3B13A

Crystal structure of the dhr-2 domain of dock2 in complex with rac1 (t17n mutant)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
427
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for mutual relief of the Rac guanine nucleotide exchange factor DOCK2 and its partner ELMO1 from their autoinhibited forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords Dedicator of cytokinesis protein 2
total genus 139
structure length 427
sequence length 427
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b13A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3b13A01
2YINA 2WMOA 2WMNA 3VHLA 2WM9A 3B13A
chains in the Genus database with same CATH superfamily
3FXDB 2VGEA 4HRMB 3ONXA 2CXDA 3EHZA 1E8WA 5LG4A 4RQIA 1MMGA 1E90A 3V5UA 4A1GA 4NPPA 3G2WA 3MX3A 2ZMAA 4KHPT 3BG1B 1NI1A 2RKKA 3PS6A 3C51A 4DRXE 4HB5A 4N3AA 2YU1A 4PS7A 3ONLA 4GYWA 4EBAG 5IHYA 1FVFA 3PE3A 1U3CA 1ZB1A 2VASA 5A23A 4U2ZA 5JREA 1OWPA 4JI4T 4TUMA 3C98B 2KCVA 4I0UA 5HXCA 3TWRA 2YQ8A 2NOXA 5HWXA 2YDSA 4MKTA 2HHHT 1A5EA 3UM1A 4YVOA 4JA9A 4FHKA 4M7CA 4PDXA 3JADA 3RYHE 4H9SE 2F37A 5AQNB 3CVQA 4WBOA 5E0OA 1IZNB 4AJWA 3DSTA 3LFMA 1SZ9A 3SGHA 5FZSA 3AXJB 3KV5A 1N9AA 4U7EB 4HOUA 2XZTG 1JNZA 3UUMA 3CVYA 1TNYA 2LLYA 5JJ6A 1CUNA 2I6HA 4OYSA 4ABNA 4DBQA 3FZLB 4B93B 1Y6IA 2DWGA 1WYBA 3QB5A 5FY0A 1NFIE 2RP4A 2DVWA 1OWAA 4A56A 1KT1A 2CXFA 2J08A 5JR9C 3IBEA 2EIJE 1HZ4A 2VYIA 3AG2E 1BR2A 4DVDA 1UK5A 5FKYA 3UINC 1O1RA 4XIFA 1Z3XA 3JUEA 2AVPA 4J6IA 1TN6A 2A5EA 4UQZA 3RKOA 4Z8XA 2NP9A 2FJAA 4IE7A 1J5WA 3FBZA 3R9AB 1H6PA 3L3PA 4ZI3C 1EYHA 2XHEA 4PAGA 3TLVA 4DX7D 2QGSA 1IBMT 3LBXB 3DBSA 4YDYA 2XRYA 1LKXA 2XAFB 4DR4T 3Q9UC 4I9EA 2R02A 2BS2A 4N5CA 2V7IA 5EX3A 3ABME 4U33A 2ETBA 5CA1E 2OCCE 3QNKA 1DCQA 2VJ8A 3HXCA 3OXLA 2OA5A 4BERA 4UELA 3OTOT 3ASOE 4JHJA 3FH8A 5AQQB 2R5SA 4QH1A 4GYSA 3DSUA 2QFCA 4X5TA 1N34T 2N9DA 3OAWA 4KBQA 1TN7A 2CWYA 3QWVA 5CMWA 4CN4A 3CIRA 2E5LT 3AB3B 1OEDE 4E6HA 4X1KE 5D0QD 4LF5T 4JI6T 2L0TB 1KK7A 3CVLA 4H9RC 2X9XA 4IYPA 5FY7A 2XQAA 4JYAT 3F31A 1KPSB 2Q7FA 5CHEE 3B5MA 4GZ3A 2IJGX 4TUUA 1OT8A 3SBTB 2LOSA 2XPZA 3AE6A 3NZQA 2HR2A 5AQRB 4DIDB 3QARA 4KUMB 3F6QA 2VSNA 3N2KE 4IE4A 3P4QA 1N4QA 3ZKJA 3FHNA 2LSUA 3VHLA 4A3VA 5E76A 1US7B 5L4HA 2GRRB 3L54A 2MYOA 3NWIA 5AQMB 2A4ZA 2BDEA 3DSVA 3HXEA 2Q9QA 1EZ3A 3K9IA 3O1IA 3N2OA 2EIKE 2LSKA 2X6FA 2DCFA 3JAEA 2IIUA 3AEBA 3KS2A 4DX6D 4BTBA 2ZM8A 3ABKE 2A9UA 3G2UA 3SO8A 2CHWA 3IA3A 2CBJA 2GRPB 3ZGQA 4HWIB 4EV6A 3UU4A 1ZKEA 4YXDA 1OY3D 3RYIE 2F8XK 2XY8B 4YHHT 3NBXX 3LY7A 2XS8A 2FUPA 4OHFA 2V7MA 1XGWA 3Q9NC 4I43B 3SY2A 3QWPA 3DWLG 4U7YA 4J8DA 3MA9A 2ZM2A 3Q2MA 5LOVE 4TXPA 1T72A 2CG3A 5HWYA 2MBGA 3MJXA 3DP7A 1LVKA 4HXIA 2EIME 5ENSD 3U3IA 2WMNA 3D9IA 3UUBA 2YEVC 2ETCA 2P9IG 4YDEA 5FXVA 2X6KA 2MTQA 3LPZA 5FWQA 4AKIA 3MA5A 1DU2A 1NL4A 3FZHB 1ZHCA 4ILBA 4H9OC 4LG6A 3HHMA 3FUKA 3I0OA 2KZ7B 2C5JA 4DR7T 5L3DB 3Q5WA 1DNPA 5D66A 5KNHD 4XE0A 2E9XC 2H7OA 4BFRA 5CBOA 1UN9A 1HH8A 3Q79A 5LMUT 5KMGP 3H37A 4NUUA 4CZZB 1E8ZA 2IOSA 3PEVB 5AENA 4AVXA 2HH7A 4BAYB 3EUVA 3HRAA 1O3XA 3EDTB 4K0UA 3D3MA 3UT8A 2W66A 5EX0A 3RQWA 5FXXA 5ENPD 4HFBA 3OYXA 2ETAA 1TN8A 3LVQE 4EECA 3I1AA 3PNLB 3AE7A 3FU5A 2NWBA 4KP3C 4G1TA 4MLPA 2OVBA 4ZXLA 1E96B 4JL0A 3EVYA 1A17A 4DO0A 4I50E 1MIVA 2FO1E 4WNDA 5EYLA 4AIFA 3DPDA 4GYOA 3S7BA 1O1TA 4GIWA 4O2BE 3CQXC 3PUJA 5ENRD 3HKEE 4N3CA 5AQSB 2CHXA 5CMYA 3QAQA 3SF4A 2M67A 1BI8B 5ANLA 1FVHA 5FP3A 1G73A 4KI0F 1WR0A 5L3FB 3ISMC 3ZHEA 4G23A 5LG3A 4BY6A 3P4PA 5GONE 2XASB 5DBKA 3UMVA 3FULA 4N5QA 3KDSE 4HTEA 3QB5K 1XDPA 2V8SE 3FWVA 3N9QA 1HF8A 3TWTA 2XAGB 4M1PA 4YSZA 1QQEA 4JI1T 5DQVA 1BLXB 1H0AA 3ZC0A 4EXTA 2X66A 2FJDA 3RIUC 4XZCA 5AQFB 2R59A 3FTWA 2X9HA 4IRUA 1N95A 4FP7A 3AA0B 3CK6A 4FJOA 4DMVA 4DR3T 1H2VC 3VTYA 5AAOA 4GZCA 4U2YA 4FI5A 3CIAA 4Q96A 4L9PA 4MFRA 2KNDA 3AE8A 5AIJA 1W0AA 2LSIA 4J7WA 4XI9A 4LF4T 2BG9B 2UWJG 1LD7A 4FULA 1L5JA 3QKYA 1O1SA 3UPVA 3RF1A 4YVQC 3FTUA 2CG2A 2A72A 1H7CA 4N78D 4PJNA 3TLWA 4AOFA 4DR2T 2KMFA 2FBWA 3ZMSB 3IEEA 3QC9A 5LJMA 4ANXA 4FC8A 4I1AA 3UIOC 4H63V 3I0QA 1UUSA 3ZYKA 2E0IA 4KXKB 2WXGA 2Y3AA 4DUIA 1FMVA 2WSSV 3CK7A 3ONJA 4LNBA 2GROB 2WXRA 5HCJA 4XZ4A 5HAXA 1VDYA 4HLLA 3AJIA 3L13A 4KVOA 2Y1LE 1DCEA 2HM8A 4JW1A 5FTPA 2RPAA 5KJMA 4I55E 1NA0A 4EZHA 4Y6CA 4AY5A 2HPLA 2A5UA 4PJMA 4GCOA 2EHOC 3CHPA 3JQ1A 5KJNA 2LKHA 4HOSA 2LE8A 1E7VA 2FI7A 2IDOB 2X67A 3HG0D 4BSXA 5LJNA 4TWDA 2WXLA 3MZLB 3APFA 2HE0A 3NF1A 4DV0T 4Z91A 3ZSSA 3ZN0B 1FEWA 2WQHA 2VKJA 1Q2ZA 4WNKA 3IHVA 4BWRA 2WXFA 3QK6A 2CPTA 4PK5A 3IHYA 4UVBB 5FL1A 3UQ3A 2XAJB 2XQ5A 2WXJA 2D2SA 5LB7B 3HR0A 3LDQB 4YY3T 3ZEFA 3T1YT 4JZYA 3Q9DA 3SQVA 3PJAA 3AAIA 3Q78A 2EQXA 1HNXT 2LOPA 2R2LA 3PUXF 5LCWC 4XKBA 3L22A 2V5DA 2J09A 4CN1A 4JXTA 5BPPA 3LSVA 3IXEA 3ZU7B 3ZJ2A 3FUDA 4D10C 2IU1A 4K0RA 2AXVA 5AARA 1Z3YA 3RYFE 5BNWA 2LM2A 2X6IA 3RRUA 3FUFA 4K5AB 4PK6A 1MMDA 2AWIA 3RKVA 4ZI2C 2IUBA 1MX2A 3EABA 1WLXA 1XNFA 4JHKA 1PAQA 5L2LA 1CHUA 1BU9A 3AA1B 4CDRA 1FT2A 1ZV4X 3AU4A 2W2UA 1DC2A 1IJ5A 2VSXE 3ESLA 1K1BA 3HL6A 1SQMA 2YDRA 4Q69A 2VVSA 4JV5T 1UURA 2R03A 2PQRA 4L2YA 3UFGA 5AQ9A 3C72A 5G05J 4X66T 5ENQD 4ZS3A 2DHRA 2XSBA 4NRHB 4GTVA 3W9GA 1JWGA 4HFDA 2E9XA 5EK4A 4PK4A 5BV0A 4KBMB 1N54A 1OCCE 1S64A 2IO3C 2XJ7A 5ABFA 1TEZA 2CRBA 5AJLA 3X2QE 4HFIA 5G2NA 4CDMA 4GZ5A 3RSEG 4DBRA 3UFEA 2XGSA 3V31A 1H2UA 1D0XA 2X51A 2PJQA 1VRBA 3MKQA 3FP3A 3ZMZB 4NXMT 3MCXA 3ZXSA 4IULA 4UWKA 4YHJA 1N4SA 1OWOA 3PNTB 3W9FA 1D0ZA 4J0UA 1JNRA 3D9JA 1HE8A 2V8SV 3PUQA 3QK0A 3DSXA 3CHSA 3ML8A 3P4RA 4IE5A 4JHRA 3L9TA 3UT5E 4YDWA 4DI3A 3LVRE 1E1HB 1D8DA 1OWNA 3ASDA 3N9NA 5LHHB 2XGMA 2LJLA 1E7UA 4EZKA 2DYRE 2IFUA 4X62T 4EYYR 5J2TE 4HWDA 1HR0T 3R7QA 1N0RA 5FMNA 3J9X1 2C0LA 4B94A 5LHIB 5HI7A 3CWZB 3LYAA 3APDA 2XZDG 4NIKA 2H6GA 2Y69E 1H6OA 4CT4A 4OAVB 2PZIA 4A63B 4U8HA 2XAQB 4UI9C 1OWMA 1BR4A 3MKDA 4JI3T 2JMKA 2VQET 2XQ9A 4JI0T 1EF1C 2LXMA 2WP9A 2XQ3A 3SZ7A 5LNKA 3EUHA 2LNIA 2ZU6B 3UI2A 3F2EA 4PNIA 4F3VA 3HVEA 3UM2A 2ODVA 3UX4A 2WB5A 3E30A 1ELWA 2KATA 4U74A 3ASHA 4DUYT 4KT6B 4HLEA 2E2AA 5FZRA 2WBLA 1HNWT 4DX5D 3PZ3A 4TV8E 2WS3A 3TWUA 4APOA 2QRXA 1KNPA 1UX5A 5FVLA 1IXVA 2R17C 2DIWA 3PUSA 4G8KA 2OEVA 2I9CA 4F1SA 3QC1A 1UJJA 4I6JA 2XRZA 5HEJA 2WXPA 3UU5A 2KWHA 3CK8A 2XPKA 4AQYT 2WWVA 4V1Av 4P09A 4EB6E 3PUWF 4RSYA 3Q15A 4G26A 3SFXA 1AJ3A 1KNZA 4HRNA 1QUUA 2DYSE 2BVLA 4EBAA 2JQHA 1WR6A 4I6GA 3DTOA 3FTYA 2ZM0A 2F0YA 2AXDS 2CM0A 4GKKT 1KEYA 1RW2A 4CXYA 2VSOE 3RPUA 5ABEA 5JDNA 4U95D 3FU6A 2JJ9A 4UWLA 4FJYA 3ZXPA 4WBNE 4X64T 4PW8A 5IYZE 1FPPA 4N39A 2W67A 4EEBA 4NACA 1YA0A 4DUZT 2DCPA 4G25A 3PU8A 5B3SE 5FL0A 4A5XA 2R6GF 1MIYA 4HGAA 1JUQA 2BBJA 2NW8A 4IDOA 4TUYE 5AQHB 5AQKB 3EJNA 3L09A 4XAXB 4MRUA 2RD0A 2JEKA 4GMRA 3UM0A 3PRZA 3G2TA 3AG1E 5AQGB 3U9WA 4HEAA 4DR5T 1IHBA 4LMLA 4ASKA 3JXIA 3BQOA 1HU3A 3I3NA 4N3BA 4LF7T 2CE7A 5C2TA 3MZKB 4X65T 5HRYA 1I6ZA 3BU8A 3ULYA 1L0VA 4MLKA 5ENNA 1WY6A 4TWFA 3EI0A 4H9PC 1H19A 3T9KA 2XAHB 3AS5A 1D1CA 4F7AA 4MBGA 4UEMA 3N2GE 4H9NC 2YHEA 4MHCA 5AYWD 3NVOA 3AVRA 3QOFA 4HBDA 2FULA 5FNVE 2K9AA 5IUXA 2UUCT 2XQ4A 3RO2A 2BKNA 5LA6E 3EHMA 4C0MA 2WM9A 4KHZF 2X3MA 1MQSA 3NBNB 3NOCD 4JVSA 3ENEA 4JEUA 1N11A 2MHKA 3TXMA 1IJ6A 4ANJA 3CR3A 2WCAA 4IDZA 5CCMA 4DR6T 4QKNA 2PM7A 3DSWA 1Y8MA 2L3LA 4G2AA 3K3OA 1Y64B 2V4HC 4UI9J 3SFYA 3E37A 4RLYA 4O6FA 5D0OD 5B1BE 1KZPA 3E33A 1QYMA 2PL2A 2WXNA 4ZZBA 4CQIA 2V0PA 3R84B 3C5RA 3ETUA 4N2QA 2WQ6A 2UXNB 2ACXA 2X6HA 1IQRA 1P5QA 3ZW3A 1JCSA 1JCQA 4XI0A 2KCKA 4QHOA 2VWAA 1MMAA 2FJBA 3AEAA 2L0IA 3UKRG 4JD2G 1LF8A 4IE0A 2KSRA 2MOZA 3ZT5A 2NSZA 2BBHA 2J1DG 2ZGGA 4CXXA 2J9QA 5CERB 3ABLE 3CMLA 5ITZF 3GA8A 2P58C 3OKQA 5A1LA 3Q75A 5EK2A 5JRCA 3ZPOA 1H6KA 5IY5E 4AXPA 3ULQA 4ZZCA 5HXHA 1PC2A 2JPFA 5LHGB 2KZTA 2NC9A 5FQ7A 3PE0A 3T1HT 4B8AA 2WWUA 2NTXA 1MJ0A 2XUEA 3UT4A 3ZT7A 2ZISA 3LJNA 4H7YA 1VCTA 5L4EA 2EHOB 5LCYA 3ZLIA 2N1GA 4H7XA 3A5XA 3FEYA 4EAHA 3DPYA 3Q73A 4YDOA 2V6YA 4IDPA 3PTRB 3PZ4A 3Q7FA 1I94T 4HFVA 2P9LG 3B95A 2ONDA 4BTAA 3EAMA 3SRZA 2H6HA 3AE9A 1TNUA 2J07A 4I17A 3AECA 2XM1A 3FDHA 1HTJF 4QX8B 2LSGA 5J1GA 4ILAA 5JDLA 3QWWA 3KEAA 3ANWA 2IC9A 2C2LA 5H7PA 3FTXA 2V6XA 4YJ2E 4X1YE 3RC3A 4BX8A 4P29A 4GZDA 3T8MA 1QNFA 2LAIA 2J4GA 4F6RC 2W62A 2IW5B 3PUYF 3IF8B 4PS8A 3S7FA 4DV3T 3JC6D 4HI8A 3TLTA 2B76A 2VKOA 2GW1A 3KD7A 3OBVE 2BVMA 3Q47B 1FT1A 3E08A 3CQGB 3UTKA 3KBUA 1XNRT 2C5KT 2NXPA 3NZSA 3AA7B 3MK7C 3ZSTA 4GK5E 3O4ZA 4OVUA 2D5UA 2W4XA 1B7TA 3ZKRA 3I5PA 3AAAB 2BKKB 5DIZA 2WPVA 5JDMA 3QNUA 3JC6C 4F53A 3CVNA 5HEUA 1R8IA 3TGOA 3OVUA 2JIWA 1AP7A 5JR9A 4P0AA 2A2FX 3JAFA 5LFAA 2WY2A 3LK42 1YW0A 3FTZA 4BT9A 4U3CA 3ZN1B 2W00A 4AISA 2X9YA 5A7DB 2J49A 1HFAA 4B3ST 2ZIRA 4K03A 4WYVA 3D9NA 1LRZA 3TWQA 3UM3A 4EZJA 3P4SA 2IONA 4GOUA 4UF0A 3H3AA 3AU5A 4H63H 2IMLA 3D9LA 1RZ4A 3SD5A 1HS6A 5LYJE 3RIFA 4JEHA 2L6JA 4A1SA 4PH4B 3TWWA 2KXPC 2QY7A 2PG8A 4ANWA 3VR8A 4QH4A 4DV2T 1T8BA 5FZQA 3SNXA 4CGWA 1UOHA 3DJBA 5FJYA 1NENA 2D0TA 5FY1A 2LUHA 3K3QC 3NQPA 5L47A 2CBIA 4ILIA 3JUIA 3TLSA 4U0SA 3RO3A 4EEDA 4CYMD 2VL0A 2I2OA 1HX8A 4CT0A 1ZP0A 4GK0E 1SW6A 4LMKA 4IDQA 2N2NA 2JLBA 3TJPA 3V30A 4UV9B 4HFGA 4EHMA 4Q25A 3QB2A 3NZUA 4WNGA 2DL1A 4APFA 2W0GA 2XEHA 4ANVA 4TNVA 2IAKA 3ABVA 5AN8A 2OV8A 3RIBA 2JQQA 3FH7A 4WZXA 3S4UA 3L6AA 2UXXB 1E7PA 2Q9QC 2D9DA 5AQ7A 4I2WA 3Q4AB 1OUVA 1ZOYA 3A7MA 3CX7B 3ZIMA 1SHZC 2WU2A 3AEEA 4LF6T 2GRNB 2BG9C 3MJWA 3APCA 5KBAA 5BXOA 3TKLB 2IF4A 2PM6A 3MEKA 2WXQA 3J5PA 5FINA 4HS2A 4A3TA 3P50A 3SHFA 1ELRA 4GPMA 1LVFA 4U63A 4U0ZA 1WAO1 2BG9E 4MALA 5LOZA 1W9RA 3KV9A 3MKRA 3V79K 4U96D 5HYAA 5LX8A 5AQVB 5DQWA 3WXXA 4C0EA 4A98A 3ZVVA 4DI4A 4XX5A 4IL9A 4ZS2A 3HA4A 4G63A 3N9LA 3CSFA 2ACZA 4HFHA 3RHWA 4OYKA 4DR1T 2K24A 3MV2B 4JC8A 3MYVA 2BKGA 2WXHA 3JCKC 4JA7A 3HI2A 3ONKA 1UCUA 5ABFB 2V4LA 2L6BA 3ASFA 3C3RA 1HCIA 3TG4A 4FA6A 3CPZA 1D1AA 4GTOA 2YK0A 2VQ2A 4WAFA 5L3EB 2KCLA 4QQIA 3B57A 1FMWA 4E7ZA 4HI9A 2H7VC 1MNDA 3NZPA 4NURA 1MX4A 4UWGA 5FXWA 4O2AE 3SFEA 3AE5A 3C98A 3ZMUB 4UWFA 1BD8A 3K8PC 2KT9A 5KCMA 2X6JA 1KZOA 2FO7A 3AA6B 3L39A 3B7BA 5TAOA 1EPUA 3CKCA 3GWHA 2MYSA 3EHRA 3FH5A 3AXJA 5BT1A 4HQDA 4ISSA 3ZRHA 4EQFA 2ZM6T 2KM4A 1Z6TA 3HKDE 2M63A 4N2SA 4FU3A 3B7UX 3OYZA 4ANUA 2LAHA 2FBNA 4QXCB 3R7RA 5BXUA 3ZYLA 3LY9A 1VOMA 4J8FA 3VLFA 2XQ0A 4ILCA 4J8SA 1GQEA 4UV8B 4GA1A 1ZU2A 4JI8T 3KFWX 4WWOA 3B7RL 3UUNA 1YXRA 2AW6A 2GRLA 4GA0A 4JUYA 2X68A 2LSJA 1D9SA 4PJLA 3B13A 3N9OA 1XMOT 2B6CA 1LTXA 4LMJA 3PZDA 2CMRA 3WAKA 3AS4A 5AJDA 5AQJB 5LGTB 3P8CD 4ACKA 4B3TT 4YFSA 2Y0BG 5CRVA 2IY0C 3X1DA 4HKAA 3FZFB 1H2TC 4L0RA 3R6NA 2UXCT 1SA4A 4L2LA 3BK9A 3C50A 3ETVA 2VGXB 3SOLA 3UUXA 2XCCA 3UTMA 2FEZA 2ES0A 2Q9QB 2H89A 3RLFF 5F3JA 3KBTA 1S0PA 2C0SA 5LBMA 1FCHA 1XZYA 5EYPF 4AIUA 1TR4A 2B1EA 3N9PA 5AQUB 5LCWJ 1X9BA 4U7IA 2KC7A 2UUAT 2Y6XA 3I9WA 4CI1B 4O1PA 1IYGA 3E4BA 4AQFC 4YTNA 3ZCJA 5LGUB 1K3ZD 5JMND 2V7LA 4ZOLE 1YKEB 2WQ7A 3PEUB 4DLOA 4DMWA 5JHAA 1OCOE 2MPKA 2VURA 3S2AA 3ULEG 4TZ4C 3CK9A 5ADXL 3CHOA 4YSXA 3PDYA 1SA5A 4CN6A 2YOEA 5HXRA 5T3RA 1N4PA 4EGWA 2P9UG 4KZ0A 3DEOA 3J5QB 2KINB 1HNZT 1XMQT 4I2ZA 1J1JA 4XEIG 4CDNA 1NWMX 3O4XE 5FQ4A 2WXOA 2P9SG 1OEDA 3VKHA 3PH0C 2OLTA 3GZ2A 5CCLA 4LF9T 5IWAT 4AEZC 5ENTD 4C9BB 1TNOA 3BQLA 4JI5T 2RFAA 5C2YA 3URZA 2CXLA 1YQ3A 4DX1A 4DV4T 3U64A 4BJNA 2CEAA 4ZHQE 1WG0A 2L9BA 2E9XD 1U4QA 1UJKA 1UN8A 1ELKA 2DWZA 3PJAJ 4BT8A 2G0UA 3QUJA 4O4HE 5CJ5A 3MGBA 3AG3E 3HXBA 5C3JA 2UY1B 3P1UA 3EDUA 4HN9A 4UVCB 3I9YA 2Y4TA 3N5LA 4ATZD 3D9OA 2C0MA 4FLBA 2XSAA 3HXFA 3KINB 4UQYA 5JDFA 3S7JA 3TAXA 3CVVA 1KNRA 3KV6A 1DVPA 3GZSA 4KZCA 4C91A 4I43A 4HVBA 1VCSA 4Y6WA 2UXDT 4GTTA 5E75A 2HYZA 2VL8A 4W9RA 4ILUA 2M6BA 4ZHBA 5EIDA 2YDQA 3PU3A 4AP2A 2PTFA 3BQKA 5BV1A 3DSSA 4OVVA 2LHRA 3IBPA 4L1BA 3SBSA 5HS0A 1M7KA 4CEMA 2CLYC 2XQ6A 4YTMA 2KWIB 3FFLA 5J0ZA 2J4BA 1SE7A 4HORA 3T8KA 2V7JA 2R05A 3VU7H 4U0UA 1QBQA 3ZFWA 3FUIA 5C8YE 2KLQA 4UUCA 3FB2A 2YINA 4EZ4A 3CVPA 3UU8A 1MNEA 5CB4E 2V26A 3VR9A 1N94A 1Y01A 2HN2A 2F8YA 1JWFA 5JVDE 2WDVA 2WU5A 4IE6A 2WZHA 5AQTB 4B8CB 1YQ4A 1E2AA 2PQNA 4B0ZA 2CHOA 3W15B 2VTBB 1IHGA 4KVMA 4Z68A 2V5FA 3HKCE 2PFVA 1UGOA 3PUAA 2YHCA 4ZI2D 4BESA 4G8LA 1W09A 5FXZA 2VKHA 4IIJE 1KF6A 4AKRB 2F4VT 1J5ET 5LXTE 2EHOD 4WWPA 4FADA 4O8SA 4AKGA 3UQ4A 4UR9A 4GKJT 4L9IA 4HWHA 2IHR1 1MIWA 3NOGD 2I59A 1FIOA 2QYWA 1S70B 3RIUA 4TWHA 4ILGA 3SWHA 1X79A 2NW9A 1NP7A 3VRAA 3FUNA 3NRXA 4PFPA 2I1KA 4F8HA 2XPYA 4L7TA 3U66A 1UX4A 3L8RA 4GMJA 5FT9A 5JH7E 1AWCB 3FUHA 4KMOA 2KZTB 2AJAA 3GN5A 3IKOB 4QWNB 3ZPJA 3B7SA 2X0YA 2E9XB 2V7KA 5H6QB 2BTDA 2P9NG 4AM9A 3CX6B 1D1BA 5KJKA 2LRLA 5HEHA 2A3DA 2LSVA 5HKPA 4LFBT 1S35A 3ZT6A 4O1OA 3MXZA 4U8VD 2V6YB 3FEXA 3NAWA 3AEDA 1O5MA 4C48B 2QVAA 2XZEA 3HKBE 5B1AE 2D0UA 2E8IA 3O48A 3U78A 1V55E 4HRLA 3TXNA 2UU9T 3ANWB 1IKND 4CZ2D 4IDNA 3R9MA 3LDZA 3QOUA 2ZLYA 3C3OA 3LCAA 1JCRA 2VVNA 3ZEFB 1K8KG 3S7DA 4CCAA 2DNXA 1D8EA 4JPSA 1EDUA 2VSYA 1TJFA 4QH5A 5ETWA 2K3WA 2FF4A 3FTVA 3MV3B 4WWNA 4OK0A 3EU5A 3VRBA 3WAJA 3TWVA 2KXPB 3OTNA 1OEDC 3ZYMA 3ZYQA 5AQOB 3D9MA 5HEOA 3KSQA 3PZ1A 3ASNE 2GGFA 5T4YA 4WNFA 5CBNA 3V5SA 1V54E 4GMLA 4U31A 4E7SA 2QYUA 2OEWA 4B3RT 2JABA 3UQ7A 3ZNGA 4IHJE 2CLYB 4LF8T 3NRYA 4HFEA 4DK5A 4A55A 3RH3A 5JDHA 3L17A 3H3MA 5FQ6A 5FYMA 5EN5D 4J8EA 3CVXA 5JR9B 2Y48B 1N52A 3HVEB 5EZYE 2XCBA 3DEPA 4WNEA 3G06A 1TJCA 2X0LB 4OYJA 2LXLA 1D0YA 3ZMVB 2WDQA 4CRWA 4GTSA 5KDMC 1WCRA 4QFVA 3RQUA 2BZBA 4L23A 4O4IE 1UW4B 2J62A 1JPLA 4JEHB 3E22E 5BUZA 4GB9A 2XS1A 3KEZA 5JDQA 4GPKA 2BS3A 5KNGA 3V2XA 4ACLA 2CFUA 3ZN3A 3U3WA 3TG5A 4B3MT 4UIGA 2P9PG 2ODUA 5HXEA 4I4TE 2DI4A 1M62A 2WQYA 4RG6A 3ZUVB 5H6RB 3CEQA 3PDNA 4UWHA 4PJJA 3JQ0A 3CKDA 3IEGA 4CGVA 2LKGA 4CI2B 4C90A 1MMNA 1V9DA 1XWMA 4BJMA 2WXIA 2BKOA 4WW0A 2WB2A 2CFZA 4R7LA 2YN6A 2IO2C 1WFDA 3FXEB 1N0QA 2XQ7A 1QLBA 3PUGA 3AEGA 2J8SD 3LG7A 4JLEA 3LXUX 3N71A 3VLDA 3EIQC 1OXJA 3EIJA 2K5BB 2W63A 3KAEA 3M65A 1N33T 2ZXWE 2C5IT 3PUVF 4DLQA 1TYQG 5L3BB 2IQCA 3CGHA 2OOEA 3FU3A 4HNAD 4M3OA 3AAEB 3NB2A 2XQYA 3K3NA 4NUVA 3MACA 5HXSA 4B89A 3CVWA 2E2EA 2VQFT 2DBAA 2PNNA 4Z90A 3SS1A 1WM5A 4XBFB 5BW8C 1T98A 5LBQB 3BG0B 3RJVA 2XTLA 4QXHB 4YLHA 3TL5A 3UULA 2B0OE 4X8QA 5FIOA 5CA0E 2ILRA 3FZKB 4B6XA 2SPCA 3P7IA 4HE8A 1N36T 3UT7A 4O4JE 1U5PA 2HO1A 4IREA 3ZC1A 1SVXA 4F1PA 3LEWA 2UY1A 3LK3B 4LSZE 4U8YD 1NEKA 3CHRA 2XPIA 5EDSA 3VKGA 3UXGA 2JQ9A 2W61A 5JJ7A 4IT4A 5CGMA 3FY4A 4FHJA 4UI9K 4A97A 4U07A 5AQBA 4LERA 2RA1A 5G04C 5JTGA 2NW7A 3LJ3A 3DXMG 3FUMA 4H9QC 3AG4E 3UIPC 2EINE 1ZBPA 4U72A 4ATGA 1OWLA 5C1DA 4GCNA 2Q9QD 3OXFA 2IEJA 3AE3A 4TV9E 2BS4A 4G2VA 2WDRA 1YMPA 2P9BA 5CEDB 2DZNA 4TXRA 4HOQA 2WMOA 3E32A 1S63A 2OVFA 2CA5A 3OPCA 4I6EA 1FJGT 3J7Yq 2XEVA 3D9KA 4J2CA 1HS7A 1UG3A 3QJZA 2H6IA 4FJZA 1MX6A 3PV0F 5HCMA 1BPOA 4HOTA 2LT3A 3SFDA 3AE1A 3Q49B 3C4WA 4LFCT 3E0ZA 4O4LE 2WVIA 3Q7AA 4UQXA 5LP6E 1E8XA 3CKBA 3RYCE 5ARGA 2LRKA 2HN1A 3RRWA 3HXDA 4JBWF 1QZ2A 3WI3A 4I1OB 2Y8DA 2IC6A 4BSZB 5EIBE 4HFCA 5DJQC 3M3ZB 1NZNA 2BEDA 3HIZA 4Q94A 2NTYA 4YT0A 3I4GA 2H3RA 3CHQA 3WG7E 2V5QC 3CVUA 3O9XA 4AQFA 2FJEA 4E85A 2MRIA 1HG5A 4K5CA 3ZMTB 3T8OA 2QA7A 4XKCA 4RG9A 1KLXA 2P9KG 1HO8A 5M4YA 4L5GA 3P2BA 3RK6A 4HWCA 2GRMA 4GU5A 4QXBB 2LSYA 2WXKA 2V5CA 3BUAA 1OXZA 1HX1B 1HXIA 4AKHA 3RAUA 1Z0PA 4JB8P 4MBQA 5JQGE 2VB6A 4LNUD 3F57A 4X1IE 4AQGA 1WRDA 2WZIA 5KXJA 5ABHA 3RRMB 2CHNA 3CSTA 1SZAA 4BETA 1BR0A 4G11A 5JDGA 5AQLB 1YYHA 4OAUC 2XGOA 1W3BA 3Q5EA 2DLRA 4J8YA 2HPJA 4K5BA 5JJTA 3E34A 4DJAA 3HYMB 1OEDB 4EYUA 2XENA 3D0TA 3JYSA 5KX5E 3UU6A 1BI7B 2LM9A 3I4RB 5AQPB 1MHQA 3RU0A 2NYJA 3RKGA 4OX9T 3RC8A 3CVRA 3A8YC 2JQKA 3Q5DA 2Z6EA 5FVKA 5JA4D 4NQ0A 2XHEB 3ASGA 4FLHA 5M72A 4HWFA 4I9CA 3LBXA 4PS3A 5G05C 1N4RA 4DV5T 3DRAA 3VTXA 2J47A 2UXBT 3C4XA 3KVAA 4TRQA 2L8KA 4KX6A 4LUNU 4RVBA 4DX2A 3PUKA 3EDVA 3ONLC 1U2VG 2BUGA 2MOWA 5JHBA 2JMHA 3ZJ1A 2WXMA 1W0BA 2QYJA 5JRCB 5J90A 3NKZA 4GAAA 2I1JA 3EU9A 1TNZA 3C3QA 3HDXA 1B89A 2EILE 4DV7T 3EHQA 1S94A 3GW4A 4GTPA 1INZA 4X20E 4YTPA 3TWXA 3ZHEB 3Q5XA 4LRZA 1K1AA 4PFOA 4ISTA 3IHRA 4ZI7E 2VGYA 4URKA 4V3IA 5KWDA 2AXUA 5HQ8A 5EILA 3FTSA 4MS6A 3L16A 3AAAC 3JXJA 3PVLA 5ANRA 2X0HA 3D9HA 3LKUA 4ADZA 1XNQT 5EKQD 4LFAT 1T7SA 3FUJA 4IL4A 3PUZF 3G2SA 2P2CP 4KMCA 3K1SA 1TNBA 1YKHB 5LP0A 3BQIA 1MYOA 4P0BA 3L08A 3CQCB 1WYCA 3FZMB 2UUBT 2MAWA 3AS8A 4GTMA 5AQAA 3EHNA 1IBLT 4UVAB 4LEUA 2CWOA 4GYRA 2CHZA 3TWSA 3BEEA 3RRCA 2VKDA 3FBLA 3LY8A 5AQIB 5LMNT 3OXGA 3QDNA 4GA2A 2GK9A 4IGUA 3U4TA 4DPRA 2AXZA 4I1MA 2BG9A 5AFUL 4O60A 3RGLA 5BR8T 5CRUA 2WAUA 1G8XA 2QC9A 3B7TA 4UXNB 2PBIA 4ERRA 1ZEEA 5CFBA 5KJLA 4LCTA 2X9WA 2VTBA 4TX5A 5G04J 1OCZE 2XEEA 3LS8A 5F8PA 5CEAA 3O1JA 4OFZA 3TLUA 3DXKG 1PY1A 3KV4A 4AY6A 2DWKA 1Z5SC 3JCFA 3AE4A 2YNQA 2BKPA 2H6FA 5D2MC 4BX9A 1X5BA 3O1HA 2EHOA 3Q5MA 5ENOD 3VLEA 5F5WA 2OV9A 3SFZA 2VK9A 1IQUA 1NAFA 2V1DB 1U3DA 1X81A 2KBXA 3RI5A 2J4DA 3KSLA 1SA0E 3L82A 3GZ1A 3PE4A 2YU2A 5EK3A 4QX7B 3ESKA 3KVBA 3GN5B 2RG8A 1KFYA 4NIQA 5CECB 2XQ8A 1MZCA 4JEUB 3PREA 4GZ6A 4GTQA 4TXQA 2LO6A 2GRQB 3CV0A 3FU0A 5J08A 3IV0A 4TN7B 3RX6A 1IBKT 4TNWA 4COFA 4P1NA 2YKSA 2CCQA 3ML9A 1SUMB 5ABGA 4DV6T 4G24A 3CX8B 3GMIA 5L3GB 2X38A 4ZEYA 5J2UE 1YCSB 3PZ2A 1KT0A 1QSDA 4EIWA 4JI2T 2DZOA 4ZFHA 4AI6A 2Y4UA 2K48A 4LNGA 1Z8UA 4U04A 2L9QA 3SI5A 1HG2A 2LEHA 4WUYA 2BF0X 1WDYA 4BA9A 3AVSA 4GTRA 5FQ8A 5ARFA 4EPZA 2H88A 3LK2B 2IOLA 4F6RD 2ZGDA 2LHNA 3C4ZA 4NXNT 4YSYA 2JRKA 1OCRE 5G55A 4YJ3E 5A6CA 2NR4A 1E8YA 4IN3B 5HEGA 4AXHA 4EOZB 3AE2A 4JI7T 4KYOB 4ILHB 1IAPA 3LJCA 1GW6A 5BMVE 5T8IA 4CI3B 2RFMA 3D9PA 2QZAA 1N32T 3N9MA 4UF0B 1YD8G 1G3NB 4DV1T 3GYZA 3RRNB 4BEPA 3UU3A 1LD8A 3RIAA 1XDOA 4PUCA 5L3CB 5LGNB 3CLJA 3PURA 1NA3A 4YNDA 2I0MA 4AKLA 4ZI3D 3CHMA 3P4WA 3UUXB 2VGXA 3T5VA 3T5XA 3AEFA 1BR1A 4CXWA 3FUEA 3OJAA 3C64A 4DNDA 4ME2A 3UKUG 3FHEA 3G2VA 4TV3A 3V2OA 3MKQB 5DABA 3ZCIA 2XM2A 2M6IA 4EZLA 2AE9A 4K0KT 4AV7A 2E5VA 4GYYA
chains in the Genus database with same CATH topology
3FXDB 3ONXA 2CXDA 1E8WA 5LG4A 1MMGA 1E90A 3V5UA 4A1GA 3G2WA 3MX3A 2ZMAA 3BG1B 3PS6A 3C51A 4N3AA 2YU1A 4PS7A 3ONLA 4GYWA 4EBAG 5IHYA 1FVFA 3PE3A 1U3CA 2VASA 5A23A 5JREA 1OWPA 3C98B 2KCVA 5HXCA 2YQ8A 2NOXA 5HWXA 4MKTA 4YVOA 4JA9A 4FHKA 4PDXA 3RYHE 4H9SE 3CVQA 4WBOA 5E0OA 1IZNB 4AJWA 3LFMA 1SZ9A 3SGHA 5FZSA 3KV5A 4HOUA 3UUMA 3CVYA 5JJ6A 1CUNA 2I6HA 4OYSA 4ABNA 4DBQA 1Y6IA 2DWGA 1WYBA 5FY0A 2RP4A 1OWAA 4A56A 1KT1A 2CXFA 2J08A 5JR9C 3IBEA 1HZ4A 2VYIA 1BR2A 4DVDA 4XIFA 1Z3XA 2AVPA 4J6IA 4UQZA 3RKOA 4Z8XA 2NP9A 4IE7A 3FBZA 3R9AB 3L3PA 4ZI3C 1EYHA 2XHEA 4PAGA 2QGSA 3LBXB 3DBSA 2XRYA 1LKXA 2XAFB 4I9EA 4N5CA 5EX3A 2V7IA 5CA1E 3QNKA 2VJ8A 3OXLA 2OA5A 4UELA 4JHJA 3FH8A 2R5SA 4GYSA 2QFCA 2N9DA 3OAWA 4KBQA 2CWYA 3QWVA 5CMWA 3AB3B 4E6HA 4X1KE 5D0QD 2L0TB 1KK7A 3CVLA 4H9RC 2X9XA 4IYPA 5FY7A 2Q7FA 3F31A 5CHEE 4GZ3A 2IJGX 4TUUA 3SBTB 2LOSA 2XPZA 3NZQA 2HR2A 3QARA 4KUMB 2VSNA 3N2KE 4IE4A 3FHNA 2LSUA 3VHLA 4A3VA 5E76A 1US7B 3L54A 2A4ZA 2BDEA 2Q9QA 1EZ3A 3K9IA 3O1IA 3N2OA 2LSKA 2X6FA 2DCFA 3KS2A 4BTBA 2ZM8A 3G2UA 2CHWA 3ZGQA 1ZKEA 3RYIE 3NBXX 3LY7A 4OHFA 2V7MA 1XGWA 4I43B 3QWPA 4J8DA 3MA9A 2ZM2A 3Q2MA 5LOVE 2CG3A 5HWYA 2MBGA 3MJXA 3DP7A 1LVKA 4HXIA 3U3IA 2WMNA 3D9IA 2YEVC 5FXVA 2X6KA 2MTQA 3LPZA 5FWQA 4AKIA 3MA5A 1ZHCA 4H9OC 3HHMA 3FUKA 3I0OA 2C5JA 2KZ7B 5L3DB 3Q5WA 1DNPA 4XE0A 2E9XC 2H7OA 4BFRA 1UN9A 1HH8A 5KMGP 2IOSA 3H37A 4NUUA 4CZZB 1E8ZA 3PEVB 5AENA 4AVXA 2HH7A 4BAYB 1O3XA 3EDTB 4K0UA 3D3MA 3UT8A 5EX0A 5FXXA 3OYXA 3LVQE 4EECA 3I1AA 3PNLB 3FU5A 2NWBA 4KP3C 4G1TA 4MLPA 2OVBA 4JL0A 1E96B 3EVYA 1A17A 4DO0A 4I50E 1MIVA 4WNDA 4AIFA 3DPDA 4GYOA 3S7BA 4GIWA 4O2BE 3CQXC 3PUJA 3HKEE 4N3CA 2CHXA 5CMYA 3QAQA 3SF4A 2M67A 5ANLA 1FVHA 5FP3A 1G73A 5L3FB 3ZHEA 4G23A 4BY6A 5GONE 2XASB 5DBKA 3UMVA 3FULA 3KDSE 4HTEA 2V8SE 3FWVA 3N9QA 1HF8A 2XAGB 4M1PA 1QQEA 5DQVA 1H0AA 3ZC0A 4EXTA 2X66A 4XZCA 2R59A 3FTWA 2X9HA 4IRUA 4FP7A 3AA0B 4DMVA 4FJOA 1H2VC 3VTYA 4GZCA 4FI5A 3CIAA 4Q96A 4MFRA 2KNDA 5AIJA 2LSIA 4XI9A 2UWJG 4FULA 1L5JA 3QKYA 3UPVA 4YVQC 3FTUA 2CG2A 2A72A 1H7CA 4N78D 4PJNA 4AOFA 2KMFA 3ZMSB 3IEEA 3QC9A 5LJMA 4ANXA 4FC8A 4I1AA 4H63V 3I0QA 2E0IA 3ZYKA 4KXKB 2WXGA 2Y3AA 1FMVA 2WSSV 3CK7A 2WXRA 4XZ4A 5HAXA 1VDYA 3L13A 4KVOA 5FTPA 2HM8A 4JW1A 5KJMA 4I55E 1NA0A 4EZHA 4Y6CA 4AY5A 2HPLA 2A5UA 4PJMA 4GCOA 2EHOC 3CHPA 3JQ1A 5KJNA 4HOSA 2LE8A 1E7VA 2FI7A 2X67A 4BSXA 5LJNA 2WXLA 3MZLB 3APFA 3NF1A 3ZN0B 1FEWA 2WQHA 2VKJA 4WNKA 3IHVA 4BWRA 2WXFA 3QK6A 4PK5A 3IHYA 4UVBB 3UQ3A 2XAJB 2WXJA 2D2SA 3HR0A 3ZEFA 4JZYA 3Q9DA 3AAIA 2EQXA 2LOPA 5LCWC 4XKBA 3L22A 2J09A 4JXTA 5BPPA 3ZJ2A 3FUDA 4D10C 2IU1A 4K0RA 2AXVA 1Z3YA 3RYFE 5BNWA 3RRUA 2X6IA 3FUFA 4PK6A 1MMDA 2AWIA 3RKVA 4ZI2C 1XNFA 1WLXA 4JHKA 1PAQA 5L2LA 3AA1B 4CDRA 1ZV4X 3AU4A 1IJ5A 2VSXE 3ESLA 3HL6A 1SQMA 4Q69A 2PQRA 4L2YA 5G05J 4ZS3A 2DHRA 4NRHB 1JWGA 2E9XA 5EK4A 4PK4A 5BV0A 4KBMB 1N54A 1TEZA 5AJLA 5G2NA 4CDMA 4GZ5A 4DBRA 3UFEA 2XGSA 1H2UA 1D0XA 2X51A 2PJQA 1VRBA 3MKQA 3FP3A 3ZMZB 3MCXA 3ZXSA 4IULA 4UWKA 4YHJA 1OWOA 3PNTB 1D0ZA 4J0UA 3D9JA 1HE8A 3PUQA 3QK0A 3CHSA 3ML8A 4IE5A 4JHRA 3UT5E 4DI3A 3LVRE 1E1HB 1OWNA 3ASDA 3N9NA 5LHHB 2XGMA 2LJLA 1E7UA 4EZKA 2IFUA 4EYYR 5J2TE 3R7QA 5FMNA 3J9X1 2C0LA 4B94A 5LHIB 5HI7A 3CWZB 3LYAA 3APDA 4CT4A 2PZIA 4U8HA 2XAQB 4UI9C 1OWMA 1BR4A 3MKDA 2JMKA 1EF1C 3SZ7A 5LNKA 3EUHA 2LNIA 2ZU6B 3F2EA 4PNIA 4F3VA 3HVEA 2ODVA 3UX4A 1ELWA 2KATA 4U74A 3ASHA 4KT6B 4HLEA 5FZRA 2WBLA 4TV8E 4APOA 1UX5A 2R17C 2DIWA 3PUSA 2I9CA 4F1SA 3QC1A 1UJJA 4I6JA 2XRZA 2WXPA 2KWHA 3CK8A 4V1Av 4P09A 4EB6E 4RSYA 3Q15A 4G26A 1AJ3A 1KNZA 1QUUA 2BVLA 4EBAA 1WR6A 4I6GA 3DTOA 3FTYA 2ZM0A 2CM0A 4CXYA 2VSOE 3RPUA 5JDNA 3FU6A 2JJ9A 4UWLA 4FJYA 4WBNE 4PW8A 5IYZE 4N39A 4NACA 1YA0A 2DCPA 4G25A 3PU8A 4HGAA 1MIYA 1JUQA 2NW8A 4TUYE 3EJNA 3L09A 4XAXB 4MRUA 2RD0A 2JEKA 3PRZA 3G2TA 3U9WA 4HEAA 4ASKA 3I3NA 1HU3A 4N3BA 2CE7A 3MZKB 4MLKA 5ENNA 1WY6A 1H19A 4H9PC 2XAHB 3AS5A 1D1CA 4F7AA 3N2GE 4H9NC 4UEMA 2YHEA 4MHCA 5AYWD 3AVRA 2FULA 5FNVE 2K9AA 3RO2A 5LA6E 3EHMA 4C0MA 2WM9A 2X3MA 1MQSA 4JVSA 3ENEA 4JEUA 3TXMA 2MHKA 1IJ6A 4ANJA 3CR3A 4IDZA 5CCMA 4QKNA 2PM7A 1Y8MA 2L3LA 4G2AA 3K3OA 1Y64B 4UI9J 4O6FA 5D0OD 2PL2A 2WXNA 4CQIA 2V0PA 3R84B 3ETUA 4N2QA 2WQ6A 2UXNB 2ACXA 2X6HA 1IQRA 1P5QA 3ZW3A 4XI0A 2KCKA 4QHOA 2VWAA 1MMAA 2L0IA 1LF8A 4IE0A 2MOZA 2NSZA 2J1DG 4CXXA 2J9QA 3CMLA 3GA8A 2P58C 3OKQA 5A1LA 5EK2A 5JRCA 3ZPOA 1H6KA 4AXPA 3ULQA 5HXHA 1PC2A 2JPFA 5LHGB 2KZTA 2NC9A 5FQ7A 3PE0A 4B8AA 2WWUA 2NTXA 2XUEA 3UT4A 4H7YA 2EHOB 5LCYA 3ZLIA 2N1GA 4H7XA 3A5XA 3FEYA 4EAHA 3PTRB 4HFVA 2ONDA 4BTAA 3SRZA 2J07A 4I17A 3FDHA 1HTJF 4QX8B 2LSGA 5J1GA 5JDLA 3QWWA 3ANWA 2IC9A 2C2LA 3FTXA 4BX8A 4YJ2E 4X1YE 3RC3A 4P29A 4GZDA 3T8MA 1QNFA 2LAIA 4F6RC 2W62A 2IW5B 3IF8B 4PS8A 3S7FA 3JC6D 2VKOA 2GW1A 3KD7A 3OBVE 2BVMA 3Q47B 3E08A 3UTKA 3CQGB 3KBUA 2C5KT 2NXPA 3NZSA 3AA7B 3MK7C 4GK5E 3O4ZA 4OVUA 2D5UA 1B7TA 3I5PA 3AAAB 5DIZA 2WPVA 5JDMA 3JC6C 4F53A 3CVNA 3TGOA 5JR9A 4P0AA 2A2FX 5LFAA 3LK42 1YW0A 3FTZA 4BT9A 3ZN1B 2W00A 2X9YA 5A7DB 2J49A 1HFAA 4K03A 3D9NA 1LRZA 4EZJA 2IONA 4GOUA 4UF0A 3H3AA 3AU5A 4H63H 3D9LA 3SD5A 1HS6A 5LYJE 4JEHA 2L6JA 4A1SA 4PH4B 2QY7A 2PG8A 4ANWA 5FZQA 3SNXA 4CGWA 3DJBA 5FJYA 2D0TA 5FY1A 3K3QC 3NQPA 4ILIA 3JUIA 4U0SA 3RO3A 2I2OA 1HX8A 4CT0A 4GK0E 2N2NA 2JLBA 3TJPA 4UV9B 4HFGA 3QB2A 3NZUA 4WNGA 4APFA 2W0GA 4ANVA 2IAKA 2OV8A 3RIBA 2JQQA 3FH7A 3S4UA 3L6AA 2UXXB 2Q9QC 4I2WA 3Q4AB 1OUVA 3CX7B 3ZIMA 1SHZC 3MJWA 3APCA 3TKLB 2IF4A 2PM6A 3MEKA 2WXQA 4HS2A 4A3TA 3SHFA 1ELRA 1LVFA 4U63A 4U0ZA 1WAO1 4MALA 5LOZA 3KV9A 3MKRA 5HYAA 5LX8A 5DQWA 3WXXA 4C0EA 3ZVVA 4DI4A 4XX5A 4ZS2A 3HA4A 4G63A 3N9LA 3CSFA 4OYKA 2K24A 3MV2B 4JC8A 3MYVA 2WXHA 3JCKC 4JA7A 3HI2A 3ONKA 1UCUA 2V4LA 3ASFA 1HCIA 3TG4A 4FA6A 3CPZA 1D1AA 2YK0A 2VQ2A 4WAFA 5L3EB 2KCLA 3B57A 1FMWA 4E7ZA 2H7VC 1MNDA 3NZPA 4NURA 4UWGA 5FXWA 4O2AE 3C98A 3ZMUB 4UWFA 3K8PC 2KT9A 5KCMA 2X6JA 2FO7A 3AA6B 5TAOA 1EPUA 3CKCA 3GWHA 2MYSA 3FH5A 5BT1A 4ISSA 3ZRHA 4EQFA 2KM4A 1Z6TA 3HKDE 2M63A 4N2SA 4FU3A 3B7UX 3OYZA 4ANUA 2LAHA 2FBNA 4QXCB 3R7RA 3ZYLA 3LY9A 1VOMA 4J8FA 3VLFA 2XQ0A 4J8SA 4UV8B 4GA1A 1ZU2A 3KFWX 4WWOA 3B7RL 3UUNA 2AW6A 2GRLA 4GA0A 4JUYA 2X68A 2LSJA 4PJLA 3B13A 3N9OA 3PZDA 2CMRA 3WAKA 3AS4A 5AJDA 5LGTB 3P8CD 4ACKA 4YFSA 4HKAA 3R6NA 4L0RA 1H2TC 4L2LA 3BK9A 3C50A 3ETVA 2VGXB 3SOLA 3UUXA 2XCCA 2FEZA 2ES0A 2Q9QB 5F3JA 3KBTA 1S0PA 2C0SA 5LBMA 1FCHA 2B1EA 3N9PA 5LCWJ 2KC7A 2Y6XA 3I9WA 4CI1B 1IYGA 3E4BA 4AQFC 5LGUB 3ZCJA 2V7LA 4ZOLE 1YKEB 2WQ7A 3PEUB 4DLOA 4DMWA 5JHAA 3S2AA 4TZ4C 3CK9A 5ADXL 3CHOA 3PDYA 5HXRA 5T3RA 4KZ0A 2KINB 4I2ZA 4CDNA 1NWMX 3O4XE 5FQ4A 2WXOA 3VKHA 3PH0C 3GZ2A 5CCLA 4AEZC 4C9BB 3BQLA 5C2YA 3URZA 2CXLA 3U64A 4BJNA 2CEAA 4ZHQE 2L9BA 2E9XD 1U4QA 1UJKA 1UN8A 1ELKA 4BT8A 2G0UA 3QUJA 4O4HE 3MGBA 1INZA 3P1UA 2UY1B 3EDUA 4HN9A 4UVCB 3I9YA 2Y4TA 3N5LA 3D9OA 2C0MA 4FLBA 3KINB 4UQYA 5JDFA 3S7JA 3TAXA 3CVVA 3KV6A 1DVPA 3GZSA 4KZCA 4C91A 4I43A 4HVBA 4Y6WA 5E75A 2HYZA 2VL8A 4W9RA 4ILUA 3PU3A 4AP2A 3BQKA 5BV1A 4OVVA 2LHRA 3IBPA 4L1BA 3SBSA 4CEMA 2CLYC 2KWIB 3FFLA 2J4BA 4HORA 2V7JA 3VU7H 4U0UA 3ZFWA 3FUIA 5C8YE 2KLQA 3FB2A 2YINA 4EZ4A 3CVPA 1MNEA 5CB4E 2V26A 1JWFA 5JVDE 4IE6A 4B8CB 2PQNA 4B0ZA 3W15B 2VTBB 1IHGA 4KVMA 2V5FA 3HKCE 2PFVA 3PUAA 2YHCA 4ZI2D 5FXZA 2VKHA 4IIJE 4AKRB 5LXTE 2EHOD 4WWPA 4FADA 4O8SA 4AKGA 4L9IA 1MIWA 2I59A 1FIOA 4ILGA 3SWHA 1X79A 2NW9A 1NP7A 3FUNA 3NRXA 4PFPA 2I1KA 2XPYA 4L7TA 3U66A 1UX4A 4GMJA 5FT9A 5JH7E 3FUHA 4KMOA 2KZTB 3GN5A 3IKOB 4QWNB 3ZPJA 3B7SA 2E9XB 2V7KA 5H6QB 2BTDA 4AM9A 3CX6B 1D1BA 5KJKA 2A3DA 2LSVA 1S35A 3MXZA 3FEXA 3HKBE 2D0UA 2E8IA 3O48A 3U78A 3TXNA 3ANWB 3LDZA 3QOUA 2ZLYA 3LCAA 3ZEFB 3S7DA 4CCAA 2DNXA 4JPSA 1EDUA 2VSYA 1TJFA 5ETWA 2FF4A 3FTVA 3MV3B 4WWNA 4OK0A 3WAJA 2KXPB 3OTNA 3ZYMA 3ZYQA 3D9MA 2GGFA 5T4YA 4WNFA 3V5SA 4GMLA 4E7SA 4IHJE 2CLYB 3NRYA 4DK5A 4A55A 3RH3A 5JDHA 3L17A 5FQ6A 5FYMA 4J8EA 3CVXA 5JR9B 2Y48B 1N52A 3HVEB 5EZYE 2XCBA 4WNEA 1TJCA 2X0LB 4OYJA 1D0YA 3ZMVB 4CRWA 5KDMC 4QFVA 2BZBA 4L23A 4O4IE 1UW4B 1JPLA 4JEHB 3E22E 5BUZA 4GB9A 3KEZA 5JDQA 4GPKA 4ACLA 2CFUA 3ZN3A 3U3WA 3TG5A 4UIGA 2ODUA 5HXEA 4I4TE 2DI4A 4RG6A 5H6RB 3CEQA 3PDNA 4UWHA 4PJJA 3JQ0A 3CKDA 3IEGA 4CGVA 4CI2B 4C90A 1MMNA 1V9DA 4BJMA 2WXIA 4WW0A 2WB2A 2CFZA 4R7LA 3FXEB 3PUGA 3LG7A 4JLEA 3LXUX 3N71A 3VLDA 3EIQC 3EIJA 2K5BB 2W63A 3KAEA 3M65A 2C5IT 4DLQA 5L3BB 2IQCA 3CGHA 2OOEA 3FU3A 4M3OA 3AAEB 2XQYA 3K3NA 4NUVA 3MACA 5HXSA 4B89A 3CVWA 2E2EA 2DBAA 3SS1A 1WM5A 4XBFB 5BW8C 1T98A 5LBQB 3BG0B 3RJVA 2XTLA 4QXHB 4YLHA 3TL5A 3UULA 5CA0E 2ILRA 4B6XA 2SPCA 3P7IA 4HE8A 3UT7A 4O4JE 1U5PA 2HO1A 3ZC1A 3LEWA 2UY1A 3LK3B 3CHRA 2XPIA 5EDSA 3VKGA 2W61A 5JJ7A 3FY4A 4FHJA 4UI9K 4U07A 4LERA 2RA1A 5G04C 2NW7A 3LJ3A 3FUMA 4H9QC 1ZBPA 4U72A 4ATGA 1OWLA 5C1DA 4GCNA 2Q9QD 3OXFA 4TV9E 2P9BA 4HOQA 2WMOA 2OVFA 2CA5A 4I6EA 3J7Yq 2XEVA 3D9KA 4J2CA 1HS7A 1UG3A 3QJZA 4FJZA 1BPOA 4HOTA 2LT3A 3Q49B 3C4WA 3E0ZA 4O4LE 2WVIA 4UQXA 5LP6E 1E8XA 3CKBA 3RYCE 5ARGA 3RRWA 1QZ2A 3WI3A 4I1OB 2Y8DA 2IC6A 5DJQC 1NZNA 3HIZA 4Q94A 2NTYA 3I4GA 2H3RA 3CHQA 3CVUA 3O9XA 4AQFA 4E85A 2MRIA 1HG5A 3ZMTB 3T8OA 2QA7A 4XKCA 4RG9A 1KLXA 1HO8A 5M4YA 4L5GA 3P2BA 3RK6A 2GRMA 4GU5A 4QXBB 2LSYA 2WXKA 1OXZA 1HXIA 4AKHA 1Z0PA 4MBQA 5JQGE 2VB6A 3F57A 4X1IE 4AQGA 1WRDA 3RRMB 3CSTA 1SZAA 1BR0A 4G11A 5JDGA 2XGOA 1W3BA 2DLRA 2HPJA 5JJTA 4DJAA 3HYMB 4EYUA 3D0TA 3JYSA 5KX5E 2LM9A 3I4RB 1MHQA 3RU0A 3RC8A 3CVRA 2Z6EA 4NQ0A 2XHEB 3ASGA 4FLHA 5M72A 4I9CA 3LBXA 4PS3A 5G05C 3VTXA 3C4XA 3KVAA 4TRQA 2L8KA 4LUNU 4RVBA 3PUKA 3EDVA 2BUGA 2MOWA 5JHBA 2JMHA 3ZJ1A 2WXMA 5JRCB 5J90A 4GAAA 2I1JA 3HDXA 1B89A 3GW4A 1S94A 4X20E 3ZHEB 3Q5XA 4LRZA 4PFOA 4ISTA 3IHRA 4ZI7E 2VGYA 4URKA 4V3IA 2AXUA 5HQ8A 3FTSA 4MS6A 3L16A 3PVLA 5ANRA 3LKUA 4ADZA 5EKQD 3FUJA 3G2SA 4KMCA 1YKHB 5LP0A 3BQIA 4P0BA 3L08A 3CQCB 1WYCA 3AS8A 3EHNA 4UVAB 4LEUA 2CWOA 4GYRA 2CHZA 3BEEA 3RRCA 2VKDA 3FBLA 3LY8A 3OXGA 3QDNA 4GA2A 2GK9A 4IGUA 3U4TA 4DPRA 2AXZA 4I1MA 5AFUL 2WAUA 1G8XA 3B7TA 4UXNB 2PBIA 4ERRA 1ZEEA 5KJLA 4LCTA 2X9WA 2VTBA 4TX5A 5G04J 3LS8A 5F8PA 3O1JA 4OFZA 1PY1A 3KV4A 4AY6A 2DWKA 2YNQA 4BX9A 1X5BA 3O1HA 2EHOA 3Q5MA 3VLEA 3SFZA 2VK9A 1IQUA 1NAFA 2V1DB 1U3DA 2J4DA 1SA0E 3GZ1A 3PE4A 2YU2A 5EK3A 4QX7B 3ESKA 3KVBA 3GN5B 2RG8A 4JEUB 3PREA 4GZ6A 2LO6A 3CV0A 3FU0A 5J08A 3IV0A 4TN7B 3RX6A 2CCQA 3ML9A 4G24A 3CX8B 3GMIA 5L3GB 2X38A 5J2UE 1KT0A 1QSDA 4EIWA 4AI6A 2Y4UA 2K48A 4U04A 2L9QA 3SI5A 1HG2A 2LEHA 4WUYA 2BF0X 4BA9A 3AVSA 5FQ8A 5ARFA 4EPZA 3LK2B 2IOLA 2LHNA 3C4ZA 2JRKA 5G55A 4YJ3E 5A6CA 1E8YA 4IN3B 4AXHA 4EOZB 4KYOB 4ILHB 1IAPA 3LJCA 1GW6A 5BMVE 5T8IA 4CI3B 3D9PA 3N9MA 4UF0B 1YD8G 3GYZA 3RRNB 4PUCA 5L3CB 5LGNB 3CLJA 3PURA 1NA3A 4YNDA 4AKLA 4ZI3D 3CHMA 3UUXB 2VGXA 3T5VA 3T5XA 4CXWA 1BR1A 3FUEA 3OJAA 3C64A 4DNDA 4ME2A 3FHEA 3G2VA 4TV3A 3MKQB 5DABA 3ZCIA 4EZLA 4G2VA 4AV7A 4GYYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YIN A;  2WMO A;  2WMN A;  3VHL A;  2WM9 A;  3B13 A; 
#chains in the Genus database with same CATH topology
 3FXD B;  2VGE A;  4HRM B;  3ONX A;  2CXD A;  3EHZ A;  1E8W A;  5LG4 A;  4RQI A;  1MMG A;  1E90 A;  3V5U A;  4A1G A;  4NPP A;  3G2W A;  3MX3 A;  2ZMA A;  4KHP T;  3BG1 B;  1NI1 A;  2RKK A;  3PS6 A;  3C51 A;  4DRX E;  4HB5 A;  4N3A A;  2YU1 A;  4PS7 A;  3ONL A;  4GYW A;  4EBA G;  5IHY A;  1FVF A;  3PE3 A;  1U3C A;  1ZB1 A;  2VAS A;  5A23 A;  4U2Z A;  5JRE A;  1OWP A;  4JI4 T;  4TUM A;  3C98 B;  2KCV A;  4I0U A;  5HXC A;  3TWR A;  2YQ8 A;  2NOX A;  5HWX A;  2YDS A;  4MKT A;  2HHH T;  1A5E A;  3UM1 A;  4YVO A;  4JA9 A;  4FHK A;  4M7C A;  4PDX A;  3JAD A;  3RYH E;  4H9S E;  2F37 A;  5AQN B;  3CVQ A;  4WBO A;  5E0O A;  1IZN B;  4AJW A;  3DST A;  3LFM A;  1SZ9 A;  3SGH A;  5FZS A;  3AXJ B;  3KV5 A;  1N9A A;  4U7E B;  4HOU A;  2XZT G;  1JNZ A;  3UUM A;  3CVY A;  1TNY A;  2LLY A;  5JJ6 A;  1CUN A;  2I6H A;  4OYS A;  4ABN A;  4DBQ A;  3FZL B;  4B93 B;  1Y6I A;  2DWG A;  1WYB A;  3QB5 A;  5FY0 A;  1NFI E;  2RP4 A;  2DVW A;  1OWA A;  4A56 A;  1KT1 A;  2CXF A;  2J08 A;  5JR9 C;  3IBE A;  2EIJ E;  1HZ4 A;  2VYI A;  3AG2 E;  1BR2 A;  4DVD A;  1UK5 A;  5FKY A;  3UIN C;  1O1R A;  4XIF A;  1Z3X A;  3JUE A;  2AVP A;  4J6I A;  1TN6 A;  2A5E A;  4UQZ A;  3RKO A;  4Z8X A;  2NP9 A;  2FJA A;  4IE7 A;  1J5W A;  3FBZ A;  3R9A B;  1H6P A;  3L3P A;  4ZI3 C;  1EYH A;  2XHE A;  4PAG A;  3TLV A;  4DX7 D;  2QGS A;  1IBM T;  3LBX B;  3DBS A;  4YDY A;  2XRY A;  1LKX A;  2XAF B;  4DR4 T;  3Q9U C;  4I9E A;  2R02 A;  2BS2 A;  4N5C A;  2V7I A;  5EX3 A;  3ABM E;  4U33 A;  2ETB A;  5CA1 E;  2OCC E;  3QNK A;  1DCQ A;  2VJ8 A;  3HXC A;  3OXL A;  2OA5 A;  4BER A;  4UEL A;  3OTO T;  3ASO E;  4JHJ A;  3FH8 A;  5AQQ B;  2R5S A;  4QH1 A;  4GYS A;  3DSU A;  2QFC A;  4X5T A;  1N34 T;  2N9D A;  3OAW A;  4KBQ A;  1TN7 A;  2CWY A;  3QWV A;  5CMW A;  4CN4 A;  3CIR A;  2E5L T;  3AB3 B;  1OED E;  4E6H A;  4X1K E;  5D0Q D;  4LF5 T;  4JI6 T;  2L0T B;  1KK7 A;  3CVL A;  4H9R C;  2X9X A;  4IYP A;  5FY7 A;  2XQA A;  4JYA T;  3F31 A;  1KPS B;  2Q7F A;  5CHE E;  3B5M A;  4GZ3 A;  2IJG X;  4TUU A;  1OT8 A;  3SBT B;  2LOS A;  2XPZ A;  3AE6 A;  3NZQ A;  2HR2 A;  5AQR B;  4DID B;  3QAR A;  4KUM B;  3F6Q A;  2VSN A;  3N2K E;  4IE4 A;  3P4Q A;  1N4Q A;  3ZKJ A;  3FHN A;  2LSU A;  3VHL A;  4A3V A;  5E76 A;  1US7 B;  5L4H A;  2GRR B;  3L54 A;  2MYO A;  3NWI A;  5AQM B;  2A4Z A;  2BDE A;  3DSV A;  3HXE A;  2Q9Q A;  1EZ3 A;  3K9I A;  3O1I A;  3N2O A;  2EIK E;  2LSK A;  2X6F A;  2DCF A;  3JAE A;  2IIU A;  3AEB A;  3KS2 A;  4DX6 D;  4BTB A;  2ZM8 A;  3ABK E;  2A9U A;  3G2U A;  3SO8 A;  2CHW A;  3IA3 A;  2CBJ A;  2GRP B;  3ZGQ A;  4HWI B;  4EV6 A;  3UU4 A;  1ZKE A;  4YXD A;  1OY3 D;  3RYI E;  2F8X K;  2XY8 B;  4YHH T;  3NBX X;  3LY7 A;  2XS8 A;  2FUP A;  4OHF A;  2V7M A;  1XGW A;  3Q9N C;  4I43 B;  3SY2 A;  3QWP A;  3DWL G;  4U7Y A;  4J8D A;  3MA9 A;  2ZM2 A;  3Q2M A;  5LOV E;  4TXP A;  1T72 A;  2CG3 A;  5HWY A;  2MBG A;  3MJX A;  3DP7 A;  1LVK A;  4HXI A;  2EIM E;  5ENS D;  3U3I A;  2WMN A;  3D9I A;  3UUB A;  2YEV C;  2ETC A;  2P9I G;  4YDE A;  5FXV A;  2X6K A;  2MTQ A;  3LPZ A;  5FWQ A;  4AKI A;  3MA5 A;  1DU2 A;  1NL4 A;  3FZH B;  1ZHC A;  4ILB A;  4H9O C;  4LG6 A;  3HHM A;  3FUK A;  3I0O A;  2KZ7 B;  2C5J A;  4DR7 T;  5L3D B;  3Q5W A;  1DNP A;  5D66 A;  5KNH D;  4XE0 A;  2E9X C;  2H7O A;  4BFR A;  5CBO A;  1UN9 A;  1HH8 A;  3Q79 A;  5LMU T;  5KMG P;  3H37 A;  4NUU A;  4CZZ B;  1E8Z A;  2IOS A;  3PEV B;  5AEN A;  4AVX A;  2HH7 A;  4BAY B;  3EUV A;  3HRA A;  1O3X A;  3EDT B;  4K0U A;  3D3M A;  3UT8 A;  2W66 A;  5EX0 A;  3RQW A;  5FXX A;  5ENP D;  4HFB A;  3OYX A;  2ETA A;  1TN8 A;  3LVQ E;  4EEC A;  3I1A A;  3PNL B;  3AE7 A;  3FU5 A;  2NWB A;  4KP3 C;  4G1T A;  4MLP A;  2OVB A;  4ZXL A;  1E96 B;  4JL0 A;  3EVY A;  1A17 A;  4DO0 A;  4I50 E;  1MIV A;  2FO1 E;  4WND A;  5EYL A;  4AIF A;  3DPD A;  4GYO A;  3S7B A;  1O1T A;  4GIW A;  4O2B E;  3CQX C;  3PUJ A;  5ENR D;  3HKE E;  4N3C A;  5AQS B;  2CHX A;  5CMY A;  3QAQ A;  3SF4 A;  2M67 A;  1BI8 B;  5ANL A;  1FVH A;  5FP3 A;  1G73 A;  4KI0 F;  1WR0 A;  5L3F B;  3ISM C;  3ZHE A;  4G23 A;  5LG3 A;  4BY6 A;  3P4P A;  5GON E;  2XAS B;  5DBK A;  3UMV A;  3FUL A;  4N5Q A;  3KDS E;  4HTE A;  3QB5 K;  1XDP A;  2V8S E;  3FWV A;  3N9Q A;  1HF8 A;  3TWT A;  2XAG B;  4M1P A;  4YSZ A;  1QQE A;  4JI1 T;  5DQV A;  1BLX B;  1H0A A;  3ZC0 A;  4EXT A;  2X66 A;  2FJD A;  3RIU C;  4XZC A;  5AQF B;  2R59 A;  3FTW A;  2X9H A;  4IRU A;  1N95 A;  4FP7 A;  3AA0 B;  3CK6 A;  4FJO A;  4DMV A;  4DR3 T;  1H2V C;  3VTY A;  5AAO A;  4GZC A;  4U2Y A;  4FI5 A;  3CIA A;  4Q96 A;  4L9P A;  4MFR A;  2KND A;  3AE8 A;  5AIJ A;  1W0A A;  2LSI A;  4J7W A;  4XI9 A;  4LF4 T;  2BG9 B;  2UWJ G;  1LD7 A;  4FUL A;  1L5J A;  3QKY A;  1O1S A;  3UPV A;  3RF1 A;  4YVQ C;  3FTU A;  2CG2 A;  2A72 A;  1H7C A;  4N78 D;  4PJN A;  3TLW A;  4AOF A;  4DR2 T;  2KMF A;  2FBW A;  3ZMS B;  3IEE A;  3QC9 A;  5LJM A;  4ANX A;  4FC8 A;  4I1A A;  3UIO C;  4H63 V;  3I0Q A;  1UUS A;  3ZYK A;  2E0I A;  4KXK B;  2WXG A;  2Y3A A;  4DUI A;  1FMV A;  2WSS V;  3CK7 A;  3ONJ A;  4LNB A;  2GRO B;  2WXR A;  5HCJ A;  4XZ4 A;  5HAX A;  1VDY A;  4HLL A;  3AJI A;  3L13 A;  4KVO A;  2Y1L E;  1DCE A;  2HM8 A;  4JW1 A;  5FTP A;  2RPA A;  5KJM A;  4I55 E;  1NA0 A;  4EZH A;  4Y6C A;  4AY5 A;  2HPL A;  2A5U A;  4PJM A;  4GCO A;  2EHO C;  3CHP A;  3JQ1 A;  5KJN A;  2LKH A;  4HOS A;  2LE8 A;  1E7V A;  2FI7 A;  2IDO B;  2X67 A;  3HG0 D;  4BSX A;  5LJN A;  4TWD A;  2WXL A;  3MZL B;  3APF A;  2HE0 A;  3NF1 A;  4DV0 T;  4Z91 A;  3ZSS A;  3ZN0 B;  1FEW A;  2WQH A;  2VKJ A;  1Q2Z A;  4WNK A;  3IHV A;  4BWR A;  2WXF A;  3QK6 A;  2CPT A;  4PK5 A;  3IHY A;  4UVB B;  5FL1 A;  3UQ3 A;  2XAJ B;  2XQ5 A;  2WXJ A;  2D2S A;  5LB7 B;  3HR0 A;  3LDQ B;  4YY3 T;  3ZEF A;  3T1Y T;  4JZY A;  3Q9D A;  3SQV A;  3PJA A;  3AAI A;  3Q78 A;  2EQX A;  1HNX T;  2LOP A;  2R2L A;  3PUX F;  5LCW C;  4XKB A;  3L22 A;  2V5D A;  2J09 A;  4CN1 A;  4JXT A;  5BPP A;  3LSV A;  3IXE A;  3ZU7 B;  3ZJ2 A;  3FUD A;  4D10 C;  2IU1 A;  4K0R A;  2AXV A;  5AAR A;  1Z3Y A;  3RYF E;  5BNW A;  2LM2 A;  2X6I A;  3RRU A;  3FUF A;  4K5A B;  4PK6 A;  1MMD A;  2AWI A;  3RKV A;  4ZI2 C;  2IUB A;  1MX2 A;  3EAB A;  1WLX A;  1XNF A;  4JHK A;  1PAQ A;  5L2L A;  1CHU A;  1BU9 A;  3AA1 B;  4CDR A;  1FT2 A;  1ZV4 X;  3AU4 A;  2W2U A;  1DC2 A;  1IJ5 A;  2VSX E;  3ESL A;  1K1B A;  3HL6 A;  1SQM A;  2YDR A;  4Q69 A;  2VVS A;  4JV5 T;  1UUR A;  2R03 A;  2PQR A;  4L2Y A;  3UFG A;  5AQ9 A;  3C72 A;  5G05 J;  4X66 T;  5ENQ D;  4ZS3 A;  2DHR A;  2XSB A;  4NRH B;  4GTV A;  3W9G A;  1JWG A;  4HFD A;  2E9X A;  5EK4 A;  4PK4 A;  5BV0 A;  4KBM B;  1N54 A;  1OCC E;  1S64 A;  2IO3 C;  2XJ7 A;  5ABF A;  1TEZ A;  2CRB A;  5AJL A;  3X2Q E;  4HFI A;  5G2N A;  4CDM A;  4GZ5 A;  3RSE G;  4DBR A;  3UFE A;  2XGS A;  3V31 A;  1H2U A;  1D0X A;  2X51 A;  2PJQ A;  1VRB A;  3MKQ A;  3FP3 A;  3ZMZ B;  4NXM T;  3MCX A;  3ZXS A;  4IUL A;  4UWK A;  4YHJ A;  1N4S A;  1OWO A;  3PNT B;  3W9F A;  1D0Z A;  4J0U A;  1JNR A;  3D9J A;  1HE8 A;  2V8S V;  3PUQ A;  3QK0 A;  3DSX A;  3CHS A;  3ML8 A;  3P4R A;  4IE5 A;  4JHR A;  3L9T A;  3UT5 E;  4YDW A;  4DI3 A;  3LVR E;  1E1H B;  1D8D A;  1OWN A;  3ASD A;  3N9N A;  5LHH B;  2XGM A;  2LJL A;  1E7U A;  4EZK A;  2DYR E;  2IFU A;  4X62 T;  4EYY R;  5J2T E;  4HWD A;  1HR0 T;  3R7Q A;  1N0R A;  5FMN A;  3J9X 1;  2C0L A;  4B94 A;  5LHI B;  5HI7 A;  3CWZ B;  3LYA A;  3APD A;  2XZD G;  4NIK A;  2H6G A;  2Y69 E;  1H6O A;  4CT4 A;  4OAV B;  2PZI A;  4A63 B;  4U8H A;  2XAQ B;  4UI9 C;  1OWM A;  1BR4 A;  3MKD A;  4JI3 T;  2JMK A;  2VQE T;  2XQ9 A;  4JI0 T;  1EF1 C;  2LXM A;  2WP9 A;  2XQ3 A;  3SZ7 A;  5LNK A;  3EUH A;  2LNI A;  2ZU6 B;  3UI2 A;  3F2E A;  4PNI A;  4F3V A;  3HVE A;  3UM2 A;  2ODV A;  3UX4 A;  2WB5 A;  3E30 A;  1ELW A;  2KAT A;  4U74 A;  3ASH A;  4DUY T;  4KT6 B;  4HLE A;  2E2A A;  5FZR A;  2WBL A;  1HNW T;  4DX5 D;  3PZ3 A;  4TV8 E;  2WS3 A;  3TWU A;  4APO A;  2QRX A;  1KNP A;  1UX5 A;  5FVL A;  1IXV A;  2R17 C;  2DIW A;  3PUS A;  4G8K A;  2OEV A;  2I9C A;  4F1S A;  3QC1 A;  1UJJ A;  4I6J A;  2XRZ A;  5HEJ A;  2WXP A;  3UU5 A;  2KWH A;  3CK8 A;  2XPK A;  4AQY T;  2WWV A;  4V1A v;  4P09 A;  4EB6 E;  3PUW F;  4RSY A;  3Q15 A;  4G26 A;  3SFX A;  1AJ3 A;  1KNZ A;  4HRN A;  1QUU A;  2DYS E;  2BVL A;  4EBA A;  2JQH A;  1WR6 A;  4I6G A;  3DTO A;  3FTY A;  2ZM0 A;  2F0Y A;  2AXD S;  2CM0 A;  4GKK T;  1KEY A;  1RW2 A;  4CXY A;  2VSO E;  3RPU A;  5ABE A;  5JDN A;  4U95 D;  3FU6 A;  2JJ9 A;  4UWL A;  4FJY A;  3ZXP A;  4WBN E;  4X64 T;  4PW8 A;  5IYZ E;  1FPP A;  4N39 A;  2W67 A;  4EEB A;  4NAC A;  1YA0 A;  4DUZ T;  2DCP A;  4G25 A;  3PU8 A;  5B3S E;  5FL0 A;  4A5X A;  2R6G F;  1MIY A;  4HGA A;  1JUQ A;  2BBJ A;  2NW8 A;  4IDO A;  4TUY E;  5AQH B;  5AQK B;  3EJN A;  3L09 A;  4XAX B;  4MRU A;  2RD0 A;  2JEK A;  4GMR A;  3UM0 A;  3PRZ A;  3G2T A;  3AG1 E;  5AQG B;  3U9W A;  4HEA A;  4DR5 T;  1IHB A;  4LML A;  4ASK A;  3JXI A;  3BQO A;  1HU3 A;  3I3N A;  4N3B A;  4LF7 T;  2CE7 A;  5C2T A;  3MZK B;  4X65 T;  5HRY A;  1I6Z A;  3BU8 A;  3ULY A;  1L0V A;  4MLK A;  5ENN A;  1WY6 A;  4TWF A;  3EI0 A;  4H9P C;  1H19 A;  3T9K A;  2XAH B;  3AS5 A;  1D1C A;  4F7A A;  4MBG A;  4UEM A;  3N2G E;  4H9N C;  2YHE A;  4MHC A;  5AYW D;  3NVO A;  3AVR A;  3QOF A;  4HBD A;  2FUL A;  5FNV E;  2K9A A;  5IUX A;  2UUC T;  2XQ4 A;  3RO2 A;  2BKN A;  5LA6 E;  3EHM A;  4C0M A;  2WM9 A;  4KHZ F;  2X3M A;  1MQS A;  3NBN B;  3NOC D;  4JVS A;  3ENE A;  4JEU A;  1N11 A;  2MHK A;  3TXM A;  1IJ6 A;  4ANJ A;  3CR3 A;  2WCA A;  4IDZ A;  5CCM A;  4DR6 T;  4QKN A;  2PM7 A;  3DSW A;  1Y8M A;  2L3L A;  4G2A A;  3K3O A;  1Y64 B;  2V4H C;  4UI9 J;  3SFY A;  3E37 A;  4RLY A;  4O6F A;  5D0O D;  5B1B E;  1KZP A;  3E33 A;  1QYM A;  2PL2 A;  2WXN A;  4ZZB A;  4CQI A;  2V0P A;  3R84 B;  3C5R A;  3ETU A;  4N2Q A;  2WQ6 A;  2UXN B;  2ACX A;  2X6H A;  1IQR A;  1P5Q A;  3ZW3 A;  1JCS A;  1JCQ A;  4XI0 A;  2KCK A;  4QHO A;  2VWA A;  1MMA A;  2FJB A;  3AEA A;  2L0I A;  3UKR G;  4JD2 G;  1LF8 A;  4IE0 A;  2KSR A;  2MOZ A;  3ZT5 A;  2NSZ A;  2BBH A;  2J1D G;  2ZGG A;  4CXX A;  2J9Q A;  5CER B;  3ABL E;  3CML A;  5ITZ F;  3GA8 A;  2P58 C;  3OKQ A;  5A1L A;  3Q75 A;  5EK2 A;  5JRC A;  3ZPO A;  1H6K A;  5IY5 E;  4AXP A;  3ULQ A;  4ZZC A;  5HXH A;  1PC2 A;  2JPF A;  5LHG B;  2KZT A;  2NC9 A;  5FQ7 A;  3PE0 A;  3T1H T;  4B8A A;  2WWU A;  2NTX A;  1MJ0 A;  2XUE A;  3UT4 A;  3ZT7 A;  2ZIS A;  3LJN A;  4H7Y A;  1VCT A;  5L4E A;  2EHO B;  5LCY A;  3ZLI A;  2N1G A;  4H7X A;  3A5X A;  3FEY A;  4EAH A;  3DPY A;  3Q73 A;  4YDO A;  2V6Y A;  4IDP A;  3PTR B;  3PZ4 A;  3Q7F A;  1I94 T;  4HFV A;  2P9L G;  3B95 A;  2OND A;  4BTA A;  3EAM A;  3SRZ A;  2H6H A;  3AE9 A;  1TNU A;  2J07 A;  4I17 A;  3AEC A;  2XM1 A;  3FDH A;  1HTJ F;  4QX8 B;  2LSG A;  5J1G A;  4ILA A;  5JDL A;  3QWW A;  3KEA A;  3ANW A;  2IC9 A;  2C2L A;  5H7P A;  3FTX A;  2V6X A;  4YJ2 E;  4X1Y E;  3RC3 A;  4BX8 A;  4P29 A;  4GZD A;  3T8M A;  1QNF A;  2LAI A;  2J4G A;  4F6R C;  2W62 A;  2IW5 B;  3PUY F;  3IF8 B;  4PS8 A;  3S7F A;  4DV3 T;  3JC6 D;  4HI8 A;  3TLT A;  2B76 A;  2VKO A;  2GW1 A;  3KD7 A;  3OBV E;  2BVM A;  3Q47 B;  1FT1 A;  3E08 A;  3CQG B;  3UTK A;  3KBU A;  1XNR T;  2C5K T;  2NXP A;  3NZS A;  3AA7 B;  3MK7 C;  3ZST A;  4GK5 E;  3O4Z A;  4OVU A;  2D5U A;  2W4X A;  1B7T A;  3ZKR A;  3I5P A;  3AAA B;  2BKK B;  5DIZ A;  2WPV A;  5JDM A;  3QNU A;  3JC6 C;  4F53 A;  3CVN A;  5HEU A;  1R8I A;  3TGO A;  3OVU A;  2JIW A;  1AP7 A;  5JR9 A;  4P0A A;  2A2F X;  3JAF A;  5LFA A;  2WY2 A;  3LK4 2;  1YW0 A;  3FTZ A;  4BT9 A;  4U3C A;  3ZN1 B;  2W00 A;  4AIS A;  2X9Y A;  5A7D B;  2J49 A;  1HFA A;  4B3S T;  2ZIR A;  4K03 A;  4WYV A;  3D9N A;  1LRZ A;  3TWQ A;  3UM3 A;  4EZJ A;  3P4S A;  2ION A;  4GOU A;  4UF0 A;  3H3A A;  3AU5 A;  4H63 H;  2IML A;  3D9L A;  1RZ4 A;  3SD5 A;  1HS6 A;  5LYJ E;  3RIF A;  4JEH A;  2L6J A;  4A1S A;  4PH4 B;  3TWW A;  2KXP C;  2QY7 A;  2PG8 A;  4ANW A;  3VR8 A;  4QH4 A;  4DV2 T;  1T8B A;  5FZQ A;  3SNX A;  4CGW A;  1UOH A;  3DJB A;  5FJY A;  1NEN A;  2D0T A;  5FY1 A;  2LUH A;  3K3Q C;  3NQP A;  5L47 A;  2CBI A;  4ILI A;  3JUI A;  3TLS A;  4U0S A;  3RO3 A;  4EED A;  4CYM D;  2VL0 A;  2I2O A;  1HX8 A;  4CT0 A;  1ZP0 A;  4GK0 E;  1SW6 A;  4LMK A;  4IDQ A;  2N2N A;  2JLB A;  3TJP A;  3V30 A;  4UV9 B;  4HFG A;  4EHM A;  4Q25 A;  3QB2 A;  3NZU A;  4WNG A;  2DL1 A;  4APF A;  2W0G A;  2XEH A;  4ANV A;  4TNV A;  2IAK A;  3ABV A;  5AN8 A;  2OV8 A;  3RIB A;  2JQQ A;  3FH7 A;  4WZX A;  3S4U A;  3L6A A;  2UXX B;  1E7P A;  2Q9Q C;  2D9D A;  5AQ7 A;  4I2W A;  3Q4A B;  1OUV A;  1ZOY A;  3A7M A;  3CX7 B;  3ZIM A;  1SHZ C;  2WU2 A;  3AEE A;  4LF6 T;  2GRN B;  2BG9 C;  3MJW A;  3APC A;  5KBA A;  5BXO A;  3TKL B;  2IF4 A;  2PM6 A;  3MEK A;  2WXQ A;  3J5P A;  5FIN A;  4HS2 A;  4A3T A;  3P50 A;  3SHF A;  1ELR A;  4GPM A;  1LVF A;  4U63 A;  4U0Z A;  1WAO 1;  2BG9 E;  4MAL A;  5LOZ A;  1W9R A;  3KV9 A;  3MKR A;  3V79 K;  4U96 D;  5HYA A;  5LX8 A;  5AQV B;  5DQW A;  3WXX A;  4C0E A;  4A98 A;  3ZVV A;  4DI4 A;  4XX5 A;  4IL9 A;  4ZS2 A;  3HA4 A;  4G63 A;  3N9L A;  3CSF A;  2ACZ A;  4HFH A;  3RHW A;  4OYK A;  4DR1 T;  2K24 A;  3MV2 B;  4JC8 A;  3MYV A;  2BKG A;  2WXH A;  3JCK C;  4JA7 A;  3HI2 A;  3ONK A;  1UCU A;  5ABF B;  2V4L A;  2L6B A;  3ASF A;  3C3R A;  1HCI A;  3TG4 A;  4FA6 A;  3CPZ A;  1D1A A;  4GTO A;  2YK0 A;  2VQ2 A;  4WAF A;  5L3E B;  2KCL A;  4QQI A;  3B57 A;  1FMW A;  4E7Z A;  4HI9 A;  2H7V C;  1MND A;  3NZP A;  4NUR A;  1MX4 A;  4UWG A;  5FXW A;  4O2A E;  3SFE A;  3AE5 A;  3C98 A;  3ZMU B;  4UWF A;  1BD8 A;  3K8P C;  2KT9 A;  5KCM A;  2X6J A;  1KZO A;  2FO7 A;  3AA6 B;  3L39 A;  3B7B A;  5TAO A;  1EPU A;  3CKC A;  3GWH A;  2MYS A;  3EHR A;  3FH5 A;  3AXJ A;  5BT1 A;  4HQD A;  4ISS A;  3ZRH A;  4EQF A;  2ZM6 T;  2KM4 A;  1Z6T A;  3HKD E;  2M63 A;  4N2S A;  4FU3 A;  3B7U X;  3OYZ A;  4ANU A;  2LAH A;  2FBN A;  4QXC B;  3R7R A;  5BXU A;  3ZYL A;  3LY9 A;  1VOM A;  4J8F A;  3VLF A;  2XQ0 A;  4ILC A;  4J8S A;  1GQE A;  4UV8 B;  4GA1 A;  1ZU2 A;  4JI8 T;  3KFW X;  4WWO A;  3B7R L;  3UUN A;  1YXR A;  2AW6 A;  2GRL A;  4GA0 A;  4JUY A;  2X68 A;  2LSJ A;  1D9S A;  4PJL A;  3B13 A;  3N9O A;  1XMO T;  2B6C A;  1LTX A;  4LMJ A;  3PZD A;  2CMR A;  3WAK A;  3AS4 A;  5AJD A;  5AQJ B;  5LGT B;  3P8C D;  4ACK A;  4B3T T;  4YFS A;  2Y0B G;  5CRV A;  2IY0 C;  3X1D A;  4HKA A;  3FZF B;  1H2T C;  4L0R A;  3R6N A;  2UXC T;  1SA4 A;  4L2L A;  3BK9 A;  3C50 A;  3ETV A;  2VGX B;  3SOL A;  3UUX A;  2XCC A;  3UTM A;  2FEZ A;  2ES0 A;  2Q9Q B;  2H89 A;  3RLF F;  5F3J A;  3KBT A;  1S0P A;  2C0S A;  5LBM A;  1FCH A;  1XZY A;  5EYP F;  4AIU A;  1TR4 A;  2B1E A;  3N9P A;  5AQU B;  5LCW J;  1X9B A;  4U7I A;  2KC7 A;  2UUA T;  2Y6X A;  3I9W A;  4CI1 B;  4O1P A;  1IYG A;  3E4B A;  4AQF C;  4YTN A;  3ZCJ A;  5LGU B;  1K3Z D;  5JMN D;  2V7L A;  4ZOL E;  1YKE B;  2WQ7 A;  3PEU B;  4DLO A;  4DMW A;  5JHA A;  1OCO E;  2MPK A;  2VUR A;  3S2A A;  3ULE G;  4TZ4 C;  3CK9 A;  5ADX L;  3CHO A;  4YSX A;  3PDY A;  1SA5 A;  4CN6 A;  2YOE A;  5HXR A;  5T3R A;  1N4P A;  4EGW A;  2P9U G;  4KZ0 A;  3DEO A;  3J5Q B;  2KIN B;  1HNZ T;  1XMQ T;  4I2Z A;  1J1J A;  4XEI G;  4CDN A;  1NWM X;  3O4X E;  5FQ4 A;  2WXO A;  2P9S G;  1OED A;  3VKH A;  3PH0 C;  2OLT A;  3GZ2 A;  5CCL A;  4LF9 T;  5IWA T;  4AEZ C;  5ENT D;  4C9B B;  1TNO A;  3BQL A;  4JI5 T;  2RFA A;  5C2Y A;  3URZ A;  2CXL A;  1YQ3 A;  4DX1 A;  4DV4 T;  3U64 A;  4BJN A;  2CEA A;  4ZHQ E;  1WG0 A;  2L9B A;  2E9X D;  1U4Q A;  1UJK A;  1UN8 A;  1ELK A;  2DWZ A;  3PJA J;  4BT8 A;  2G0U A;  3QUJ A;  4O4H E;  5CJ5 A;  3MGB A;  3AG3 E;  3HXB A;  5C3J A;  2UY1 B;  3P1U A;  3EDU A;  4HN9 A;  4UVC B;  3I9Y A;  2Y4T A;  3N5L A;  4ATZ D;  3D9O A;  2C0M A;  4FLB A;  2XSA A;  3HXF A;  3KIN B;  4UQY A;  5JDF A;  3S7J A;  3TAX A;  3CVV A;  1KNR A;  3KV6 A;  1DVP A;  3GZS A;  4KZC A;  4C91 A;  4I43 A;  4HVB A;  1VCS A;  4Y6W A;  2UXD T;  4GTT A;  5E75 A;  2HYZ A;  2VL8 A;  4W9R A;  4ILU A;  2M6B A;  4ZHB A;  5EID A;  2YDQ A;  3PU3 A;  4AP2 A;  2PTF A;  3BQK A;  5BV1 A;  3DSS A;  4OVV A;  2LHR A;  3IBP A;  4L1B A;  3SBS A;  5HS0 A;  1M7K A;  4CEM A;  2CLY C;  2XQ6 A;  4YTM A;  2KWI B;  3FFL A;  5J0Z A;  2J4B A;  1SE7 A;  4HOR A;  3T8K A;  2V7J A;  2R05 A;  3VU7 H;  4U0U A;  1QBQ A;  3ZFW A;  3FUI A;  5C8Y E;  2KLQ A;  4UUC A;  3FB2 A;  2YIN A;  4EZ4 A;  3CVP A;  3UU8 A;  1MNE A;  5CB4 E;  2V26 A;  3VR9 A;  1N94 A;  1Y01 A;  2HN2 A;  2F8Y A;  1JWF A;  5JVD E;  2WDV A;  2WU5 A;  4IE6 A;  2WZH A;  5AQT B;  4B8C B;  1YQ4 A;  1E2A A;  2PQN A;  4B0Z A;  2CHO A;  3W15 B;  2VTB B;  1IHG A;  4KVM A;  4Z68 A;  2V5F A;  3HKC E;  2PFV A;  1UGO A;  3PUA A;  2YHC A;  4ZI2 D;  4BES A;  4G8L A;  1W09 A;  5FXZ A;  2VKH A;  4IIJ E;  1KF6 A;  4AKR B;  2F4V T;  1J5E T;  5LXT E;  2EHO D;  4WWP A;  4FAD A;  4O8S A;  4AKG A;  3UQ4 A;  4UR9 A;  4GKJ T;  4L9I A;  4HWH A;  2IHR 1;  1MIW A;  3NOG D;  2I59 A;  1FIO A;  2QYW A;  1S70 B;  3RIU A;  4TWH A;  4ILG A;  3SWH A;  1X79 A;  2NW9 A;  1NP7 A;  3VRA A;  3FUN A;  3NRX A;  4PFP A;  2I1K A;  4F8H A;  2XPY A;  4L7T A;  3U66 A;  1UX4 A;  3L8R A;  4GMJ A;  5FT9 A;  5JH7 E;  1AWC B;  3FUH A;  4KMO A;  2KZT B;  2AJA A;  3GN5 A;  3IKO B;  4QWN B;  3ZPJ A;  3B7S A;  2X0Y A;  2E9X B;  2V7K A;  5H6Q B;  2BTD A;  2P9N G;  4AM9 A;  3CX6 B;  1D1B A;  5KJK A;  2LRL A;  5HEH A;  2A3D A;  2LSV A;  5HKP A;  4LFB T;  1S35 A;  3ZT6 A;  4O1O A;  3MXZ A;  4U8V D;  2V6Y B;  3FEX A;  3NAW A;  3AED A;  1O5M A;  4C48 B;  2QVA A;  2XZE A;  3HKB E;  5B1A E;  2D0U A;  2E8I A;  3O48 A;  3U78 A;  1V55 E;  4HRL A;  3TXN A;  2UU9 T;  3ANW B;  1IKN D;  4CZ2 D;  4IDN A;  3R9M A;  3LDZ A;  3QOU A;  2ZLY A;  3C3O A;  3LCA A;  1JCR A;  2VVN A;  3ZEF B;  1K8K G;  3S7D A;  4CCA A;  2DNX A;  1D8E A;  4JPS A;  1EDU A;  2VSY A;  1TJF A;  4QH5 A;  5ETW A;  2K3W A;  2FF4 A;  3FTV A;  3MV3 B;  4WWN A;  4OK0 A;  3EU5 A;  3VRB A;  3WAJ A;  3TWV A;  2KXP B;  3OTN A;  1OED C;  3ZYM A;  3ZYQ A;  5AQO B;  3D9M A;  5HEO A;  3KSQ A;  3PZ1 A;  3ASN E;  2GGF A;  5T4Y A;  4WNF A;  5CBN A;  3V5S A;  1V54 E;  4GML A;  4U31 A;  4E7S A;  2QYU A;  2OEW A;  4B3R T;  2JAB A;  3UQ7 A;  3ZNG A;  4IHJ E;  2CLY B;  4LF8 T;  3NRY A;  4HFE A;  4DK5 A;  4A55 A;  3RH3 A;  5JDH A;  3L17 A;  3H3M A;  5FQ6 A;  5FYM A;  5EN5 D;  4J8E A;  3CVX A;  5JR9 B;  2Y48 B;  1N52 A;  3HVE B;  5EZY E;  2XCB A;  3DEP A;  4WNE A;  3G06 A;  1TJC A;  2X0L B;  4OYJ A;  2LXL A;  1D0Y A;  3ZMV B;  2WDQ A;  4CRW A;  4GTS A;  5KDM C;  1WCR A;  4QFV A;  3RQU A;  2BZB A;  4L23 A;  4O4I E;  1UW4 B;  2J62 A;  1JPL A;  4JEH B;  3E22 E;  5BUZ A;  4GB9 A;  2XS1 A;  3KEZ A;  5JDQ A;  4GPK A;  2BS3 A;  5KNG A;  3V2X A;  4ACL A;  2CFU A;  3ZN3 A;  3U3W A;  3TG5 A;  4B3M T;  4UIG A;  2P9P G;  2ODU A;  5HXE A;  4I4T E;  2DI4 A;  1M62 A;  2WQY A;  4RG6 A;  3ZUV B;  5H6R B;  3CEQ A;  3PDN A;  4UWH A;  4PJJ A;  3JQ0 A;  3CKD A;  3IEG A;  4CGV A;  2LKG A;  4CI2 B;  4C90 A;  1MMN A;  1V9D A;  1XWM A;  4BJM A;  2WXI A;  2BKO A;  4WW0 A;  2WB2 A;  2CFZ A;  4R7L A;  2YN6 A;  2IO2 C;  1WFD A;  3FXE B;  1N0Q A;  2XQ7 A;  1QLB A;  3PUG A;  3AEG A;  2J8S D;  3LG7 A;  4JLE A;  3LXU X;  3N71 A;  3VLD A;  3EIQ C;  1OXJ A;  3EIJ A;  2K5B B;  2W63 A;  3KAE A;  3M65 A;  1N33 T;  2ZXW E;  2C5I T;  3PUV F;  4DLQ A;  1TYQ G;  5L3B B;  2IQC A;  3CGH A;  2OOE A;  3FU3 A;  4HNA D;  4M3O A;  3AAE B;  3NB2 A;  2XQY A;  3K3N A;  4NUV A;  3MAC A;  5HXS A;  4B89 A;  3CVW A;  2E2E A;  2VQF T;  2DBA A;  2PNN A;  4Z90 A;  3SS1 A;  1WM5 A;  4XBF B;  5BW8 C;  1T98 A;  5LBQ B;  3BG0 B;  3RJV A;  2XTL A;  4QXH B;  4YLH A;  3TL5 A;  3UUL A;  2B0O E;  4X8Q A;  5FIO A;  5CA0 E;  2ILR A;  3FZK B;  4B6X A;  2SPC A;  3P7I A;  4HE8 A;  1N36 T;  3UT7 A;  4O4J E;  1U5P A;  2HO1 A;  4IRE A;  3ZC1 A;  1SVX A;  4F1P A;  3LEW A;  2UY1 A;  3LK3 B;  4LSZ E;  4U8Y D;  1NEK A;  3CHR A;  2XPI A;  5EDS A;  3VKG A;  3UXG A;  2JQ9 A;  2W61 A;  5JJ7 A;  4IT4 A;  5CGM A;  3FY4 A;  4FHJ A;  4UI9 K;  4A97 A;  4U07 A;  5AQB A;  4LER A;  2RA1 A;  5G04 C;  5JTG A;  2NW7 A;  3LJ3 A;  3DXM G;  3FUM A;  4H9Q C;  3AG4 E;  3UIP C;  2EIN E;  1ZBP A;  4U72 A;  4ATG A;  1OWL A;  5C1D A;  4GCN A;  2Q9Q D;  3OXF A;  2IEJ A;  3AE3 A;  4TV9 E;  2BS4 A;  4G2V A;  2WDR A;  1YMP A;  2P9B A;  5CED B;  2DZN A;  4TXR A;  4HOQ A;  2WMO A;  3E32 A;  1S63 A;  2OVF A;  2CA5 A;  3OPC A;  4I6E A;  1FJG T;  3J7Y q;  2XEV A;  3D9K A;  4J2C A;  1HS7 A;  1UG3 A;  3QJZ A;  2H6I A;  4FJZ A;  1MX6 A;  3PV0 F;  5HCM A;  1BPO A;  4HOT A;  2LT3 A;  3SFD A;  3AE1 A;  3Q49 B;  3C4W A;  4LFC T;  3E0Z A;  4O4L E;  2WVI A;  3Q7A A;  4UQX A;  5LP6 E;  1E8X A;  3CKB A;  3RYC E;  5ARG A;  2LRK A;  2HN1 A;  3RRW A;  3HXD A;  4JBW F;  1QZ2 A;  3WI3 A;  4I1O B;  2Y8D A;  2IC6 A;  4BSZ B;  5EIB E;  4HFC A;  5DJQ C;  3M3Z B;  1NZN A;  2BED A;  3HIZ A;  4Q94 A;  2NTY A;  4YT0 A;  3I4G A;  2H3R A;  3CHQ A;  3WG7 E;  2V5Q C;  3CVU A;  3O9X A;  4AQF A;  2FJE A;  4E85 A;  2MRI A;  1HG5 A;  4K5C A;  3ZMT B;  3T8O A;  2QA7 A;  4XKC A;  4RG9 A;  1KLX A;  2P9K G;  1HO8 A;  5M4Y A;  4L5G A;  3P2B A;  3RK6 A;  4HWC A;  2GRM A;  4GU5 A;  4QXB B;  2LSY A;  2WXK A;  2V5C A;  3BUA A;  1OXZ A;  1HX1 B;  1HXI A;  4AKH A;  3RAU A;  1Z0P A;  4JB8 P;  4MBQ A;  5JQG E;  2VB6 A;  4LNU D;  3F57 A;  4X1I E;  4AQG A;  1WRD A;  2WZI A;  5KXJ A;  5ABH A;  3RRM B;  2CHN A;  3CST A;  1SZA A;  4BET A;  1BR0 A;  4G11 A;  5JDG A;  5AQL B;  1YYH A;  4OAU C;  2XGO A;  1W3B A;  3Q5E A;  2DLR A;  4J8Y A;  2HPJ A;  4K5B A;  5JJT A;  3E34 A;  4DJA A;  3HYM B;  1OED B;  4EYU A;  2XEN A;  3D0T A;  3JYS A;  5KX5 E;  3UU6 A;  1BI7 B;  2LM9 A;  3I4R B;  5AQP B;  1MHQ A;  3RU0 A;  2NYJ A;  3RKG A;  4OX9 T;  3RC8 A;  3CVR A;  3A8Y C;  2JQK A;  3Q5D A;  2Z6E A;  5FVK A;  5JA4 D;  4NQ0 A;  2XHE B;  3ASG A;  4FLH A;  5M72 A;  4HWF A;  4I9C A;  3LBX A;  4PS3 A;  5G05 C;  1N4R A;  4DV5 T;  3DRA A;  3VTX A;  2J47 A;  2UXB T;  3C4X A;  3KVA A;  4TRQ A;  2L8K A;  4KX6 A;  4LUN U;  4RVB A;  4DX2 A;  3PUK A;  3EDV A;  3ONL C;  1U2V G;  2BUG A;  2MOW A;  5JHB A;  2JMH A;  3ZJ1 A;  2WXM A;  1W0B A;  2QYJ A;  5JRC B;  5J90 A;  3NKZ A;  4GAA A;  2I1J A;  3EU9 A;  1TNZ A;  3C3Q A;  3HDX A;  1B89 A;  2EIL E;  4DV7 T;  3EHQ A;  1S94 A;  3GW4 A;  4GTP A;  1INZ A;  4X20 E;  4YTP A;  3TWX A;  3ZHE B;  3Q5X A;  4LRZ A;  1K1A A;  4PFO A;  4IST A;  3IHR A;  4ZI7 E;  2VGY A;  4URK A;  4V3I A;  5KWD A;  2AXU A;  5HQ8 A;  5EIL A;  3FTS A;  4MS6 A;  3L16 A;  3AAA C;  3JXJ A;  3PVL A;  5ANR A;  2X0H A;  3D9H A;  3LKU A;  4ADZ A;  1XNQ T;  5EKQ D;  4LFA T;  1T7S A;  3FUJ A;  4IL4 A;  3PUZ F;  3G2S A;  2P2C P;  4KMC A;  3K1S A;  1TNB A;  1YKH B;  5LP0 A;  3BQI A;  1MYO A;  4P0B A;  3L08 A;  3CQC B;  1WYC A;  3FZM B;  2UUB T;  2MAW A;  3AS8 A;  4GTM A;  5AQA A;  3EHN A;  1IBL T;  4UVA B;  4LEU A;  2CWO A;  4GYR A;  2CHZ A;  3TWS A;  3BEE A;  3RRC A;  2VKD A;  3FBL A;  3LY8 A;  5AQI B;  5LMN T;  3OXG A;  3QDN A;  4GA2 A;  2GK9 A;  4IGU A;  3U4T A;  4DPR A;  2AXZ A;  4I1M A;  2BG9 A;  5AFU L;  4O60 A;  3RGL A;  5BR8 T;  5CRU A;  2WAU A;  1G8X A;  2QC9 A;  3B7T A;  4UXN B;  2PBI A;  4ERR A;  1ZEE A;  5CFB A;  5KJL A;  4LCT A;  2X9W A;  2VTB A;  4TX5 A;  5G04 J;  1OCZ E;  2XEE A;  3LS8 A;  5F8P A;  5CEA A;  3O1J A;  4OFZ A;  3TLU A;  3DXK G;  1PY1 A;  3KV4 A;  4AY6 A;  2DWK A;  1Z5S C;  3JCF A;  3AE4 A;  2YNQ A;  2BKP A;  2H6F A;  5D2M C;  4BX9 A;  1X5B A;  3O1H A;  2EHO A;  3Q5M A;  5ENO D;  3VLE A;  5F5W A;  2OV9 A;  3SFZ A;  2VK9 A;  1IQU A;  1NAF A;  2V1D B;  1U3D A;  1X81 A;  2KBX A;  3RI5 A;  2J4D A;  3KSL A;  1SA0 E;  3L82 A;  3GZ1 A;  3PE4 A;  2YU2 A;  5EK3 A;  4QX7 B;  3ESK A;  3KVB A;  3GN5 B;  2RG8 A;  1KFY A;  4NIQ A;  5CEC B;  2XQ8 A;  1MZC A;  4JEU B;  3PRE A;  4GZ6 A;  4GTQ A;  4TXQ A;  2LO6 A;  2GRQ B;  3CV0 A;  3FU0 A;  5J08 A;  3IV0 A;  4TN7 B;  3RX6 A;  1IBK T;  4TNW A;  4COF A;  4P1N A;  2YKS A;  2CCQ A;  3ML9 A;  1SUM B;  5ABG A;  4DV6 T;  4G24 A;  3CX8 B;  3GMI A;  5L3G B;  2X38 A;  4ZEY A;  5J2U E;  1YCS B;  3PZ2 A;  1KT0 A;  1QSD A;  4EIW A;  4JI2 T;  2DZO A;  4ZFH A;  4AI6 A;  2Y4U A;  2K48 A;  4LNG A;  1Z8U A;  4U04 A;  2L9Q A;  3SI5 A;  1HG2 A;  2LEH A;  4WUY A;  2BF0 X;  1WDY A;  4BA9 A;  3AVS A;  4GTR A;  5FQ8 A;  5ARF A;  4EPZ A;  2H88 A;  3LK2 B;  2IOL A;  4F6R D;  2ZGD A;  2LHN A;  3C4Z A;  4NXN T;  4YSY A;  2JRK A;  1OCR E;  5G55 A;  4YJ3 E;  5A6C A;  2NR4 A;  1E8Y A;  4IN3 B;  5HEG A;  4AXH A;  4EOZ B;  3AE2 A;  4JI7 T;  4KYO B;  4ILH B;  1IAP A;  3LJC A;  1GW6 A;  5BMV E;  5T8I A;  4CI3 B;  2RFM A;  3D9P A;  2QZA A;  1N32 T;  3N9M A;  4UF0 B;  1YD8 G;  1G3N B;  4DV1 T;  3GYZ A;  3RRN B;  4BEP A;  3UU3 A;  1LD8 A;  3RIA A;  1XDO A;  4PUC A;  5L3C B;  5LGN B;  3CLJ A;  3PUR A;  1NA3 A;  4YND A;  2I0M A;  4AKL A;  4ZI3 D;  3CHM A;  3P4W A;  3UUX B;  2VGX A;  3T5V A;  3T5X A;  3AEF A;  1BR1 A;  4CXW A;  3FUE A;  3OJA A;  3C64 A;  4DND A;  4ME2 A;  3UKU G;  3FHE A;  3G2V A;  4TV3 A;  3V2O A;  3MKQ B;  5DAB A;  3ZCI A;  2XM2 A;  2M6I A;  4EZL A;  2AE9 A;  4K0K T;  4AV7 A;  2E5V A;  4GYY A; 
#chains in the Genus database with same CATH homology
 3FXD B;  3ONX A;  2CXD A;  1E8W A;  5LG4 A;  1MMG A;  1E90 A;  3V5U A;  4A1G A;  3G2W A;  3MX3 A;  2ZMA A;  3BG1 B;  3PS6 A;  3C51 A;  4N3A A;  2YU1 A;  4PS7 A;  3ONL A;  4GYW A;  4EBA G;  5IHY A;  1FVF A;  3PE3 A;  1U3C A;  2VAS A;  5A23 A;  5JRE A;  1OWP A;  3C98 B;  2KCV A;  5HXC A;  2YQ8 A;  2NOX A;  5HWX A;  4MKT A;  4YVO A;  4JA9 A;  4FHK A;  4PDX A;  3RYH E;  4H9S E;  3CVQ A;  4WBO A;  5E0O A;  1IZN B;  4AJW A;  3LFM A;  1SZ9 A;  3SGH A;  5FZS A;  3KV5 A;  4HOU A;  3UUM A;  3CVY A;  5JJ6 A;  1CUN A;  2I6H A;  4OYS A;  4ABN A;  4DBQ A;  1Y6I A;  2DWG A;  1WYB A;  5FY0 A;  2RP4 A;  1OWA A;  4A56 A;  1KT1 A;  2CXF A;  2J08 A;  5JR9 C;  3IBE A;  1HZ4 A;  2VYI A;  1BR2 A;  4DVD A;  4XIF A;  1Z3X A;  2AVP A;  4J6I A;  4UQZ A;  3RKO A;  4Z8X A;  2NP9 A;  4IE7 A;  3FBZ A;  3R9A B;  3L3P A;  4ZI3 C;  1EYH A;  2XHE A;  4PAG A;  2QGS A;  3LBX B;  3DBS A;  2XRY A;  1LKX A;  2XAF B;  4I9E A;  4N5C A;  5EX3 A;  2V7I A;  5CA1 E;  3QNK A;  2VJ8 A;  3OXL A;  2OA5 A;  4UEL A;  4JHJ A;  3FH8 A;  2R5S A;  4GYS A;  2QFC A;  2N9D A;  3OAW A;  4KBQ A;  2CWY A;  3QWV A;  5CMW A;  3AB3 B;  4E6H A;  4X1K E;  5D0Q D;  2L0T B;  1KK7 A;  3CVL A;  4H9R C;  2X9X A;  4IYP A;  5FY7 A;  2Q7F A;  3F31 A;  5CHE E;  4GZ3 A;  2IJG X;  4TUU A;  3SBT B;  2LOS A;  2XPZ A;  3NZQ A;  2HR2 A;  3QAR A;  4KUM B;  2VSN A;  3N2K E;  4IE4 A;  3FHN A;  2LSU A;  3VHL A;  4A3V A;  5E76 A;  1US7 B;  3L54 A;  2A4Z A;  2BDE A;  2Q9Q A;  1EZ3 A;  3K9I A;  3O1I A;  3N2O A;  2LSK A;  2X6F A;  2DCF A;  3KS2 A;  4BTB A;  2ZM8 A;  3G2U A;  2CHW A;  3ZGQ A;  1ZKE A;  3RYI E;  3NBX X;  3LY7 A;  4OHF A;  2V7M A;  1XGW A;  4I43 B;  3QWP A;  4J8D A;  3MA9 A;  2ZM2 A;  3Q2M A;  5LOV E;  2CG3 A;  5HWY A;  2MBG A;  3MJX A;  3DP7 A;  1LVK A;  4HXI A;  3U3I A;  2WMN A;  3D9I A;  2YEV C;  5FXV A;  2X6K A;  2MTQ A;  3LPZ A;  5FWQ A;  4AKI A;  3MA5 A;  1ZHC A;  4H9O C;  3HHM A;  3FUK A;  3I0O A;  2C5J A;  2KZ7 B;  5L3D B;  3Q5W A;  1DNP A;  4XE0 A;  2E9X C;  2H7O A;  4BFR A;  1UN9 A;  1HH8 A;  5KMG P;  2IOS A;  3H37 A;  4NUU A;  4CZZ B;  1E8Z A;  3PEV B;  5AEN A;  4AVX A;  2HH7 A;  4BAY B;  1O3X A;  3EDT B;  4K0U A;  3D3M A;  3UT8 A;  5EX0 A;  5FXX A;  3OYX A;  3LVQ E;  4EEC A;  3I1A A;  3PNL B;  3FU5 A;  2NWB A;  4KP3 C;  4G1T A;  4MLP A;  2OVB A;  4JL0 A;  1E96 B;  3EVY A;  1A17 A;  4DO0 A;  4I50 E;  1MIV A;  4WND A;  4AIF A;  3DPD A;  4GYO A;  3S7B A;  4GIW A;  4O2B E;  3CQX C;  3PUJ A;  3HKE E;  4N3C A;  2CHX A;  5CMY A;  3QAQ A;  3SF4 A;  2M67 A;  5ANL A;  1FVH A;  5FP3 A;  1G73 A;  5L3F B;  3ZHE A;  4G23 A;  4BY6 A;  5GON E;  2XAS B;  5DBK A;  3UMV A;  3FUL A;  3KDS E;  4HTE A;  2V8S E;  3FWV A;  3N9Q A;  1HF8 A;  2XAG B;  4M1P A;  1QQE A;  5DQV A;  1H0A A;  3ZC0 A;  4EXT A;  2X66 A;  4XZC A;  2R59 A;  3FTW A;  2X9H A;  4IRU A;  4FP7 A;  3AA0 B;  4DMV A;  4FJO A;  1H2V C;  3VTY A;  4GZC A;  4FI5 A;  3CIA A;  4Q96 A;  4MFR A;  2KND A;  5AIJ A;  2LSI A;  4XI9 A;  2UWJ G;  4FUL A;  1L5J A;  3QKY A;  3UPV A;  4YVQ C;  3FTU A;  2CG2 A;  2A72 A;  1H7C A;  4N78 D;  4PJN A;  4AOF A;  2KMF A;  3ZMS B;  3IEE A;  3QC9 A;  5LJM A;  4ANX A;  4FC8 A;  4I1A A;  4H63 V;  3I0Q A;  2E0I A;  3ZYK A;  4KXK B;  2WXG A;  2Y3A A;  1FMV A;  2WSS V;  3CK7 A;  2WXR A;  4XZ4 A;  5HAX A;  1VDY A;  3L13 A;  4KVO A;  5FTP A;  2HM8 A;  4JW1 A;  5KJM A;  4I55 E;  1NA0 A;  4EZH A;  4Y6C A;  4AY5 A;  2HPL A;  2A5U A;  4PJM A;  4GCO A;  2EHO C;  3CHP A;  3JQ1 A;  5KJN A;  4HOS A;  2LE8 A;  1E7V A;  2FI7 A;  2X67 A;  4BSX A;  5LJN A;  2WXL A;  3MZL B;  3APF A;  3NF1 A;  3ZN0 B;  1FEW A;  2WQH A;  2VKJ A;  4WNK A;  3IHV A;  4BWR A;  2WXF A;  3QK6 A;  4PK5 A;  3IHY A;  4UVB B;  3UQ3 A;  2XAJ B;  2WXJ A;  2D2S A;  3HR0 A;  3ZEF A;  4JZY A;  3Q9D A;  3AAI A;  2EQX A;  2LOP A;  5LCW C;  4XKB A;  3L22 A;  2J09 A;  4JXT A;  5BPP A;  3ZJ2 A;  3FUD A;  4D10 C;  2IU1 A;  4K0R A;  2AXV A;  1Z3Y A;  3RYF E;  5BNW A;  3RRU A;  2X6I A;  3FUF A;  4PK6 A;  1MMD A;  2AWI A;  3RKV A;  4ZI2 C;  1XNF A;  1WLX A;  4JHK A;  1PAQ A;  5L2L A;  3AA1 B;  4CDR A;  1ZV4 X;  3AU4 A;  1IJ5 A;  2VSX E;  3ESL A;  3HL6 A;  1SQM A;  4Q69 A;  2PQR A;  4L2Y A;  5G05 J;  4ZS3 A;  2DHR A;  4NRH B;  1JWG A;  2E9X A;  5EK4 A;  4PK4 A;  5BV0 A;  4KBM B;  1N54 A;  1TEZ A;  5AJL A;  5G2N A;  4CDM A;  4GZ5 A;  4DBR A;  3UFE A;  2XGS A;  1H2U A;  1D0X A;  2X51 A;  2PJQ A;  1VRB A;  3MKQ A;  3FP3 A;  3ZMZ B;  3MCX A;  3ZXS A;  4IUL A;  4UWK A;  4YHJ A;  1OWO A;  3PNT B;  1D0Z A;  4J0U A;  3D9J A;  1HE8 A;  3PUQ A;  3QK0 A;  3CHS A;  3ML8 A;  4IE5 A;  4JHR A;  3UT5 E;  4DI3 A;  3LVR E;  1E1H B;  1OWN A;  3ASD A;  3N9N A;  5LHH B;  2XGM A;  2LJL A;  1E7U A;  4EZK A;  2IFU A;  4EYY R;  5J2T E;  3R7Q A;  5FMN A;  3J9X 1;  2C0L A;  4B94 A;  5LHI B;  5HI7 A;  3CWZ B;  3LYA A;  3APD A;  4CT4 A;  2PZI A;  4U8H A;  2XAQ B;  4UI9 C;  1OWM A;  1BR4 A;  3MKD A;  2JMK A;  1EF1 C;  3SZ7 A;  5LNK A;  3EUH A;  2LNI A;  2ZU6 B;  3F2E A;  4PNI A;  4F3V A;  3HVE A;  2ODV A;  3UX4 A;  1ELW A;  2KAT A;  4U74 A;  3ASH A;  4KT6 B;  4HLE A;  5FZR A;  2WBL A;  4TV8 E;  4APO A;  1UX5 A;  2R17 C;  2DIW A;  3PUS A;  2I9C A;  4F1S A;  3QC1 A;  1UJJ A;  4I6J A;  2XRZ A;  2WXP A;  2KWH A;  3CK8 A;  4V1A v;  4P09 A;  4EB6 E;  4RSY A;  3Q15 A;  4G26 A;  1AJ3 A;  1KNZ A;  1QUU A;  2BVL A;  4EBA A;  1WR6 A;  4I6G A;  3DTO A;  3FTY A;  2ZM0 A;  2CM0 A;  4CXY A;  2VSO E;  3RPU A;  5JDN A;  3FU6 A;  2JJ9 A;  4UWL A;  4FJY A;  4WBN E;  4PW8 A;  5IYZ E;  4N39 A;  4NAC A;  1YA0 A;  2DCP A;  4G25 A;  3PU8 A;  4HGA A;  1MIY A;  1JUQ A;  2NW8 A;  4TUY E;  3EJN A;  3L09 A;  4XAX B;  4MRU A;  2RD0 A;  2JEK A;  3PRZ A;  3G2T A;  3U9W A;  4HEA A;  4ASK A;  3I3N A;  1HU3 A;  4N3B A;  2CE7 A;  3MZK B;  4MLK A;  5ENN A;  1WY6 A;  1H19 A;  4H9P C;  2XAH B;  3AS5 A;  1D1C A;  4F7A A;  3N2G E;  4H9N C;  4UEM A;  2YHE A;  4MHC A;  5AYW D;  3AVR A;  2FUL A;  5FNV E;  2K9A A;  3RO2 A;  5LA6 E;  3EHM A;  4C0M A;  2WM9 A;  2X3M A;  1MQS A;  4JVS A;  3ENE A;  4JEU A;  3TXM A;  2MHK A;  1IJ6 A;  4ANJ A;  3CR3 A;  4IDZ A;  5CCM A;  4QKN A;  2PM7 A;  1Y8M A;  2L3L A;  4G2A A;  3K3O A;  1Y64 B;  4UI9 J;  4O6F A;  5D0O D;  2PL2 A;  2WXN A;  4CQI A;  2V0P A;  3R84 B;  3ETU A;  4N2Q A;  2WQ6 A;  2UXN B;  2ACX A;  2X6H A;  1IQR A;  1P5Q A;  3ZW3 A;  4XI0 A;  2KCK A;  4QHO A;  2VWA A;  1MMA A;  2L0I A;  1LF8 A;  4IE0 A;  2MOZ A;  2NSZ A;  2J1D G;  4CXX A;  2J9Q A;  3CML A;  3GA8 A;  2P58 C;  3OKQ A;  5A1L A;  5EK2 A;  5JRC A;  3ZPO A;  1H6K A;  4AXP A;  3ULQ A;  5HXH A;  1PC2 A;  2JPF A;  5LHG B;  2KZT A;  2NC9 A;  5FQ7 A;  3PE0 A;  4B8A A;  2WWU A;  2NTX A;  2XUE A;  3UT4 A;  4H7Y A;  2EHO B;  5LCY A;  3ZLI A;  2N1G A;  4H7X A;  3A5X A;  3FEY A;  4EAH A;  3PTR B;  4HFV A;  2OND A;  4BTA A;  3SRZ A;  2J07 A;  4I17 A;  3FDH A;  1HTJ F;  4QX8 B;  2LSG A;  5J1G A;  5JDL A;  3QWW A;  3ANW A;  2IC9 A;  2C2L A;  3FTX A;  4BX8 A;  4YJ2 E;  4X1Y E;  3RC3 A;  4P29 A;  4GZD A;  3T8M A;  1QNF A;  2LAI A;  4F6R C;  2W62 A;  2IW5 B;  3IF8 B;  4PS8 A;  3S7F A;  3JC6 D;  2VKO A;  2GW1 A;  3KD7 A;  3OBV E;  2BVM A;  3Q47 B;  3E08 A;  3UTK A;  3CQG B;  3KBU A;  2C5K T;  2NXP A;  3NZS A;  3AA7 B;  3MK7 C;  4GK5 E;  3O4Z A;  4OVU A;  2D5U A;  1B7T A;  3I5P A;  3AAA B;  5DIZ A;  2WPV A;  5JDM A;  3JC6 C;  4F53 A;  3CVN A;  3TGO A;  5JR9 A;  4P0A A;  2A2F X;  5LFA A;  3LK4 2;  1YW0 A;  3FTZ A;  4BT9 A;  3ZN1 B;  2W00 A;  2X9Y A;  5A7D B;  2J49 A;  1HFA A;  4K03 A;  3D9N A;  1LRZ A;  4EZJ A;  2ION A;  4GOU A;  4UF0 A;  3H3A A;  3AU5 A;  4H63 H;  3D9L A;  3SD5 A;  1HS6 A;  5LYJ E;  4JEH A;  2L6J A;  4A1S A;  4PH4 B;  2QY7 A;  2PG8 A;  4ANW A;  5FZQ A;  3SNX A;  4CGW A;  3DJB A;  5FJY A;  2D0T A;  5FY1 A;  3K3Q C;  3NQP A;  4ILI A;  3JUI A;  4U0S A;  3RO3 A;  2I2O A;  1HX8 A;  4CT0 A;  4GK0 E;  2N2N A;  2JLB A;  3TJP A;  4UV9 B;  4HFG A;  3QB2 A;  3NZU A;  4WNG A;  4APF A;  2W0G A;  4ANV A;  2IAK A;  2OV8 A;  3RIB A;  2JQQ A;  3FH7 A;  3S4U A;  3L6A A;  2UXX B;  2Q9Q C;  4I2W A;  3Q4A B;  1OUV A;  3CX7 B;  3ZIM A;  1SHZ C;  3MJW A;  3APC A;  3TKL B;  2IF4 A;  2PM6 A;  3MEK A;  2WXQ A;  4HS2 A;  4A3T A;  3SHF A;  1ELR A;  1LVF A;  4U63 A;  4U0Z A;  1WAO 1;  4MAL A;  5LOZ A;  3KV9 A;  3MKR A;  5HYA A;  5LX8 A;  5DQW A;  3WXX A;  4C0E A;  3ZVV A;  4DI4 A;  4XX5 A;  4ZS2 A;  3HA4 A;  4G63 A;  3N9L A;  3CSF A;  4OYK A;  2K24 A;  3MV2 B;  4JC8 A;  3MYV A;  2WXH A;  3JCK C;  4JA7 A;  3HI2 A;  3ONK A;  1UCU A;  2V4L A;  3ASF A;  1HCI A;  3TG4 A;  4FA6 A;  3CPZ A;  1D1A A;  2YK0 A;  2VQ2 A;  4WAF A;  5L3E B;  2KCL A;  3B57 A;  1FMW A;  4E7Z A;  2H7V C;  1MND A;  3NZP A;  4NUR A;  4UWG A;  5FXW A;  4O2A E;  3C98 A;  3ZMU B;  4UWF A;  3K8P C;  2KT9 A;  5KCM A;  2X6J A;  2FO7 A;  3AA6 B;  5TAO A;  1EPU A;  3CKC A;  3GWH A;  2MYS A;  3FH5 A;  5BT1 A;  4ISS A;  3ZRH A;  4EQF A;  2KM4 A;  1Z6T A;  3HKD E;  2M63 A;  4N2S A;  4FU3 A;  3B7U X;  3OYZ A;  4ANU A;  2LAH A;  2FBN A;  4QXC B;  3R7R A;  3ZYL A;  3LY9 A;  1VOM A;  4J8F A;  3VLF A;  2XQ0 A;  4J8S A;  4UV8 B;  4GA1 A;  1ZU2 A;  3KFW X;  4WWO A;  3B7R L;  3UUN A;  2AW6 A;  2GRL A;  4GA0 A;  4JUY A;  2X68 A;  2LSJ A;  4PJL A;  3B13 A;  3N9O A;  3PZD A;  2CMR A;  3WAK A;  3AS4 A;  5AJD A;  5LGT B;  3P8C D;  4ACK A;  4YFS A;  4HKA A;  3R6N A;  4L0R A;  1H2T C;  4L2L A;  3BK9 A;  3C50 A;  3ETV A;  2VGX B;  3SOL A;  3UUX A;  2XCC A;  2FEZ A;  2ES0 A;  2Q9Q B;  5F3J A;  3KBT A;  1S0P A;  2C0S A;  5LBM A;  1FCH A;  2B1E A;  3N9P A;  5LCW J;  2KC7 A;  2Y6X A;  3I9W A;  4CI1 B;  1IYG A;  3E4B A;  4AQF C;  5LGU B;  3ZCJ A;  2V7L A;  4ZOL E;  1YKE B;  2WQ7 A;  3PEU B;  4DLO A;  4DMW A;  5JHA A;  3S2A A;  4TZ4 C;  3CK9 A;  5ADX L;  3CHO A;  3PDY A;  5HXR A;  5T3R A;  4KZ0 A;  2KIN B;  4I2Z A;  4CDN A;  1NWM X;  3O4X E;  5FQ4 A;  2WXO A;  3VKH A;  3PH0 C;  3GZ2 A;  5CCL A;  4AEZ C;  4C9B B;  3BQL A;  5C2Y A;  3URZ A;  2CXL A;  3U64 A;  4BJN A;  2CEA A;  4ZHQ E;  2L9B A;  2E9X D;  1U4Q A;  1UJK A;  1UN8 A;  1ELK A;  4BT8 A;  2G0U A;  3QUJ A;  4O4H E;  3MGB A;  1INZ A;  3P1U A;  2UY1 B;  3EDU A;  4HN9 A;  4UVC B;  3I9Y A;  2Y4T A;  3N5L A;  3D9O A;  2C0M A;  4FLB A;  3KIN B;  4UQY A;  5JDF A;  3S7J A;  3TAX A;  3CVV A;  3KV6 A;  1DVP A;  3GZS A;  4KZC A;  4C91 A;  4I43 A;  4HVB A;  4Y6W A;  5E75 A;  2HYZ A;  2VL8 A;  4W9R A;  4ILU A;  3PU3 A;  4AP2 A;  3BQK A;  5BV1 A;  4OVV A;  2LHR A;  3IBP A;  4L1B A;  3SBS A;  4CEM A;  2CLY C;  2KWI B;  3FFL A;  2J4B A;  4HOR A;  2V7J A;  3VU7 H;  4U0U A;  3ZFW A;  3FUI A;  5C8Y E;  2KLQ A;  3FB2 A;  2YIN A;  4EZ4 A;  3CVP A;  1MNE A;  5CB4 E;  2V26 A;  1JWF A;  5JVD E;  4IE6 A;  4B8C B;  2PQN A;  4B0Z A;  3W15 B;  2VTB B;  1IHG A;  4KVM A;  2V5F A;  3HKC E;  2PFV A;  3PUA A;  2YHC A;  4ZI2 D;  5FXZ A;  2VKH A;  4IIJ E;  4AKR B;  5LXT E;  2EHO D;  4WWP A;  4FAD A;  4O8S A;  4AKG A;  4L9I A;  1MIW A;  2I59 A;  1FIO A;  4ILG A;  3SWH A;  1X79 A;  2NW9 A;  1NP7 A;  3FUN A;  3NRX A;  4PFP A;  2I1K A;  2XPY A;  4L7T A;  3U66 A;  1UX4 A;  4GMJ A;  5FT9 A;  5JH7 E;  3FUH A;  4KMO A;  2KZT B;  3GN5 A;  3IKO B;  4QWN B;  3ZPJ A;  3B7S A;  2E9X B;  2V7K A;  5H6Q B;  2BTD A;  4AM9 A;  3CX6 B;  1D1B A;  5KJK A;  2A3D A;  2LSV A;  1S35 A;  3MXZ A;  3FEX A;  3HKB E;  2D0U A;  2E8I A;  3O48 A;  3U78 A;  3TXN A;  3ANW B;  3LDZ A;  3QOU A;  2ZLY A;  3LCA A;  3ZEF B;  3S7D A;  4CCA A;  2DNX A;  4JPS A;  1EDU A;  2VSY A;  1TJF A;  5ETW A;  2FF4 A;  3FTV A;  3MV3 B;  4WWN A;  4OK0 A;  3WAJ A;  2KXP B;  3OTN A;  3ZYM A;  3ZYQ A;  3D9M A;  2GGF A;  5T4Y A;  4WNF A;  3V5S A;  4GML A;  4E7S A;  4IHJ E;  2CLY B;  3NRY A;  4DK5 A;  4A55 A;  3RH3 A;  5JDH A;  3L17 A;  5FQ6 A;  5FYM A;  4J8E A;  3CVX A;  5JR9 B;  2Y48 B;  1N52 A;  3HVE B;  5EZY E;  2XCB A;  4WNE A;  1TJC A;  2X0L B;  4OYJ A;  1D0Y A;  3ZMV B;  4CRW A;  5KDM C;  4QFV A;  2BZB A;  4L23 A;  4O4I E;  1UW4 B;  1JPL A;  4JEH B;  3E22 E;  5BUZ A;  4GB9 A;  3KEZ A;  5JDQ A;  4GPK A;  4ACL A;  2CFU A;  3ZN3 A;  3U3W A;  3TG5 A;  4UIG A;  2ODU A;  5HXE A;  4I4T E;  2DI4 A;  4RG6 A;  5H6R B;  3CEQ A;  3PDN A;  4UWH A;  4PJJ A;  3JQ0 A;  3CKD A;  3IEG A;  4CGV A;  4CI2 B;  4C90 A;  1MMN A;  1V9D A;  4BJM A;  2WXI A;  4WW0 A;  2WB2 A;  2CFZ A;  4R7L A;  3FXE B;  3PUG A;  3LG7 A;  4JLE A;  3LXU X;  3N71 A;  3VLD A;  3EIQ C;  3EIJ A;  2K5B B;  2W63 A;  3KAE A;  3M65 A;  2C5I T;  4DLQ A;  5L3B B;  2IQC A;  3CGH A;  2OOE A;  3FU3 A;  4M3O A;  3AAE B;  2XQY A;  3K3N A;  4NUV A;  3MAC A;  5HXS A;  4B89 A;  3CVW A;  2E2E A;  2DBA A;  3SS1 A;  1WM5 A;  4XBF B;  5BW8 C;  1T98 A;  5LBQ B;  3BG0 B;  3RJV A;  2XTL A;  4QXH B;  4YLH A;  3TL5 A;  3UUL A;  5CA0 E;  2ILR A;  4B6X A;  2SPC A;  3P7I A;  4HE8 A;  3UT7 A;  4O4J E;  1U5P A;  2HO1 A;  3ZC1 A;  3LEW A;  2UY1 A;  3LK3 B;  3CHR A;  2XPI A;  5EDS A;  3VKG A;  2W61 A;  5JJ7 A;  3FY4 A;  4FHJ A;  4UI9 K;  4U07 A;  4LER A;  2RA1 A;  5G04 C;  2NW7 A;  3LJ3 A;  3FUM A;  4H9Q C;  1ZBP A;  4U72 A;  4ATG A;  1OWL A;  5C1D A;  4GCN A;  2Q9Q D;  3OXF A;  4TV9 E;  2P9B A;  4HOQ A;  2WMO A;  2OVF A;  2CA5 A;  4I6E A;  3J7Y q;  2XEV A;  3D9K A;  4J2C A;  1HS7 A;  1UG3 A;  3QJZ A;  4FJZ A;  1BPO A;  4HOT A;  2LT3 A;  3Q49 B;  3C4W A;  3E0Z A;  4O4L E;  2WVI A;  4UQX A;  5LP6 E;  1E8X A;  3CKB A;  3RYC E;  5ARG A;  3RRW A;  1QZ2 A;  3WI3 A;  4I1O B;  2Y8D A;  2IC6 A;  5DJQ C;  1NZN A;  3HIZ A;  4Q94 A;  2NTY A;  3I4G A;  2H3R A;  3CHQ A;  3CVU A;  3O9X A;  4AQF A;  4E85 A;  2MRI A;  1HG5 A;  3ZMT B;  3T8O A;  2QA7 A;  4XKC A;  4RG9 A;  1KLX A;  1HO8 A;  5M4Y A;  4L5G A;  3P2B A;  3RK6 A;  2GRM A;  4GU5 A;  4QXB B;  2LSY A;  2WXK A;  1OXZ A;  1HXI A;  4AKH A;  1Z0P A;  4MBQ A;  5JQG E;  2VB6 A;  3F57 A;  4X1I E;  4AQG A;  1WRD A;  3RRM B;  3CST A;  1SZA A;  1BR0 A;  4G11 A;  5JDG A;  2XGO A;  1W3B A;  2DLR A;  2HPJ A;  5JJT A;  4DJA A;  3HYM B;  4EYU A;  3D0T A;  3JYS A;  5KX5 E;  2LM9 A;  3I4R B;  1MHQ A;  3RU0 A;  3RC8 A;  3CVR A;  2Z6E A;  4NQ0 A;  2XHE B;  3ASG A;  4FLH A;  5M72 A;  4I9C A;  3LBX A;  4PS3 A;  5G05 C;  3VTX A;  3C4X A;  3KVA A;  4TRQ A;  2L8K A;  4LUN U;  4RVB A;  3PUK A;  3EDV A;  2BUG A;  2MOW A;  5JHB A;  2JMH A;  3ZJ1 A;  2WXM A;  5JRC B;  5J90 A;  4GAA A;  2I1J A;  3HDX A;  1B89 A;  3GW4 A;  1S94 A;  4X20 E;  3ZHE B;  3Q5X A;  4LRZ A;  4PFO A;  4IST A;  3IHR A;  4ZI7 E;  2VGY A;  4URK A;  4V3I A;  2AXU A;  5HQ8 A;  3FTS A;  4MS6 A;  3L16 A;  3PVL A;  5ANR A;  3LKU A;  4ADZ A;  5EKQ D;  3FUJ A;  3G2S A;  4KMC A;  1YKH B;  5LP0 A;  3BQI A;  4P0B A;  3L08 A;  3CQC B;  1WYC A;  3AS8 A;  3EHN A;  4UVA B;  4LEU A;  2CWO A;  4GYR A;  2CHZ A;  3BEE A;  3RRC A;  2VKD A;  3FBL A;  3LY8 A;  3OXG A;  3QDN A;  4GA2 A;  2GK9 A;  4IGU A;  3U4T A;  4DPR A;  2AXZ A;  4I1M A;  5AFU L;  2WAU A;  1G8X A;  3B7T A;  4UXN B;  2PBI A;  4ERR A;  1ZEE A;  5KJL A;  4LCT A;  2X9W A;  2VTB A;  4TX5 A;  5G04 J;  3LS8 A;  5F8P A;  3O1J A;  4OFZ A;  1PY1 A;  3KV4 A;  4AY6 A;  2DWK A;  2YNQ A;  4BX9 A;  1X5B A;  3O1H A;  2EHO A;  3Q5M A;  3VLE A;  3SFZ A;  2VK9 A;  1IQU A;  1NAF A;  2V1D B;  1U3D A;  2J4D A;  1SA0 E;  3GZ1 A;  3PE4 A;  2YU2 A;  5EK3 A;  4QX7 B;  3ESK A;  3KVB A;  3GN5 B;  2RG8 A;  4JEU B;  3PRE A;  4GZ6 A;  2LO6 A;  3CV0 A;  3FU0 A;  5J08 A;  3IV0 A;  4TN7 B;  3RX6 A;  2CCQ A;  3ML9 A;  4G24 A;  3CX8 B;  3GMI A;  5L3G B;  2X38 A;  5J2U E;  1KT0 A;  1QSD A;  4EIW A;  4AI6 A;  2Y4U A;  2K48 A;  4U04 A;  2L9Q A;  3SI5 A;  1HG2 A;  2LEH A;  4WUY A;  2BF0 X;  4BA9 A;  3AVS A;  5FQ8 A;  5ARF A;  4EPZ A;  3LK2 B;  2IOL A;  2LHN A;  3C4Z A;  2JRK A;  5G55 A;  4YJ3 E;  5A6C A;  1E8Y A;  4IN3 B;  4AXH A;  4EOZ B;  4KYO B;  4ILH B;  1IAP A;  3LJC A;  1GW6 A;  5BMV E;  5T8I A;  4CI3 B;  3D9P A;  3N9M A;  4UF0 B;  1YD8 G;  3GYZ A;  3RRN B;  4PUC A;  5L3C B;  5LGN B;  3CLJ A;  3PUR A;  1NA3 A;  4YND A;  4AKL A;  4ZI3 D;  3CHM A;  3UUX B;  2VGX A;  3T5V A;  3T5X A;  4CXW A;  1BR1 A;  3FUE A;  3OJA A;  3C64 A;  4DND A;  4ME2 A;  3FHE A;  3G2V A;  4TV3 A;  3MKQ B;  5DAB A;  3ZCI A;  4EZL A;  4G2V A;  4AV7 A;  4GYY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...