBA 1NKZB 1P84I 3RJVA 3IF4A 2BEDA 4TRQA 2IFNA 1NP7A 4XI0A 4D6TJ 4JW1A 2IF4A 2ZAEB 1KB9D 1WY6A 2V0PA 1L0LG 1JWFA 2KS1B 5BW8C 1GL2B 5ARGA 3E7KA 1SLQA 3FXDA 1IHBA 2XGMA 4HRMB 1HBWA 2I1KA 3BEEA 3CHPA 3FEXA 4KVOA 3NB2A 5BV0A 5G2NA 1S3JA 2RG8A 3CC7P 1XTGB 2IYOA 2AVPA 2M3EA 2KM4A 1E79H 5AJDA 4BXLA 1NU1K 4UB8H 2QG4A 4YVOA 4RG9A 1T3JA 4D10C 3ZW3A 2Y0EA 3LS8A 1ZXGA 3R7QA 3B7RL 1KYOD 2QYJA 2BUGA 2MHKA 1SQXG 3C8VA 1K8AQ 1WDYA 1INZA 2W6BA 4JYBA 4AOFA 3U1CA 2KIKA 3B8EB 4XI9A 4GA2A 3TJPA 1KN7A 3IXEA 4HRLA 3D9LA 1NTZE 4KYOB 3V2OA 1IYGA 2MRIA 4EYYQ 2RH0A 4N39A 1AVOA 2IQCA 5D66A 3RIBA 1RY3A 3S9OA 2FYZA 4JEHA 2D2CB 2QJPB 4APOA 4ME2A 4BX9A 1SS1A 1Q2ZA 3AG4E 1K73Q 4G2VA 4LG6A 1KYOH 1SVXA 3EIQC 3CQGB 5DJUB 4BTAA 2P9PG 3BVHA 3U66A 3G2TA 4D6TG 1OUVA 3SI5A 4HKZH 3H1KE 3HXDA 5DBKA 4FHJA 4OYSA 1SW6A 4C48B 3SD5A 1GW6A 5AJLA 5AVYB 3E30A 2GRNB 3AE7C 1TNZA 1XNFA 4I6EA 1L0NJ 2GM4A 3EJNA 4PS8A 3I55P 4GAAA 3FY4A 1HWTC 5BV1A 1YYCA 1S70B 4GTSA 2QIWA 4I2ZA 1U3CA 2MYOA 2XHEA 5BVZA 2XU6A 1D8DA 4GDOA 1QVFO 5EIBE 1VQ8P 4U3FE 1QZ2A 5C2YA 1VF5B 3Q78A 4JHKA 4GZDA 2FYUK 2WTYA 5AIJA 2HLOA 2LSVA 2ZGGA 4C7NA 3ZYQA 1EXJA 1TNUA 2X3MA 1PPJG 5KCMA 2H88C 3U59A 2PQNA 5APSA 4IOIH 4C7NB 3SFZA 3Q15A 4FLHA 1LWUA 1FVFA 2LUHA 2KCVA 4GCOA 1G1IA 1RF1C 3CVQA 2M0BA 1DNPA 4KT6B 1S5LH 3AE8C 1Z3YA 2KI7B 3N4XA 1V55E 2OOEA 4ZHBA 1DC2A 3WMM0 1NTKE 3JYSA 3FUIA 3Q47B 1PP9J 2LKMA 4W80A 1IZNB 3O8ZA 1QBQA 2L0TB 3ASGA 4K5BA 3VYIA 4GT1A 4H13D 1JTHA 2V4LA 1HG5A 4M3OA 3JXIA 1SFCC 3K5BA 2ZXEB 4NRHB 4UQZA 2BCCD 3DEPA 5AW6B 5AVUB 1BD8A 2WXQA 1K8KG 2JO1A 3RL0C 1JTHB 2XRYA 1L0NG 2DW3A 3CD6P 5ENOD 1DEEG 5GTHH 2LO6A 1WG0A 3Q4AB 2GRQB 2WPSA 3CKCA 3L70D 3Q75A 3TXMA 4KBQA 1N11A 5ENPD 5APQA 2FBWC 5TJHA 3H1IE 5KLIC 3W68A 5AAOA 4BESA 3A0BH 1N73B 4AM9A 3L71E 4XFJA 2WXLA 4I1OB 1DX7A 4JB8P 2QJYC 2NSZA 1H89A 1NU1J 2ETCA 1KQLA 3PNTB 3CMEP 1N7SC 1FZCA 1TNBA 2AEJA 1FJPA 4C0MA 1VQMP 2KB7P 2XNXA 4H0LB 1L4AD 4JHJA 5KJMA 4YDWA 3L74J 1NGMB 2IX7C 3CC4P 3UX4A 2UWJG 3CVVA 4JPZB 1FZCB 2YIUB 2ETBA 2NPSC 3SWYA 1IFNA 3G2SA 1HFAA 1R5LA 4I1LA 1J1DC 5KTBA 3EUVA 3EIJA 2E76D 3TNUA 4OH8B 3MUDC 4WAFA 2OYIA 3IAOA 2YO3A 1MX4A 3C3QA 1E5WA 2DIWA 4HOTA 2J09A 2OYIB 1YQ3C 1KTMA 1BE3D 3PVLA 1KZOA 4FULA 2M63A 2VSOE 3DEOA 1URQA 2BASA 3TL5A 4AEZC 3SBTB 2IBZG 2KYVA 3TGUD 1T6AA 3B95A 3J5QB 4WY4B 4W9RA 1JWGA 1URQB 2FY8A 3HE5A 1S5LX 2BKKB 3VOPA 2JABA 3CCEP 3MJWA 5FWQA 2QFCA 1IFMA 2WPVA 1IFPA 1OMIA 3TG4A 4F3VA 3B7TA 2ZFCA 3PZ1A 3L75D 4RO0A 4K35A 2AW6A 2OEVA 1KMIZ 2P67A 3UTMA 3IEGA 3D71A 1NAYA 3V79K 2XEEA 1FE6A 1NU1G 2JJLA 4HYTB 5CJ0A 4DI4A 1UJJA 2KOGA 1Z5SC 2K3RA 1LT9C 2ZXXA 4N78E 3NF1A 3QK0A 2E75B 2KCLA 1RQUA 1CSBA 3EHRA 5CRUA 2AWIA 4CGWA 3L74G 2NC9A 2CG2A 1MYOA 2P9UG 5K5GB 3WXXA 3HXCA 3UM0A 3I56P 1JY3O 3RSEG 5LX8A 2O01H 2JP3A 1OY3D 3SWKA 5EIDA 1HUCA 4BWNA 2PM6A 1T2KC 5AARA 1DIPA 1GK6A 4U96D 1L0LE 3LY7A 3SWFA 1Q81Q 3C3RA 3II6A 1G2CA 2J49A 4RG6A 1M56D 3BCCG 2QM8A 4EZLA 4TLFA 3S7JA 3TWVA 1OCRE 5KNHD 1TN8A 4LLHA 1G2CB 4FLBA 5M1BA 3FGAD 5AW2B 3U1AA 1IK7A 4L23A 4JEUA 2WXJA 3TWTA 2P2CP 4G25A 4J8FA 3ABME 5EX3A 2C0MA 3TGOA 1JEKA 1NJIQ 2LXMA 2PAJA 1TJCA 2DYSE 5AQ9A 4J8SA 3SGHA 4DPRA 1SA4A 3KAEA 2RKLA 1DD3A 2IOSA 4H13C 1SQXE 3ML9A 3UKUG 2JR8A 1JUQA 1HX8A 4DCKA 3ZEFA 2YQ8A 4G8KA 4N5QA 3Q49B 1BDCA 4IFFA 2QM7A 1KPSB 1DCQA 2F8YA 1N0QA 4B89A 2L5GB 3CLJA 5KJKA 3GHGA 2E42A 4NPEA 1MFZA 3IBEA 3L4FA 1AA0A 1OVUA 3CEQA 1CZQA 2POHA 2D2CD 1MJ0A 1E96B 3GHGB 3DSWA 3DSSA 5KAIH 1Y8MA 3P32A 1HU3A 3RK6A 2KNCB 1NTKJ 2P10A 3D9MA 4HI9A 4I2LC 5KNGA 4MN4C 4MKTA 1IK9A 3VTPC 1N4RA 2FF4A 2HODA 2NXPA 3C72A 3VMYA 3RL0g 1BSHA 2RFAA 1EDKA 3CX5E 5E79E 4D6TE 4DX1A 4U7JA 4GTQA 2Q9IA 1EDLA 2HODB 2IZ0A 2LNIA 4I1AA 2XRZA 3DWLG 1AV1A 2L6JA 4H7YA 3SFXA 5AW8B 3S4RA 3FU5A 4CEMA 1OZHA 3AS8A 1R5SA 5EFWB 3FH8A 2UY1A 3VP9A 1JY2O 3H1LJ 1EZVD 3B4SA 1GMJA 3ONLA 4XZ4A 5CJ4A 2UY1B 3ENEA 2BEQD 3CR3A 4ILHB 4PV1C 4UWKA 3M0DC 1NHLA 2X38A 2E76C 4PH4B 1NL4A 1ZRTE 2KZTA 3CCUP 1S4XA 3L71J 3WUUA 5LOZA 2GRRB 5E76A 3VLEA 1JUNA 2VGEA 3V31A 2Q1KA 5KKZC 1GDTA 2QEXP 1N86A 2KZTB 3AEFC 1PC2A 1SQBJ 1FOSE 3AJIA 1PPJE 2IONA 3B5ND 3P1UA 2AEFA 4XA4A 5CCHD 3KSQA 3A0HE 3W9GA 2C2LA 5AVSB 3AEGC 1FDIA 4OVVA 3V4WA 4UQXA 3E4BA 1JMBA 4N3CA 1NVOA 3GF3A 2FXMA 2N9YB 4ABNA 3NBNB 2C9LY 3CVNA 1HTLC 4JHRA 3A7OA 1FPPA 2XV5A 4CGVA 3UXGA 2Q7CA 2XPZA 1TNYA 2NRGA 1K1AA 1RE3C 2QA4P 4ASVA 1P84D 3LW5H 2PZIA 2KUBA 1X0TA 4AIFA 1IFDA 2P7JA 3I4GA 4L9PA 1K05A 1LNQA 1IJDB 3H1LG 2BCCJ 2QYUA 2JLBA 1L0NE 2XDJA 2XEVA 4KXKB 4KMOA 2YO2A 3MIWA 4C0EA 1GL2C 5AVRB 2XZDG 4FC8A 1ZN5A 1N9AA 2O1KA 3CPWO 3VP8A 2R02A 1Y8AA 4PJ0H 1BI8B 3L70J 4IYPA 5J90A 1EC5A 2FKWB 5BNWA 5ENTD 1JCSA 3H25A 3AE2C 5EILA 1IFIA 1P84H 1TJFA 4HLLA 2XENA 4YDOA 4BSXA 1L4AA 1SQBG 2I1JA 3DPYA 4HNAD 4H0LD 5IY5E 5ENQD 5GTIH 3RK3B 3ASNE 1PAQA 3UM1A 5CMYA 3I5PA 2PGDA 4G26A 3TG5A 2M5AA 4HJGH 2X6KA 2ZVNB 4JVSA 2KATA 2UWJE 3CCVP 3DXKG 4KZCA 3D9KA 2R5SA 5T3RA 2WMMA 1PGPA 2M5AB 4LRZA 1Q7YQ 1MQSA 3KD7A 5JJTA 1GK4A 3PH0A 4YVQC 4N3YB 2PL2A 1L0LJ 5KLVD 3AG2E 1GZLA 2R03A 1T3UA 1DEBA 4WB4A 3W67A 4V3IA 5TISH 2WXRA 4KZ0A 2QZAA 1YMPA 3LPZA 1SQQK 4YTPC 2BTDA 5T8IA 3KPEA 4ANXA 2H43A 4GTVA 3KSLA 4EPZA 2D2CC 2QJPC 4IRUA 4BSZB 3CSFA 4GPMA 4WY4D 4M7CA 4LCTA 5HRYA 4ACKA 1URQD 2BCCG 1IHGA 3HG0D 4MLPA 1BE3J 1NWQA 2IBZE 4CYMD 3D3MA 2V4HA 5G04C 2X6HA 1BCCD 2MKVA 4IL6H 1YHQP 3TGUJ 1MFTA 5H2FE 3AE1C 5B66E 3IFMA 4OAVB 4AXHA 3Q5PA 4AVXA 5CMZA 3QOUA 1P5QA 3KXDA 1RE3A 3L70G 2W8ZA 3VMXA 4ZNCA 1IQRA 3J5PA 1M1JA 3KZIE 3ZXSA 5A23A 4LNUD 1J2JB 4N2SA 3FDHA 4AP2A 2GUVA 2V7QJ 4L1BA 5ANLA 3ZUVB 2E75D 1M1JB 2YNQA 2WQYC 1NU1E 4RSYA 2P1JA 4AV7A 3HXBA 4I9CA 2B9BA 2FYUD 2WPQA 3CL3D 1NTZD 4Y28J 4ANUA 1S64A 3MHVA 2W90A 4N5CA 3L74E 3LJ3A 1WAO1 2B87A 5G05C 1VF5C 1ZU2A 1D7MA 5FZQA 1A02F 4BETA 2B87B 5APYA 1QLED 3GW4A 3ZDMA 3RO3A 3RRUA 2WSFJ 2WB2A 1PIXA 3ASFA 5BXOA 2PM7A 5CCGA 2XZRA 5B3SE 4N6JA 2YHEA 4ATGA 3BCCE 1PZQA 2KBXA 3CK8A 5KJ7A 1LWUC 4LERA 3FUFA 4F7AA 2XNDH 2WXGA 2R3CA 5AW4B 2JKVA 2XPYA 1O1SA 1BE3G 3Q2YA 3HXFA 2RKKA 4EBAG 2CHXA 3FH7A 4DJAA 4GZCA 1LD7A 4MRUA 3R7RA 1D9SA 1FBMA 1A5EA 1JMMA 3TGUG 1G1JA 3MX3A 3JCKC 2WXFA 3ZPJA 2V5FA 2SPZA 1JNMA 2RFMA 2XS1A 1SQPD 5D2MC 1YJ9P 2X6IA 3ESKA 3ZYKA 1OT8A 5EYPF 5CCMA 4AYCA 2N9BA 1BU9A 3N7NA 1S0PA 3FU6A 3TWSA 1LTJB 2WSCJ 4ZKUA 5FZSA 3SY2A 1QL2A 2WZ7A 2HYZA 4BX8A 5KLVK 2J07A 3LIEA 3G2VA 4XKCA 1RW2A 3AG3E 2YHCA 3AAAC 3CCMP 3PRZA 1FC2C 3ULQA 2GRMA 3CMAP 3ZKJA 3ZRHA 1B89A 3IR9A 3RK2D 1MX2A 1J1EB 2CG3A 2P9LG 3USSA 3V2RA 3D9IA 1KT1A 1BGYJ 4TT3H 5G04J 5J08A 3UT8A 3CC2P 3NQPA 5AQBA 1N52A 1N54A 2YNYA 3JCUE 4DZOA 1KB9E
chains in the Genus database with same CATH topology
2PNNA 2BKGA 5JMND 4HBDA 2KZJA 3DEOA 2XEHA 3EHQA 1Q2NA 3B95A 3J5QB 4HRNA 3NOCD 3V2XA 3T8KA 1OVRA 2J8SD 2BKKB 4HB1A 2JABA 2B0OE 2AJAA 2FO1E 1LT1A 4K35A 4HI8A 3UTMA 2L6BA 3V79K 2XEEA 2K3RA 3RGUA 5ENSD 3B7BA 3EHRA 5CERB 1MYOA 2F8XK 5K5GB 5CEAA 1JM0A 2DVWA 5C39A 4DX6D 3ZNGA 1OY3D 3TWWA 3F6QA 5EIDA 5AARA 1LP1A 4U96D 4BERA 5JA4D 4QQIA 2B88A 3LJNA 1LP1B 5HKPA 3T9KA 3TWVA 5CEDB 5KNHD 3D9HA 4A63B 5CBOA 3MZWB 1H0TA 3TWTA 2P2CP 2LXCB 4DUIA 2JWDA 1H0TB 5AQ9A 1NFIE 5FINA 1U7MA 2P58A 4BEPA 2RKLA 5EN5D 3TWUA 5CECB 4G8KA 4N5QA 1TR4A 1BDCA 4CZ2D 4TUMA 1DCQA 1N0QA 4NPFX 2F8YA 2KZIA 2DZNA 4DX2A 4NPEA 4B93B 4G8LA 1OVUA 3Q9UC 3SO8A 1MJ0A 1EDJA 4HI9A 2NYJA 2LR2A 4K3AA 5KNGA 2OTKE 4MN4C 2HE0A 3JUEA 2QRXA 4J8YA 2RFAA 1EDKA 1AWCB 2F37A 4DX1A 1EDLA 1Y47A 1BDDA 2ZGDA 3FXEA 2B89A 4NIKA 5EFWB 1G3NB 4F6RD 3S1KA 4WWIA 4KJMA 5BXUA 1OVVA 3HRAA 2VGEA 3V31A 2Q1KA 2HR3A 3Q9NC 1YYHA 1IKND 5ENRD 5DJTB 4GODA 3AJIA 3W9GA 2Y0BG 4QFVA 5AQ7A 5AN8A 4U8VD 1JMBA 1NVOA 3TWRA 5CBNA 3NBNB 5EYLA 3UXGA 1K1AA 2ZAEB 4UUCA 2KS1B 4ASVA 4HRMB 1IHBA 3FXDA 2KUBA 5KBAA 1X0TA 4DRXE 1S3JA 4K5AB 4U95D 3EU9A 5FIOA 1ZW0A 1BI7B 4BXLA 4O1OA 2R44A 4O1PA 4YDYA 4K5CA 2XZDG 2A5EA 2ETAA 1ZXGA 1BI8B 2QYJA 1EC5A 5ENTD 5EILA 1WDYA 4HLLA 2XENA 4CPGA 3C5RA 2KIKA 4HNAD 4ZMDA 5ENQD 1BLXB 3NOGD 3IXEA 3UI2A 1U7JA 4HRLA 3V2OA 2M5AA 4RLYA 4HJGH 3V30A 4EYYQ 2UWJE 5D66A 2KXPC 2WMMA 4J7WA 2M5AB 1SS1A 2XZTG 3PH0A 4LG6A 1SVXA 4Z68A 1EDIA 5DJUB 1N0RA 1YMPA 4HKZH 1SW6A 4C48B 4OAUC 4BSZB 4GPMA 5HRYA 3HG0D 4CYMD 4GMRA 4ZFHA 4F1PA 1MFTA 1S70B 3JXJA 3KEAA 2MYOA 4OAVB 4DX7D 4NPDA 4DX5D 5EIBE 4ZNCA 3J5PA 4LNUD 4ATZD 4ASWA 2ZGGA 3ZUVB 4U8YD 5AQAA 4IOIH 2V4HC 3MHVA 4LSZE 2DZOA 2B87A 2M0BA 2KI7B 4BETA 2B87B 4ZHBA 4HB5A 1DC2A 3ZDMA 2V5QC 1AP7A 4GOFA 5BXOA 4K5BA 4JBZA 1UOHA 2KBXA 3JXIA 4HQDA 3QWOC 3DEPA 1BD8A 4O60A 5ENOD 1DEEG 2I8DA 1WG0A 1D9SA 1A5EA 2Y1LE 3W9FA 4GOEA 5HS0A 3ZU7B 1N11A 5ENPD 2SPZA 2RFMA 5AAOA 4BESA 1K3ZD 1OT8A 5ITZF 5EYPF 1BU9A 3TWSA 4JB8P 2ETCA 3TWXA 2QVAA 1K1BA 2QC9A 4YDWA 3AAAC 1IXVA 1FC2C 1MX6A 2ETBA 3ZKJA 1MX2A 1YCSB 5KWDA 1QYMA 2DWZA 2LXBA 3TWQA 5AQBA 1MX4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PNN A;  2BKG A;  5JMN D;  4HBD A;  2KZJ A;  3DEO A;  2XEH A;  3EHQ A;  1Q2N A;  3B95 A;  3J5Q B;  4HRN A;  3NOC D;  3V2X A;  3T8K A;  1OVR A;  2J8S D;  2BKK B;  4HB1 A;  2JAB A;  2B0O E;  2AJA A;  2FO1 E;  1LT1 A;  4K35 A;  4HI8 A;  3UTM A;  2L6B A;  3V79 K;  2XEE A;  2K3R A;  3RGU A;  5ENS D;  3B7B A;  3EHR A;  5CER B;  1MYO A;  2F8X K;  5K5G B;  5CEA A;  1JM0 A;  2DVW A;  5C39 A;  4DX6 D;  3ZNG A;  1OY3 D;  3TWW A;  3F6Q A;  5EID A;  5AAR A;  1LP1 A;  4U96 D;  4BER A;  5JA4 D;  4QQI A;  2B88 A;  3LJN A;  1LP1 B;  5HKP A;  3T9K A;  3TWV A;  5CED B;  5KNH D;  3D9H A;  4A63 B;  5CBO A;  3MZW B;  1H0T A;  3TWT A;  2P2C P;  2LXC B;  4DUI A;  2JWD A;  1H0T B;  5AQ9 A;  1NFI E;  5FIN A;  1U7M A;  2P58 A;  4BEP A;  2RKL A;  5EN5 D;  3TWU A;  5CEC B;  4G8K A;  4N5Q A;  1TR4 A;  1BDC A;  4CZ2 D;  4TUM A;  1DCQ A;  1N0Q A;  4NPF X;  2F8Y A;  2KZI A;  2DZN A;  4DX2 A;  4NPE A;  4B93 B;  4G8L A;  1OVU A;  3Q9U C;  3SO8 A;  1MJ0 A;  1EDJ A;  4HI9 A;  2NYJ A;  2LR2 A;  4K3A A;  5KNG A;  2OTK E;  4MN4 C;  2HE0 A;  3JUE A;  2QRX A;  4J8Y A;  2RFA A;  1EDK A;  1AWC B;  2F37 A;  4DX1 A;  1EDL A;  1Y47 A;  1BDD A;  2ZGD A;  3FXE A;  2B89 A;  4NIK A;  5EFW B;  1G3N B;  4F6R D;  3S1K A;  4WWI A;  4KJM A;  5BXU A;  1OVV A;  3HRA A;  2VGE A;  3V31 A;  2Q1K A;  2HR3 A;  3Q9N C;  1YYH A;  1IKN D;  5ENR D;  5DJT B;  4GOD A;  3AJI A;  3W9G A;  2Y0B G;  4QFV A;  5AQ7 A;  5AN8 A;  4U8V D;  1JMB A;  1NVO A;  3TWR A;  5CBN A;  3NBN B;  5EYL A;  3UXG A;  1K1A A;  2ZAE B;  4UUC A;  2KS1 B;  4ASV A;  4HRM B;  1IHB A;  3FXD A;  2KUB A;  5KBA A;  1X0T A;  4DRX E;  1S3J A;  4K5A B;  4U95 D;  3EU9 A;  5FIO A;  1ZW0 A;  1BI7 B;  4BXL A;  4O1O A;  2R44 A;  4O1P A;  4YDY A;  4K5C A;  2XZD G;  2A5E A;  2ETA A;  1ZXG A;  1BI8 B;  2QYJ A;  1EC5 A;  5ENT D;  5EIL A;  1WDY A;  4HLL A;  2XEN A;  4CPG A;  3C5R A;  2KIK A;  4HNA D;  4ZMD A;  5ENQ D;  1BLX B;  3NOG D;  3IXE A;  3UI2 A;  1U7J A;  4HRL A;  3V2O A;  2M5A A;  4RLY A;  4HJG H;  3V30 A;  4EYY Q;  2UWJ E;  5D66 A;  2KXP C;  2WMM A;  4J7W A;  2M5A B;  1SS1 A;  2XZT G;  3PH0 A;  4LG6 A;  1SVX A;  4Z68 A;  1EDI A;  5DJU B;  1N0R A;  1YMP A;  4HKZ H;  1SW6 A;  4C48 B;  4OAU C;  4BSZ B;  4GPM A;  5HRY A;  3HG0 D;  4CYM D;  4GMR A;  4ZFH A;  4F1P A;  1MFT A;  1S70 B;  3JXJ A;  3KEA A;  2MYO A;  4OAV B;  4DX7 D;  4NPD A;  4DX5 D;  5EIB E;  4ZNC A;  3J5P A;  4LNU D;  4ATZ D;  4ASW A;  2ZGG A;  3ZUV B;  4U8Y D;  5AQA A;  4IOI H;  2V4H C;  3MHV A;  4LSZ E;  2DZO A;  2B87 A;  2M0B A;  2KI7 B;  4BET A;  2B87 B;  4ZHB A;  4HB5 A;  1DC2 A;  3ZDM A;  2V5Q C;  1AP7 A;  4GOF A;  5BXO A;  4K5B A;  4JBZ A;  1UOH A;  2KBX A;  3JXI A;  4HQD A;  3QWO C;  3DEP A;  1BD8 A;  4O60 A;  5ENO D;  1DEE G;  2I8D A;  1WG0 A;  1D9S A;  1A5E A;  2Y1L E;  3W9F A;  4GOE A;  5HS0 A;  3ZU7 B;  1N11 A;  5ENP D;  2SPZ A;  2RFM A;  5AAO A;  4BES A;  1K3Z D;  1OT8 A;  5ITZ F;  5EYP F;  1BU9 A;  3TWS A;  4JB8 P;  2ETC A;  3TWX A;  2QVA A;  1K1B A;  2QC9 A;  4YDW A;  3AAA C;  1IXV A;  1FC2 C;  1MX6 A;  2ETB A;  3ZKJ A;  1MX2 A;  1YCS B;  5KWD A;  1QYM A;  2DWZ A;  2LXB A;  3TWQ A;  5AQB A;  1MX4 A; 
#chains in the Genus database with same CATH topology
 2G3A A;  3HUS A;  2PNN A;  1FZC C;  4CT4 A;  3SFE C;  3NXS A;  4HBD A;  2KZJ A;  4RJT A;  4YPC A;  1SZ9 A;  2H6F A;  3LEW A;  4ZKP A;  3TXN A;  3HUS B;  3EHQ A;  1ZP0 C;  3E1R A;  1OXZ A;  1SQM A;  4WVZ A;  2WT7 A;  3V2X A;  3L9T A;  4HXI A;  1YBK A;  3RAU A;  5AEN A;  2WT7 B;  1OW7 A;  4HB1 A;  4IFD K;  3PUJ A;  3U64 A;  2OYI C;  4OGQ B;  3UIO C;  5APW A;  2B0O E;  3ZVV A;  1M7L A;  1NTZ K;  2AJA A;  1H2T C;  5G05 J;  3B5N A;  3HTK A;  5CCH A;  4JL0 A;  1S1C X;  2PRR A;  4PUC A;  5KAF E;  1N95 A;  1LT1 A;  3VLD A;  1N94 A;  2OV8 A;  3B5N B;  3HTK B;  1URQ C;  1KIL B;  1OWO A;  3CXH E;  3MGN A;  2DBA A;  4R7L A;  1SQV D;  3EU5 A;  3QJZ A;  1RQV A;  3RGU A;  1EPU A;  1JCR A;  1FT1 A;  4EHM A;  4HOS A;  1XTC C;  1SVF A;  5AW5 B;  2Y3A A;  1VQN P;  3MV3 B;  1GD2 E;  3H1J J;  4WUY A;  2IYP A;  2VJ8 A;  4B94 A;  3ZNG A;  2VGX B;  2KK7 A;  1BGY G;  5G55 A;  1NTM J;  3CHM A;  3NZS A;  2H6I A;  3PZ2 A;  2E75 C;  3R9A B;  1VQ9 P;  4JZY A;  2B88 A;  3FUJ A;  4FAD A;  4TXR A;  4Y6C A;  5CED B;  4K03 A;  3ABK E;  1X22 A;  2GRL A;  3D9H A;  3LCA A;  4A63 B;  5CBO A;  1HO8 A;  2WXO A;  3H1L E;  3R2P A;  1YI2 P;  1SQP K;  3I5C A;  3CHR A;  3EHM A;  2KSE A;  1N73 A;  3L73 D;  4EIJ A;  1HE8 A;  1TN6 A;  3L13 A;  1VQL P;  3PE3 A;  5ARF A;  4HFG A;  1HGZ A;  5FT9 A;  4DUI A;  3APD A;  2KSJ A;  4HS2 A;  3MTU E;  3L72 D;  1ZME C;  1NFI E;  1USE A;  3PZ4 A;  4GTP A;  5EN5 D;  3UT7 A;  3U4T A;  4DI3 A;  1KFM A;  1YTZ T;  4J8D A;  1N2D C;  1A02 J;  3RK3 D;  3CXH I;  4M3L A;  3CHO A;  1GU5 A;  3ULE G;  4NPF X;  4TUM A;  1SQB E;  4DX2 A;  2WXN A;  1EXI A;  1YTZ I;  4G8L A;  2XCC A;  3CST A;  2Y4U A;  1E8X A;  1MZ9 A;  3Q9U C;  4XIF A;  4N78 D;  1LGH B;  2OND A;  1JCC A;  1ZOY C;  3OAW A;  2LR2 A;  4CDN A;  5JHB A;  1PGJ A;  3H1J G;  1Y9B A;  3UQ3 A;  4RES B;  2OTJ P;  1KT0 A;  3MKR A;  1IC2 A;  3UIN C;  2QRX A;  3FUL A;  2WXH A;  4GTO A;  1AWC B;  3ABL E;  1NTM G;  3BCC J;  3PUK A;  3D9N A;  1YA0 A;  5A7D B;  2VYI A;  3GZ1 A;  1BDD A;  1LTB C;  4WY4 A;  4XE0 A;  3GHG C;  3R4Y A;  3M9Q A;  1Z3X A;  2C0W A;  3A2A A;  4GML A;  2FXO A;  4NIK A;  1HJ0 A;  1VQ7 P;  3GZS A;  3BU8 A;  1NAF A;  3TYY A;  2BCC E;  1BPO A;  1FZF A;  4JF7 A;  1DVP A;  5AVT B;  1U2V G;  3APC A;  3ZXP A;  2IZ1 A;  1GW3 A;  4GTR A;  4TXP A;  2AXZ A;  2FYN B;  5AVQ B;  1OWA A;  4AJW A;  1M57 D;  4KJM A;  3X2Q E;  1LTS C;  1BCC J;  1SQV K;  1SP4 A;  4GB9 A;  4I43 A;  2OEW A;  3L70 E;  3H1H J;  4Q69 A;  1OVV A;  3HRA A;  3QAR A;  1FDO A;  1VQ6 P;  2KP8 A;  5EKQ D;  3BQO A;  3ZIM A;  1YYH A;  4BRY B;  2F0Y A;  5ENR D;  4O9B A;  2W6A A;  2Q3E A;  4GIF A;  2EIM E;  2R2L A;  3CK9 A;  4I9E A;  3NTN A;  4ACL A;  1V54 E;  4U63 A;  4A1S A;  3HVE A;  3C98 A;  4QFV A;  5AW0 B;  2VGY A;  3B7U X;  2VSN A;  5B5E E;  2FYU J;  4U8V D;  2MOW A;  2LXL A;  2ZU6 B;  3TWR A;  3HVE B;  3OXG A;  2XGS A;  3AEA C;  1SFC B;  5JJ6 A;  3AE4 C;  5BU8 B;  1E8W A;  5FTP A;  4XX5 A;  3E32 A;  3CWB D;  3FWL A;  3MKQ B;  1S2E A;  3UM3 A;  4A1G A;  5KLV G;  3S7D A;  4UUC A;  1RHZ B;  2Y69 E;  2XCB A;  1N4P A;  3DPD A;  5CCG D;  5KBA A;  1TEZ A;  4OVN F;  1NI1 A;  1JB0 J;  5KJ7 D;  3EU9 A;  5FIO A;  1ZW0 A;  3BG1 B;  4PS7 A;  3EHN A;  1BI7 B;  1BE3 E;  1OWM A;  1GTW A;  1TNO A;  5LP0 A;  1H0A A;  2FI7 A;  2YXQ B;  1MKM A;  4O1O A;  4UB6 E;  2R44 A;  4FA6 A;  4O1P A;  3TGU E;  3QH9 A;  3O48 A;  4YDE A;  3AE6 C;  2A45 G;  4YXD C;  1BCC G;  1MV8 A;  2IFM A;  3B71 A;  1ZLL A;  3CX5 H;  2OVB A;  4TUU A;  4WND A;  3V5B A;  1N7S B;  3H1H G;  2A06 D;  4GYY A;  1MUU A;  5E79 H;  3S2A A;  1FCH A;  2KXP B;  1LD8 A;  3FTX A;  1BSN A;  2OYO A;  2KNC A;  2OCC E;  4ZMD A;  1PPJ D;  1BLX B;  4N2Q A;  2NPS B;  3H6P A;  4AQR D;  1O5M A;  2J5U A;  3BAT A;  4RLY A;  3V30 A;  3Q3D A;  3UIP C;  2FYU G;  4EOT A;  3PZ3 A;  3DSU A;  4BFR A;  5KJN A;  3RK2 B;  2XZT G;  5AVZ B;  3IHV A;  2K9Y A;  3I3N A;  3RK3 C;  1O1R A;  1EDI A;  1PL5 A;  1RF0 A;  2WQ7 A;  3ZGQ A;  2I9C A;  4MS6 A;  2EIK E;  2Z4E A;  3CHS A;  1L4A C;  4GMJ A;  2Q6Q A;  2YKP A;  4Y6W A;  1QL1 A;  3FUH A;  1FZA A;  2LAI A;  1N4S A;  3ZFW A;  1GW4 A;  3V4Q A;  2E74 B;  2R32 A;  3CGH A;  3A0H H;  1SQQ D;  3M06 A;  4XE5 B;  2VQ2 A;  3DSV A;  3CI9 A;  4FHK A;  1JO5 A;  3L6A A;  1H6K A;  1UN8 A;  1PY1 A;  3P7K A;  4UWG A;  1M8O B;  3CCQ P;  2R17 C;  1UW4 B;  3PH0 C;  2PFX A;  4OGQ D;  1H2U A;  3FHE A;  2R3S A;  4F1P A;  3IV0 A;  3QWW A;  3JXJ A;  4O6F A;  3HD7 D;  2QY7 A;  2W27 A;  4NPD A;  4DX5 D;  4CT0 A;  1LF8 A;  3D6Z A;  3VMZ A;  1KIL D;  2ZJS E;  3EFG A;  3E33 A;  1SQP G;  3I4R B;  4OWF A;  2J58 A;  4U8Y D;  1HH8 A;  2NZ2 A;  3LXU X;  2M3B A;  2P2U A;  5LCW C;  2V4H C;  3EFF K;  4LSZ E;  2ZT9 B;  3CX5 I;  1SQV J;  2WM9 A;  3D9O A;  1ELW A;  4EZK A;  4E85 A;  2W83 C;  5C1D A;  1LJ2 A;  4B86 A;  5ANR A;  4U04 A;  2J08 A;  3G2U A;  2E5T A;  1M1J C;  3JQ0 A;  3C3O A;  2QJK C;  1BGY E;  3R9M A;  1DH3 A;  1ELK A;  1WM5 A;  1WT6 A;  2AXT E;  3CCL P;  1AP7 A;  1PP9 D;  2JWA A;  1KC8 Q;  3AEB C;  3AU5 A;  4A3T A;  1VL2 A;  1KQS O;  4GZ5 A;  2YKQ A;  2P9K G;  4JBZ A;  1UN9 A;  2HR2 A;  4C46 A;  2OQQ A;  1VDF A;  4Q96 A;  2HG5 D;  3PRE A;  4L75 A;  3WG7 E;  2BEZ F;  3DST A;  4G23 A;  3CHQ A;  1VPC A;  4O60 A;  5D0Q D;  3OAK A;  1ZV8 A;  2EIN E;  1W3B A;  2R05 A;  1AQT A;  3KQG A;  3MV2 B;  1HF8 A;  1YIT P;  2PQR A;  2WQH A;  3ZU7 B;  2IY0 C;  1IQU A;  1Z6T A;  3E1I A;  4OVU A;  2CPS A;  1OCZ E;  2R59 A;  3AEC C;  3L72 J;  5CCG C;  3Q5M A;  2ZIR A;  1YJW P;  4L2Y A;  5KJ7 C;  2WPR A;  3URZ A;  2C9N Y;  4DT0 A;  2QE7 H;  3C1L A;  1QEX A;  4YXW H;  2KLV A;  1S9K D;  4JYC A;  2H6G A;  4C9B B;  1UII A;  1K1B A;  2ZYD A;  4Y99 B;  3BRV B;  2QC9 A;  3NAW A;  5FZR A;  1SQV G;  1WMK A;  3L74 D;  1IXV A;  3E37 A;  1HG2 A;  4GA1 A;  4E6H A;  1MX6 A;  2A5U A;  4L73 A;  5AW9 B;  4GYW A;  4J6I A;  3M91 A;  3H1J E;  5H2F H;  4W7Z A;  5APV A;  5KWD A;  4DLO A;  5B66 H;  1NTM E;  1NYH A;  2E0I A;  2P58 C;  4F1S A;  3Q79 A;  3KZI H;  4RQI A;  2DWZ A;  2LXB A;  3FTW A;  3NZU A;  2QSI A;  4XKB A;  4FP7 A;  3FUN A;  2WXM A;  2OYH A;  3IHY A;  2AXV A;  3CQC B;  4URK A;  2BKG A;  3BRT B;  2J9Q A;  3BG0 B;  3SF4 A;  2X6J A;  4PV1 B;  5FQ6 A;  4WBA A;  5EDS A;  3PLN A;  1CW5 A;  1SA5 A;  4BT8 A;  1XGW A;  1J1E C;  4PD4 E;  3LY9 A;  4UQY A;  2OYH B;  1JCQ A;  2J59 M;  3FUE A;  2DYR E;  1OIP A;  1Q2N A;  5AVX B;  2IFU A;  3GZ2 A;  2WVR A;  1LTA C;  5KKZ B;  4GKG A;  1OVR A;  2R5D A;  2J8S D;  5LCW J;  2IPP A;  3L73 G;  3E34 A;  3FU0 A;  2O01 J;  3CCR P;  3D70 A;  2YMK A;  1K04 A;  2YKO A;  3OA7 A;  3L72 G;  3PNL B;  5LFA A;  3VTX A;  4HOQ A;  4A55 A;  3L75 J;  3HUS C;  3ASD A;  1A17 A;  4I7Z B;  4HI8 A;  3QWP A;  1X79 B;  3FUK A;  4I2W A;  3CVW A;  1EDU A;  4NAC A;  1FZE A;  1QNF A;  1N7L A;  1UJK A;  4B0Z A;  1HXI A;  2Q3I A;  3B7B A;  2JEK A;  4OGQ C;  3EDT B;  3LVQ E;  5CER B;  1KQG B;  3MA5 A;  1JY3 N;  4H44 B;  1FJK A;  2VSY A;  3V2Q A;  3QB2 A;  4JXT A;  5CEA A;  1SFC D;  2OVF A;  1JM0 A;  1TU3 F;  1WRG A;  3LID A;  3L37 A;  3M9B A;  2DVW A;  3L16 A;  5C39 A;  4JQ0 D;  1Y6I A;  2N1T A;  3EWK A;  2XQ0 A;  3RRM B;  3B5N C;  5CCH C;  1KZU B;  2I2O A;  3TWW A;  1OCO E;  2MJZ A;  3UT4 A;  3H1K D;  3RBX A;  1OFC X;  1Q90 D;  5KLV E;  4QMA A;  2Z5H A;  4TV3 A;  5CCL A;  1X8Y A;  2N1T B;  4GCN A;  2IBZ I;  5JA4 D;  3ONK A;  4C7R A;  4QQI A;  3CWB J;  2GRP B;  3DSX A;  1TN7 A;  4PD4 I;  2Y0C A;  2FBN A;  3LJN A;  4J0U A;  1KOR A;  2ITA A;  5HKP A;  3SFD C;  3T9K A;  1OW8 A;  3AG1 E;  1W5C E;  3Q5S A;  1UIX A;  4IN3 B;  3O4Z A;  3FH5 A;  1OX3 A;  1KD1 Q;  4L2L A;  5FQ8 A;  2LXC B;  1PV3 A;  1NOH A;  3QKY A;  1JCD A;  2CK3 H;  1K9M Q;  2JWD A;  1LTJ A;  3SNX A;  5BUZ A;  2H8P D;  1N7S D;  5L8R J;  1KFN A;  3ABV C;  3WU2 E;  4U3F D;  1BCC E;  2GUS A;  1AFO A;  3G71 P;  2O01 N;  2AXU A;  2P58 A;  2CFZ A;  5FIN A;  4F53 A;  2FXP A;  4WWP A;  3H1H E;  3PEU B;  5CEC B;  4L7T A;  4CDM A;  3Q73 A;  3A5T A;  3L75 G;  1TR4 A;  2NPS D;  2WXI A;  2IU1 A;  3JCU H;  4WNG A;  1KB9 H;  4LNG A;  2KZI A;  4HH2 A;  3DXM G;  2DZN A;  2HO1 A;  2YMY A;  3CXH D;  4B93 B;  3PP5 A;  4CDR A;  1N73 C;  2AXC A;  3HXE A;  1S63 A;  4IUL A;  4IL6 X;  3LYA A;  3P8C E;  1FU1 A;  2FYU E;  5CHE E;  4PDX A;  2VRS A;  3AEE C;  4UB8 E;  1TYQ G;  3ZYM A;  3HHM A;  3UPV A;  3M0A A;  4B8A A;  1NTK D;  3CCJ P;  2OTK E;  1AVY A;  2HE0 A;  5AW7 B;  4H0L C;  3JUE A;  4J8Y A;  2DCP A;  1PGO A;  3VN0 A;  4U7E B;  3K9I A;  2YIU C;  2EIJ E;  2ZGD A;  5KAF H;  2H6H A;  3PEV B;  2B89 A;  2E74 D;  3CWB G;  1HZ4 A;  1N8R Q;  1M1K Q;  1JY2 N;  3SQV A;  3D9J A;  3MGB A;  3CXH H;  2EIL E;  1E8Z A;  4J8E A;  3JC2 2;  4BT9 A;  3PE4 A;  2VTB A;  3G9R A;  3H1L D;  1G3N B;  5M72 A;  1L2P A;  4LC1 A;  4F6R D;  2W6J H;  1SQQ J;  2A45 I;  3HD7 A;  1RE4 A;  4HVB A;  4WWI A;  3UMV A;  2VTB B;  3VMA A;  2Y9Y A;  3H1I D;  2ZYA A;  1KYO E;  1KIL A;  4HOU A;  3HD7 B;  1EYH A;  2C0L A;  1ZR4 A;  3MD0 A;  4UWH A;  3L71 D;  4CCA A;  2ZVO B;  2FFD A;  4WY4 C;  3L22 A;  3QDN A;  3APF A;  4AUW A;  4GYO A;  1OCC E;  5DJT B;  3GG2 A;  1SQP E;  2A06 G;  3WUV A;  5D0O D;  4IFM A;  3LW5 J;  3GF7 A;  2FFD B;  3G4S P;  1FZB A;  1MHQ A;  4H7X A;  1SQB D;  3MYV A;  2IO2 C;  5HI7 A;  2FYN C;  2ZT9 D;  1T2K D;  3QNK A;  1O1T A;  1X81 A;  3A3Y B;  2VGX A;  3BUA A;  3TAX A;  3NMD A;  4I1M A;  5AQ7 A;  4U0S A;  3RBZ A;  3PHL A;  5FQ7 A;  3DBS A;  1E90 A;  4L74 A;  1ZB1 A;  3VLF A;  3NFQ A;  5CBN A;  2Y4T A;  1KB9 I;  1RZ4 A;  4A7P A;  3MCX A;  3ZN3 A;  5EYL A;  1LWU B;  2RN0 A;  2ZXW E;  1H6O A;  3S7F A;  4YND A;  3G3Z A;  4LEU A;  4NUR A;  3ITK A;  2OAR A;  3AE9 C;  1Q86 Q;  2P9N G;  3CVL A;  4BY6 A;  1YQ4 C;  5HQ8 A;  5B1B E;  4DRX E;  4GTM A;  3T5X A;  3U9W A;  2FUL A;  4K5A B;  4U95 D;  3KHU A;  1FZG A;  4GZ6 A;  1R8E A;  3MEK A;  1EZV G;  3GYZ A;  2FO7 A;  3IN6 A;  2H7H A;  5JJ7 A;  1SQQ G;  1KYO I;  2K1A A;  3RRN B;  1IO4 A;  3QAQ A;  4YDY A;  4K5C A;  5CRV A;  1S5L E;  3JQ1 A;  2A5E A;  2ETA A;  4ILI A;  3ASH A;  1KQF B;  1DCE A;  1L5J A;  3FTY A;  1JY3 P;  5CHX A;  2M8R A;  4JC8 A;  4CPG A;  1QVG O;  1LTT C;  3SBS A;  1NTK K;  3C5R A;  2WXP A;  1SZA A;  4JPS A;  4AY5 A;  1DD4 A;  2EQX A;  3NOG D;  4GU5 A;  3UI2 A;  1VQK P;  1U7J A;  3TF5 A;  3PS6 A;  5FQ4 A;  2IO3 C;  2WSE J;  2JEE A;  1SQV E;  3LVR E;  1Q82 Q;  5GTH E;  2IJG X;  2KXP C;  5APX A;  4J7W A;  4GPK A;  2I6H A;  4U0Z A;  3D6Y A;  4I6G A;  5KLV J;  2YIN A;  3Q5R A;  3PZD A;  4Z68 A;  4U07 A;  1ZBP A;  1L0L D;  2Y9Z A;  2CPB A;  3L82 A;  3LDZ A;  4BWR A;  3SSU A;  1W2E A;  1N0R A;  1ZR2 A;  3A0B E;  1OW6 A;  4PV1 D;  1YIJ P;  3CIA A;  4K0R A;  1PP9 G;  4NQ0 A;  3C9I A;  4OAU C;  4WNF A;  3FUM A;  3RK2 C;  3ULY A;  3TNU B;  4ANW A;  1OWP A;  3CVP A;  2B6C A;  5B5E H;  2PP6 A;  2V8S E;  1MZC A;  4L76 A;  2HFE D;  4BRY A;  3FU3 A;  4GMR A;  4ZFH A;  1RF1 A;  2YXR B;  1SQB K;  3L73 E;  2O3J A;  1SQX D;  1LTI C;  1RF0 C;  1VDY A;  3KEA A;  2KLU A;  5JHA A;  4DX7 D;  1H88 A;  2E74 C;  5BU5 A;  1RF1 B;  3Q7A A;  3L72 E;  2WVI A;  2J4D A;  4ATZ D;  4I6J A;  4ASW A;  3T8M A;  4EEC A;  5KJL A;  3CLQ A;  3HRN A;  3UKR G;  3HE5 B;  2L9B A;  2K88 A;  3RK3 E;  1M90 Q;  4N3A A;  2XS8 A;  3QC1 A;  2ZYG A;  5AQA A;  4H44 D;  4I6M C;  3FEY A;  1NTZ J;  1SFC A;  2C0X A;  5BPP A;  2LSU A;  1Z56 A;  2WPV B;  1JOC A;  3P2B A;  3HDX A;  3MKQ A;  2DZO A;  1ELR A;  3ZHE A;  5A6C A;  4LGD E;  4UB6 H;  3ISM C;  3PJS K;  5B1A E;  1JY2 P;  4KHX A;  3L36 A;  3CX5 D;  3FFL A;  4WNE A;  3RL0 B;  4D6T D;  3ZHE B;  2N1T D;  4HB5 A;  1PFI A;  2V5Q C;  4R4M A;  3GMA A;  4UI9 K;  2AEM A;  4GOF A;  3QWV A;  5EX0 A;  3Q7F A;  1GL2 D;  5H7P A;  2ZT9 C;  3H1K J;  3VTY A;  4KVM A;  2V7Q H;  4PS3 A;  1NO4 A;  1UOH A;  4HQD A;  3JSV C;  3AU4 A;  3QWO C;  5KLI B;  4G1T A;  2L0I A;  3OXL A;  1N7S A;  2WQ6 A;  2I8D A;  2QJY B;  3UIA A;  2ILR A;  1ZRT D;  2IOL A;  3SZ7 A;  1VQ4 P;  2Y1L E;  1UG3 A;  3AE5 C;  2GA1 A;  3W9F A;  3L17 A;  3LY8 A;  1YJN P;  3F5H A;  4GOE A;  5HS0 A;  2NPS A;  4FJZ A;  3FWV A;  1QGK B;  1SQP J;  2G8Y A;  2XPI A;  4U3F J;  2WSF H;  1K3Z D;  5ITZ F;  5BT1 A;  1USD A;  3L75 E;  3MUD A;  1KLX A;  3FTZ A;  4RVB A;  2CFU A;  4HLE A;  1EF1 C;  1J1D B;  1H19 A;  4UI9 C;  3TWX A;  1L0L K;  3D9P A;  2QVA A;  1NTZ G;  5AYW D;  5APU A;  1HF9 A;  4CRW A;  3FX0 A;  4JD2 G;  3UM2 A;  2P9I G;  4N3B A;  2IEJ A;  1HJB A;  5T4Y A;  1HS6 A;  3M9H A;  3S7B A;  3L08 A;  4P29 A;  2XGO A;  4XEI G;  1AJY A;  3T97 A;  3KS2 A;  1YCS B;  2Q7F A;  2Q5U A;  3KDP B;  4GZ3 A;  1FS0 E;  1QYM A;  3HE4 A;  4GTT A;  1BGY D;  1X9V A;  3HYM B;  4W7Y A;  3T97 B;  3TWQ A;  3LKU A;  3SFY A;  1H8A A;  4Y99 C;  3V2P A;  4TXQ A;  2HYN A;  2KC7 A;  3CWB E;  3H1K G;  2GRO B;  3HE4 B;  2WSC H;  2HPC A;  3AE3 C;  1SQX K;  4U0U A;  5JMN D;  2Y0D A;  1L0N D;  3HIZ A;  4DJG A;  2Z5I A;  2XEH A;  2HPC B;  1LT9 A;  3ML8 A;  1E8Y A;  4HRN A;  5KAI E;  3NOC D;  3TK1 A;  1E7V A;  3T8K A;  4ANV A;  1S72 P;  4G11 A;  1LT9 B;  3OJA B;  2L91 A;  5ENN A;  5AVW B;  3ESL A;  2AXT H;  4UWF A;  1PGQ A;  1OWL A;  3H1I J;  4U3F G;  2LAH A;  2FO1 E;  1VF5 D;  2OYH C;  3RU0 A;  4AY6 A;  2A06 E;  2IDB A;  3B7S A;  4MBG A;  2L6B A;  3G2W A;  3AS5 A;  2WXK A;  1NH4 A;  4DLQ A;  4I17 A;  4EDF A;  5ENS D;  4G24 A;  2GGF A;  1KZP A;  2F8X K;  1CI6 A;  1U3D A;  5DIZ A;  4U8H A;  2FEZ A;  3KEZ A;  1U57 A;  4R4L A;  2WIT A;  4I7Z C;  3H1J D;  4DX6 D;  1CI6 B;  1FOS F;  4LNB A;  3F6Q A;  1NTK G;  5AVV B;  2K9J A;  2XKM A;  2H89 C;  1N4Q A;  1NTM D;  1LP1 A;  3CVU A;  4BER A;  5AW1 B;  1E7U A;  1KV4 A;  3F89 A;  4H44 C;  1AQ5 A;  2K9J B;  3CV0 A;  3RO2 A;  4RKU J;  1LP1 B;  3FTV A;  3RKV A;  2KCK A;  4X8Q A;  4H13 B;  2IBZ D;  1JPL A;  1T8Z A;  2HM8 A;  3PTZ A;  1EQ7 A;  3FTU A;  4PD4 D;  3MZL B;  3OTN A;  1EZV E;  1HVV A;  3MZW B;  2VSX E;  3SHF A;  1H0T A;  3L73 J;  2E5Y A;  1HGV A;  5AW3 B;  1SQQ E;  1H2V C;  5FJY A;  4UI9 J;  3WUT A;  2N1T C;  4DOJ A;  3PDN A;  3FUD A;  3BAS A;  1RH5 B;  1H0T B;  4ILG A;  4JA7 A;  5CMW A;  4BEP A;  1U7M A;  4EI2 A;  2J4B A;  4APF A;  3TWU A;  3H1I G;  1GU4 A;  1OWN A;  4EZJ A;  1NU1 D;  3L71 G;  3IKO B;  3GW6 A;  4CZ2 D;  3OXF A;  1KIL E;  2CHW A;  4UWL A;  3V6I A;  1NKN A;  2WWW A;  4Z1M H;  3N71 A;  4FJY A;  4PD4 H;  4A3V A;  3SO8 A;  1W2B O;  2E2E A;  4JA9 A;  1NZN A;  5E75 A;  3ASO E;  4FU3 A;  4HOR A;  1LTJ C;  1EDJ A;  3FP3 A;  3UUX A;  2CHZ A;  2X6F A;  3DRA A;  1L4A B;  2NYJ A;  3ZYL A;  4EQF A;  4K3A A;  1LTG C;  4WWN A;  4Q94 A;  1VQ5 P;  3FTS A;  3CK7 A;  1L0N K;  2E43 A;  1FVH A;  3M0D A;  2WMN A;  2OTL P;  3Q1M A;  4WWO A;  4PJ0 E;  1VQP P;  3TDK A;  2F37 A;  4B8C B;  3BCC D;  3G6E P;  2P9S G;  1Y47 A;  3FXE A;  1P84 E;  2E76 B;  1QQE A;  1PP9 E;  3L35 A;  2R5B A;  3PRJ A;  1EZV I;  3P8M C;  2WMO A;  3T5V A;  4EBA A;  5GTI E;  2BF0 X;  3CVY A;  1HH0 A;  2JDI H;  4GA0 A;  3GLM A;  3S1K A;  2WSE H;  1H6P A;  1IFJ A;  1D8E A;  2WSS H;  3EQ2 A;  3KYQ A;  3B13 A;  3MP7 B;  1OXJ A;  2RD0 A;  2K37 A;  1NA3 A;  5BXU A;  3L54 A;  1SQX J;  3H32 A;  5TIS E;  3H1H D;  1FAV A;  3CCS P;  3AS4 A;  1QX8 A;  2HR3 A;  1LTX A;  2GW1 A;  3Q9N C;  2OGU A;  1IKN D;  1FT2 A;  3H32 B;  4GOD A;  3FWN A;  2RMZ A;  4DK5 A;  3U3W A;  1NA0 A;  3OW2 O;  3JUI A;  3O6Q A;  4LUN U;  1NTM K;  3HD7 C;  5APT A;  2Y0B G;  4BTB A;  2QJK B;  1RE4 C;  1S9K E;  5AN8 A;  3P8C D;  3TSI A;  4KT0 J;  3RL0 D;  3O6Q B;  1KIL C;  4IL6 E;  1VQO P;  2O1J A;  1FDM A;  1X5B A;  2A4Z A;  3CVX A;  2A45 H;  3WU2 H;  3AED C;  2KS1 A;  3V2N A;  1GL2 A;  2FFD C;  2ZIS A;  3CKB A;  1NKZ B;  1P84 I;  3RJV A;  3IF4 A;  2BED A;  4TRQ A;  2IFN A;  1NP7 A;  4XI0 A;  4D6T J;  4JW1 A;  2IF4 A;  2ZAE B;  1KB9 D;  1WY6 A;  2V0P A;  1L0L G;  1JWF A;  2KS1 B;  5BW8 C;  1GL2 B;  5ARG A;  3E7K A;  1SLQ A;  3FXD A;  1IHB A;  2XGM A;  4HRM B;  1HBW A;  2I1K A;  3BEE A;  3CHP A;  3FEX A;  4KVO A;  3NB2 A;  5BV0 A;  5G2N A;  1S3J A;  2RG8 A;  3CC7 P;  1XTG B;  2IYO A;  2AVP A;  2M3E A;  2KM4 A;  1E79 H;  5AJD A;  4BXL A;  1NU1 K;  4UB8 H;  2QG4 A;  4YVO A;  4RG9 A;  1T3J A;  4D10 C;  3ZW3 A;  2Y0E A;  3LS8 A;  1ZXG A;  3R7Q A;  3B7R L;  1KYO D;  2QYJ A;  2BUG A;  2MHK A;  1SQX G;  3C8V A;  1K8A Q;  1WDY A;  1INZ A;  2W6B A;  4JYB A;  4AOF A;  3U1C A;  2KIK A;  3B8E B;  4XI9 A;  4GA2 A;  3TJP A;  1KN7 A;  3IXE A;  4HRL A;  3D9L A;  1NTZ E;  4KYO B;  3V2O A;  1IYG A;  2MRI A;  4EYY Q;  2RH0 A;  4N39 A;  1AVO A;  2IQC A;  5D66 A;  3RIB A;  1RY3 A;  3S9O A;  2FYZ A;  4JEH A;  2D2C B;  2QJP B;  4APO A;  4ME2 A;  4BX9 A;  1SS1 A;  1Q2Z A;  3AG4 E;  1K73 Q;  4G2V A;  4LG6 A;  1KYO H;  1SVX A;  3EIQ C;  3CQG B;  5DJU B;  4BTA A;  2P9P G;  3BVH A;  3U66 A;  3G2T A;  4D6T G;  1OUV A;  3SI5 A;  4HKZ H;  3H1K E;  3HXD A;  5DBK A;  4FHJ A;  4OYS A;  1SW6 A;  4C48 B;  3SD5 A;  1GW6 A;  5AJL A;  5AVY B;  3E30 A;  2GRN B;  3AE7 C;  1TNZ A;  1XNF A;  4I6E A;  1L0N J;  2GM4 A;  3EJN A;  4PS8 A;  3I55 P;  4GAA A;  3FY4 A;  1HWT C;  5BV1 A;  1YYC A;  1S70 B;  4GTS A;  2QIW A;  4I2Z A;  1U3C A;  2MYO A;  2XHE A;  5BVZ A;  2XU6 A;  1D8D A;  4GDO A;  1QVF O;  5EIB E;  1VQ8 P;  4U3F E;  1QZ2 A;  5C2Y A;  1VF5 B;  3Q78 A;  4JHK A;  4GZD A;  2FYU K;  2WTY A;  5AIJ A;  2HLO A;  2LSV A;  2ZGG A;  4C7N A;  3ZYQ A;  1EXJ A;  1TNU A;  2X3M A;  1PPJ G;  5KCM A;  2H88 C;  3U59 A;  2PQN A;  5APS A;  4IOI H;  4C7N B;  3SFZ A;  3Q15 A;  4FLH A;  1LWU A;  1FVF A;  2LUH A;  2KCV A;  4GCO A;  1G1I A;  1RF1 C;  3CVQ A;  2M0B A;  1DNP A;  4KT6 B;  1S5L H;  3AE8 C;  1Z3Y A;  2KI7 B;  3N4X A;  1V55 E;  2OOE A;  4ZHB A;  1DC2 A;  3WMM 0;  1NTK E;  3JYS A;  3FUI A;  3Q47 B;  1PP9 J;  2LKM A;  4W80 A;  1IZN B;  3O8Z A;  1QBQ A;  2L0T B;  3ASG A;  4K5B A;  3VYI A;  4GT1 A;  4H13 D;  1JTH A;  2V4L A;  1HG5 A;  4M3O A;  3JXI A;  1SFC C;  3K5B A;  2ZXE B;  4NRH B;  4UQZ A;  2BCC D;  3DEP A;  5AW6 B;  5AVU B;  1BD8 A;  2WXQ A;  1K8K G;  2JO1 A;  3RL0 C;  1JTH B;  2XRY A;  1L0N G;  2DW3 A;  3CD6 P;  5ENO D;  1DEE G;  5GTH H;  2LO6 A;  1WG0 A;  3Q4A B;  2GRQ B;  2WPS A;  3CKC A;  3L70 D;  3Q75 A;  3TXM A;  4KBQ A;  1N11 A;  5ENP D;  5APQ A;  2FBW C;  5TJH A;  3H1I E;  5KLI C;  3W68 A;  5AAO A;  4BES A;  3A0B H;  1N73 B;  4AM9 A;  3L71 E;  4XFJ A;  2WXL A;  4I1O B;  1DX7 A;  4JB8 P;  2QJY C;  2NSZ A;  1H89 A;  1NU1 J;  2ETC A;  1KQL A;  3PNT B;  3CME P;  1N7S C;  1FZC A;  1TNB A;  2AEJ A;  1FJP A;  4C0M A;  1VQM P;  2KB7 P;  2XNX A;  4H0L B;  1L4A D;  4JHJ A;  5KJM A;  4YDW A;  3L74 J;  1NGM B;  2IX7 C;  3CC4 P;  3UX4 A;  2UWJ G;  3CVV A;  4JPZ B;  1FZC B;  2YIU B;  2ETB A;  2NPS C;  3SWY A;  1IFN A;  3G2S A;  1HFA A;  1R5L A;  4I1L A;  1J1D C;  5KTB A;  3EUV A;  3EIJ A;  2E76 D;  3TNU A;  4OH8 B;  3MUD C;  4WAF A;  2OYI A;  3IAO A;  2YO3 A;  1MX4 A;  3C3Q A;  1E5W A;  2DIW A;  4HOT A;  2J09 A;  2OYI B;  1YQ3 C;  1KTM A;  1BE3 D;  3PVL A;  1KZO A;  4FUL A;  2M63 A;  2VSO E;  3DEO A;  1URQ A;  2BAS A;  3TL5 A;  4AEZ C;  3SBT B;  2IBZ G;  2KYV A;  3TGU D;  1T6A A;  3B95 A;  3J5Q B;  4WY4 B;  4W9R A;  1JWG A;  1URQ B;  2FY8 A;  3HE5 A;  1S5L X;  2BKK B;  3VOP A;  2JAB A;  3CCE P;  3MJW A;  5FWQ A;  2QFC A;  1IFM A;  2WPV A;  1IFP A;  1OMI A;  3TG4 A;  4F3V A;  3B7T A;  2ZFC A;  3PZ1 A;  3L75 D;  4RO0 A;  4K35 A;  2AW6 A;  2OEV A;  1KMI Z;  2P67 A;  3UTM A;  3IEG A;  3D71 A;  1NAY A;  3V79 K;  2XEE A;  1FE6 A;  1NU1 G;  2JJL A;  4HYT B;  5CJ0 A;  4DI4 A;  1UJJ A;  2KOG A;  1Z5S C;  2K3R A;  1LT9 C;  2ZXX A;  4N78 E;  3NF1 A;  3QK0 A;  2E75 B;  2KCL A;  1RQU A;  1CSB A;  3EHR A;  5CRU A;  2AWI A;  4CGW A;  3L74 G;  2NC9 A;  2CG2 A;  1MYO A;  2P9U G;  5K5G B;  3WXX A;  3HXC A;  3UM0 A;  3I56 P;  1JY3 O;  3RSE G;  5LX8 A;  2O01 H;  2JP3 A;  1OY3 D;  3SWK A;  5EID A;  1HUC A;  4BWN A;  2PM6 A;  1T2K C;  5AAR A;  1DIP A;  1GK6 A;  4U96 D;  1L0L E;  3LY7 A;  3SWF A;  1Q81 Q;  3C3R A;  3II6 A;  1G2C A;  2J49 A;  4RG6 A;  1M56 D;  3BCC G;  2QM8 A;  4EZL A;  4TLF A;  3S7J A;  3TWV A;  1OCR E;  5KNH D;  1TN8 A;  4LLH A;  1G2C B;  4FLB A;  5M1B A;  3FGA D;  5AW2 B;  3U1A A;  1IK7 A;  4L23 A;  4JEU A;  2WXJ A;  3TWT A;  2P2C P;  4G25 A;  4J8F A;  3ABM E;  5EX3 A;  2C0M A;  3TGO A;  1JEK A;  1NJI Q;  2LXM A;  2PAJ A;  1TJC A;  2DYS E;  5AQ9 A;  4J8S A;  3SGH A;  4DPR A;  1SA4 A;  3KAE A;  2RKL A;  1DD3 A;  2IOS A;  4H13 C;  1SQX E;  3ML9 A;  3UKU G;  2JR8 A;  1JUQ A;  1HX8 A;  4DCK A;  3ZEF A;  2YQ8 A;  4G8K A;  4N5Q A;  3Q49 B;  1BDC A;  4IFF A;  2QM7 A;  1KPS B;  1DCQ A;  2F8Y A;  1N0Q A;  4B89 A;  2L5G B;  3CLJ A;  5KJK A;  3GHG A;  2E42 A;  4NPE A;  1MFZ A;  3IBE A;  3L4F A;  1AA0 A;  1OVU A;  3CEQ A;  1CZQ A;  2POH A;  2D2C D;  1MJ0 A;  1E96 B;  3GHG B;  3DSW A;  3DSS A;  5KAI H;  1Y8M A;  3P32 A;  1HU3 A;  3RK6 A;  2KNC B;  1NTK J;  2P10 A;  3D9M A;  4HI9 A;  4I2L C;  5KNG A;  4MN4 C;  4MKT A;  1IK9 A;  3VTP C;  1N4R A;  2FF4 A;  2HOD A;  2NXP A;  3C72 A;  3VMY A;  3RL0 g;  1BSH A;  2RFA A;  1EDK A;  3CX5 E;  5E79 E;  4D6T E;  4DX1 A;  4U7J A;  4GTQ A;  2Q9I A;  1EDL A;  2HOD B;  2IZ0 A;  2LNI A;  4I1A A;  2XRZ A;  3DWL G;  1AV1 A;  2L6J A;  4H7Y A;  3SFX A;  5AW8 B;  3S4R A;  3FU5 A;  4CEM A;  1OZH A;  3AS8 A;  1R5S A;  5EFW B;  3FH8 A;  2UY1 A;  3VP9 A;  1JY2 O;  3H1L J;  1EZV D;  3B4S A;  1GMJ A;  3ONL A;  4XZ4 A;  5CJ4 A;  2UY1 B;  3ENE A;  2BEQ D;  3CR3 A;  4ILH B;  4PV1 C;  4UWK A;  3M0D C;  1NHL A;  2X38 A;  2E76 C;  4PH4 B;  1NL4 A;  1ZRT E;  2KZT A;  3CCU P;  1S4X A;  3L71 J;  3WUU A;  5LOZ A;  2GRR B;  5E76 A;  3VLE A;  1JUN A;  2VGE A;  3V31 A;  2Q1K A;  5KKZ C;  1GDT A;  2QEX P;  1N86 A;  2KZT B;  3AEF C;  1PC2 A;  1SQB J;  1FOS E;  3AJI A;  1PPJ E;  2ION A;  3B5N D;  3P1U A;  2AEF A;  4XA4 A;  5CCH D;  3KSQ A;  3A0H E;  3W9G A;  2C2L A;  5AVS B;  3AEG C;  1FDI A;  4OVV A;  3V4W A;  4UQX A;  3E4B A;  1JMB A;  4N3C A;  1NVO A;  3GF3 A;  2FXM A;  2N9Y B;  4ABN A;  3NBN B;  2C9L Y;  3CVN A;  1HTL C;  4JHR A;  3A7O A;  1FPP A;  2XV5 A;  4CGV A;  3UXG A;  2Q7C A;  2XPZ A;  1TNY A;  2NRG A;  1K1A A;  1RE3 C;  2QA4 P;  4ASV A;  1P84 D;  3LW5 H;  2PZI A;  2KUB A;  1X0T A;  4AIF A;  1IFD A;  2P7J A;  3I4G A;  4L9P A;  1K05 A;  1LNQ A;  1IJD B;  3H1L G;  2BCC J;  2QYU A;  2JLB A;  1L0N E;  2XDJ A;  2XEV A;  4KXK B;  4KMO A;  2YO2 A;  3MIW A;  4C0E A;  1GL2 C;  5AVR B;  2XZD G;  4FC8 A;  1ZN5 A;  1N9A A;  2O1K A;  3CPW O;  3VP8 A;  2R02 A;  1Y8A A;  4PJ0 H;  1BI8 B;  3L70 J;  4IYP A;  5J90 A;  1EC5 A;  2FKW B;  5BNW A;  5ENT D;  1JCS A;  3H25 A;  3AE2 C;  5EIL A;  1IFI A;  1P84 H;  1TJF A;  4HLL A;  2XEN A;  4YDO A;  4BSX A;  1L4A A;  1SQB G;  2I1J A;  3DPY A;  4HNA D;  4H0L D;  5IY5 E;  5ENQ D;  5GTI H;  3RK3 B;  3ASN E;  1PAQ A;  3UM1 A;  5CMY A;  3I5P A;  2PGD A;  4G26 A;  3TG5 A;  2M5A A;  4HJG H;  2X6K A;  2ZVN B;  4JVS A;  2KAT A;  2UWJ E;  3CCV P;  3DXK G;  4KZC A;  3D9K A;  2R5S A;  5T3R A;  2WMM A;  1PGP A;  2M5A B;  4LRZ A;  1Q7Y Q;  1MQS A;  3KD7 A;  5JJT A;  1GK4 A;  3PH0 A;  4YVQ C;  4N3Y B;  2PL2 A;  1L0L J;  5KLV D;  3AG2 E;  1GZL A;  2R03 A;  1T3U A;  1DEB A;  4WB4 A;  3W67 A;  4V3I A;  5TIS H;  2WXR A;  4KZ0 A;  2QZA A;  1YMP A;  3LPZ A;  1SQQ K;  4YTP C;  2BTD A;  5T8I A;  3KPE A;  4ANX A;  2H43 A;  4GTV A;  3KSL A;  4EPZ A;  2D2C C;  2QJP C;  4IRU A;  4BSZ B;  3CSF A;  4GPM A;  4WY4 D;  4M7C A;  4LCT A;  5HRY A;  4ACK A;  1URQ D;  2BCC G;  1IHG A;  3HG0 D;  4MLP A;  1BE3 J;  1NWQ A;  2IBZ E;  4CYM D;  3D3M A;  2V4H A;  5G04 C;  2X6H A;  1BCC D;  2MKV A;  4IL6 H;  1YHQ P;  3TGU J;  1MFT A;  5H2F E;  3AE1 C;  5B66 E;  3IFM A;  4OAV B;  4AXH A;  3Q5P A;  4AVX A;  5CMZ A;  3QOU A;  1P5Q A;  3KXD A;  1RE3 A;  3L70 G;  2W8Z A;  3VMX A;  4ZNC A;  1IQR A;  3J5P A;  1M1J A;  3KZI E;  3ZXS A;  5A23 A;  4LNU D;  1J2J B;  4N2S A;  3FDH A;  4AP2 A;  2GUV A;  2V7Q J;  4L1B A;  5ANL A;  3ZUV B;  2E75 D;  1M1J B;  2YNQ A;  2WQY C;  1NU1 E;  4RSY A;  2P1J A;  4AV7 A;  3HXB A;  4I9C A;  2B9B A;  2FYU D;  2WPQ A;  3CL3 D;  1NTZ D;  4Y28 J;  4ANU A;  1S64 A;  3MHV A;  2W90 A;  4N5C A;  3L74 E;  3LJ3 A;  1WAO 1;  2B87 A;  5G05 C;  1VF5 C;  1ZU2 A;  1D7M A;  5FZQ A;  1A02 F;  4BET A;  2B87 B;  5APY A;  1QLE D;  3GW4 A;  3ZDM A;  3RO3 A;  3RRU A;  2WSF J;  2WB2 A;  1PIX A;  3ASF A;  5BXO A;  2PM7 A;  5CCG A;  2XZR A;  5B3S E;  4N6J A;  2YHE A;  4ATG A;  3BCC E;  1PZQ A;  2KBX A;  3CK8 A;  5KJ7 A;  1LWU C;  4LER A;  3FUF A;  4F7A A;  2XND H;  2WXG A;  2R3C A;  5AW4 B;  2JKV A;  2XPY A;  1O1S A;  1BE3 G;  3Q2Y A;  3HXF A;  2RKK A;  4EBA G;  2CHX A;  3FH7 A;  4DJA A;  4GZC A;  1LD7 A;  4MRU A;  3R7R A;  1D9S A;  1FBM A;  1A5E A;  1JMM A;  3TGU G;  1G1J A;  3MX3 A;  3JCK C;  2WXF A;  3ZPJ A;  2V5F A;  2SPZ A;  1JNM A;  2RFM A;  2XS1 A;  1SQP D;  5D2M C;  1YJ9 P;  2X6I A;  3ESK A;  3ZYK A;  1OT8 A;  5EYP F;  5CCM A;  4AYC A;  2N9B A;  1BU9 A;  3N7N A;  1S0P A;  3FU6 A;  3TWS A;  1LTJ B;  2WSC J;  4ZKU A;  5FZS A;  3SY2 A;  1QL2 A;  2WZ7 A;  2HYZ A;  4BX8 A;  5KLV K;  2J07 A;  3LIE A;  3G2V A;  4XKC A;  1RW2 A;  3AG3 E;  2YHC A;  3AAA C;  3CCM P;  3PRZ A;  1FC2 C;  3ULQ A;  2GRM A;  3CMA P;  3ZKJ A;  3ZRH A;  1B89 A;  3IR9 A;  3RK2 D;  1MX2 A;  1J1E B;  2CG3 A;  2P9L G;  3USS A;  3V2R A;  3D9I A;  1KT1 A;  1BGY J;  4TT3 H;  5G04 J;  5J08 A;  3UT8 A;  3CC2 P;  3NQP A;  5AQB A;  1N52 A;  1N54 A;  2YNY A;  3JCU E;  4DZO A;  1KB9 E; 
#chains in the Genus database with same CATH homology
 2PNN A;  2BKG A;  5JMN D;  4HBD A;  2KZJ A;  3DEO A;  2XEH A;  3EHQ A;  1Q2N A;  3B95 A;  3J5Q B;  4HRN A;  3NOC D;  3V2X A;  3T8K A;  1OVR A;  2J8S D;  2BKK B;  4HB1 A;  2JAB A;  2B0O E;  2AJA A;  2FO1 E;  1LT1 A;  4K35 A;  4HI8 A;  3UTM A;  2L6B A;  3V79 K;  2XEE A;  2K3R A;  3RGU A;  5ENS D;  3B7B A;  3EHR A;  5CER B;  1MYO A;  2F8X K;  5K5G B;  5CEA A;  1JM0 A;  2DVW A;  5C39 A;  4DX6 D;  3ZNG A;  1OY3 D;  3TWW A;  3F6Q A;  5EID A;  5AAR A;  1LP1 A;  4U96 D;  4BER A;  5JA4 D;  4QQI A;  2B88 A;  3LJN A;  1LP1 B;  5HKP A;  3T9K A;  3TWV A;  5CED B;  5KNH D;  3D9H A;  4A63 B;  5CBO A;  3MZW B;  1H0T A;  3TWT A;  2P2C P;  2LXC B;  4DUI A;  2JWD A;  1H0T B;  5AQ9 A;  1NFI E;  5FIN A;  1U7M A;  2P58 A;  4BEP A;  2RKL A;  5EN5 D;  3TWU A;  5CEC B;  4G8K A;  4N5Q A;  1TR4 A;  1BDC A;  4CZ2 D;  4TUM A;  1DCQ A;  1N0Q A;  4NPF X;  2F8Y A;  2KZI A;  2DZN A;  4DX2 A;  4NPE A;  4B93 B;  4G8L A;  1OVU A;  3Q9U C;  3SO8 A;  1MJ0 A;  1EDJ A;  4HI9 A;  2NYJ A;  2LR2 A;  4K3A A;  5KNG A;  2OTK E;  4MN4 C;  2HE0 A;  3JUE A;  2QRX A;  4J8Y A;  2RFA A;  1EDK A;  1AWC B;  2F37 A;  4DX1 A;  1EDL A;  1Y47 A;  1BDD A;  2ZGD A;  3FXE A;  2B89 A;  4NIK A;  5EFW B;  1G3N B;  4F6R D;  3S1K A;  4WWI A;  4KJM A;  5BXU A;  1OVV A;  3HRA A;  2VGE A;  3V31 A;  2Q1K A;  2HR3 A;  3Q9N C;  1YYH A;  1IKN D;  5ENR D;  5DJT B;  4GOD A;  3AJI A;  3W9G A;  2Y0B G;  4QFV A;  5AQ7 A;  5AN8 A;  4U8V D;  1JMB A;  1NVO A;  3TWR A;  5CBN A;  3NBN B;  5EYL A;  3UXG A;  1K1A A;  2ZAE B;  4UUC A;  2KS1 B;  4ASV A;  4HRM B;  1IHB A;  3FXD A;  2KUB A;  5KBA A;  1X0T A;  4DRX E;  1S3J A;  4K5A B;  4U95 D;  3EU9 A;  5FIO A;  1ZW0 A;  1BI7 B;  4BXL A;  4O1O A;  2R44 A;  4O1P A;  4YDY A;  4K5C A;  2XZD G;  2A5E A;  2ETA A;  1ZXG A;  1BI8 B;  2QYJ A;  1EC5 A;  5ENT D;  5EIL A;  1WDY A;  4HLL A;  2XEN A;  4CPG A;  3C5R A;  2KIK A;  4HNA D;  4ZMD A;  5ENQ D;  1BLX B;  3NOG D;  3IXE A;  3UI2 A;  1U7J A;  4HRL A;  3V2O A;  2M5A A;  4RLY A;  4HJG H;  3V30 A;  4EYY Q;  2UWJ E;  5D66 A;  2KXP C;  2WMM A;  4J7W A;  2M5A B;  1SS1 A;  2XZT G;  3PH0 A;  4LG6 A;  1SVX A;  4Z68 A;  1EDI A;  5DJU B;  1N0R A;  1YMP A;  4HKZ H;  1SW6 A;  4C48 B;  4OAU C;  4BSZ B;  4GPM A;  5HRY A;  3HG0 D;  4CYM D;  4GMR A;  4ZFH A;  4F1P A;  1MFT A;  1S70 B;  3JXJ A;  3KEA A;  2MYO A;  4OAV B;  4DX7 D;  4NPD A;  4DX5 D;  5EIB E;  4ZNC A;  3J5P A;  4LNU D;  4ATZ D;  4ASW A;  2ZGG A;  3ZUV B;  4U8Y D;  5AQA A;  4IOI H;  2V4H C;  3MHV A;  4LSZ E;  2DZO A;  2B87 A;  2M0B A;  2KI7 B;  4BET A;  2B87 B;  4ZHB A;  4HB5 A;  1DC2 A;  3ZDM A;  2V5Q C;  1AP7 A;  4GOF A;  5BXO A;  4K5B A;  4JBZ A;  1UOH A;  2KBX A;  3JXI A;  4HQD A;  3QWO C;  3DEP A;  1BD8 A;  4O60 A;  5ENO D;  1DEE G;  2I8D A;  1WG0 A;  1D9S A;  1A5E A;  2Y1L E;  3W9F A;  4GOE A;  5HS0 A;  3ZU7 B;  1N11 A;  5ENP D;  2SPZ A;  2RFM A;  5AAO A;  4BES A;  1K3Z D;  1OT8 A;  5ITZ F;  5EYP F;  1BU9 A;  3TWS A;  4JB8 P;  2ETC A;  3TWX A;  2QVA A;  1K1B A;  2QC9 A;  4YDW A;  3AAA C;  1IXV A;  1FC2 C;  1MX6 A;  2ETB A;  3ZKJ A;  1MX2 A;  1YCS B;  5KWD A;  1QYM A;  2DWZ A;  2LXB A;  3TWQ A;  5AQB A;  1MX4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...