3B13A

Crystal structure of the dhr-2 domain of dock2 in complex with rac1 (t17n mutant)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
427
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis for mutual relief of the Rac guanine nucleotide exchange factor DOCK2 and its partner ELMO1 from their autoinhibited forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
molecule keywords Dedicator of cytokinesis protein 2
total genus 139
structure length 427
sequence length 427
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b13A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3b13A01
2WMOA 2WMNA 2YINA 3B13A 3VHLA 2WM9A
chains in the Genus database with same CATH superfamily
4I9CA 2V0PA 4CRWA 4DV7T 4XI0A 4DNDA 4O2BE 4BY6A 1D0XA 2UXNB 1BI8B 2IW5B 2R6GF 3OJAA 3FH8A 4ZEYA 3PE3A 2X0HA 4ILIA 5JH7E 2DWGA 4G2AA 3EJNA 2IMLA 3AE3A 3N9PA 4HS2A 3MCXA 3Q79A 2I59A 3ZHEB 4KVMA 5E76A 4HLEA 5CA0E 1N34T 4GTRA 1QUUA 5G04J 2CG3A 2YHEA 1KLXA 2A4ZA 5AQTB 3FH7A 5DABA 3PDNA 2VJ8A 2P9IG 3AA6B 1UJKA 5AQNB 4LFAT 4HEAA 4H9QC 2KT9A 5L3FB 3QWWA 2CG2A 1KT1A 4GKJT 5IY5E 4BJNA 1WYCA 3HDXA 1YD8G 2ZGDA 4EZLA 1N4SA 3RK6A 5JDQA 1TNOA 3UM3A 4JVSA 3KBUA 5F3JA 4GMLA 5EK2A 5EYLA 4BSXA 3ZUVB 1T7SA 2EQXA 1OWNA 4BTBA 2XEEA 3AAAB 3RGLA 1QQEA 3FB2A 3FEYA 4UF0A 1LTXA 4LFBT 4YVOA 3NOCD 1A17A 2UXBT 2QFCA 1O5MA 4CI3B 4GMRA 5CRVA 2BKOA 3LS8A 1UURA 3L22A 1YCSB 3DSXA 3RX6A 5FINA 3JQ1A 5HQ8A 3FULA 5KNGA 3TWTA 1MMGA 3Q5WA 3W9GA 2LLYA 4ASKA 1XGWA 3UU8A 4O6FA 2KATA 5D66A 3SS1A 1K3ZD 4ILCA 4AJWA 2X0LB 5J90A 2HE0A 2WXFA 3EU9A 4DLQA 2BS2A 3F2EA 5HKPA 2W0GA 2W61A 2JEKA 3JUIA 2CA5A 3GN5A 3ML8A 3QDNA 1H6OA 3UT4A 5L2LA 4U72A 2J09A 1B7TA 1UCUA 3KV9A 4FHJA 3ZVVA 1DVPA 4JBWF 4OK0A 2E5VA 4GB9A 2X9HA 3SGHA 4Q94A 3CLJA 2DYSE 2Y3AA 2HM8A 2OEWA 4TNVA 4HFGA 5LBMA 2XHEB 3HL6A 3L09A 2FULA 3T8KA 3EAMA 3NBNB 5ENQD 3HRAA 3UPVA 2ODUA 3FUFA 3LVQE 4ANVA 2B76A 4BESA 3L3PA 4AISA 1E90A 2W4XA 4FJZA 2YEVC 2VSXE 5FZQA 4U2YA 2VTBA 2CHNA 2PTFA 3L9TA 3FBLA 3B7SA 1MX2A 4TV3A 4E7SA 4OVVA 3E33A 4K5BA 1FMWA 1SA0E 1LVFA 1IQUA 4JV5T 4XEIG 3LVRE 4PJLA 2XQ5A 3RRWA 2H88A 4A1SA 1HCIA 3QC1A 4I1AA 4NXMT 3FTYA 5AQJB 3L82A 4MBGA 3PZ4A 1ZBPA 2FJEA 4BX9A 4YSXA 2FO7A 4JYAT 1Z3YA 3DSVA 5J1GA 4CN1A 4B93B 2C2LA 3ONXA 2IY0C 3CR3A 4U0ZA 2W62A 3RYIE 3NZUA 3ANWB 2E9XB 1TNBA 3O1JA 4FI5A 4JHJA 2Z6EA 4TXQA 4NURA 1R8IA 2WBLA 4AKRB 3FZHB 3N9NA 4HVBA 2IUBA 1MMNA 2DWKA 1IJ5A 4H63V 2K3WA 2XQYA 4LF4T 3TGOA 1HNXT 4YHJA 1IHGA 1SZ9A 4A5XA 1N52A 1MYOA 1VOMA 3K3OA 4JEUB 3UU6A 4ZS2A 4M1PA 4R7LA 2UXCT 5H6RB 5FY0A 4H9OC 3AEDA 5JR9C 4HQDA 2V5FA 3E32A 4QH5A 2LKHA 1QBQA 2LSIA 4WBNE 2IJGX 3UUXA 1NA3A 1OWLA 4APFA 4ANWA 2KCLA 2QYJA 4GTSA 5AQSB 2RKKA 5AJDA 4YJ3E 2NR4A 3SRZA 3LY7A 3AAIA 4AXPA 1H2VC 3JAFA 3AEAA 3DPYA 2F4VT 4UQZA 4DIDB 3NZQA 2P9KG 2LXLA 1OXJA 3FH5A 3H37A 3JYSA 2V5QC 4HE8A 2ES0A 2J8SD 4A63B 2VKOA 2DCPA 3SOLA 1L0VA 2R17C 4B3RT 4K0KT 2F8YA 2KINB 2ETAA 3CWZB 2HH7A 5AQVB 1OUVA 4G63A 5AQUB 4MLPA 3GYZA 2C5IT 4I2ZA 2UWJG 5HXEA 2GRQB 5ADXL 4HTEA 4UI9J 4B8CB 3JC6D 2JQKA 4AV7A 3PE0A 5AQPB 2XZEA 3ONJA 2UUAT 1KEYA 1KZPA 1BR4A 2YKSA 4IGUA 4AKHA 1N4RA 3Q5DA 4NUUA 4RLYA 3O1IA 3RYFE 3C3QA 2VWAA 3N5LA 5EK4A 3AECA 2HN2A 5JMND 1KNZA 3UKUG 1V9DA 2ZGGA 2KMFA 1YMPA 5AAOA 1N0QA 3FUIA 4OVUA 2XQ8A 2JPFA 3HKBE 5AQIB 4K0RA 1X5BA 2VQ2A 3IHRA 1EYHA 3CX8B 3D9PA 3Q9DA 5LOVE 2Y69E 3KEZA 3CKDA 4UUCA 3ZYLA 3AE4A 3VKGA 1BU9A 4KUMB 4RSYA 5FT9A 3CQGB 4CDMA 3TWXA 3FUKA 2AXZA 2BBJA 3AU5A 2X6IA 5JVDE 2L6JA 3URZA 1EDUA 4DUYT 5AQLB 3CGHA 3RHWA 4WBOA 3AG1E 2ACZA 2BVMA 2M6IA 5ENTD 2IONA 2WM9A 1TNUA 2AVPA 1OXZA 3C4ZA 3CVRA 4YJ2E 2M63A 3GA8A 3AE7A 3ESKA 3UMVA 3PVLA 4CCAA 5KJLA 3HXEA 3PEVB 2PNNA 4XKBA 1WCRA 1MMAA 2Y4TA 2H89A 1N9AA 5D2MC 4IE0A 3T5VA 1NWMX 3UUXB 2WXPA 4JI5T 5L4EA 1V54E 2P9NG 3ULEG 4DMVA 4AP2A 2C0SA 4OYKA 1E7PA 5KMGP 2L9QA 5HEUA 4XI9A 2WXMA 3QARA 5BNWA 3Q78A 1T98A 1HZ4A 2LOSA 3JC6C 2WXJA 3IBPA 4O4JE 4WNKA 3HXCA 3P1UA 2XJ7A 5FL1A 2V26A 3WAJA 3FU0A 4EBAG 4CXXA 2IO2C 2YQ8A 4UWFA 2MPKA 1WDYA 3G06A 3U64A 3FUHA 3ZEFA 3PU3A 4GZ5A 3RJVA 1WR0A 3IEEA 3PZ1A 5FMNA 2V7LA 4HFBA 3N2OA 3D9HA 4DLOA 3DJBA 3FZLB 4HFHA 4EAHA 4BSZB 3EVYA 2NTXA 3R9MA 2LKGA 1XDPA 4A98A 2DVWA 1WRDA 4F3VA 4I6GA 1H6KA 1NI1A 2Y1LE 1HE8A 4BJMA 3PZ2A 1MHQA 4J8SA 3LJNA 4PW8A 2BG9C 3HHMA 4UWLA 5LJMA 2I9CA 2KCVA 3N2GE 2JABA 2ZISA 4F53A 4YSZA 4PUCA 1H19A 2QVAA 3KSQA 4N5QA 3MV3B 2OCCE 5BR8T 1NENA 3SFXA 2V8SE 2IC6A 3CVXA 4AM9A 4O4HE 3JUEA 4CQIA 4HNAD 3BEEA 3RF1A 2A3DA 5E0OA 3ASHA 2WY2A 2LSGA 2XPYA 3PUWF 3AVRA 4WAFA 3OPCA 3AA1B 3PUQA 3FBZA 5LNKA 2NW9A 3HR0A 3O9XA 3OVUA 3MEKA 4GOUA 2IHR1 2LM2A 2E9XC 5JRCB 5AENA 3P8CD 1TJFA 3HI2A 3PUAA 3LEWA 2ZIRA 2SPCA 4DV6T 1OY3D 4IL4A 1RW2A 1UJJA 2VSYA 2BKGA 3L8RA 3DEOA 3A7MA 2FO1E 3D9JA 3KBTA 3OXGA 1MX4A 3EU5A 3N9MA 4DI4A 4WW0A 3FU3A 5JDLA 2XRZA 4EBAA 3DRAA 2WB5A 2NW7A 3SWHA 1T8BA 2DNXA 2KZ7B 1Y64B 3S2AA 4GZCA 4DV4T 3D3MA 1U5PA 1HU3A 4ILUA 3CMLA 5JDNA 4IDPA 4XX5A 3J5PA 5FXWA 5HEHA 4CGWA 3ZJ1A 1XWMA 3PUVF 4BWRA 5HRYA 1MIVA 2J1DG 2H6HA 1WR6A 1FT2A 4AKGA 2N2NA 3ZCIA 2D5UA 3L08A 3Q9NC 2XAJB 2X66A 2OEVA 3PZDA 4URKA 2CBIA 5ARFA 1P5QA 2NOXA 2E9XD 5FVLA 4I1OB 3I5PA 4KBQA 3NRYA 2WXLA 3GZ2A 2PQNA 1PC2A 1WAO1 4HXIA 4MBQA 2GGFA 3CK9A 2L6BA 4DMWA 5LJNA 1TN7A 2WQHA 5FZRA 1OCRE 1JUQA 3NB2A 3N2KE 1WY6A 3L17A 3TLSA 1HX1B 2QA7A 1AP7A 3AS5A 2RD0A 4LMJA 1FCHA 3JQ0A 3FTWA 2XAGB 3SI5A 3RO2A 4H9RC 3UUNA 3AS4A 2F0YA 3AEBA 3R9AB 3EIQC 4QXHB 2Q9QA 2M6BA 1UGOA 2JMKA 3HKCE 2LSYA 3AEGA 2V7MA 1SUMB 5G05J 2AXVA 2UY1B 1MJ0A 2XPZA 5JJ7A 4C48B 2LM9A 1Y6IA 2VL0A 3T5XA 5AN8A 2X9XA 2YINA 4FJYA 4G2VA 5FL0A 1SHZC 2XQ0A 1LRZA 2KZTB 4CN4A 3OTNA 4QQIA 5J2UE 1N33T 2LSVA 2MAWA 3L13A 3MZLB 4L2LA 3SHFA 4X20E 4QH1A 2OVFA 3HVEA 5L47A 4YDEA 3UU4A 4DPRA 4YLHA 2R02A 1N0RA 3MKQB 2VQET 4AQYT 3IKOB 4JL0A 5M72A 1IBMT 2IAKA 2P9UG 3B95A 1HX8A 2NXPA 4MRUA 3D9OA 4PS8A 2R05A 3V2OA 1U3DA 3Q4AB 3IBEA 3PH0C 2WQYA 3E30A 4GKKT 1OCOE 2EHOB 4GYSA 4O4IE 5M4YA 1W0BA 2PQRA 4J8FA 2WVIA 4NIQA 5L3GB 2XQ7A 3UFGA 4GCNA 3LY8A 4LNUD 3C5RA 5BW8C 4E85A 4X65T 4DR7T 3SY2A 4CI1B 3T8OA 3ZYMA 4U7YA 5KJKA 3G2UA 2OV8A 5EILA 3MKQA 2XGSA 5AQOB 3QK6A 2ODVA 4K5AB 1MX6A 1RZ4A 1BR2A 2GRPB 4QFVA 5KX5E 2KWIB 3VR8A 5LCWC 4GTMA 4JI6T 2X38A 4GA2A 1XMOT 2NW8A 3R7RA 5JDMA 4JI3T 3QAQA 3TAXA 4CZZB 1NA0A 3CK8A 1H0AA 5KBAA 1H6PA 4ZI2D 5G05C 4CXWA 2P9BA 4HI9A 4X8QA 3TJPA 3LJ3A 5KWDA 5FVKA 2WZIA 2LXMA 4ZFHA 4KBMB 2WDRA 3LBXA 4QH4A 2N1GA 4UVCB 2P9LG 4Q96A 1U2VG 5HXHA 4ERRA 2XGOA 3KV6A 3QK0A 4P29A 3CSTA 3AXJA 5HWYA 4DJAA 4Q69A 4PH4B 3OKQA 2X6KA 4JUYA 3CHSA 4EGWA 3KS2A 2IIUA 3FXEB 3ZW3A 3G2SA 2I1KA 3UUMA 2VKDA 2CHZA 3CX6B 4A55A 3QB5A 2V4LA 3MZKB 5FXZA 4V1Av 3D0TA 3FEXA 5D0OD 4NXNT 3E0ZA 5ENPD 3KVAA 3KINB 3DWLG 3ZHEA 1NAFA 1J1JA 3FUDA 2J9QA 1SA5A 4LG6A 4QKNA 2WQ6A 3ZIMA 3HVEB 2KC7A 2JIWA 3BQKA 3T8MA 3ZYKA 4EZHA 2W63A 5FIOA 3NVOA 2PM6A 4G23A 3D9NA 2R2LA 5CECB 2VYIA 4B6XA 3MYVA 3T9KA 3UI2A 4TRQA 4DV5T 1S70B 4GYWA 3PNLB 4TWHA 4HFIA 1S94A 2EIJE 1UG3A 3LK2B 1HXIA 3OYXA 3ETUA 2BG9A 2Y6XA 2ZLYA 2R5SA 2WZHA 2XZTG 4M7CA 5G04C 2WCAA 1SE7A 1S64A 4B89A 1OWMA 3AE1A 2XZDG 5L3CB 3SNXA 2V7KA 2LAHA 3RSEG 4CYMD 2PG8A 3CQCB 2DCFA 4JXTA 3D9LA 1ZEEA 4RVBA 1D8EA 5AQ9A 1X79A 4UEMA 4HRMB 4BERA 5LP0A 3J5QB 3UM2A 4IDOA 5B3SE 3QJZA 1HS6A 2PM7A 2LEHA 2XSBA 2LOPA 1WM5A 2K24A 1IZNB 4PJMA 3RI5A 1N36T 3AB3B 3BQOA 5EK3A 5LCYA 4EZKA 1YKHB 1AJ3A 4D10C 2XS1A 2X9YA 1MIYA 3MK7C 5AJLA 1D1BA 4OHFA 4NUVA 3A5XA 1E8XA 3ASFA 4U0SA 1CHUA 3E37A 2BF0X 3KAEA 5CFBA 5LB7B 3AU4A 4E7ZA 3FUMA 3M65A 1FMVA 4JI4T 3AG2E 4RG9A 4KMCA 3LDZA 1JNRA 2V6XA 4B3MT 4FC8A 2XQ6A 3PURA 2QYWA 2E2EA 2J62A 3PUGA 4PK5A 2CXFA 4L2YA 4GYOA 3CHQA 1OEDA 3ZT7A 4Z8XA 4X64T 3QNKA 3UIOC 3U3IA 3MA5A 4RQIA 3TLUA 3HKEE 3EI0A 2GW1A 4ZI7E 3AVSA 3CV0A 4WUYA 4TV9E 2XASB 3TG4A 4IREA 3E4BA 2J4BA 1ZB1A 4U8YD 3ULQA 4B0ZA 5JR9B 4DX7D 2UXXB 1YKEB 4WYVA 4EQFA 2XAHB 3RIBA 4C90A 4KZ0A 4YHHT 1JWFA 5AQHB 2Q9QC 3ZLIA 4DR5T 3WXXA 3UINC 4DX6D 4BFRA 3SF4A 3SBSA 3FDHA 3CHPA 5KDMC 2C0LA 4J7WA 4KXKB 3DSWA 5HEJA 3QWPA 4QX8B 4AQFC 4IE7A 4MALA 3U4TA 2JQ9A 2WMOA 1KF6A 1U4QA 4U8HA 1FVFA 1JCSA 3ENEA 5AQAA 4AQGA 4J8YA 3Q7FA 4ISSA 1XZYA 5CJ5A 4AY6A 4C91A 4U2ZA 3FZKB 4KI0F 5F5WA 2ZM6T 3AE5A 3N9LA 3CPZA 4A97A 2E0IA 3MV2B 1KT0A 4XBFB 1LKXA 5LA6E 3AE6A 4IULA 3I1AA 5DQVA 3LSVA 2NTYA 1ZKEA 3RRMB 3B7BA 3RRUA 2VL8A 5FNVE 4XE0A 4LNGA 5FYMA 4PS7A 5LGNB 4QXBB 3C64A 1HS7A 2WXNA 5HEOA 5FQ4A 4O8SA 4EXTA 2MBGA 4WNFA 3ZGQA 3CX7B 2H7OA 4DX1A 1UN9A 2NP9A 1Z8UA 5AQGB 2AW6A 2H6IA 3GZ1A 3CVUA 2ETBA 4PFPA 5BMVE 5ITZF 3CVYA 3VHLA 2D0UA 4HFCA 4UV9B 3CIAA 3I4RB 1MNDA 3PTRB 1BR1A 4JLEA 1MIWA 1OCCE 3ZRHA 5ABHA 4CT0A 4IIJE 3UTMA 4PNIA 5ENRD 3UTKA 5JDGA 3G2VA 3PUSA 2DZOA 2AE9A 2JJ9A 4FHKA 5JA4D 4QXCB 2A5EA 2VQFT 2QYUA 3FTUA 4LMKA 3BG0B 3FP3A 2WAUA 3Q73A 4C0EA 4ANUA 2KZTA 3F57A 5FQ8A 2DIWA 3VR9A 1Y01A 4F1PA 2V7IA 3ZU7B 3RU0A 4G11A 4HB5A 5BV0A 3BU8A 2I6HA 4O4LE 3B13A 3E08A 1N95A 4I2WA 4OX9T 2EINE 2IEJA 1VDYA 1TEZA 4TX5A 4I43A 3SZ7A 2LT3A 1GW6A 5J08A 4YXDA 2PZIA 3GW4A 5IUXA 3UU5A 1XNRT 1IKND 2J4GA 5ABFB 4DK5A 3HXDA 4OYSA 2HYZA 3ISMC 4F1SA 1SVXA 2A2FX 5HCMA 4Q25A 3LYAA 1WYBA 2IOLA 2MYOA 3HIZA 2XPKA 1OWPA 4BT8A 2CMRA 3CHMA 4JHRA 5HXRA 2R59A 3TWVA 4MKTA 1IQRA 4EIWA 2H7VC 3UT5E 4DR4T 5HAXA 4H63H 4I50E 2WU5A 3ABVA 3RIFA 4U7IA 3EHNA 3SD5A 4P0BA 1TR4A 4HRNA 3AA7B 3Q7AA 2DYRE 4IL9A 3KV5A 5H6QB 3FTVA 4N5CA 4HOQA 3ZMUB 4AKLA 4MHCA 1Z0PA 4WWPA 1XNFA 2V8SV 5KCMA 3L39A 1QZ2A 4BT9A 2J47A 4AY5A 1E1HB 3C51A 4BTAA 4K03A 3K3QC 2XCBA 4AI6A 4GYYA 3ASNE 4BA9A 2P58C 5CRUA 3H3AA 4LF8T 3PE4A 2QRXA 3ZMSB 1N54A 2ZMAA 4G24A 5C3JA 2BEDA 5LP6E 3ZEFB 5AARA 4HOTA 1PAQA 3RQUA 3G2WA 3TLTA 2WXGA 4KMOA 1QSDA 3ZN0B 4X5TA 4ZS3A 3ASOE 2IF4A 2KXPB 3ABLE 4IRUA 3RIAA 4EOZB 4L23A 4PJJA 3EUVA 1JPLA 4ACLA 2VGEA 4C0MA 2HPJA 1HTJF 5EDSA 4IDQA 3ZXPA 3TXMA 4XZCA 4I55E 3AG3E 3C50A 4OAVB 4GA0A 4JA7A 5D0QD 2BG9E 3CVNA 1WLXA 2LSKA 3RKGA 4DV0T 4XZ4A 3IHYA 4O1PA 1UUSA 4L5GA 3B7TA 1HNWT 1LD8A 4RG6A 3FUNA 4K0UA 2IDOB 3AEFA 1W0AA 2AXDS 5KJMA 1UK5A 4I4TE 3S7FA 1MZCA 3R7QA 2V5CA 1S0PA 3EIJA 4N3BA 1HO8A 2RFAA 4U7EB 3EDVA 3Q47B 2HN1A 1D1AA 4GMJA 5CMWA 4DBRA 4BX8A 4X1IE 2CFUA 3ZN1B 2AWIA 3AE8A 5JQGE 2NC9A 2XSAA 4CGVA 3GN5B 1G3NB 2C5KT 4IDZA 3C3RA 5DBKA 2XM1A 3OXFA 3RKOA 1S35A 4LFCT 2DWZA 2UXDT 1ZOYA 1KFYA 2Y8DA 2L9BA 3PJAJ 4HWCA 2CFZA 3OBVE 2CRBA 5LFAA 4ABNA 1V55E 2P9PG 2JQHA 3Q5XA 2LJLA 4B3ST 4EB6E 3P4PA 5FKYA 5DQWA 1O1RA 2E8IA 3IA3A 2D2SA 3F6QA 2VURA 5T8IA 1H2UA 3DBSA 4ILGA 2BDEA 2WXIA 4HWDA 3OAWA 3LKUA 3P50A 1E8YA 1ZU2A 3D9KA 5AQBA 4FJOA 4H9SE 2IFUA 2J07A 3TLWA 3CVVA 4GZ6A 4UWHA 4ADZA 4GPMA 2M67A 4IE4A 3QNUA 3SQVA 1QNFA 4IN3B 1IHBA 4HBDA 1W09A 1WG0A 2G0UA 4KX6A 4GK5E 5ENNA 1Z3XA 2ZM8A 3KD7A 4C9BB 3EUHA 5L4HA 3UQ4A 3TWQA 4APOA 1NEKA 4DV2T 3CVQA 4ACKA 3ZXSA 5EX3A 3ASGA 4HOSA 3B57A 3VKHA 3SO8A 3ZT5A 5LMNT 4P0AA 2X51A 2ACXA 4AVXA 3Q49B 2D0TA 2YU2A 3APDA 5ARGA 1N32T 5LHHB 3CHOA 4O2AE 5EN5D 4TV8E 4Z90A 5JJ6A 1SA4A 4U95D 4FP7A 4UWGA 3AAAC 3I9WA 4LF9T 3LPZA 3Q9UC 3O4ZA 2PFVA 3AG4E 4W9RA 1HR0T 2WXHA 3SFZA 4DR3T 2KWHA 2F37A 5E75A 3LJCA 3C72A 2HR2A 2E5LT 2GRLA 3DSUA 3U66A 1YYHA 5F8PA 3S7BA 4FU3A 1QLBA 4HGAA 4M3OA 2XEHA 1XNQT 4NACA 1KPSB 4BEPA 2NSZA 4JA9A 2R03A 4UIGA 5EIDA 1KZOA 4AIFA 3C98B 3AEEA 3OYZA 5GONE 4HWHA 5C8YE 5FWQA 5BPPA 4FULA 3JAEA 1MQSA 4HOUA 2WDQA 2KM4A 4G8KA 4GYRA 3DEPA 2V6YA 4ILBA 1JNZA 2B0OE 3E22E 4OFZA 1FVHA 2H6GA 2XEVA 1ELKA 1E8WA 1J5WA 1UW4B 5J2TE 4GTVA 1OEDC 4PDXA 4XAXB 3V30A 5IWAT 2CWYA 2X6JA 3FZFB 2VGYA 5B1BE 5LHIB 2LHNA 2CHWA 2EHOD 2X6FA 2EIKE 3ESLA 4V3IA 4KHZF 1H7CA 4I17A 1Z6TA 4N3CA 4DUIA 4UR9A 4CEMA 1UX5A 3ZT6A 3UXGA 1VCSA 4TWFA 5A23A 5IYZE 2AJAA 4DVDA 3UU3A 2BKKB 2VKHA 4ZI3C 5FXXA 3RRCA 1OT8A 3APCA 1LD7A 2VASA 1US7B 2QZAA 2VSOE 4PK4A 2I0MA 4U74A 5HCJA 2NYJA 4HORA 5CEDB 3DTOA 3PS6A 4YY3T 4NIKA 4GPKA 4XIFA 2A72A 3V5SA 5BXOA 3OTOT 2PL2A 3Q5MA 4UV8B 5LHGB 5LYJE 1OEDB 4EYYR 2WXRA 3AXJB 4YTMA 1LF8A 2EILE 2XGMA 3CKCA 2HPLA 3HYMB 3Q2MA 1TN6A 5LBQB 5LOZA 2C5JA 1I94T 3LBXB 5ENSD 1IYGA 5ANLA 1IXVA 4GTTA 4O60A 2CBJA 4KP3C 3ZSSA 4EV6A 3PUKA 4I0UA 5B1AE 5AQ7A 3AS8A 1O1TA 4DX2A 4QWNB 5LMUT 3SFYA 2RA1A 4ANJA 4JEHA 4YFSA 3UM1A 3ZC0A 1MNEA 3CIRA 2VSNA 1SQMA 5JRCA 3CSFA 2V5DA 5ABGA 3K9IA 3RPUA 3IHVA 4DRXE 4UWKA 2B6CA 4JI8T 3SFDA 5L3EB 3T1YT 3LFMA 2LRLA 3X1DA 5HYAA 3IF8B 4UELA 2I1JA 5G2NA 3ETVA 2IU1A 1OCZE 2Q7FA 3UIPC 4J8EA 1ELWA 1XMQT 3RIUA 3ZJ2A 5FQ6A 4ZI3D 3LY9A 1YXRA 4J0UA 1D9SA 2XUEA 2LO6A 4EEDA 2L0TB 2WPVA 2XQ4A 4NRHB 1OEDE 2XAQB 3AE2A 2X67A 3FXDB 1TNYA 3W9FA 4G25A 2K9AA 2NWBA 4DI3A 5EYPF 2Y48B 4JI7T 4YT0A 4AEZC 2HO1A 3JCKC 4CXYA 2AXUA 4EEBA 4YTNA 3I4GA 4UQXA 3ONLC 3AJIA 1BD8A 1Y8MA 5JHAA 3IEGA 2X0YA 1O3XA 1N4PA 2FBNA 3HXFA 2CHOA 2GK9A 3WG7E 4I6EA 3VU7H 1ELRA 2XENA 4Z68A 3ONLA 1NZNA 4A1GA 4WNDA 4LMLA 2UU9T 3CVLA 3CVWA 1JWGA 1TN8A 5JR9A 1OWAA 3K8PC 2GRNB 3U9WA 4CDRA 1UX4A 3QKYA 3RQWA 4WWNA 3S7DA 1D0YA 4F7AA 4JC8A 3NOGD 1E7VA 4I9EA 3OXLA 4F8HA 2ZM0A 5CGMA 4DR6T 4HLLA 3UT8A 3ULYA 2CLYB 1X9BA 5LG4A 2ZU6B 1SW6A 2F8XK 4EYUA 3QC9A 2JRKA 4IE6A 5FP3A 5CCMA 4JI0T 2CXDA 1IBLT 3BK9A 2I2OA 4LF6T 3TWRA 3T1HT 3MXZA 4F6RC 3C3OA 2WU2A 3F31A 4L9IA 2B1EA 5JREA 5LGTB 1BPOA 3KDSE 3LG7A 3ZFWA 4Z91A 3ABKE 3UFEA 4N3AA 1E8ZA 3AAEB 2P2CP 5CBNA 4IDNA 3PUZF 3NQPA 5CBOA 2BBHA 2RPAA 2ETCA 3FZMB 3ZYQA 5ABFA 4DV1T 3NZPA 1L5JA 2D9DA 4CZ2D 2QC9A 2V6YB 3KV4A 3JCFA 3B5MA 4YSYA 2LNIA 3N71A 3W15B 4LRZA 4GTPA 4TXRA 4L0RA 3CQXC 2FUPA 2KCKA 4HFDA 4ZI2C 4JEUA 4GZDA 4UVBB 4UQYA 1K8KG 1JCQA 2KBXA 2LRKA 2ZXWE 3IXEA 3RO3A 4MLKA 2OA5A 2FJBA 5A7DB 1CUNA 2BZBA 2DZNA 4HI8A 3U78A 3EDTB 4HRLA 2BS3A 1PY1A 3FWVA 3VTXA 2UUBT 3O48A 4YNDA 5EKQD 3EHRA 5LGUB 4WWOA 4CT4A 5G55A 5BV1A 1LVKA 2BG9B 3GMIA 3BQIA 3PV0F 1WFDA 4FA6A 3P7IA 2DHRA 2QGSA 2JQQA 5FQ7A 3EABA 5FXVA 4U63A 4Y6WA 2MYSA 2YOEA 3FHEA 2FJDA 4HWFA 1N11A 2FJAA 3X2QE 3S4UA 3FUEA 3JADA 2ONDA 5ETWA 5A1LA 2VGXB 3MACA 1A5EA 3NRXA 5FY1A 3FTZA 4UI9K 5AFUL 3M3ZB 3ZKJA 3CVPA 3RYCE 4DR2T 4N2QA 1O1SA 4Y6CA 4YDYA 4DR1T 2PBIA 4G1TA 2VB6A 5FJYA 5DIZA 3ZKRA 2BVLA 4MS6A 4TN7B 3KFWX 4MFRA 5T3RA 3ZMVB 4AXHA 3EDUA 4LF5T 3APFA 4YVQC 2LAIA 2RG8A 2BUGA 5FTPA 3TWSA 4K5CA 3NWIA 2W2UA 1QYMA 4YTPA 3RYHE 3DP7A 3EHZA 1X81A 4GIWA 1YQ3A 2P9SG 3TXNA 3FUJA 3DPDA 2WXQA 4UI9C 4PS3A 5C2YA 3RKVA 1VCTA 1YA0A 1FEWA 4DO0A 3J9X1 1AWCB 5TAOA 1H2TC 2CXLA 3UKRG 1DCQA 2E9XA 3ZNGA 4LF7T 4NPPA 5CCLA 4LCTA 4ILHB 1IAPA 3P4QA 2IO3C 2WDVA 5HEGA 3ONKA 3HKDE 4PK6A 3LK3B 2LHRA 3ZN3A 4U3CA 3RRNB 1UOHA 4J6IA 5AYWD 3EHQA 3DSSA 5BUZA 3MA9A 5ENOD 4H7XA 2V7JA 3QUJA 2CLYC 3RH3A 3QOFA 3P4WA 1YQ4A 1ZP0A 3TWWA 2OVBA 3RC3A 1GQEA 2ILRA 3QOUA 4U8VD 4KT6B 2MRIA 2PJQA 5ANRA 4JZYA 3L6AA 4L1BA 3UUBA 4AOFA 4L9PA 2QY7A 3B7UX 3V2XA 5AQKB 3DXMG 3FTSA 2ZM2A 1HG2A 4GTQA 5LCWJ 2WP9A 2DL1A 2X9WA 4HWIB 3V79K 2XM2A 3Q5EA 2WB2A 4P1NA 3PUYF 3ZPOA 1XDOA 3P4SA 4GZ3A 2DLRA 1DU2A 2JLBA 2KSRA 4X1YE 2BKPA 5CA1E 1JCRA 2XAFB 4TXPA 3ZC1A 2FI7A 2MOZA 5AQRB 5HWXA 5HI7A 3FHNA 1ZV4X 5CHEE 4AIUA 2HHHT 3KSLA 4UF0B 1FPPA 4G26A 4QX7B 4EHMA 1I6ZA 1E7UA 5BT1A 1G73A 3MKDA 2YK0A 4AKIA 2WXKA 3R6NA 2CE7A 2BS4A 3NBXX 4JI1T 4N39A 5J0ZA 2UY1A 3CKBA 1W9RA 3TL5A 3K1SA 5LX8A 1K1AA 3SFEA 4KHPT 2Q9QB 3O4XE 5T4YA 2J4DA 3UM0A 2XPIA 5JDFA 2IOSA 3CK7A 2X68A 3FU6A 2C0MA 3KVBA 4ILAA 1SZAA 5L3BB 5LG3A 2RP4A 4ZZBA 2CEAA 4DV3T 4IHJE 2A9UA 3KEAA 2W67A 5JHBA 3LDQB 4L7TA 3ZSTA 4GU5A 4TUUA 3PRZA 5AQQB 5EX0A 1EZ3A 3ASDA 2W66A 2J49A 1U3CA 4U31A 1G8XA 2VK9A 5KNHD 2WMNA 3C98A 2CPTA 3AA0B 3C4WA 5L3DB 3U3WA 4EZ4A 2KXPC 4ATGA 4B8AA 1M7KA 3WAKA 4NQ0A 1KNRA 4LNBA 4I1MA 1TJCA 1N94A 1Z5SC 5HXSA 3ZCJA 3GZSA 1D0ZA 1T72A 5EZYE 4ZXLA 2RFMA 2IQCA 4LUNU 5C1DA 4TUYE 5HXCA 3VLEA 4I43B 4PJNA 2J08A 5AIJA 3UX4A 4DX5D 4IE5A 4DBQA 5KJNA 1FT1A 4HFEA 3JXIA 3ZPJA 3SBTB 3ZMTB 4X62T 3Q15A 2YDSA 4P09A 2Y0BG 3VLDA 3C4XA 4U07A 5A6CA 5DJQC 3AE9A 4EECA 3HG0D 4GCOA 4BETA 2VKJA 1E2AA 5AQFB 2MHKA 5H7PA 2L8KA 3O1HA 5IHYA 3TG5A 2KLQA 2W00A 3TKLB 1INZA 3FY4A 4ZZCA 2YDQA 4WZXA 3RIUC 1NL4A 1FJGT 4XKCA 2LUHA 3HA4A 2JMHA 2CHXA 2VTBB 3PEUB 1EPUA 4KYOB 1BI7B 3CK6A 3N9OA 3VLFA 2YHCA 2CWOA 4CI2B 2BTDA 2E2AA 4H7YA 4PFOA 5FY7A 3K3NA 5ABEA 4LERA 3NAWA 4X1KE 5BXUA 1OWOA 2EIME 4GTOA 3B7RL 2GROB 4J8DA 1MMDA 1HG5A 2OV9A 3MJXA 3FTXA 4CN6A 3UQ3A 2OOEA 1BR0A 3HXBA 5EIBE 3A8YC 2GRRB 2DI4A 3MX3A 2MTQA 3UT7A 1YW0A 5KXJA 4FLBA 4H9NC 4I6JA 3ABME 3E34A 4A3TA 2IC9A 1HH8A 4H9PC 4A56A 2X6HA 4UXNB 3I9YA 1NFIE 2WSSV 4N2SA 4OAUC 2WWVA 3NF1A 4TWDA 4JW1A 2VVNA 3MJWA 2Y4UA 4B94A 3VTYA 3CHRA 3RAUA 3TLVA 3PNTB 4IYPA 4ME2A 3Q75A 4ATZD 1EF1C 4JB8P 4TUMA 2WQ7A 4GK0E 4U33A 5CERB 2XQ3A 3MKRA 1N4QA 1BLXB 5CB4E 3ZMZB 2Q9QD 4UVAB 2XRYA 3BG1B 4LEUA 3V31A 2K48A 4IT4A 3VRAA 5JDHA 1HNZT 4YDOA 4ZHBA 2L0IA 1B89A 4LSZE 4JD2G 2LSUA 3S7JA 1KNPA 3ML9A 4WNGA 3GWHA 4A3VA 2X3MA 3WI3A 2XQAA 1S63A 4YDWA 1NP7A 1J5ET 4FADA 2UUCT 4ZHQE 4U96D 3PREA 3LXUX 1KK7A 5JJTA 2VVSA 2XY8B 3PDYA 2XS8A 2CM0A 4CDNA 3R84B 2YNQA 3D9IA 5AQMB 1M62A 3IV0A 3RC8A 2N9DA 2K5BB 3NZSA 1E96B 3CEQA 4JHKA 3I3NA 1IJ6A 1D8DA 4PAGA 2BKNA 3PU8A 4GAAA 4FLHA 3PZ3A 4DUZT 4HKAA 3L16A 1TYQG 4E6HA 3I0QA 4O1OA 3PUJA 3L54A 3P4RA 3LK42 2GRMA 5CMYA 2YN6A 5FZSA 4COFA 3I0OA 2XHEA 1HFAA 5CEAA 2WWUA 5JTGA 4G8LA 2CCQA 4TZ4C 3QB2A 4JI2T 3G2TA 3RLFF 1IBKT 4QHOA 2MOWA 4BAYB 2VGXA 3H3MA 2LSJA 4ISTA 2XQ9A 2KNDA 2H6FA 3NKZA 5C2TA 2EHOC 4ZOLE 3FU5A 5HS0A 2DBAA 4OYJA 1DCEA 1UN8A 3D9MA 3PUXF 4GA1A 3N9QA 4AQFA 2LE8A 1FIOA 3PJAA 3MGBA 4U04A 1Q2ZA 3LCAA 3J7Yq 2EHOA 4J2CA 4B3TT 2H3RA 4X66T 1VRBA 2FBWA 3DXKG 3QB5K 3UULA 3JXJA 2XTLA 4F6RD 4TNWA 4JEHB 4KVOA 4N78D 1HF8A 3BQLA 2V4HC 4WNEA 4HN9A 2YU1A 2A5UA 2OLTA 2WS3A 3VRBA 1ZHCA 3ANWA 4JPSA 2V1DB 2XCCA 3V5UA 1DNPA 1W3BA 1DC2A 2WXOA 2YDRA 3BUAA 5LXTE 3EHMA 3TWUA 3FFLA 4EPZA 4U0UA 3UQ7A 4ANXA 1D1CA 1K1BA 3QWVA 3P2BA 4EZJA 4HFVA 1TNZA 3DSTA 2FEZA 2L3LA 4KZCA 2FF4A
chains in the Genus database with same CATH topology
4I9CA 2V0PA 4CRWA 4XI0A 4DNDA 4O2BE 4BY6A 1D0XA 2UXNB 2IW5B 3OJAA 3FH8A 3PE3A 4ILIA 5JH7E 2DWGA 4G2AA 3EJNA 4HS2A 3N9PA 3MCXA 2I59A 3ZHEB 4KVMA 5E76A 4HLEA 5CA0E 1QUUA 5G04J 2CG3A 2YHEA 1KLXA 2A4ZA 3FH7A 5DABA 3PDNA 2VJ8A 3AA6B 1UJKA 4HEAA 4H9QC 2KT9A 5L3FB 3QWWA 2CG2A 1KT1A 4BJNA 1WYCA 3HDXA 1YD8G 4EZLA 3RK6A 5JDQA 4JVSA 3KBUA 5F3JA 4GMLA 5EK2A 4BSXA 2EQXA 1OWNA 4BTBA 3AAAB 1QQEA 3FB2A 3FEYA 4UF0A 4YVOA 1A17A 2QFCA 4CI3B 3LS8A 3L22A 3RX6A 3JQ1A 3FULA 1MMGA 3Q5WA 4ASKA 1XGWA 4O6FA 2KATA 3SS1A 4AJWA 2X0LB 5J90A 2WXFA 4DLQA 3F2EA 2W0GA 2W61A 2JEKA 3JUIA 2CA5A 3GN5A 3ML8A 3QDNA 3UT4A 5L2LA 4U72A 2J09A 1B7TA 1UCUA 3KV9A 4FHJA 3ZVVA 1DVPA 4OK0A 4GB9A 2X9HA 3SGHA 4Q94A 3CLJA 2Y3AA 2HM8A 4HFGA 5LBMA 2XHEB 3HL6A 3L09A 2FULA 3UPVA 2ODUA 3FUFA 3LVQE 4ANVA 3L3PA 1E90A 4FJZA 2YEVC 2VSXE 5FZQA 2VTBA 3FBLA 3B7SA 4TV3A 4E7SA 4OVVA 1FMWA 1SA0E 1LVFA 1IQUA 3LVRE 4PJLA 3RRWA 4A1SA 3QC1A 1HCIA 4I1AA 3FTYA 1ZBPA 4BX9A 2FO7A 1Z3YA 5J1GA 2C2LA 3ONXA 3CR3A 4U0ZA 2W62A 3RYIE 3NZUA 3ANWB 2E9XB 3O1JA 4FI5A 4JHJA 2Z6EA 4NURA 2WBLA 4AKRB 3N9NA 4HVBA 1MMNA 2DWKA 1IJ5A 4H63V 2XQYA 3TGOA 4YHJA 1IHGA 1SZ9A 1N52A 1VOMA 3K3OA 4JEUB 4ZS2A 4M1PA 4R7LA 5H6RB 5FY0A 4H9OC 5JR9C 2V5FA 2LSIA 4WBNE 2IJGX 3UUXA 1NA3A 1OWLA 4APFA 4ANWA 2KCLA 5AJDA 4YJ3E 3LY7A 3SRZA 3AAIA 4AXPA 1H2VC 4UQZA 3NZQA 3FH5A 3H37A 3JYSA 4HE8A 2ES0A 2VKOA 2DCPA 3SOLA 2R17C 2KINB 3CWZB 2HH7A 1OUVA 4G63A 4MLPA 3GYZA 2C5IT 4I2ZA 2UWJG 5HXEA 4UI9J 5ADXL 4HTEA 4B8CB 3JC6D 4AV7A 3PE0A 1BR4A 4IGUA 4AKHA 4NUUA 3O1IA 3RYFE 2VWAA 3N5LA 5EK4A 1KNZA 1V9DA 2KMFA 3FUIA 4OVUA 4K0RA 2JPFA 3HKBE 1X5BA 2VQ2A 3IHRA 1EYHA 3CX8B 3D9PA 3Q9DA 5LOVE 3KEZA 3CKDA 3ZYLA 3VKGA 4KUMB 4RSYA 5FT9A 3CQGB 4CDMA 3FUKA 2AXZA 3AU5A 2X6IA 5JVDE 2L6JA 3URZA 1EDUA 3CGHA 4WBOA 2BVMA 2IONA 2WM9A 2AVPA 1OXZA 3C4ZA 3CVRA 4YJ2E 2M63A 3GA8A 3ESKA 3UMVA 3PVLA 4CCAA 5KJLA 3PEVB 4XKBA 1MMAA 2Y4TA 4IE0A 3T5VA 1NWMX 3UUXB 2WXPA 4AP2A 4DMVA 2C0SA 4OYKA 5KMGP 2L9QA 4XI9A 2WXMA 3QARA 5BNWA 1T98A 1HZ4A 2LOSA 3JC6C 2WXJA 3IBPA 4O4JE 4WNKA 3P1UA 3FU0A 2V26A 3WAJA 4EBAG 4CXXA 2YQ8A 4UWFA 3U64A 3FUHA 3ZEFA 3PU3A 4GZ5A 3RJVA 3IEEA 5FMNA 2V7LA 3N2OA 4DLOA 3DJBA 4EAHA 3EVYA 2NTXA 1WRDA 4F3VA 4I6GA 1H6KA 1HE8A 4BJMA 1MHQA 4J8SA 4PW8A 3HHMA 4UWLA 5LJMA 2I9CA 2KCVA 3N2GE 4F53A 4PUCA 1H19A 3MV3B 2V8SE 2IC6A 3CVXA 4AM9A 4O4HE 4CQIA 3BEEA 2A3DA 5E0OA 3ASHA 2LSGA 2XPYA 3AVRA 4WAFA 3AA1B 3PUQA 3FBZA 5LNKA 2NW9A 3HR0A 3O9XA 3MEKA 4GOUA 5JRCB 2E9XC 5AENA 3P8CD 1TJFA 3HI2A 3PUAA 3LEWA 2SPCA 1UJJA 2VSYA 3D9JA 3KBTA 3OXGA 3N9MA 4DI4A 4WW0A 3FU3A 5JDLA 2XRZA 4EBAA 2NW7A 3SWHA 2DNXA 2KZ7B 1Y64B 3S2AA 4GZCA 3D3MA 1U5PA 1HU3A 4ILUA 3CMLA 5JDNA 4XX5A 5FXWA 4CGWA 3ZJ1A 4BWRA 1MIVA 2J1DG 1WR6A 4AKGA 2N2NA 3ZCIA 2D5UA 3L08A 2XAJB 2X66A 3PZDA 4URKA 5ARFA 1P5QA 2NOXA 2E9XD 4I1OB 3I5PA 4KBQA 3NRYA 2WXLA 3GZ2A 2PQNA 1PC2A 1WAO1 4HXIA 4MBQA 2GGFA 3CK9A 4DMWA 5LJNA 2WQHA 5FZRA 1JUQA 3N2KE 1WY6A 3L17A 2QA7A 3AS5A 2RD0A 1FCHA 3JQ0A 3FTWA 2XAGB 3SI5A 3RO2A 4H9RC 3UUNA 3AS4A 3R9AB 3EIQC 4QXHB 2Q9QA 2JMKA 3HKCE 2LSYA 2V7MA 5G05J 2AXVA 2UY1B 2XPZA 5JJ7A 2LM9A 1Y6IA 3T5XA 2X9XA 2YINA 4FJYA 4G2VA 1SHZC 2XQ0A 1LRZA 2KZTB 3OTNA 5J2UE 2LSVA 3L13A 3MZLB 4L2LA 3SHFA 4X20E 2OVFA 3HVEA 4DPRA 4YLHA 3MKQB 3IKOB 5M72A 4JL0A 2IAKA 1HX8A 2NXPA 4MRUA 3D9OA 4PS8A 1U3DA 3Q4AB 3IBEA 3PH0C 2EHOB 4GYSA 4O4IE 5M4YA 2PQRA 4J8FA 2WVIA 5L3GB 4GCNA 3LY8A 5BW8C 4E85A 4CI1B 3T8OA 3ZYMA 5KJKA 3G2UA 2OV8A 3MKQA 2XGSA 3QK6A 2ODVA 1BR2A 4QFVA 5KX5E 2KWIB 5LCWC 2X38A 4GA2A 2NW8A 3R7RA 5JDMA 3QAQA 3TAXA 4CZZB 1NA0A 3CK8A 1H0AA 4ZI2D 5G05C 4CXWA 2P9BA 3TJPA 3LJ3A 4KBMB 3LBXA 2N1GA 4UVCB 4Q96A 5HXHA 4ERRA 2XGOA 3KV6A 3QK0A 4P29A 3CSTA 5HWYA 4DJAA 4Q69A 4PH4B 3OKQA 2X6KA 4JUYA 3CHSA 3KS2A 3FXEB 3ZW3A 3G2SA 2I1KA 3UUMA 2VKDA 2CHZA 3CX6B 4A55A 2V4LA 3MZKB 5FXZA 4V1Av 3D0TA 3FEXA 5D0OD 3E0ZA 3KVAA 3KINB 3ZHEA 1NAFA 3FUDA 2J9QA 4QKNA 2WQ6A 3ZIMA 3HVEB 2KC7A 3BQKA 3T8MA 3ZYKA 4EZHA 2W63A 2PM6A 4G23A 3D9NA 2VYIA 4B6XA 3MYVA 4TRQA 4GYWA 3PNLB 1S94A 1UG3A 3LK2B 3OYXA 3ETUA 2Y6XA 2ZLYA 1HXIA 2R5SA 5HQ8A 5G04C 4B89A 1OWMA 5L3CB 3SNXA 2V7KA 2LAHA 2PG8A 3CQCB 2DCFA 4JXTA 3D9LA 1ZEEA 4RVBA 1X79A 4UEMA 5LP0A 3QJZA 1HS6A 2PM7A 2LEHA 2LOPA 1WM5A 2K24A 1IZNB 4PJMA 3AB3B 5EK3A 5LCYA 4EZKA 1YKHB 1AJ3A 4D10C 2X9YA 1MIYA 3MK7C 5AJLA 1D1BA 4OHFA 4NUVA 3A5XA 1E8XA 3ASFA 4U0SA 2BF0X 3KAEA 3AU4A 4E7ZA 3FUMA 3M65A 1FMVA 4RG9A 4KMCA 3LDZA 4FC8A 3PURA 2E2EA 3PUGA 4PK5A 2CXFA 4L2YA 4GYOA 3CHQA 4Z8XA 3QNKA 3U3IA 3MA5A 3HKEE 2GW1A 4ZI7E 3AVSA 3CV0A 4WUYA 4TV9E 2XASB 3TG4A 3E4BA 2J4BA 3ULQA 4B0ZA 5JR9B 2UXXB 1YKEB 4EQFA 2XAHB 3RIBA 4C90A 4KZ0A 1JWFA 2Q9QC 3ZLIA 3WXXA 4BFRA 3SF4A 3SBSA 3FDHA 3CHPA 5KDMC 2C0LA 4KXKB 3QWPA 4QX8B 4AQFC 4IE7A 4MALA 3U4TA 2WMOA 4U8HA 1U4QA 1FVFA 3ENEA 4AQGA 4ISSA 4AY6A 4C91A 3N9LA 3CPZA 2E0IA 3MV2B 1KT0A 4XBFB 1LKXA 5LA6E 4IULA 3I1AA 5DQVA 2NTYA 1ZKEA 3RRMB 3RRUA 2VL8A 5FNVE 4XE0A 5FYMA 4PS7A 5LGNB 4QXBB 3C64A 1HS7A 2WXNA 5FQ4A 4O8SA 4EXTA 2MBGA 4WNFA 3ZGQA 3CX7B 2H7OA 1UN9A 2NP9A 2AW6A 3GZ1A 3CVUA 4PFPA 5BMVE 3CVYA 3VHLA 2D0UA 4UV9B 3CIAA 3I4RB 1MNDA 3PTRB 1BR1A 4JLEA 1MIWA 3ZRHA 4CT0A 4IIJE 4PNIA 3UTKA 5JDGA 3G2VA 3PUSA 2JJ9A 4FHKA 4QXCB 3FTUA 3BG0B 3FP3A 2WAUA 4C0EA 4ANUA 2KZTA 3F57A 5FQ8A 2DIWA 2V7IA 3RU0A 4G11A 5BV0A 2I6HA 4O4LE 3B13A 3E08A 4I2WA 1VDYA 1TEZA 4TX5A 4I43A 3SZ7A 2LT3A 1GW6A 5J08A 2PZIA 3GW4A 4DK5A 4OYSA 2HYZA 4F1SA 2A2FX 3LYAA 1WYBA 2IOLA 3HIZA 1OWPA 4BT8A 2CMRA 3CHMA 4JHRA 5HXRA 2R59A 4MKTA 1IQRA 4EIWA 2H7VC 3UT5E 5HAXA 4H63H 4I50E 3EHNA 3SD5A 4P0BA 3AA7B 3KV5A 5H6QB 3FTVA 4N5CA 4HOQA 3ZMUB 4AKLA 4MHCA 1Z0PA 4WWPA 1XNFA 5KCMA 1QZ2A 4BT9A 4AY5A 1E1HB 3C51A 4BTAA 4K03A 3K3QC 2XCBA 4AI6A 4GYYA 4BA9A 2P58C 3H3AA 3PE4A 3ZMSB 1N54A 2ZMAA 4G24A 5LP6E 3ZEFB 4HOTA 1PAQA 3G2WA 2WXGA 4KMOA 1QSDA 3ZN0B 4ZS3A 2IF4A 2KXPB 4IRUA 4EOZB 4L23A 4PJJA 1JPLA 4ACLA 4C0MA 2HPJA 1HTJF 5EDSA 3TXMA 4XZCA 4I55E 3C50A 4GA0A 4JA7A 5D0QD 3CVNA 1WLXA 2LSKA 4XZ4A 3IHYA 4L5GA 3B7TA 4RG6A 3FUNA 4K0UA 5KJMA 3S7FA 4I4TE 3R7QA 1S0PA 4N3BA 3EIJA 1HO8A 3EDVA 3Q47B 1D1AA 4GMJA 5CMWA 4DBRA 4BX8A 4X1IE 2CFUA 3ZN1B 2AWIA 5JQGE 2NC9A 4CGVA 3GN5B 2C5KT 4IDZA 5DBKA 3OXFA 3RKOA 1S35A 2Y8DA 2L9BA 2CFZA 3OBVE 5LFAA 4ABNA 3Q5XA 2LJLA 4EB6E 5DQWA 2E8IA 2D2SA 5T8IA 1H2UA 3DBSA 4ILGA 2BDEA 2WXIA 3OAWA 3LKUA 1E8YA 1ZU2A 3D9KA 4FJOA 4H9SE 2IFUA 2J07A 3CVVA 4GZ6A 4UWHA 4ADZA 2M67A 4IE4A 1QNFA 4IN3B 2G0UA 4GK5E 5ENNA 1Z3XA 2ZM8A 3KD7A 4C9BB 3EUHA 4APOA 3CVQA 4ACKA 3ZXSA 5EX3A 3ASGA 4HOSA 3B57A 3VKHA 4P0AA 2X51A 2ACXA 4AVXA 3Q49B 2D0TA 2YU2A 3APDA 5ARGA 5LHHB 3CHOA 4O2AE 4TV8E 5JJ6A 4FP7A 4UWGA 3I9WA 3LPZA 3O4ZA 2PFVA 4W9RA 2WXHA 3SFZA 2KWHA 5E75A 3LJCA 2HR2A 2GRLA 3U66A 5F8PA 3S7BA 4FU3A 4HGAA 4M3OA 4NACA 2NSZA 4JA9A 4UIGA 4AIFA 3C98B 3OYZA 5GONE 5C8YE 5FWQA 5BPPA 4FULA 1MQSA 4HOUA 2KM4A 4GYRA 2XEVA 3E22E 4OFZA 1FVHA 1ELKA 1E8WA 1UW4B 5J2TE 4PDXA 4XAXB 2CWYA 2X6JA 2VGYA 5LHIB 2LHNA 2CHWA 2EHOD 2X6FA 3ESLA 4V3IA 1H7CA 4I17A 1Z6TA 4N3CA 4CEMA 1UX5A 5A23A 5IYZE 4DVDA 2VKHA 4ZI3C 5FXXA 3RRCA 3APCA 2VASA 1US7B 2VSOE 4PK4A 4U74A 4HORA 3DTOA 3PS6A 4GPKA 4XIFA 2A72A 3V5SA 2PL2A 3Q5MA 4UV8B 5LHGB 5LYJE 4EYYR 2WXRA 1LF8A 3CKCA 2XGMA 2HPLA 3HYMB 3Q2MA 5LBQB 5LOZA 2C5JA 3LBXB 1IYGA 5ANLA 4KP3C 3PUKA 3AS8A 4QWNB 2RA1A 4ANJA 4JEHA 4YFSA 3ZC0A 1MNEA 2VSNA 1SQMA 5JRCA 3CSFA 3K9IA 3RPUA 3IHVA 4UWKA 5L3EB 3LFMA 5HYAA 3IF8B 4UELA 2I1JA 5G2NA 3ETVA 2IU1A 2Q7FA 4J8EA 1ELWA 3ZJ2A 5FQ6A 4ZI3D 3LY9A 4J0UA 2XUEA 2LO6A 2L0TB 2WPVA 4NRHB 2XAQB 2X67A 3FXDB 4G25A 2K9AA 2NWBA 4DI3A 2Y48B 4AEZC 2HO1A 3JCKC 4CXYA 2AXUA 4UQXA 3I4GA 1Y8MA 5JHAA 3IEGA 1O3XA 2FBNA 2GK9A 4I6EA 3VU7H 1ELRA 3ONLA 1NZNA 4A1GA 4WNDA 3CVLA 3CVWA 1JWGA 5JR9A 1OWAA 3K8PC 3U9WA 4CDRA 1UX4A 3QKYA 4WWNA 3S7DA 1D0YA 4F7AA 4JC8A 1E7VA 4I9EA 3OXLA 2ZM0A 3UT8A 2CLYB 5LG4A 2ZU6B 4EYUA 3QC9A 2JRKA 4IE6A 5FP3A 5CCMA 2CXDA 2I2OA 3BK9A 3MXZA 4F6RC 3F31A 4L9IA 2B1EA 5JREA 5LGTB 1BPOA 3KDSE 3LG7A 3ZFWA 3UFEA 4N3AA 1E8ZA 3AAEB 3NQPA 3ZYQA 3NZPA 1L5JA 3KV4A 2LNIA 3N71A 3W15B 4LRZA 4L0RA 3CQXC 2KCKA 4JEUA 4ZI2C 4GZDA 4UVBB 4UQYA 3RO3A 4MLKA 2OA5A 5A7DB 1CUNA 2BZBA 3U78A 3EDTB 1PY1A 3FWVA 3VTXA 3O48A 4YNDA 5EKQD 5LGUB 4WWOA 4CT4A 5G55A 5BV1A 1LVKA 3GMIA 3BQIA 4FA6A 3P7IA 2DHRA 2QGSA 2JQQA 5FQ7A 5FXVA 4U63A 4Y6WA 2MYSA 3FHEA 3S4UA 3FUEA 2ONDA 5ETWA 5A1LA 2VGXB 3MACA 3NRXA 5FY1A 3FTZA 4UI9K 5AFUL 3CVPA 3RYCE 4N2QA 4Y6CA 2PBIA 4G1TA 2VB6A 5FJYA 5DIZA 2BVLA 4MS6A 4TN7B 3KFWX 4MFRA 5T3RA 3ZMVB 4AXHA 3EDUA 3APFA 4YVQC 2LAIA 2RG8A 2BUGA 5FTPA 3RYHE 3DP7A 4GIWA 3TXNA 3FUJA 3DPDA 2WXQA 4UI9C 4PS3A 5C2YA 3RKVA 1YA0A 1FEWA 4DO0A 3J9X1 5TAOA 1H2TC 2CXLA 2E9XA 5CCLA 4LCTA 4ILHB 1IAPA 3ONKA 3HKDE 4PK6A 3LK3B 2LHRA 3ZN3A 3RRNB 4J6IA 5AYWD 5BUZA 3MA9A 4H7XA 2V7JA 3QUJA 2CLYC 3RH3A 2OVBA 3RC3A 2ILRA 3QOUA 4KT6B 2MRIA 2PJQA 5ANRA 4JZYA 3L6AA 4L1BA 4AOFA 2QY7A 3B7UX 3FTSA 2ZM2A 1HG2A 5LCWJ 2X9WA 2WB2A 3ZPOA 4GZ3A 2DLRA 2JLBA 4X1YE 5CA1E 2XAFB 3ZC1A 2FI7A 2MOZA 5HWXA 5HI7A 3FHNA 1ZV4X 5CHEE 4UF0B 4G26A 5BT1A 4QX7B 1E7UA 1G73A 3MKDA 2YK0A 4AKIA 2WXKA 3R6NA 2CE7A 3NBXX 4N39A 2UY1A 3CKBA 3TL5A 5LX8A 2Q9QB 3O4XE 5T4YA 2J4DA 2XPIA 2IOSA 5JDFA 3CK7A 2X68A 3FU6A 2C0MA 3KVBA 1SZAA 5L3BB 2RP4A 2CEAA 4IHJE 5JHBA 4L7TA 4GU5A 4TUUA 3PRZA 5EX0A 1EZ3A 3ASDA 2J49A 1U3CA 1G8XA 2VK9A 2WMNA 3C98A 3AA0B 3C4WA 5L3DB 3U3WA 4EZ4A 4ATGA 4B8AA 3WAKA 4NQ0A 4I1MA 1TJCA 5HXSA 3ZCJA 3GZSA 1D0ZA 5EZYE 2IQCA 4LUNU 5C1DA 4TUYE 5HXCA 3VLEA 4I43B 4PJNA 2J08A 5AIJA 3UX4A 4IE5A 4DBQA 5KJNA 3ZPJA 3SBTB 3ZMTB 3Q15A 4P09A 3VLDA 3C4XA 4U07A 5A6CA 5DJQC 4EECA 4GCOA 2VKJA 2MHKA 2L8KA 3O1HA 5IHYA 3TG5A 2KLQA 2W00A 3TKLB 1INZA 3FY4A 4XKCA 3HA4A 2JMHA 2CHXA 2VTBB 3PEUB 1EPUA 4KYOB 3N9OA 3VLFA 2YHCA 2CWOA 4CI2B 2BTDA 4H7YA 4PFOA 5FY7A 3K3NA 4LERA 4X1KE 1OWOA 3B7RL 4J8DA 1MMDA 1HG5A 3MJXA 3FTXA 3UQ3A 2OOEA 1BR0A 2DI4A 3MX3A 2MTQA 3UT7A 1YW0A 4FLBA 4H9NC 4I6JA 4A3TA 2IC9A 1HH8A 4H9PC 4A56A 2X6HA 4UXNB 3I9YA 2WSSV 4N2SA 3NF1A 4JW1A 3MJWA 2Y4UA 4B94A 3VTYA 3CHRA 3PNTB 4IYPA 4ME2A 1EF1C 2WQ7A 4GK0E 3MKRA 5CB4E 3ZMZB 2Q9QD 4UVAB 2XRYA 3BG1B 4LEUA 2K48A 5JDHA 2L0IA 1B89A 2LSUA 3S7JA 3ML9A 4WNGA 3GWHA 4A3VA 2X3MA 3WI3A 1NP7A 4FADA 4ZHQE 3PREA 3LXUX 1KK7A 5JJTA 3PDYA 4CDNA 2CM0A 3R84B 2YNQA 3D9IA 3IV0A 3RC8A 2N9DA 2K5BB 3NZSA 1E96B 3CEQA 4JHKA 3I3NA 1IJ6A 4PAGA 3PU8A 4GAAA 4FLHA 4HKAA 3L16A 4E6HA 3I0QA 3PUJA 3L54A 3LK42 2GRMA 5CMYA 5FZSA 3I0OA 2XHEA 1HFAA 2WWUA 2CCQA 4TZ4C 3QB2A 3G2TA 4QHOA 2MOWA 4BAYB 2VGXA 2LSJA 4ISTA 2KNDA 2EHOC 4ZOLE 3FU5A 2DBAA 4OYJA 3D9MA 1UN8A 4GA1A 3N9QA 4AQFA 2LE8A 1FIOA 3MGBA 4U04A 3LCAA 3J7Yq 2EHOA 4J2CA 2H3RA 1VRBA 3UULA 2XTLA 4JEHB 4KVOA 4N78D 1HF8A 3BQLA 4WNEA 4HN9A 2YU1A 2A5UA 1ZHCA 3ANWA 4JPSA 2V1DB 2XCCA 3V5UA 1DNPA 1W3BA 2WXOA 5LXTE 3EHMA 3FFLA 4EPZA 4U0UA 4ANXA 1D1CA 3QWVA 3P2BA 4EZJA 4HFVA 2FEZA 2L3LA 4KZCA 2FF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMO A;  2WMN A;  2YIN A;  3B13 A;  3VHL A;  2WM9 A; 
#chains in the Genus database with same CATH topology
 4I9C A;  2V0P A;  4CRW A;  4DV7 T;  4XI0 A;  4DND A;  4O2B E;  4BY6 A;  1D0X A;  2UXN B;  1BI8 B;  2IW5 B;  2R6G F;  3OJA A;  3FH8 A;  4ZEY A;  3PE3 A;  2X0H A;  4ILI A;  5JH7 E;  2DWG A;  4G2A A;  3EJN A;  2IML A;  3AE3 A;  3N9P A;  4HS2 A;  3MCX A;  3Q79 A;  2I59 A;  3ZHE B;  4KVM A;  5E76 A;  4HLE A;  5CA0 E;  1N34 T;  4GTR A;  1QUU A;  5G04 J;  2CG3 A;  2YHE A;  1KLX A;  2A4Z A;  5AQT B;  3FH7 A;  5DAB A;  3PDN A;  2VJ8 A;  2P9I G;  3AA6 B;  1UJK A;  5AQN B;  4LFA T;  4HEA A;  4H9Q C;  2KT9 A;  5L3F B;  3QWW A;  2CG2 A;  1KT1 A;  4GKJ T;  5IY5 E;  4BJN A;  1WYC A;  3HDX A;  1YD8 G;  2ZGD A;  4EZL A;  1N4S A;  3RK6 A;  5JDQ A;  1TNO A;  3UM3 A;  4JVS A;  3KBU A;  5F3J A;  4GML A;  5EK2 A;  5EYL A;  4BSX A;  3ZUV B;  1T7S A;  2EQX A;  1OWN A;  4BTB A;  2XEE A;  3AAA B;  3RGL A;  1QQE A;  3FB2 A;  3FEY A;  4UF0 A;  1LTX A;  4LFB T;  4YVO A;  3NOC D;  1A17 A;  2UXB T;  2QFC A;  1O5M A;  4CI3 B;  4GMR A;  5CRV A;  2BKO A;  3LS8 A;  1UUR A;  3L22 A;  1YCS B;  3DSX A;  3RX6 A;  5FIN A;  3JQ1 A;  5HQ8 A;  3FUL A;  5KNG A;  3TWT A;  1MMG A;  3Q5W A;  3W9G A;  2LLY A;  4ASK A;  1XGW A;  3UU8 A;  4O6F A;  2KAT A;  5D66 A;  3SS1 A;  1K3Z D;  4ILC A;  4AJW A;  2X0L B;  5J90 A;  2HE0 A;  2WXF A;  3EU9 A;  4DLQ A;  2BS2 A;  3F2E A;  5HKP A;  2W0G A;  2W61 A;  2JEK A;  3JUI A;  2CA5 A;  3GN5 A;  3ML8 A;  3QDN A;  1H6O A;  3UT4 A;  5L2L A;  4U72 A;  2J09 A;  1B7T A;  1UCU A;  3KV9 A;  4FHJ A;  3ZVV A;  1DVP A;  4JBW F;  4OK0 A;  2E5V A;  4GB9 A;  2X9H A;  3SGH A;  4Q94 A;  3CLJ A;  2DYS E;  2Y3A A;  2HM8 A;  2OEW A;  4TNV A;  4HFG A;  5LBM A;  2XHE B;  3HL6 A;  3L09 A;  2FUL A;  3T8K A;  3EAM A;  3NBN B;  5ENQ D;  3HRA A;  3UPV A;  2ODU A;  3FUF A;  3LVQ E;  4ANV A;  2B76 A;  4BES A;  3L3P A;  4AIS A;  1E90 A;  2W4X A;  4FJZ A;  2YEV C;  2VSX E;  5FZQ A;  4U2Y A;  2VTB A;  2CHN A;  2PTF A;  3L9T A;  3FBL A;  3B7S A;  1MX2 A;  4TV3 A;  4E7S A;  4OVV A;  3E33 A;  4K5B A;  1FMW A;  1SA0 E;  1LVF A;  1IQU A;  4JV5 T;  4XEI G;  3LVR E;  4PJL A;  2XQ5 A;  3RRW A;  2H88 A;  4A1S A;  1HCI A;  3QC1 A;  4I1A A;  4NXM T;  3FTY A;  5AQJ B;  3L82 A;  4MBG A;  3PZ4 A;  1ZBP A;  2FJE A;  4BX9 A;  4YSX A;  2FO7 A;  4JYA T;  1Z3Y A;  3DSV A;  5J1G A;  4CN1 A;  4B93 B;  2C2L A;  3ONX A;  2IY0 C;  3CR3 A;  4U0Z A;  2W62 A;  3RYI E;  3NZU A;  3ANW B;  2E9X B;  1TNB A;  3O1J A;  4FI5 A;  4JHJ A;  2Z6E A;  4TXQ A;  4NUR A;  1R8I A;  2WBL A;  4AKR B;  3FZH B;  3N9N A;  4HVB A;  2IUB A;  1MMN A;  2DWK A;  1IJ5 A;  4H63 V;  2K3W A;  2XQY A;  4LF4 T;  3TGO A;  1HNX T;  4YHJ A;  1IHG A;  1SZ9 A;  4A5X A;  1N52 A;  1MYO A;  1VOM A;  3K3O A;  4JEU B;  3UU6 A;  4ZS2 A;  4M1P A;  4R7L A;  2UXC T;  5H6R B;  5FY0 A;  4H9O C;  3AED A;  5JR9 C;  4HQD A;  2V5F A;  3E32 A;  4QH5 A;  2LKH A;  1QBQ A;  2LSI A;  4WBN E;  2IJG X;  3UUX A;  1NA3 A;  1OWL A;  4APF A;  4ANW A;  2KCL A;  2QYJ A;  4GTS A;  5AQS B;  2RKK A;  5AJD A;  4YJ3 E;  2NR4 A;  3SRZ A;  3LY7 A;  3AAI A;  4AXP A;  1H2V C;  3JAF A;  3AEA A;  3DPY A;  2F4V T;  4UQZ A;  4DID B;  3NZQ A;  2P9K G;  2LXL A;  1OXJ A;  3FH5 A;  3H37 A;  3JYS A;  2V5Q C;  4HE8 A;  2ES0 A;  2J8S D;  4A63 B;  2VKO A;  2DCP A;  3SOL A;  1L0V A;  2R17 C;  4B3R T;  4K0K T;  2F8Y A;  2KIN B;  2ETA A;  3CWZ B;  2HH7 A;  5AQV B;  1OUV A;  4G63 A;  5AQU B;  4MLP A;  3GYZ A;  2C5I T;  4I2Z A;  2UWJ G;  5HXE A;  2GRQ B;  5ADX L;  4HTE A;  4UI9 J;  4B8C B;  3JC6 D;  2JQK A;  4AV7 A;  3PE0 A;  5AQP B;  2XZE A;  3ONJ A;  2UUA T;  1KEY A;  1KZP A;  1BR4 A;  2YKS A;  4IGU A;  4AKH A;  1N4R A;  3Q5D A;  4NUU A;  4RLY A;  3O1I A;  3RYF E;  3C3Q A;  2VWA A;  3N5L A;  5EK4 A;  3AEC A;  2HN2 A;  5JMN D;  1KNZ A;  3UKU G;  1V9D A;  2ZGG A;  2KMF A;  1YMP A;  5AAO A;  1N0Q A;  3FUI A;  4OVU A;  2XQ8 A;  2JPF A;  3HKB E;  5AQI B;  4K0R A;  1X5B A;  2VQ2 A;  3IHR A;  1EYH A;  3CX8 B;  3D9P A;  3Q9D A;  5LOV E;  2Y69 E;  3KEZ A;  3CKD A;  4UUC A;  3ZYL A;  3AE4 A;  3VKG A;  1BU9 A;  4KUM B;  4RSY A;  5FT9 A;  3CQG B;  4CDM A;  3TWX A;  3FUK A;  2AXZ A;  2BBJ A;  3AU5 A;  2X6I A;  5JVD E;  2L6J A;  3URZ A;  1EDU A;  4DUY T;  5AQL B;  3CGH A;  3RHW A;  4WBO A;  3AG1 E;  2ACZ A;  2BVM A;  2M6I A;  5ENT D;  2ION A;  2WM9 A;  1TNU A;  2AVP A;  1OXZ A;  3C4Z A;  3CVR A;  4YJ2 E;  2M63 A;  3GA8 A;  3AE7 A;  3ESK A;  3UMV A;  3PVL A;  4CCA A;  5KJL A;  3HXE A;  3PEV B;  2PNN A;  4XKB A;  1WCR A;  1MMA A;  2Y4T A;  2H89 A;  1N9A A;  5D2M C;  4IE0 A;  3T5V A;  1NWM X;  3UUX B;  2WXP A;  4JI5 T;  5L4E A;  1V54 E;  2P9N G;  3ULE G;  4DMV A;  4AP2 A;  2C0S A;  4OYK A;  1E7P A;  5KMG P;  2L9Q A;  5HEU A;  4XI9 A;  2WXM A;  3QAR A;  5BNW A;  3Q78 A;  1T98 A;  1HZ4 A;  2LOS A;  3JC6 C;  2WXJ A;  3IBP A;  4O4J E;  4WNK A;  3HXC A;  3P1U A;  2XJ7 A;  5FL1 A;  2V26 A;  3WAJ A;  3FU0 A;  4EBA G;  4CXX A;  2IO2 C;  2YQ8 A;  4UWF A;  2MPK A;  1WDY A;  3G06 A;  3U64 A;  3FUH A;  3ZEF A;  3PU3 A;  4GZ5 A;  3RJV A;  1WR0 A;  3IEE A;  3PZ1 A;  5FMN A;  2V7L A;  4HFB A;  3N2O A;  3D9H A;  4DLO A;  3DJB A;  3FZL B;  4HFH A;  4EAH A;  4BSZ B;  3EVY A;  2NTX A;  3R9M A;  2LKG A;  1XDP A;  4A98 A;  2DVW A;  1WRD A;  4F3V A;  4I6G A;  1H6K A;  1NI1 A;  2Y1L E;  1HE8 A;  4BJM A;  3PZ2 A;  1MHQ A;  4J8S A;  3LJN A;  4PW8 A;  2BG9 C;  3HHM A;  4UWL A;  5LJM A;  2I9C A;  2KCV A;  3N2G E;  2JAB A;  2ZIS A;  4F53 A;  4YSZ A;  4PUC A;  1H19 A;  2QVA A;  3KSQ A;  4N5Q A;  3MV3 B;  2OCC E;  5BR8 T;  1NEN A;  3SFX A;  2V8S E;  2IC6 A;  3CVX A;  4AM9 A;  4O4H E;  3JUE A;  4CQI A;  4HNA D;  3BEE A;  3RF1 A;  2A3D A;  5E0O A;  3ASH A;  2WY2 A;  2LSG A;  2XPY A;  3PUW F;  3AVR A;  4WAF A;  3OPC A;  3AA1 B;  3PUQ A;  3FBZ A;  5LNK A;  2NW9 A;  3HR0 A;  3O9X A;  3OVU A;  3MEK A;  4GOU A;  2IHR 1;  2LM2 A;  2E9X C;  5JRC B;  5AEN A;  3P8C D;  1TJF A;  3HI2 A;  3PUA A;  3LEW A;  2ZIR A;  2SPC A;  4DV6 T;  1OY3 D;  4IL4 A;  1RW2 A;  1UJJ A;  2VSY A;  2BKG A;  3L8R A;  3DEO A;  3A7M A;  2FO1 E;  3D9J A;  3KBT A;  3OXG A;  1MX4 A;  3EU5 A;  3N9M A;  4DI4 A;  4WW0 A;  3FU3 A;  5JDL A;  2XRZ A;  4EBA A;  3DRA A;  2WB5 A;  2NW7 A;  3SWH A;  1T8B A;  2DNX A;  2KZ7 B;  1Y64 B;  3S2A A;  4GZC A;  4DV4 T;  3D3M A;  1U5P A;  1HU3 A;  4ILU A;  3CML A;  5JDN A;  4IDP A;  4XX5 A;  3J5P A;  5FXW A;  5HEH A;  4CGW A;  3ZJ1 A;  1XWM A;  3PUV F;  4BWR A;  5HRY A;  1MIV A;  2J1D G;  2H6H A;  1WR6 A;  1FT2 A;  4AKG A;  2N2N A;  3ZCI A;  2D5U A;  3L08 A;  3Q9N C;  2XAJ B;  2X66 A;  2OEV A;  3PZD A;  4URK A;  2CBI A;  5ARF A;  1P5Q A;  2NOX A;  2E9X D;  5FVL A;  4I1O B;  3I5P A;  4KBQ A;  3NRY A;  2WXL A;  3GZ2 A;  2PQN A;  1PC2 A;  1WAO 1;  4HXI A;  4MBQ A;  2GGF A;  3CK9 A;  2L6B A;  4DMW A;  5LJN A;  1TN7 A;  2WQH A;  5FZR A;  1OCR E;  1JUQ A;  3NB2 A;  3N2K E;  1WY6 A;  3L17 A;  3TLS A;  1HX1 B;  2QA7 A;  1AP7 A;  3AS5 A;  2RD0 A;  4LMJ A;  1FCH A;  3JQ0 A;  3FTW A;  2XAG B;  3SI5 A;  3RO2 A;  4H9R C;  3UUN A;  3AS4 A;  2F0Y A;  3AEB A;  3R9A B;  3EIQ C;  4QXH B;  2Q9Q A;  2M6B A;  1UGO A;  2JMK A;  3HKC E;  2LSY A;  3AEG A;  2V7M A;  1SUM B;  5G05 J;  2AXV A;  2UY1 B;  1MJ0 A;  2XPZ A;  5JJ7 A;  4C48 B;  2LM9 A;  1Y6I A;  2VL0 A;  3T5X A;  5AN8 A;  2X9X A;  2YIN A;  4FJY A;  4G2V A;  5FL0 A;  1SHZ C;  2XQ0 A;  1LRZ A;  2KZT B;  4CN4 A;  3OTN A;  4QQI A;  5J2U E;  1N33 T;  2LSV A;  2MAW A;  3L13 A;  3MZL B;  4L2L A;  3SHF A;  4X20 E;  4QH1 A;  2OVF A;  3HVE A;  5L47 A;  4YDE A;  3UU4 A;  4DPR A;  4YLH A;  2R02 A;  1N0R A;  3MKQ B;  2VQE T;  4AQY T;  3IKO B;  4JL0 A;  5M72 A;  1IBM T;  2IAK A;  2P9U G;  3B95 A;  1HX8 A;  2NXP A;  4MRU A;  3D9O A;  4PS8 A;  2R05 A;  3V2O A;  1U3D A;  3Q4A B;  3IBE A;  3PH0 C;  2WQY A;  3E30 A;  4GKK T;  1OCO E;  2EHO B;  4GYS A;  4O4I E;  5M4Y A;  1W0B A;  2PQR A;  4J8F A;  2WVI A;  4NIQ A;  5L3G B;  2XQ7 A;  3UFG A;  4GCN A;  3LY8 A;  4LNU D;  3C5R A;  5BW8 C;  4E85 A;  4X65 T;  4DR7 T;  3SY2 A;  4CI1 B;  3T8O A;  3ZYM A;  4U7Y A;  5KJK A;  3G2U A;  2OV8 A;  5EIL A;  3MKQ A;  2XGS A;  5AQO B;  3QK6 A;  2ODV A;  4K5A B;  1MX6 A;  1RZ4 A;  1BR2 A;  2GRP B;  4QFV A;  5KX5 E;  2KWI B;  3VR8 A;  5LCW C;  4GTM A;  4JI6 T;  2X38 A;  4GA2 A;  1XMO T;  2NW8 A;  3R7R A;  5JDM A;  4JI3 T;  3QAQ A;  3TAX A;  4CZZ B;  1NA0 A;  3CK8 A;  1H0A A;  5KBA A;  1H6P A;  4ZI2 D;  5G05 C;  4CXW A;  2P9B A;  4HI9 A;  4X8Q A;  3TJP A;  3LJ3 A;  5KWD A;  5FVK A;  2WZI A;  2LXM A;  4ZFH A;  4KBM B;  2WDR A;  3LBX A;  4QH4 A;  2N1G A;  4UVC B;  2P9L G;  4Q96 A;  1U2V G;  5HXH A;  4ERR A;  2XGO A;  3KV6 A;  3QK0 A;  4P29 A;  3CST A;  3AXJ A;  5HWY A;  4DJA A;  4Q69 A;  4PH4 B;  3OKQ A;  2X6K A;  4JUY A;  3CHS A;  4EGW A;  3KS2 A;  2IIU A;  3FXE B;  3ZW3 A;  3G2S A;  2I1K A;  3UUM A;  2VKD A;  2CHZ A;  3CX6 B;  4A55 A;  3QB5 A;  2V4L A;  3MZK B;  5FXZ A;  4V1A v;  3D0T A;  3FEX A;  5D0O D;  4NXN T;  3E0Z A;  5ENP D;  3KVA A;  3KIN B;  3DWL G;  3ZHE A;  1NAF A;  1J1J A;  3FUD A;  2J9Q A;  1SA5 A;  4LG6 A;  4QKN A;  2WQ6 A;  3ZIM A;  3HVE B;  2KC7 A;  2JIW A;  3BQK A;  3T8M A;  3ZYK A;  4EZH A;  2W63 A;  5FIO A;  3NVO A;  2PM6 A;  4G23 A;  3D9N A;  2R2L A;  5CEC B;  2VYI A;  4B6X A;  3MYV A;  3T9K A;  3UI2 A;  4TRQ A;  4DV5 T;  1S70 B;  4GYW A;  3PNL B;  4TWH A;  4HFI A;  1S94 A;  2EIJ E;  1UG3 A;  3LK2 B;  1HXI A;  3OYX A;  3ETU A;  2BG9 A;  2Y6X A;  2ZLY A;  2R5S A;  2WZH A;  2XZT G;  4M7C A;  5G04 C;  2WCA A;  1SE7 A;  1S64 A;  4B89 A;  1OWM A;  3AE1 A;  2XZD G;  5L3C B;  3SNX A;  2V7K A;  2LAH A;  3RSE G;  4CYM D;  2PG8 A;  3CQC B;  2DCF A;  4JXT A;  3D9L A;  1ZEE A;  4RVB A;  1D8E A;  5AQ9 A;  1X79 A;  4UEM A;  4HRM B;  4BER A;  5LP0 A;  3J5Q B;  3UM2 A;  4IDO A;  5B3S E;  3QJZ A;  1HS6 A;  2PM7 A;  2LEH A;  2XSB A;  2LOP A;  1WM5 A;  2K24 A;  1IZN B;  4PJM A;  3RI5 A;  1N36 T;  3AB3 B;  3BQO A;  5EK3 A;  5LCY A;  4EZK A;  1YKH B;  1AJ3 A;  4D10 C;  2XS1 A;  2X9Y A;  1MIY A;  3MK7 C;  5AJL A;  1D1B A;  4OHF A;  4NUV A;  3A5X A;  1E8X A;  3ASF A;  4U0S A;  1CHU A;  3E37 A;  2BF0 X;  3KAE A;  5CFB A;  5LB7 B;  3AU4 A;  4E7Z A;  3FUM A;  3M65 A;  1FMV A;  4JI4 T;  3AG2 E;  4RG9 A;  4KMC A;  3LDZ A;  1JNR A;  2V6X A;  4B3M T;  4FC8 A;  2XQ6 A;  3PUR A;  2QYW A;  2E2E A;  2J62 A;  3PUG A;  4PK5 A;  2CXF A;  4L2Y A;  4GYO A;  3CHQ A;  1OED A;  3ZT7 A;  4Z8X A;  4X64 T;  3QNK A;  3UIO C;  3U3I A;  3MA5 A;  4RQI A;  3TLU A;  3HKE E;  3EI0 A;  2GW1 A;  4ZI7 E;  3AVS A;  3CV0 A;  4WUY A;  4TV9 E;  2XAS B;  3TG4 A;  4IRE A;  3E4B A;  2J4B A;  1ZB1 A;  4U8Y D;  3ULQ A;  4B0Z A;  5JR9 B;  4DX7 D;  2UXX B;  1YKE B;  4WYV A;  4EQF A;  2XAH B;  3RIB A;  4C90 A;  4KZ0 A;  4YHH T;  1JWF A;  5AQH B;  2Q9Q C;  3ZLI A;  4DR5 T;  3WXX A;  3UIN C;  4DX6 D;  4BFR A;  3SF4 A;  3SBS A;  3FDH A;  3CHP A;  5KDM C;  2C0L A;  4J7W A;  4KXK B;  3DSW A;  5HEJ A;  3QWP A;  4QX8 B;  4AQF C;  4IE7 A;  4MAL A;  3U4T A;  2JQ9 A;  2WMO A;  1KF6 A;  1U4Q A;  4U8H A;  1FVF A;  1JCS A;  3ENE A;  5AQA A;  4AQG A;  4J8Y A;  3Q7F A;  4ISS A;  1XZY A;  5CJ5 A;  4AY6 A;  4C91 A;  4U2Z A;  3FZK B;  4KI0 F;  5F5W A;  2ZM6 T;  3AE5 A;  3N9L A;  3CPZ A;  4A97 A;  2E0I A;  3MV2 B;  1KT0 A;  4XBF B;  1LKX A;  5LA6 E;  3AE6 A;  4IUL A;  3I1A A;  5DQV A;  3LSV A;  2NTY A;  1ZKE A;  3RRM B;  3B7B A;  3RRU A;  2VL8 A;  5FNV E;  4XE0 A;  4LNG A;  5FYM A;  4PS7 A;  5LGN B;  4QXB B;  3C64 A;  1HS7 A;  2WXN A;  5HEO A;  5FQ4 A;  4O8S A;  4EXT A;  2MBG A;  4WNF A;  3ZGQ A;  3CX7 B;  2H7O A;  4DX1 A;  1UN9 A;  2NP9 A;  1Z8U A;  5AQG B;  2AW6 A;  2H6I A;  3GZ1 A;  3CVU A;  2ETB A;  4PFP A;  5BMV E;  5ITZ F;  3CVY A;  3VHL A;  2D0U A;  4HFC A;  4UV9 B;  3CIA A;  3I4R B;  1MND A;  3PTR B;  1BR1 A;  4JLE A;  1MIW A;  1OCC E;  3ZRH A;  5ABH A;  4CT0 A;  4IIJ E;  3UTM A;  4PNI A;  5ENR D;  3UTK A;  5JDG A;  3G2V A;  3PUS A;  2DZO A;  2AE9 A;  2JJ9 A;  4FHK A;  5JA4 D;  4QXC B;  2A5E A;  2VQF T;  2QYU A;  3FTU A;  4LMK A;  3BG0 B;  3FP3 A;  2WAU A;  3Q73 A;  4C0E A;  4ANU A;  2KZT A;  3F57 A;  5FQ8 A;  2DIW A;  3VR9 A;  1Y01 A;  4F1P A;  2V7I A;  3ZU7 B;  3RU0 A;  4G11 A;  4HB5 A;  5BV0 A;  3BU8 A;  2I6H A;  4O4L E;  3B13 A;  3E08 A;  1N95 A;  4I2W A;  4OX9 T;  2EIN E;  2IEJ A;  1VDY A;  1TEZ A;  4TX5 A;  4I43 A;  3SZ7 A;  2LT3 A;  1GW6 A;  5J08 A;  4YXD A;  2PZI A;  3GW4 A;  5IUX A;  3UU5 A;  1XNR T;  1IKN D;  2J4G A;  5ABF B;  4DK5 A;  3HXD A;  4OYS A;  2HYZ A;  3ISM C;  4F1S A;  1SVX A;  2A2F X;  5HCM A;  4Q25 A;  3LYA A;  1WYB A;  2IOL A;  2MYO A;  3HIZ A;  2XPK A;  1OWP A;  4BT8 A;  2CMR A;  3CHM A;  4JHR A;  5HXR A;  2R59 A;  3TWV A;  4MKT A;  1IQR A;  4EIW A;  2H7V C;  3UT5 E;  4DR4 T;  5HAX A;  4H63 H;  4I50 E;  2WU5 A;  3ABV A;  3RIF A;  4U7I A;  3EHN A;  3SD5 A;  4P0B A;  1TR4 A;  4HRN A;  3AA7 B;  3Q7A A;  2DYR E;  4IL9 A;  3KV5 A;  5H6Q B;  3FTV A;  4N5C A;  4HOQ A;  3ZMU B;  4AKL A;  4MHC A;  1Z0P A;  4WWP A;  1XNF A;  2V8S V;  5KCM A;  3L39 A;  1QZ2 A;  4BT9 A;  2J47 A;  4AY5 A;  1E1H B;  3C51 A;  4BTA A;  4K03 A;  3K3Q C;  2XCB A;  4AI6 A;  4GYY A;  3ASN E;  4BA9 A;  2P58 C;  5CRU A;  3H3A A;  4LF8 T;  3PE4 A;  2QRX A;  3ZMS B;  1N54 A;  2ZMA A;  4G24 A;  5C3J A;  2BED A;  5LP6 E;  3ZEF B;  5AAR A;  4HOT A;  1PAQ A;  3RQU A;  3G2W A;  3TLT A;  2WXG A;  4KMO A;  1QSD A;  3ZN0 B;  4X5T A;  4ZS3 A;  3ASO E;  2IF4 A;  2KXP B;  3ABL E;  4IRU A;  3RIA A;  4EOZ B;  4L23 A;  4PJJ A;  3EUV A;  1JPL A;  4ACL A;  2VGE A;  4C0M A;  2HPJ A;  1HTJ F;  5EDS A;  4IDQ A;  3ZXP A;  3TXM A;  4XZC A;  4I55 E;  3AG3 E;  3C50 A;  4OAV B;  4GA0 A;  4JA7 A;  5D0Q D;  2BG9 E;  3CVN A;  1WLX A;  2LSK A;  3RKG A;  4DV0 T;  4XZ4 A;  3IHY A;  4O1P A;  1UUS A;  4L5G A;  3B7T A;  1HNW T;  1LD8 A;  4RG6 A;  3FUN A;  4K0U A;  2IDO B;  3AEF A;  1W0A A;  2AXD S;  5KJM A;  1UK5 A;  4I4T E;  3S7F A;  1MZC A;  3R7Q A;  2V5C A;  1S0P A;  3EIJ A;  4N3B A;  1HO8 A;  2RFA A;  4U7E B;  3EDV A;  3Q47 B;  2HN1 A;  1D1A A;  4GMJ A;  5CMW A;  4DBR A;  4BX8 A;  4X1I E;  2CFU A;  3ZN1 B;  2AWI A;  3AE8 A;  5JQG E;  2NC9 A;  2XSA A;  4CGV A;  3GN5 B;  1G3N B;  2C5K T;  4IDZ A;  3C3R A;  5DBK A;  2XM1 A;  3OXF A;  3RKO A;  1S35 A;  4LFC T;  2DWZ A;  2UXD T;  1ZOY A;  1KFY A;  2Y8D A;  2L9B A;  3PJA J;  4HWC A;  2CFZ A;  3OBV E;  2CRB A;  5LFA A;  4ABN A;  1V55 E;  2P9P G;  2JQH A;  3Q5X A;  2LJL A;  4B3S T;  4EB6 E;  3P4P A;  5FKY A;  5DQW A;  1O1R A;  2E8I A;  3IA3 A;  2D2S A;  3F6Q A;  2VUR A;  5T8I A;  1H2U A;  3DBS A;  4ILG A;  2BDE A;  2WXI A;  4HWD A;  3OAW A;  3LKU A;  3P50 A;  1E8Y A;  1ZU2 A;  3D9K A;  5AQB A;  4FJO A;  4H9S E;  2IFU A;  2J07 A;  3TLW A;  3CVV A;  4GZ6 A;  4UWH A;  4ADZ A;  4GPM A;  2M67 A;  4IE4 A;  3QNU A;  3SQV A;  1QNF A;  4IN3 B;  1IHB A;  4HBD A;  1W09 A;  1WG0 A;  2G0U A;  4KX6 A;  4GK5 E;  5ENN A;  1Z3X A;  2ZM8 A;  3KD7 A;  4C9B B;  3EUH A;  5L4H A;  3UQ4 A;  3TWQ A;  4APO A;  1NEK A;  4DV2 T;  3CVQ A;  4ACK A;  3ZXS A;  5EX3 A;  3ASG A;  4HOS A;  3B57 A;  3VKH A;  3SO8 A;  3ZT5 A;  5LMN T;  4P0A A;  2X51 A;  2ACX A;  4AVX A;  3Q49 B;  2D0T A;  2YU2 A;  3APD A;  5ARG A;  1N32 T;  5LHH B;  3CHO A;  4O2A E;  5EN5 D;  4TV8 E;  4Z90 A;  5JJ6 A;  1SA4 A;  4U95 D;  4FP7 A;  4UWG A;  3AAA C;  3I9W A;  4LF9 T;  3LPZ A;  3Q9U C;  3O4Z A;  2PFV A;  3AG4 E;  4W9R A;  1HR0 T;  2WXH A;  3SFZ A;  4DR3 T;  2KWH A;  2F37 A;  5E75 A;  3LJC A;  3C72 A;  2HR2 A;  2E5L T;  2GRL A;  3DSU A;  3U66 A;  1YYH A;  5F8P A;  3S7B A;  4FU3 A;  1QLB A;  4HGA A;  4M3O A;  2XEH A;  1XNQ T;  4NAC A;  1KPS B;  4BEP A;  2NSZ A;  4JA9 A;  2R03 A;  4UIG A;  5EID A;  1KZO A;  4AIF A;  3C98 B;  3AEE A;  3OYZ A;  5GON E;  4HWH A;  5C8Y E;  5FWQ A;  5BPP A;  4FUL A;  3JAE A;  1MQS A;  4HOU A;  2WDQ A;  2KM4 A;  4G8K A;  4GYR A;  3DEP A;  2V6Y A;  4ILB A;  1JNZ A;  2B0O E;  3E22 E;  4OFZ A;  1FVH A;  2H6G A;  2XEV A;  1ELK A;  1E8W A;  1J5W A;  1UW4 B;  5J2T E;  4GTV A;  1OED C;  4PDX A;  4XAX B;  3V30 A;  5IWA T;  2CWY A;  2X6J A;  3FZF B;  2VGY A;  5B1B E;  5LHI B;  2LHN A;  2CHW A;  2EHO D;  2X6F A;  2EIK E;  3ESL A;  4V3I A;  4KHZ F;  1H7C A;  4I17 A;  1Z6T A;  4N3C A;  4DUI A;  4UR9 A;  4CEM A;  1UX5 A;  3ZT6 A;  3UXG A;  1VCS A;  4TWF A;  5A23 A;  5IYZ E;  2AJA A;  4DVD A;  3UU3 A;  2BKK B;  2VKH A;  4ZI3 C;  5FXX A;  3RRC A;  1OT8 A;  3APC A;  1LD7 A;  2VAS A;  1US7 B;  2QZA A;  2VSO E;  4PK4 A;  2I0M A;  4U74 A;  5HCJ A;  2NYJ A;  4HOR A;  5CED B;  3DTO A;  3PS6 A;  4YY3 T;  4NIK A;  4GPK A;  4XIF A;  2A72 A;  3V5S A;  5BXO A;  3OTO T;  2PL2 A;  3Q5M A;  4UV8 B;  5LHG B;  5LYJ E;  1OED B;  4EYY R;  2WXR A;  3AXJ B;  4YTM A;  1LF8 A;  2EIL E;  2XGM A;  3CKC A;  2HPL A;  3HYM B;  3Q2M A;  1TN6 A;  5LBQ B;  5LOZ A;  2C5J A;  1I94 T;  3LBX B;  5ENS D;  1IYG A;  5ANL A;  1IXV A;  4GTT A;  4O60 A;  2CBJ A;  4KP3 C;  3ZSS A;  4EV6 A;  3PUK A;  4I0U A;  5B1A E;  5AQ7 A;  3AS8 A;  1O1T A;  4DX2 A;  4QWN B;  5LMU T;  3SFY A;  2RA1 A;  4ANJ A;  4JEH A;  4YFS A;  3UM1 A;  3ZC0 A;  1MNE A;  3CIR A;  2VSN A;  1SQM A;  5JRC A;  3CSF A;  2V5D A;  5ABG A;  3K9I A;  3RPU A;  3IHV A;  4DRX E;  4UWK A;  2B6C A;  4JI8 T;  3SFD A;  5L3E B;  3T1Y T;  3LFM A;  2LRL A;  3X1D A;  5HYA A;  3IF8 B;  4UEL A;  2I1J A;  5G2N A;  3ETV A;  2IU1 A;  1OCZ E;  2Q7F A;  3UIP C;  4J8E A;  1ELW A;  1XMQ T;  3RIU A;  3ZJ2 A;  5FQ6 A;  4ZI3 D;  3LY9 A;  1YXR A;  4J0U A;  1D9S A;  2XUE A;  2LO6 A;  4EED A;  2L0T B;  2WPV A;  2XQ4 A;  4NRH B;  1OED E;  2XAQ B;  3AE2 A;  2X67 A;  3FXD B;  1TNY A;  3W9F A;  4G25 A;  2K9A A;  2NWB A;  4DI3 A;  5EYP F;  2Y48 B;  4JI7 T;  4YT0 A;  4AEZ C;  2HO1 A;  3JCK C;  4CXY A;  2AXU A;  4EEB A;  4YTN A;  3I4G A;  4UQX A;  3ONL C;  3AJI A;  1BD8 A;  1Y8M A;  5JHA A;  3IEG A;  2X0Y A;  1O3X A;  1N4P A;  2FBN A;  3HXF A;  2CHO A;  2GK9 A;  3WG7 E;  4I6E A;  3VU7 H;  1ELR A;  2XEN A;  4Z68 A;  3ONL A;  1NZN A;  4A1G A;  4WND A;  4LML A;  2UU9 T;  3CVL A;  3CVW A;  1JWG A;  1TN8 A;  5JR9 A;  1OWA A;  3K8P C;  2GRN B;  3U9W A;  4CDR A;  1UX4 A;  3QKY A;  3RQW A;  4WWN A;  3S7D A;  1D0Y A;  4F7A A;  4JC8 A;  3NOG D;  1E7V A;  4I9E A;  3OXL A;  4F8H A;  2ZM0 A;  5CGM A;  4DR6 T;  4HLL A;  3UT8 A;  3ULY A;  2CLY B;  1X9B A;  5LG4 A;  2ZU6 B;  1SW6 A;  2F8X K;  4EYU A;  3QC9 A;  2JRK A;  4IE6 A;  5FP3 A;  5CCM A;  4JI0 T;  2CXD A;  1IBL T;  3BK9 A;  2I2O A;  4LF6 T;  3TWR A;  3T1H T;  3MXZ A;  4F6R C;  3C3O A;  2WU2 A;  3F31 A;  4L9I A;  2B1E A;  5JRE A;  5LGT B;  1BPO A;  3KDS E;  3LG7 A;  3ZFW A;  4Z91 A;  3ABK E;  3UFE A;  4N3A A;  1E8Z A;  3AAE B;  2P2C P;  5CBN A;  4IDN A;  3PUZ F;  3NQP A;  5CBO A;  2BBH A;  2RPA A;  2ETC A;  3FZM B;  3ZYQ A;  5ABF A;  4DV1 T;  3NZP A;  1L5J A;  2D9D A;  4CZ2 D;  2QC9 A;  2V6Y B;  3KV4 A;  3JCF A;  3B5M A;  4YSY A;  2LNI A;  3N71 A;  3W15 B;  4LRZ A;  4GTP A;  4TXR A;  4L0R A;  3CQX C;  2FUP A;  2KCK A;  4HFD A;  4ZI2 C;  4JEU A;  4GZD A;  4UVB B;  4UQY A;  1K8K G;  1JCQ A;  2KBX A;  2LRK A;  2ZXW E;  3IXE A;  3RO3 A;  4MLK A;  2OA5 A;  2FJB A;  5A7D B;  1CUN A;  2BZB A;  2DZN A;  4HI8 A;  3U78 A;  3EDT B;  4HRL A;  2BS3 A;  1PY1 A;  3FWV A;  3VTX A;  2UUB T;  3O48 A;  4YND A;  5EKQ D;  3EHR A;  5LGU B;  4WWO A;  4CT4 A;  5G55 A;  5BV1 A;  1LVK A;  2BG9 B;  3GMI A;  3BQI A;  3PV0 F;  1WFD A;  4FA6 A;  3P7I A;  2DHR A;  2QGS A;  2JQQ A;  5FQ7 A;  3EAB A;  5FXV A;  4U63 A;  4Y6W A;  2MYS A;  2YOE A;  3FHE A;  2FJD A;  4HWF A;  1N11 A;  2FJA A;  3X2Q E;  3S4U A;  3FUE A;  3JAD A;  2OND A;  5ETW A;  5A1L A;  2VGX B;  3MAC A;  1A5E A;  3NRX A;  5FY1 A;  3FTZ A;  4UI9 K;  5AFU L;  3M3Z B;  3ZKJ A;  3CVP A;  3RYC E;  4DR2 T;  4N2Q A;  1O1S A;  4Y6C A;  4YDY A;  4DR1 T;  2PBI A;  4G1T A;  2VB6 A;  5FJY A;  5DIZ A;  3ZKR A;  2BVL A;  4MS6 A;  4TN7 B;  3KFW X;  4MFR A;  5T3R A;  3ZMV B;  4AXH A;  3EDU A;  4LF5 T;  3APF A;  4YVQ C;  2LAI A;  2RG8 A;  2BUG A;  5FTP A;  3TWS A;  4K5C A;  3NWI A;  2W2U A;  1QYM A;  4YTP A;  3RYH E;  3DP7 A;  3EHZ A;  1X81 A;  4GIW A;  1YQ3 A;  2P9S G;  3TXN A;  3FUJ A;  3DPD A;  2WXQ A;  4UI9 C;  4PS3 A;  5C2Y A;  3RKV A;  1VCT A;  1YA0 A;  1FEW A;  4DO0 A;  3J9X 1;  1AWC B;  5TAO A;  1H2T C;  2CXL A;  3UKR G;  1DCQ A;  2E9X A;  3ZNG A;  4LF7 T;  4NPP A;  5CCL A;  4LCT A;  4ILH B;  1IAP A;  3P4Q A;  2IO3 C;  2WDV A;  5HEG A;  3ONK A;  3HKD E;  4PK6 A;  3LK3 B;  2LHR A;  3ZN3 A;  4U3C A;  3RRN B;  1UOH A;  4J6I A;  5AYW D;  3EHQ A;  3DSS A;  5BUZ A;  3MA9 A;  5ENO D;  4H7X A;  2V7J A;  3QUJ A;  2CLY C;  3RH3 A;  3QOF A;  3P4W A;  1YQ4 A;  1ZP0 A;  3TWW A;  2OVB A;  3RC3 A;  1GQE A;  2ILR A;  3QOU A;  4U8V D;  4KT6 B;  2MRI A;  2PJQ A;  5ANR A;  4JZY A;  3L6A A;  4L1B A;  3UUB A;  4AOF A;  4L9P A;  2QY7 A;  3B7U X;  3V2X A;  5AQK B;  3DXM G;  3FTS A;  2ZM2 A;  1HG2 A;  4GTQ A;  5LCW J;  2WP9 A;  2DL1 A;  2X9W A;  4HWI B;  3V79 K;  2XM2 A;  3Q5E A;  2WB2 A;  4P1N A;  3PUY F;  3ZPO A;  1XDO A;  3P4S A;  4GZ3 A;  2DLR A;  1DU2 A;  2JLB A;  2KSR A;  4X1Y E;  2BKP A;  5CA1 E;  1JCR A;  2XAF B;  4TXP A;  3ZC1 A;  2FI7 A;  2MOZ A;  5AQR B;  5HWX A;  5HI7 A;  3FHN A;  1ZV4 X;  5CHE E;  4AIU A;  2HHH T;  3KSL A;  4UF0 B;  1FPP A;  4G26 A;  4QX7 B;  4EHM A;  1I6Z A;  1E7U A;  5BT1 A;  1G73 A;  3MKD A;  2YK0 A;  4AKI A;  2WXK A;  3R6N A;  2CE7 A;  2BS4 A;  3NBX X;  4JI1 T;  4N39 A;  5J0Z A;  2UY1 A;  3CKB A;  1W9R A;  3TL5 A;  3K1S A;  5LX8 A;  1K1A A;  3SFE A;  4KHP T;  2Q9Q B;  3O4X E;  5T4Y A;  2J4D A;  3UM0 A;  2XPI A;  5JDF A;  2IOS A;  3CK7 A;  2X68 A;  3FU6 A;  2C0M A;  3KVB A;  4ILA A;  1SZA A;  5L3B B;  5LG3 A;  2RP4 A;  4ZZB A;  2CEA A;  4DV3 T;  4IHJ E;  2A9U A;  3KEA A;  2W67 A;  5JHB A;  3LDQ B;  4L7T A;  3ZST A;  4GU5 A;  4TUU A;  3PRZ A;  5AQQ B;  5EX0 A;  1EZ3 A;  3ASD A;  2W66 A;  2J49 A;  1U3C A;  4U31 A;  1G8X A;  2VK9 A;  5KNH D;  2WMN A;  3C98 A;  2CPT A;  3AA0 B;  3C4W A;  5L3D B;  3U3W A;  4EZ4 A;  2KXP C;  4ATG A;  4B8A A;  1M7K A;  3WAK A;  4NQ0 A;  1KNR A;  4LNB A;  4I1M A;  1TJC A;  1N94 A;  1Z5S C;  5HXS A;  3ZCJ A;  3GZS A;  1D0Z A;  1T72 A;  5EZY E;  4ZXL A;  2RFM A;  2IQC A;  4LUN U;  5C1D A;  4TUY E;  5HXC A;  3VLE A;  4I43 B;  4PJN A;  2J08 A;  5AIJ A;  3UX4 A;  4DX5 D;  4IE5 A;  4DBQ A;  5KJN A;  1FT1 A;  4HFE A;  3JXI A;  3ZPJ A;  3SBT B;  3ZMT B;  4X62 T;  3Q15 A;  2YDS A;  4P09 A;  2Y0B G;  3VLD A;  3C4X A;  4U07 A;  5A6C A;  5DJQ C;  3AE9 A;  4EEC A;  3HG0 D;  4GCO A;  4BET A;  2VKJ A;  1E2A A;  5AQF B;  2MHK A;  5H7P A;  2L8K A;  3O1H A;  5IHY A;  3TG5 A;  2KLQ A;  2W00 A;  3TKL B;  1INZ A;  3FY4 A;  4ZZC A;  2YDQ A;  4WZX A;  3RIU C;  1NL4 A;  1FJG T;  4XKC A;  2LUH A;  3HA4 A;  2JMH A;  2CHX A;  2VTB B;  3PEU B;  1EPU A;  4KYO B;  1BI7 B;  3CK6 A;  3N9O A;  3VLF A;  2YHC A;  2CWO A;  4CI2 B;  2BTD A;  2E2A A;  4H7Y A;  4PFO A;  5FY7 A;  3K3N A;  5ABE A;  4LER A;  3NAW A;  4X1K E;  5BXU A;  1OWO A;  2EIM E;  4GTO A;  3B7R L;  2GRO B;  4J8D A;  1MMD A;  1HG5 A;  2OV9 A;  3MJX A;  3FTX A;  4CN6 A;  3UQ3 A;  2OOE A;  1BR0 A;  3HXB A;  5EIB E;  3A8Y C;  2GRR B;  2DI4 A;  3MX3 A;  2MTQ A;  3UT7 A;  1YW0 A;  5KXJ A;  4FLB A;  4H9N C;  4I6J A;  3ABM E;  3E34 A;  4A3T A;  2IC9 A;  1HH8 A;  4H9P C;  4A56 A;  2X6H A;  4UXN B;  3I9Y A;  1NFI E;  2WSS V;  4N2S A;  4OAU C;  2WWV A;  3NF1 A;  4TWD A;  4JW1 A;  2VVN A;  3MJW A;  2Y4U A;  4B94 A;  3VTY A;  3CHR A;  3RAU A;  3TLV A;  3PNT B;  4IYP A;  4ME2 A;  3Q75 A;  4ATZ D;  1EF1 C;  4JB8 P;  4TUM A;  2WQ7 A;  4GK0 E;  4U33 A;  5CER B;  2XQ3 A;  3MKR A;  1N4Q A;  1BLX B;  5CB4 E;  3ZMZ B;  2Q9Q D;  4UVA B;  2XRY A;  3BG1 B;  4LEU A;  3V31 A;  2K48 A;  4IT4 A;  3VRA A;  5JDH A;  1HNZ T;  4YDO A;  4ZHB A;  2L0I A;  1B89 A;  4LSZ E;  4JD2 G;  2LSU A;  3S7J A;  1KNP A;  3ML9 A;  4WNG A;  3GWH A;  4A3V A;  2X3M A;  3WI3 A;  2XQA A;  1S63 A;  4YDW A;  1NP7 A;  1J5E T;  4FAD A;  2UUC T;  4ZHQ E;  4U96 D;  3PRE A;  3LXU X;  1KK7 A;  5JJT A;  2VVS A;  2XY8 B;  3PDY A;  2XS8 A;  2CM0 A;  4CDN A;  3R84 B;  2YNQ A;  3D9I A;  5AQM B;  1M62 A;  3IV0 A;  3RC8 A;  2N9D A;  2K5B B;  3NZS A;  1E96 B;  3CEQ A;  4JHK A;  3I3N A;  1IJ6 A;  1D8D A;  4PAG A;  2BKN A;  3PU8 A;  4GAA A;  4FLH A;  3PZ3 A;  4DUZ T;  4HKA A;  3L16 A;  1TYQ G;  4E6H A;  3I0Q A;  4O1O A;  3PUJ A;  3L54 A;  3P4R A;  3LK4 2;  2GRM A;  5CMY A;  2YN6 A;  5FZS A;  4COF A;  3I0O A;  2XHE A;  1HFA A;  5CEA A;  2WWU A;  5JTG A;  4G8L A;  2CCQ A;  4TZ4 C;  3QB2 A;  4JI2 T;  3G2T A;  3RLF F;  1IBK T;  4QHO A;  2MOW A;  4BAY B;  2VGX A;  3H3M A;  2LSJ A;  4IST A;  2XQ9 A;  2KND A;  2H6F A;  3NKZ A;  5C2T A;  2EHO C;  4ZOL E;  3FU5 A;  5HS0 A;  2DBA A;  4OYJ A;  1DCE A;  1UN8 A;  3D9M A;  3PUX F;  4GA1 A;  3N9Q A;  4AQF A;  2LE8 A;  1FIO A;  3PJA A;  3MGB A;  4U04 A;  1Q2Z A;  3LCA A;  3J7Y q;  2EHO A;  4J2C A;  4B3T T;  2H3R A;  4X66 T;  1VRB A;  2FBW A;  3DXK G;  3QB5 K;  3UUL A;  3JXJ A;  2XTL A;  4F6R D;  4TNW A;  4JEH B;  4KVO A;  4N78 D;  1HF8 A;  3BQL A;  2V4H C;  4WNE A;  4HN9 A;  2YU1 A;  2A5U A;  2OLT A;  2WS3 A;  3VRB A;  1ZHC A;  3ANW A;  4JPS A;  2V1D B;  2XCC A;  3V5U A;  1DNP A;  1W3B A;  1DC2 A;  2WXO A;  2YDR A;  3BUA A;  5LXT E;  3EHM A;  3TWU A;  3FFL A;  4EPZ A;  4U0U A;  3UQ7 A;  4ANX A;  1D1C A;  1K1B A;  3QWV A;  3P2B A;  4EZJ A;  4HFV A;  1TNZ A;  3DST A;  2FEZ A;  2L3L A;  4KZC A;  2FF4 A; 
#chains in the Genus database with same CATH homology
 4I9C A;  2V0P A;  4CRW A;  4XI0 A;  4DND A;  4O2B E;  4BY6 A;  1D0X A;  2UXN B;  2IW5 B;  3OJA A;  3FH8 A;  3PE3 A;  4ILI A;  5JH7 E;  2DWG A;  4G2A A;  3EJN A;  4HS2 A;  3N9P A;  3MCX A;  2I59 A;  3ZHE B;  4KVM A;  5E76 A;  4HLE A;  5CA0 E;  1QUU A;  5G04 J;  2CG3 A;  2YHE A;  1KLX A;  2A4Z A;  3FH7 A;  5DAB A;  3PDN A;  2VJ8 A;  3AA6 B;  1UJK A;  4HEA A;  4H9Q C;  2KT9 A;  5L3F B;  3QWW A;  2CG2 A;  1KT1 A;  4BJN A;  1WYC A;  3HDX A;  1YD8 G;  4EZL A;  3RK6 A;  5JDQ A;  4JVS A;  3KBU A;  5F3J A;  4GML A;  5EK2 A;  4BSX A;  2EQX A;  1OWN A;  4BTB A;  3AAA B;  1QQE A;  3FB2 A;  3FEY A;  4UF0 A;  4YVO A;  1A17 A;  2QFC A;  4CI3 B;  3LS8 A;  3L22 A;  3RX6 A;  3JQ1 A;  3FUL A;  1MMG A;  3Q5W A;  4ASK A;  1XGW A;  4O6F A;  2KAT A;  3SS1 A;  4AJW A;  2X0L B;  5J90 A;  2WXF A;  4DLQ A;  3F2E A;  2W0G A;  2W61 A;  2JEK A;  3JUI A;  2CA5 A;  3GN5 A;  3ML8 A;  3QDN A;  3UT4 A;  5L2L A;  4U72 A;  2J09 A;  1B7T A;  1UCU A;  3KV9 A;  4FHJ A;  3ZVV A;  1DVP A;  4OK0 A;  4GB9 A;  2X9H A;  3SGH A;  4Q94 A;  3CLJ A;  2Y3A A;  2HM8 A;  4HFG A;  5LBM A;  2XHE B;  3HL6 A;  3L09 A;  2FUL A;  3UPV A;  2ODU A;  3FUF A;  3LVQ E;  4ANV A;  3L3P A;  1E90 A;  4FJZ A;  2YEV C;  2VSX E;  5FZQ A;  2VTB A;  3FBL A;  3B7S A;  4TV3 A;  4E7S A;  4OVV A;  1FMW A;  1SA0 E;  1LVF A;  1IQU A;  3LVR E;  4PJL A;  3RRW A;  4A1S A;  3QC1 A;  1HCI A;  4I1A A;  3FTY A;  1ZBP A;  4BX9 A;  2FO7 A;  1Z3Y A;  5J1G A;  2C2L A;  3ONX A;  3CR3 A;  4U0Z A;  2W62 A;  3RYI E;  3NZU A;  3ANW B;  2E9X B;  3O1J A;  4FI5 A;  4JHJ A;  2Z6E A;  4NUR A;  2WBL A;  4AKR B;  3N9N A;  4HVB A;  1MMN A;  2DWK A;  1IJ5 A;  4H63 V;  2XQY A;  3TGO A;  4YHJ A;  1IHG A;  1SZ9 A;  1N52 A;  1VOM A;  3K3O A;  4JEU B;  4ZS2 A;  4M1P A;  4R7L A;  5H6R B;  5FY0 A;  4H9O C;  5JR9 C;  2V5F A;  2LSI A;  4WBN E;  2IJG X;  3UUX A;  1NA3 A;  1OWL A;  4APF A;  4ANW A;  2KCL A;  5AJD A;  4YJ3 E;  3LY7 A;  3SRZ A;  3AAI A;  4AXP A;  1H2V C;  4UQZ A;  3NZQ A;  3FH5 A;  3H37 A;  3JYS A;  4HE8 A;  2ES0 A;  2VKO A;  2DCP A;  3SOL A;  2R17 C;  2KIN B;  3CWZ B;  2HH7 A;  1OUV A;  4G63 A;  4MLP A;  3GYZ A;  2C5I T;  4I2Z A;  2UWJ G;  5HXE A;  4UI9 J;  5ADX L;  4HTE A;  4B8C B;  3JC6 D;  4AV7 A;  3PE0 A;  1BR4 A;  4IGU A;  4AKH A;  4NUU A;  3O1I A;  3RYF E;  2VWA A;  3N5L A;  5EK4 A;  1KNZ A;  1V9D A;  2KMF A;  3FUI A;  4OVU A;  4K0R A;  2JPF A;  3HKB E;  1X5B A;  2VQ2 A;  3IHR A;  1EYH A;  3CX8 B;  3D9P A;  3Q9D A;  5LOV E;  3KEZ A;  3CKD A;  3ZYL A;  3VKG A;  4KUM B;  4RSY A;  5FT9 A;  3CQG B;  4CDM A;  3FUK A;  2AXZ A;  3AU5 A;  2X6I A;  5JVD E;  2L6J A;  3URZ A;  1EDU A;  3CGH A;  4WBO A;  2BVM A;  2ION A;  2WM9 A;  2AVP A;  1OXZ A;  3C4Z A;  3CVR A;  4YJ2 E;  2M63 A;  3GA8 A;  3ESK A;  3UMV A;  3PVL A;  4CCA A;  5KJL A;  3PEV B;  4XKB A;  1MMA A;  2Y4T A;  4IE0 A;  3T5V A;  1NWM X;  3UUX B;  2WXP A;  4AP2 A;  4DMV A;  2C0S A;  4OYK A;  5KMG P;  2L9Q A;  4XI9 A;  2WXM A;  3QAR A;  5BNW A;  1T98 A;  1HZ4 A;  2LOS A;  3JC6 C;  2WXJ A;  3IBP A;  4O4J E;  4WNK A;  3P1U A;  3FU0 A;  2V26 A;  3WAJ A;  4EBA G;  4CXX A;  2YQ8 A;  4UWF A;  3U64 A;  3FUH A;  3ZEF A;  3PU3 A;  4GZ5 A;  3RJV A;  3IEE A;  5FMN A;  2V7L A;  3N2O A;  4DLO A;  3DJB A;  4EAH A;  3EVY A;  2NTX A;  1WRD A;  4F3V A;  4I6G A;  1H6K A;  1HE8 A;  4BJM A;  1MHQ A;  4J8S A;  4PW8 A;  3HHM A;  4UWL A;  5LJM A;  2I9C A;  2KCV A;  3N2G E;  4F53 A;  4PUC A;  1H19 A;  3MV3 B;  2V8S E;  2IC6 A;  3CVX A;  4AM9 A;  4O4H E;  4CQI A;  3BEE A;  2A3D A;  5E0O A;  3ASH A;  2LSG A;  2XPY A;  3AVR A;  4WAF A;  3AA1 B;  3PUQ A;  3FBZ A;  5LNK A;  2NW9 A;  3HR0 A;  3O9X A;  3MEK A;  4GOU A;  5JRC B;  2E9X C;  5AEN A;  3P8C D;  1TJF A;  3HI2 A;  3PUA A;  3LEW A;  2SPC A;  1UJJ A;  2VSY A;  3D9J A;  3KBT A;  3OXG A;  3N9M A;  4DI4 A;  4WW0 A;  3FU3 A;  5JDL A;  2XRZ A;  4EBA A;  2NW7 A;  3SWH A;  2DNX A;  2KZ7 B;  1Y64 B;  3S2A A;  4GZC A;  3D3M A;  1U5P A;  1HU3 A;  4ILU A;  3CML A;  5JDN A;  4XX5 A;  5FXW A;  4CGW A;  3ZJ1 A;  4BWR A;  1MIV A;  2J1D G;  1WR6 A;  4AKG A;  2N2N A;  3ZCI A;  2D5U A;  3L08 A;  2XAJ B;  2X66 A;  3PZD A;  4URK A;  5ARF A;  1P5Q A;  2NOX A;  2E9X D;  4I1O B;  3I5P A;  4KBQ A;  3NRY A;  2WXL A;  3GZ2 A;  2PQN A;  1PC2 A;  1WAO 1;  4HXI A;  4MBQ A;  2GGF A;  3CK9 A;  4DMW A;  5LJN A;  2WQH A;  5FZR A;  1JUQ A;  3N2K E;  1WY6 A;  3L17 A;  2QA7 A;  3AS5 A;  2RD0 A;  1FCH A;  3JQ0 A;  3FTW A;  2XAG B;  3SI5 A;  3RO2 A;  4H9R C;  3UUN A;  3AS4 A;  3R9A B;  3EIQ C;  4QXH B;  2Q9Q A;  2JMK A;  3HKC E;  2LSY A;  2V7M A;  5G05 J;  2AXV A;  2UY1 B;  2XPZ A;  5JJ7 A;  2LM9 A;  1Y6I A;  3T5X A;  2X9X A;  2YIN A;  4FJY A;  4G2V A;  1SHZ C;  2XQ0 A;  1LRZ A;  2KZT B;  3OTN A;  5J2U E;  2LSV A;  3L13 A;  3MZL B;  4L2L A;  3SHF A;  4X20 E;  2OVF A;  3HVE A;  4DPR A;  4YLH A;  3MKQ B;  3IKO B;  5M72 A;  4JL0 A;  2IAK A;  1HX8 A;  2NXP A;  4MRU A;  3D9O A;  4PS8 A;  1U3D A;  3Q4A B;  3IBE A;  3PH0 C;  2EHO B;  4GYS A;  4O4I E;  5M4Y A;  2PQR A;  4J8F A;  2WVI A;  5L3G B;  4GCN A;  3LY8 A;  5BW8 C;  4E85 A;  4CI1 B;  3T8O A;  3ZYM A;  5KJK A;  3G2U A;  2OV8 A;  3MKQ A;  2XGS A;  3QK6 A;  2ODV A;  1BR2 A;  4QFV A;  5KX5 E;  2KWI B;  5LCW C;  2X38 A;  4GA2 A;  2NW8 A;  3R7R A;  5JDM A;  3QAQ A;  3TAX A;  4CZZ B;  1NA0 A;  3CK8 A;  1H0A A;  4ZI2 D;  5G05 C;  4CXW A;  2P9B A;  3TJP A;  3LJ3 A;  4KBM B;  3LBX A;  2N1G A;  4UVC B;  4Q96 A;  5HXH A;  4ERR A;  2XGO A;  3KV6 A;  3QK0 A;  4P29 A;  3CST A;  5HWY A;  4DJA A;  4Q69 A;  4PH4 B;  3OKQ A;  2X6K A;  4JUY A;  3CHS A;  3KS2 A;  3FXE B;  3ZW3 A;  3G2S A;  2I1K A;  3UUM A;  2VKD A;  2CHZ A;  3CX6 B;  4A55 A;  2V4L A;  3MZK B;  5FXZ A;  4V1A v;  3D0T A;  3FEX A;  5D0O D;  3E0Z A;  3KVA A;  3KIN B;  3ZHE A;  1NAF A;  3FUD A;  2J9Q A;  4QKN A;  2WQ6 A;  3ZIM A;  3HVE B;  2KC7 A;  3BQK A;  3T8M A;  3ZYK A;  4EZH A;  2W63 A;  2PM6 A;  4G23 A;  3D9N A;  2VYI A;  4B6X A;  3MYV A;  4TRQ A;  4GYW A;  3PNL B;  1S94 A;  1UG3 A;  3LK2 B;  3OYX A;  3ETU A;  2Y6X A;  2ZLY A;  1HXI A;  2R5S A;  5HQ8 A;  5G04 C;  4B89 A;  1OWM A;  5L3C B;  3SNX A;  2V7K A;  2LAH A;  2PG8 A;  3CQC B;  2DCF A;  4JXT A;  3D9L A;  1ZEE A;  4RVB A;  1X79 A;  4UEM A;  5LP0 A;  3QJZ A;  1HS6 A;  2PM7 A;  2LEH A;  2LOP A;  1WM5 A;  2K24 A;  1IZN B;  4PJM A;  3AB3 B;  5EK3 A;  5LCY A;  4EZK A;  1YKH B;  1AJ3 A;  4D10 C;  2X9Y A;  1MIY A;  3MK7 C;  5AJL A;  1D1B A;  4OHF A;  4NUV A;  3A5X A;  1E8X A;  3ASF A;  4U0S A;  2BF0 X;  3KAE A;  3AU4 A;  4E7Z A;  3FUM A;  3M65 A;  1FMV A;  4RG9 A;  4KMC A;  3LDZ A;  4FC8 A;  3PUR A;  2E2E A;  3PUG A;  4PK5 A;  2CXF A;  4L2Y A;  4GYO A;  3CHQ A;  4Z8X A;  3QNK A;  3U3I A;  3MA5 A;  3HKE E;  2GW1 A;  4ZI7 E;  3AVS A;  3CV0 A;  4WUY A;  4TV9 E;  2XAS B;  3TG4 A;  3E4B A;  2J4B A;  3ULQ A;  4B0Z A;  5JR9 B;  2UXX B;  1YKE B;  4EQF A;  2XAH B;  3RIB A;  4C90 A;  4KZ0 A;  1JWF A;  2Q9Q C;  3ZLI A;  3WXX A;  4BFR A;  3SF4 A;  3SBS A;  3FDH A;  3CHP A;  5KDM C;  2C0L A;  4KXK B;  3QWP A;  4QX8 B;  4AQF C;  4IE7 A;  4MAL A;  3U4T A;  2WMO A;  4U8H A;  1U4Q A;  1FVF A;  3ENE A;  4AQG A;  4ISS A;  4AY6 A;  4C91 A;  3N9L A;  3CPZ A;  2E0I A;  3MV2 B;  1KT0 A;  4XBF B;  1LKX A;  5LA6 E;  4IUL A;  3I1A A;  5DQV A;  2NTY A;  1ZKE A;  3RRM B;  3RRU A;  2VL8 A;  5FNV E;  4XE0 A;  5FYM A;  4PS7 A;  5LGN B;  4QXB B;  3C64 A;  1HS7 A;  2WXN A;  5FQ4 A;  4O8S A;  4EXT A;  2MBG A;  4WNF A;  3ZGQ A;  3CX7 B;  2H7O A;  1UN9 A;  2NP9 A;  2AW6 A;  3GZ1 A;  3CVU A;  4PFP A;  5BMV E;  3CVY A;  3VHL A;  2D0U A;  4UV9 B;  3CIA A;  3I4R B;  1MND A;  3PTR B;  1BR1 A;  4JLE A;  1MIW A;  3ZRH A;  4CT0 A;  4IIJ E;  4PNI A;  3UTK A;  5JDG A;  3G2V A;  3PUS A;  2JJ9 A;  4FHK A;  4QXC B;  3FTU A;  3BG0 B;  3FP3 A;  2WAU A;  4C0E A;  4ANU A;  2KZT A;  3F57 A;  5FQ8 A;  2DIW A;  2V7I A;  3RU0 A;  4G11 A;  5BV0 A;  2I6H A;  4O4L E;  3B13 A;  3E08 A;  4I2W A;  1VDY A;  1TEZ A;  4TX5 A;  4I43 A;  3SZ7 A;  2LT3 A;  1GW6 A;  5J08 A;  2PZI A;  3GW4 A;  4DK5 A;  4OYS A;  2HYZ A;  4F1S A;  2A2F X;  3LYA A;  1WYB A;  2IOL A;  3HIZ A;  1OWP A;  4BT8 A;  2CMR A;  3CHM A;  4JHR A;  5HXR A;  2R59 A;  4MKT A;  1IQR A;  4EIW A;  2H7V C;  3UT5 E;  5HAX A;  4H63 H;  4I50 E;  3EHN A;  3SD5 A;  4P0B A;  3AA7 B;  3KV5 A;  5H6Q B;  3FTV A;  4N5C A;  4HOQ A;  3ZMU B;  4AKL A;  4MHC A;  1Z0P A;  4WWP A;  1XNF A;  5KCM A;  1QZ2 A;  4BT9 A;  4AY5 A;  1E1H B;  3C51 A;  4BTA A;  4K03 A;  3K3Q C;  2XCB A;  4AI6 A;  4GYY A;  4BA9 A;  2P58 C;  3H3A A;  3PE4 A;  3ZMS B;  1N54 A;  2ZMA A;  4G24 A;  5LP6 E;  3ZEF B;  4HOT A;  1PAQ A;  3G2W A;  2WXG A;  4KMO A;  1QSD A;  3ZN0 B;  4ZS3 A;  2IF4 A;  2KXP B;  4IRU A;  4EOZ B;  4L23 A;  4PJJ A;  1JPL A;  4ACL A;  4C0M A;  2HPJ A;  1HTJ F;  5EDS A;  3TXM A;  4XZC A;  4I55 E;  3C50 A;  4GA0 A;  4JA7 A;  5D0Q D;  3CVN A;  1WLX A;  2LSK A;  4XZ4 A;  3IHY A;  4L5G A;  3B7T A;  4RG6 A;  3FUN A;  4K0U A;  5KJM A;  3S7F A;  4I4T E;  3R7Q A;  1S0P A;  4N3B A;  3EIJ A;  1HO8 A;  3EDV A;  3Q47 B;  1D1A A;  4GMJ A;  5CMW A;  4DBR A;  4BX8 A;  4X1I E;  2CFU A;  3ZN1 B;  2AWI A;  5JQG E;  2NC9 A;  4CGV A;  3GN5 B;  2C5K T;  4IDZ A;  5DBK A;  3OXF A;  3RKO A;  1S35 A;  2Y8D A;  2L9B A;  2CFZ A;  3OBV E;  5LFA A;  4ABN A;  3Q5X A;  2LJL A;  4EB6 E;  5DQW A;  2E8I A;  2D2S A;  5T8I A;  1H2U A;  3DBS A;  4ILG A;  2BDE A;  2WXI A;  3OAW A;  3LKU A;  1E8Y A;  1ZU2 A;  3D9K A;  4FJO A;  4H9S E;  2IFU A;  2J07 A;  3CVV A;  4GZ6 A;  4UWH A;  4ADZ A;  2M67 A;  4IE4 A;  1QNF A;  4IN3 B;  2G0U A;  4GK5 E;  5ENN A;  1Z3X A;  2ZM8 A;  3KD7 A;  4C9B B;  3EUH A;  4APO A;  3CVQ A;  4ACK A;  3ZXS A;  5EX3 A;  3ASG A;  4HOS A;  3B57 A;  3VKH A;  4P0A A;  2X51 A;  2ACX A;  4AVX A;  3Q49 B;  2D0T A;  2YU2 A;  3APD A;  5ARG A;  5LHH B;  3CHO A;  4O2A E;  4TV8 E;  5JJ6 A;  4FP7 A;  4UWG A;  3I9W A;  3LPZ A;  3O4Z A;  2PFV A;  4W9R A;  2WXH A;  3SFZ A;  2KWH A;  5E75 A;  3LJC A;  2HR2 A;  2GRL A;  3U66 A;  5F8P A;  3S7B A;  4FU3 A;  4HGA A;  4M3O A;  4NAC A;  2NSZ A;  4JA9 A;  4UIG A;  4AIF A;  3C98 B;  3OYZ A;  5GON E;  5C8Y E;  5FWQ A;  5BPP A;  4FUL A;  1MQS A;  4HOU A;  2KM4 A;  4GYR A;  2XEV A;  3E22 E;  4OFZ A;  1FVH A;  1ELK A;  1E8W A;  1UW4 B;  5J2T E;  4PDX A;  4XAX B;  2CWY A;  2X6J A;  2VGY A;  5LHI B;  2LHN A;  2CHW A;  2EHO D;  2X6F A;  3ESL A;  4V3I A;  1H7C A;  4I17 A;  1Z6T A;  4N3C A;  4CEM A;  1UX5 A;  5A23 A;  5IYZ E;  4DVD A;  2VKH A;  4ZI3 C;  5FXX A;  3RRC A;  3APC A;  2VAS A;  1US7 B;  2VSO E;  4PK4 A;  4U74 A;  4HOR A;  3DTO A;  3PS6 A;  4GPK A;  4XIF A;  2A72 A;  3V5S A;  2PL2 A;  3Q5M A;  4UV8 B;  5LHG B;  5LYJ E;  4EYY R;  2WXR A;  1LF8 A;  3CKC A;  2XGM A;  2HPL A;  3HYM B;  3Q2M A;  5LBQ B;  5LOZ A;  2C5J A;  3LBX B;  1IYG A;  5ANL A;  4KP3 C;  3PUK A;  3AS8 A;  4QWN B;  2RA1 A;  4ANJ A;  4JEH A;  4YFS A;  3ZC0 A;  1MNE A;  2VSN A;  1SQM A;  5JRC A;  3CSF A;  3K9I A;  3RPU A;  3IHV A;  4UWK A;  5L3E B;  3LFM A;  5HYA A;  3IF8 B;  4UEL A;  2I1J A;  5G2N A;  3ETV A;  2IU1 A;  2Q7F A;  4J8E A;  1ELW A;  3ZJ2 A;  5FQ6 A;  4ZI3 D;  3LY9 A;  4J0U A;  2XUE A;  2LO6 A;  2L0T B;  2WPV A;  4NRH B;  2XAQ B;  2X67 A;  3FXD B;  4G25 A;  2K9A A;  2NWB A;  4DI3 A;  2Y48 B;  4AEZ C;  2HO1 A;  3JCK C;  4CXY A;  2AXU A;  4UQX A;  3I4G A;  1Y8M A;  5JHA A;  3IEG A;  1O3X A;  2FBN A;  2GK9 A;  4I6E A;  3VU7 H;  1ELR A;  3ONL A;  1NZN A;  4A1G A;  4WND A;  3CVL A;  3CVW A;  1JWG A;  5JR9 A;  1OWA A;  3K8P C;  3U9W A;  4CDR A;  1UX4 A;  3QKY A;  4WWN A;  3S7D A;  1D0Y A;  4F7A A;  4JC8 A;  1E7V A;  4I9E A;  3OXL A;  2ZM0 A;  3UT8 A;  2CLY B;  5LG4 A;  2ZU6 B;  4EYU A;  3QC9 A;  2JRK A;  4IE6 A;  5FP3 A;  5CCM A;  2CXD A;  2I2O A;  3BK9 A;  3MXZ A;  4F6R C;  3F31 A;  4L9I A;  2B1E A;  5JRE A;  5LGT B;  1BPO A;  3KDS E;  3LG7 A;  3ZFW A;  3UFE A;  4N3A A;  1E8Z A;  3AAE B;  3NQP A;  3ZYQ A;  3NZP A;  1L5J A;  3KV4 A;  2LNI A;  3N71 A;  3W15 B;  4LRZ A;  4L0R A;  3CQX C;  2KCK A;  4JEU A;  4ZI2 C;  4GZD A;  4UVB B;  4UQY A;  3RO3 A;  4MLK A;  2OA5 A;  5A7D B;  1CUN A;  2BZB A;  3U78 A;  3EDT B;  1PY1 A;  3FWV A;  3VTX A;  3O48 A;  4YND A;  5EKQ D;  5LGU B;  4WWO A;  4CT4 A;  5G55 A;  5BV1 A;  1LVK A;  3GMI A;  3BQI A;  4FA6 A;  3P7I A;  2DHR A;  2QGS A;  2JQQ A;  5FQ7 A;  5FXV A;  4U63 A;  4Y6W A;  2MYS A;  3FHE A;  3S4U A;  3FUE A;  2OND A;  5ETW A;  5A1L A;  2VGX B;  3MAC A;  3NRX A;  5FY1 A;  3FTZ A;  4UI9 K;  5AFU L;  3CVP A;  3RYC E;  4N2Q A;  4Y6C A;  2PBI A;  4G1T A;  2VB6 A;  5FJY A;  5DIZ A;  2BVL A;  4MS6 A;  4TN7 B;  3KFW X;  4MFR A;  5T3R A;  3ZMV B;  4AXH A;  3EDU A;  3APF A;  4YVQ C;  2LAI A;  2RG8 A;  2BUG A;  5FTP A;  3RYH E;  3DP7 A;  4GIW A;  3TXN A;  3FUJ A;  3DPD A;  2WXQ A;  4UI9 C;  4PS3 A;  5C2Y A;  3RKV A;  1YA0 A;  1FEW A;  4DO0 A;  3J9X 1;  5TAO A;  1H2T C;  2CXL A;  2E9X A;  5CCL A;  4LCT A;  4ILH B;  1IAP A;  3ONK A;  3HKD E;  4PK6 A;  3LK3 B;  2LHR A;  3ZN3 A;  3RRN B;  4J6I A;  5AYW D;  5BUZ A;  3MA9 A;  4H7X A;  2V7J A;  3QUJ A;  2CLY C;  3RH3 A;  2OVB A;  3RC3 A;  2ILR A;  3QOU A;  4KT6 B;  2MRI A;  2PJQ A;  5ANR A;  4JZY A;  3L6A A;  4L1B A;  4AOF A;  2QY7 A;  3B7U X;  3FTS A;  2ZM2 A;  1HG2 A;  5LCW J;  2X9W A;  2WB2 A;  3ZPO A;  4GZ3 A;  2DLR A;  2JLB A;  4X1Y E;  5CA1 E;  2XAF B;  3ZC1 A;  2FI7 A;  2MOZ A;  5HWX A;  5HI7 A;  3FHN A;  1ZV4 X;  5CHE E;  4UF0 B;  4G26 A;  5BT1 A;  4QX7 B;  1E7U A;  1G73 A;  3MKD A;  2YK0 A;  4AKI A;  2WXK A;  3R6N A;  2CE7 A;  3NBX X;  4N39 A;  2UY1 A;  3CKB A;  3TL5 A;  5LX8 A;  2Q9Q B;  3O4X E;  5T4Y A;  2J4D A;  2XPI A;  2IOS A;  5JDF A;  3CK7 A;  2X68 A;  3FU6 A;  2C0M A;  3KVB A;  1SZA A;  5L3B B;  2RP4 A;  2CEA A;  4IHJ E;  5JHB A;  4L7T A;  4GU5 A;  4TUU A;  3PRZ A;  5EX0 A;  1EZ3 A;  3ASD A;  2J49 A;  1U3C A;  1G8X A;  2VK9 A;  2WMN A;  3C98 A;  3AA0 B;  3C4W A;  5L3D B;  3U3W A;  4EZ4 A;  4ATG A;  4B8A A;  3WAK A;  4NQ0 A;  4I1M A;  1TJC A;  5HXS A;  3ZCJ A;  3GZS A;  1D0Z A;  5EZY E;  2IQC A;  4LUN U;  5C1D A;  4TUY E;  5HXC A;  3VLE A;  4I43 B;  4PJN A;  2J08 A;  5AIJ A;  3UX4 A;  4IE5 A;  4DBQ A;  5KJN A;  3ZPJ A;  3SBT B;  3ZMT B;  3Q15 A;  4P09 A;  3VLD A;  3C4X A;  4U07 A;  5A6C A;  5DJQ C;  4EEC A;  4GCO A;  2VKJ A;  2MHK A;  2L8K A;  3O1H A;  5IHY A;  3TG5 A;  2KLQ A;  2W00 A;  3TKL B;  1INZ A;  3FY4 A;  4XKC A;  3HA4 A;  2JMH A;  2CHX A;  2VTB B;  3PEU B;  1EPU A;  4KYO B;  3N9O A;  3VLF A;  2YHC A;  2CWO A;  4CI2 B;  2BTD A;  4H7Y A;  4PFO A;  5FY7 A;  3K3N A;  4LER A;  4X1K E;  1OWO A;  3B7R L;  4J8D A;  1MMD A;  1HG5 A;  3MJX A;  3FTX A;  3UQ3 A;  2OOE A;  1BR0 A;  2DI4 A;  3MX3 A;  2MTQ A;  3UT7 A;  1YW0 A;  4FLB A;  4H9N C;  4I6J A;  4A3T A;  2IC9 A;  1HH8 A;  4H9P C;  4A56 A;  2X6H A;  4UXN B;  3I9Y A;  2WSS V;  4N2S A;  3NF1 A;  4JW1 A;  3MJW A;  2Y4U A;  4B94 A;  3VTY A;  3CHR A;  3PNT B;  4IYP A;  4ME2 A;  1EF1 C;  2WQ7 A;  4GK0 E;  3MKR A;  5CB4 E;  3ZMZ B;  2Q9Q D;  4UVA B;  2XRY A;  3BG1 B;  4LEU A;  2K48 A;  5JDH A;  2L0I A;  1B89 A;  2LSU A;  3S7J A;  3ML9 A;  4WNG A;  3GWH A;  4A3V A;  2X3M A;  3WI3 A;  1NP7 A;  4FAD A;  4ZHQ E;  3PRE A;  3LXU X;  1KK7 A;  5JJT A;  3PDY A;  4CDN A;  2CM0 A;  3R84 B;  2YNQ A;  3D9I A;  3IV0 A;  3RC8 A;  2N9D A;  2K5B B;  3NZS A;  1E96 B;  3CEQ A;  4JHK A;  3I3N A;  1IJ6 A;  4PAG A;  3PU8 A;  4GAA A;  4FLH A;  4HKA A;  3L16 A;  4E6H A;  3I0Q A;  3PUJ A;  3L54 A;  3LK4 2;  2GRM A;  5CMY A;  5FZS A;  3I0O A;  2XHE A;  1HFA A;  2WWU A;  2CCQ A;  4TZ4 C;  3QB2 A;  3G2T A;  4QHO A;  2MOW A;  4BAY B;  2VGX A;  2LSJ A;  4IST A;  2KND A;  2EHO C;  4ZOL E;  3FU5 A;  2DBA A;  4OYJ A;  3D9M A;  1UN8 A;  4GA1 A;  3N9Q A;  4AQF A;  2LE8 A;  1FIO A;  3MGB A;  4U04 A;  3LCA A;  3J7Y q;  2EHO A;  4J2C A;  2H3R A;  1VRB A;  3UUL A;  2XTL A;  4JEH B;  4KVO A;  4N78 D;  1HF8 A;  3BQL A;  4WNE A;  4HN9 A;  2YU1 A;  2A5U A;  1ZHC A;  3ANW A;  4JPS A;  2V1D B;  2XCC A;  3V5U A;  1DNP A;  1W3B A;  2WXO A;  5LXT E;  3EHM A;  3FFL A;  4EPZ A;  4U0U A;  4ANX A;  1D1C A;  3QWV A;  3P2B A;  4EZJ A;  4HFV A;  2FEZ A;  2L3L A;  4KZC A;  2FF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...