3B13A

Crystal structure of the dhr-2 domain of dock2 in complex with rac1 (t17n mutant)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
427
Chain Sequence
b'SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis for mutual relief of the Rac guanine nucleotide exchange factor DOCK2 and its partner ELMO1 from their autoinhibited forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 139
structure length 427
sequence length 427
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b13A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3b13A01
2WMOA 2WM9A 3VHLA 2WMNA 2YINA 3B13A
chains in the Genus database with same CATH superfamily
2DL1A 2A72A 3C72A 3UINC 4HLEA 3NKZA 4WZXA 4DMVA 1FJGT 3PH0C 3Q78A 4HFGA 4FA6A 4R7LA 2WU5A 1I94T 2DWKA 3TWVA 4X5TA 4NXNT 3M3ZB 4G8KA 4EOZB 2LSVA 4AKIA 3RH3A 2QVAA 2WU2A 3FTWA 5JDGA 2P58C 4ILUA 3UKRG 1BI8B 3JAEA 5EZYE 5KNHD 2V6YA 1DCQA 2IW5B 3ZLIA 2XGSA 2JQ9A 1Z0PA 4U0SA 4A98A 2VL0A 2FULA 4APOA 1EF1C 3ZKJA 4CGWA 1OCCE 3L39A 3HVEB 2YEVC 3FDHA 3AE9A 4QKNA 4UWHA 1W3BA 3LDZA 4MS6A 3O1IA 3U4TA 3RRMB 1JNRA 3OKQA 3Q7AA 4EECA 3HG0D 1BR0A 3LVRE 5AN8A 1OCOE 3FTVA 3FY4A 4GCOA 1SHZC 4ANVA 3AVRA 1BLXB 4UQZA 4DR2T 3LVQE 4BAYB 5LHHB 3UUXA 3I4GA 4CQIA 3P1UA 5FXVA 4EZ4A 3KFWX 4JV5T 3C3QA 2DYRE 4Z91A 3BUAA 4CT0A 1UURA 1O1RA 2D2SA 3DSWA 4PK5A 1D0XA 2RA1A 3CWZB 3TLTA 3JCKC 4NXMT 2MAWA 3SY2A 5L3DB 4YSXA 4N3CA 1BU9A 1XMOT 3ZT5A 4E7SA 5T3RA 2X6JA 4YJ3E 3UFGA 3QNKA 4I1OB 3PUWF 2UY1B 2J47A 3P50A 3J9X1 3O4ZA 4A3TA 3IBPA 3EAMA 3ZT6A 2D0TA 1HX1B 3MGBA 1IBMT 2XQ6A 2XPYA 2XZEA 4XBFB 1HU3A 3WAJA 2X67A 1N4RA 3FU0A 4BJNA 2NTYA 4MALA 5JR9B 4OYJA 3ZJ2A 3UPVA 1OWNA 4GYSA 4PDXA 3RYHE 4LF9T 3UQ4A 3CLJA 1W0AA 2SPCA 3FB2A 1S94A 1Y01A 2KT9A 5CA0E 1AP7A 3HXDA 2PTFA 4PS7A 3LK3B 3VHLA 2VQET 2P2CP 4TXRA 4G26A 2QFCA 3C3RA 1UJKA 3HA4A 4CDMA 4KZ0A 5JDQA 2V7MA 1DC2A 2DWZA 4O4HE 1UUSA 2BKPA 3C5RA 2LRKA 3DRAA 2R02A 2P9NG 2VWAA 4UV8B 4CN4A 3AECA 3TLVA 3AE1A 2EILE 4ZXLA 5AARA 1W09A 4AI6A 2UXDT 3FUHA 5DQWA 5AQHB 3V5SA 3V30A 4ILBA 3OVUA 4Y6CA 3TKLB 4AEZC 4CEMA 2XRZA 5ENSD 2YN6A 3JUEA 1J5WA 4GU5A 4TN7B 4TWHA 3PDYA 3UT4A 5EYLA 2IC6A 4OFZA 5G05J 3D9OA 4LF6T 4L23A 4LMJA 1UOHA 1N11A 5JDNA 3DXKG 2MYSA 4XKBA 4EPZA 3T8OA 1SW6A 2XQ5A 3UULA 2P9UG 3ZMTB 4UR9A 1MNEA 5FY1A 2WMNA 2WB2A 1X5BA 4KBQA 1DU2A 2KXPB 5AENA 5H7PA 3APCA 1GQEA 1ZV4X 2XQ8A 4I50E 3W9FA 3B7UX 1UX4A 2XZTG 4HFDA 2X9YA 2CFZA 2KC7A 1WR6A 2IQCA 3CVYA 3SI5A 2ZM2A 4YTPA 3PUGA 2QGSA 5FZSA 2LNIA 1KK7A 4JUYA 2FUPA 1LF8A 4EQFA 2KMFA 2CHXA 3V31A 1AWCB 3EHMA 4C90A 2C5JA 3AXJA 2KWHA 3CHOA 4AOFA 5LBQB 3CHRA 3ZPOA 4J8YA 3UU5A 4U8VD 3TWUA 3QUJA 2WXNA 1X79A 2KATA 3ENEA 2ZU6B 4GTSA 4B0ZA 5FKYA 3LCAA 2JQQA 3VRAA 3AEAA 3NZPA 5FY7A 3CVNA 2WXKA 3RRWA 2XM2A 3SF4A 5AQPB 1LD8A 5LCWC 3ISMC 3Q5EA 2J08A 3KV4A 3NRYA 4DI4A 5IWAT 3VR9A 2VKJA 3F57A 4KVOA 5KJMA 2KCVA 1L5JA 4NRHB 1FMWA 4LEUA 5JJ7A 3ZN3A 2XRYA 4L7TA 4LNUD 5EIDA 2YU1A 1TN8A 3CHSA 5ARGA 4JXTA 3CSTA 2FBWA 3PUQA 1NI1A 2KINB 5FL1A 3WG7E 2UXNB 2WXHA 2BKGA 2E9XB 5FYMA 1MMDA 5BW8C 4I43B 5HCMA 1YCSB 3S7BA 3P7IA 4LG6A 3GYZA 4O1PA 5FTPA 3DP7A 3LBXA 2W67A 1K3ZD 4P1NA 3E37A 1QBQA 4U33A 3FUMA 3NB2A 5FVKA 1KNRA 2AXVA 2Q9QB 5C2YA 3PV0F 5FWQA 1L0VA 3RU0A 4X1IE 2BKKB 3I5PA 3QC1A 4APFA 2M6IA 3ZPJA 2V26A 3AE5A 2XQYA 3VR8A 4HNAD 1O1TA 2MPKA 4P09A 3OTOT 2VJ8A 3UMVA 5M72A 3Q4AB 3FH5A 3O1JA 4TX5A 2PFVA 3ZMVB 1HE8A 4J8DA 5E75A 2X9WA 1OWOA 4H7XA 1U5PA 4DLQA 4AKHA 4ILIA 4WNEA 1XDPA 4Z68A 5ARFA 4I1AA 4AQYT 3MJWA 2Y48B 1N4PA 2DZNA 1E7VA 2M67A 3QNUA 4JD2G 2CEAA 3SFDA 3ULQA 4DV3T 1QUUA 3P2BA 5JH7E 2UXBT 3PDNA 3MKDA 4QH4A 3ZGQA 5J2UE 5CEDB 4GPKA 4U2ZA 2WM9A 3HKBE 2IIUA 4KZCA 3PE0A 4AJWA 4K03A 5AQTB 3ZN0B 3S2AA 2WQ7A 3AA0B 4F7AA 3RAUA 5HAXA 1T72A 3ZXSA 3O1HA 5IYZE 2XQ4A 5CA1E 1NFIE 3KSQA 5HYAA 1OY3D 4L9IA 3LPZA 3Q7FA 5AJDA 4DX6D 2BTDA 2XENA 2IOSA 2XSBA 4EZLA 3PZDA 4I1MA 1HNWT 2W0GA 5CB4E 2AE9A 3JUIA 2HPLA 3R9AB 2L6JA 4IHJE 3RHWA 3LJ3A 3MCXA 4NUVA 1UN8A 4EBAA 3FUNA 2WQYA 4WYVA 3AJIA 4EZJA 4X20E 2B6CA 2XPKA 1E96B 2XS8A 4U74A 2R6GF 3RX6A 4H9OC 1NZNA 2XUEA 4JPSA 3E22E 2KCKA 2LSIA 1MQSA 2BZBA 4BT9A 3UIPC 4WNKA 1HR0T 3CK7A 4O60A 2JQKA 4G2VA 3L9TA 4YDWA 2E2AA 3HR0A 3AE2A 3J5PA 5J90A 1Z6TA 4FJYA 4LFCT 4HE8A 4K0RA 2VTBA 5JHAA 3AA1B 2CMRA 5G04J 4UWKA 2CXDA 3SFXA 2PNNA 3EIJA 3MKQA 1NL4A 5CEAA 2BG9C 2KM4A 4ISTA 3FU3A 1DNPA 2IJGX 3CPZA 1H6KA 2V7LA 2IDOB 3AEFA 4UUCA 2XQ0A 2FO7A 4WUYA 3ANWB 4HN9A 2YDSA 2X38A 3FWVA 2LT3A 2ZGDA 3I9WA 4O2BE 1FVHA 5AQJB 4I55E 3PZ1A 2CXLA 1LRZA 2N2NA 3ZC1A 4DV1T 3FULA 5HEUA 4BJMA 5LGTB 3K8PC 4G1TA 1OCZE 3EHQA 4HWFA 4EV6A 4ZFHA 4MHCA 1ZBPA 2VSYA 3RRNB 1KPSB 4ME2A 4AQFA 5BR8T 3PUJA 4DV7T 3BG0B 4DV4T 4XI0A 3TJPA 1IXVA 3GN5B 2XJ7A 2GRRB 1K1BA 1N32T 1N33T 4EEBA 3APDA 2E0IA 5FIOA 4JI0T 3AEEA 3D9JA 2KZ7B 2X66A 3UU6A 2V5DA 3K9IA 1D1CA 2WMOA 2XPZA 5D66A 1MHQA 3BK9A 2FJDA 2K3WA 4DVDA 5EK3A 4RG9A 2WP9A 4DJAA 4ILCA 1BI7B 2OV8A 4ILAA 4MFRA 1FIOA 5KMGP 4A97A 3A7MA 5FL0A 3FEXA 4ADZA 3CVLA 4DX1A 5JQGE 1EYHA 3LDQB 1V9DA 4HWIB 3SRZA 5L3GB 1ZEEA 3NZSA 4IL9A 5HCJA 3B7RL 4ZZBA 1IHGA 3MXZA 1W0BA 3ETVA 1UCUA 3KINB 2BBHA 3MA5A 4JI2T 4AXHA 4NQ0A 4CXYA 2HM8A 3UIOC 2QY7A 2BEDA 3CK9A 5FXXA 1E8XA 5EILA 3U3WA 3ESLA 1H19A 5AIJA 4WNFA 5HWXA 5AQOB 2DNXA 1IQUA 3D9HA 3QB2A 4GTPA 4AM9A 3R7QA 2J4DA 4ANWA 4K0KT 3I9YA 4OAUC 4U95D 4QHOA 4GZ6A 1SQMA 3DSTA 2VURA 5LJNA 2XGMA 2QC9A 3O4XE 3LXUX 3RRCA 1B89A 5FZRA 2Q7FA 1S63A 4JA7A 3MACA 1KNZA 2L0TB 4GA2A 1N54A 2F37A 3I3NA 4H63H 3NQPA 2DWGA 4HI9A 3N2KE 3HKDE 2MTQA 3FP3A 3KS2A 1G3NB 5LGNB 2VKOA 1E1HB 4GYWA 4F8HA 3OYZA 4LF4T 2WDVA 3L54A 1NA3A 3PEUB 2XY8B 3EHZA 2LJLA 3C98A 4O4JE 3F6QA 3TL5A 5CBNA 2CG3A 3ZHEB 3CHPA 4OVVA 5LP6E 4A3VA 3OBVE 1E90A 2CHOA 4AKRB 3UM3A 5BPPA 5CCLA 2IFUA 3NF1A 4UI9J 1Q2ZA 3DBSA 1KZPA 4PJNA 3CSFA 2WS3A 2H89A 5TAOA 3RYCE 4DBQA 2AVPA 2X68A 2HE0A 3EDVA 2IC9A 4LNGA 3CMLA 4NURA 4UVCB 2E8IA 3EUVA 3Q5WA 2XAFB 3TG5A 3Q5DA 3LY7A 5HXCA 1MX4A 2LSKA 1CUNA 3DSVA 4B3MT 3U66A 4DLOA 3FUJA 4KVMA 4OK0A 3ULYA 4GA0A 3C4XA 3CEQA 3N9NA 3FZKB 3E34A 3IF8B 2CHWA 1MYOA 1FVFA 5F8PA 3ZMSB 1TJCA 4LF5T 2Y6XA 3FTXA 2RKKA 3OTNA 4RSYA 3QWVA 2DYSE 4JI4T 4Z90A 2MYOA 1US7B 3VTYA 3UT8A 3KVBA 4MKTA 4DUIA 4ANUA 4DX5D 5BXOA 4A56A 2A5UA 3L6AA 3Q5XA 5HXRA 2J4GA 4L2YA 2WDRA 3CIRA 2PG8A 2XSAA 3HVEA 5FMNA 1WDYA 3LFMA 3JCFA 3HXEA 1UN9A 2I6HA 3T9KA 2XQAA 2NWBA 3ZN1B 3MZLB 5FZQA 3OJAA 5FNVE 5L2LA 4ZZCA 5H6QB 5L3CB 1BD8A 3CK8A 2OEVA 1RW2A 2VGXA 1VRBA 1YXRA 4H63V 2WQ6A 4C9BB 1IYGA 3N71A 3ZCIA 4WAFA 2KWIB 2A3DA 1XDOA 1M62A 5EK2A 3S7FA 5KWDA 3LSVA 4AQGA 2CCQA 3FUKA 4BX9A 4L9PA 3K1SA 3OYXA 3UQ3A 1TYQG 4KUMB 4N5CA 4ABNA 4PUCA 3BQIA 3ONLA 1E8YA 4YY3T 3AS4A 2Y4UA 2CRBA 2VL8A 3L17A 3DTOA 2XAHB 5LX8A 2R2LA 1V54E 4UQXA 3JQ1A 2A4ZA 1XZYA 3LK2B 1TR4A 1FMVA 3HI2A 4XAXB 2V6YB 4J2CA 2YDRA 4PAGA 4ZS3A 3TWRA 4HWHA 5FXZA 3RYIE 4BTBA 3LG7A 1H2VC 2BS2A 3K3OA 4AIFA 3AEGA 4PK6A 3RF1A 3BQOA 1MIVA 3PEVB 3RGLA 1YA0A 5DABA 2ONDA 5T4YA 2QA7A 5LYJE 5ENTD 4NUUA 3NAWA 1O3XA 3ZEFB 5T8IA 3AEDA 4V3IA 2V5QC 2ZGGA 5CCMA 2LE8A 3OAWA 5JR9A 4F1PA 3CQXC 4BTAA 3BQKA 3AA7B 2DCFA 2BBJA 5FQ4A 3PRZA 5ADXL 3ULEG 3RQUA 1A17A 4BA9A 3ASNE 4JHJA 1U2VG 2V4HC 3NBXX 2IMLA 2LM9A 3ZUVB 4AISA 3D9LA 1HH8A 2BDEA 3KV9A 1VCTA 2NXPA 4U72A 3PU3A 4PNIA 4GCNA 5CECB 5EN5D 2RG8A 1SE7A 1YMPA 1ELKA 4RVBA 2LOPA 3CV0A 5L3EB 4GZCA 2ZM8A 1VOMA 5AQNB 4FHJA 1S35A 2AW6A 2KLQA 3FZFB 4IULA 5EX0A 1LVFA 5HXEA 4OYKA 2L8KA 3CX6B 4AQFC 4RG6A 5LMUT 2BUGA 2PM7A 4YVOA 3DSUA 4K5AB 3FBZA 5J2TE 5BT1A 2NSZA 5ANLA 3T1HT 4TV9E 2K24A 4TNWA 1UK5A 2L6BA 1DCEA 2BG9B 1H2TC 4BERA 4U8HA 2YOEA 4LRZA 2ETAA 2WXIA 3N2GE 3VLDA 3KSLA 2CLYC 2P9KG 5IY5E 4Q94A 4IDOA 1QYMA 3I1AA 2X9XA 4GTRA 2MOWA 4A1SA 2IF4A 2V8SE 3PZ4A 2EIKE 4QFVA 3ZU7B 3LJNA 3RI5A 1QSDA 2NP9A 2OA5A 4IYPA 3ZYQA 4FC8A 2LKHA 3WAKA 3RC3A 4J7WA 1FT1A 4BX8A 3JYSA 5ABFB 3CKCA 3T8KA 3IHRA 3FEYA 2XAGB 4DR4T 3Q9NC 5FVLA 3LKUA 3IHYA 2CFUA 3EDTB 3AE4A 1HFAA 4IN3B 4HQDA 1Z8UA 4DV6T 3SHFA 2VSOE 2CPTA 4HTEA 4U96D 3GWHA 1Y8MA 4OX9T 1MMGA 3G2TA 4BESA 3H37A 1KEYA 3AG1E 2R03A 4L5GA 3WXXA 3FTUA 3CK6A 4X65T 3DXMG 1H7CA 4GTMA 2V6XA 1XWMA 3IV0A 4X1KE 3LJCA 5D0QD 2BS3A 3V2XA 2JPFA 4IDNA 5ENQD 2DLRA 2IUBA 3ZSSA 4LF7T 1XGWA 2BKOA 3P4PA 3UU3A 1PAQA 2V8SV 2WXJA 4GPMA 3B5MA 3OPCA 5LXTE 2Y4TA 2P9PG 1Z3YA 4X62T 2EHOA 1JCQA 2XAJB 3QK0A 4I9CA 2L9BA 2NYJA 2XS1A 3ASFA 4HI8A 4M7CA 4UEMA 3NVOA 2IO3C 1MIYA 4GMLA 4JEHA 5G05C 3ZCJA 1E8WA 2WWUA 4PW8A 4C0MA 4JEUB 3E4BA 3ESKA 4B3ST 4YLHA 2HR2A 2XGOA 3FH8A 3AB3B 4ZI2D 2I9CA 1ZB1A 2E9XA 4TUUA 3Q75A 5AQ9A 1HG2A 3FTYA 3KAEA 4FLHA 3AXJB 5AQKB 4I43A 2J07A 2IHR1 4DV5T 2Y1LE 4I6GA 3PZ3A 2VQFT 2LKGA 4U31A 4KXKB 4PFPA 3J5QB 4AY6A 4FULA 1E2AA 4CN6A 4U7YA 2Q9QA 3KV5A 5HEOA 4GYRA 1JUQA 2NW8A 5JREA 4TXQA 4N3AA 2MHKA 3KEAA 5B1AE 1KT0A 4G25A 3ABKE 4BEPA 3B7BA 4PS3A 4J8FA 3VLFA 3ZYLA 3E08A 4UELA 4CXWA 3RC8A 2OVFA 3CVPA 4HS2A 3EVYA 1D0ZA 1WG0A 5ITZF 5GONE 1IJ5A 4G63A 2XTLA 4ZEYA 4U0UA 5JJ6A 1TN6A 3UX4A 4N2SA 4FP7A 1XNQT 2JLBA 4U04A 4M3OA 4V1Av 4KT6B 4CN1A 4DR5T 5CBOA 3MV2B 1N95A 4JC8A 2AWIA 3BQLA 4FJOA 2VVSA 5CJ5A 3AG4E 2XPIA 3KD7A 4HFEA 1WYCA 2LXMA 4HFHA 4DR6T 4DX2A 1OWMA 1WYBA 4KI0F 3SD5A 1IAPA 3LBXB 2GROB 5G55A 3SFZA 2BG9E 3PUAA 3MYVA 1QLBA 1N34T 5JDFA 1OEDA 2PJQA 2WXFA 5ENNA 1HNZT 2MBGA 4JI5T 2QZAA 4N2QA 3PURA 4E7ZA 1H6OA 1YQ4A 2OOEA 3HDXA 4Q69A 2YK0A 2EHOD 4CGVA 1N94A 4IRUA 3HL6A 4KP3C 4GZDA 2M63A 1N52A 2KCLA 5AJLA 5G2NA 3PUXF 2IOLA 4B94A 3ABVA 4H9PC 3FXEB 3QOUA 3P4WA 3GMIA 3ZMUB 5KBAA 3UM1A 2NW9A 3DSXA 4AV7A 4MBQA 4X1YE 2I0MA 2VB6A 2KNDA 2KZTA 1HG5A 4HOQA 4O4IE 3CIAA 4ZI3D 2WXOA 3LEWA 5JDLA 3ONLC 5AQIB 1GW6A 4QQIA 4GTVA 5L4EA 3BG1B 4GB9A 1QQEA 3R9MA 1BR1A 2C0SA 2ODVA 1TNYA 2HN2A 2XEHA 4EIWA 4JHRA 3EU5A 1O1SA 5DIZA 4FJZA 1NWMX 3ZXPA 4L1BA 2C5IT 3AS5A 3FTZA 1NP7A 2L0IA 3O48A 4XIFA 3ZVVA 2LSJA 4CI2B 3CVVA 2X6KA 3TXMA 1K8KG 2GK9A 1S0PA 4LNBA 2LEHA 3SQVA 4NPPA 5AAOA 2PL2A 2UU9T 2GRPB 3FU6A 1WAO1 3G2WA 2GW1A 3KBUA 3TWXA 5JRCA 3DEOA 3AAAC 5D0OD 3D3MA 5ABEA 4RLYA 5FJYA 4XZCA 5LG3A 2YU2A 4JI1T 4B3TT 4GKJT 4EYUA 4TNVA 3ANWA 3PNLB 2RFMA 3UUMA 4DI3A 3IHVA 4J6IA 4O8SA 2WZIA 2H88A 2XEEA 5B3SE 3BU8A 1JWGA 2WPVA 5C8YE 3MA9A 2DIWA 3UT7A 3C64A 3Q79A 1SA4A 4HOSA 3SNXA 2X6HA 3N9OA 2HH7A 2LM2A 3FHNA 3VKGA 3QOFA 2H6IA 4LSZE 5HRYA 2GRLA 3LK42 3U3IA 4GKKT 4M1PA 4GIWA 5FQ8A 4PFOA 3RO2A 3QAQA 4GYOA 2VTBB 4O6FA 1SVXA 3GN5A 1YKHB 3RLFF 5LFAA 1HCIA 3ONJA 1SZ9A 5CRVA 2J4BA 4COFA 3HXFA 4LFBT 3PUKA 4ZI2C 1PC2A 2E5VA 3L22A 4ERRA 4YSZA 3ONKA 4JHKA 3P4RA 3PUSA 1KNPA 3ASDA 3E0ZA 1ELWA 4HOUA 4W9RA 1FPPA 3IBEA 3APFA 2B0OE 2QYJA 4HORA 4CDRA 3PJAJ 3C3OA 4GA1A 5HQ8A 5JDHA 5A1LA 1HZ4A 4G23A 3EI0A 5KNGA 4MBGA 5HEHA 5JTGA 1OCRE 3D9NA 2QYUA 4JB8P 2IO2C 4LMKA 5DBKA 2OCCE 1FEWA 1OT8A 3AEBA 2UUAT 2FI7A 3WI3A 1RZ4A 4CI3B 1MX6A 4U3CA 2CHZA 5DQVA 3EDUA 4WWPA 3ZYMA 3ZC0A 5AQVB 2QYWA 3RRUA 2BVLA 2UWJG 3NOGD 3RKVA 4GTQA 2UUBT 5BUZA 3Q2MA 1IKND 3I4RB 3Q49B 5A7DB 4H9NC 4IT4A 3TWWA 5KXJA 1HS6A 3JXIA 5LNKA 5FXWA 2CLYB 2J8SD 1XNRT 1S70B 2J62A 4LCTA 4A55A 3D9KA 1K1AA 4WBNE 4TWFA 4IREA 3SBSA 2ODUA 3G2SA 4JW1A 4ZS2A 4E6HA 4A5XA 2ZM6T 2EHOC 1MMAA 4TV8E 2XCBA 2EINE 3MZKB 4J8EA 4TV3A 5KJLA 2ETCA 2YNQA 4KMCA 3L3PA 5H6RB 4IDZA 4XEIG 3GZ2A 2E2EA 2XQ9A 3HKCE 2V5FA 4ZI3C 1N0RA 4YFSA 5L47A 2JEKA 4HOTA 4GMJA 4MLKA 1KF6A 2HYZA 3ZT7A 4DUYT 1LD7A 2X6IA 2WQHA 3UFEA 3I0OA 4IE4A 2XHEA 2JRKA 3D0TA 4ATZD 4FADA 5LOZA 2WXQA 3EUHA 2J09A 3HRAA 2X3MA 3E33A 3RJVA 2W4XA 2H7OA 3AE6A 4ANXA 5BNWA 3PUYF 2BVMA 2WY2A 3AU5A 3RIBA 2LAHA 3H3AA 2ZM0A 1NAFA 3TXNA 4BSXA 2IONA 2CE7A 4PK4A 3CQCB 3PZ2A 1ZKEA 5ABHA 2H6FA 2P9LG 3TLUA 3QARA 4XX5A 3TG4A 2FJAA 3L13A 4BT8A 2VK9A 3Q9DA 4QX7B 2RPAA 3N5LA 3U9WA 2YINA 1TNBA 4JL0A 3D9MA 2CHNA 4YHJA 4I0UA 3C98B 3FUDA 3LS8A 2EIJE 4I6EA 1NA0A 3RO3A 1YKEB 3Q47B 4DV0T 4FHKA 5HS0A 4AY5A 2RFAA 3M65A 4CCAA 3IEEA 1UG3A 1HTJF 4IIJE 3GA8A 2OVBA 2NC9A 1BPOA 4GK5E 3QWWA 4DPRA 5AQMB 1WRDA 2UXXB 4QWNB 3JXJA 3ML9A 2CBIA 4H7YA 4KYOB 4JVSA 3OXFA 1OEDC 4MLPA 4N3BA 4UWLA 1SA0E 2WSSV 2H7VC 2HO1A 1Y6IA 2WDQA 5BV0A 3N9LA 3PS6A 5LCYA 3SS1A 4B8CB 1E7PA 3RIAA 4L0RA 1INZA 2CG2A 2LAIA 3RPUA 1Z3XA 4YXDA 4UI9C 1TNZA 3A5XA 2NTXA 4MRUA 3ASGA 4UF0B 5E76A 4DMWA 3RK6A 3NRXA 5J1GA 3GZ1A 2LSUA 5AQLB 3UUBA 2BS4A 2DVWA 3RIUA 4ACLA 3SWHA 2VKHA 2X0HA 2YHCA 2FBNA 1NEKA 4IL4A 2XM1A 4IDPA 4P0AA 2F0YA 3P4QA 1S64A 4DIDB 1OWAA 2VASA 2LRLA 3D9PA 4EZKA 4BY6A 3FZLB 1Z5SC 3ZEFA 3MK7C 3UT5E 5HKPA 2W00A 4GMRA 2XZDG 1IBKT 2VGXB 2GGFA 3UM0A 2UY1A 2FF4A 5AQFB 4IE0A 4HLLA 4L2LA 4HFVA 5CFBA 1KLXA 3LY9A 2VSXE 3BEEA 2RP4A 2XQ3A 5ETWA 4KX6A 4XZ4A 4YSYA 3JQ0A 3TWQA 2IY0C 3UUXB 4HB5A 3PTRB 2Y8DA 4I6JA 1U4QA 1QNFA 2D0UA 1UJJA 3HHMA 1OUVA 2PBIA 2W62A 3DPDA 4K0UA 2AXZA 1AJ3A 1SA5A 5ENPD 5FT9A 4YDOA 4KHPT 4XE0A 1D9SA 4ACKA 5LHIB 2K5BB 4UWGA 5CERB 4CZZB 5LGUB 2V7IA 5HEJA 3UXGA 4UV9B 1T8BA 3VU7H 2VSNA 1H2UA 2WWVA 4G2AA 4KBMB 3TGOA 2V5CA 3QB5K 5ABGA 3EABA 4EXTA 1O5MA 4HRNA 3R6NA 5FINA 4CXXA 1IBLT 3FH7A 3DWLG 4BSZB 4U0ZA 4HEAA 3C4WA 2C0MA 2BG9A 1CHUA 3HKEE 2V7JA 5LOVE 2GRQB 2N9DA 2KBXA 3AAAB 4UXNB 3B13A 4JI6T 4U07A 4EAHA 1UGOA 2WXMA 3IKOB 5L4HA 3L08A 4OHFA 1D0YA 3DEPA 3Q9UC 4YVQC 4D10C 4WBOA 3PREA 2H3RA 1FCHA 5AQ7A 1IJ6A 2FEZA 3W9GA 3X2QE 2WBLA 4UVAB 2X0YA 3RIFA 3TAXA 3F31A 3TWSA 3S7JA 1JPLA 2QRXA 1UX5A 2WZHA 4JLEA 1HS7A 3QB5A 3ZFWA 5ABFA 3U64A 2UUCT 3OXGA 3AE3A 4HRLA 2NOXA 3IA3A 3CGHA 2XEVA 3E32A 3KEZA 4I9EA 3CHQA 2I59A 4UQYA 5AQRB 4AKLA 5JHBA 2BF0X 4QXBB 1OXJA 2WB5A 4EEDA 5KJKA 3SO8A 1KFYA 5LCWJ 4JI3T 1BR4A 2ETBA 2FJBA 4P29A 3OXLA 4HWCA 3SOLA 3GZSA 4LFAT 3AAEB 4U7IA 3UU8A 4WW0A 3PUVF 3SFYA 3I0QA 1D1AA 3N9PA 2ACXA 4O1OA 3U78A 2AXUA 2CA5A 4ILHB 4ANJA 3ZW3A 4ZI7E 4FLBA 2LSYA 4UIGA 3L82A 4N78D 3E30A 1XMQT 3NOCD 3VTXA 4JI8T 1BR2A 3ZSTA 2V1DB 1HO8A 2OV9A 3JC6D 1TJFA 4X8QA 3CVXA 2GRMA 5KX5E 2WXLA 3HIZA 3HXBA 3ML8A 1Y64B 3CVUA 2DZOA 1EPUA 3EIQC 4HFBA 5KCMA 1JWFA 3UQ7A 3DSSA 4OYSA 4I2ZA 2MRIA 2JIWA 2VGEA 3G2UA 5CMYA 1MMNA 4JEUA 5CMWA 4YNDA 3L16A 4QH5A 4C91A 4WWNA 2C5KT 5LB7B 1G73A 4U63A 5JMND 2ES0A 4I17A 2M6BA 1KT1A 3T5VA 3PJAA 4A63B 1HXIA 4WNGA 4O4LE 3UM2A 2IU1A 2ACZA 2P9IG 5ANRA 5EX3A 3ASOE 2E5LT 2R59A 3UKUG 1JCSA 3PUZF 2JJ9A 2K48A 2C0LA 4H9RC 2LHNA 4DR7T 5EK4A 2F8XK 4FU3A 2JQHA 2L3LA 4Q96A 3CVRA 4OVUA 4ZHBA 3A8YC 4JYAT 4DX7D 2FJEA 3CX7B 1X81A 2A9UA 3PE3A 3PNTB 2EHOB 3AAIA 4GZ3A 5EIBE 1MIWA 4P0BA 3N9MA 2AJAA 4CT4A 3D9IA 4JEHB 3LY8A 2Y69E 3MJXA 1VDYA 2UXCT 1IZNB 1IHBA 2H6HA 4B3RT 3EHRA 3ZNGA 1QZ2A 2VGYA 1LKXA 3IXEA 4HXIA 4HBDA 3C51A 3RSEG 1U3DA 2J1DG 4PH4B 2GRNB 3CX8B 2I1JA 4F1SA 5HEGA 2R17C 4G8LA 4NIKA 3MV3B 4CDNA 1HNXT 5JA4D 2DI4A 4YJ2E 3CVQA 4GYYA 4UI9K 3VKHA 3AA6B 1WCRA 3SZ7A 4OAVB 1G8XA 4EB6E 1T7SA 2B1EA 3AVSA 4G24A 3HXCA 3FXDB 1J1JA 4CI1B 5F5WA 3ZIMA 1B7TA 3UI2A 3RKGA 3N2OA 3B7SA 3NZQA 5E0OA 3G06A 5LHGB 3X1DA 1W9RA 5BXUA 4DR1T 2NW7A 4AP2A 4QXHB 4TWDA 5LP0A 3URZA 2H6GA 3SGHA 3K3QC 3VLEA 4C0EA 2YHEA 4C48B 3FZHB 2V7KA 1TEZA 2V4LA 5J08A 5AQGB 2R5SA 2Y3AA 2XASB 5J0ZA 5BV1A 4IE6A 3CR3A 2OEWA 4Y6WA 4J0UA 5LMNT 3MEKA 5FY0A 3ONXA 4IE5A 3RIUC 5BMVE 2E9XD 4EYYR 5CGMA 5HI7A 2W61A 3K3NA 4IDQA 3VRBA 1T98A 3P8CD 3FUFA 2FO1E 1WLXA 3V5UA 4TZ4C 3T1YT 4LERA 3QDNA 4ATGA 1J5ET 2Q9QD 3ZYKA 1OEDB 1R8IA 2LXLA 1WM5A 1N0QA 3ZRHA 1TNOA 4HFCA 5AQAA 5AFUL 2F4VT 3ETUA 4F6RD 5JDMA 3EU9A 3FBLA 3NZUA 2XCCA 3S4UA 2ZMAA 3UU4A 1N36T 3ABME 4LF8T 1A5EA 4QH1A 3QKYA 2WCAA 4GZ5A 4GK0E 2DHRA 1N4SA 2JMKA 2CBJA 2Y0BG 4K5CA 4ILGA 4DBRA 2KZTB 4HVBA 2Z6EA 1ZP0A 5D2MC 5JR9C 4WWOA 3G2VA 3RYFE 3Q5MA 1EZ3A 4O2AE 1WFDA 4H9SE 2ILRA 5L3BB 4B89A 1ZOYA 2WXGA 3V79K 2K9AA 4PJMA 4CRWA 1VCSA 4YT0A 2X6FA 2XQ7A 3JC6C 5EKQD 3PVLA 2ZIRA 3C4ZA 1TNUA 4URKA 1NENA 4GOUA 4HWDA 1SUMB 3AE7A 4UVBB 2CXFA 4YDYA 4U2YA 4N39A 2HN1A 5C2TA 1XNFA 3R84B 4YDEA 2I2OA 1D8EA 1UW4B 3CHMA 1SZAA 1E8ZA 4X64T 4CZ2D 2WXRA 3NWIA 5FP3A 4XKCA 2YDQA 2PQRA 5JRCB 3KV6A 2CWYA 4ZHQE 4AVXA 5EDSA 3ABLE 3RKOA 4GTOA 4EHMA 2HPJA 3MX3A 4NACA 3MKQB 3QWPA 4LUNU 1X9BA 5LJMA 1V55E 4TUMA 4DRXE 4U8YD 1PY1A 2B76A 2X9HA 3ZMZB 3GW4A 3MKRA 2PZIA 3FZMB 2G0UA 4F53A 3F2EA 2J9QA 4RQIA 2P9BA 1N9AA 4DR3T 2LLYA 3KVAA 3UTMA 3NBNB 3QC9A 4JBWF 5ENRD 3CVWA 5DJQC 3CKDA 1ELRA 3T5XA 3AU4A 4A1GA 4AKGA 3FTSA 3EHNA 1KZOA 4UWFA 2KXPC 4YHHT 2VVNA 4I4TE 2JABA 5G04C 3T8MA 1ZU2A 2LHRA 3ZJ1A 5CRUA 2DBAA 3TLSA 2X51A 3L8RA 5AQQB 3PU8A 4YTNA 1ZHCA 4EZHA 2LSGA 4BFRA 3C50A 2CM0A 1DVPA 3FU5A 1I6ZA 5AQSB 2OLTA 4HFIA 4B8AA 4PJLA 4N5QA 4U7EB 1MX2A 3CQGB 1YYHA 3DJBA 2ZXWE 4BETA 3UTKA 5L3FB 2J49A 1E7UA 4DV2T 2HHHT 5FQ6A 4PS8A 4HGAA 4AIUA 5M4YA 5A6CA 4WNDA 2VKDA 1TN7A 2YQ8A 3B7TA 4HKAA 4EBAG 2R05A 2WAUA 3O9XA 3ZKRA 2PQNA 3FUEA 2PM6A 3JADA 5AQBA 4KMOA 4TUYE 4DUZT 3SBTB 4QXCB 4DO0A 2JMHA 2A5EA 4AXPA 5LA6E 5HXSA 4NIQA 2RD0A 2D5UA 1EDUA 3L09A 3LYAA 1JNZA 2N1GA 2KSRA 4GAAA 3ASHA 5AQUB 2MOZA 1LVKA 2I1KA 5C1DA 4X66T 1OEDE 2WXPA 1N4QA 4Z8XA 4KHZF 4DK5A 3V2OA 5B1BE 5LG4A 2ZISA 4TRQA 2BKNA 3ZHEA 4CYMD 2E9XC 2IEJA 1MZCA 1M7KA 3RQWA 3IEGA 5HXHA 5KDMC 4B93B 4GTTA 2ZLYA 3N9QA 4ZOLE 3B95A 1H6PA 1YD8G 5HWYA 2CWOA 2W2UA 2A2FX 2Q9QC 3CKBA 1OXZA 5KJNA 4I2WA 5JVDE 4F6RC 4DNDA 2F8YA 4G11A 1HF8A 3W15B 4J8SA 1D1BA 1MNDA 2XAQB 5F3JA 4EGWA 3EJNA 5LBMA 4HRMB 2EIME 4QX8B 4JZYA 2P9SG 2X0LB 1JCRA 2W66A 3SFEA 3Q15A 3Q73A 2W63A 4ASKA 5IUXA 2LUHA 3FUIA 3FHEA 4JA9A 1D8DA 4Q25A 3DPYA 1OWPA 3TWTA 4FI5A 3J7Yq 1MJ0A 3QJZA 3AE8A 1IQRA 2D9DA 4IE7A 2WVIA 2NR4A 1WR0A 4XI9A 2XHEB 3S7DA 2VYIA 4LMLA 2LO6A 1OWLA 3TLWA 4B6XA 1YW0A 2VQ2A 3R7RA 3AG3E 1WY6A 2LOSA 4YTMA 1U3CA 5FQ7A 4TXPA 4F3VA 4H9QC 1LTXA 3H3MA 4ISSA 3PE4A 4E85A 4K5BA 4PJJA 4JI7T 3AG2E 2L9QA 5C3JA 5CHEE 5AYWD 3KBTA 1HX8A 3KDSE 3P4SA 4IGUA 3QK6A 1P5QA 3UUNA 5IHYA 5ENOD 5A23A 3FFLA 2V0PA 3B57A 5EYPF 4BWRA 5JJTA 3HYMB 2AXDS 4UF0A 3JAFA 2IAKA 1FT2A 3AS8A 2C2LA 2DCPA 2EQXA 1YQ3A 2YKSA 1H0AA
chains in the Genus database with same CATH topology
2A72A 4HLEA 4DMVA 3PH0C 4HFGA 4FA6A 4R7LA 2DWKA 4EOZB 2LSVA 4AKIA 3RH3A 3FTWA 5JDGA 2P58C 4ILUA 5EZYE 2IW5B 3ZLIA 2XGSA 1Z0PA 4U0SA 2FULA 4APOA 1EF1C 4CGWA 3HVEB 2YEVC 3FDHA 4QKNA 4UWHA 1W3BA 3LDZA 4MS6A 3O1IA 3U4TA 3RRMB 3OKQA 4EECA 1BR0A 3LVRE 3FTVA 3FY4A 4GCOA 1SHZC 4ANVA 3AVRA 4UQZA 3LVQE 4BAYB 5LHHB 3UUXA 3I4GA 4CQIA 3P1UA 5FXVA 4EZ4A 3KFWX 4CT0A 2D2SA 4PK5A 1D0XA 2RA1A 3CWZB 3JCKC 5L3DB 4N3CA 4E7SA 5T3RA 2X6JA 4YJ3E 3QNKA 4I1OB 2UY1B 3J9X1 3O4ZA 4A3TA 3IBPA 2D0TA 3MGBA 2XPYA 4XBFB 1HU3A 3WAJA 2X67A 3FU0A 4BJNA 2NTYA 4MALA 5JR9B 4OYJA 3ZJ2A 3UPVA 1OWNA 4GYSA 4PDXA 3RYHE 3CLJA 2SPCA 3FB2A 1S94A 5CA0E 2KT9A 4PS7A 3LK3B 3VHLA 4G26A 2QFCA 1UJKA 3HA4A 4CDMA 4KZ0A 5JDQA 2V7MA 4O4HE 2VWAA 4UV8B 4AI6A 3FUHA 5DQWA 3V5SA 4Y6CA 3TKLB 4AEZC 4CEMA 2XRZA 4GU5A 4TN7B 3PDYA 3UT4A 2IC6A 4OFZA 5G05J 3D9OA 4L23A 5JDNA 2MYSA 4XKBA 4EPZA 3T8OA 3UULA 3ZMTB 1MNEA 5FY1A 2WMNA 2WB2A 1X5BA 4KBQA 2KXPB 5AENA 3APCA 1ZV4X 4I50E 3B7UX 1UX4A 2X9YA 2CFZA 2KC7A 1WR6A 2IQCA 3CVYA 3SI5A 2ZM2A 3PUGA 2QGSA 5FZSA 2LNIA 1KK7A 4JUYA 1LF8A 4EQFA 2KMFA 2CHXA 3EHMA 4C90A 2C5JA 2KWHA 3CHOA 4AOFA 5LBQB 3CHRA 3ZPOA 3QUJA 2WXNA 1X79A 2KATA 3ENEA 2ZU6B 4B0ZA 3LCAA 2JQQA 3NZPA 5FY7A 3CVNA 2WXKA 3RRWA 3SF4A 5LCWC 2J08A 3KV4A 3NRYA 4DI4A 2VKJA 3F57A 4KVOA 5KJMA 2KCVA 1L5JA 4NRHB 1FMWA 4LEUA 5JJ7A 3ZN3A 2XRYA 4L7TA 2YU1A 3CHSA 5ARGA 4JXTA 3CSTA 3PUQA 2KINB 2UXNB 2WXHA 2E9XB 5FYMA 1MMDA 5BW8C 4I43B 3S7BA 3P7IA 3GYZA 5FTPA 3DP7A 3LBXA 3FUMA 2AXVA 2Q9QB 5C2YA 5FWQA 3RU0A 4X1IE 3I5PA 3QC1A 4APFA 3ZPJA 2V26A 2XQYA 4P09A 2VJ8A 3UMVA 5M72A 3Q4AB 3FH5A 3O1JA 4TX5A 2PFVA 3ZMVB 1HE8A 4J8DA 5E75A 2X9WA 1OWOA 4H7XA 1U5PA 4DLQA 4AKHA 4ILIA 4WNEA 5ARFA 4I1AA 3MJWA 2Y48B 1E7VA 2M67A 2CEAA 3ULQA 1QUUA 3P2BA 5JH7E 3PDNA 3MKDA 3ZGQA 5J2UE 4GPKA 2WM9A 3HKBE 4KZCA 3PE0A 4AJWA 4K03A 3ZN0B 3S2AA 2WQ7A 3AA0B 4F7AA 5HAXA 3ZXSA 3O1HA 5IYZE 5CA1E 5HYAA 4L9IA 3LPZA 5AJDA 2BTDA 2IOSA 4EZLA 3PZDA 4I1MA 2W0GA 5CB4E 3JUIA 2HPLA 3R9AB 2L6JA 4IHJE 3LJ3A 3MCXA 4NUVA 1UN8A 4EBAA 3FUNA 4EZJA 4X20E 1E96B 4U74A 3RX6A 4H9OC 1NZNA 2XUEA 4JPSA 3E22E 2KCKA 2LSIA 1MQSA 2BZBA 4BT9A 4WNKA 3CK7A 4G2VA 3HR0A 5J90A 1Z6TA 4FJYA 4HE8A 4K0RA 2VTBA 5JHAA 3AA1B 2CMRA 5G04J 4UWKA 2CXDA 3EIJA 3MKQA 2KM4A 4ISTA 3FU3A 1DNPA 2IJGX 3CPZA 1H6KA 2V7LA 2XQ0A 2FO7A 4WUYA 3ANWB 4HN9A 2X38A 3FWVA 2LT3A 3I9WA 4O2BE 1FVHA 4I55E 2CXLA 1LRZA 2N2NA 3ZC1A 3FULA 4BJMA 5LGTB 3K8PC 4G1TA 4MHCA 1ZBPA 2VSYA 3RRNB 4ME2A 4AQFA 3PUJA 3BG0B 4XI0A 3TJPA 3GN5B 3APDA 2E0IA 3D9JA 2KZ7B 2X66A 3K9IA 1D1CA 2WMOA 2XPZA 1MHQA 3BK9A 4DVDA 5EK3A 4RG9A 4DJAA 2OV8A 4MFRA 1FIOA 5KMGP 3FEXA 4ADZA 3CVLA 5JQGE 1EYHA 1V9DA 5L3GB 3SRZA 1ZEEA 3NZSA 3B7RL 1IHGA 3MXZA 3ETVA 1UCUA 3KINB 3MA5A 4AXHA 4NQ0A 4CXYA 2HM8A 2QY7A 3CK9A 5FXXA 1E8XA 3U3WA 3ESLA 1H19A 5AIJA 4WNFA 5HWXA 2DNXA 1IQUA 3QB2A 4AM9A 3R7QA 2J4DA 4ANWA 3I9YA 4QHOA 4GZ6A 1SQMA 5LJNA 2XGMA 3O4XE 3LXUX 3RRCA 1B89A 5FZRA 2Q7FA 4JA7A 3MACA 1KNZA 2L0TB 4GA2A 1N54A 3I3NA 4H63H 3NQPA 2DWGA 3N2KE 3HKDE 2MTQA 3FP3A 3KS2A 5LGNB 2VKOA 1E1HB 4GYWA 3OYZA 3L54A 1NA3A 3PEUB 2LJLA 3C98A 4O4JE 3TL5A 2CG3A 3ZHEB 3CHPA 4OVVA 5LP6E 4A3VA 3OBVE 1E90A 4AKRB 5BPPA 5CCLA 2IFUA 3NF1A 4UI9J 3DBSA 4PJNA 3CSFA 5TAOA 3RYCE 4DBQA 2AVPA 2X68A 3EDVA 2IC9A 3CMLA 4NURA 4UVCB 2E8IA 3Q5WA 2XAFB 3TG5A 3LY7A 5HXCA 2LSKA 1CUNA 3U66A 4DLOA 3FUJA 4KVMA 4OK0A 4GA0A 3C4XA 3CEQA 3N9NA 3IF8B 2CHWA 1FVFA 5F8PA 3ZMSB 1TJCA 2Y6XA 3FTXA 3OTNA 4RSYA 3QWVA 1US7B 3VTYA 3UT8A 3KVBA 4MKTA 4ANUA 4A56A 2A5UA 3L6AA 3Q5XA 5HXRA 4L2YA 2PG8A 3HVEA 5FMNA 3LFMA 1UN9A 2I6HA 3MZLB 2NWBA 3ZN1B 5FZQA 3OJAA 5FNVE 5L2LA 5H6QB 5L3CB 3CK8A 2VGXA 1VRBA 4H63V 2WQ6A 4C9BB 1IYGA 3N71A 3ZCIA 4WAFA 2KWIB 2A3DA 5EK2A 3S7FA 4AQGA 2CCQA 3FUKA 4BX9A 3OYXA 3UQ3A 4KUMB 4N5CA 4ABNA 4PUCA 3BQIA 3ONLA 1E8YA 3AS4A 2Y4UA 2VL8A 3L17A 3DTOA 2XAHB 5LX8A 4UQXA 3JQ1A 2A4ZA 3LK2B 1FMVA 3HI2A 4XAXB 4J2CA 4PAGA 4ZS3A 5FXZA 3RYIE 4BTBA 3LG7A 1H2VC 3K3OA 4AIFA 4PK6A 1MIVA 3PEVB 1YA0A 5DABA 2ONDA 5T4YA 2QA7A 5LYJE 4NUUA 1O3XA 3ZEFB 5T8IA 4V3IA 5CCMA 2LE8A 3OAWA 5JR9A 3CQXC 4BTAA 3BQKA 3AA7B 2DCFA 5FQ4A 3PRZA 5ADXL 1A17A 4BA9A 4JHJA 3NBXX 2LM9A 3D9LA 1HH8A 2BDEA 3KV9A 2NXPA 4U72A 3PU3A 4PNIA 4GCNA 2RG8A 1ELKA 4RVBA 2LOPA 3CV0A 5L3EB 4GZCA 2ZM8A 1VOMA 4FHJA 1S35A 2AW6A 2KLQA 4IULA 5EX0A 1LVFA 4OYKA 5HXEA 2L8KA 3CX6B 4AQFC 4RG6A 2BUGA 2PM7A 4YVOA 3FBZA 5J2TE 5BT1A 2NSZA 5ANLA 4TV9E 2K24A 1H2TC 4U8HA 4LRZA 2WXIA 3N2GE 3VLDA 2CLYC 4Q94A 3I1AA 2X9XA 2MOWA 4A1SA 2IF4A 2V8SE 4QFVA 1QSDA 2NP9A 2OA5A 4IYPA 3ZYQA 4FC8A 3WAKA 3RC3A 4BX8A 3JYSA 3CKCA 3IHRA 3FEYA 2XAGB 3LKUA 3IHYA 2CFUA 3EDTB 1HFAA 4IN3B 3SHFA 2VSOE 4HTEA 3GWHA 1Y8MA 1MMGA 3G2TA 3H37A 4L5GA 3WXXA 3FTUA 1H7CA 3IV0A 4X1KE 3LJCA 5D0QD 2JPFA 2DLRA 1XGWA 1PAQA 2WXJA 5LXTE 2Y4TA 1Z3YA 2EHOA 2XAJB 3QK0A 4I9CA 2L9BA 3ASFA 4UEMA 1MIYA 4GMLA 4JEHA 5G05C 3ZCJA 1E8WA 2WWUA 4PW8A 4C0MA 3E4BA 4JEUB 3ESKA 4YLHA 2HR2A 2XGOA 3FH8A 3AB3B 4ZI2D 2I9CA 2E9XA 4TUUA 1HG2A 3FTYA 3KAEA 4FLHA 4I43A 2J07A 4I6GA 4KXKB 4PFPA 4AY6A 4FULA 2Q9QA 3KV5A 4GYRA 1JUQA 2NW8A 5JREA 4N3AA 2MHKA 1KT0A 4G25A 4PS3A 4J8FA 3VLFA 3ZYLA 3E08A 4UELA 4CXWA 3RC8A 2OVFA 3CVPA 4HS2A 3EVYA 1D0ZA 5GONE 1IJ5A 4G63A 2XTLA 4U0UA 5JJ6A 3UX4A 4N2SA 4FP7A 2JLBA 4U04A 4M3OA 4V1Av 4KT6B 3MV2B 4JC8A 2AWIA 3BQLA 4FJOA 2XPIA 3KD7A 1WYCA 1OWMA 1WYBA 3SD5A 1IAPA 3LBXB 5G55A 3SFZA 3PUAA 3MYVA 5JDFA 2PJQA 2WXFA 5ENNA 2MBGA 4N2QA 3PURA 4E7ZA 2OOEA 3HDXA 4Q69A 2YK0A 2EHOD 4CGVA 4IRUA 3HL6A 4KP3C 4GZDA 2M63A 1N52A 2KCLA 5AJLA 5G2NA 4B94A 2IOLA 4H9PC 3FXEB 3QOUA 3GMIA 3ZMUB 2NW9A 4AV7A 4MBQA 4X1YE 2VB6A 2KNDA 2KZTA 1HG5A 4HOQA 4O4IE 3CIAA 4ZI3D 2WXOA 3LEWA 5JDLA 1GW6A 3BG1B 4GB9A 1QQEA 1BR1A 2C0SA 2ODVA 4EIWA 4JHRA 5DIZA 4FJZA 1NWMX 4L1BA 2C5IT 3AS5A 3FTZA 1NP7A 2L0IA 3O48A 4XIFA 3ZVVA 2LSJA 4CI2B 3CVVA 2X6KA 3TXMA 2GK9A 1S0PA 2LEHA 2PL2A 3FU6A 1WAO1 3G2WA 2GW1A 3KBUA 5JRCA 5D0OD 3D3MA 5FJYA 4XZCA 2YU2A 4EYUA 3ANWA 3PNLB 3UUMA 4DI3A 3IHVA 4J6IA 4O8SA 1JWGA 2WPVA 5C8YE 3MA9A 2DIWA 3UT7A 3C64A 4HOSA 3SNXA 2X6HA 3N9OA 2HH7A 3VKGA 3FHNA 2GRLA 3LK42 3U3IA 4M1PA 4GIWA 5FQ8A 4PFOA 3RO2A 3QAQA 4GYOA 2VTBB 4O6FA 3GN5A 1YKHB 5LFAA 1HCIA 1SZ9A 2J4BA 3PUKA 4ZI2C 1PC2A 3L22A 4ERRA 3ONKA 4JHKA 3PUSA 3ASDA 3E0ZA 1ELWA 4HOUA 4W9RA 3IBEA 3APFA 4HORA 4CDRA 4GA1A 5HQ8A 5JDHA 5A1LA 1HZ4A 4G23A 3D9NA 5DBKA 1FEWA 2FI7A 3WI3A 4CI3B 2CHZA 5DQVA 3EDUA 4WWPA 3ZYMA 3ZC0A 3RRUA 2BVLA 2UWJG 3RKVA 5BUZA 3Q2MA 3I4RB 3Q49B 5A7DB 4H9NC 1HS6A 5LNKA 5FXWA 2CLYB 4LCTA 4A55A 3D9KA 4WBNE 3SBSA 2ODUA 3G2SA 4JW1A 4ZS2A 4E6HA 2EHOC 1MMAA 4TV8E 2XCBA 3MZKB 4J8EA 4TV3A 5KJLA 2YNQA 4KMCA 3L3PA 5H6RB 4IDZA 3GZ2A 2E2EA 3HKCE 2V5FA 4ZI3C 4YFSA 4HOTA 2JEKA 4GMJA 4MLKA 2HYZA 2X6IA 2WQHA 3UFEA 3I0OA 4IE4A 2XHEA 2JRKA 3D0TA 4FADA 5LOZA 2WXQA 3EUHA 2J09A 2X3MA 3RJVA 2H7OA 4ANXA 5BNWA 2BVMA 3AU5A 3RIBA 2LAHA 3H3AA 2ZM0A 1NAFA 3TXNA 4BSXA 2IONA 2CE7A 4PK4A 3CQCB 1ZKEA 3QARA 4XX5A 3TG4A 3L13A 4BT8A 2VK9A 3Q9DA 4QX7B 3N5LA 3U9WA 2YINA 4JL0A 3D9MA 4YHJA 3C98B 3FUDA 3LS8A 4I6EA 1NA0A 3RO3A 1YKEB 3Q47B 4FHKA 4AY5A 3M65A 4CCAA 3IEEA 1UG3A 1HTJF 4IIJE 3GA8A 2OVBA 2NC9A 1BPOA 4GK5E 3QWWA 4DPRA 1WRDA 2UXXB 4QWNB 3ML9A 4H7YA 4KYOB 4JVSA 3OXFA 4MLPA 4N3BA 4UWLA 1SA0E 2WSSV 2H7VC 2HO1A 1Y6IA 5BV0A 3N9LA 3PS6A 5LCYA 3SS1A 4B8CB 4L0RA 1INZA 2CG2A 2LAIA 3RPUA 1Z3XA 4UI9C 3A5XA 2NTXA 4MRUA 3ASGA 4UF0B 5E76A 4DMWA 3RK6A 3NRXA 5J1GA 3GZ1A 2LSUA 4ACLA 3SWHA 2VKHA 2YHCA 2FBNA 4P0AA 2VASA 1OWAA 3D9PA 4EZKA 4BY6A 3ZEFA 3MK7C 3UT5E 2W00A 2VGXB 2GGFA 2UY1A 2FF4A 4IE0A 4L2LA 4HFVA 1KLXA 3LY9A 2VSXE 3BEEA 2RP4A 5ETWA 4XZ4A 3JQ0A 3UUXB 3PTRB 2Y8DA 4I6JA 1U4QA 1QNFA 2D0UA 1UJJA 3HHMA 1OUVA 2PBIA 2W62A 3DPDA 4K0UA 2AXZA 1AJ3A 5FT9A 4XE0A 4ACKA 5LHIB 2K5BB 4UWGA 4CZZB 5LGUB 2V7IA 4UV9B 3VU7H 2VSNA 1H2UA 4G2AA 4KBMB 3TGOA 4EXTA 3R6NA 4CXXA 3FH7A 4U0ZA 4HEAA 3C4WA 2C0MA 3HKEE 2V7JA 5LOVE 2N9DA 3AAAB 4UXNB 3B13A 4U07A 4EAHA 2WXMA 3IKOB 3L08A 4OHFA 1D0YA 4YVQC 4D10C 4WBOA 3PREA 2H3RA 1FCHA 1IJ6A 2FEZA 2WBLA 4UVAB 3TAXA 3F31A 3S7JA 1JPLA 4JLEA 1UX5A 1HS7A 3ZFWA 3U64A 3OXGA 2NOXA 3CGHA 2XEVA 3KEZA 4I9EA 3CHQA 2I59A 4UQYA 4AKLA 5JHBA 2BF0X 4QXBB 5KJKA 5LCWJ 1BR4A 4P29A 3OXLA 3SOLA 3GZSA 3AAEB 4WW0A 3I0QA 1D1AA 3N9PA 2ACXA 3U78A 2AXUA 2CA5A 4ILHB 4ANJA 3ZW3A 4ZI7E 4FLBA 2LSYA 4UIGA 4N78D 3VTXA 1BR2A 2V1DB 1HO8A 1TJFA 3JC6D 3CVXA 2GRMA 5KX5E 2WXLA 3HIZA 3ML8A 1Y64B 3CVUA 1EPUA 3EIQC 5KCMA 1JWFA 4OYSA 4I2ZA 2MRIA 5CMYA 3G2UA 1MMNA 4JEUA 5CMWA 4YNDA 3L16A 4C91A 4WWNA 2C5KT 1G73A 4U63A 2ES0A 4I17A 1KT1A 3T5VA 1HXIA 4WNGA 4O4LE 2IU1A 5ANRA 5EX3A 2R59A 2JJ9A 2K48A 2C0LA 4H9RC 2LHNA 5EK4A 4FU3A 2L3LA 4Q96A 3CVRA 4OVUA 3CX7B 3PE3A 3PNTB 2EHOB 3AAIA 4GZ3A 1MIWA 4P0BA 3N9MA 4CT4A 3D9IA 4JEHB 3LY8A 3MJXA 1VDYA 1IZNB 1QZ2A 2VGYA 1LKXA 4HXIA 3C51A 1U3DA 2J1DG 4PH4B 3CX8B 2I1JA 4F1SA 2R17C 3MV3B 4CDNA 2DI4A 4YJ2E 3CVQA 4GYYA 4UI9K 3VKHA 3AA6B 3SZ7A 1G8XA 4EB6E 2B1EA 3AVSA 4G24A 3FXDB 4CI1B 3ZIMA 1B7TA 3N2OA 3B7SA 3NZQA 5E0OA 5LHGB 2NW7A 4AP2A 4QXHB 5LP0A 3URZA 3SGHA 3K3QC 3VLEA 4C0EA 2YHEA 2V7KA 1TEZA 2V4LA 5J08A 2R5SA 2Y3AA 2XASB 5BV1A 4IE6A 3CR3A 4Y6WA 4J0UA 3MEKA 5FY0A 3ONXA 4IE5A 5BMVE 2E9XD 4EYYR 5HI7A 2W61A 3K3NA 1T98A 3P8CD 3FUFA 1WLXA 3V5UA 4TZ4C 4LERA 3QDNA 4ATGA 2Q9QD 3ZYKA 1WM5A 3ZRHA 5AFUL 3ETUA 5JDMA 3FBLA 3NZUA 2XCCA 3S4UA 2ZMAA 3QKYA 4GZ5A 4GK0E 2DHRA 2JMKA 4ILGA 4DBRA 2KZTB 4HVBA 2Z6EA 5JR9C 4WWOA 3G2VA 3RYFE 3Q5MA 1EZ3A 4O2AE 4H9SE 2ILRA 5L3BB 4B89A 2WXGA 2K9AA 4PJMA 4CRWA 2X6FA 3JC6C 5EKQD 3PVLA 3C4ZA 4URKA 4GOUA 4UVBB 2CXFA 4N39A 1XNFA 3R84B 2I2OA 1UW4B 3CHMA 1SZAA 1E8ZA 2WXRA 5FP3A 4XKCA 2PQRA 5JRCB 3KV6A 2CWYA 4ZHQE 4AVXA 5EDSA 3RKOA 2HPJA 3MX3A 4NACA 3MKQB 3QWPA 4LUNU 5LJMA 1PY1A 3GW4A 2X9HA 3ZMZB 3MKRA 2PZIA 2G0UA 4F53A 3F2EA 2J9QA 2P9BA 3CVWA 3KVAA 3QC9A 5DJQC 3CKDA 1ELRA 3T5XA 3AU4A 4A1GA 4AKGA 3FTSA 3EHNA 4UWFA 4I4TE 3T8MA 5G04C 1ZU2A 2LHRA 3ZJ1A 2DBAA 2X51A 3PU8A 1ZHCA 4EZHA 2LSGA 4BFRA 3C50A 2CM0A 1DVPA 3FU5A 4B8AA 4PJLA 3CQGB 3DJBA 3UTKA 5L3FB 2J49A 1E7UA 5FQ6A 4PS8A 4HGAA 5M4YA 5A6CA 4WNDA 2VKDA 2YQ8A 3B7TA 4HKAA 4EBAG 2WAUA 3O9XA 2PQNA 3FUEA 2PM6A 4KMOA 4TUYE 3SBTB 4QXCB 4DO0A 2JMHA 4AXPA 5LA6E 5HXSA 2RD0A 2D5UA 1EDUA 3L09A 3LYAA 2N1GA 4GAAA 3ASHA 2MOZA 1LVKA 2I1KA 5C1DA 2WXPA 4Z8XA 4DK5A 5LG4A 4TRQA 3ZHEA 2E9XC 3IEGA 5HXHA 5KDMC 2ZLYA 3N9QA 4ZOLE 1YD8G 5HWYA 2CWOA 2A2FX 2Q9QC 3CKBA 1OXZA 5KJNA 4I2WA 5JVDE 4F6RC 4DNDA 4G11A 1HF8A 3W15B 4J8SA 1D1BA 1MNDA 2XAQB 5F3JA 3EJNA 5LBMA 4JZYA 4QX8B 2X0LB 3Q15A 2W63A 4ASKA 3FUIA 3FHEA 4JA9A 1OWPA 4FI5A 3J7Yq 3QJZA 1IQRA 4IE7A 2WVIA 4XI9A 2XHEB 3S7DA 2VYIA 2LO6A 1OWLA 4B6XA 1YW0A 2VQ2A 3R7RA 1WY6A 2LOSA 1U3CA 5FQ7A 4F3VA 4H9QC 4ISSA 3PE4A 4E85A 4PJJA 2L9QA 5CHEE 5AYWD 3KBTA 1HX8A 3KDSE 4IGUA 3QK6A 1P5QA 3UUNA 5IHYA 5A23A 3FFLA 2V0PA 3B57A 4BWRA 5JJTA 3HYMB 4UF0A 2IAKA 3AS8A 2C2LA 2DCPA 2EQXA 1H0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMO A;  2WM9 A;  3VHL A;  2WMN A;  2YIN A;  3B13 A; 
#chains in the Genus database with same CATH topology
 2DL1 A;  2A72 A;  3C72 A;  3UIN C;  4HLE A;  3NKZ A;  4WZX A;  4DMV A;  1FJG T;  3PH0 C;  3Q78 A;  4HFG A;  4FA6 A;  4R7L A;  2WU5 A;  1I94 T;  2DWK A;  3TWV A;  4X5T A;  4NXN T;  3M3Z B;  4G8K A;  4EOZ B;  2LSV A;  4AKI A;  3RH3 A;  2QVA A;  2WU2 A;  3FTW A;  5JDG A;  2P58 C;  4ILU A;  3UKR G;  1BI8 B;  3JAE A;  5EZY E;  5KNH D;  2V6Y A;  1DCQ A;  2IW5 B;  3ZLI A;  2XGS A;  2JQ9 A;  1Z0P A;  4U0S A;  4A98 A;  2VL0 A;  2FUL A;  4APO A;  1EF1 C;  3ZKJ A;  4CGW A;  1OCC E;  3L39 A;  3HVE B;  2YEV C;  3FDH A;  3AE9 A;  4QKN A;  4UWH A;  1W3B A;  3LDZ A;  4MS6 A;  3O1I A;  3U4T A;  3RRM B;  1JNR A;  3OKQ A;  3Q7A A;  4EEC A;  3HG0 D;  1BR0 A;  3LVR E;  5AN8 A;  1OCO E;  3FTV A;  3FY4 A;  4GCO A;  1SHZ C;  4ANV A;  3AVR A;  1BLX B;  4UQZ A;  4DR2 T;  3LVQ E;  4BAY B;  5LHH B;  3UUX A;  3I4G A;  4CQI A;  3P1U A;  5FXV A;  4EZ4 A;  3KFW X;  4JV5 T;  3C3Q A;  2DYR E;  4Z91 A;  3BUA A;  4CT0 A;  1UUR A;  1O1R A;  2D2S A;  3DSW A;  4PK5 A;  1D0X A;  2RA1 A;  3CWZ B;  3TLT A;  3JCK C;  4NXM T;  2MAW A;  3SY2 A;  5L3D B;  4YSX A;  4N3C A;  1BU9 A;  1XMO T;  3ZT5 A;  4E7S A;  5T3R A;  2X6J A;  4YJ3 E;  3UFG A;  3QNK A;  4I1O B;  3PUW F;  2UY1 B;  2J47 A;  3P50 A;  3J9X 1;  3O4Z A;  4A3T A;  3IBP A;  3EAM A;  3ZT6 A;  2D0T A;  1HX1 B;  3MGB A;  1IBM T;  2XQ6 A;  2XPY A;  2XZE A;  4XBF B;  1HU3 A;  3WAJ A;  2X67 A;  1N4R A;  3FU0 A;  4BJN A;  2NTY A;  4MAL A;  5JR9 B;  4OYJ A;  3ZJ2 A;  3UPV A;  1OWN A;  4GYS A;  4PDX A;  3RYH E;  4LF9 T;  3UQ4 A;  3CLJ A;  1W0A A;  2SPC A;  3FB2 A;  1S94 A;  1Y01 A;  2KT9 A;  5CA0 E;  1AP7 A;  3HXD A;  2PTF A;  4PS7 A;  3LK3 B;  3VHL A;  2VQE T;  2P2C P;  4TXR A;  4G26 A;  2QFC A;  3C3R A;  1UJK A;  3HA4 A;  4CDM A;  4KZ0 A;  5JDQ A;  2V7M A;  1DC2 A;  2DWZ A;  4O4H E;  1UUS A;  2BKP A;  3C5R A;  2LRK A;  3DRA A;  2R02 A;  2P9N G;  2VWA A;  4UV8 B;  4CN4 A;  3AEC A;  3TLV A;  3AE1 A;  2EIL E;  4ZXL A;  5AAR A;  1W09 A;  4AI6 A;  2UXD T;  3FUH A;  5DQW A;  5AQH B;  3V5S A;  3V30 A;  4ILB A;  3OVU A;  4Y6C A;  3TKL B;  4AEZ C;  4CEM A;  2XRZ A;  5ENS D;  2YN6 A;  3JUE A;  1J5W A;  4GU5 A;  4TN7 B;  4TWH A;  3PDY A;  3UT4 A;  5EYL A;  2IC6 A;  4OFZ A;  5G05 J;  3D9O A;  4LF6 T;  4L23 A;  4LMJ A;  1UOH A;  1N11 A;  5JDN A;  3DXK G;  2MYS A;  4XKB A;  4EPZ A;  3T8O A;  1SW6 A;  2XQ5 A;  3UUL A;  2P9U G;  3ZMT B;  4UR9 A;  1MNE A;  5FY1 A;  2WMN A;  2WB2 A;  1X5B A;  4KBQ A;  1DU2 A;  2KXP B;  5AEN A;  5H7P A;  3APC A;  1GQE A;  1ZV4 X;  2XQ8 A;  4I50 E;  3W9F A;  3B7U X;  1UX4 A;  2XZT G;  4HFD A;  2X9Y A;  2CFZ A;  2KC7 A;  1WR6 A;  2IQC A;  3CVY A;  3SI5 A;  2ZM2 A;  4YTP A;  3PUG A;  2QGS A;  5FZS A;  2LNI A;  1KK7 A;  4JUY A;  2FUP A;  1LF8 A;  4EQF A;  2KMF A;  2CHX A;  3V31 A;  1AWC B;  3EHM A;  4C90 A;  2C5J A;  3AXJ A;  2KWH A;  3CHO A;  4AOF A;  5LBQ B;  3CHR A;  3ZPO A;  4J8Y A;  3UU5 A;  4U8V D;  3TWU A;  3QUJ A;  2WXN A;  1X79 A;  2KAT A;  3ENE A;  2ZU6 B;  4GTS A;  4B0Z A;  5FKY A;  3LCA A;  2JQQ A;  3VRA A;  3AEA A;  3NZP A;  5FY7 A;  3CVN A;  2WXK A;  3RRW A;  2XM2 A;  3SF4 A;  5AQP B;  1LD8 A;  5LCW C;  3ISM C;  3Q5E A;  2J08 A;  3KV4 A;  3NRY A;  4DI4 A;  5IWA T;  3VR9 A;  2VKJ A;  3F57 A;  4KVO A;  5KJM A;  2KCV A;  1L5J A;  4NRH B;  1FMW A;  4LEU A;  5JJ7 A;  3ZN3 A;  2XRY A;  4L7T A;  4LNU D;  5EID A;  2YU1 A;  1TN8 A;  3CHS A;  5ARG A;  4JXT A;  3CST A;  2FBW A;  3PUQ A;  1NI1 A;  2KIN B;  5FL1 A;  3WG7 E;  2UXN B;  2WXH A;  2BKG A;  2E9X B;  5FYM A;  1MMD A;  5BW8 C;  4I43 B;  5HCM A;  1YCS B;  3S7B A;  3P7I A;  4LG6 A;  3GYZ A;  4O1P A;  5FTP A;  3DP7 A;  3LBX A;  2W67 A;  1K3Z D;  4P1N A;  3E37 A;  1QBQ A;  4U33 A;  3FUM A;  3NB2 A;  5FVK A;  1KNR A;  2AXV A;  2Q9Q B;  5C2Y A;  3PV0 F;  5FWQ A;  1L0V A;  3RU0 A;  4X1I E;  2BKK B;  3I5P A;  3QC1 A;  4APF A;  2M6I A;  3ZPJ A;  2V26 A;  3AE5 A;  2XQY A;  3VR8 A;  4HNA D;  1O1T A;  2MPK A;  4P09 A;  3OTO T;  2VJ8 A;  3UMV A;  5M72 A;  3Q4A B;  3FH5 A;  3O1J A;  4TX5 A;  2PFV A;  3ZMV B;  1HE8 A;  4J8D A;  5E75 A;  2X9W A;  1OWO A;  4H7X A;  1U5P A;  4DLQ A;  4AKH A;  4ILI A;  4WNE A;  1XDP A;  4Z68 A;  5ARF A;  4I1A A;  4AQY T;  3MJW A;  2Y48 B;  1N4P A;  2DZN A;  1E7V A;  2M67 A;  3QNU A;  4JD2 G;  2CEA A;  3SFD A;  3ULQ A;  4DV3 T;  1QUU A;  3P2B A;  5JH7 E;  2UXB T;  3PDN A;  3MKD A;  4QH4 A;  3ZGQ A;  5J2U E;  5CED B;  4GPK A;  4U2Z A;  2WM9 A;  3HKB E;  2IIU A;  4KZC A;  3PE0 A;  4AJW A;  4K03 A;  5AQT B;  3ZN0 B;  3S2A A;  2WQ7 A;  3AA0 B;  4F7A A;  3RAU A;  5HAX A;  1T72 A;  3ZXS A;  3O1H A;  5IYZ E;  2XQ4 A;  5CA1 E;  1NFI E;  3KSQ A;  5HYA A;  1OY3 D;  4L9I A;  3LPZ A;  3Q7F A;  5AJD A;  4DX6 D;  2BTD A;  2XEN A;  2IOS A;  2XSB A;  4EZL A;  3PZD A;  4I1M A;  1HNW T;  2W0G A;  5CB4 E;  2AE9 A;  3JUI A;  2HPL A;  3R9A B;  2L6J A;  4IHJ E;  3RHW A;  3LJ3 A;  3MCX A;  4NUV A;  1UN8 A;  4EBA A;  3FUN A;  2WQY A;  4WYV A;  3AJI A;  4EZJ A;  4X20 E;  2B6C A;  2XPK A;  1E96 B;  2XS8 A;  4U74 A;  2R6G F;  3RX6 A;  4H9O C;  1NZN A;  2XUE A;  4JPS A;  3E22 E;  2KCK A;  2LSI A;  1MQS A;  2BZB A;  4BT9 A;  3UIP C;  4WNK A;  1HR0 T;  3CK7 A;  4O60 A;  2JQK A;  4G2V A;  3L9T A;  4YDW A;  2E2A A;  3HR0 A;  3AE2 A;  3J5P A;  5J90 A;  1Z6T A;  4FJY A;  4LFC T;  4HE8 A;  4K0R A;  2VTB A;  5JHA A;  3AA1 B;  2CMR A;  5G04 J;  4UWK A;  2CXD A;  3SFX A;  2PNN A;  3EIJ A;  3MKQ A;  1NL4 A;  5CEA A;  2BG9 C;  2KM4 A;  4IST A;  3FU3 A;  1DNP A;  2IJG X;  3CPZ A;  1H6K A;  2V7L A;  2IDO B;  3AEF A;  4UUC A;  2XQ0 A;  2FO7 A;  4WUY A;  3ANW B;  4HN9 A;  2YDS A;  2X38 A;  3FWV A;  2LT3 A;  2ZGD A;  3I9W A;  4O2B E;  1FVH A;  5AQJ B;  4I55 E;  3PZ1 A;  2CXL A;  1LRZ A;  2N2N A;  3ZC1 A;  4DV1 T;  3FUL A;  5HEU A;  4BJM A;  5LGT B;  3K8P C;  4G1T A;  1OCZ E;  3EHQ A;  4HWF A;  4EV6 A;  4ZFH A;  4MHC A;  1ZBP A;  2VSY A;  3RRN B;  1KPS B;  4ME2 A;  4AQF A;  5BR8 T;  3PUJ A;  4DV7 T;  3BG0 B;  4DV4 T;  4XI0 A;  3TJP A;  1IXV A;  3GN5 B;  2XJ7 A;  2GRR B;  1K1B A;  1N32 T;  1N33 T;  4EEB A;  3APD A;  2E0I A;  5FIO A;  4JI0 T;  3AEE A;  3D9J A;  2KZ7 B;  2X66 A;  3UU6 A;  2V5D A;  3K9I A;  1D1C A;  2WMO A;  2XPZ A;  5D66 A;  1MHQ A;  3BK9 A;  2FJD A;  2K3W A;  4DVD A;  5EK3 A;  4RG9 A;  2WP9 A;  4DJA A;  4ILC A;  1BI7 B;  2OV8 A;  4ILA A;  4MFR A;  1FIO A;  5KMG P;  4A97 A;  3A7M A;  5FL0 A;  3FEX A;  4ADZ A;  3CVL A;  4DX1 A;  5JQG E;  1EYH A;  3LDQ B;  1V9D A;  4HWI B;  3SRZ A;  5L3G B;  1ZEE A;  3NZS A;  4IL9 A;  5HCJ A;  3B7R L;  4ZZB A;  1IHG A;  3MXZ A;  1W0B A;  3ETV A;  1UCU A;  3KIN B;  2BBH A;  3MA5 A;  4JI2 T;  4AXH A;  4NQ0 A;  4CXY A;  2HM8 A;  3UIO C;  2QY7 A;  2BED A;  3CK9 A;  5FXX A;  1E8X A;  5EIL A;  3U3W A;  3ESL A;  1H19 A;  5AIJ A;  4WNF A;  5HWX A;  5AQO B;  2DNX A;  1IQU A;  3D9H A;  3QB2 A;  4GTP A;  4AM9 A;  3R7Q A;  2J4D A;  4ANW A;  4K0K T;  3I9Y A;  4OAU C;  4U95 D;  4QHO A;  4GZ6 A;  1SQM A;  3DST A;  2VUR A;  5LJN A;  2XGM A;  2QC9 A;  3O4X E;  3LXU X;  3RRC A;  1B89 A;  5FZR A;  2Q7F A;  1S63 A;  4JA7 A;  3MAC A;  1KNZ A;  2L0T B;  4GA2 A;  1N54 A;  2F37 A;  3I3N A;  4H63 H;  3NQP A;  2DWG A;  4HI9 A;  3N2K E;  3HKD E;  2MTQ A;  3FP3 A;  3KS2 A;  1G3N B;  5LGN B;  2VKO A;  1E1H B;  4GYW A;  4F8H A;  3OYZ A;  4LF4 T;  2WDV A;  3L54 A;  1NA3 A;  3PEU B;  2XY8 B;  3EHZ A;  2LJL A;  3C98 A;  4O4J E;  3F6Q A;  3TL5 A;  5CBN A;  2CG3 A;  3ZHE B;  3CHP A;  4OVV A;  5LP6 E;  4A3V A;  3OBV E;  1E90 A;  2CHO A;  4AKR B;  3UM3 A;  5BPP A;  5CCL A;  2IFU A;  3NF1 A;  4UI9 J;  1Q2Z A;  3DBS A;  1KZP A;  4PJN A;  3CSF A;  2WS3 A;  2H89 A;  5TAO A;  3RYC E;  4DBQ A;  2AVP A;  2X68 A;  2HE0 A;  3EDV A;  2IC9 A;  4LNG A;  3CML A;  4NUR A;  4UVC B;  2E8I A;  3EUV A;  3Q5W A;  2XAF B;  3TG5 A;  3Q5D A;  3LY7 A;  5HXC A;  1MX4 A;  2LSK A;  1CUN A;  3DSV A;  4B3M T;  3U66 A;  4DLO A;  3FUJ A;  4KVM A;  4OK0 A;  3ULY A;  4GA0 A;  3C4X A;  3CEQ A;  3N9N A;  3FZK B;  3E34 A;  3IF8 B;  2CHW A;  1MYO A;  1FVF A;  5F8P A;  3ZMS B;  1TJC A;  4LF5 T;  2Y6X A;  3FTX A;  2RKK A;  3OTN A;  4RSY A;  3QWV A;  2DYS E;  4JI4 T;  4Z90 A;  2MYO A;  1US7 B;  3VTY A;  3UT8 A;  3KVB A;  4MKT A;  4DUI A;  4ANU A;  4DX5 D;  5BXO A;  4A56 A;  2A5U A;  3L6A A;  3Q5X A;  5HXR A;  2J4G A;  4L2Y A;  2WDR A;  3CIR A;  2PG8 A;  2XSA A;  3HVE A;  5FMN A;  1WDY A;  3LFM A;  3JCF A;  3HXE A;  1UN9 A;  2I6H A;  3T9K A;  2XQA A;  2NWB A;  3ZN1 B;  3MZL B;  5FZQ A;  3OJA A;  5FNV E;  5L2L A;  4ZZC A;  5H6Q B;  5L3C B;  1BD8 A;  3CK8 A;  2OEV A;  1RW2 A;  2VGX A;  1VRB A;  1YXR A;  4H63 V;  2WQ6 A;  4C9B B;  1IYG A;  3N71 A;  3ZCI A;  4WAF A;  2KWI B;  2A3D A;  1XDO A;  1M62 A;  5EK2 A;  3S7F A;  5KWD A;  3LSV A;  4AQG A;  2CCQ A;  3FUK A;  4BX9 A;  4L9P A;  3K1S A;  3OYX A;  3UQ3 A;  1TYQ G;  4KUM B;  4N5C A;  4ABN A;  4PUC A;  3BQI A;  3ONL A;  1E8Y A;  4YY3 T;  3AS4 A;  2Y4U A;  2CRB A;  2VL8 A;  3L17 A;  3DTO A;  2XAH B;  5LX8 A;  2R2L A;  1V54 E;  4UQX A;  3JQ1 A;  2A4Z A;  1XZY A;  3LK2 B;  1TR4 A;  1FMV A;  3HI2 A;  4XAX B;  2V6Y B;  4J2C A;  2YDR A;  4PAG A;  4ZS3 A;  3TWR A;  4HWH A;  5FXZ A;  3RYI E;  4BTB A;  3LG7 A;  1H2V C;  2BS2 A;  3K3O A;  4AIF A;  3AEG A;  4PK6 A;  3RF1 A;  3BQO A;  1MIV A;  3PEV B;  3RGL A;  1YA0 A;  5DAB A;  2OND A;  5T4Y A;  2QA7 A;  5LYJ E;  5ENT D;  4NUU A;  3NAW A;  1O3X A;  3ZEF B;  5T8I A;  3AED A;  4V3I A;  2V5Q C;  2ZGG A;  5CCM A;  2LE8 A;  3OAW A;  5JR9 A;  4F1P A;  3CQX C;  4BTA A;  3BQK A;  3AA7 B;  2DCF A;  2BBJ A;  5FQ4 A;  3PRZ A;  5ADX L;  3ULE G;  3RQU A;  1A17 A;  4BA9 A;  3ASN E;  4JHJ A;  1U2V G;  2V4H C;  3NBX X;  2IML A;  2LM9 A;  3ZUV B;  4AIS A;  3D9L A;  1HH8 A;  2BDE A;  3KV9 A;  1VCT A;  2NXP A;  4U72 A;  3PU3 A;  4PNI A;  4GCN A;  5CEC B;  5EN5 D;  2RG8 A;  1SE7 A;  1YMP A;  1ELK A;  4RVB A;  2LOP A;  3CV0 A;  5L3E B;  4GZC A;  2ZM8 A;  1VOM A;  5AQN B;  4FHJ A;  1S35 A;  2AW6 A;  2KLQ A;  3FZF B;  4IUL A;  5EX0 A;  1LVF A;  5HXE A;  4OYK A;  2L8K A;  3CX6 B;  4AQF C;  4RG6 A;  5LMU T;  2BUG A;  2PM7 A;  4YVO A;  3DSU A;  4K5A B;  3FBZ A;  5J2T E;  5BT1 A;  2NSZ A;  5ANL A;  3T1H T;  4TV9 E;  2K24 A;  4TNW A;  1UK5 A;  2L6B A;  1DCE A;  2BG9 B;  1H2T C;  4BER A;  4U8H A;  2YOE A;  4LRZ A;  2ETA A;  2WXI A;  3N2G E;  3VLD A;  3KSL A;  2CLY C;  2P9K G;  5IY5 E;  4Q94 A;  4IDO A;  1QYM A;  3I1A A;  2X9X A;  4GTR A;  2MOW A;  4A1S A;  2IF4 A;  2V8S E;  3PZ4 A;  2EIK E;  4QFV A;  3ZU7 B;  3LJN A;  3RI5 A;  1QSD A;  2NP9 A;  2OA5 A;  4IYP A;  3ZYQ A;  4FC8 A;  2LKH A;  3WAK A;  3RC3 A;  4J7W A;  1FT1 A;  4BX8 A;  3JYS A;  5ABF B;  3CKC A;  3T8K A;  3IHR A;  3FEY A;  2XAG B;  4DR4 T;  3Q9N C;  5FVL A;  3LKU A;  3IHY A;  2CFU A;  3EDT B;  3AE4 A;  1HFA A;  4IN3 B;  4HQD A;  1Z8U A;  4DV6 T;  3SHF A;  2VSO E;  2CPT A;  4HTE A;  4U96 D;  3GWH A;  1Y8M A;  4OX9 T;  1MMG A;  3G2T A;  4BES A;  3H37 A;  1KEY A;  3AG1 E;  2R03 A;  4L5G A;  3WXX A;  3FTU A;  3CK6 A;  4X65 T;  3DXM G;  1H7C A;  4GTM A;  2V6X A;  1XWM A;  3IV0 A;  4X1K E;  3LJC A;  5D0Q D;  2BS3 A;  3V2X A;  2JPF A;  4IDN A;  5ENQ D;  2DLR A;  2IUB A;  3ZSS A;  4LF7 T;  1XGW A;  2BKO A;  3P4P A;  3UU3 A;  1PAQ A;  2V8S V;  2WXJ A;  4GPM A;  3B5M A;  3OPC A;  5LXT E;  2Y4T A;  2P9P G;  1Z3Y A;  4X62 T;  2EHO A;  1JCQ A;  2XAJ B;  3QK0 A;  4I9C A;  2L9B A;  2NYJ A;  2XS1 A;  3ASF A;  4HI8 A;  4M7C A;  4UEM A;  3NVO A;  2IO3 C;  1MIY A;  4GML A;  4JEH A;  5G05 C;  3ZCJ A;  1E8W A;  2WWU A;  4PW8 A;  4C0M A;  4JEU B;  3E4B A;  3ESK A;  4B3S T;  4YLH A;  2HR2 A;  2XGO A;  3FH8 A;  3AB3 B;  4ZI2 D;  2I9C A;  1ZB1 A;  2E9X A;  4TUU A;  3Q75 A;  5AQ9 A;  1HG2 A;  3FTY A;  3KAE A;  4FLH A;  3AXJ B;  5AQK B;  4I43 A;  2J07 A;  2IHR 1;  4DV5 T;  2Y1L E;  4I6G A;  3PZ3 A;  2VQF T;  2LKG A;  4U31 A;  4KXK B;  4PFP A;  3J5Q B;  4AY6 A;  4FUL A;  1E2A A;  4CN6 A;  4U7Y A;  2Q9Q A;  3KV5 A;  5HEO A;  4GYR A;  1JUQ A;  2NW8 A;  5JRE A;  4TXQ A;  4N3A A;  2MHK A;  3KEA A;  5B1A E;  1KT0 A;  4G25 A;  3ABK E;  4BEP A;  3B7B A;  4PS3 A;  4J8F A;  3VLF A;  3ZYL A;  3E08 A;  4UEL A;  4CXW A;  3RC8 A;  2OVF A;  3CVP A;  4HS2 A;  3EVY A;  1D0Z A;  1WG0 A;  5ITZ F;  5GON E;  1IJ5 A;  4G63 A;  2XTL A;  4ZEY A;  4U0U A;  5JJ6 A;  1TN6 A;  3UX4 A;  4N2S A;  4FP7 A;  1XNQ T;  2JLB A;  4U04 A;  4M3O A;  4V1A v;  4KT6 B;  4CN1 A;  4DR5 T;  5CBO A;  3MV2 B;  1N95 A;  4JC8 A;  2AWI A;  3BQL A;  4FJO A;  2VVS A;  5CJ5 A;  3AG4 E;  2XPI A;  3KD7 A;  4HFE A;  1WYC A;  2LXM A;  4HFH A;  4DR6 T;  4DX2 A;  1OWM A;  1WYB A;  4KI0 F;  3SD5 A;  1IAP A;  3LBX B;  2GRO B;  5G55 A;  3SFZ A;  2BG9 E;  3PUA A;  3MYV A;  1QLB A;  1N34 T;  5JDF A;  1OED A;  2PJQ A;  2WXF A;  5ENN A;  1HNZ T;  2MBG A;  4JI5 T;  2QZA A;  4N2Q A;  3PUR A;  4E7Z A;  1H6O A;  1YQ4 A;  2OOE A;  3HDX A;  4Q69 A;  2YK0 A;  2EHO D;  4CGV A;  1N94 A;  4IRU A;  3HL6 A;  4KP3 C;  4GZD A;  2M63 A;  1N52 A;  2KCL A;  5AJL A;  5G2N A;  3PUX F;  2IOL A;  4B94 A;  3ABV A;  4H9P C;  3FXE B;  3QOU A;  3P4W A;  3GMI A;  3ZMU B;  5KBA A;  3UM1 A;  2NW9 A;  3DSX A;  4AV7 A;  4MBQ A;  4X1Y E;  2I0M A;  2VB6 A;  2KND A;  2KZT A;  1HG5 A;  4HOQ A;  4O4I E;  3CIA A;  4ZI3 D;  2WXO A;  3LEW A;  5JDL A;  3ONL C;  5AQI B;  1GW6 A;  4QQI A;  4GTV A;  5L4E A;  3BG1 B;  4GB9 A;  1QQE A;  3R9M A;  1BR1 A;  2C0S A;  2ODV A;  1TNY A;  2HN2 A;  2XEH A;  4EIW A;  4JHR A;  3EU5 A;  1O1S A;  5DIZ A;  4FJZ A;  1NWM X;  3ZXP A;  4L1B A;  2C5I T;  3AS5 A;  3FTZ A;  1NP7 A;  2L0I A;  3O48 A;  4XIF A;  3ZVV A;  2LSJ A;  4CI2 B;  3CVV A;  2X6K A;  3TXM A;  1K8K G;  2GK9 A;  1S0P A;  4LNB A;  2LEH A;  3SQV A;  4NPP A;  5AAO A;  2PL2 A;  2UU9 T;  2GRP B;  3FU6 A;  1WAO 1;  3G2W A;  2GW1 A;  3KBU A;  3TWX A;  5JRC A;  3DEO A;  3AAA C;  5D0O D;  3D3M A;  5ABE A;  4RLY A;  5FJY A;  4XZC A;  5LG3 A;  2YU2 A;  4JI1 T;  4B3T T;  4GKJ T;  4EYU A;  4TNV A;  3ANW A;  3PNL B;  2RFM A;  3UUM A;  4DI3 A;  3IHV A;  4J6I A;  4O8S A;  2WZI A;  2H88 A;  2XEE A;  5B3S E;  3BU8 A;  1JWG A;  2WPV A;  5C8Y E;  3MA9 A;  2DIW A;  3UT7 A;  3C64 A;  3Q79 A;  1SA4 A;  4HOS A;  3SNX A;  2X6H A;  3N9O A;  2HH7 A;  2LM2 A;  3FHN A;  3VKG A;  3QOF A;  2H6I A;  4LSZ E;  5HRY A;  2GRL A;  3LK4 2;  3U3I A;  4GKK T;  4M1P A;  4GIW A;  5FQ8 A;  4PFO A;  3RO2 A;  3QAQ A;  4GYO A;  2VTB B;  4O6F A;  1SVX A;  3GN5 A;  1YKH B;  3RLF F;  5LFA A;  1HCI A;  3ONJ A;  1SZ9 A;  5CRV A;  2J4B A;  4COF A;  3HXF A;  4LFB T;  3PUK A;  4ZI2 C;  1PC2 A;  2E5V A;  3L22 A;  4ERR A;  4YSZ A;  3ONK A;  4JHK A;  3P4R A;  3PUS A;  1KNP A;  3ASD A;  3E0Z A;  1ELW A;  4HOU A;  4W9R A;  1FPP A;  3IBE A;  3APF A;  2B0O E;  2QYJ A;  4HOR A;  4CDR A;  3PJA J;  3C3O A;  4GA1 A;  5HQ8 A;  5JDH A;  5A1L A;  1HZ4 A;  4G23 A;  3EI0 A;  5KNG A;  4MBG A;  5HEH A;  5JTG A;  1OCR E;  3D9N A;  2QYU A;  4JB8 P;  2IO2 C;  4LMK A;  5DBK A;  2OCC E;  1FEW A;  1OT8 A;  3AEB A;  2UUA T;  2FI7 A;  3WI3 A;  1RZ4 A;  4CI3 B;  1MX6 A;  4U3C A;  2CHZ A;  5DQV A;  3EDU A;  4WWP A;  3ZYM A;  3ZC0 A;  5AQV B;  2QYW A;  3RRU A;  2BVL A;  2UWJ G;  3NOG D;  3RKV A;  4GTQ A;  2UUB T;  5BUZ A;  3Q2M A;  1IKN D;  3I4R B;  3Q49 B;  5A7D B;  4H9N C;  4IT4 A;  3TWW A;  5KXJ A;  1HS6 A;  3JXI A;  5LNK A;  5FXW A;  2CLY B;  2J8S D;  1XNR T;  1S70 B;  2J62 A;  4LCT A;  4A55 A;  3D9K A;  1K1A A;  4WBN E;  4TWF A;  4IRE A;  3SBS A;  2ODU A;  3G2S A;  4JW1 A;  4ZS2 A;  4E6H A;  4A5X A;  2ZM6 T;  2EHO C;  1MMA A;  4TV8 E;  2XCB A;  2EIN E;  3MZK B;  4J8E A;  4TV3 A;  5KJL A;  2ETC A;  2YNQ A;  4KMC A;  3L3P A;  5H6R B;  4IDZ A;  4XEI G;  3GZ2 A;  2E2E A;  2XQ9 A;  3HKC E;  2V5F A;  4ZI3 C;  1N0R A;  4YFS A;  5L47 A;  2JEK A;  4HOT A;  4GMJ A;  4MLK A;  1KF6 A;  2HYZ A;  3ZT7 A;  4DUY T;  1LD7 A;  2X6I A;  2WQH A;  3UFE A;  3I0O A;  4IE4 A;  2XHE A;  2JRK A;  3D0T A;  4ATZ D;  4FAD A;  5LOZ A;  2WXQ A;  3EUH A;  2J09 A;  3HRA A;  2X3M A;  3E33 A;  3RJV A;  2W4X A;  2H7O A;  3AE6 A;  4ANX A;  5BNW A;  3PUY F;  2BVM A;  2WY2 A;  3AU5 A;  3RIB A;  2LAH A;  3H3A A;  2ZM0 A;  1NAF A;  3TXN A;  4BSX A;  2ION A;  2CE7 A;  4PK4 A;  3CQC B;  3PZ2 A;  1ZKE A;  5ABH A;  2H6F A;  2P9L G;  3TLU A;  3QAR A;  4XX5 A;  3TG4 A;  2FJA A;  3L13 A;  4BT8 A;  2VK9 A;  3Q9D A;  4QX7 B;  2RPA A;  3N5L A;  3U9W A;  2YIN A;  1TNB A;  4JL0 A;  3D9M A;  2CHN A;  4YHJ A;  4I0U A;  3C98 B;  3FUD A;  3LS8 A;  2EIJ E;  4I6E A;  1NA0 A;  3RO3 A;  1YKE B;  3Q47 B;  4DV0 T;  4FHK A;  5HS0 A;  4AY5 A;  2RFA A;  3M65 A;  4CCA A;  3IEE A;  1UG3 A;  1HTJ F;  4IIJ E;  3GA8 A;  2OVB A;  2NC9 A;  1BPO A;  4GK5 E;  3QWW A;  4DPR A;  5AQM B;  1WRD A;  2UXX B;  4QWN B;  3JXJ A;  3ML9 A;  2CBI A;  4H7Y A;  4KYO B;  4JVS A;  3OXF A;  1OED C;  4MLP A;  4N3B A;  4UWL A;  1SA0 E;  2WSS V;  2H7V C;  2HO1 A;  1Y6I A;  2WDQ A;  5BV0 A;  3N9L A;  3PS6 A;  5LCY A;  3SS1 A;  4B8C B;  1E7P A;  3RIA A;  4L0R A;  1INZ A;  2CG2 A;  2LAI A;  3RPU A;  1Z3X A;  4YXD A;  4UI9 C;  1TNZ A;  3A5X A;  2NTX A;  4MRU A;  3ASG A;  4UF0 B;  5E76 A;  4DMW A;  3RK6 A;  3NRX A;  5J1G A;  3GZ1 A;  2LSU A;  5AQL B;  3UUB A;  2BS4 A;  2DVW A;  3RIU A;  4ACL A;  3SWH A;  2VKH A;  2X0H A;  2YHC A;  2FBN A;  1NEK A;  4IL4 A;  2XM1 A;  4IDP A;  4P0A A;  2F0Y A;  3P4Q A;  1S64 A;  4DID B;  1OWA A;  2VAS A;  2LRL A;  3D9P A;  4EZK A;  4BY6 A;  3FZL B;  1Z5S C;  3ZEF A;  3MK7 C;  3UT5 E;  5HKP A;  2W00 A;  4GMR A;  2XZD G;  1IBK T;  2VGX B;  2GGF A;  3UM0 A;  2UY1 A;  2FF4 A;  5AQF B;  4IE0 A;  4HLL A;  4L2L A;  4HFV A;  5CFB A;  1KLX A;  3LY9 A;  2VSX E;  3BEE A;  2RP4 A;  2XQ3 A;  5ETW A;  4KX6 A;  4XZ4 A;  4YSY A;  3JQ0 A;  3TWQ A;  2IY0 C;  3UUX B;  4HB5 A;  3PTR B;  2Y8D A;  4I6J A;  1U4Q A;  1QNF A;  2D0U A;  1UJJ A;  3HHM A;  1OUV A;  2PBI A;  2W62 A;  3DPD A;  4K0U A;  2AXZ A;  1AJ3 A;  1SA5 A;  5ENP D;  5FT9 A;  4YDO A;  4KHP T;  4XE0 A;  1D9S A;  4ACK A;  5LHI B;  2K5B B;  4UWG A;  5CER B;  4CZZ B;  5LGU B;  2V7I A;  5HEJ A;  3UXG A;  4UV9 B;  1T8B A;  3VU7 H;  2VSN A;  1H2U A;  2WWV A;  4G2A A;  4KBM B;  3TGO A;  2V5C A;  3QB5 K;  5ABG A;  3EAB A;  4EXT A;  1O5M A;  4HRN A;  3R6N A;  5FIN A;  4CXX A;  1IBL T;  3FH7 A;  3DWL G;  4BSZ B;  4U0Z A;  4HEA A;  3C4W A;  2C0M A;  2BG9 A;  1CHU A;  3HKE E;  2V7J A;  5LOV E;  2GRQ B;  2N9D A;  2KBX A;  3AAA B;  4UXN B;  3B13 A;  4JI6 T;  4U07 A;  4EAH A;  1UGO A;  2WXM A;  3IKO B;  5L4H A;  3L08 A;  4OHF A;  1D0Y A;  3DEP A;  3Q9U C;  4YVQ C;  4D10 C;  4WBO A;  3PRE A;  2H3R A;  1FCH A;  5AQ7 A;  1IJ6 A;  2FEZ A;  3W9G A;  3X2Q E;  2WBL A;  4UVA B;  2X0Y A;  3RIF A;  3TAX A;  3F31 A;  3TWS A;  3S7J A;  1JPL A;  2QRX A;  1UX5 A;  2WZH A;  4JLE A;  1HS7 A;  3QB5 A;  3ZFW A;  5ABF A;  3U64 A;  2UUC T;  3OXG A;  3AE3 A;  4HRL A;  2NOX A;  3IA3 A;  3CGH A;  2XEV A;  3E32 A;  3KEZ A;  4I9E A;  3CHQ A;  2I59 A;  4UQY A;  5AQR B;  4AKL A;  5JHB A;  2BF0 X;  4QXB B;  1OXJ A;  2WB5 A;  4EED A;  5KJK A;  3SO8 A;  1KFY A;  5LCW J;  4JI3 T;  1BR4 A;  2ETB A;  2FJB A;  4P29 A;  3OXL A;  4HWC A;  3SOL A;  3GZS A;  4LFA T;  3AAE B;  4U7I A;  3UU8 A;  4WW0 A;  3PUV F;  3SFY A;  3I0Q A;  1D1A A;  3N9P A;  2ACX A;  4O1O A;  3U78 A;  2AXU A;  2CA5 A;  4ILH B;  4ANJ A;  3ZW3 A;  4ZI7 E;  4FLB A;  2LSY A;  4UIG A;  3L82 A;  4N78 D;  3E30 A;  1XMQ T;  3NOC D;  3VTX A;  4JI8 T;  1BR2 A;  3ZST A;  2V1D B;  1HO8 A;  2OV9 A;  3JC6 D;  1TJF A;  4X8Q A;  3CVX A;  2GRM A;  5KX5 E;  2WXL A;  3HIZ A;  3HXB A;  3ML8 A;  1Y64 B;  3CVU A;  2DZO A;  1EPU A;  3EIQ C;  4HFB A;  5KCM A;  1JWF A;  3UQ7 A;  3DSS A;  4OYS A;  4I2Z A;  2MRI A;  2JIW A;  2VGE A;  3G2U A;  5CMY A;  1MMN A;  4JEU A;  5CMW A;  4YND A;  3L16 A;  4QH5 A;  4C91 A;  4WWN A;  2C5K T;  5LB7 B;  1G73 A;  4U63 A;  5JMN D;  2ES0 A;  4I17 A;  2M6B A;  1KT1 A;  3T5V A;  3PJA A;  4A63 B;  1HXI A;  4WNG A;  4O4L E;  3UM2 A;  2IU1 A;  2ACZ A;  2P9I G;  5ANR A;  5EX3 A;  3ASO E;  2E5L T;  2R59 A;  3UKU G;  1JCS A;  3PUZ F;  2JJ9 A;  2K48 A;  2C0L A;  4H9R C;  2LHN A;  4DR7 T;  5EK4 A;  2F8X K;  4FU3 A;  2JQH A;  2L3L A;  4Q96 A;  3CVR A;  4OVU A;  4ZHB A;  3A8Y C;  4JYA T;  4DX7 D;  2FJE A;  3CX7 B;  1X81 A;  2A9U A;  3PE3 A;  3PNT B;  2EHO B;  3AAI A;  4GZ3 A;  5EIB E;  1MIW A;  4P0B A;  3N9M A;  2AJA A;  4CT4 A;  3D9I A;  4JEH B;  3LY8 A;  2Y69 E;  3MJX A;  1VDY A;  2UXC T;  1IZN B;  1IHB A;  2H6H A;  4B3R T;  3EHR A;  3ZNG A;  1QZ2 A;  2VGY A;  1LKX A;  3IXE A;  4HXI A;  4HBD A;  3C51 A;  3RSE G;  1U3D A;  2J1D G;  4PH4 B;  2GRN B;  3CX8 B;  2I1J A;  4F1S A;  5HEG A;  2R17 C;  4G8L A;  4NIK A;  3MV3 B;  4CDN A;  1HNX T;  5JA4 D;  2DI4 A;  4YJ2 E;  3CVQ A;  4GYY A;  4UI9 K;  3VKH A;  3AA6 B;  1WCR A;  3SZ7 A;  4OAV B;  1G8X A;  4EB6 E;  1T7S A;  2B1E A;  3AVS A;  4G24 A;  3HXC A;  3FXD B;  1J1J A;  4CI1 B;  5F5W A;  3ZIM A;  1B7T A;  3UI2 A;  3RKG A;  3N2O A;  3B7S A;  3NZQ A;  5E0O A;  3G06 A;  5LHG B;  3X1D A;  1W9R A;  5BXU A;  4DR1 T;  2NW7 A;  4AP2 A;  4QXH B;  4TWD A;  5LP0 A;  3URZ A;  2H6G A;  3SGH A;  3K3Q C;  3VLE A;  4C0E A;  2YHE A;  4C48 B;  3FZH B;  2V7K A;  1TEZ A;  2V4L A;  5J08 A;  5AQG B;  2R5S A;  2Y3A A;  2XAS B;  5J0Z A;  5BV1 A;  4IE6 A;  3CR3 A;  2OEW A;  4Y6W A;  4J0U A;  5LMN T;  3MEK A;  5FY0 A;  3ONX A;  4IE5 A;  3RIU C;  5BMV E;  2E9X D;  4EYY R;  5CGM A;  5HI7 A;  2W61 A;  3K3N A;  4IDQ A;  3VRB A;  1T98 A;  3P8C D;  3FUF A;  2FO1 E;  1WLX A;  3V5U A;  4TZ4 C;  3T1Y T;  4LER A;  3QDN A;  4ATG A;  1J5E T;  2Q9Q D;  3ZYK A;  1OED B;  1R8I A;  2LXL A;  1WM5 A;  1N0Q A;  3ZRH A;  1TNO A;  4HFC A;  5AQA A;  5AFU L;  2F4V T;  3ETU A;  4F6R D;  5JDM A;  3EU9 A;  3FBL A;  3NZU A;  2XCC A;  3S4U A;  2ZMA A;  3UU4 A;  1N36 T;  3ABM E;  4LF8 T;  1A5E A;  4QH1 A;  3QKY A;  2WCA A;  4GZ5 A;  4GK0 E;  2DHR A;  1N4S A;  2JMK A;  2CBJ A;  2Y0B G;  4K5C A;  4ILG A;  4DBR A;  2KZT B;  4HVB A;  2Z6E A;  1ZP0 A;  5D2M C;  5JR9 C;  4WWO A;  3G2V A;  3RYF E;  3Q5M A;  1EZ3 A;  4O2A E;  1WFD A;  4H9S E;  2ILR A;  5L3B B;  4B89 A;  1ZOY A;  2WXG A;  3V79 K;  2K9A A;  4PJM A;  4CRW A;  1VCS A;  4YT0 A;  2X6F A;  2XQ7 A;  3JC6 C;  5EKQ D;  3PVL A;  2ZIR A;  3C4Z A;  1TNU A;  4URK A;  1NEN A;  4GOU A;  4HWD A;  1SUM B;  3AE7 A;  4UVB B;  2CXF A;  4YDY A;  4U2Y A;  4N39 A;  2HN1 A;  5C2T A;  1XNF A;  3R84 B;  4YDE A;  2I2O A;  1D8E A;  1UW4 B;  3CHM A;  1SZA A;  1E8Z A;  4X64 T;  4CZ2 D;  2WXR A;  3NWI A;  5FP3 A;  4XKC A;  2YDQ A;  2PQR A;  5JRC B;  3KV6 A;  2CWY A;  4ZHQ E;  4AVX A;  5EDS A;  3ABL E;  3RKO A;  4GTO A;  4EHM A;  2HPJ A;  3MX3 A;  4NAC A;  3MKQ B;  3QWP A;  4LUN U;  1X9B A;  5LJM A;  1V55 E;  4TUM A;  4DRX E;  4U8Y D;  1PY1 A;  2B76 A;  2X9H A;  3ZMZ B;  3GW4 A;  3MKR A;  2PZI A;  3FZM B;  2G0U A;  4F53 A;  3F2E A;  2J9Q A;  4RQI A;  2P9B A;  1N9A A;  4DR3 T;  2LLY A;  3KVA A;  3UTM A;  3NBN B;  3QC9 A;  4JBW F;  5ENR D;  3CVW A;  5DJQ C;  3CKD A;  1ELR A;  3T5X A;  3AU4 A;  4A1G A;  4AKG A;  3FTS A;  3EHN A;  1KZO A;  4UWF A;  2KXP C;  4YHH T;  2VVN A;  4I4T E;  2JAB A;  5G04 C;  3T8M A;  1ZU2 A;  2LHR A;  3ZJ1 A;  5CRU A;  2DBA A;  3TLS A;  2X51 A;  3L8R A;  5AQQ B;  3PU8 A;  4YTN A;  1ZHC A;  4EZH A;  2LSG A;  4BFR A;  3C50 A;  2CM0 A;  1DVP A;  3FU5 A;  1I6Z A;  5AQS B;  2OLT A;  4HFI A;  4B8A A;  4PJL A;  4N5Q A;  4U7E B;  1MX2 A;  3CQG B;  1YYH A;  3DJB A;  2ZXW E;  4BET A;  3UTK A;  5L3F B;  2J49 A;  1E7U A;  4DV2 T;  2HHH T;  5FQ6 A;  4PS8 A;  4HGA A;  4AIU A;  5M4Y A;  5A6C A;  4WND A;  2VKD A;  1TN7 A;  2YQ8 A;  3B7T A;  4HKA A;  4EBA G;  2R05 A;  2WAU A;  3O9X A;  3ZKR A;  2PQN A;  3FUE A;  2PM6 A;  3JAD A;  5AQB A;  4KMO A;  4TUY E;  4DUZ T;  3SBT B;  4QXC B;  4DO0 A;  2JMH A;  2A5E A;  4AXP A;  5LA6 E;  5HXS A;  4NIQ A;  2RD0 A;  2D5U A;  1EDU A;  3L09 A;  3LYA A;  1JNZ A;  2N1G A;  2KSR A;  4GAA A;  3ASH A;  5AQU B;  2MOZ A;  1LVK A;  2I1K A;  5C1D A;  4X66 T;  1OED E;  2WXP A;  1N4Q A;  4Z8X A;  4KHZ F;  4DK5 A;  3V2O A;  5B1B E;  5LG4 A;  2ZIS A;  4TRQ A;  2BKN A;  3ZHE A;  4CYM D;  2E9X C;  2IEJ A;  1MZC A;  1M7K A;  3RQW A;  3IEG A;  5HXH A;  5KDM C;  4B93 B;  4GTT A;  2ZLY A;  3N9Q A;  4ZOL E;  3B95 A;  1H6P A;  1YD8 G;  5HWY A;  2CWO A;  2W2U A;  2A2F X;  2Q9Q C;  3CKB A;  1OXZ A;  5KJN A;  4I2W A;  5JVD E;  4F6R C;  4DND A;  2F8Y A;  4G11 A;  1HF8 A;  3W15 B;  4J8S A;  1D1B A;  1MND A;  2XAQ B;  5F3J A;  4EGW A;  3EJN A;  5LBM A;  4HRM B;  2EIM E;  4QX8 B;  4JZY A;  2P9S G;  2X0L B;  1JCR A;  2W66 A;  3SFE A;  3Q15 A;  3Q73 A;  2W63 A;  4ASK A;  5IUX A;  2LUH A;  3FUI A;  3FHE A;  4JA9 A;  1D8D A;  4Q25 A;  3DPY A;  1OWP A;  3TWT A;  4FI5 A;  3J7Y q;  1MJ0 A;  3QJZ A;  3AE8 A;  1IQR A;  2D9D A;  4IE7 A;  2WVI A;  2NR4 A;  1WR0 A;  4XI9 A;  2XHE B;  3S7D A;  2VYI A;  4LML A;  2LO6 A;  1OWL A;  3TLW A;  4B6X A;  1YW0 A;  2VQ2 A;  3R7R A;  3AG3 E;  1WY6 A;  2LOS A;  4YTM A;  1U3C A;  5FQ7 A;  4TXP A;  4F3V A;  4H9Q C;  1LTX A;  3H3M A;  4ISS A;  3PE4 A;  4E85 A;  4K5B A;  4PJJ A;  4JI7 T;  3AG2 E;  2L9Q A;  5C3J A;  5CHE E;  5AYW D;  3KBT A;  1HX8 A;  3KDS E;  3P4S A;  4IGU A;  3QK6 A;  1P5Q A;  3UUN A;  5IHY A;  5ENO D;  5A23 A;  3FFL A;  2V0P A;  3B57 A;  5EYP F;  4BWR A;  5JJT A;  3HYM B;  2AXD S;  4UF0 A;  3JAF A;  2IAK A;  1FT2 A;  3AS8 A;  2C2L A;  2DCP A;  2EQX A;  1YQ3 A;  2YKS A;  1H0A A; 
#chains in the Genus database with same CATH homology
 2A72 A;  4HLE A;  4DMV A;  3PH0 C;  4HFG A;  4FA6 A;  4R7L A;  2DWK A;  4EOZ B;  2LSV A;  4AKI A;  3RH3 A;  3FTW A;  5JDG A;  2P58 C;  4ILU A;  5EZY E;  2IW5 B;  3ZLI A;  2XGS A;  1Z0P A;  4U0S A;  2FUL A;  4APO A;  1EF1 C;  4CGW A;  3HVE B;  2YEV C;  3FDH A;  4QKN A;  4UWH A;  1W3B A;  3LDZ A;  4MS6 A;  3O1I A;  3U4T A;  3RRM B;  3OKQ A;  4EEC A;  1BR0 A;  3LVR E;  3FTV A;  3FY4 A;  4GCO A;  1SHZ C;  4ANV A;  3AVR A;  4UQZ A;  3LVQ E;  4BAY B;  5LHH B;  3UUX A;  3I4G A;  4CQI A;  3P1U A;  5FXV A;  4EZ4 A;  3KFW X;  4CT0 A;  2D2S A;  4PK5 A;  1D0X A;  2RA1 A;  3CWZ B;  3JCK C;  5L3D B;  4N3C A;  4E7S A;  5T3R A;  2X6J A;  4YJ3 E;  3QNK A;  4I1O B;  2UY1 B;  3J9X 1;  3O4Z A;  4A3T A;  3IBP A;  2D0T A;  3MGB A;  2XPY A;  4XBF B;  1HU3 A;  3WAJ A;  2X67 A;  3FU0 A;  4BJN A;  2NTY A;  4MAL A;  5JR9 B;  4OYJ A;  3ZJ2 A;  3UPV A;  1OWN A;  4GYS A;  4PDX A;  3RYH E;  3CLJ A;  2SPC A;  3FB2 A;  1S94 A;  5CA0 E;  2KT9 A;  4PS7 A;  3LK3 B;  3VHL A;  4G26 A;  2QFC A;  1UJK A;  3HA4 A;  4CDM A;  4KZ0 A;  5JDQ A;  2V7M A;  4O4H E;  2VWA A;  4UV8 B;  4AI6 A;  3FUH A;  5DQW A;  3V5S A;  4Y6C A;  3TKL B;  4AEZ C;  4CEM A;  2XRZ A;  4GU5 A;  4TN7 B;  3PDY A;  3UT4 A;  2IC6 A;  4OFZ A;  5G05 J;  3D9O A;  4L23 A;  5JDN A;  2MYS A;  4XKB A;  4EPZ A;  3T8O A;  3UUL A;  3ZMT B;  1MNE A;  5FY1 A;  2WMN A;  2WB2 A;  1X5B A;  4KBQ A;  2KXP B;  5AEN A;  3APC A;  1ZV4 X;  4I50 E;  3B7U X;  1UX4 A;  2X9Y A;  2CFZ A;  2KC7 A;  1WR6 A;  2IQC A;  3CVY A;  3SI5 A;  2ZM2 A;  3PUG A;  2QGS A;  5FZS A;  2LNI A;  1KK7 A;  4JUY A;  1LF8 A;  4EQF A;  2KMF A;  2CHX A;  3EHM A;  4C90 A;  2C5J A;  2KWH A;  3CHO A;  4AOF A;  5LBQ B;  3CHR A;  3ZPO A;  3QUJ A;  2WXN A;  1X79 A;  2KAT A;  3ENE A;  2ZU6 B;  4B0Z A;  3LCA A;  2JQQ A;  3NZP A;  5FY7 A;  3CVN A;  2WXK A;  3RRW A;  3SF4 A;  5LCW C;  2J08 A;  3KV4 A;  3NRY A;  4DI4 A;  2VKJ A;  3F57 A;  4KVO A;  5KJM A;  2KCV A;  1L5J A;  4NRH B;  1FMW A;  4LEU A;  5JJ7 A;  3ZN3 A;  2XRY A;  4L7T A;  2YU1 A;  3CHS A;  5ARG A;  4JXT A;  3CST A;  3PUQ A;  2KIN B;  2UXN B;  2WXH A;  2E9X B;  5FYM A;  1MMD A;  5BW8 C;  4I43 B;  3S7B A;  3P7I A;  3GYZ A;  5FTP A;  3DP7 A;  3LBX A;  3FUM A;  2AXV A;  2Q9Q B;  5C2Y A;  5FWQ A;  3RU0 A;  4X1I E;  3I5P A;  3QC1 A;  4APF A;  3ZPJ A;  2V26 A;  2XQY A;  4P09 A;  2VJ8 A;  3UMV A;  5M72 A;  3Q4A B;  3FH5 A;  3O1J A;  4TX5 A;  2PFV A;  3ZMV B;  1HE8 A;  4J8D A;  5E75 A;  2X9W A;  1OWO A;  4H7X A;  1U5P A;  4DLQ A;  4AKH A;  4ILI A;  4WNE A;  5ARF A;  4I1A A;  3MJW A;  2Y48 B;  1E7V A;  2M67 A;  2CEA A;  3ULQ A;  1QUU A;  3P2B A;  5JH7 E;  3PDN A;  3MKD A;  3ZGQ A;  5J2U E;  4GPK A;  2WM9 A;  3HKB E;  4KZC A;  3PE0 A;  4AJW A;  4K03 A;  3ZN0 B;  3S2A A;  2WQ7 A;  3AA0 B;  4F7A A;  5HAX A;  3ZXS A;  3O1H A;  5IYZ E;  5CA1 E;  5HYA A;  4L9I A;  3LPZ A;  5AJD A;  2BTD A;  2IOS A;  4EZL A;  3PZD A;  4I1M A;  2W0G A;  5CB4 E;  3JUI A;  2HPL A;  3R9A B;  2L6J A;  4IHJ E;  3LJ3 A;  3MCX A;  4NUV A;  1UN8 A;  4EBA A;  3FUN A;  4EZJ A;  4X20 E;  1E96 B;  4U74 A;  3RX6 A;  4H9O C;  1NZN A;  2XUE A;  4JPS A;  3E22 E;  2KCK A;  2LSI A;  1MQS A;  2BZB A;  4BT9 A;  4WNK A;  3CK7 A;  4G2V A;  3HR0 A;  5J90 A;  1Z6T A;  4FJY A;  4HE8 A;  4K0R A;  2VTB A;  5JHA A;  3AA1 B;  2CMR A;  5G04 J;  4UWK A;  2CXD A;  3EIJ A;  3MKQ A;  2KM4 A;  4IST A;  3FU3 A;  1DNP A;  2IJG X;  3CPZ A;  1H6K A;  2V7L A;  2XQ0 A;  2FO7 A;  4WUY A;  3ANW B;  4HN9 A;  2X38 A;  3FWV A;  2LT3 A;  3I9W A;  4O2B E;  1FVH A;  4I55 E;  2CXL A;  1LRZ A;  2N2N A;  3ZC1 A;  3FUL A;  4BJM A;  5LGT B;  3K8P C;  4G1T A;  4MHC A;  1ZBP A;  2VSY A;  3RRN B;  4ME2 A;  4AQF A;  3PUJ A;  3BG0 B;  4XI0 A;  3TJP A;  3GN5 B;  3APD A;  2E0I A;  3D9J A;  2KZ7 B;  2X66 A;  3K9I A;  1D1C A;  2WMO A;  2XPZ A;  1MHQ A;  3BK9 A;  4DVD A;  5EK3 A;  4RG9 A;  4DJA A;  2OV8 A;  4MFR A;  1FIO A;  5KMG P;  3FEX A;  4ADZ A;  3CVL A;  5JQG E;  1EYH A;  1V9D A;  5L3G B;  3SRZ A;  1ZEE A;  3NZS A;  3B7R L;  1IHG A;  3MXZ A;  3ETV A;  1UCU A;  3KIN B;  3MA5 A;  4AXH A;  4NQ0 A;  4CXY A;  2HM8 A;  2QY7 A;  3CK9 A;  5FXX A;  1E8X A;  3U3W A;  3ESL A;  1H19 A;  5AIJ A;  4WNF A;  5HWX A;  2DNX A;  1IQU A;  3QB2 A;  4AM9 A;  3R7Q A;  2J4D A;  4ANW A;  3I9Y A;  4QHO A;  4GZ6 A;  1SQM A;  5LJN A;  2XGM A;  3O4X E;  3LXU X;  3RRC A;  1B89 A;  5FZR A;  2Q7F A;  4JA7 A;  3MAC A;  1KNZ A;  2L0T B;  4GA2 A;  1N54 A;  3I3N A;  4H63 H;  3NQP A;  2DWG A;  3N2K E;  3HKD E;  2MTQ A;  3FP3 A;  3KS2 A;  5LGN B;  2VKO A;  1E1H B;  4GYW A;  3OYZ A;  3L54 A;  1NA3 A;  3PEU B;  2LJL A;  3C98 A;  4O4J E;  3TL5 A;  2CG3 A;  3ZHE B;  3CHP A;  4OVV A;  5LP6 E;  4A3V A;  3OBV E;  1E90 A;  4AKR B;  5BPP A;  5CCL A;  2IFU A;  3NF1 A;  4UI9 J;  3DBS A;  4PJN A;  3CSF A;  5TAO A;  3RYC E;  4DBQ A;  2AVP A;  2X68 A;  3EDV A;  2IC9 A;  3CML A;  4NUR A;  4UVC B;  2E8I A;  3Q5W A;  2XAF B;  3TG5 A;  3LY7 A;  5HXC A;  2LSK A;  1CUN A;  3U66 A;  4DLO A;  3FUJ A;  4KVM A;  4OK0 A;  4GA0 A;  3C4X A;  3CEQ A;  3N9N A;  3IF8 B;  2CHW A;  1FVF A;  5F8P A;  3ZMS B;  1TJC A;  2Y6X A;  3FTX A;  3OTN A;  4RSY A;  3QWV A;  1US7 B;  3VTY A;  3UT8 A;  3KVB A;  4MKT A;  4ANU A;  4A56 A;  2A5U A;  3L6A A;  3Q5X A;  5HXR A;  4L2Y A;  2PG8 A;  3HVE A;  5FMN A;  3LFM A;  1UN9 A;  2I6H A;  3MZL B;  2NWB A;  3ZN1 B;  5FZQ A;  3OJA A;  5FNV E;  5L2L A;  5H6Q B;  5L3C B;  3CK8 A;  2VGX A;  1VRB A;  4H63 V;  2WQ6 A;  4C9B B;  1IYG A;  3N71 A;  3ZCI A;  4WAF A;  2KWI B;  2A3D A;  5EK2 A;  3S7F A;  4AQG A;  2CCQ A;  3FUK A;  4BX9 A;  3OYX A;  3UQ3 A;  4KUM B;  4N5C A;  4ABN A;  4PUC A;  3BQI A;  3ONL A;  1E8Y A;  3AS4 A;  2Y4U A;  2VL8 A;  3L17 A;  3DTO A;  2XAH B;  5LX8 A;  4UQX A;  3JQ1 A;  2A4Z A;  3LK2 B;  1FMV A;  3HI2 A;  4XAX B;  4J2C A;  4PAG A;  4ZS3 A;  5FXZ A;  3RYI E;  4BTB A;  3LG7 A;  1H2V C;  3K3O A;  4AIF A;  4PK6 A;  1MIV A;  3PEV B;  1YA0 A;  5DAB A;  2OND A;  5T4Y A;  2QA7 A;  5LYJ E;  4NUU A;  1O3X A;  3ZEF B;  5T8I A;  4V3I A;  5CCM A;  2LE8 A;  3OAW A;  5JR9 A;  3CQX C;  4BTA A;  3BQK A;  3AA7 B;  2DCF A;  5FQ4 A;  3PRZ A;  5ADX L;  1A17 A;  4BA9 A;  4JHJ A;  3NBX X;  2LM9 A;  3D9L A;  1HH8 A;  2BDE A;  3KV9 A;  2NXP A;  4U72 A;  3PU3 A;  4PNI A;  4GCN A;  2RG8 A;  1ELK A;  4RVB A;  2LOP A;  3CV0 A;  5L3E B;  4GZC A;  2ZM8 A;  1VOM A;  4FHJ A;  1S35 A;  2AW6 A;  2KLQ A;  4IUL A;  5EX0 A;  1LVF A;  4OYK A;  5HXE A;  2L8K A;  3CX6 B;  4AQF C;  4RG6 A;  2BUG A;  2PM7 A;  4YVO A;  3FBZ A;  5J2T E;  5BT1 A;  2NSZ A;  5ANL A;  4TV9 E;  2K24 A;  1H2T C;  4U8H A;  4LRZ A;  2WXI A;  3N2G E;  3VLD A;  2CLY C;  4Q94 A;  3I1A A;  2X9X A;  2MOW A;  4A1S A;  2IF4 A;  2V8S E;  4QFV A;  1QSD A;  2NP9 A;  2OA5 A;  4IYP A;  3ZYQ A;  4FC8 A;  3WAK A;  3RC3 A;  4BX8 A;  3JYS A;  3CKC A;  3IHR A;  3FEY A;  2XAG B;  3LKU A;  3IHY A;  2CFU A;  3EDT B;  1HFA A;  4IN3 B;  3SHF A;  2VSO E;  4HTE A;  3GWH A;  1Y8M A;  1MMG A;  3G2T A;  3H37 A;  4L5G A;  3WXX A;  3FTU A;  1H7C A;  3IV0 A;  4X1K E;  3LJC A;  5D0Q D;  2JPF A;  2DLR A;  1XGW A;  1PAQ A;  2WXJ A;  5LXT E;  2Y4T A;  1Z3Y A;  2EHO A;  2XAJ B;  3QK0 A;  4I9C A;  2L9B A;  3ASF A;  4UEM A;  1MIY A;  4GML A;  4JEH A;  5G05 C;  3ZCJ A;  1E8W A;  2WWU A;  4PW8 A;  4C0M A;  3E4B A;  4JEU B;  3ESK A;  4YLH A;  2HR2 A;  2XGO A;  3FH8 A;  3AB3 B;  4ZI2 D;  2I9C A;  2E9X A;  4TUU A;  1HG2 A;  3FTY A;  3KAE A;  4FLH A;  4I43 A;  2J07 A;  4I6G A;  4KXK B;  4PFP A;  4AY6 A;  4FUL A;  2Q9Q A;  3KV5 A;  4GYR A;  1JUQ A;  2NW8 A;  5JRE A;  4N3A A;  2MHK A;  1KT0 A;  4G25 A;  4PS3 A;  4J8F A;  3VLF A;  3ZYL A;  3E08 A;  4UEL A;  4CXW A;  3RC8 A;  2OVF A;  3CVP A;  4HS2 A;  3EVY A;  1D0Z A;  5GON E;  1IJ5 A;  4G63 A;  2XTL A;  4U0U A;  5JJ6 A;  3UX4 A;  4N2S A;  4FP7 A;  2JLB A;  4U04 A;  4M3O A;  4V1A v;  4KT6 B;  3MV2 B;  4JC8 A;  2AWI A;  3BQL A;  4FJO A;  2XPI A;  3KD7 A;  1WYC A;  1OWM A;  1WYB A;  3SD5 A;  1IAP A;  3LBX B;  5G55 A;  3SFZ A;  3PUA A;  3MYV A;  5JDF A;  2PJQ A;  2WXF A;  5ENN A;  2MBG A;  4N2Q A;  3PUR A;  4E7Z A;  2OOE A;  3HDX A;  4Q69 A;  2YK0 A;  2EHO D;  4CGV A;  4IRU A;  3HL6 A;  4KP3 C;  4GZD A;  2M63 A;  1N52 A;  2KCL A;  5AJL A;  5G2N A;  4B94 A;  2IOL A;  4H9P C;  3FXE B;  3QOU A;  3GMI A;  3ZMU B;  2NW9 A;  4AV7 A;  4MBQ A;  4X1Y E;  2VB6 A;  2KND A;  2KZT A;  1HG5 A;  4HOQ A;  4O4I E;  3CIA A;  4ZI3 D;  2WXO A;  3LEW A;  5JDL A;  1GW6 A;  3BG1 B;  4GB9 A;  1QQE A;  1BR1 A;  2C0S A;  2ODV A;  4EIW A;  4JHR A;  5DIZ A;  4FJZ A;  1NWM X;  4L1B A;  2C5I T;  3AS5 A;  3FTZ A;  1NP7 A;  2L0I A;  3O48 A;  4XIF A;  3ZVV A;  2LSJ A;  4CI2 B;  3CVV A;  2X6K A;  3TXM A;  2GK9 A;  1S0P A;  2LEH A;  2PL2 A;  3FU6 A;  1WAO 1;  3G2W A;  2GW1 A;  3KBU A;  5JRC A;  5D0O D;  3D3M A;  5FJY A;  4XZC A;  2YU2 A;  4EYU A;  3ANW A;  3PNL B;  3UUM A;  4DI3 A;  3IHV A;  4J6I A;  4O8S A;  1JWG A;  2WPV A;  5C8Y E;  3MA9 A;  2DIW A;  3UT7 A;  3C64 A;  4HOS A;  3SNX A;  2X6H A;  3N9O A;  2HH7 A;  3VKG A;  3FHN A;  2GRL A;  3LK4 2;  3U3I A;  4M1P A;  4GIW A;  5FQ8 A;  4PFO A;  3RO2 A;  3QAQ A;  4GYO A;  2VTB B;  4O6F A;  3GN5 A;  1YKH B;  5LFA A;  1HCI A;  1SZ9 A;  2J4B A;  3PUK A;  4ZI2 C;  1PC2 A;  3L22 A;  4ERR A;  3ONK A;  4JHK A;  3PUS A;  3ASD A;  3E0Z A;  1ELW A;  4HOU A;  4W9R A;  3IBE A;  3APF A;  4HOR A;  4CDR A;  4GA1 A;  5HQ8 A;  5JDH A;  5A1L A;  1HZ4 A;  4G23 A;  3D9N A;  5DBK A;  1FEW A;  2FI7 A;  3WI3 A;  4CI3 B;  2CHZ A;  5DQV A;  3EDU A;  4WWP A;  3ZYM A;  3ZC0 A;  3RRU A;  2BVL A;  2UWJ G;  3RKV A;  5BUZ A;  3Q2M A;  3I4R B;  3Q49 B;  5A7D B;  4H9N C;  1HS6 A;  5LNK A;  5FXW A;  2CLY B;  4LCT A;  4A55 A;  3D9K A;  4WBN E;  3SBS A;  2ODU A;  3G2S A;  4JW1 A;  4ZS2 A;  4E6H A;  2EHO C;  1MMA A;  4TV8 E;  2XCB A;  3MZK B;  4J8E A;  4TV3 A;  5KJL A;  2YNQ A;  4KMC A;  3L3P A;  5H6R B;  4IDZ A;  3GZ2 A;  2E2E A;  3HKC E;  2V5F A;  4ZI3 C;  4YFS A;  4HOT A;  2JEK A;  4GMJ A;  4MLK A;  2HYZ A;  2X6I A;  2WQH A;  3UFE A;  3I0O A;  4IE4 A;  2XHE A;  2JRK A;  3D0T A;  4FAD A;  5LOZ A;  2WXQ A;  3EUH A;  2J09 A;  2X3M A;  3RJV A;  2H7O A;  4ANX A;  5BNW A;  2BVM A;  3AU5 A;  3RIB A;  2LAH A;  3H3A A;  2ZM0 A;  1NAF A;  3TXN A;  4BSX A;  2ION A;  2CE7 A;  4PK4 A;  3CQC B;  1ZKE A;  3QAR A;  4XX5 A;  3TG4 A;  3L13 A;  4BT8 A;  2VK9 A;  3Q9D A;  4QX7 B;  3N5L A;  3U9W A;  2YIN A;  4JL0 A;  3D9M A;  4YHJ A;  3C98 B;  3FUD A;  3LS8 A;  4I6E A;  1NA0 A;  3RO3 A;  1YKE B;  3Q47 B;  4FHK A;  4AY5 A;  3M65 A;  4CCA A;  3IEE A;  1UG3 A;  1HTJ F;  4IIJ E;  3GA8 A;  2OVB A;  2NC9 A;  1BPO A;  4GK5 E;  3QWW A;  4DPR A;  1WRD A;  2UXX B;  4QWN B;  3ML9 A;  4H7Y A;  4KYO B;  4JVS A;  3OXF A;  4MLP A;  4N3B A;  4UWL A;  1SA0 E;  2WSS V;  2H7V C;  2HO1 A;  1Y6I A;  5BV0 A;  3N9L A;  3PS6 A;  5LCY A;  3SS1 A;  4B8C B;  4L0R A;  1INZ A;  2CG2 A;  2LAI A;  3RPU A;  1Z3X A;  4UI9 C;  3A5X A;  2NTX A;  4MRU A;  3ASG A;  4UF0 B;  5E76 A;  4DMW A;  3RK6 A;  3NRX A;  5J1G A;  3GZ1 A;  2LSU A;  4ACL A;  3SWH A;  2VKH A;  2YHC A;  2FBN A;  4P0A A;  2VAS A;  1OWA A;  3D9P A;  4EZK A;  4BY6 A;  3ZEF A;  3MK7 C;  3UT5 E;  2W00 A;  2VGX B;  2GGF A;  2UY1 A;  2FF4 A;  4IE0 A;  4L2L A;  4HFV A;  1KLX A;  3LY9 A;  2VSX E;  3BEE A;  2RP4 A;  5ETW A;  4XZ4 A;  3JQ0 A;  3UUX B;  3PTR B;  2Y8D A;  4I6J A;  1U4Q A;  1QNF A;  2D0U A;  1UJJ A;  3HHM A;  1OUV A;  2PBI A;  2W62 A;  3DPD A;  4K0U A;  2AXZ A;  1AJ3 A;  5FT9 A;  4XE0 A;  4ACK A;  5LHI B;  2K5B B;  4UWG A;  4CZZ B;  5LGU B;  2V7I A;  4UV9 B;  3VU7 H;  2VSN A;  1H2U A;  4G2A A;  4KBM B;  3TGO A;  4EXT A;  3R6N A;  4CXX A;  3FH7 A;  4U0Z A;  4HEA A;  3C4W A;  2C0M A;  3HKE E;  2V7J A;  5LOV E;  2N9D A;  3AAA B;  4UXN B;  3B13 A;  4U07 A;  4EAH A;  2WXM A;  3IKO B;  3L08 A;  4OHF A;  1D0Y A;  4YVQ C;  4D10 C;  4WBO A;  3PRE A;  2H3R A;  1FCH A;  1IJ6 A;  2FEZ A;  2WBL A;  4UVA B;  3TAX A;  3F31 A;  3S7J A;  1JPL A;  4JLE A;  1UX5 A;  1HS7 A;  3ZFW A;  3U64 A;  3OXG A;  2NOX A;  3CGH A;  2XEV A;  3KEZ A;  4I9E A;  3CHQ A;  2I59 A;  4UQY A;  4AKL A;  5JHB A;  2BF0 X;  4QXB B;  5KJK A;  5LCW J;  1BR4 A;  4P29 A;  3OXL A;  3SOL A;  3GZS A;  3AAE B;  4WW0 A;  3I0Q A;  1D1A A;  3N9P A;  2ACX A;  3U78 A;  2AXU A;  2CA5 A;  4ILH B;  4ANJ A;  3ZW3 A;  4ZI7 E;  4FLB A;  2LSY A;  4UIG A;  4N78 D;  3VTX A;  1BR2 A;  2V1D B;  1HO8 A;  1TJF A;  3JC6 D;  3CVX A;  2GRM A;  5KX5 E;  2WXL A;  3HIZ A;  3ML8 A;  1Y64 B;  3CVU A;  1EPU A;  3EIQ C;  5KCM A;  1JWF A;  4OYS A;  4I2Z A;  2MRI A;  5CMY A;  3G2U A;  1MMN A;  4JEU A;  5CMW A;  4YND A;  3L16 A;  4C91 A;  4WWN A;  2C5K T;  1G73 A;  4U63 A;  2ES0 A;  4I17 A;  1KT1 A;  3T5V A;  1HXI A;  4WNG A;  4O4L E;  2IU1 A;  5ANR A;  5EX3 A;  2R59 A;  2JJ9 A;  2K48 A;  2C0L A;  4H9R C;  2LHN A;  5EK4 A;  4FU3 A;  2L3L A;  4Q96 A;  3CVR A;  4OVU A;  3CX7 B;  3PE3 A;  3PNT B;  2EHO B;  3AAI A;  4GZ3 A;  1MIW A;  4P0B A;  3N9M A;  4CT4 A;  3D9I A;  4JEH B;  3LY8 A;  3MJX A;  1VDY A;  1IZN B;  1QZ2 A;  2VGY A;  1LKX A;  4HXI A;  3C51 A;  1U3D A;  2J1D G;  4PH4 B;  3CX8 B;  2I1J A;  4F1S A;  2R17 C;  3MV3 B;  4CDN A;  2DI4 A;  4YJ2 E;  3CVQ A;  4GYY A;  4UI9 K;  3VKH A;  3AA6 B;  3SZ7 A;  1G8X A;  4EB6 E;  2B1E A;  3AVS A;  4G24 A;  3FXD B;  4CI1 B;  3ZIM A;  1B7T A;  3N2O A;  3B7S A;  3NZQ A;  5E0O A;  5LHG B;  2NW7 A;  4AP2 A;  4QXH B;  5LP0 A;  3URZ A;  3SGH A;  3K3Q C;  3VLE A;  4C0E A;  2YHE A;  2V7K A;  1TEZ A;  2V4L A;  5J08 A;  2R5S A;  2Y3A A;  2XAS B;  5BV1 A;  4IE6 A;  3CR3 A;  4Y6W A;  4J0U A;  3MEK A;  5FY0 A;  3ONX A;  4IE5 A;  5BMV E;  2E9X D;  4EYY R;  5HI7 A;  2W61 A;  3K3N A;  1T98 A;  3P8C D;  3FUF A;  1WLX A;  3V5U A;  4TZ4 C;  4LER A;  3QDN A;  4ATG A;  2Q9Q D;  3ZYK A;  1WM5 A;  3ZRH A;  5AFU L;  3ETU A;  5JDM A;  3FBL A;  3NZU A;  2XCC A;  3S4U A;  2ZMA A;  3QKY A;  4GZ5 A;  4GK0 E;  2DHR A;  2JMK A;  4ILG A;  4DBR A;  2KZT B;  4HVB A;  2Z6E A;  5JR9 C;  4WWO A;  3G2V A;  3RYF E;  3Q5M A;  1EZ3 A;  4O2A E;  4H9S E;  2ILR A;  5L3B B;  4B89 A;  2WXG A;  2K9A A;  4PJM A;  4CRW A;  2X6F A;  3JC6 C;  5EKQ D;  3PVL A;  3C4Z A;  4URK A;  4GOU A;  4UVB B;  2CXF A;  4N39 A;  1XNF A;  3R84 B;  2I2O A;  1UW4 B;  3CHM A;  1SZA A;  1E8Z A;  2WXR A;  5FP3 A;  4XKC A;  2PQR A;  5JRC B;  3KV6 A;  2CWY A;  4ZHQ E;  4AVX A;  5EDS A;  3RKO A;  2HPJ A;  3MX3 A;  4NAC A;  3MKQ B;  3QWP A;  4LUN U;  5LJM A;  1PY1 A;  3GW4 A;  2X9H A;  3ZMZ B;  3MKR A;  2PZI A;  2G0U A;  4F53 A;  3F2E A;  2J9Q A;  2P9B A;  3CVW A;  3KVA A;  3QC9 A;  5DJQ C;  3CKD A;  1ELR A;  3T5X A;  3AU4 A;  4A1G A;  4AKG A;  3FTS A;  3EHN A;  4UWF A;  4I4T E;  3T8M A;  5G04 C;  1ZU2 A;  2LHR A;  3ZJ1 A;  2DBA A;  2X51 A;  3PU8 A;  1ZHC A;  4EZH A;  2LSG A;  4BFR A;  3C50 A;  2CM0 A;  1DVP A;  3FU5 A;  4B8A A;  4PJL A;  3CQG B;  3DJB A;  3UTK A;  5L3F B;  2J49 A;  1E7U A;  5FQ6 A;  4PS8 A;  4HGA A;  5M4Y A;  5A6C A;  4WND A;  2VKD A;  2YQ8 A;  3B7T A;  4HKA A;  4EBA G;  2WAU A;  3O9X A;  2PQN A;  3FUE A;  2PM6 A;  4KMO A;  4TUY E;  3SBT B;  4QXC B;  4DO0 A;  2JMH A;  4AXP A;  5LA6 E;  5HXS A;  2RD0 A;  2D5U A;  1EDU A;  3L09 A;  3LYA A;  2N1G A;  4GAA A;  3ASH A;  2MOZ A;  1LVK A;  2I1K A;  5C1D A;  2WXP A;  4Z8X A;  4DK5 A;  5LG4 A;  4TRQ A;  3ZHE A;  2E9X C;  3IEG A;  5HXH A;  5KDM C;  2ZLY A;  3N9Q A;  4ZOL E;  1YD8 G;  5HWY A;  2CWO A;  2A2F X;  2Q9Q C;  3CKB A;  1OXZ A;  5KJN A;  4I2W A;  5JVD E;  4F6R C;  4DND A;  4G11 A;  1HF8 A;  3W15 B;  4J8S A;  1D1B A;  1MND A;  2XAQ B;  5F3J A;  3EJN A;  5LBM A;  4JZY A;  4QX8 B;  2X0L B;  3Q15 A;  2W63 A;  4ASK A;  3FUI A;  3FHE A;  4JA9 A;  1OWP A;  4FI5 A;  3J7Y q;  3QJZ A;  1IQR A;  4IE7 A;  2WVI A;  4XI9 A;  2XHE B;  3S7D A;  2VYI A;  2LO6 A;  1OWL A;  4B6X A;  1YW0 A;  2VQ2 A;  3R7R A;  1WY6 A;  2LOS A;  1U3C A;  5FQ7 A;  4F3V A;  4H9Q C;  4ISS A;  3PE4 A;  4E85 A;  4PJJ A;  2L9Q A;  5CHE E;  5AYW D;  3KBT A;  1HX8 A;  3KDS E;  4IGU A;  3QK6 A;  1P5Q A;  3UUN A;  5IHY A;  5A23 A;  3FFL A;  2V0P A;  3B57 A;  4BWR A;  5JJT A;  3HYM B;  4UF0 A;  2IAK A;  3AS8 A;  2C2L A;  2DCP A;  2EQX A;  1H0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...