3B13A

Crystal structure of the dhr-2 domain of dock2 in complex with rac1 (t17n mutant)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
427
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for mutual relief of the Rac guanine nucleotide exchange factor DOCK2 and its partner ELMO1 from their autoinhibited forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords Dedicator of cytokinesis protein 2
total genus 139
structure length 427
sequence length 427
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b13A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3b13A01
2WM9A 2WMOA 3B13A 2YINA 3VHLA 2WMNA
chains in the Genus database with same CATH superfamily
1MNDA 3RRMB 5HKPA 1N36T 5LGUB 4ZZCA 3U66A 4EOZB 5JR9B 2FJAA 2HPJA 1MMGA 1YD8G 2HR2A 3RIUA 4UR9A 4YSXA 3ASGA 2R17C 4OAUC 3L82A 4O6FA 1N54A 2XGOA 3CKDA 1MHQA 3QC1A 5HXEA 4Z91A 3V31A 4O4HE 2IUBA 3ZLIA 4AP2A 4PJMA 3Q78A 4ME2A 2BBJA 2QRXA 3F6QA 4UWKA 4IYPA 2LSUA 4HKAA 2LJLA 4QXBB 4PS7A 3OBVE 5CEDB 4ZZBA 4AXHA 3JC6D 5AJDA 2V4LA 5AQHB 3QWVA 4F8HA 4JEHB 3IEEA 2FJBA 4F7AA 4H63H 2JJ9A 4I55E 3C64A 2XQ0A 3CWZB 3UU6A 4DUIA 5CHEE 4OYJA 2VKHA 4AV7A 4ANWA 1H6OA 4G2VA 3ZEFA 4O4IE 3QJZA 2R05A 2IOSA 3PJAA 3LK2B 3X1DA 3KVAA 3IF8B 3L39A 3O48A 2Y1LE 5FY1A 5E76A 2R03A 1D0ZA 4U95D 4CN1A 4AQFC 3ETUA 2R5SA 3PEUB 4HLLA 1QQEA 4ATZD 4K0RA 4I17A 4WW0A 4WWNA 3VRBA 3RLFF 3CHPA 5BPPA 4KHPT 3BG0B 4ILIA 2NW9A 2WQ7A 3PRZA 4YJ2E 1O5MA 2YK0A 4YLHA 3F31A 5HEUA 4JBWF 4KVOA 2I59A 2VURA 1PY1A 3HIZA 3RKGA 4I2WA 2XQ5A 3X2QE 1Y64B 1DC2A 4FI5A 3RRUA 3E33A 1OCRE 2D2SA 4GB9A 4A63B 1V55E 3EDUA 3AVSA 3LCAA 4N3AA 3GMIA 3MYVA 4E85A 4BETA 3I5PA 4X65T 4I6GA 4XEIG 4KBQA 2JEKA 3TLVA 1N33T 1LKXA 4RG6A 3N71A 4GZDA 5ENSD 1WR6A 5L3BB 2SPCA 2VSYA 2ZGGA 4JZYA 2BG9C 4UIGA 2EINE 4BEPA 1E96B 1KT0A 4JXTA 4NUUA 5IUXA 1MZCA 2OEWA 3PZDA 3CR3A 3SOLA 3RYCE 4LFAT 4RVBA 2VKJA 4IDZA 3V79K 2K5BB 3HA4A 4W9RA 4QXHB 3SD5A 3HKCE 5A1LA 2ETAA 1A17A 1SW6A 3HKDE 2UY1A 3EIJA 3FHNA 1FIOA 5EYPF 3C5RA 1A5EA 5EYLA 2WZIA 2WCAA 1T8BA 1I6ZA 2WSSV 2AXVA 2XPZA 4MBGA 2LM2A 3KEAA 2UXBT 1S0PA 4UWLA 1KLXA 5H6RB 4F1PA 2AXDS 2FBWA 2LHRA 1WRDA 4DR1T 3LK3B 3CVVA 2PQNA 5JDQA 2GRRB 1HE8A 5FT9A 4CEMA 3Q73A 4G26A 4BT9A 4UI9C 2EHOA 3QOUA 2XCCA 1FVFA 3PJAJ 1X5BA 5AQGB 2I9CA 2M6IA 2BS3A 4WWOA 2NWBA 4B8AA 3GZ2A 3GA8A 1Q2ZA 3MA5A 1JCRA 2X6JA 3BQOA 3VKGA 4FULA 3LJ3A 4HFEA 5FVLA 1XWMA 2RPAA 3IHYA 3CVXA 2JPFA 3C3OA 2KSRA 4TWHA 2CEAA 4IT4A 4PK4A 5DQVA 2LOPA 4UI9K 2ODUA 3MA9A 2KCLA 1HFAA 4B3RT 3CVYA 4U74A 2AXUA 5AQBA 4CZZB 2IU1A 4G24A 3I9YA 3NVOA 3BG1B 3BEEA 5JJ7A 3CKCA 4DX7D 2X6KA 3FH5A 3ABME 5KDMC 3G2TA 3CVUA 2WM9A 4ISSA 2VASA 4KBMB 4AKIA 2XGSA 2BKOA 4IL4A 3FUMA 3N9QA 3T8OA 1TN8A 5HCMA 2UWJG 3FTVA 2YDSA 1FJGT 2YU2A 4WBNE 1VCTA 5ABHA 4BTBA 2JQQA 5L3DB 1OEDB 2IQCA 2V7KA 3RKVA 3D9IA 4A3VA 3EABA 1OWAA 3CPZA 3CVRA 4UWFA 4KMOA 3P2BA 2V5DA 4X1IE 5JVDE 5AQSB 1SE7A 2VQFT 2EHOD 3MKRA 4GYOA 2BG9E 4EHMA 5LP0A 5JDMA 3SFXA 4HFDA 1L5JA 2LRLA 4XKCA 1IQRA 3UUXA 3B57A 1X81A 3AS5A 3SF4A 3W9GA 1VDYA 3AU5A 4ASKA 5J2TE 4YSYA 1SA5A 3QB2A 1QBQA 3ZSTA 4PFPA 1W3BA 4KT6B 3HXBA 4U07A 2IF4A 5ANRA 4CQIA 4MALA 3T8MA 4QX7B 3RH3A 4KXKB 2Y4UA 4B3ST 1UX5A 4PJLA 5BT1A 2A2FX 3WXXA 1HNZT 1RW2A 3S7JA 5HXRA 3OAWA 2JMHA 1BI8B 2BKKB 3Q9UC 4BY6A 3EU9A 2UUAT 4BAYB 3VTXA 4HGAA 2E5LT 4X1YE 3DXKG 5J90A 1YKEB 2WS3A 2XQAA 4PK5A 2WXLA 3AU4A 3FUHA 1MNEA 4DBRA 3CSFA 2G0UA 1JUQA 3O4ZA 5FL0A 4YY3T 1ZV4X 1D0YA 2XRYA 4U8HA 3LJNA 2OEVA 3UUMA 3AAEB 2VL8A 4QX8B 2WAUA 4A97A 3LK42 3Q5XA 3ZYLA 3VU7H 4H9SE 3FZFB 1OEDC 2J49A 4YVOA 3NOCD 1CUNA 4TV9E 5ENNA 5LNKA 3LY7A 3ZVVA 3D9KA 4MFRA 2JRKA 1LD8A 2WPVA 2YKSA 3MJXA 2WXRA 3EDVA 4EEDA 3AA6B 3C51A 4DV6T 2WXHA 2BDEA 3CQGB 3NZUA 2XS8A 2C0LA 2XEHA 2ZLYA 3DTOA 3D9MA 5A7DB 4YDEA 4H9PC 5AQVB 4C48B 4IGUA 2E9XB 1TR4A 3A8YC 4UVCB 4ZXLA 5AFUL 4LF9T 3I3NA 4I2ZA 2J9QA 2AWIA 1TNOA 3QK6A 3ZC1A 4I1MA 4XAXB 2A72A 4I9CA 3HKBE 2UXXB 4I1OB 4GA1A 3UMVA 2V8SE 1HX1B 5ABGA 1H6KA 3AE5A 4EZKA 5L3EB 3ZC0A 5GONE 4H9OC 1BD8A 2WP9A 2NP9A 5AQLB 3ZMVB 1KT1A 2JMKA 4HE8A 4JI2T 2F8YA 4HWDA 3TLSA 1V9DA 3UU4A 4HLEA 2DYSE 3Q5WA 4E6HA 1D1AA 1W9RA 4B94A 2DNXA 3DXMG 4U0SA 3V2OA 3NKZA 4WBOA 4ZHQE 5JRCA 2ETBA 2KCKA 4YJ3E 4K0UA 2H6IA 1E7VA 1HO8A 3ASHA 3RIUC 5BV0A 2K3WA 3RSEG 4O4LE 2UXCT 2VVNA 4LMLA 4I6EA 3W15B 1WCRA 4DPRA 4BT8A 2UY1B 4B8CB 1UUSA 3AG2E 2KT9A 5BNWA 3A7MA 2IC6A 3CQCB 3DBSA 4ILGA 2I1JA 4MLPA 3WI3A 4UUCA 2B0OE 5FNVE 2PJQA 2A5UA 4F3VA 2HN2A 5CFBA 2M63A 1N0RA 3O1IA 4BA9A 1NI1A 3B5MA 4HRMB 5FQ6A 2BS2A 4ZS3A 5D0OD 4ILCA 4DR2T 2VGEA 2VB6A 3HXCA 1Y01A 2FUPA 1O1TA 1PC2A 3PU8A 2QYWA 4HFHA 5BW8C 3AE7A 2YN6A 2XAJB 3N2OA 2P9IG 4WAFA 4AY5A 2PFVA 1X79A 1NWMX 5ENQD 4OX9T 3TLTA 3AS4A 3R84B 3MZLB 2QGSA 3P4RA 4J7WA 4GTPA 2XM1A 2JLBA 2X9WA 1BR2A 1E1HB 2VQET 5HAXA 1SZAA 2W0GA 1OCZE 3UT7A 3JCFA 4GPMA 5JA4D 3RRNB 1FMVA 3DSUA 5CBOA 2H7VC 2AW6A 4DV4T 3UM3A 1YA0A 4ZS2A 5J08A 3N9OA 2F4VT 3IHRA 1FVHA 3G06A 2FJEA 3HXDA 3AG1E 3PUJA 3LVQE 1HG2A 3GZ1A 3C3QA 5B1AE 1WYBA 4IDOA 3KEZA 4HI8A 2MOZA 2L8KA 3ZT6A 5CMWA 5LMUT 4L2LA 2P58C 5T4YA 3LKUA 3H3MA 1N4SA 5L3CB 4LFCT 3F2EA 2JQ9A 3I4GA 4L2YA 3I4RB 2E9XD 4IE7A 2IJGX 4CZ2D 4OVUA 5JJ6A 2H89A 4XX5A 3OVUA 3G2VA 2MYSA 1IKND 3B7UX 3HG0D 2CE7A 1ZKEA 3ZYKA 4CRWA 3MEKA 5LHGB 3ZMUB 2YDQA 4ILUA 3SI5A 2V5CA 2KZTB 3D9PA 3Q5MA 3TWWA 4KZCA 2DZNA 1VRBA 3U9WA 3O1JA 4ZEYA 4GZCA 2BEDA 2H3RA 3ZIMA 2QZAA 2CFUA 3L9TA 4JI1T 4F6RD 1HS6A 1B7TA 4AQGA 3FXDB 3NRYA 2IOLA 4U04A 1NA3A 4TUYE 3UULA 3D9NA 1SHZC 2GK9A 4UQYA 5FIOA 2LO6A 1G73A 2R59A 2EIKE 2P9PG 5LG3A 1H19A 3TJPA 2ES0A 4GK0E 3NZQA 2LOSA 4Z90A 2R2LA 2P9UG 5LMNT 1W0AA 5LOVE 3CLJA 5AQIB 5JR9C 3ZRHA 3P4PA 4GK5E 3DSTA 2XAGB 4NIKA 4EAHA 5J0ZA 3OKQA 2VTBA 3IBPA 2CA5A 4NACA 3LBXA 3FDHA 2F0YA 3UU3A 2H6HA 3N9PA 1W09A 3ZJ2A 3AAAC 3ZKJA 2WQYA 4OVVA 2V7LA 3PUQA 4YNDA 3PH0C 4LG6A 3HL6A 3HKEE 3ABVA 3LVRE 5HEHA 5JDNA 4HOQA 3RIBA 2V8SV 2XZEA 3TWQA 4WWPA 2QYJA 3SGHA 3UKRG 2W2UA 3CK8A 1INZA 1S64A 1HH8A 2J07A 4R7LA 2DZOA 2W62A 5ABFA 2ETCA 2RFAA 3C3RA 4Z8XA 4ILAA 4IDPA 3PE0A 1OWLA 3UT5E 4GKJT 1J5ET 4QKNA 2PNNA 2XEVA 4KUMB 3TL5A 2LSYA 5AQJB 4L9IA 1OCCE 3ZXSA 3QDNA 4JVSA 4KZ0A 3SFEA 2HPLA 2NTXA 4XZ4A 3CX6B 3BQLA 2BKNA 3UTKA 3C98A 4N5QA 5JJTA 5KJMA 2V5QC 4HOSA 2H88A 2NC9A 3RYIE 5AQQB 4PNIA 4HWCA 4GTRA 3QUJA 2IO3C 2YINA 4QXCB 2X6HA 1NP7A 4TWDA 3WAJA 2KZTA 3PZ3A 5BXOA 3RPUA 4UV9B 3TWSA 2WXQA 1OT8A 1QUUA 3PUGA 2MRIA 3QWWA 3U3WA 2A5EA 4HFIA 1WLXA 2JQHA 3RRCA 2WDVA 2XAFB 3AB3B 5FY0A 4GCNA 5AN8A 3RK6A 5TAOA 1E2AA 5C3JA 3JAEA 2A4ZA 4X66T 2IW5B 2BVMA 1TNUA 3Q7AA 4EPZA 2Q9QB 3UUBA 5HWYA 1EF1C 3ZU7B 1G8XA 3Q15A 3WAKA 5LJNA 5AQ7A 5D66A 3SBTB 2IONA 4PFOA 4G25A 3GWHA 2J1DG 3SRZA 4CXXA 2NW8A 2ZM2A 4JB8P 2FI7A 1D1BA 4U33A 2LE8A 5LB7B 2X0HA 3PE4A 4LF6T 3VLEA 4RSYA 3V2XA 1BR4A 3JC6C 5BXUA 4F6RC 4YHJA 2BF0X 5FQ4A 3E22E 3M65A 3NOGD 4HFCA 4QWNB 1T7SA 2CWOA 2J47A 2X9YA 1UX4A 3UQ4A 3R9MA 4J0UA 1H2UA 1D8EA 1UG3A 2DIWA 4HRLA 2CHOA 2E9XC 4L23A 2VJ8A 3ZGQA 2YNQA 4UV8B 4AQFA 5LGNB 2NOXA 3CK7A 2XHEA 1SQMA 3S7BA 3KDSE 2GW1A 1WR0A 4JW1A 4BFRA 1XDOA 3ONXA 1WDYA 1XNRT 3Q75A 2LSJA 2WXKA 5J1GA 3FY4A 2PM6A 3AAAB 3CEQA 3DSSA 4N3BA 2VKOA 1XNQT 2X9HA 3O9XA 2LT3A 1MMAA 1B89A 1RZ4A 3B13A 4U63A 3E32A 1KNRA 5B3SE 3UFGA 1TJCA 5LBMA 3FUJA 5EX0A 5G05C 3N2KE 1UGOA 3PUXF 3UUNA 1E8WA 4NRHB 4HFGA 2X6FA 4I6JA 3T5XA 2VSNA 2J8SD 2RD0A 5L3GB 4C9BB 3ZNGA 3QOFA 2NTYA 3AA1B 1T98A 3EHRA 3L16A 2X6IA 1IZNB 5HYAA 1JWFA 2ACZA 3FUEA 4AVXA 5JRCB 2MHKA 5AENA 3J5PA 2X38A 4FJOA 2X66A 4APFA 1AJ3A 3UIPC 4JYAT 3LFMA 2OA5A 1IJ6A 4XBFB 1LF8A 2VGXA 2GRNB 3HDXA 4GPKA 2X67A 2C5KT 3RO3A 4J8DA 2XY8B 2PQRA 3MV3B 3TWRA 1IBLT 3AEBA 5ADXL 1FPPA 3DPDA 2GRQB 4UF0A 3RQUA 4DX5D 5BMVE 1S35A 3ZSSA 5ENOD 3VTYA 4HWHA 3TWTA 3ZUVB 2W00A 4LF4T 2E9XA 1HNXT 3K1SA 2CXFA 2JABA 3NQPA 1N34T 2OCCE 1K1BA 4DR6T 4X5TA 2V6YA 5FY7A 3VRAA 3EDTB 4GTQA 3JYSA 2B6CA 1P5QA 3O4XE 2UU9T 2IO2C 5EK4A 3GN5B 4TXPA 5AQAA 3CVWA 1H2VC 4O1OA 2P9NG 3C98B 4AOFA 5KX5E 3AS8A 5G2NA 2QY7A 3IHVA 4CI1B 3PU3A 2J62A 4YTNA 1OEDE 3LDZA 2Y8DA 4YSZA 4UQXA 2WXFA 3OTOT 5EKQD 1IYGA 1U4QA 2ONDA 3ZFWA 3FUFA 3MCXA 2XPKA 3HVEB 1MX2A 4EZLA 3DEPA 4U7IA 2VL0A 2XQ9A 4P1NA 1OWOA 1KPSB 2AVPA 3Q49B 2KATA 1Y8MA 4U0UA 4MKTA 2XSBA 4OAVB 1M62A 2BTDA 4LSZE 4ATGA 4N2QA 3N9MA 1OUVA 4AQYT 3KVBA 5C2YA 2WMNA 1BR0A 4JI3T 1K1AA 2CBJA 5FXWA 5CGMA 1WYCA 3SY2A 4TN7B 1QZ2A 3AE1A 5F8PA 1ZP0A 4DV3T 3SO8A 4GYSA 4TRQA 4JHJA 4IDNA 3B7SA 3PE3A 3M3ZB 3N9NA 3RC3A 3EAMA 3Q5DA 3ZPJA 3QWPA 4GMLA 2DWGA 3S2AA 1D0XA 3RHWA 2LHNA 2DCPA 3FUDA 2IFUA 2WXOA 5EIBE 4DV7T 3B7BA 2H6GA 4Y6WA 3RF1A 3AEFA 4KYOB 4K03A 1TNBA 5DBKA 3EI0A 1Z3YA 2UXNB 3QKYA 5AQFB 3EVYA 3UUXB 1HZ4A 3FTYA 4G8LA 4YVQC 4ZI2C 4ABNA 4DX2A 3AE9A 4DI4A 1AP7A 4JI5T 2KNDA 2QFCA 3CVPA 4G23A 4FADA 4OFZA 3I0QA 2NYJA 1FT1A 3C50A 4ZFHA 2IDOB 3TG5A 2RG8A 1TEZA 2VYIA 5HXHA 3ZYMA 1TNZA 4RQIA 5T3RA 3R7RA 3VR9A 5JDFA 2MBGA 1LRZA 2CHNA 1AWCB 3TXNA 3PNTB 3PUSA 5FKYA 1EDUA 5L3FB 5L4HA 4GTTA 4PS3A 4DMWA 1NZNA 2RKKA 3A5XA 3G2WA 2V7IA 4KP3C 2W67A 4U2YA 3JUIA 3PS6A 3OPCA 4U31A 4YTMA 2FO7A 3Q79A 2WVIA 2KXPC 5FXVA 3ASOE 4LERA 3JAFA 4HBDA 4DVDA 2A9UA 2J4BA 4G63A 3PV0F 1TJFA 2YDRA 4ACLA 4HVBA 3QAQA 4WNEA 4QHOA 2WDRA 4QH5A 3HXEA 4MLKA 5AQMB 2P9KG 3PZ2A 2HHHT 4OYKA 3C4ZA 2Q9QC 3QB5A 3PVLA 4TV3A 5LJMA 4DJAA 1XMQT 2WY2A 5EIDA 4DR4T 4BTAA 3UT8A 4D10C 2BS4A 2KM4A 1XGWA 2CRBA 3HHMA 3CGHA 4IE5A 2XQ3A 3Q47B 2X0YA 3ZT5A 5JH7E 2LRKA 3MV2B 4GZ5A 3J5QB 4ZOLE 5ARFA 1O1RA 4X62T 1N4QA 3Q9DA 3BU8A 5FJYA 1TN6A 2X3MA 3UU8A 4DIDB 3ONLC 2E5VA 2ODVA 3APDA 3FFLA 1U3CA 4G2AA 1GQEA 2Q9QD 2HH7A 3Q5EA 2H7OA 2WQ6A 2Y48B 4JLEA 3PUWF 1KNPA 4YFSA 5CERB 3S7FA 3ZXPA 2RP4A 2W66A 1ELWA 2WXMA 3SNXA 4MHCA 2Y4TA 2LUHA 2CMRA 2UUBT 3VHLA 2W63A 1LD7A 3LJCA 1Z5SC 5DQWA 1MYOA 1LVFA 4XKBA 4U72A 1BLXB 5KNHD 4LMKA 3SZ7A 4UXNB 3RI5A 5LA6E 5AQTB 2LXMA 4O8SA 4K5CA 2E0IA 3ZMTB 3RYHE 4V3IA 2FJDA 3ZMSB 3NWIA 5CA1E 4U7EB 5KCMA 4UVAB 2WU2A 2V0PA 5FINA 2LKHA 4CGWA 4AIFA 4J8YA 4WZXA 2XSAA 3LXUX 1UN9A 5ENRD 2KINB 3D9JA 4DBQA 3P1UA 3HI2A 2MYOA 5KJLA 2XQ6A 2WWVA 2Y0BG 3LYAA 4H7YA 3E08A 3DSXA 2X68A 3R9AB 5G05J 3AAIA 5ETWA 4F53A 2WMOA 4ERRA 3ZEFB 2XZTG 4B3TT 2FBNA 4M1PA 2IEJA 2L9BA 3C4WA 2P9LG 2WZHA 3FH7A 4RG9A 1US7B 2LAHA 3UFEA 1NAFA 1DU2A 4GKKT 2ZISA 4JUYA 2C2LA 4PUCA 2DCFA 3L8RA 3WG7E 1Z8UA 4H63V 4CXWA 4EZHA 1YXRA 3RJVA 5AQKB 3CIAA 2FULA 4DI3A 5KWDA 3L17A 2CXDA 3ONKA 3U78A 4I43B 2LNIA 2F37A 3NRXA 4J6IA 5JDLA 4AI6A 5FQ7A 2YU1A 3CV0A 4TXQA 3L13A 3UM1A 5LG4A 1T72A 4CDRA 3AEGA 4JV5T 1KF6A 4HFBA 1HU3A 3Q9NC 3ULEG 4EYYR 5E75A 4M3OA 2ZM0A 4LNBA 2C5JA 3T9KA 3L22A 4XI9A 4UWGA 3T5VA 3RYFE 4BX8A 4EEBA 4GA2A 3CHMA 3PREA 3JQ1A 3AE4A 2H6FA 2VVSA 3JXIA 4Q94A 5EK2A 4ANJA 4PH4B 5HEGA 2L0TB 2CM0A 3ISMC 2ZXWE 5HXSA 4N78D 3NF1A 4JL0A 3QNUA 5CBNA 4P29A 5LGTB 3PTRB 4GOUA 1ZHCA 2VKDA 5LP6E 4DV2T 3AJIA 5LCWC 5L4EA 5IWAT 3AEAA 5E0OA 2AXZA 2KXPB 3D0TA 3AXJB 3K8PC 4Z68A 3QB5K 1UJJA 3FBLA 2I1KA 2CHXA 3MZKB 2LSKA 4A3TA 5FQ8A 2NW7A 4NXNT 3HYMB 4CI2B 3IEGA 3LG7A 1KNZA 1UN8A 3FZHB 5DJQC 2J08A 4TNVA 3AEEA 5HWXA 1IXVA 1YQ4A 2WXNA 3SFYA 1YMPA 4DO0A 2ZGDA 4LCTA 3DSVA 2XM2A 4A98A 2V26A 1EPUA 2DBAA 2XPYA 4YTPA 4Q25A 5LXTE 2B1EA 2YHEA 4JHRA 1OXZA 1WY6A 3SFZA 4URKA 3LSVA 2VGYA 4MRUA 4B93B 4FP7A 3KFWX 1D8DA 5LHHB 3V5UA 5FTPA 5EN5D 5BR8T 5ENTD 4ACKA 4FLBA 2GROB 2Y69E 3EUVA 3ETVA 3FZKB 4FA6A 5CEAA 3S4UA 4AKGA 4N2SA 4GTVA 3HRAA 2X0LB 3FU5A 4DMVA 3MKQB 3W9FA 3OYXA 4YHHT 2QA7A 5G04C 2L6BA 2WQHA 3EHNA 3LEWA 4C91A 2V6YB 3FZLB 4HI9A 4BX9A 3IXEA 3I1AA 5KNGA 2J4GA 3IV0A 3TG4A 2WXIA 3KBTA 3GYZA 3NZPA 4Q96A 4TZ4C 3IBEA 1SZ9A 1MX6A 4N39A 4PAGA 4AEZC 1N0QA 5IYZE 5JTGA 4HXIA 1IAPA 4O60A 3N2GE 1EZ3A 1JPLA 3ULYA 5KJNA 3PDYA 3AA0B 1QLBA 3SFDA 3CK9A 3Q2MA 2MTQA 2BG9B 4JI0T 2CHWA 1MIWA 2VGXB 5FXZA 3TWXA 1U2VG 3UTMA 3H3AA 3CK6A 4TWFA 3T8KA 3JQ0A 3K3NA 2OV8A 5EILA 4U96D 3KBUA 3KSQA 4LMJA 4A55A 4CCAA 1UURA 5AAOA 4G8KA 1FMWA 1TNYA 1L0VA 1UK5A 3EIQC 4TX5A 3U64A 3D9HA 3ZPOA 2W61A 3ZN1B 2HYZA 1EYHA 4UI9J 1U5PA 3CIRA 3P50A 3FB2A 5C8YE 2VSXE 2XCBA 1QYMA 2N9DA 3FULA 3MKDA 3ZHEB 4CN4A 5AJLA 2XGMA 2KMFA 4M7CA 3MGBA 1N95A 5FXXA 5JMND 4K5AB 3DWLG 4IDQA 4JA7A 3ZW3A 2YHCA 3DJBA 4HFVA 2JIWA 1VCSA 2CFZA 1N32T 5CRUA 3P4SA 5KJKA 2IC9A 2R02A 4UEMA 1HF8A 1VOMA 3D9LA 3FWVA 2V7MA 3CMLA 3PURA 4A1GA 3UPVA 3AE8A 3AA7B 4QQIA 1JNRA 3TGOA 4L9PA 3J9X1 4GZ3A 2WWUA 3FHEA 3AXJA 2R6GF 2V4HC 1S94A 2LLYA 5LBQB 2XHEB 4AKHA 4JD2G 2FEZA 3B95A 3BQIA 4DNDA 5CA0E 5KBAA 2DLRA 2NR4A 3UQ7A 2N1GA 2CBIA 3KD7A 1I94T 1N9AA 5EZYE 3V5SA 4KMCA 4FJYA 4EZJA 3APFA 4EXTA 5JHAA 5CECB 4E7ZA 3PZ1A 3C4XA 4IE4A 1Z3XA 4YT0A 1YKHB 5ITZF 3KINB 3QC9A 2CG2A 4DR3T 2B76A 3D3MA 5DABA 4X8QA 4HTEA 5LHIB 4TXRA 4G1TA 1NL4A 4GZ6A 3L54A 3JADA 1Z0PA 2P9BA 3AE3A 2WXGA 3UU5A 2D5UA 4LF7T 2DL1A 3I9WA 4LRZA 1MMDA 4J8EA 3DP7A 5CCLA 2RFMA 2LXLA 1UW4B 2HE0A 1D9SA 4WUYA 4N5CA 5HEOA 4EV6A 2L6JA 1GW6A 1N4RA 4AM9A 3PDNA 4ZHBA 1WM5A 2VSOE 3I0OA 3KV9A 4A56A 1SVXA 4GTMA 2XUEA 4HWFA 3ASNE 1IHBA 4I43A 4DR7T 5AQNB 5FVKA 5CRVA 5LFAA 4PW8A 4U8VD 3P4QA 3L3PA 4JEHA 5AQRB 1U3DA 2YOEA 1JWGA 2OVFA 3ZCJA 2V7JA 1N94A 1OWPA 1KZOA 2OVBA 3TXMA 3FEXA 5ENPD 1DVPA 2HM8A 3JUEA 4Q69A 4I0UA 1YQ3A 2IHR1 3RIFA 2CLYC 3CSTA 2WB5A 4IREA 4U0ZA 5DIZA 4CT0A 4AIUA 1V54E 3ASDA 1JCQA 1NA0A 2GRMA 3FEYA 1MQSA 4H9NC 4KX6A 4DLQA 3MACA 4YDOA 2K9AA 3N9LA 2LSIA 2W4XA 4QH1A 2OOEA 3RQWA 4P0BA 4XIFA 1XZYA 5JR9A 3UINC 5JQGE 5ABFB 5A6CA 1XDPA 3PUKA 3EHMA 4DLOA 2IMLA 3APCA 1D1CA 4J8SA 4XZCA 1O3XA 3UX4A 2UXDT 4HRNA 2KCVA 4JI6T 2LSVA 3AEDA 4CDNA 1H2TC 4NIQA 4JI7T 3Q7FA 3UM0A 2WXJA 3KSLA 1CHUA 2C5IT 2WXPA 2I6HA 4DV5T 1M7KA 4LFBT 2VTBB 4WNFA 5A23A 4PJJA 1KFYA 4GYWA 1WG0A 3ABKE 4HB5A 1XNFA 2OV9A 3QK0A 4B0ZA 3OTNA 5ANLA 3J7Yq 4WYVA 4DR5T 4GMRA 1TYQG 4HQDA 3KS2A 4ZI3C 3S7DA 3SBSA 3VLFA 2V5FA 5ARGA 3CX8B 2CXLA 5F3JA 4DUZT 3UKUG 4ADZA 2IIUA 2XEEA 1J5WA 1UCUA 1E90A 3EU5A 2K48A 3URZA 2BKGA 5EDSA 5HXCA 5L47A 1ZU2A 2C0MA 2D0TA 4CXYA 3ANWB 4O2BE 3KAEA 2EIJE 2BBHA 3TLWA 4ZI7E 3FTSA 1J1JA 2Z6EA 2A3DA 2GRLA 2XPIA 3OXFA 3ZYQA 4LNGA 2CPTA 4H9QC 5J2UE 3JXJA 1SA0E 2PBIA 3T1YT 5EX3A 4X64T 3EJNA 2X9XA 4YDWA 1LVKA 5ABEA 3R7QA 1OCOE 1K3ZD 1QSDA 2J09A 5JHBA 3Q4AB 3L09A 1H6PA 3TWVA 1N4PA 5HS0A 3UQ3A 1MJ0A 3FU3A 3B7RL 3RAUA 4U3CA 4JC8A 2BKPA 3ESKA 3CVNA 2RA1A 4IULA 4DV0T 4LEUA 3CHQA 3CHSA 2L9QA 3FTWA 4JI8T 1ZOYA 2PL2A 5AQOB 2KLQA 4KI0F 3ML9A 1BU9A 4JI4T 4RLYA 1G3NB 4PS8A 5F5WA 4E7SA 3VKHA 4HOUA 2IAKA 5LYJE 5LX8A 3IA3A 3ONJA 4L1BA 1JNZA 3F57A 1KZPA 3JCKC 3KV5A 2E2EA 3BUAA 3E34A 4C0EA 5JDHA 2NSZA 4CN6A 4FHJA 3LY9A 3GZSA 3K3QC 4K0KT 1BPOA 3O1HA 3EHQA 3U4TA 3NAWA 2KBXA 5FZQA 1UJKA 5EK3A 2QC9A 3RX6A 3FP3A 4AISA 3MX3A 3ABLE 2D9DA 2GGFA 4OK0A 1OWMA 3L6AA 4BSXA 3BK9A 4J2CA 5FWQA 2CLYB 1IBKT 1BI7B 3ONLA 3RC8A 4HNAD 4IHJE 4LF5T 2OLTA 3RKOA 3ZCIA 4JPSA 3PNLB 4WNKA 3T1HT 3AE6A 2XRZA 5FMNA 1MX4A 5HCJA 3CHRA 4FJZA 2CHZA 4EIWA 2ZM8A 1HNWT 3NB2A 2QVAA 2E8IA 3VR8A 1FCHA 3K3OA 5FZSA 3AE2A 4UELA 1HXIA 2DWKA 3E37A 4CGVA 3ML8A 3V30A 4F1SA 4XI0A 4B89A 4IIJE 4NQ0A 2DI4A 4HOTA 1FEWA 4DX6D 4JEUB 2EHOC 2ZMAA 1E7UA 2VQ2A 3VLDA 4ILHB 5HQ8A 3LDQB 1KEYA 4ZI3D 1IBMT 1HR0T 2AJAA 3LS8A 2HN1A 2X51A 1MIVA 5KXJA 2J4DA 3FTUA 1DNPA 1H0AA 3UIOC 1E7PA 1N11A 4H9RC 5BV1A 4ANVA 4U7YA 3ZN3A 1HS7A 2LSGA 2XQYA 2PG8A 2M67A 3NBXX 3P4WA 3PUAA 2LM9A 3KV4A 4DK5A 4EGWA 4DUYT 4TUMA 2MPKA 3TAXA 4GU5A 3AVRA 4C90A 3N5LA 5H7PA 1S70B 4CYMD 3NZSA 3FXEB 4LF8T 1N52A 4AKRB 4Y6CA 4CI3B 4CT4A 1TN7A 3HVEA 3CX7B 5JDGA 1IHGA 1H7CA 3CVLA 4UVBB 4OHFA 1MIYA 4WNDA 1Z6TA 3G2UA 3CKBA 4UWHA 2ACXA 3CQXC 3GN5A 3EUHA 4O4JE 4EB6E 2XQ7A 2XAHB 4X20E 3DSWA 5LCYA 2PTFA 4FHKA 2ZIRA 4GAAA 3OJAA 5C1DA 5HRYA 1NENA 4H7XA 4TV8E 4O2AE 3NBNB 3SS1A 4L7TA 4GTSA 3RIAA 5HEJA 2AE9A 3R6NA 3TWUA 1YCSB 5C2TA 3FTXA 4L0RA 3UM2A 2D0UA 4IL9A 4UF0B 1IQUA 4UQZA 3PUZF 3PEVB 2YQ8A 2KWHA 5BUZA 2WB2A 1ELKA 4JA9A 3H37A 4HN9A 4A1SA 1LTXA 4GMJA 4ANXA 3U3IA 4GIWA 2ILRA 4XE0A 3D9OA 2K24A 1Y6IA 1UOHA 3UXGA 2KZ7B 3ZN0B 3PUVF 3CHOA 3RRWA 3KV6A 4X1KE 5LCWJ 4U2ZA 5AARA 1O1SA 1HG5A 4K5BA 1ZBPA 3QARA 4BERA 3RGLA 2EILE 4I1AA 4DV1T 2FO1E 3ZT7A 3AECA 3L08A 4JEUA 4OYSA 4I9EA 4EQFA 4EYUA 4APOA 2UUCT 2FF4A 3SWHA 3FTZA 4AKLA 3FUNA 5CMYA 2DHRA 3LPZA 3ESLA 4IRUA 2WBLA 4YXDA 4O1PA 5LOZA 4FC8A 1SUMB 2LKGA 2DVWA 2PZIA 3OXLA 2KC7A 2CCQA 2EQXA 4WNGA 4ANUA 5CJ5A 4DX1A 3AG4E 3MK7C 3OYZA 3CVQA 4AJWA 2BVLA 5AQ9A 4LNUD 2WDQA 4N3CA 2Y3AA 4IE0A 3FU0A 1OEDA 5G04J 1E8ZA 1HCIA 3UT4A 2P9SG 1W0BA 1E8XA 3ASFA 5AIJA 2XQ4A 1YYHA 3G2SA 4GA0A 4U8YD 1BR1A 3MJWA 1OWNA 5H6QB 2V1DB 3K9IA 3DEOA 5M72A 1ZB1A 3OXGA 1S63A 5JREA 2HO1A 1X9BA 3DPYA 2XENA 5FP3A 5M4YA 5IHYA 5FZRA 4NPPA 1XMOT 3GW4A 3IKOB 4JHKA 3ZHEA 3ZKRA 2XZDG 4G11A 4KHZF 5CB4E 4HORA 2EIME 1HX8A 2XAQB 3EHZA 4NUVA 1YW0A 1KK7A 4I4TE 4MS6A 3MXZA 4ISTA 2CWYA 4B6XA 3DRAA 1QNFA 4EBAA 2C0SA 2KWIB 2ZM6T 4GTOA 3AG3E 3FBZA 3UI2A 3P7IA 1OXJA 1HTJF 4MBQA 1NEKA 3E4BA 3ZMZB 1MMNA 2MAWA 4IN3B 3RO2A 2BZBA 3BQKA 4P09A 2Q7FA 2I0MA 2N2NA 2Q9QA 4NURA 5FYMA 2BG9A 4I50E 2NXPA 2ZU6B 1ELRA 3PUYF 2WU5A 4AY6A 2V6XA 2EHOB 3SHFA 4TUUA 3TLUA 4B3MT 4YDYA 1ZEEA 2XTLA 5D2MC 2QYUA 4GYRA 2I2OA 2XASB 5AQUB 2BUGA 2L0IA 5B1BE 2P2CP 3TKLB 1OY3D 2CG3A 4KVMA 4QH4A 3FH8A 1WFDA 4P0AA 1FT2A 2E2AA 4TNWA 3MKQA 5T8IA 3QNKA 4HWIB 2XJ7A 3ULQA 1E8YA 4BESA 2M6BA 3ANWA 4C0MA 2VK9A 5KMGP 3FZMB 4EBAG 1K8KG 3E30A 4NXMT 1WAO1 2VWAA 4A5XA 2L3LA 5G55A 2GRPB 4IE6A 4EZ4A 5FL1A 4J8FA 2PM7A 4GCOA 4AXPA 5IY5E 4ZI2D 1DCQA 3P8CD 5AQPB 2JQKA 2Y6XA 1JCSA 2DYRE 3B7TA 3LY8A 4GYYA 4FLHA 1NFIE 4BSZB 3HR0A 4QFVA 5L2LA 2XQ8A 4COFA 1R8IA 4V1Av 2DWZA 3FUKA 1PAQA 3PZ4A 3FUIA 4PJNA 4LUNU 3SQVA 2XS1A 5HI7A 4PK6A 4BJMA 3FU6A 4HEAA 2F8XK 4HS2A 1DCEA 1IJ5A 4FU3A 4PDXA 4ILBA 4BJNA 3RU0A 3LBXB 2YEVC 4CDMA 2IY0C 2LEHA 3E0ZA 1SA4A 3ENEA 4L5GA 4EECA 3HXFA 5AYWD 2MOWA 3C72A 5D0QD 2LAIA 4BWRA 3ZJ1A 4DRXE 5CCMA
chains in the Genus database with same CATH topology
1MNDA 3RRMB 5LGUB 3U66A 4EOZB 5JR9B 2HPJA 1MMGA 1YD8G 2HR2A 3ASGA 2R17C 4O6FA 1N54A 2XGOA 3CKDA 1MHQA 3QC1A 5HXEA 4O4HE 3ZLIA 4AP2A 4PJMA 4ME2A 4UWKA 4IYPA 2LSUA 4HKAA 2LJLA 4QXBB 4PS7A 3OBVE 4AXHA 3JC6D 5AJDA 2V4LA 3QWVA 4JEHB 3IEEA 4F7AA 4H63H 2JJ9A 4I55E 3C64A 2XQ0A 3CWZB 5CHEE 4OYJA 2VKHA 4AV7A 4ANWA 4G2VA 3ZEFA 4O4IE 3QJZA 2IOSA 3LK2B 3KVAA 3IF8B 3O48A 5FY1A 5E76A 1D0ZA 4AQFC 3ETUA 2R5SA 3PEUB 1QQEA 4K0RA 4I17A 4WW0A 4WWNA 3CHPA 5BPPA 3BG0B 4ILIA 2NW9A 2WQ7A 3PRZA 4YJ2E 2YK0A 4YLHA 3F31A 4KVOA 2I59A 1PY1A 3HIZA 4I2WA 1Y64B 4FI5A 3RRUA 4GB9A 2D2SA 3EDUA 3AVSA 3LCAA 4N3AA 3GMIA 3MYVA 4E85A 3I5PA 4I6GA 4KBQA 2JEKA 1LKXA 4RG6A 3N71A 4GZDA 1WR6A 5L3BB 2SPCA 2VSYA 4JZYA 4UIGA 1E96B 1KT0A 4JXTA 4NUUA 3PZDA 3CR3A 3SOLA 3RYCE 4RVBA 2VKJA 4IDZA 2K5BB 3HA4A 4W9RA 4QXHB 3SD5A 3HKCE 5A1LA 1A17A 3HKDE 2UY1A 3EIJA 3FHNA 1FIOA 2WSSV 2AXVA 2XPZA 1S0PA 4UWLA 1KLXA 5H6RB 2LHRA 1WRDA 3LK3B 3CVVA 2PQNA 5JDQA 1HE8A 5FT9A 4CEMA 4G26A 4BT9A 4UI9C 2EHOA 3QOUA 2XCCA 1FVFA 1X5BA 2I9CA 4WWOA 2NWBA 4B8AA 3GZ2A 3GA8A 3MA5A 2X6JA 3VKGA 4FULA 3LJ3A 3IHYA 3CVXA 2JPFA 2CEAA 4PK4A 5DQVA 2LOPA 4UI9K 2ODUA 3MA9A 2KCLA 1HFAA 3CVYA 4U74A 2AXUA 4CZZB 2IU1A 4G24A 3I9YA 3BG1B 3BEEA 5JJ7A 3CKCA 2X6KA 3FH5A 3G2TA 5KDMC 3CVUA 2WM9A 4ISSA 2VASA 4KBMB 4AKIA 2XGSA 3FUMA 3N9QA 3T8OA 2UWJG 3FTVA 2YU2A 4WBNE 4BTBA 2JQQA 5L3DB 2IQCA 2V7KA 3RKVA 3D9IA 4A3VA 1OWAA 3CPZA 3CVRA 4UWFA 4KMOA 3P2BA 4X1IE 5JVDE 2EHOD 3MKRA 4GYOA 5LP0A 5JDMA 1L5JA 4XKCA 1IQRA 3UUXA 3B57A 3AS5A 3SF4A 1VDYA 3AU5A 4ASKA 5J2TE 3QB2A 1W3BA 4PFPA 4KT6B 4U07A 5ANRA 2IF4A 4CQIA 4MALA 3T8MA 4QX7B 3RH3A 4KXKB 2Y4UA 1UX5A 4PJLA 5BT1A 2A2FX 3WXXA 3S7JA 5HXRA 3OAWA 2JMHA 4BY6A 4BAYB 3VTXA 4HGAA 4X1YE 5J90A 1YKEB 2WXLA 4PK5A 3AU4A 3FUHA 1MNEA 4DBRA 3CSFA 2G0UA 1JUQA 3O4ZA 1ZV4X 1D0YA 2XRYA 4U8HA 3UUMA 3AAEB 2VL8A 4QX8B 2WAUA 3LK42 3Q5XA 3ZYLA 3VU7H 4H9SE 2J49A 4YVOA 1CUNA 4TV9E 5ENNA 5LNKA 3LY7A 3ZVVA 3D9KA 4MFRA 2JRKA 2WPVA 3MJXA 2WXRA 3EDVA 3AA6B 3C51A 2WXHA 2BDEA 3CQGB 3NZUA 2C0LA 2ZLYA 3DTOA 3D9MA 5A7DB 4H9PC 4IGUA 2E9XB 4UVCB 5AFUL 4I2ZA 3I3NA 2J9QA 2AWIA 3QK6A 3ZC1A 4I1MA 4XAXB 4I9CA 2A72A 3HKBE 2UXXB 4I1OB 4GA1A 3UMVA 2V8SE 1H6KA 4EZKA 5L3EB 3ZC0A 4H9OC 5GONE 2NP9A 3ZMVB 1KT1A 2JMKA 4HE8A 1V9DA 4HLEA 3Q5WA 4E6HA 1D1AA 4B94A 2DNXA 4U0SA 5JRCA 4WBOA 4ZHQE 2KCKA 4YJ3E 4K0UA 1E7VA 1HO8A 3ASHA 5BV0A 4O4LE 4I6EA 3W15B 4DPRA 4BT8A 2UY1B 4B8CB 5BNWA 2KT9A 2IC6A 3CQCB 3DBSA 4ILGA 2I1JA 4MLPA 3WI3A 5FNVE 2PJQA 2A5UA 4F3VA 2M63A 3O1IA 4BA9A 5FQ6A 4ZS3A 5D0OD 2VB6A 1PC2A 3PU8A 5BW8C 2XAJB 3N2OA 4WAFA 4AY5A 2PFVA 1X79A 1NWMX 3AS4A 3R84B 3MZLB 2QGSA 2JLBA 2X9WA 1BR2A 1E1HB 5HAXA 1SZAA 2W0GA 3UT7A 3RRNB 1FMVA 2H7VC 2AW6A 1YA0A 4ZS2A 5J08A 3N9OA 3IHRA 1FVHA 3PUJA 3LVQE 1HG2A 3GZ1A 1WYBA 3KEZA 2MOZA 2L8KA 5CMWA 4L2LA 2P58C 5T4YA 3LKUA 5L3CB 3F2EA 3I4GA 4L2YA 3I4RB 2E9XD 4IE7A 2IJGX 4OVUA 5JJ6A 4XX5A 3G2VA 2MYSA 3B7UX 2CE7A 1ZKEA 3ZYKA 4CRWA 3MEKA 5LHGB 3ZMUB 4ILUA 3SI5A 2KZTB 3D9PA 3Q5MA 4KZCA 1VRBA 3U9WA 3O1JA 4GZCA 2H3RA 3ZIMA 2CFUA 1HS6A 1B7TA 4AQGA 3FXDB 3NRYA 2IOLA 4U04A 1NA3A 4TUYE 3UULA 3D9NA 1SHZC 2GK9A 4UQYA 2LO6A 1G73A 2R59A 1H19A 3TJPA 2ES0A 4GK0E 3NZQA 2LOSA 5LOVE 3CLJA 5JR9C 3ZRHA 4GK5E 2XAGB 4EAHA 3OKQA 2VTBA 3IBPA 2CA5A 4NACA 3LBXA 3FDHA 3N9PA 3ZJ2A 4OVVA 2V7LA 3PUQA 4YNDA 3PH0C 3HL6A 3HKEE 3LVRE 5JDNA 4HOQA 3RIBA 4WWPA 3SGHA 3CK8A 1INZA 1HH8A 2J07A 4R7LA 2W62A 4Z8XA 3PE0A 1OWLA 3UT5E 4QKNA 2XEVA 4KUMB 3TL5A 2LSYA 4L9IA 3ZXSA 3QDNA 4JVSA 4KZ0A 2NTXA 2HPLA 4XZ4A 3CX6B 3BQLA 3UTKA 5JJTA 3C98A 5KJMA 4HOSA 2NC9A 3RYIE 4PNIA 3QUJA 2YINA 4QXCB 2X6HA 1NP7A 3WAJA 2KZTA 3RPUA 4UV9B 2WXQA 1QUUA 3PUGA 2MRIA 3QWWA 3U3WA 1WLXA 3RRCA 2XAFB 3AB3B 5FY0A 4GCNA 3RK6A 5TAOA 2A4ZA 2IW5B 2BVMA 4EPZA 2Q9QB 5HWYA 1EF1C 1G8XA 3Q15A 3WAKA 5LJNA 3SBTB 2IONA 4PFOA 4G25A 3GWHA 2J1DG 3SRZA 4CXXA 2NW8A 2ZM2A 2FI7A 1D1BA 2LE8A 3PE4A 3VLEA 4RSYA 1BR4A 3JC6C 4F6RC 4YHJA 2BF0X 5FQ4A 3E22E 3M65A 2CWOA 4QWNB 2X9YA 1UX4A 4J0UA 1H2UA 1UG3A 2DIWA 2E9XC 4L23A 2VJ8A 3ZGQA 2YNQA 4UV8B 4AQFA 5LGNB 2NOXA 3CK7A 2XHEA 1SQMA 3S7BA 3KDSE 2GW1A 4JW1A 4BFRA 3ONXA 2LSJA 2WXKA 5J1GA 3FY4A 2PM6A 3AAAB 3CEQA 4N3BA 2VKOA 2X9HA 3O9XA 2LT3A 1MMAA 1B89A 3B13A 4U63A 1TJCA 5LBMA 3FUJA 5EX0A 5G05C 3N2KE 3UUNA 1E8WA 4NRHB 4HFGA 2X6FA 4I6JA 3T5XA 2VSNA 2RD0A 4C9BB 5L3GB 2NTYA 3AA1B 1T98A 3L16A 2X6IA 1IZNB 5HYAA 1JWFA 3FUEA 4AVXA 5JRCB 2MHKA 5AENA 2X38A 4FJOA 2X66A 4APFA 1AJ3A 3LFMA 2OA5A 1IJ6A 4XBFB 1LF8A 2VGXA 3HDXA 4GPKA 2X67A 2C5KT 3RO3A 4J8DA 2PQRA 3MV3B 5ADXL 3DPDA 4UF0A 5BMVE 1S35A 3VTYA 2W00A 2E9XA 2CXFA 3NQPA 5FY7A 3EDTB 3JYSA 1P5QA 3O4XE 5EK4A 3GN5B 3CVWA 1H2VC 3C98B 4AOFA 5KX5E 3AS8A 5G2NA 2QY7A 3IHVA 4CI1B 3PU3A 3LDZA 2Y8DA 4UQXA 2WXFA 5EKQD 1IYGA 1U4QA 2ONDA 3ZFWA 3FUFA 3MCXA 3HVEB 4EZLA 1OWOA 2AVPA 3Q49B 2KATA 1Y8MA 4U0UA 4MKTA 2BTDA 4ATGA 4N2QA 3N9MA 1OUVA 3KVBA 5C2YA 2WMNA 1BR0A 5FXWA 1WYCA 4TN7B 1QZ2A 5F8PA 4GYSA 4TRQA 4JHJA 3B7SA 3PE3A 3N9NA 3RC3A 3ZPJA 3QWPA 4GMLA 2DWGA 3S2AA 1D0XA 2LHNA 2DCPA 3FUDA 2IFUA 2WXOA 4Y6WA 4KYOB 4K03A 5DBKA 1Z3YA 2UXNB 3QKYA 3EVYA 3UUXB 1HZ4A 3FTYA 4YVQC 4ZI2C 4ABNA 4DI4A 2KNDA 2QFCA 3CVPA 4G23A 4FADA 4OFZA 3I0QA 3C50A 3TG5A 2RG8A 1TEZA 2VYIA 5HXHA 3ZYMA 5T3RA 3R7RA 5JDFA 2MBGA 1LRZA 3TXNA 3PNTB 3PUSA 1EDUA 5L3FB 4PS3A 4DMWA 1NZNA 3A5XA 3G2WA 2V7IA 4KP3C 3JUIA 3PS6A 2FO7A 2WVIA 5FXVA 4LERA 4DVDA 2J4BA 4G63A 1TJFA 4ACLA 4HVBA 3QAQA 4WNEA 4QHOA 4MLKA 4OYKA 3C4ZA 2Q9QC 3PVLA 4TV3A 5LJMA 4DJAA 4BTAA 3UT8A 4D10C 2KM4A 1XGWA 3HHMA 3CGHA 4IE5A 3Q47B 5JH7E 3MV2B 4GZ5A 4ZOLE 5ARFA 3Q9DA 5FJYA 2X3MA 2ODVA 3APDA 3FFLA 1U3CA 4G2AA 2Q9QD 2HH7A 2H7OA 2WQ6A 2Y48B 4JLEA 4YFSA 3S7FA 2RP4A 1ELWA 2WXMA 3SNXA 4MHCA 2Y4TA 2CMRA 3VHLA 2W63A 3LJCA 5DQWA 4XKBA 1LVFA 4U72A 3SZ7A 4UXNB 5LA6E 4O8SA 2E0IA 3ZMTB 3RYHE 4V3IA 3ZMSB 5CA1E 5KCMA 4UVAB 2V0PA 4CGWA 4AIFA 3LXUX 1UN9A 2KINB 3D9JA 4DBQA 3P1UA 3HI2A 5KJLA 3LYAA 4H7YA 3E08A 2X68A 3R9AB 5G05J 3AAIA 5ETWA 4F53A 2WMOA 4ERRA 3ZEFB 2FBNA 4M1PA 2L9BA 3C4WA 3FH7A 4RG9A 1US7B 2LAHA 3UFEA 1NAFA 4JUYA 2C2LA 4PUCA 2DCFA 4H63V 4CXWA 4EZHA 3RJVA 3CIAA 2FULA 4DI3A 3L17A 2CXDA 3ONKA 3U78A 4I43B 2LNIA 3NRXA 4J6IA 5JDLA 4AI6A 5FQ7A 2YU1A 3CV0A 3L13A 5LG4A 4CDRA 1HU3A 4EYYR 5E75A 4M3OA 2ZM0A 2C5JA 3L22A 4XI9A 4UWGA 3T5VA 3RYFE 4BX8A 4GA2A 3CHMA 3PREA 3JQ1A 4Q94A 5EK2A 4ANJA 4PH4B 2L0TB 2CM0A 5HXSA 4N78D 3NF1A 4JL0A 4P29A 5LGTB 3PTRB 4GOUA 1ZHCA 2VKDA 5LP6E 5LCWC 5E0OA 2AXZA 2KXPB 3D0TA 3K8PC 1UJJA 3FBLA 2I1KA 2CHXA 3MZKB 2LSKA 4A3TA 5FQ8A 2NW7A 3HYMB 4CI2B 3IEGA 3LG7A 1KNZA 1UN8A 5DJQC 2J08A 5HWXA 2WXNA 4LCTA 4DO0A 2V26A 1EPUA 2DBAA 2XPYA 4JHRA 5LXTE 2B1EA 2YHEA 1OXZA 1WY6A 3SFZA 4URKA 2VGYA 4MRUA 4FP7A 3KFWX 5LHHB 3V5UA 5FTPA 4ACKA 4FLBA 3ETVA 4FA6A 3S4UA 4AKGA 4N2SA 2X0LB 3FU5A 4DMVA 3MKQB 3OYXA 2QA7A 5G04C 2WQHA 3EHNA 3LEWA 4C91A 4BX9A 3I1AA 3TG4A 3IV0A 2WXIA 3KBTA 3GYZA 3NZPA 4Q96A 4TZ4C 3IBEA 1SZ9A 4N39A 4PAGA 4AEZC 5IYZE 4HXIA 1IAPA 3N2GE 1EZ3A 1JPLA 5KJNA 3PDYA 3AA0B 3CK9A 3Q2MA 2MTQA 2CHWA 1MIWA 2VGXB 5FXZA 3H3AA 3JQ0A 3K3NA 2OV8A 3KBUA 4CCAA 4A55A 1FMWA 3EIQC 4TX5A 3U64A 3ZPOA 2W61A 3ZN1B 2HYZA 1EYHA 4UI9J 1U5PA 3FB2A 5C8YE 2VSXE 2XCBA 2N9DA 3FULA 3MKDA 3ZHEB 5AJLA 2XGMA 2KMFA 3MGBA 5FXXA 4JA7A 3ZW3A 2YHCA 3DJBA 4HFVA 2CFZA 5KJKA 2IC9A 4UEMA 1HF8A 3FWVA 1VOMA 3D9LA 2V7MA 3CMLA 3PURA 4A1GA 3UPVA 3AA7B 3TGOA 3J9X1 4GZ3A 2WWUA 3FHEA 1S94A 5LBQB 2XHEB 4AKHA 2FEZA 3BQIA 4DNDA 5CA0E 2DLRA 3KD7A 2N1GA 5EZYE 3V5SA 4KMCA 4FJYA 4EZJA 3APFA 4EXTA 5JHAA 4E7ZA 3C4XA 4IE4A 1Z3XA 1YKHB 3KINB 3QC9A 2CG2A 3D3MA 5DABA 4HTEA 5LHIB 4G1TA 4GZ6A 3L54A 1Z0PA 2P9BA 2WXGA 2D5UA 3I9WA 4LRZA 1MMDA 4J8EA 3DP7A 5CCLA 1UW4B 4WUYA 4N5CA 2L6JA 1GW6A 4AM9A 3PDNA 1WM5A 2VSOE 3I0OA 3KV9A 4A56A 2XUEA 4I43A 5LFAA 4PW8A 3L3PA 4JEHA 1U3DA 1JWGA 2OVFA 3ZCJA 2V7JA 1OWPA 3TXMA 2OVBA 3FEXA 1DVPA 2HM8A 4Q69A 2CLYC 3CSTA 4U0ZA 5DIZA 4CT0A 3ASDA 1NA0A 2GRMA 3FEYA 1MQSA 4H9NC 4DLQA 3MACA 2K9AA 3N9LA 2LSIA 2OOEA 4P0BA 4XIFA 5JR9A 5JQGE 5A6CA 3PUKA 3EHMA 4DLOA 3APCA 1D1CA 4J8SA 4XZCA 1O3XA 3UX4A 2KCVA 2LSVA 4CDNA 1H2TC 2WXJA 2C5IT 2WXPA 2I6HA 2VTBB 4WNFA 5A23A 4PJJA 4GYWA 1XNFA 4B0ZA 3QK0A 3OTNA 5ANLA 3J7Yq 3KS2A 4ZI3C 3S7DA 3SBSA 3VLFA 2V5FA 5ARGA 3CX8B 2CXLA 5F3JA 4ADZA 1UCUA 1E90A 2K48A 3URZA 5EDSA 5HXCA 1ZU2A 2C0MA 2D0TA 4CXYA 3ANWB 4O2BE 3KAEA 4ZI7E 3FTSA 2Z6EA 2A3DA 2GRLA 2XPIA 3OXFA 3ZYQA 4H9QC 5J2UE 1SA0E 2PBIA 5EX3A 3EJNA 2X9XA 1LVKA 3R7QA 1QSDA 2J09A 5JHBA 3Q4AB 3L09A 3UQ3A 3FU3A 3B7RL 4JC8A 3ESKA 3CVNA 2RA1A 4IULA 4LEUA 3CHQA 3CHSA 2L9QA 3FTWA 2PL2A 3ML9A 2KLQA 4PS8A 4HOUA 3VKHA 4E7SA 2IAKA 5LYJE 5LX8A 4L1BA 3F57A 3JCKC 3KV5A 2E2EA 4C0EA 5JDHA 2NSZA 4FHJA 3LY9A 3GZSA 3K3QC 1BPOA 3O1HA 3U4TA 5FZQA 1UJKA 5EK3A 3RX6A 3FP3A 3MX3A 2GGFA 4OK0A 1OWMA 3L6AA 4BSXA 3BK9A 4J2CA 5FWQA 2CLYB 3ONLA 3RC8A 4IHJE 3RKOA 3ZCIA 4JPSA 3PNLB 4WNKA 2XRZA 5FMNA 3CHRA 4FJZA 2CHZA 4EIWA 2ZM8A 2E8IA 1FCHA 3K3OA 5FZSA 4UELA 1HXIA 2DWKA 4CGVA 3ML8A 4F1SA 4XI0A 4B89A 4IIJE 4NQ0A 2DI4A 4HOTA 1FEWA 4JEUB 2EHOC 2ZMAA 1E7UA 2VQ2A 3VLDA 4ILHB 5HQ8A 4ZI3D 3LS8A 2X51A 1MIVA 2J4DA 3FTUA 1DNPA 1H0AA 4H9RC 5BV1A 4ANVA 3ZN3A 1HS7A 2LSGA 2XQYA 2PG8A 2M67A 3NBXX 3PUAA 2LM9A 3KV4A 4DK5A 3TAXA 4GU5A 3AVRA 4C90A 3N5LA 3NZSA 3FXEB 1N52A 4AKRB 4Y6CA 4CI3B 4CT4A 3HVEA 3CX7B 5JDGA 1IHGA 1H7CA 3CVLA 4UVBB 4OHFA 1MIYA 4WNDA 1Z6TA 3G2UA 3CKBA 4UWHA 2ACXA 3CQXC 3GN5A 3EUHA 4O4JE 4EB6E 2XAHB 4X20E 5LCYA 4FHKA 4GAAA 3OJAA 5C1DA 4H7XA 4TV8E 4O2AE 3SS1A 4L7TA 3R6NA 3FTXA 4L0RA 2D0UA 4UF0B 1IQUA 4UQZA 3PEVB 2YQ8A 2KWHA 5BUZA 2WB2A 1ELKA 4JA9A 3H37A 4HN9A 4A1SA 4GMJA 4ANXA 3U3IA 4GIWA 2ILRA 4XE0A 3D9OA 2K24A 1Y6IA 2KZ7B 3ZN0B 3CHOA 3RRWA 3KV6A 4X1KE 5LCWJ 1HG5A 1ZBPA 3QARA 4I1AA 3L08A 4JEUA 4OYSA 4I9EA 4EQFA 4EYUA 4APOA 2FF4A 3SWHA 3FTZA 4AKLA 3FUNA 5CMYA 2DHRA 3LPZA 3ESLA 4IRUA 2WBLA 5LOZA 4FC8A 2PZIA 3OXLA 2KC7A 2CCQA 2EQXA 4WNGA 4ANUA 3MK7C 3OYZA 3CVQA 4AJWA 2BVLA 4N3CA 2Y3AA 4IE0A 3FU0A 5G04J 1E8ZA 1HCIA 3UT4A 1E8XA 3ASFA 5AIJA 3G2SA 4GA0A 1BR1A 3MJWA 1OWNA 5H6QB 3K9IA 2V1DB 5M72A 3OXGA 5JREA 2HO1A 5FP3A 5M4YA 5IHYA 5FZRA 3IKOB 3GW4A 4JHKA 3ZHEA 4G11A 5CB4E 4HORA 1HX8A 2XAQB 4NUVA 1YW0A 1KK7A 4I4TE 4MS6A 3MXZA 4ISTA 2CWYA 4B6XA 1QNFA 4EBAA 2C0SA 2KWIB 3FBZA 3P7IA 1HTJF 4MBQA 3E4BA 3ZMZB 1MMNA 4IN3B 3RO2A 2BZBA 3BQKA 4P09A 2Q7FA 2N2NA 2Q9QA 4NURA 5FYMA 4I50E 2NXPA 2ZU6B 1ELRA 4AY6A 2EHOB 3SHFA 4TUUA 1ZEEA 2XTLA 4GYRA 2I2OA 2XASB 2BUGA 2L0IA 3TKLB 2CG3A 4KVMA 3FH8A 4P0AA 3MKQA 5T8IA 3QNKA 3ULQA 1E8YA 3ANWA 4C0MA 2VK9A 5KMGP 4EBAG 1WAO1 2VWAA 2L3LA 5G55A 4IE6A 4EZ4A 4J8FA 4GCOA 2PM7A 4AXPA 4ZI2D 3P8CD 2Y6XA 3B7TA 3LY8A 4GYYA 4FLHA 3HR0A 4QFVA 5L2LA 4V1Av 3FUKA 1PAQA 3FUIA 4PJNA 4LUNU 5HI7A 4PK6A 4BJMA 3FU6A 4HEAA 4HS2A 1IJ5A 4FU3A 4PDXA 4BJNA 3RU0A 3LBXB 2YEVC 4CDMA 2LEHA 3E0ZA 3ENEA 4L5GA 4EECA 5AYWD 2MOWA 5D0QD 2LAIA 4BWRA 3ZJ1A 5CCMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WM9 A;  2WMO A;  3B13 A;  2YIN A;  3VHL A;  2WMN A; 
#chains in the Genus database with same CATH topology
 1MND A;  3RRM B;  5HKP A;  1N36 T;  5LGU B;  4ZZC A;  3U66 A;  4EOZ B;  5JR9 B;  2FJA A;  2HPJ A;  1MMG A;  1YD8 G;  2HR2 A;  3RIU A;  4UR9 A;  4YSX A;  3ASG A;  2R17 C;  4OAU C;  3L82 A;  4O6F A;  1N54 A;  2XGO A;  3CKD A;  1MHQ A;  3QC1 A;  5HXE A;  4Z91 A;  3V31 A;  4O4H E;  2IUB A;  3ZLI A;  4AP2 A;  4PJM A;  3Q78 A;  4ME2 A;  2BBJ A;  2QRX A;  3F6Q A;  4UWK A;  4IYP A;  2LSU A;  4HKA A;  2LJL A;  4QXB B;  4PS7 A;  3OBV E;  5CED B;  4ZZB A;  4AXH A;  3JC6 D;  5AJD A;  2V4L A;  5AQH B;  3QWV A;  4F8H A;  4JEH B;  3IEE A;  2FJB A;  4F7A A;  4H63 H;  2JJ9 A;  4I55 E;  3C64 A;  2XQ0 A;  3CWZ B;  3UU6 A;  4DUI A;  5CHE E;  4OYJ A;  2VKH A;  4AV7 A;  4ANW A;  1H6O A;  4G2V A;  3ZEF A;  4O4I E;  3QJZ A;  2R05 A;  2IOS A;  3PJA A;  3LK2 B;  3X1D A;  3KVA A;  3IF8 B;  3L39 A;  3O48 A;  2Y1L E;  5FY1 A;  5E76 A;  2R03 A;  1D0Z A;  4U95 D;  4CN1 A;  4AQF C;  3ETU A;  2R5S A;  3PEU B;  4HLL A;  1QQE A;  4ATZ D;  4K0R A;  4I17 A;  4WW0 A;  4WWN A;  3VRB A;  3RLF F;  3CHP A;  5BPP A;  4KHP T;  3BG0 B;  4ILI A;  2NW9 A;  2WQ7 A;  3PRZ A;  4YJ2 E;  1O5M A;  2YK0 A;  4YLH A;  3F31 A;  5HEU A;  4JBW F;  4KVO A;  2I59 A;  2VUR A;  1PY1 A;  3HIZ A;  3RKG A;  4I2W A;  2XQ5 A;  3X2Q E;  1Y64 B;  1DC2 A;  4FI5 A;  3RRU A;  3E33 A;  1OCR E;  2D2S A;  4GB9 A;  4A63 B;  1V55 E;  3EDU A;  3AVS A;  3LCA A;  4N3A A;  3GMI A;  3MYV A;  4E85 A;  4BET A;  3I5P A;  4X65 T;  4I6G A;  4XEI G;  4KBQ A;  2JEK A;  3TLV A;  1N33 T;  1LKX A;  4RG6 A;  3N71 A;  4GZD A;  5ENS D;  1WR6 A;  5L3B B;  2SPC A;  2VSY A;  2ZGG A;  4JZY A;  2BG9 C;  4UIG A;  2EIN E;  4BEP A;  1E96 B;  1KT0 A;  4JXT A;  4NUU A;  5IUX A;  1MZC A;  2OEW A;  3PZD A;  3CR3 A;  3SOL A;  3RYC E;  4LFA T;  4RVB A;  2VKJ A;  4IDZ A;  3V79 K;  2K5B B;  3HA4 A;  4W9R A;  4QXH B;  3SD5 A;  3HKC E;  5A1L A;  2ETA A;  1A17 A;  1SW6 A;  3HKD E;  2UY1 A;  3EIJ A;  3FHN A;  1FIO A;  5EYP F;  3C5R A;  1A5E A;  5EYL A;  2WZI A;  2WCA A;  1T8B A;  1I6Z A;  2WSS V;  2AXV A;  2XPZ A;  4MBG A;  2LM2 A;  3KEA A;  2UXB T;  1S0P A;  4UWL A;  1KLX A;  5H6R B;  4F1P A;  2AXD S;  2FBW A;  2LHR A;  1WRD A;  4DR1 T;  3LK3 B;  3CVV A;  2PQN A;  5JDQ A;  2GRR B;  1HE8 A;  5FT9 A;  4CEM A;  3Q73 A;  4G26 A;  4BT9 A;  4UI9 C;  2EHO A;  3QOU A;  2XCC A;  1FVF A;  3PJA J;  1X5B A;  5AQG B;  2I9C A;  2M6I A;  2BS3 A;  4WWO A;  2NWB A;  4B8A A;  3GZ2 A;  3GA8 A;  1Q2Z A;  3MA5 A;  1JCR A;  2X6J A;  3BQO A;  3VKG A;  4FUL A;  3LJ3 A;  4HFE A;  5FVL A;  1XWM A;  2RPA A;  3IHY A;  3CVX A;  2JPF A;  3C3O A;  2KSR A;  4TWH A;  2CEA A;  4IT4 A;  4PK4 A;  5DQV A;  2LOP A;  4UI9 K;  2ODU A;  3MA9 A;  2KCL A;  1HFA A;  4B3R T;  3CVY A;  4U74 A;  2AXU A;  5AQB A;  4CZZ B;  2IU1 A;  4G24 A;  3I9Y A;  3NVO A;  3BG1 B;  3BEE A;  5JJ7 A;  3CKC A;  4DX7 D;  2X6K A;  3FH5 A;  3ABM E;  5KDM C;  3G2T A;  3CVU A;  2WM9 A;  4ISS A;  2VAS A;  4KBM B;  4AKI A;  2XGS A;  2BKO A;  4IL4 A;  3FUM A;  3N9Q A;  3T8O A;  1TN8 A;  5HCM A;  2UWJ G;  3FTV A;  2YDS A;  1FJG T;  2YU2 A;  4WBN E;  1VCT A;  5ABH A;  4BTB A;  2JQQ A;  5L3D B;  1OED B;  2IQC A;  2V7K A;  3RKV A;  3D9I A;  4A3V A;  3EAB A;  1OWA A;  3CPZ A;  3CVR A;  4UWF A;  4KMO A;  3P2B A;  2V5D A;  4X1I E;  5JVD E;  5AQS B;  1SE7 A;  2VQF T;  2EHO D;  3MKR A;  4GYO A;  2BG9 E;  4EHM A;  5LP0 A;  5JDM A;  3SFX A;  4HFD A;  1L5J A;  2LRL A;  4XKC A;  1IQR A;  3UUX A;  3B57 A;  1X81 A;  3AS5 A;  3SF4 A;  3W9G A;  1VDY A;  3AU5 A;  4ASK A;  5J2T E;  4YSY A;  1SA5 A;  3QB2 A;  1QBQ A;  3ZST A;  4PFP A;  1W3B A;  4KT6 B;  3HXB A;  4U07 A;  2IF4 A;  5ANR A;  4CQI A;  4MAL A;  3T8M A;  4QX7 B;  3RH3 A;  4KXK B;  2Y4U A;  4B3S T;  1UX5 A;  4PJL A;  5BT1 A;  2A2F X;  3WXX A;  1HNZ T;  1RW2 A;  3S7J A;  5HXR A;  3OAW A;  2JMH A;  1BI8 B;  2BKK B;  3Q9U C;  4BY6 A;  3EU9 A;  2UUA T;  4BAY B;  3VTX A;  4HGA A;  2E5L T;  4X1Y E;  3DXK G;  5J90 A;  1YKE B;  2WS3 A;  2XQA A;  4PK5 A;  2WXL A;  3AU4 A;  3FUH A;  1MNE A;  4DBR A;  3CSF A;  2G0U A;  1JUQ A;  3O4Z A;  5FL0 A;  4YY3 T;  1ZV4 X;  1D0Y A;  2XRY A;  4U8H A;  3LJN A;  2OEV A;  3UUM A;  3AAE B;  2VL8 A;  4QX8 B;  2WAU A;  4A97 A;  3LK4 2;  3Q5X A;  3ZYL A;  3VU7 H;  4H9S E;  3FZF B;  1OED C;  2J49 A;  4YVO A;  3NOC D;  1CUN A;  4TV9 E;  5ENN A;  5LNK A;  3LY7 A;  3ZVV A;  3D9K A;  4MFR A;  2JRK A;  1LD8 A;  2WPV A;  2YKS A;  3MJX A;  2WXR A;  3EDV A;  4EED A;  3AA6 B;  3C51 A;  4DV6 T;  2WXH A;  2BDE A;  3CQG B;  3NZU A;  2XS8 A;  2C0L A;  2XEH A;  2ZLY A;  3DTO A;  3D9M A;  5A7D B;  4YDE A;  4H9P C;  5AQV B;  4C48 B;  4IGU A;  2E9X B;  1TR4 A;  3A8Y C;  4UVC B;  4ZXL A;  5AFU L;  4LF9 T;  3I3N A;  4I2Z A;  2J9Q A;  2AWI A;  1TNO A;  3QK6 A;  3ZC1 A;  4I1M A;  4XAX B;  2A72 A;  4I9C A;  3HKB E;  2UXX B;  4I1O B;  4GA1 A;  3UMV A;  2V8S E;  1HX1 B;  5ABG A;  1H6K A;  3AE5 A;  4EZK A;  5L3E B;  3ZC0 A;  5GON E;  4H9O C;  1BD8 A;  2WP9 A;  2NP9 A;  5AQL B;  3ZMV B;  1KT1 A;  2JMK A;  4HE8 A;  4JI2 T;  2F8Y A;  4HWD A;  3TLS A;  1V9D A;  3UU4 A;  4HLE A;  2DYS E;  3Q5W A;  4E6H A;  1D1A A;  1W9R A;  4B94 A;  2DNX A;  3DXM G;  4U0S A;  3V2O A;  3NKZ A;  4WBO A;  4ZHQ E;  5JRC A;  2ETB A;  2KCK A;  4YJ3 E;  4K0U A;  2H6I A;  1E7V A;  1HO8 A;  3ASH A;  3RIU C;  5BV0 A;  2K3W A;  3RSE G;  4O4L E;  2UXC T;  2VVN A;  4LML A;  4I6E A;  3W15 B;  1WCR A;  4DPR A;  4BT8 A;  2UY1 B;  4B8C B;  1UUS A;  3AG2 E;  2KT9 A;  5BNW A;  3A7M A;  2IC6 A;  3CQC B;  3DBS A;  4ILG A;  2I1J A;  4MLP A;  3WI3 A;  4UUC A;  2B0O E;  5FNV E;  2PJQ A;  2A5U A;  4F3V A;  2HN2 A;  5CFB A;  2M63 A;  1N0R A;  3O1I A;  4BA9 A;  1NI1 A;  3B5M A;  4HRM B;  5FQ6 A;  2BS2 A;  4ZS3 A;  5D0O D;  4ILC A;  4DR2 T;  2VGE A;  2VB6 A;  3HXC A;  1Y01 A;  2FUP A;  1O1T A;  1PC2 A;  3PU8 A;  2QYW A;  4HFH A;  5BW8 C;  3AE7 A;  2YN6 A;  2XAJ B;  3N2O A;  2P9I G;  4WAF A;  4AY5 A;  2PFV A;  1X79 A;  1NWM X;  5ENQ D;  4OX9 T;  3TLT A;  3AS4 A;  3R84 B;  3MZL B;  2QGS A;  3P4R A;  4J7W A;  4GTP A;  2XM1 A;  2JLB A;  2X9W A;  1BR2 A;  1E1H B;  2VQE T;  5HAX A;  1SZA A;  2W0G A;  1OCZ E;  3UT7 A;  3JCF A;  4GPM A;  5JA4 D;  3RRN B;  1FMV A;  3DSU A;  5CBO A;  2H7V C;  2AW6 A;  4DV4 T;  3UM3 A;  1YA0 A;  4ZS2 A;  5J08 A;  3N9O A;  2F4V T;  3IHR A;  1FVH A;  3G06 A;  2FJE A;  3HXD A;  3AG1 E;  3PUJ A;  3LVQ E;  1HG2 A;  3GZ1 A;  3C3Q A;  5B1A E;  1WYB A;  4IDO A;  3KEZ A;  4HI8 A;  2MOZ A;  2L8K A;  3ZT6 A;  5CMW A;  5LMU T;  4L2L A;  2P58 C;  5T4Y A;  3LKU A;  3H3M A;  1N4S A;  5L3C B;  4LFC T;  3F2E A;  2JQ9 A;  3I4G A;  4L2Y A;  3I4R B;  2E9X D;  4IE7 A;  2IJG X;  4CZ2 D;  4OVU A;  5JJ6 A;  2H89 A;  4XX5 A;  3OVU A;  3G2V A;  2MYS A;  1IKN D;  3B7U X;  3HG0 D;  2CE7 A;  1ZKE A;  3ZYK A;  4CRW A;  3MEK A;  5LHG B;  3ZMU B;  2YDQ A;  4ILU A;  3SI5 A;  2V5C A;  2KZT B;  3D9P A;  3Q5M A;  3TWW A;  4KZC A;  2DZN A;  1VRB A;  3U9W A;  3O1J A;  4ZEY A;  4GZC A;  2BED A;  2H3R A;  3ZIM A;  2QZA A;  2CFU A;  3L9T A;  4JI1 T;  4F6R D;  1HS6 A;  1B7T A;  4AQG A;  3FXD B;  3NRY A;  2IOL A;  4U04 A;  1NA3 A;  4TUY E;  3UUL A;  3D9N A;  1SHZ C;  2GK9 A;  4UQY A;  5FIO A;  2LO6 A;  1G73 A;  2R59 A;  2EIK E;  2P9P G;  5LG3 A;  1H19 A;  3TJP A;  2ES0 A;  4GK0 E;  3NZQ A;  2LOS A;  4Z90 A;  2R2L A;  2P9U G;  5LMN T;  1W0A A;  5LOV E;  3CLJ A;  5AQI B;  5JR9 C;  3ZRH A;  3P4P A;  4GK5 E;  3DST A;  2XAG B;  4NIK A;  4EAH A;  5J0Z A;  3OKQ A;  2VTB A;  3IBP A;  2CA5 A;  4NAC A;  3LBX A;  3FDH A;  2F0Y A;  3UU3 A;  2H6H A;  3N9P A;  1W09 A;  3ZJ2 A;  3AAA C;  3ZKJ A;  2WQY A;  4OVV A;  2V7L A;  3PUQ A;  4YND A;  3PH0 C;  4LG6 A;  3HL6 A;  3HKE E;  3ABV A;  3LVR E;  5HEH A;  5JDN A;  4HOQ A;  3RIB A;  2V8S V;  2XZE A;  3TWQ A;  4WWP A;  2QYJ A;  3SGH A;  3UKR G;  2W2U A;  3CK8 A;  1INZ A;  1S64 A;  1HH8 A;  2J07 A;  4R7L A;  2DZO A;  2W62 A;  5ABF A;  2ETC A;  2RFA A;  3C3R A;  4Z8X A;  4ILA A;  4IDP A;  3PE0 A;  1OWL A;  3UT5 E;  4GKJ T;  1J5E T;  4QKN A;  2PNN A;  2XEV A;  4KUM B;  3TL5 A;  2LSY A;  5AQJ B;  4L9I A;  1OCC E;  3ZXS A;  3QDN A;  4JVS A;  4KZ0 A;  3SFE A;  2HPL A;  2NTX A;  4XZ4 A;  3CX6 B;  3BQL A;  2BKN A;  3UTK A;  3C98 A;  4N5Q A;  5JJT A;  5KJM A;  2V5Q C;  4HOS A;  2H88 A;  2NC9 A;  3RYI E;  5AQQ B;  4PNI A;  4HWC A;  4GTR A;  3QUJ A;  2IO3 C;  2YIN A;  4QXC B;  2X6H A;  1NP7 A;  4TWD A;  3WAJ A;  2KZT A;  3PZ3 A;  5BXO A;  3RPU A;  4UV9 B;  3TWS A;  2WXQ A;  1OT8 A;  1QUU A;  3PUG A;  2MRI A;  3QWW A;  3U3W A;  2A5E A;  4HFI A;  1WLX A;  2JQH A;  3RRC A;  2WDV A;  2XAF B;  3AB3 B;  5FY0 A;  4GCN A;  5AN8 A;  3RK6 A;  5TAO A;  1E2A A;  5C3J A;  3JAE A;  2A4Z A;  4X66 T;  2IW5 B;  2BVM A;  1TNU A;  3Q7A A;  4EPZ A;  2Q9Q B;  3UUB A;  5HWY A;  1EF1 C;  3ZU7 B;  1G8X A;  3Q15 A;  3WAK A;  5LJN A;  5AQ7 A;  5D66 A;  3SBT B;  2ION A;  4PFO A;  4G25 A;  3GWH A;  2J1D G;  3SRZ A;  4CXX A;  2NW8 A;  2ZM2 A;  4JB8 P;  2FI7 A;  1D1B A;  4U33 A;  2LE8 A;  5LB7 B;  2X0H A;  3PE4 A;  4LF6 T;  3VLE A;  4RSY A;  3V2X A;  1BR4 A;  3JC6 C;  5BXU A;  4F6R C;  4YHJ A;  2BF0 X;  5FQ4 A;  3E22 E;  3M65 A;  3NOG D;  4HFC A;  4QWN B;  1T7S A;  2CWO A;  2J47 A;  2X9Y A;  1UX4 A;  3UQ4 A;  3R9M A;  4J0U A;  1H2U A;  1D8E A;  1UG3 A;  2DIW A;  4HRL A;  2CHO A;  2E9X C;  4L23 A;  2VJ8 A;  3ZGQ A;  2YNQ A;  4UV8 B;  4AQF A;  5LGN B;  2NOX A;  3CK7 A;  2XHE A;  1SQM A;  3S7B A;  3KDS E;  2GW1 A;  1WR0 A;  4JW1 A;  4BFR A;  1XDO A;  3ONX A;  1WDY A;  1XNR T;  3Q75 A;  2LSJ A;  2WXK A;  5J1G A;  3FY4 A;  2PM6 A;  3AAA B;  3CEQ A;  3DSS A;  4N3B A;  2VKO A;  1XNQ T;  2X9H A;  3O9X A;  2LT3 A;  1MMA A;  1B89 A;  1RZ4 A;  3B13 A;  4U63 A;  3E32 A;  1KNR A;  5B3S E;  3UFG A;  1TJC A;  5LBM A;  3FUJ A;  5EX0 A;  5G05 C;  3N2K E;  1UGO A;  3PUX F;  3UUN A;  1E8W A;  4NRH B;  4HFG A;  2X6F A;  4I6J A;  3T5X A;  2VSN A;  2J8S D;  2RD0 A;  5L3G B;  4C9B B;  3ZNG A;  3QOF A;  2NTY A;  3AA1 B;  1T98 A;  3EHR A;  3L16 A;  2X6I A;  1IZN B;  5HYA A;  1JWF A;  2ACZ A;  3FUE A;  4AVX A;  5JRC B;  2MHK A;  5AEN A;  3J5P A;  2X38 A;  4FJO A;  2X66 A;  4APF A;  1AJ3 A;  3UIP C;  4JYA T;  3LFM A;  2OA5 A;  1IJ6 A;  4XBF B;  1LF8 A;  2VGX A;  2GRN B;  3HDX A;  4GPK A;  2X67 A;  2C5K T;  3RO3 A;  4J8D A;  2XY8 B;  2PQR A;  3MV3 B;  3TWR A;  1IBL T;  3AEB A;  5ADX L;  1FPP A;  3DPD A;  2GRQ B;  4UF0 A;  3RQU A;  4DX5 D;  5BMV E;  1S35 A;  3ZSS A;  5ENO D;  3VTY A;  4HWH A;  3TWT A;  3ZUV B;  2W00 A;  4LF4 T;  2E9X A;  1HNX T;  3K1S A;  2CXF A;  2JAB A;  3NQP A;  1N34 T;  2OCC E;  1K1B A;  4DR6 T;  4X5T A;  2V6Y A;  5FY7 A;  3VRA A;  3EDT B;  4GTQ A;  3JYS A;  2B6C A;  1P5Q A;  3O4X E;  2UU9 T;  2IO2 C;  5EK4 A;  3GN5 B;  4TXP A;  5AQA A;  3CVW A;  1H2V C;  4O1O A;  2P9N G;  3C98 B;  4AOF A;  5KX5 E;  3AS8 A;  5G2N A;  2QY7 A;  3IHV A;  4CI1 B;  3PU3 A;  2J62 A;  4YTN A;  1OED E;  3LDZ A;  2Y8D A;  4YSZ A;  4UQX A;  2WXF A;  3OTO T;  5EKQ D;  1IYG A;  1U4Q A;  2OND A;  3ZFW A;  3FUF A;  3MCX A;  2XPK A;  3HVE B;  1MX2 A;  4EZL A;  3DEP A;  4U7I A;  2VL0 A;  2XQ9 A;  4P1N A;  1OWO A;  1KPS B;  2AVP A;  3Q49 B;  2KAT A;  1Y8M A;  4U0U A;  4MKT A;  2XSB A;  4OAV B;  1M62 A;  2BTD A;  4LSZ E;  4ATG A;  4N2Q A;  3N9M A;  1OUV A;  4AQY T;  3KVB A;  5C2Y A;  2WMN A;  1BR0 A;  4JI3 T;  1K1A A;  2CBJ A;  5FXW A;  5CGM A;  1WYC A;  3SY2 A;  4TN7 B;  1QZ2 A;  3AE1 A;  5F8P A;  1ZP0 A;  4DV3 T;  3SO8 A;  4GYS A;  4TRQ A;  4JHJ A;  4IDN A;  3B7S A;  3PE3 A;  3M3Z B;  3N9N A;  3RC3 A;  3EAM A;  3Q5D A;  3ZPJ A;  3QWP A;  4GML A;  2DWG A;  3S2A A;  1D0X A;  3RHW A;  2LHN A;  2DCP A;  3FUD A;  2IFU A;  2WXO A;  5EIB E;  4DV7 T;  3B7B A;  2H6G A;  4Y6W A;  3RF1 A;  3AEF A;  4KYO B;  4K03 A;  1TNB A;  5DBK A;  3EI0 A;  1Z3Y A;  2UXN B;  3QKY A;  5AQF B;  3EVY A;  3UUX B;  1HZ4 A;  3FTY A;  4G8L A;  4YVQ C;  4ZI2 C;  4ABN A;  4DX2 A;  3AE9 A;  4DI4 A;  1AP7 A;  4JI5 T;  2KND A;  2QFC A;  3CVP A;  4G23 A;  4FAD A;  4OFZ A;  3I0Q A;  2NYJ A;  1FT1 A;  3C50 A;  4ZFH A;  2IDO B;  3TG5 A;  2RG8 A;  1TEZ A;  2VYI A;  5HXH A;  3ZYM A;  1TNZ A;  4RQI A;  5T3R A;  3R7R A;  3VR9 A;  5JDF A;  2MBG A;  1LRZ A;  2CHN A;  1AWC B;  3TXN A;  3PNT B;  3PUS A;  5FKY A;  1EDU A;  5L3F B;  5L4H A;  4GTT A;  4PS3 A;  4DMW A;  1NZN A;  2RKK A;  3A5X A;  3G2W A;  2V7I A;  4KP3 C;  2W67 A;  4U2Y A;  3JUI A;  3PS6 A;  3OPC A;  4U31 A;  4YTM A;  2FO7 A;  3Q79 A;  2WVI A;  2KXP C;  5FXV A;  3ASO E;  4LER A;  3JAF A;  4HBD A;  4DVD A;  2A9U A;  2J4B A;  4G63 A;  3PV0 F;  1TJF A;  2YDR A;  4ACL A;  4HVB A;  3QAQ A;  4WNE A;  4QHO A;  2WDR A;  4QH5 A;  3HXE A;  4MLK A;  5AQM B;  2P9K G;  3PZ2 A;  2HHH T;  4OYK A;  3C4Z A;  2Q9Q C;  3QB5 A;  3PVL A;  4TV3 A;  5LJM A;  4DJA A;  1XMQ T;  2WY2 A;  5EID A;  4DR4 T;  4BTA A;  3UT8 A;  4D10 C;  2BS4 A;  2KM4 A;  1XGW A;  2CRB A;  3HHM A;  3CGH A;  4IE5 A;  2XQ3 A;  3Q47 B;  2X0Y A;  3ZT5 A;  5JH7 E;  2LRK A;  3MV2 B;  4GZ5 A;  3J5Q B;  4ZOL E;  5ARF A;  1O1R A;  4X62 T;  1N4Q A;  3Q9D A;  3BU8 A;  5FJY A;  1TN6 A;  2X3M A;  3UU8 A;  4DID B;  3ONL C;  2E5V A;  2ODV A;  3APD A;  3FFL A;  1U3C A;  4G2A A;  1GQE A;  2Q9Q D;  2HH7 A;  3Q5E A;  2H7O A;  2WQ6 A;  2Y48 B;  4JLE A;  3PUW F;  1KNP A;  4YFS A;  5CER B;  3S7F A;  3ZXP A;  2RP4 A;  2W66 A;  1ELW A;  2WXM A;  3SNX A;  4MHC A;  2Y4T A;  2LUH A;  2CMR A;  2UUB T;  3VHL A;  2W63 A;  1LD7 A;  3LJC A;  1Z5S C;  5DQW A;  1MYO A;  1LVF A;  4XKB A;  4U72 A;  1BLX B;  5KNH D;  4LMK A;  3SZ7 A;  4UXN B;  3RI5 A;  5LA6 E;  5AQT B;  2LXM A;  4O8S A;  4K5C A;  2E0I A;  3ZMT B;  3RYH E;  4V3I A;  2FJD A;  3ZMS B;  3NWI A;  5CA1 E;  4U7E B;  5KCM A;  4UVA B;  2WU2 A;  2V0P A;  5FIN A;  2LKH A;  4CGW A;  4AIF A;  4J8Y A;  4WZX A;  2XSA A;  3LXU X;  1UN9 A;  5ENR D;  2KIN B;  3D9J A;  4DBQ A;  3P1U A;  3HI2 A;  2MYO A;  5KJL A;  2XQ6 A;  2WWV A;  2Y0B G;  3LYA A;  4H7Y A;  3E08 A;  3DSX A;  2X68 A;  3R9A B;  5G05 J;  3AAI A;  5ETW A;  4F53 A;  2WMO A;  4ERR A;  3ZEF B;  2XZT G;  4B3T T;  2FBN A;  4M1P A;  2IEJ A;  2L9B A;  3C4W A;  2P9L G;  2WZH A;  3FH7 A;  4RG9 A;  1US7 B;  2LAH A;  3UFE A;  1NAF A;  1DU2 A;  4GKK T;  2ZIS A;  4JUY A;  2C2L A;  4PUC A;  2DCF A;  3L8R A;  3WG7 E;  1Z8U A;  4H63 V;  4CXW A;  4EZH A;  1YXR A;  3RJV A;  5AQK B;  3CIA A;  2FUL A;  4DI3 A;  5KWD A;  3L17 A;  2CXD A;  3ONK A;  3U78 A;  4I43 B;  2LNI A;  2F37 A;  3NRX A;  4J6I A;  5JDL A;  4AI6 A;  5FQ7 A;  2YU1 A;  3CV0 A;  4TXQ A;  3L13 A;  3UM1 A;  5LG4 A;  1T72 A;  4CDR A;  3AEG A;  4JV5 T;  1KF6 A;  4HFB A;  1HU3 A;  3Q9N C;  3ULE G;  4EYY R;  5E75 A;  4M3O A;  2ZM0 A;  4LNB A;  2C5J A;  3T9K A;  3L22 A;  4XI9 A;  4UWG A;  3T5V A;  3RYF E;  4BX8 A;  4EEB A;  4GA2 A;  3CHM A;  3PRE A;  3JQ1 A;  3AE4 A;  2H6F A;  2VVS A;  3JXI A;  4Q94 A;  5EK2 A;  4ANJ A;  4PH4 B;  5HEG A;  2L0T B;  2CM0 A;  3ISM C;  2ZXW E;  5HXS A;  4N78 D;  3NF1 A;  4JL0 A;  3QNU A;  5CBN A;  4P29 A;  5LGT B;  3PTR B;  4GOU A;  1ZHC A;  2VKD A;  5LP6 E;  4DV2 T;  3AJI A;  5LCW C;  5L4E A;  5IWA T;  3AEA A;  5E0O A;  2AXZ A;  2KXP B;  3D0T A;  3AXJ B;  3K8P C;  4Z68 A;  3QB5 K;  1UJJ A;  3FBL A;  2I1K A;  2CHX A;  3MZK B;  2LSK A;  4A3T A;  5FQ8 A;  2NW7 A;  4NXN T;  3HYM B;  4CI2 B;  3IEG A;  3LG7 A;  1KNZ A;  1UN8 A;  3FZH B;  5DJQ C;  2J08 A;  4TNV A;  3AEE A;  5HWX A;  1IXV A;  1YQ4 A;  2WXN A;  3SFY A;  1YMP A;  4DO0 A;  2ZGD A;  4LCT A;  3DSV A;  2XM2 A;  4A98 A;  2V26 A;  1EPU A;  2DBA A;  2XPY A;  4YTP A;  4Q25 A;  5LXT E;  2B1E A;  2YHE A;  4JHR A;  1OXZ A;  1WY6 A;  3SFZ A;  4URK A;  3LSV A;  2VGY A;  4MRU A;  4B93 B;  4FP7 A;  3KFW X;  1D8D A;  5LHH B;  3V5U A;  5FTP A;  5EN5 D;  5BR8 T;  5ENT D;  4ACK A;  4FLB A;  2GRO B;  2Y69 E;  3EUV A;  3ETV A;  3FZK B;  4FA6 A;  5CEA A;  3S4U A;  4AKG A;  4N2S A;  4GTV A;  3HRA A;  2X0L B;  3FU5 A;  4DMV A;  3MKQ B;  3W9F A;  3OYX A;  4YHH T;  2QA7 A;  5G04 C;  2L6B A;  2WQH A;  3EHN A;  3LEW A;  4C91 A;  2V6Y B;  3FZL B;  4HI9 A;  4BX9 A;  3IXE A;  3I1A A;  5KNG A;  2J4G A;  3IV0 A;  3TG4 A;  2WXI A;  3KBT A;  3GYZ A;  3NZP A;  4Q96 A;  4TZ4 C;  3IBE A;  1SZ9 A;  1MX6 A;  4N39 A;  4PAG A;  4AEZ C;  1N0Q A;  5IYZ E;  5JTG A;  4HXI A;  1IAP A;  4O60 A;  3N2G E;  1EZ3 A;  1JPL A;  3ULY A;  5KJN A;  3PDY A;  3AA0 B;  1QLB A;  3SFD A;  3CK9 A;  3Q2M A;  2MTQ A;  2BG9 B;  4JI0 T;  2CHW A;  1MIW A;  2VGX B;  5FXZ A;  3TWX A;  1U2V G;  3UTM A;  3H3A A;  3CK6 A;  4TWF A;  3T8K A;  3JQ0 A;  3K3N A;  2OV8 A;  5EIL A;  4U96 D;  3KBU A;  3KSQ A;  4LMJ A;  4A55 A;  4CCA A;  1UUR A;  5AAO A;  4G8K A;  1FMW A;  1TNY A;  1L0V A;  1UK5 A;  3EIQ C;  4TX5 A;  3U64 A;  3D9H A;  3ZPO A;  2W61 A;  3ZN1 B;  2HYZ A;  1EYH A;  4UI9 J;  1U5P A;  3CIR A;  3P50 A;  3FB2 A;  5C8Y E;  2VSX E;  2XCB A;  1QYM A;  2N9D A;  3FUL A;  3MKD A;  3ZHE B;  4CN4 A;  5AJL A;  2XGM A;  2KMF A;  4M7C A;  3MGB A;  1N95 A;  5FXX A;  5JMN D;  4K5A B;  3DWL G;  4IDQ A;  4JA7 A;  3ZW3 A;  2YHC A;  3DJB A;  4HFV A;  2JIW A;  1VCS A;  2CFZ A;  1N32 T;  5CRU A;  3P4S A;  5KJK A;  2IC9 A;  2R02 A;  4UEM A;  1HF8 A;  1VOM A;  3D9L A;  3FWV A;  2V7M A;  3CML A;  3PUR A;  4A1G A;  3UPV A;  3AE8 A;  3AA7 B;  4QQI A;  1JNR A;  3TGO A;  4L9P A;  3J9X 1;  4GZ3 A;  2WWU A;  3FHE A;  3AXJ A;  2R6G F;  2V4H C;  1S94 A;  2LLY A;  5LBQ B;  2XHE B;  4AKH A;  4JD2 G;  2FEZ A;  3B95 A;  3BQI A;  4DND A;  5CA0 E;  5KBA A;  2DLR A;  2NR4 A;  3UQ7 A;  2N1G A;  2CBI A;  3KD7 A;  1I94 T;  1N9A A;  5EZY E;  3V5S A;  4KMC A;  4FJY A;  4EZJ A;  3APF A;  4EXT A;  5JHA A;  5CEC B;  4E7Z A;  3PZ1 A;  3C4X A;  4IE4 A;  1Z3X A;  4YT0 A;  1YKH B;  5ITZ F;  3KIN B;  3QC9 A;  2CG2 A;  4DR3 T;  2B76 A;  3D3M A;  5DAB A;  4X8Q A;  4HTE A;  5LHI B;  4TXR A;  4G1T A;  1NL4 A;  4GZ6 A;  3L54 A;  3JAD A;  1Z0P A;  2P9B A;  3AE3 A;  2WXG A;  3UU5 A;  2D5U A;  4LF7 T;  2DL1 A;  3I9W A;  4LRZ A;  1MMD A;  4J8E A;  3DP7 A;  5CCL A;  2RFM A;  2LXL A;  1UW4 B;  2HE0 A;  1D9S A;  4WUY A;  4N5C A;  5HEO A;  4EV6 A;  2L6J A;  1GW6 A;  1N4R A;  4AM9 A;  3PDN A;  4ZHB A;  1WM5 A;  2VSO E;  3I0O A;  3KV9 A;  4A56 A;  1SVX A;  4GTM A;  2XUE A;  4HWF A;  3ASN E;  1IHB A;  4I43 A;  4DR7 T;  5AQN B;  5FVK A;  5CRV A;  5LFA A;  4PW8 A;  4U8V D;  3P4Q A;  3L3P A;  4JEH A;  5AQR B;  1U3D A;  2YOE A;  1JWG A;  2OVF A;  3ZCJ A;  2V7J A;  1N94 A;  1OWP A;  1KZO A;  2OVB A;  3TXM A;  3FEX A;  5ENP D;  1DVP A;  2HM8 A;  3JUE A;  4Q69 A;  4I0U A;  1YQ3 A;  2IHR 1;  3RIF A;  2CLY C;  3CST A;  2WB5 A;  4IRE A;  4U0Z A;  5DIZ A;  4CT0 A;  4AIU A;  1V54 E;  3ASD A;  1JCQ A;  1NA0 A;  2GRM A;  3FEY A;  1MQS A;  4H9N C;  4KX6 A;  4DLQ A;  3MAC A;  4YDO A;  2K9A A;  3N9L A;  2LSI A;  2W4X A;  4QH1 A;  2OOE A;  3RQW A;  4P0B A;  4XIF A;  1XZY A;  5JR9 A;  3UIN C;  5JQG E;  5ABF B;  5A6C A;  1XDP A;  3PUK A;  3EHM A;  4DLO A;  2IML A;  3APC A;  1D1C A;  4J8S A;  4XZC A;  1O3X A;  3UX4 A;  2UXD T;  4HRN A;  2KCV A;  4JI6 T;  2LSV A;  3AED A;  4CDN A;  1H2T C;  4NIQ A;  4JI7 T;  3Q7F A;  3UM0 A;  2WXJ A;  3KSL A;  1CHU A;  2C5I T;  2WXP A;  2I6H A;  4DV5 T;  1M7K A;  4LFB T;  2VTB B;  4WNF A;  5A23 A;  4PJJ A;  1KFY A;  4GYW A;  1WG0 A;  3ABK E;  4HB5 A;  1XNF A;  2OV9 A;  3QK0 A;  4B0Z A;  3OTN A;  5ANL A;  3J7Y q;  4WYV A;  4DR5 T;  4GMR A;  1TYQ G;  4HQD A;  3KS2 A;  4ZI3 C;  3S7D A;  3SBS A;  3VLF A;  2V5F A;  5ARG A;  3CX8 B;  2CXL A;  5F3J A;  4DUZ T;  3UKU G;  4ADZ A;  2IIU A;  2XEE A;  1J5W A;  1UCU A;  1E90 A;  3EU5 A;  2K48 A;  3URZ A;  2BKG A;  5EDS A;  5HXC A;  5L47 A;  1ZU2 A;  2C0M A;  2D0T A;  4CXY A;  3ANW B;  4O2B E;  3KAE A;  2EIJ E;  2BBH A;  3TLW A;  4ZI7 E;  3FTS A;  1J1J A;  2Z6E A;  2A3D A;  2GRL A;  2XPI A;  3OXF A;  3ZYQ A;  4LNG A;  2CPT A;  4H9Q C;  5J2U E;  3JXJ A;  1SA0 E;  2PBI A;  3T1Y T;  5EX3 A;  4X64 T;  3EJN A;  2X9X A;  4YDW A;  1LVK A;  5ABE A;  3R7Q A;  1OCO E;  1K3Z D;  1QSD A;  2J09 A;  5JHB A;  3Q4A B;  3L09 A;  1H6P A;  3TWV A;  1N4P A;  5HS0 A;  3UQ3 A;  1MJ0 A;  3FU3 A;  3B7R L;  3RAU A;  4U3C A;  4JC8 A;  2BKP A;  3ESK A;  3CVN A;  2RA1 A;  4IUL A;  4DV0 T;  4LEU A;  3CHQ A;  3CHS A;  2L9Q A;  3FTW A;  4JI8 T;  1ZOY A;  2PL2 A;  5AQO B;  2KLQ A;  4KI0 F;  3ML9 A;  1BU9 A;  4JI4 T;  4RLY A;  1G3N B;  4PS8 A;  5F5W A;  4E7S A;  3VKH A;  4HOU A;  2IAK A;  5LYJ E;  5LX8 A;  3IA3 A;  3ONJ A;  4L1B A;  1JNZ A;  3F57 A;  1KZP A;  3JCK C;  3KV5 A;  2E2E A;  3BUA A;  3E34 A;  4C0E A;  5JDH A;  2NSZ A;  4CN6 A;  4FHJ A;  3LY9 A;  3GZS A;  3K3Q C;  4K0K T;  1BPO A;  3O1H A;  3EHQ A;  3U4T A;  3NAW A;  2KBX A;  5FZQ A;  1UJK A;  5EK3 A;  2QC9 A;  3RX6 A;  3FP3 A;  4AIS A;  3MX3 A;  3ABL E;  2D9D A;  2GGF A;  4OK0 A;  1OWM A;  3L6A A;  4BSX A;  3BK9 A;  4J2C A;  5FWQ A;  2CLY B;  1IBK T;  1BI7 B;  3ONL A;  3RC8 A;  4HNA D;  4IHJ E;  4LF5 T;  2OLT A;  3RKO A;  3ZCI A;  4JPS A;  3PNL B;  4WNK A;  3T1H T;  3AE6 A;  2XRZ A;  5FMN A;  1MX4 A;  5HCJ A;  3CHR A;  4FJZ A;  2CHZ A;  4EIW A;  2ZM8 A;  1HNW T;  3NB2 A;  2QVA A;  2E8I A;  3VR8 A;  1FCH A;  3K3O A;  5FZS A;  3AE2 A;  4UEL A;  1HXI A;  2DWK A;  3E37 A;  4CGV A;  3ML8 A;  3V30 A;  4F1S A;  4XI0 A;  4B89 A;  4IIJ E;  4NQ0 A;  2DI4 A;  4HOT A;  1FEW A;  4DX6 D;  4JEU B;  2EHO C;  2ZMA A;  1E7U A;  2VQ2 A;  3VLD A;  4ILH B;  5HQ8 A;  3LDQ B;  1KEY A;  4ZI3 D;  1IBM T;  1HR0 T;  2AJA A;  3LS8 A;  2HN1 A;  2X51 A;  1MIV A;  5KXJ A;  2J4D A;  3FTU A;  1DNP A;  1H0A A;  3UIO C;  1E7P A;  1N11 A;  4H9R C;  5BV1 A;  4ANV A;  4U7Y A;  3ZN3 A;  1HS7 A;  2LSG A;  2XQY A;  2PG8 A;  2M67 A;  3NBX X;  3P4W A;  3PUA A;  2LM9 A;  3KV4 A;  4DK5 A;  4EGW A;  4DUY T;  4TUM A;  2MPK A;  3TAX A;  4GU5 A;  3AVR A;  4C90 A;  3N5L A;  5H7P A;  1S70 B;  4CYM D;  3NZS A;  3FXE B;  4LF8 T;  1N52 A;  4AKR B;  4Y6C A;  4CI3 B;  4CT4 A;  1TN7 A;  3HVE A;  3CX7 B;  5JDG A;  1IHG A;  1H7C A;  3CVL A;  4UVB B;  4OHF A;  1MIY A;  4WND A;  1Z6T A;  3G2U A;  3CKB A;  4UWH A;  2ACX A;  3CQX C;  3GN5 A;  3EUH A;  4O4J E;  4EB6 E;  2XQ7 A;  2XAH B;  4X20 E;  3DSW A;  5LCY A;  2PTF A;  4FHK A;  2ZIR A;  4GAA A;  3OJA A;  5C1D A;  5HRY A;  1NEN A;  4H7X A;  4TV8 E;  4O2A E;  3NBN B;  3SS1 A;  4L7T A;  4GTS A;  3RIA A;  5HEJ A;  2AE9 A;  3R6N A;  3TWU A;  1YCS B;  5C2T A;  3FTX A;  4L0R A;  3UM2 A;  2D0U A;  4IL9 A;  4UF0 B;  1IQU A;  4UQZ A;  3PUZ F;  3PEV B;  2YQ8 A;  2KWH A;  5BUZ A;  2WB2 A;  1ELK A;  4JA9 A;  3H37 A;  4HN9 A;  4A1S A;  1LTX A;  4GMJ A;  4ANX A;  3U3I A;  4GIW A;  2ILR A;  4XE0 A;  3D9O A;  2K24 A;  1Y6I A;  1UOH A;  3UXG A;  2KZ7 B;  3ZN0 B;  3PUV F;  3CHO A;  3RRW A;  3KV6 A;  4X1K E;  5LCW J;  4U2Z A;  5AAR A;  1O1S A;  1HG5 A;  4K5B A;  1ZBP A;  3QAR A;  4BER A;  3RGL A;  2EIL E;  4I1A A;  4DV1 T;  2FO1 E;  3ZT7 A;  3AEC A;  3L08 A;  4JEU A;  4OYS A;  4I9E A;  4EQF A;  4EYU A;  4APO A;  2UUC T;  2FF4 A;  3SWH A;  3FTZ A;  4AKL A;  3FUN A;  5CMY A;  2DHR A;  3LPZ A;  3ESL A;  4IRU A;  2WBL A;  4YXD A;  4O1P A;  5LOZ A;  4FC8 A;  1SUM B;  2LKG A;  2DVW A;  2PZI A;  3OXL A;  2KC7 A;  2CCQ A;  2EQX A;  4WNG A;  4ANU A;  5CJ5 A;  4DX1 A;  3AG4 E;  3MK7 C;  3OYZ A;  3CVQ A;  4AJW A;  2BVL A;  5AQ9 A;  4LNU D;  2WDQ A;  4N3C A;  2Y3A A;  4IE0 A;  3FU0 A;  1OED A;  5G04 J;  1E8Z A;  1HCI A;  3UT4 A;  2P9S G;  1W0B A;  1E8X A;  3ASF A;  5AIJ A;  2XQ4 A;  1YYH A;  3G2S A;  4GA0 A;  4U8Y D;  1BR1 A;  3MJW A;  1OWN A;  5H6Q B;  2V1D B;  3K9I A;  3DEO A;  5M72 A;  1ZB1 A;  3OXG A;  1S63 A;  5JRE A;  2HO1 A;  1X9B A;  3DPY A;  2XEN A;  5FP3 A;  5M4Y A;  5IHY A;  5FZR A;  4NPP A;  1XMO T;  3GW4 A;  3IKO B;  4JHK A;  3ZHE A;  3ZKR A;  2XZD G;  4G11 A;  4KHZ F;  5CB4 E;  4HOR A;  2EIM E;  1HX8 A;  2XAQ B;  3EHZ A;  4NUV A;  1YW0 A;  1KK7 A;  4I4T E;  4MS6 A;  3MXZ A;  4IST A;  2CWY A;  4B6X A;  3DRA A;  1QNF A;  4EBA A;  2C0S A;  2KWI B;  2ZM6 T;  4GTO A;  3AG3 E;  3FBZ A;  3UI2 A;  3P7I A;  1OXJ A;  1HTJ F;  4MBQ A;  1NEK A;  3E4B A;  3ZMZ B;  1MMN A;  2MAW A;  4IN3 B;  3RO2 A;  2BZB A;  3BQK A;  4P09 A;  2Q7F A;  2I0M A;  2N2N A;  2Q9Q A;  4NUR A;  5FYM A;  2BG9 A;  4I50 E;  2NXP A;  2ZU6 B;  1ELR A;  3PUY F;  2WU5 A;  4AY6 A;  2V6X A;  2EHO B;  3SHF A;  4TUU A;  3TLU A;  4B3M T;  4YDY A;  1ZEE A;  2XTL A;  5D2M C;  2QYU A;  4GYR A;  2I2O A;  2XAS B;  5AQU B;  2BUG A;  2L0I A;  5B1B E;  2P2C P;  3TKL B;  1OY3 D;  2CG3 A;  4KVM A;  4QH4 A;  3FH8 A;  1WFD A;  4P0A A;  1FT2 A;  2E2A A;  4TNW A;  3MKQ A;  5T8I A;  3QNK A;  4HWI B;  2XJ7 A;  3ULQ A;  1E8Y A;  4BES A;  2M6B A;  3ANW A;  4C0M A;  2VK9 A;  5KMG P;  3FZM B;  4EBA G;  1K8K G;  3E30 A;  4NXM T;  1WAO 1;  2VWA A;  4A5X A;  2L3L A;  5G55 A;  2GRP B;  4IE6 A;  4EZ4 A;  5FL1 A;  4J8F A;  2PM7 A;  4GCO A;  4AXP A;  5IY5 E;  4ZI2 D;  1DCQ A;  3P8C D;  5AQP B;  2JQK A;  2Y6X A;  1JCS A;  2DYR E;  3B7T A;  3LY8 A;  4GYY A;  4FLH A;  1NFI E;  4BSZ B;  3HR0 A;  4QFV A;  5L2L A;  2XQ8 A;  4COF A;  1R8I A;  4V1A v;  2DWZ A;  3FUK A;  1PAQ A;  3PZ4 A;  3FUI A;  4PJN A;  4LUN U;  3SQV A;  2XS1 A;  5HI7 A;  4PK6 A;  4BJM A;  3FU6 A;  4HEA A;  2F8X K;  4HS2 A;  1DCE A;  1IJ5 A;  4FU3 A;  4PDX A;  4ILB A;  4BJN A;  3RU0 A;  3LBX B;  2YEV C;  4CDM A;  2IY0 C;  2LEH A;  3E0Z A;  1SA4 A;  3ENE A;  4L5G A;  4EEC A;  3HXF A;  5AYW D;  2MOW A;  3C72 A;  5D0Q D;  2LAI A;  4BWR A;  3ZJ1 A;  4DRX E;  5CCM A; 
#chains in the Genus database with same CATH homology
 1MND A;  3RRM B;  5LGU B;  3U66 A;  4EOZ B;  5JR9 B;  2HPJ A;  1MMG A;  1YD8 G;  2HR2 A;  3ASG A;  2R17 C;  4O6F A;  1N54 A;  2XGO A;  3CKD A;  1MHQ A;  3QC1 A;  5HXE A;  4O4H E;  3ZLI A;  4AP2 A;  4PJM A;  4ME2 A;  4UWK A;  4IYP A;  2LSU A;  4HKA A;  2LJL A;  4QXB B;  4PS7 A;  3OBV E;  4AXH A;  3JC6 D;  5AJD A;  2V4L A;  3QWV A;  4JEH B;  3IEE A;  4F7A A;  4H63 H;  2JJ9 A;  4I55 E;  3C64 A;  2XQ0 A;  3CWZ B;  5CHE E;  4OYJ A;  2VKH A;  4AV7 A;  4ANW A;  4G2V A;  3ZEF A;  4O4I E;  3QJZ A;  2IOS A;  3LK2 B;  3KVA A;  3IF8 B;  3O48 A;  5FY1 A;  5E76 A;  1D0Z A;  4AQF C;  3ETU A;  2R5S A;  3PEU B;  1QQE A;  4K0R A;  4I17 A;  4WW0 A;  4WWN A;  3CHP A;  5BPP A;  3BG0 B;  4ILI A;  2NW9 A;  2WQ7 A;  3PRZ A;  4YJ2 E;  2YK0 A;  4YLH A;  3F31 A;  4KVO A;  2I59 A;  1PY1 A;  3HIZ A;  4I2W A;  1Y64 B;  4FI5 A;  3RRU A;  4GB9 A;  2D2S A;  3EDU A;  3AVS A;  3LCA A;  4N3A A;  3GMI A;  3MYV A;  4E85 A;  3I5P A;  4I6G A;  4KBQ A;  2JEK A;  1LKX A;  4RG6 A;  3N71 A;  4GZD A;  1WR6 A;  5L3B B;  2SPC A;  2VSY A;  4JZY A;  4UIG A;  1E96 B;  1KT0 A;  4JXT A;  4NUU A;  3PZD A;  3CR3 A;  3SOL A;  3RYC E;  4RVB A;  2VKJ A;  4IDZ A;  2K5B B;  3HA4 A;  4W9R A;  4QXH B;  3SD5 A;  3HKC E;  5A1L A;  1A17 A;  3HKD E;  2UY1 A;  3EIJ A;  3FHN A;  1FIO A;  2WSS V;  2AXV A;  2XPZ A;  1S0P A;  4UWL A;  1KLX A;  5H6R B;  2LHR A;  1WRD A;  3LK3 B;  3CVV A;  2PQN A;  5JDQ A;  1HE8 A;  5FT9 A;  4CEM A;  4G26 A;  4BT9 A;  4UI9 C;  2EHO A;  3QOU A;  2XCC A;  1FVF A;  1X5B A;  2I9C A;  4WWO A;  2NWB A;  4B8A A;  3GZ2 A;  3GA8 A;  3MA5 A;  2X6J A;  3VKG A;  4FUL A;  3LJ3 A;  3IHY A;  3CVX A;  2JPF A;  2CEA A;  4PK4 A;  5DQV A;  2LOP A;  4UI9 K;  2ODU A;  3MA9 A;  2KCL A;  1HFA A;  3CVY A;  4U74 A;  2AXU A;  4CZZ B;  2IU1 A;  4G24 A;  3I9Y A;  3BG1 B;  3BEE A;  5JJ7 A;  3CKC A;  2X6K A;  3FH5 A;  3G2T A;  5KDM C;  3CVU A;  2WM9 A;  4ISS A;  2VAS A;  4KBM B;  4AKI A;  2XGS A;  3FUM A;  3N9Q A;  3T8O A;  2UWJ G;  3FTV A;  2YU2 A;  4WBN E;  4BTB A;  2JQQ A;  5L3D B;  2IQC A;  2V7K A;  3RKV A;  3D9I A;  4A3V A;  1OWA A;  3CPZ A;  3CVR A;  4UWF A;  4KMO A;  3P2B A;  4X1I E;  5JVD E;  2EHO D;  3MKR A;  4GYO A;  5LP0 A;  5JDM A;  1L5J A;  4XKC A;  1IQR A;  3UUX A;  3B57 A;  3AS5 A;  3SF4 A;  1VDY A;  3AU5 A;  4ASK A;  5J2T E;  3QB2 A;  1W3B A;  4PFP A;  4KT6 B;  4U07 A;  5ANR A;  2IF4 A;  4CQI A;  4MAL A;  3T8M A;  4QX7 B;  3RH3 A;  4KXK B;  2Y4U A;  1UX5 A;  4PJL A;  5BT1 A;  2A2F X;  3WXX A;  3S7J A;  5HXR A;  3OAW A;  2JMH A;  4BY6 A;  4BAY B;  3VTX A;  4HGA A;  4X1Y E;  5J90 A;  1YKE B;  2WXL A;  4PK5 A;  3AU4 A;  3FUH A;  1MNE A;  4DBR A;  3CSF A;  2G0U A;  1JUQ A;  3O4Z A;  1ZV4 X;  1D0Y A;  2XRY A;  4U8H A;  3UUM A;  3AAE B;  2VL8 A;  4QX8 B;  2WAU A;  3LK4 2;  3Q5X A;  3ZYL A;  3VU7 H;  4H9S E;  2J49 A;  4YVO A;  1CUN A;  4TV9 E;  5ENN A;  5LNK A;  3LY7 A;  3ZVV A;  3D9K A;  4MFR A;  2JRK A;  2WPV A;  3MJX A;  2WXR A;  3EDV A;  3AA6 B;  3C51 A;  2WXH A;  2BDE A;  3CQG B;  3NZU A;  2C0L A;  2ZLY A;  3DTO A;  3D9M A;  5A7D B;  4H9P C;  4IGU A;  2E9X B;  4UVC B;  5AFU L;  4I2Z A;  3I3N A;  2J9Q A;  2AWI A;  3QK6 A;  3ZC1 A;  4I1M A;  4XAX B;  4I9C A;  2A72 A;  3HKB E;  2UXX B;  4I1O B;  4GA1 A;  3UMV A;  2V8S E;  1H6K A;  4EZK A;  5L3E B;  3ZC0 A;  4H9O C;  5GON E;  2NP9 A;  3ZMV B;  1KT1 A;  2JMK A;  4HE8 A;  1V9D A;  4HLE A;  3Q5W A;  4E6H A;  1D1A A;  4B94 A;  2DNX A;  4U0S A;  5JRC A;  4WBO A;  4ZHQ E;  2KCK A;  4YJ3 E;  4K0U A;  1E7V A;  1HO8 A;  3ASH A;  5BV0 A;  4O4L E;  4I6E A;  3W15 B;  4DPR A;  4BT8 A;  2UY1 B;  4B8C B;  5BNW A;  2KT9 A;  2IC6 A;  3CQC B;  3DBS A;  4ILG A;  2I1J A;  4MLP A;  3WI3 A;  5FNV E;  2PJQ A;  2A5U A;  4F3V A;  2M63 A;  3O1I A;  4BA9 A;  5FQ6 A;  4ZS3 A;  5D0O D;  2VB6 A;  1PC2 A;  3PU8 A;  5BW8 C;  2XAJ B;  3N2O A;  4WAF A;  4AY5 A;  2PFV A;  1X79 A;  1NWM X;  3AS4 A;  3R84 B;  3MZL B;  2QGS A;  2JLB A;  2X9W A;  1BR2 A;  1E1H B;  5HAX A;  1SZA A;  2W0G A;  3UT7 A;  3RRN B;  1FMV A;  2H7V C;  2AW6 A;  1YA0 A;  4ZS2 A;  5J08 A;  3N9O A;  3IHR A;  1FVH A;  3PUJ A;  3LVQ E;  1HG2 A;  3GZ1 A;  1WYB A;  3KEZ A;  2MOZ A;  2L8K A;  5CMW A;  4L2L A;  2P58 C;  5T4Y A;  3LKU A;  5L3C B;  3F2E A;  3I4G A;  4L2Y A;  3I4R B;  2E9X D;  4IE7 A;  2IJG X;  4OVU A;  5JJ6 A;  4XX5 A;  3G2V A;  2MYS A;  3B7U X;  2CE7 A;  1ZKE A;  3ZYK A;  4CRW A;  3MEK A;  5LHG B;  3ZMU B;  4ILU A;  3SI5 A;  2KZT B;  3D9P A;  3Q5M A;  4KZC A;  1VRB A;  3U9W A;  3O1J A;  4GZC A;  2H3R A;  3ZIM A;  2CFU A;  1HS6 A;  1B7T A;  4AQG A;  3FXD B;  3NRY A;  2IOL A;  4U04 A;  1NA3 A;  4TUY E;  3UUL A;  3D9N A;  1SHZ C;  2GK9 A;  4UQY A;  2LO6 A;  1G73 A;  2R59 A;  1H19 A;  3TJP A;  2ES0 A;  4GK0 E;  3NZQ A;  2LOS A;  5LOV E;  3CLJ A;  5JR9 C;  3ZRH A;  4GK5 E;  2XAG B;  4EAH A;  3OKQ A;  2VTB A;  3IBP A;  2CA5 A;  4NAC A;  3LBX A;  3FDH A;  3N9P A;  3ZJ2 A;  4OVV A;  2V7L A;  3PUQ A;  4YND A;  3PH0 C;  3HL6 A;  3HKE E;  3LVR E;  5JDN A;  4HOQ A;  3RIB A;  4WWP A;  3SGH A;  3CK8 A;  1INZ A;  1HH8 A;  2J07 A;  4R7L A;  2W62 A;  4Z8X A;  3PE0 A;  1OWL A;  3UT5 E;  4QKN A;  2XEV A;  4KUM B;  3TL5 A;  2LSY A;  4L9I A;  3ZXS A;  3QDN A;  4JVS A;  4KZ0 A;  2NTX A;  2HPL A;  4XZ4 A;  3CX6 B;  3BQL A;  3UTK A;  5JJT A;  3C98 A;  5KJM A;  4HOS A;  2NC9 A;  3RYI E;  4PNI A;  3QUJ A;  2YIN A;  4QXC B;  2X6H A;  1NP7 A;  3WAJ A;  2KZT A;  3RPU A;  4UV9 B;  2WXQ A;  1QUU A;  3PUG A;  2MRI A;  3QWW A;  3U3W A;  1WLX A;  3RRC A;  2XAF B;  3AB3 B;  5FY0 A;  4GCN A;  3RK6 A;  5TAO A;  2A4Z A;  2IW5 B;  2BVM A;  4EPZ A;  2Q9Q B;  5HWY A;  1EF1 C;  1G8X A;  3Q15 A;  3WAK A;  5LJN A;  3SBT B;  2ION A;  4PFO A;  4G25 A;  3GWH A;  2J1D G;  3SRZ A;  4CXX A;  2NW8 A;  2ZM2 A;  2FI7 A;  1D1B A;  2LE8 A;  3PE4 A;  3VLE A;  4RSY A;  1BR4 A;  3JC6 C;  4F6R C;  4YHJ A;  2BF0 X;  5FQ4 A;  3E22 E;  3M65 A;  2CWO A;  4QWN B;  2X9Y A;  1UX4 A;  4J0U A;  1H2U A;  1UG3 A;  2DIW A;  2E9X C;  4L23 A;  2VJ8 A;  3ZGQ A;  2YNQ A;  4UV8 B;  4AQF A;  5LGN B;  2NOX A;  3CK7 A;  2XHE A;  1SQM A;  3S7B A;  3KDS E;  2GW1 A;  4JW1 A;  4BFR A;  3ONX A;  2LSJ A;  2WXK A;  5J1G A;  3FY4 A;  2PM6 A;  3AAA B;  3CEQ A;  4N3B A;  2VKO A;  2X9H A;  3O9X A;  2LT3 A;  1MMA A;  1B89 A;  3B13 A;  4U63 A;  1TJC A;  5LBM A;  3FUJ A;  5EX0 A;  5G05 C;  3N2K E;  3UUN A;  1E8W A;  4NRH B;  4HFG A;  2X6F A;  4I6J A;  3T5X A;  2VSN A;  2RD0 A;  4C9B B;  5L3G B;  2NTY A;  3AA1 B;  1T98 A;  3L16 A;  2X6I A;  1IZN B;  5HYA A;  1JWF A;  3FUE A;  4AVX A;  5JRC B;  2MHK A;  5AEN A;  2X38 A;  4FJO A;  2X66 A;  4APF A;  1AJ3 A;  3LFM A;  2OA5 A;  1IJ6 A;  4XBF B;  1LF8 A;  2VGX A;  3HDX A;  4GPK A;  2X67 A;  2C5K T;  3RO3 A;  4J8D A;  2PQR A;  3MV3 B;  5ADX L;  3DPD A;  4UF0 A;  5BMV E;  1S35 A;  3VTY A;  2W00 A;  2E9X A;  2CXF A;  3NQP A;  5FY7 A;  3EDT B;  3JYS A;  1P5Q A;  3O4X E;  5EK4 A;  3GN5 B;  3CVW A;  1H2V C;  3C98 B;  4AOF A;  5KX5 E;  3AS8 A;  5G2N A;  2QY7 A;  3IHV A;  4CI1 B;  3PU3 A;  3LDZ A;  2Y8D A;  4UQX A;  2WXF A;  5EKQ D;  1IYG A;  1U4Q A;  2OND A;  3ZFW A;  3FUF A;  3MCX A;  3HVE B;  4EZL A;  1OWO A;  2AVP A;  3Q49 B;  2KAT A;  1Y8M A;  4U0U A;  4MKT A;  2BTD A;  4ATG A;  4N2Q A;  3N9M A;  1OUV A;  3KVB A;  5C2Y A;  2WMN A;  1BR0 A;  5FXW A;  1WYC A;  4TN7 B;  1QZ2 A;  5F8P A;  4GYS A;  4TRQ A;  4JHJ A;  3B7S A;  3PE3 A;  3N9N A;  3RC3 A;  3ZPJ A;  3QWP A;  4GML A;  2DWG A;  3S2A A;  1D0X A;  2LHN A;  2DCP A;  3FUD A;  2IFU A;  2WXO A;  4Y6W A;  4KYO B;  4K03 A;  5DBK A;  1Z3Y A;  2UXN B;  3QKY A;  3EVY A;  3UUX B;  1HZ4 A;  3FTY A;  4YVQ C;  4ZI2 C;  4ABN A;  4DI4 A;  2KND A;  2QFC A;  3CVP A;  4G23 A;  4FAD A;  4OFZ A;  3I0Q A;  3C50 A;  3TG5 A;  2RG8 A;  1TEZ A;  2VYI A;  5HXH A;  3ZYM A;  5T3R A;  3R7R A;  5JDF A;  2MBG A;  1LRZ A;  3TXN A;  3PNT B;  3PUS A;  1EDU A;  5L3F B;  4PS3 A;  4DMW A;  1NZN A;  3A5X A;  3G2W A;  2V7I A;  4KP3 C;  3JUI A;  3PS6 A;  2FO7 A;  2WVI A;  5FXV A;  4LER A;  4DVD A;  2J4B A;  4G63 A;  1TJF A;  4ACL A;  4HVB A;  3QAQ A;  4WNE A;  4QHO A;  4MLK A;  4OYK A;  3C4Z A;  2Q9Q C;  3PVL A;  4TV3 A;  5LJM A;  4DJA A;  4BTA A;  3UT8 A;  4D10 C;  2KM4 A;  1XGW A;  3HHM A;  3CGH A;  4IE5 A;  3Q47 B;  5JH7 E;  3MV2 B;  4GZ5 A;  4ZOL E;  5ARF A;  3Q9D A;  5FJY A;  2X3M A;  2ODV A;  3APD A;  3FFL A;  1U3C A;  4G2A A;  2Q9Q D;  2HH7 A;  2H7O A;  2WQ6 A;  2Y48 B;  4JLE A;  4YFS A;  3S7F A;  2RP4 A;  1ELW A;  2WXM A;  3SNX A;  4MHC A;  2Y4T A;  2CMR A;  3VHL A;  2W63 A;  3LJC A;  5DQW A;  4XKB A;  1LVF A;  4U72 A;  3SZ7 A;  4UXN B;  5LA6 E;  4O8S A;  2E0I A;  3ZMT B;  3RYH E;  4V3I A;  3ZMS B;  5CA1 E;  5KCM A;  4UVA B;  2V0P A;  4CGW A;  4AIF A;  3LXU X;  1UN9 A;  2KIN B;  3D9J A;  4DBQ A;  3P1U A;  3HI2 A;  5KJL A;  3LYA A;  4H7Y A;  3E08 A;  2X68 A;  3R9A B;  5G05 J;  3AAI A;  5ETW A;  4F53 A;  2WMO A;  4ERR A;  3ZEF B;  2FBN A;  4M1P A;  2L9B A;  3C4W A;  3FH7 A;  4RG9 A;  1US7 B;  2LAH A;  3UFE A;  1NAF A;  4JUY A;  2C2L A;  4PUC A;  2DCF A;  4H63 V;  4CXW A;  4EZH A;  3RJV A;  3CIA A;  2FUL A;  4DI3 A;  3L17 A;  2CXD A;  3ONK A;  3U78 A;  4I43 B;  2LNI A;  3NRX A;  4J6I A;  5JDL A;  4AI6 A;  5FQ7 A;  2YU1 A;  3CV0 A;  3L13 A;  5LG4 A;  4CDR A;  1HU3 A;  4EYY R;  5E75 A;  4M3O A;  2ZM0 A;  2C5J A;  3L22 A;  4XI9 A;  4UWG A;  3T5V A;  3RYF E;  4BX8 A;  4GA2 A;  3CHM A;  3PRE A;  3JQ1 A;  4Q94 A;  5EK2 A;  4ANJ A;  4PH4 B;  2L0T B;  2CM0 A;  5HXS A;  4N78 D;  3NF1 A;  4JL0 A;  4P29 A;  5LGT B;  3PTR B;  4GOU A;  1ZHC A;  2VKD A;  5LP6 E;  5LCW C;  5E0O A;  2AXZ A;  2KXP B;  3D0T A;  3K8P C;  1UJJ A;  3FBL A;  2I1K A;  2CHX A;  3MZK B;  2LSK A;  4A3T A;  5FQ8 A;  2NW7 A;  3HYM B;  4CI2 B;  3IEG A;  3LG7 A;  1KNZ A;  1UN8 A;  5DJQ C;  2J08 A;  5HWX A;  2WXN A;  4LCT A;  4DO0 A;  2V26 A;  1EPU A;  2DBA A;  2XPY A;  4JHR A;  5LXT E;  2B1E A;  2YHE A;  1OXZ A;  1WY6 A;  3SFZ A;  4URK A;  2VGY A;  4MRU A;  4FP7 A;  3KFW X;  5LHH B;  3V5U A;  5FTP A;  4ACK A;  4FLB A;  3ETV A;  4FA6 A;  3S4U A;  4AKG A;  4N2S A;  2X0L B;  3FU5 A;  4DMV A;  3MKQ B;  3OYX A;  2QA7 A;  5G04 C;  2WQH A;  3EHN A;  3LEW A;  4C91 A;  4BX9 A;  3I1A A;  3TG4 A;  3IV0 A;  2WXI A;  3KBT A;  3GYZ A;  3NZP A;  4Q96 A;  4TZ4 C;  3IBE A;  1SZ9 A;  4N39 A;  4PAG A;  4AEZ C;  5IYZ E;  4HXI A;  1IAP A;  3N2G E;  1EZ3 A;  1JPL A;  5KJN A;  3PDY A;  3AA0 B;  3CK9 A;  3Q2M A;  2MTQ A;  2CHW A;  1MIW A;  2VGX B;  5FXZ A;  3H3A A;  3JQ0 A;  3K3N A;  2OV8 A;  3KBU A;  4CCA A;  4A55 A;  1FMW A;  3EIQ C;  4TX5 A;  3U64 A;  3ZPO A;  2W61 A;  3ZN1 B;  2HYZ A;  1EYH A;  4UI9 J;  1U5P A;  3FB2 A;  5C8Y E;  2VSX E;  2XCB A;  2N9D A;  3FUL A;  3MKD A;  3ZHE B;  5AJL A;  2XGM A;  2KMF A;  3MGB A;  5FXX A;  4JA7 A;  3ZW3 A;  2YHC A;  3DJB A;  4HFV A;  2CFZ A;  5KJK A;  2IC9 A;  4UEM A;  1HF8 A;  3FWV A;  1VOM A;  3D9L A;  2V7M A;  3CML A;  3PUR A;  4A1G A;  3UPV A;  3AA7 B;  3TGO A;  3J9X 1;  4GZ3 A;  2WWU A;  3FHE A;  1S94 A;  5LBQ B;  2XHE B;  4AKH A;  2FEZ A;  3BQI A;  4DND A;  5CA0 E;  2DLR A;  3KD7 A;  2N1G A;  5EZY E;  3V5S A;  4KMC A;  4FJY A;  4EZJ A;  3APF A;  4EXT A;  5JHA A;  4E7Z A;  3C4X A;  4IE4 A;  1Z3X A;  1YKH B;  3KIN B;  3QC9 A;  2CG2 A;  3D3M A;  5DAB A;  4HTE A;  5LHI B;  4G1T A;  4GZ6 A;  3L54 A;  1Z0P A;  2P9B A;  2WXG A;  2D5U A;  3I9W A;  4LRZ A;  1MMD A;  4J8E A;  3DP7 A;  5CCL A;  1UW4 B;  4WUY A;  4N5C A;  2L6J A;  1GW6 A;  4AM9 A;  3PDN A;  1WM5 A;  2VSO E;  3I0O A;  3KV9 A;  4A56 A;  2XUE A;  4I43 A;  5LFA A;  4PW8 A;  3L3P A;  4JEH A;  1U3D A;  1JWG A;  2OVF A;  3ZCJ A;  2V7J A;  1OWP A;  3TXM A;  2OVB A;  3FEX A;  1DVP A;  2HM8 A;  4Q69 A;  2CLY C;  3CST A;  4U0Z A;  5DIZ A;  4CT0 A;  3ASD A;  1NA0 A;  2GRM A;  3FEY A;  1MQS A;  4H9N C;  4DLQ A;  3MAC A;  2K9A A;  3N9L A;  2LSI A;  2OOE A;  4P0B A;  4XIF A;  5JR9 A;  5JQG E;  5A6C A;  3PUK A;  3EHM A;  4DLO A;  3APC A;  1D1C A;  4J8S A;  4XZC A;  1O3X A;  3UX4 A;  2KCV A;  2LSV A;  4CDN A;  1H2T C;  2WXJ A;  2C5I T;  2WXP A;  2I6H A;  2VTB B;  4WNF A;  5A23 A;  4PJJ A;  4GYW A;  1XNF A;  4B0Z A;  3QK0 A;  3OTN A;  5ANL A;  3J7Y q;  3KS2 A;  4ZI3 C;  3S7D A;  3SBS A;  3VLF A;  2V5F A;  5ARG A;  3CX8 B;  2CXL A;  5F3J A;  4ADZ A;  1UCU A;  1E90 A;  2K48 A;  3URZ A;  5EDS A;  5HXC A;  1ZU2 A;  2C0M A;  2D0T A;  4CXY A;  3ANW B;  4O2B E;  3KAE A;  4ZI7 E;  3FTS A;  2Z6E A;  2A3D A;  2GRL A;  2XPI A;  3OXF A;  3ZYQ A;  4H9Q C;  5J2U E;  1SA0 E;  2PBI A;  5EX3 A;  3EJN A;  2X9X A;  1LVK A;  3R7Q A;  1QSD A;  2J09 A;  5JHB A;  3Q4A B;  3L09 A;  3UQ3 A;  3FU3 A;  3B7R L;  4JC8 A;  3ESK A;  3CVN A;  2RA1 A;  4IUL A;  4LEU A;  3CHQ A;  3CHS A;  2L9Q A;  3FTW A;  2PL2 A;  3ML9 A;  2KLQ A;  4PS8 A;  4HOU A;  3VKH A;  4E7S A;  2IAK A;  5LYJ E;  5LX8 A;  4L1B A;  3F57 A;  3JCK C;  3KV5 A;  2E2E A;  4C0E A;  5JDH A;  2NSZ A;  4FHJ A;  3LY9 A;  3GZS A;  3K3Q C;  1BPO A;  3O1H A;  3U4T A;  5FZQ A;  1UJK A;  5EK3 A;  3RX6 A;  3FP3 A;  3MX3 A;  2GGF A;  4OK0 A;  1OWM A;  3L6A A;  4BSX A;  3BK9 A;  4J2C A;  5FWQ A;  2CLY B;  3ONL A;  3RC8 A;  4IHJ E;  3RKO A;  3ZCI A;  4JPS A;  3PNL B;  4WNK A;  2XRZ A;  5FMN A;  3CHR A;  4FJZ A;  2CHZ A;  4EIW A;  2ZM8 A;  2E8I A;  1FCH A;  3K3O A;  5FZS A;  4UEL A;  1HXI A;  2DWK A;  4CGV A;  3ML8 A;  4F1S A;  4XI0 A;  4B89 A;  4IIJ E;  4NQ0 A;  2DI4 A;  4HOT A;  1FEW A;  4JEU B;  2EHO C;  2ZMA A;  1E7U A;  2VQ2 A;  3VLD A;  4ILH B;  5HQ8 A;  4ZI3 D;  3LS8 A;  2X51 A;  1MIV A;  2J4D A;  3FTU A;  1DNP A;  1H0A A;  4H9R C;  5BV1 A;  4ANV A;  3ZN3 A;  1HS7 A;  2LSG A;  2XQY A;  2PG8 A;  2M67 A;  3NBX X;  3PUA A;  2LM9 A;  3KV4 A;  4DK5 A;  3TAX A;  4GU5 A;  3AVR A;  4C90 A;  3N5L A;  3NZS A;  3FXE B;  1N52 A;  4AKR B;  4Y6C A;  4CI3 B;  4CT4 A;  3HVE A;  3CX7 B;  5JDG A;  1IHG A;  1H7C A;  3CVL A;  4UVB B;  4OHF A;  1MIY A;  4WND A;  1Z6T A;  3G2U A;  3CKB A;  4UWH A;  2ACX A;  3CQX C;  3GN5 A;  3EUH A;  4O4J E;  4EB6 E;  2XAH B;  4X20 E;  5LCY A;  4FHK A;  4GAA A;  3OJA A;  5C1D A;  4H7X A;  4TV8 E;  4O2A E;  3SS1 A;  4L7T A;  3R6N A;  3FTX A;  4L0R A;  2D0U A;  4UF0 B;  1IQU A;  4UQZ A;  3PEV B;  2YQ8 A;  2KWH A;  5BUZ A;  2WB2 A;  1ELK A;  4JA9 A;  3H37 A;  4HN9 A;  4A1S A;  4GMJ A;  4ANX A;  3U3I A;  4GIW A;  2ILR A;  4XE0 A;  3D9O A;  2K24 A;  1Y6I A;  2KZ7 B;  3ZN0 B;  3CHO A;  3RRW A;  3KV6 A;  4X1K E;  5LCW J;  1HG5 A;  1ZBP A;  3QAR A;  4I1A A;  3L08 A;  4JEU A;  4OYS A;  4I9E A;  4EQF A;  4EYU A;  4APO A;  2FF4 A;  3SWH A;  3FTZ A;  4AKL A;  3FUN A;  5CMY A;  2DHR A;  3LPZ A;  3ESL A;  4IRU A;  2WBL A;  5LOZ A;  4FC8 A;  2PZI A;  3OXL A;  2KC7 A;  2CCQ A;  2EQX A;  4WNG A;  4ANU A;  3MK7 C;  3OYZ A;  3CVQ A;  4AJW A;  2BVL A;  4N3C A;  2Y3A A;  4IE0 A;  3FU0 A;  5G04 J;  1E8Z A;  1HCI A;  3UT4 A;  1E8X A;  3ASF A;  5AIJ A;  3G2S A;  4GA0 A;  1BR1 A;  3MJW A;  1OWN A;  5H6Q B;  3K9I A;  2V1D B;  5M72 A;  3OXG A;  5JRE A;  2HO1 A;  5FP3 A;  5M4Y A;  5IHY A;  5FZR A;  3IKO B;  3GW4 A;  4JHK A;  3ZHE A;  4G11 A;  5CB4 E;  4HOR A;  1HX8 A;  2XAQ B;  4NUV A;  1YW0 A;  1KK7 A;  4I4T E;  4MS6 A;  3MXZ A;  4IST A;  2CWY A;  4B6X A;  1QNF A;  4EBA A;  2C0S A;  2KWI B;  3FBZ A;  3P7I A;  1HTJ F;  4MBQ A;  3E4B A;  3ZMZ B;  1MMN A;  4IN3 B;  3RO2 A;  2BZB A;  3BQK A;  4P09 A;  2Q7F A;  2N2N A;  2Q9Q A;  4NUR A;  5FYM A;  4I50 E;  2NXP A;  2ZU6 B;  1ELR A;  4AY6 A;  2EHO B;  3SHF A;  4TUU A;  1ZEE A;  2XTL A;  4GYR A;  2I2O A;  2XAS B;  2BUG A;  2L0I A;  3TKL B;  2CG3 A;  4KVM A;  3FH8 A;  4P0A A;  3MKQ A;  5T8I A;  3QNK A;  3ULQ A;  1E8Y A;  3ANW A;  4C0M A;  2VK9 A;  5KMG P;  4EBA G;  1WAO 1;  2VWA A;  2L3L A;  5G55 A;  4IE6 A;  4EZ4 A;  4J8F A;  4GCO A;  2PM7 A;  4AXP A;  4ZI2 D;  3P8C D;  2Y6X A;  3B7T A;  3LY8 A;  4GYY A;  4FLH A;  3HR0 A;  4QFV A;  5L2L A;  4V1A v;  3FUK A;  1PAQ A;  3FUI A;  4PJN A;  4LUN U;  5HI7 A;  4PK6 A;  4BJM A;  3FU6 A;  4HEA A;  4HS2 A;  1IJ5 A;  4FU3 A;  4PDX A;  4BJN A;  3RU0 A;  3LBX B;  2YEV C;  4CDM A;  2LEH A;  3E0Z A;  3ENE A;  4L5G A;  4EEC A;  5AYW D;  2MOW A;  5D0Q D;  2LAI A;  4BWR A;  3ZJ1 A;  5CCM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...