3B13A

Crystal structure of the dhr-2 domain of dock2 in complex with rac1 (t17n mutant)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
427
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding/signaling protein
molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis for mutual relief of the Rac guanine nucleotide exchange factor DOCK2 and its partner ELMO1 from their autoinhibited forms.
pubmed doi rcsb
source organism Homo sapiens
total genus 139
structure length 427
sequence length 427
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b13A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3b13A01
2WMNA 2WM9A 3B13A 3VHLA 2WMOA 2YINA
chains in the Genus database with same CATH superfamily
5LFAA 5IUXA 4LF5T 5D66A 1NI1A 1N33T 3E37A 5C8YE 4AQGA 5CA0E 2JMHA 5AQKB 3EUHA 2F8YA 1TNBA 4JBWF 4K0UA 3Q73A 3RYIE 3TLUA 3QWVA 3E32A 4IULA 4BY6A 4JXTA 2RD0A 4U72A 4U8YD 2MBGA 4KX6A 3FTSA 2DBAA 2Y0BG 2KZTA 1Y6IA 1AP7A 5KXJA 4F1SA 5JJ7A 1H2VC 4N3BA 4HI9A 3KBUA 4F6RC 5BPPA 3VKHA 5LCWJ 5C3JA 2MYOA 1E1HB 4N5QA 2CPTA 4JEHB 2CM0A 3LJCA 4YSYA 2IU1A 2YU2A 2CHZA 3HKEE 5ENSD 4EBAG 4G25A 3N9PA 3N2OA 3PZDA 4BTBA 2GGFA 1NA0A 4FHKA 2VKOA 4YFSA 3CX8B 3AE8A 2J8SD 4I1MA 4HOUA 3KSLA 4ADZA 2IOSA 4U0ZA 2VSYA 4GA0A 1W3BA 4EYYR 4XI9A 5FQ7A 2P9KG 2KMFA 4A1GA 2ZM6T 2J4DA 3Q9DA 3ZN0B 5HXEA 1MQSA 3L6AA 5ENRD 3QC9A 1BR1A 2LAHA 2KINB 3KDSE 1EDUA 2KWHA 5ETWA 2XS8A 2ONDA 3DSSA 3KEAA 4BSXA 2L3LA 2NOXA 2Q9QD 4N39A 2M6BA 4DR4T 3GN5B 3HXFA 5G05C 4DJAA 4PS7A 3UT8A 1OCRE 1DC2A 3I4GA 3ONLA 4CDRA 5ITZF 3KFWX 2WAUA 4WWOA 2XAJB 3CQCB 2AXVA 2W4XA 3BK9A 3RI5A 1FJGT 2XGOA 3QC1A 2BG9C 2RG8A 2WQYA 4CN1A 3EHZA 4PAGA 4BA9A 1HNXT 5EN5D 2Q9QB 5EK2A 4YDYA 5LCYA 3CQXC 4NUVA 1WDYA 4LEUA 2NR4A 4L9IA 4IL4A 1MX2A 3ONJA 3ZU7B 2UUAT 3L9TA 3NKZA 3MKDA 3TAXA 2G0UA 4QH1A 5J1GA 2Y6XA 1IBMT 2CFUA 5M4YA 1OEDA 4ZXLA 4ZZCA 3C98A 3Q5WA 2CE7A 3FUNA 3SI5A 1UX5A 1BR4A 3N2KE 3WI3A 5FL1A 5LOZA 3DWLG 1OCZE 3HXDA 3FUJA 4EYUA 3VKGA 3R7RA 3TLWA 5AQ9A 3DSVA 5EILA 2PL2A 5L4HA 3B13A 4DX5D 3B7SA 1LVKA 2NTXA 3HKBE 4B3RT 3D3MA 1W0AA 2FJBA 2XM1A 1XZYA 3LFMA 4AIUA 3T8MA 3NAWA 4FC8A 5BNWA 4YNDA 4IE4A 3K3OA 2YDSA 1BR2A 3DJBA 4ZI2D 3AE1A 3T8OA 3G2VA 3CWZB 3K3NA 1MJ0A 1TNYA 1B7TA 4JC8A 1Z3YA 5L3GB 5LB7B 3I0OA 2P9NG 2XS1A 4HOSA 4L2LA 5ENQD 1LD7A 3N2GE 3Q5XA 3IBEA 2W66A 1QSDA 4GYYA 4DUIA 4U7YA 3PE3A 3D9JA 3CR3A 3DEPA 2WVIA 2CG2A 2WMOA 3V79K 4H9QC 4Z68A 3TGOA 4HOQA 2JQQA 2GK9A 1WYCA 2C5JA 2NYJA 3O9XA 4XE0A 3DP7A 3E33A 4LUNU 4YY3T 3PH0C 3ZT7A 3SFZA 4HWCA 5CERB 3PU8A 2OV8A 1GW6A 4CXXA 1N9AA 4DK5A 4A63B 4Q69A 1N34T 2BTDA 4P1NA 2OOEA 2QFCA 4MHCA 4U74A 1WAO1 4CZZB 3LKUA 4JI8T 3ZC1A 4KBMB 1JCQA 3JXIA 3GN5A 4DX7D 5JH7E 4KI0F 4LFCT 2BS4A 4AKGA 4GZDA 3CVQA 2WXMA 4TUYE 2I6HA 5FYMA 3EJNA 3QB2A 3UU8A 3EHRA 4EPZA 3MZKB 1GQEA 3VR8A 4HFEA 2DYSE 3GYZA 3PNLB 3U3WA 4PJLA 4OAVB 3IHRA 4FJOA 3JQ0A 2HE0A 3C5RA 4GTQA 2Q9QA 3AVRA 1N4SA 1K1AA 1NFIE 2LUHA 1Y64B 3OJAA 1NENA 5G04J 4J8EA 1TJFA 4GCOA 4YTPA 1FMWA 2XJ7A 1YMPA 2GW1A 3MEKA 2D2SA 3E4BA 1T98A 3SO8A 3L82A 3I0QA 2J07A 3FZFB 1SVXA 3B7UX 3PREA 3FZLB 4TX5A 2LE8A 4Q96A 2V7MA 4U95D 3A8YC 1SZ9A 3JADA 2BZBA 3UT4A 5FZQA 4HRMB 2Z6EA 3S4UA 4YTMA 3CIRA 3FUDA 3I4RB 2WXQA 4PW8A 3CX7B 4BX9A 4I1AA 3SBTB 3RHWA 3MX3A 3QNKA 1VDYA 3CX6B 4GTOA 5JREA 3C72A 1HNZT 3ULEG 4GZ6A 3PUAA 4WWPA 2WB2A 3RGLA 4WWNA 3EVYA 2KXPB 1BU9A 4X1IE 4APOA 2AVPA 5B1AE 4CCAA 4RLYA 5LMNT 1DCQA 1TN7A 2ZLYA 4PK6A 3DEOA 5KDMC 5CGMA 3UUMA 4TWHA 5LBQB 2DL1A 2DI4A 4DX2A 3NWIA 2I1KA 5CBNA 3ML9A 1T72A 2LRLA 3FHEA 2XUEA 5HYAA 3F2EA 2HN2A 2NW8A 3LY8A 1EYHA 4DPRA 1UOHA 3N9LA 4DBQA 4ERRA 1TNZA 2CFZA 4JI6T 3ETUA 2CMRA 3EIQC 2C5KT 3AA6B 2A3DA 4EOZB 1N11A 4O8SA 3LVQE 4X5TA 1UN8A 4Z8XA 1D1BA 2A9UA 1UN9A 3C51A 3T9KA 1ZEEA 3ZRHA 2NXPA 3URZA 5EYLA 3V5UA 4EGWA 4PDXA 3MA5A 2LKGA 4XBFB 3FP3A 4J7WA 3LYAA 3ULYA 2BKOA 3JAEA 5CCMA 4DI3A 4PJJA 2WDVA 2XZTG 3JCKC 1VRBA 1WFDA 5LGNB 3AXJB 4C48B 3K9IA 1HF8A 4TV9E 2GRNB 2X6KA 3HIZA 5ENOD 4XZCA 4AVXA 3QK0A 3RIUA 3ABLE 2XQ3A 4AV7A 2PJQA 5ARGA 2MAWA 2XRYA 5ADXL 4G2AA 5FIOA 5AARA 2Q9QC 4F6RD 2ZM8A 3N9NA 5FWQA 3TWTA 2XRZA 2I59A 2KWIB 3JYSA 1HX1B 2WXKA 5AQLB 1N32T 2VKDA 1TYQG 3RYHE 3S7DA 3N9OA 5M72A 4GA2A 2Y3AA 2KNDA 4XKBA 2FJEA 4FJZA 1G73A 4QXCB 4ZS2A 1XNFA 2ZIRA 4P0AA 4LF7T 1EZ3A 2HPLA 4APFA 3LDQB 1D8EA 1N4RA 4B3MT 1TNUA 3RQWA 4DRXE 5FMNA 2A5UA 1FIOA 4ZFHA 4UWFA 1SA0E 2R59A 3HR0A 1H19A 1WM5A 4G1TA 3ZW3A 4TUMA 4HRLA 3H37A 4WBOA 4TNVA 3L39A 1IAPA 3CV0A 4COFA 1X79A 1OT8A 5AQFB 1FT1A 2F8XK 4E7SA 3CVNA 2BKKB 1T7SA 2UXNB 4XEIG 2LKHA 2IY0C 5AENA 3IV0A 4KMCA 4OFZA 5FP3A 1ELWA 1V55E 4CGVA 2ACXA 5TAOA 3ZVVA 4H9PC 2V5QC 4HOTA 4QX8B 4BX8A 2YQ8A 2E0IA 1HTJF 2KSRA 5E76A 3PNTB 3V2XA 2R02A 4QHOA 4J8SA 5CFBA 4I17A 4JV5T 4OYSA 4QFVA 3ZPJA 4ZI2C 3B7BA 3LK3B 1M62A 4FHJA 1Z8UA 2BG9B 3P4WA 5L3BB 5JDNA 2XQ5A 4CN4A 1I6ZA 2CWOA 4YVQC 3FH5A 1KT1A 2ZMAA 3BQKA 4IE6A 2E2EA 3PJAJ 2BVMA 2XSAA 2N9DA 5CCLA 3NQPA 2BF0X 2I2OA 5J2TE 2FBWA 4AY5A 4A3VA 3Q79A 2QA7A 4IE7A 3EABA 3NZPA 4CI3B 3DTOA 3ML8A 2X6HA 2XEVA 2X0HA 3P7IA 2JMKA 4I43A 4JHJA 5AQOB 5ENNA 2H7VC 4P0BA 4HBDA 3ZNGA 2Y48B 4JHRA 2FI7A 2LRKA 3TWWA 3AXJA 4BT8A 3L17A 5T4YA 3U78A 5HXCA 2QYWA 2XTLA 3HL6A 1SZAA 2LSYA 3JAFA 1XMQT 2M67A 1M7KA 2D9DA 4TUUA 3UM3A 1AJ3A 4DR5T 3NF1A 4WZXA 1LRZA 2D5UA 4DV3T 4EEDA 3Q49B 1IBKT 1DU2A 3ZT6A 1SQMA 3N9MA 4NRHB 4HORA 1HCIA 3O4XE 4U2ZA 3MGBA 4AY6A 1A5EA 2GRMA 2DVWA 1OWOA 4TWFA 2XPYA 4HLLA 3O1IA 4ATGA 4DMWA 5JTGA 3ASNE 2BVLA 4PS3A 2X3MA 2VQ2A 3TLSA 4U7EB 2IMLA 2C2LA 1BLXB 4ILIA 3UUXB 1KZOA 3CIAA 3Q9NC 2WWUA 1H6KA 2J09A 3LVRE 3ZMVB 3FXEB 4GMRA 2MRIA 1S35A 1WYBA 3UKUG 2ODUA 3FH8A 1IQUA 5AQJB 2BUGA 5HEGA 3RO3A 4L2YA 3FHNA 4UWGA 4LFAT 4TWDA 5CEAA 1DNPA 4HS2A 4IDZA 3LDZA 4GTRA 2WSSV 4UIGA 3CEQA 4DR2T 2JQ9A 4H9OC 5CEDB 4U8VD 2FUPA 4GYRA 5HXSA 3RJVA 2DNXA 3O1JA 4IIJE 1J5ET 3BG0B 4U96D 2WDQA 2WDRA 5JJTA 4NPPA 2KXPC 2XGMA 1TR4A 5EX3A 4UVCB 2KCKA 4EZJA 5LBMA 3DPDA 3MKRA 4KVOA 3RSEG 4EXTA 5JQGE 3UX4A 4GKKT 2KCLA 5LOVE 3V2OA 4ACKA 3TXNA 4DX6D 4LF9T 4JI4T 3Q7FA 3H3MA 3UPVA 5L47A 2NWBA 2VSNA 4FP7A 5JDHA 3D0TA 2WQ7A 2V4HC 3B95A 3MJXA 2BG9A 5AQVB 4AKHA 4LCTA 2VGXB 4JI5T 3RK6A 1E96B 2QVAA 2WU5A 2JQKA 3AAIA 2DZNA 3T5XA 4UWLA 2IQCA 1MNEA 3MK7C 4HEAA 3PUKA 4ZI3D 3UUBA 2RFMA 5D2MC 4G24A 4QXBB 3Q47B 4RQIA 2EIME 2V7JA 3VLFA 3PTRB 3VLDA 5AQMB 2AJAA 2EQXA 1MIWA 1D0ZA 2LSKA 2MTQA 2XQ4A 3U64A 3SNXA 5CRVA 2N1GA 3K3QC 2XHEB 2DWGA 4MS6A 2PM6A 3CVXA 3ONXA 3B57A 3C4WA 4WNKA 4OX9T 5LHHB 3HKDE 1SHZC 4A56A 2X9HA 5AQGB 1D9SA 4J2CA 4F8HA 3EHMA 3S7JA 2NW7A 1CUNA 3FTZA 4JEUB 3X2QE 4NUUA 3BG1B 1V9DA 4BESA 4BJMA 2VURA 3RC3A 3B5MA 3ZEFB 3ISMC 1YQ4A 4GK0E 3PUSA 1JPLA 3ZSSA 1HZ4A 1D0YA 3LBXA 4HFCA 2IEJA 4URKA 3NZUA 4GTTA 4CT0A 4EZ4A 2QYUA 5LG3A 4MKTA 1W09A 2C5IT 4WNFA 2NW9A 3UM0A 4CDNA 3IBPA 4E6HA 3UUXA 5HEOA 4OVUA 3PUZF 3OYXA 3CVVA 2YKSA 2H88A 4PH4B 3CPZA 2LLYA 2P9PG 3LK42 1QBQA 3AE7A 2BKNA 2YHEA 3OXFA 5L3CB 1OXZA 3C3OA 3TKLB 4HGAA 2IC9A 3Q5EA 4NURA 2X51A 2I0MA 1UUSA 1US7B 3AE9A 5KX5E 5G05J 5JHAA 4HFBA 2RFAA 3MJWA 2V8SE 2XQ6A 5L2LA 5DABA 4TN7B 3L09A 1HE8A 2X6JA 3CLJA 3IF8B 4AKLA 3ETVA 2XQ7A 2EIJE 4ATZD 3ZMUB 1MMGA 4CT4A 4X65T 2BS2A 1MIYA 1PC2A 4EHMA 5BXUA 2BS3A 1LF8A 2XCCA 4O1OA 3UIOC 5KWDA 1Y8MA 4FU3A 3RKOA 3RU0A 4N78D 3PZ4A 4H7YA 4JZYA 4WNGA 5FXVA 1NL4A 3PUVF 5C1DA 5AQBA 2VWAA 5D0QD 1KLXA 3QOFA 3AG1E 4IE5A 4X62T 1WR0A 2FBNA 1WCRA 2XEEA 4QWNB 2X9XA 2P9BA 3E34A 3WAJA 2BDEA 1BD8A 3CKDA 3BEEA 4J0UA 3W9FA 2CWYA 3P1UA 1X9BA 3ASFA 5KJNA 3ZKJA 3V5SA 2V0PA 3KV5A 2X67A 1E2AA 2XQ0A 4BSZB 2XHEA 2VKHA 4KBQA 5FXZA 2W67A 3RYFE 2RPAA 4L1BA 3ZC0A 5CJ5A 4QH5A 2ZXWE 5ARFA 3UU3A 4DBRA 4C0EA 2WZHA 3H3AA 3LK2B 4DR1T 2CHXA 3D9OA 4LMLA 3WAKA 3LS8A 2P9SG 4BWRA 3ABKE 4JEUA 4CRWA 4OK0A 2LOPA 4UI9C 3HA4A 3ZEFA 4KMOA 4U0SA 2PQRA 5DIZA 1QZ2A 4NXMT 4EEBA 4HQDA 1L5JA 3AU4A 1OEDE 4IDQA 5KJMA 2JJ9A 1DCEA 4HVBA 2LSJA 3ZLIA 3D9PA 5JDQA 3ESKA 2WS3A 4HWFA 3ZPOA 5JDLA 3VHLA 2FO7A 4BFRA 3Q15A 2V7IA 1V54E 1HG5A 1HU3A 4JEHA 3G2UA 2DCFA 5L3DB 2H89A 3AVSA 2IUBA 4JA7A 5HXHA 3AEAA 2V7LA 5KBAA 4UV9B 1IYGA 3VTYA 2ZGGA 5AQPB 4XZ4A 1XMOT 3ZSTA 2XPIA 3UMVA 2WXRA 5BMVE 3AE2A 1UK5A 2LNIA 3PZ3A 4X8QA 3RRUA 3DXKG 4I9EA 1OY3D 3QOUA 2A72A 4I6GA 4KXKB 5FL0A 3VLEA 3KVAA 3PZ1A 4YTNA 2X6FA 2LEHA 2FULA 3FU5A 2AXUA 4HB5A 4J8YA 4LSZE 4G8KA 4GU5A 5HI7A 2LT3A 4GMJA 4OYJA 3S2AA 5LNKA 3GA8A 5AQQB 1S70B 1QLBA 2CRBA 4CI2B 4JLEA 1UX4A 3T8KA 4X20E 2L6JA 2VSOE 2WXHA 1OCCE 4GTSA 4UR9A 1SA5A 4K03A 1O1TA 1X5BA 1OWAA 2X38A 1ZP0A 5BUZA 3SS1A 1MMDA 2FJAA 2R05A 4AIFA 2I9CA 2WY2A 1SW6A 2H7OA 5B1BE 2L0TB 2Y4TA 3TL5A 3BQIA 2VJ8A 4FLHA 2B1EA 3UUNA 5CRUA 2L6BA 4OVVA 2X9WA 2Y8DA 4AQFC 3VTXA 2B0OE 2VQET 2ZISA 5BXOA 1O5MA 3OAWA 3AG4E 4O4JE 1N4QA 4ZI7E 2VVSA 3DSWA 3KD7A 2QGSA 3MYVA 1UG3A 4ZI3C 2CHOA 2OVFA 3RLFF 2KC7A 2IFUA 2VYIA 3K1SA 3ABME 4DV1T 4HXIA 4EQFA 3NZQA 3QB5A 4O4IE 4BTAA 2WP9A 3RKVA 3EU5A 3UIPC 4HN9A 1XNRT 3UU5A 4ILBA 2MYSA 4ASKA 5EIBE 1HG2A 3QARA 2UXXB 2W00A 3CVPA 2YDQA 3MV3B 3EUVA 4Z90A 1ZHCA 3KV6A 5CB4E 5BR8T 2XAFB 1Z6TA 3FZKB 1YXRA 2J9QA 2JEKA 1WR6A 3CVLA 4O2AE 2XASB 2DIWA 4AOFA 5KNGA 2X0LB 3CQGB 5L3FB 4HKAA 4UQXA 5H7PA 4DV6T 5BV0A 3R6NA 5HRYA 3P4PA 4GTVA 2PTFA 3BQOA 3RX6A 2WWVA 4BAYB 2XSBA 1HX8A 3AEGA 3FTXA 4IL9A 4M1PA 3QK6A 4CZ2D 5FZRA 3L22A 2LJLA 3GZ1A 2IO3C 4WUYA 3N71A 3CVWA 1N54A 2PFVA 4G2VA 3SFYA 1H6OA 3ZYLA 1E7PA 3TG5A 2K5BB 5L3EB 5JHBA 3FZHB 2V5CA 3P4QA 1FPPA 3RAUA 4PK5A 3EDVA 4XAXB 2UU9T 2F0YA 2CBIA 1VCSA 2VK9A 2IOLA 5FY7A 2VTBB 3J7Yq 3RIFA 3RH3A 2FEZA 4AM9A 4DUYT 1NA3A 3L8RA 2IJGX 2QZAA 4ISSA 4BJNA 4O4LE 2V1DB 3RRCA 4JYAT 2JABA 2CHWA 1JWFA 3SF4A 4G11A 3P4SA 5GONE 3PS6A 4OYKA 3UXGA 4JI0T 1S64A 3JC6D 4HWHA 1OWMA 3RRMB 3CGHA 1IHGA 2VASA 2EINE 1E8XA 1P5QA 3PUJA 3QNUA 2K48A 3IEEA 5A6CA 4AXPA 3PVLA 5FQ4A 1WY6A 3AEFA 1YQ3A 4I0UA 3PU3A 4IREA 2J08A 4ILUA 2AXDS 1LTXA 2ES0A 1H2UA 3E0ZA 1MZCA 3ASHA 1H6PA 3N9QA 2WXIA 4UV8B 4YJ2E 3NZSA 3RO2A 3LCAA 3FDHA 2PZIA 3AE4A 4DV7T 4GZ3A 5AQ7A 2IO2C 1NP7A 2ZU6B 4AKIA 1ELRA 5EKQD 4R7LA 2OLTA 4I55E 2H6GA 4HFGA 1FCHA 3SWHA 4ILHB 5KCMA 2V8SV 3AA0B 3V30A 3AB3B 1E90A 2CA5A 5KMGP 3ZXPA 4TNWA 3APCA 2FJDA 3PUXF 3FUHA 4LNGA 1YYHA 4U8HA 2HH7A 1FT2A 4N3CA 3S7BA 2WBLA 4U7IA 1ZB1A 1TNOA 2HR2A 4L7TA 5JA4D 2XQ8A 3AE3A 4PNIA 5B3SE 3QDNA 4K0RA 3TWUA 3AAAB 3RC8A 4Q25A 4ME2A 4RG6A 2CXDA 4YDOA 2X0YA 4H9NC 2EIKE 4EZLA 3UQ4A 3P50A 3P4RA 4JA9A 4B0ZA 3HRAA 1RW2A 2OEVA 1RZ4A 5ENPD 1Y01A 4N3AA 4RVBA 2H3RA 4U0UA 3U66A 4KT6B 2LXMA 5ANLA 2J47A 2LM2A 2E5VA 2K3WA 1KNRA 3ZYMA 3OVUA 2YU1A 3ZHEB 5AQAA 2WXNA 4UVAB 2GRPB 2W61A 2HN1A 3CHPA 3DSTA 1D1CA 2WU2A 4A98A 1MX4A 4X1KE 4HE8A 4E85A 2VTBA 2RA1A 4EZHA 4A1SA 5HS0A 4A5XA 5EK3A 2OVBA 2ZM0A 4DI4A 3F31A 2XZEA 4DO0A 3OTOT 2MHKA 2HM8A 5JR9B 3ZT5A 4YVOA 3PUYF 2C0SA 2AE9A 4GK5E 5LMUT 2F4VT 5AFUL 2AWIA 1ZV4X 3TG4A 1FVFA 1HS6A 1KFYA 4PS8A 5LA6E 4CEMA 4KHZF 1O3XA 5FXWA 1HFAA 5JDMA 1IJ5A 4IHJE 2JPFA 2N2NA 1H0AA 2DWKA 3UM1A 4CGWA 3FU3A 4A3TA 3CSFA 1KNPA 4E7ZA 1MX6A 2Y4UA 3G06A 2KLQA 4YDEA 5J2UE 2I1JA 3SZ7A 5LP0A 1U5PA 3MV2B 3OKQA 4AI6A 3FB2A 4H63H 3C3RA 1KNZA 4U3CA 5T8IA 3I9YA 3Q5MA 3FUFA 2QRXA 1SUMB 1OXJA 4I2WA 4BT9A 2RKKA 3TWQA 4FLBA 1Q2ZA 2AW6A 3QAQA 2DYRE 4MBQA 3CHMA 3CK9A 2OCCE 2XAHB 5FKYA 3UM2A 4ANUA 2OA5A 5FNVE 2LM9A 2MOWA 2XPZA 1BI8B 1TN6A 2CXLA 5DBKA 5A23A 1T8BA 1AWCB 3AE6A 2RP4A 2A5EA 3CK7A 4ISTA 4K5CA 4UI9K 3UU6A 1J5WA 3Q7AA 4EBAA 4PFPA 1QYMA 1OWPA 3PDYA 5HXRA 4DNDA 4BETA 1CHUA 5H6QB 1XNQT 3RKGA 5AQNB 1MMNA 4DV4T 3AA1B 4I50E 5LJNA 2P58C 1XDOA 2WMNA 4IN3B 1Z5SC 2P9UG 2P2CP 2CCQA 4HFDA 4DV5T 3RRWA 2CEAA 1E7UA 4ZZBA 2GRLA 4UUCA 4GMLA 5IY5E 3SRZA 4K0KT 2CHNA 4LG6A 5LYJE 2YOEA 3CHRA 4A97A 1TEZA 5FZSA 3KV4A 4GTMA 3ZHEA 4LF6T 3EHNA 4LF4T 4WBNE 1K8KG 4MFRA 4IYPA 3FEXA 4O60A 3UFEA 2VL8A 3CSTA 4DR7T 2PM7A 3ZIMA 4C0MA 3FTVA 2BG9E 4LNBA 3NOCD 3UI2A 3ZXSA 3BUAA 3C3QA 2WXJA 2L9QA 4MLPA 4ILGA 1U4QA 1XWMA 2E8IA 1PAQA 5IHYA 5FY0A 3DXMG 5J90A 3GW4A 3R7QA 4HTEA 4LFBT 3IHYA 4V3IA 3U4TA 4WW0A 4JL0A 2FO1E 3FZMB 4DLOA 3D9KA 3GMIA 3QUJA 3DBSA 4WAFA 4TZ4C 1FMVA 3C98B 5KNHD 4F7AA 2WXGA 2UY1B 3TWVA 4OAUC 4ZOLE 4UXNB 1D1AA 4PFOA 3UT5E 3ZKRA 4XIFA 1NZNA 3KINB 1Z0PA 4C9BB 1LKXA 2W63A 4QQIA 5FVKA 2ODVA 4EZKA 4IDNA 2ETCA 2HHHT 4WYVA 4UWHA 3O4ZA 3AG2E 4YDWA 2R03A 3IA3A 1YKHB 3PEVB 3J5QB 3UT7A 2NTYA 3P8CD 3JC6C 2MPKA 2GRQB 3QWWA 3JQ1A 2J1DG 4CXWA 3NB2A 3UINC 5CMWA 4G63A 2CXFA 5F5WA 4JUYA 3OXLA 3FTWA 4UWKA 1W0BA 1KZPA 2V5FA 3KV9A 3NOGD 1ZOYA 1D0XA 5EYPF 3V31A 2K9AA 3ENEA 5EZYE 3CMLA 4KZCA 5C2TA 1A17A 3B7RL 4GZ5A 3IXEA 3ZJ1A 4EV6A 3L54A 3HG0D 3JXJA 2YEVC 4GIWA 2X68A 3RIBA 2WXFA 5AIJA 4HFIA 5JDGA 4LMJA 3VRAA 3CKCA 2A4ZA 3JCFA 3R9MA 1TJCA 4IGUA 2E9XC 3I3NA 4GPMA 2VL0A 4JI3T 4AISA 2VGEA 4L23A 3AU5A 4YJ3E 3CK6A 3CHSA 4G8LA 3HXEA 2IDOB 3LSVA 4AEZC 3RQUA 1N0QA 3AAAC 3PV0F 5G2NA 3TWSA 2X6IA 1DVPA 1EF1C 3I1AA 2E2AA 2PBIA 3HXCA 1OUVA 2L8KA 5LCWC 2XAGB 2VGXA 3LY9A 4H9RC 4CQIA 3ZMTB 2ZGDA 4HWIB 3FUKA 3O48A 1WG0A 2EHOC 3CVUA 4UEMA 2YK0A 3EDUA 4OHFA 2L0IA 4GAAA 4L5GA 4YHJA 2BKPA 3ANWB 2ETBA 2E5LT 3A5XA 1U3CA 3EI0A 4J6IA 4H63V 2WM9A 3NBXX 2HYZA 5CBOA 3SFXA 3ZJ2A 5JMND 4AQFA 1E8ZA 2V6YB 1NAFA 3PE0A 4UI9J 5FT9A 5EDSA 3FBLA 4Y6WA 1JWGA 2QC9A 3FEYA 4HFVA 4YT0A 4J8FA 4UF0B 5AQSB 4DUZT 4B8CB 2KZ7B 1SA4A 5H6RB 3TJPA 3U9WA 3PE4A 4DR3T 5FQ8A 5JR9C 4AJWA 4GB9A 2V4LA 3RF1A 3KEZA 3E08A 1MMAA 5HEJA 3D9LA 3IKOB 3BQLA 4YSXA 4ANWA 5AQUB 1X81A 3UFGA 1UJKA 2UY1A 4FULA 4B3TT 3ZUVB 2UUBT 3K8PC 1ZU2A 3I9WA 2HPJA 3FXDB 4DR6T 4HFHA 4HI8A 5AYWD 3TWXA 4O6FA 4LF8T 3D9NA 3APFA 2YINA 4KUMB 2ILRA 5AJDA 4X64T 5AJLA 3HDXA 1S94A 5IYZE 4GKJT 3HHMA 3A7MA 5DQWA 1QNFA 4QH4A 2LSVA 5ABGA 3APDA 3M3ZB 1H2TC 1ELKA 4JPSA 3OYZA 1HXIA 4MRUA 5LJMA 4I6JA 3ZMSB 5LXTE 1IJ6A 1JCSA 3HKCE 2IIUA 3RPUA 3PURA 4L0RA 5HAXA 4FA6A 1KEYA 4XKCA 3L3PA 4H7XA 5LG4A 3TLVA 2XY8B 3LJ3A 3PZ2A 4HNAD 1S0PA 4EB6E 3IHVA 3WXXA 3QB5K 2P9IG 4I6EA 3SFDA 4NACA 2JQHA 3AE5A 3ZFWA 4HLEA 1JNZA 2IAKA 2V7KA 2V26A 3AECA 4GYSA 5EIDA 2ACZA 3Q78A 3JUIA 5LGTB 4HWDA 4MALA 1LVFA 4KYOB 3QWPA 4WNDA 5FINA 3M65A 4GA1A 4LERA 3MCXA 2R2LA 4DIDB 4U04A 1I94T 2WQHA 4UELA 3ANWA 3KSQA 4TXRA 2P9LG 1N4PA 5JVDE 5F3JA 2V6YA 1K1BA 3MXZA 5FY1A 3T1YT 5HEUA 2CG3A 4XX5A 1BPOA 3ONLC 3CHQA 5LGUB 5E75A 4UF0A 4UVBB 2HO1A 5AQRB 1N52A 3FTYA 2QYJA 4TV3A 5AN8A 3TXMA 4CYMD 1E8YA 3ASOE 2A2FX 3RYCE 3CHOA 5FXXA 4YXDA 3X1DA 3SHFA 5C2YA 3ABVA 3NBNB 4BERA 2LXLA 4ABNA 4GPKA 2XM2A 3VRBA 5HCMA 2KM4A 2BBHA 4KP3C 3SBSA 3LXUX 3RRNB 5BV1A 4O2BE 4QX7B 1OEDC 4PJMA 4JI1T 5KJKA 4A55A 3Q5DA 5G04C 3FTUA 3PEUB 5E0OA 2Y69E 5J08A 2VKJA 2J4GA 1UW4B 2W62A 3LEWA 3SFEA 4F1PA 2XZDG 1IQRA 4LRZA 4GOUA 4RSYA 2R5SA 3Q4AB 2JLBA 3C50A 3I5PA 1EPUA 1KK7A 2XQAA 4JW1A 2WPVA 1XGWA 1MYOA 4I4TE 3PUGA 3FWVA 3HVEB 4XI0A 3MKQB 5LHIB 3W15B 2YN6A 2YDRA 3FY4A 2H6IA 5ANRA 3EAMA 3FU0A 2CBJA 4JD2G 4L9PA 5ENTD 4G26A 1FEWA 3ZYKA 2D0TA 3ZN1B 1W9RA 2DCPA 4CXYA 4X66T 1B89A 4MBGA 1KPSB 4ANJA 1YKEB 1UJJA 3N5LA 1G8XA 2FF4A 4G23A 3GWHA 2LSIA 5A7DB 3FUMA 4YLHA 4U2YA 1YA0A 1IXVA 2XQYA 2IW5B 2WXPA 3CVYA 4GYOA 1N36T 3SQVA 1QUUA 2K24A 3TLTA 3KBTA 3S7FA 2M6IA 2CLYB 4YHHT 2J49A 1YW0A 4DVDA 5CA1E 3R84B 1LD8A 1BR0A 1E8WA 2KATA 3G2WA 5JRCB 5ABHA 3UTMA 4EAHA 3PUQA 1U2VG 1HS7A 1TN8A 2GROB 2WB5A 4MLKA 4YSZA 3ZCJA 4I1OB 2NSZA 5CHEE 2LO6A 2LSGA 5T3RA 3GZ2A 4F3VA 2M63A 3VU7H 2UXCT 4EIWA 3FU6A 2VB6A 3SOLA 3ULQA 3PJAA 4AP2A 4D10C 2LOSA 3MACA 1D8DA 4M7CA 2WQ6A 4NIKA 5ABFB 4JI7T 1HH8A 3LY7A 4JI2T 4I43B 1R8IA 2IONA 2YHCA 4ANXA 4Y6CA 4AXHA 4U31A 5D0OD 4Z91A 3Q2MA 1IZNB 2XCBA 3MA9A 3FH7A 3C4ZA 4NIQA 2XENA 5KJLA 5AQTB 5EX0A 3GZSA 2R6GF 3IEGA 2XGSA 2B76A 2JIWA 4BEPA 3C64A 2DLRA 2LSUA 4U63A 3PDNA 4GTPA 3OPCA 2LAIA 2E9XD 2XEHA 4NQ0A 2B6CA 3PUWF 3LJNA 1MIVA 1K3ZD 2DHRA 1HNWT 2YNQA 5BT1A 3KS2A 3QJZA 2OV9A 4DMVA 3J5PA 5HCJA 5G55A 4B94A 2PQNA 4CDMA 3UQ7A 1XDPA 4ANVA 1G3NB 2LHNA 4KVMA 3L13A 4V1Av 4FADA 5HWXA 4WNEA 4C90A 2E9XB 2BBJA 1N94A 1WRDA 3CVRA 2X66A 1N0RA 1VCTA 3EDTB 3UTKA 1JUQA 2EHOD 3AA7B 3AEEA 1PY1A 4TXPA 2DWZA 4IRUA 2PNNA 3ZMZB 1HO8A 3D9IA 4U33A 4PJNA 5AQIB 3T5VA 3AEDA 3HVEA 4O1PA 2W0GA 2EILE 3MKQA 2BKGA 4I9CA 4CI1B 5DQVA 4DV2T 1OWLA 1SE7A 2EHOB 4UQYA 4J8DA 5LX8A 4AQYT 5FVLA 3U3IA 3E22E 4K5BA 3HYMB 5CMYA 2VVNA 4RG9A 1N95A 4B8AA 2UXBT 5HKPA 1IHBA 5HWYA 4JB8P 2ZM2A 3MZLB 4TRQA 3Q75A 1OCOE 3UQ3A 4IDOA 2NP9A 5ABEA 4IDPA 4O4HE 5FQ6A 3F57A 2KBXA 5JRCA 3RIAA 3O1HA 3ONKA 4DX1A 4W9RA 2UXDT 3ZGQA 2J4BA 4M3OA 1ZBPA 3UU4A 2W2UA 1NWMX 4P09A 4GYWA 5J0ZA 3B7TA 3P2BA 3AS4A 3AS5A 3LPZA 2IF4A 3OXGA 4Q94A 3TWRA 2ETAA 5ABFA 3QKYA 4ILCA 1BI7B 4FJYA 5EK4A 3DSXA 3W9GA 2H6HA 3T1HT 3OTNA 3CK8A 5AAOA 4TXQA 5LP6E 1UCUA 2OEWA 1IKND 3CKBA 4P29A 2MOZA 5FTPA 2L9BA 5JDFA 3RIUC 1KT0A 2UWJG 3AAEB 4TV8E 3F6QA 2SPCA 1INZA 4X1YE 1U3DA 3BU8A 2VGYA 5DJQC 2V5DA 3AG3E 3UKRG 3LBXB 4H9SE 3LG7A 4ACLA 2WZIA 3KAEA 3KVBA 3R9AB 1WLXA 2C0LA 4QXHB 3DSUA 2KZTB 3ZCIA 2IC6A 3AEBA 2WXLA 4ZHBA 4AKRB 2D0UA 3AS8A 4KHPT 3UULA 3ASGA 3ZYQA 3EIJA 2VQFT 3PRZA 2E9XA 3C4XA 5A1LA 3FBZA 3AJIA 1O1SA 2XQ9A 1UGOA 3VR9A 3SGHA 2UUCT 3FUEA 5HEHA 4U07A 4KZ0A 3FULA 4PUCA 1YD8G 1JCRA 4ILAA 2X9YA 4C91A 1UURA 4ZS3A 1L0VA 1E7VA 4IT4A 3L08A 4QKNA 4CN6A 2JRKA 2BEDA 3L16A 2J62A 1IBLT 5FJYA 2C0MA 4LMKA 4N2SA 2PG8A 4N2QA 4B93B 2EHOA 2F37A 1OWNA 2QY7A 4JVSA 4ZHQE 3E30A 3NVOA 4PK4A 1QQEA 2VSXE 5F8PA 4JHKA 4NXNT 2WCAA 5L4EA 2AXZA 3HXBA 1VOMA 5JJ6A 1KF6A 5AQHB 4HRNA 3D9MA 2V6XA 4DV0T 4UQZA 3J9X1 1HR0T 3WG7E 5BW8C 1S63A 1H7CA 1J1JA 4B89A 2IHR1 3EU9A 3NRXA 3JUEA 4IE0A 1JNRA 4N5CA 4GCNA 2R17C 3ZN3A 4K5AB 3OBVE 3NRYA 2Y1LE 3ASDA 4ZEYA 3Q9UC 4EECA 2NC9A 4LNUD 2KT9A 2CLYC 4F53A 5LHGB 5JR9A 3G2SA 4B3ST 5HQ8A 2KCVA 3EHQA 3G2TA 4I2ZA 3SD5A 5CECB 2XAQB 3ESLA 5IWAT 1O1RA 2LHRA 1MHQA 2XPKA 2WXOA 3D9HA 3DPYA 1YCSB 2Q7FA 1OEDB 2H6FA 3FFLA 1NEKA 1Z3XA 1MNDA 4DLQA 3SY2A 1ZKEA 3HI2A 4GZCA 1FVHA 2DZOA 3FUIA 2GRRB 3DRAA 4FI5A 4B6XA
chains in the Genus database with same CATH topology
5LFAA 5C8YE 4AQGA 5CA0E 2JMHA 3EUHA 4K0UA 3RYIE 3QWVA 4IULA 4BY6A 4JXTA 2RD0A 4U72A 2MBGA 3FTSA 2DBAA 2KZTA 1Y6IA 4F1SA 5JJ7A 1H2VC 4N3BA 3KBUA 4F6RC 5BPPA 3VKHA 5LCWJ 1E1HB 4JEHB 2CM0A 3LJCA 2IU1A 2YU2A 2CHZA 3HKEE 4EBAG 4G25A 3N9PA 3N2OA 3PZDA 4BTBA 2GGFA 1NA0A 4FHKA 2VKOA 4YFSA 3CX8B 4I1MA 4HOUA 4ADZA 2IOSA 4B6XA 4U0ZA 2VSYA 4GA0A 1W3BA 4EYYR 4XI9A 5FQ7A 2KMFA 4A1GA 2J4DA 3Q9DA 3ZN0B 5HXEA 1MQSA 3L6AA 3QC9A 1BR1A 2LAHA 2KINB 3KDSE 1EDUA 2KWHA 5ETWA 2ONDA 4BSXA 2L3LA 2NOXA 2Q9QD 4N39A 5G05C 4C9BB 3GN5B 4DJAA 4PS7A 3UT8A 3I4GA 3ONLA 4CDRA 3KFWX 2WAUA 4WWOA 2XAJB 3CQCB 2AXVA 3BK9A 2XGOA 3QC1A 2RG8A 4PAGA 4BA9A 2Q9QB 5EK2A 5LCYA 3CQXC 4NUVA 4LEUA 4L9IA 3MKDA 3TAXA 2G0UA 5J1GA 2Y6XA 2CFUA 5M4YA 3C98A 3Q5WA 2CE7A 3FUNA 3SI5A 1UX5A 1BR4A 3N2KE 3WI3A 5LOZA 3FUJA 4EYUA 3VKGA 3R7RA 2PL2A 3B13A 3B7SA 1LVKA 2NTXA 3HKBE 3D3MA 3LFMA 3T8MA 4FC8A 5BNWA 4YNDA 4IE4A 3K3OA 1BR2A 3DJBA 4ZI2D 3T8OA 3G2VA 3CWZB 3K3NA 1B7TA 4JC8A 1Z3YA 5L3GB 3I0OA 4HOSA 4L2LA 3N2GE 3Q5XA 3IBEA 1QSDA 4GYYA 3PE3A 3D9JA 3CR3A 2WVIA 2CG2A 2WMOA 4H9QC 3TGOA 4HOQA 2JQQA 2GK9A 1WYCA 2C5JA 3O9XA 4XE0A 3DP7A 4LUNU 3PH0C 3SFZA 3PU8A 2OV8A 1GW6A 4CXXA 4DK5A 4Q69A 2BTDA 2OOEA 2QFCA 4MHCA 4U74A 1WAO1 4CZZB 3LKUA 3ZC1A 4KBMB 3GN5A 5JH7E 4AKGA 4GZDA 3CVQA 2WXMA 4TUYE 5FYMA 2I6HA 3EJNA 3QB2A 4EPZA 3MZKB 3U3WA 3GYZA 3PNLB 4PJLA 3IHRA 4FJOA 3JQ0A 2Q9QA 3AVRA 1Y64B 3OJAA 5G04J 4J8EA 1TJFA 4GCOA 2GW1A 1FMWA 3MEKA 2D2SA 3E4BA 1T98A 3I0QA 2J07A 3B7UX 3PREA 4TX5A 2LE8A 4Q96A 2V7MA 1SZ9A 2BZBA 3UT4A 5FZQA 2Z6EA 3S4UA 3FUDA 3I4RB 2WXQA 4PW8A 3CX7B 4BX9A 4I1AA 3SBTB 3MX3A 3QNKA 1VDYA 3CX6B 5JREA 4GZ6A 3PUAA 4WWPA 2WB2A 4WWNA 3EVYA 2KXPB 4X1IE 4APOA 2AVPA 4CCAA 2ZLYA 4PK6A 5KDMC 3UUMA 5LBQB 2DI4A 2I1KA 3ML9A 3FHEA 2XUEA 5HYAA 3F2EA 2NW8A 3LY8A 1EYHA 4DPRA 3N9LA 4DBQA 4ERRA 2CFZA 3ETUA 2CMRA 3EIQC 2C5KT 3AA6B 2A3DA 4EOZB 4O8SA 3LVQE 1UN8A 4Z8XA 1D1BA 1UN9A 3C51A 1ZEEA 3ZRHA 2NXPA 3URZA 3V5UA 4PDXA 3MA5A 4XBFB 3FP3A 3LYAA 5CCMA 4DI3A 4PJJA 3JCKC 1VRBA 5LGNB 3K9IA 1HF8A 4TV9E 2X6KA 3HIZA 4XZCA 4AVXA 3QK0A 4AV7A 2PJQA 5ARGA 2XRYA 5ADXL 4G2AA 2Q9QC 2ZM8A 3N9NA 5FWQA 2XRZA 2I59A 2KWIB 3JYSA 2WXKA 2VKDA 3RYHE 3S7DA 3N9OA 5M72A 4GA2A 2Y3AA 2KNDA 4XKBA 4FJZA 1G73A 4QXCB 4ZS2A 1XNFA 4P0AA 1EZ3A 2HPLA 4APFA 5FMNA 2A5UA 1FIOA 4UWFA 1SA0E 2R59A 3HR0A 1H19A 1WM5A 4G1TA 3ZW3A 3H37A 4WBOA 1IAPA 3CV0A 1X79A 4E7SA 3CVNA 2UXNB 5AENA 3IV0A 4KMCA 4OFZA 5FP3A 1ELWA 4CGVA 2ACXA 5TAOA 3ZVVA 4H9PC 4HOTA 4QX8B 4BX8A 2YQ8A 2E0IA 1HTJF 5E76A 3PNTB 4QHOA 4J8SA 4OYSA 4I17A 4QFVA 3ZPJA 4ZI2C 3LK3B 4FHJA 5L3BB 5JDNA 2CWOA 4YVQC 3FH5A 1KT1A 2ZMAA 3BQKA 4IE6A 2E2EA 2BVMA 2N9DA 5CCLA 3NQPA 2BF0X 2I2OA 5J2TE 4AY5A 4A3VA 2QA7A 4IE7A 3NZPA 4CI3B 3DTOA 3ML8A 2X6HA 3P7IA 2JMKA 4I43A 4JHJA 5ENNA 2H7VC 4P0BA 2Y48B 4JHRA 2FI7A 4BT8A 3L17A 5T4YA 3U78A 5HXCA 1SZAA 2XTLA 3HL6A 2LSYA 2M67A 4TUUA 1AJ3A 3NF1A 1LRZA 2D5UA 3Q49B 1SQMA 3N9MA 4NRHB 4HORA 1HCIA 3O4XE 3MGBA 4AY6A 2GRMA 1OWOA 2XPYA 3O1IA 4ATGA 4DMWA 2BVLA 4PS3A 2X3MA 2VQ2A 2C2LA 4ILIA 3UUXB 3CIAA 2WWUA 1H6KA 2J09A 3LVRE 3ZMVB 3FXEB 2MRIA 1S35A 1WYBA 2ODUA 3FH8A 1IQUA 2BUGA 3RO3A 4L2YA 3FHNA 4UWGA 1DNPA 4HS2A 4IDZA 3LDZA 2WSSV 4UIGA 3CEQA 4H9OC 4GYRA 5HXSA 3RJVA 2DNXA 3O1JA 4IIJE 3BG0B 5JJTA 2XGMA 5EX3A 4UVCB 2KCKA 4EZJA 5LBMA 3DPDA 3MKRA 4KVOA 4EXTA 5JQGE 3UX4A 2KCLA 5LOVE 4ACKA 3TXNA 3UPVA 2NWBA 2VSNA 4FP7A 5JDHA 3D0TA 2WQ7A 3MJXA 4AKHA 4LCTA 2VGXB 3RK6A 1E96B 3AAIA 3T5XA 4UWLA 2IQCA 1MNEA 3MK7C 4HEAA 3PUKA 4ZI3D 4G24A 4QXBB 3Q47B 2V7JA 3VLFA 3PTRB 3VLDA 2EQXA 1MIWA 1D0ZA 2LSKA 2MTQA 3U64A 3SNXA 2N1GA 3K3QC 2XHEB 2DWGA 4MS6A 2PM6A 3CVXA 3ONXA 3B57A 3C4WA 4WNKA 5LHHB 3HKDE 1SHZC 4A56A 2X9HA 4J2CA 3EHMA 3S7JA 2NW7A 1CUNA 3FTZA 4JEUB 4NUUA 3BG1B 1V9DA 4BJMA 3RC3A 3ZEFB 4GK0E 3PUSA 1JPLA 1HZ4A 1D0YA 3LBXA 4URKA 3NZUA 4CT0A 4EZ4A 4MKTA 2C5IT 4WNFA 2NW9A 4CDNA 3IBPA 4E6HA 3UUXA 4OVUA 3OYXA 3CVVA 4PH4B 3CPZA 3LK42 2YHEA 3OXFA 5L3CB 1OXZA 3TKLB 4HGAA 2IC9A 4NURA 2X51A 1US7B 5KX5E 5G05J 5JHAA 3MJWA 2V8SE 5L2LA 5DABA 4TN7B 3L09A 1HE8A 2X6JA 3CLJA 3IF8B 4AKLA 3ETVA 3ZMUB 1MMGA 4CT4A 1MIYA 1PC2A 1LF8A 2XCCA 1Y8MA 4FU3A 3RKOA 3RU0A 4N78D 4H7YA 4JZYA 4WNGA 5FXVA 5C1DA 2VWAA 5D0QD 1KLXA 4IE5A 2FBNA 4QWNB 2X9XA 2P9BA 3WAJA 2BDEA 3CKDA 3BEEA 4J0UA 2CWYA 3P1UA 3ASFA 5KJNA 3V5SA 2V0PA 3KV5A 2X67A 2XQ0A 2XHEA 2VKHA 4KBQA 5FXZA 3RYFE 4L1BA 3ZC0A 5ARFA 4DBRA 4C0EA 3H3AA 3LK2B 2CHXA 3D9OA 3WAKA 3LS8A 4BWRA 4JEUA 4CRWA 4OK0A 2LOPA 4UI9C 3HA4A 3ZEFA 4KMOA 4U0SA 2PQRA 5DIZA 1QZ2A 1L5JA 3AU4A 5KJMA 2JJ9A 4HVBA 2LSJA 3ZLIA 3D9PA 5JDQA 3ESKA 3ZPOA 5JDLA 3VHLA 2FO7A 4BFRA 3Q15A 2V7IA 1HG5A 1HU3A 4JEHA 3G2UA 2DCFA 5L3DB 3AVSA 4JA7A 5HXHA 2V7LA 4UV9B 1IYGA 3VTYA 4XZ4A 2XPIA 3UMVA 2WXRA 5BMVE 2LNIA 3RRUA 4I9EA 3QOUA 2A72A 4I6GA 4KXKB 3VLEA 3KVAA 2X6FA 2LEHA 2FULA 3FU5A 2AXUA 4GU5A 5HI7A 2LT3A 4GMJA 4OYJA 3S2AA 5LNKA 3GA8A 4CI2B 4JLEA 1UX4A 4X20E 2L6JA 2VSOE 2WXHA 4K03A 1X5BA 1OWAA 2X38A 5BUZA 3SS1A 1MMDA 4AIFA 2I9CA 2H7OA 2L0TB 2Y4TA 3TL5A 3BQIA 2VJ8A 4FLHA 2B1EA 3UUNA 4OVVA 2X9WA 2Y8DA 4AQFC 3VTXA 3OAWA 4O4JE 4ZI7E 3KD7A 2QGSA 3MYVA 1UG3A 4ZI3C 2OVFA 2KC7A 2IFUA 2VYIA 4HXIA 4EQFA 3NZQA 4O4IE 4BTAA 3RKVA 4HN9A 2MYSA 4ASKA 1HG2A 3QARA 2UXXB 2W00A 3CVPA 3MV3B 1ZHCA 3KV6A 5CB4E 2XAFB 1Z6TA 2JEKA 2J9QA 1WR6A 3CVLA 4O2AE 2XASB 2DIWA 4AOFA 2X0LB 3CQGB 5L3FB 4HKAA 4UQXA 5BV0A 3R6NA 3RX6A 4BAYB 1HX8A 3FTXA 4M1PA 3QK6A 5FZRA 3L22A 2LJLA 3GZ1A 4WUYA 3N71A 3CVWA 1N54A 2PFVA 4G2VA 3ZYLA 3TG5A 2K5BB 5L3EB 5JHBA 4PK5A 3EDVA 4XAXB 2VK9A 2IOLA 5FY7A 2VTBB 3J7Yq 3RH3A 2FEZA 4AM9A 1NA3A 2IJGX 4ISSA 4BJNA 4O4LE 2V1DB 3RRCA 2CHWA 1JWFA 3SF4A 4G11A 5GONE 3PS6A 4OYKA 3JC6D 1OWMA 3RRMB 3CGHA 1IHGA 2VASA 1E8XA 1P5QA 3PUJA 2K48A 3IEEA 5A6CA 4AXPA 3PVLA 5FQ4A 1WY6A 3PU3A 2J08A 4ILUA 2ES0A 1H2UA 3E0ZA 3ASHA 3N9QA 2WXIA 4UV8B 4YJ2E 3NZSA 3RO2A 3LCAA 3FDHA 2PZIA 4GZ3A 1NP7A 2ZU6B 4AKIA 1ELRA 5EKQD 4R7LA 4I55E 4HFGA 1FCHA 3SWHA 4ILHB 5KCMA 3AA0B 3AB3B 1E90A 2CA5A 5KMGP 3APCA 3FUHA 4U8HA 2HH7A 4N3CA 3S7BA 2WBLA 4L7TA 2HR2A 4PNIA 3QDNA 4K0RA 3AAAB 3RC8A 4ME2A 4RG6A 2CXDA 4H9NC 4EZLA 4JA9A 4B0ZA 4N3AA 4RVBA 2H3RA 4U0UA 3U66A 4KT6B 5ANLA 3ZYMA 2YU1A 3ZHEB 2WXNA 4UVAB 2W61A 3CHPA 1D1CA 4X1KE 4HE8A 4E85A 2VTBA 2RA1A 4EZHA 4A1SA 5EK3A 2OVBA 2ZM0A 4DI4A 3F31A 4DO0A 2MHKA 2HM8A 5JR9B 4YVOA 2C0SA 4GK5E 5AFUL 2AWIA 1ZV4X 3TG4A 1FVFA 1HS6A 4PS8A 5LA6E 4CEMA 1O3XA 5FXWA 1HFAA 5JDMA 1IJ5A 4IHJE 2JPFA 2N2NA 1H0AA 2DWKA 4CGWA 3FU3A 4A3TA 3CSFA 4E7ZA 2Y4UA 2KLQA 5J2UE 2I1JA 3SZ7A 5LP0A 1U5PA 3MV2B 3OKQA 4AI6A 3FB2A 4H63H 1KNZA 5T8IA 3I9YA 3Q5MA 3FUFA 4BT9A 4I2WA 4FLBA 2AW6A 3QAQA 4MBQA 3CHMA 3CK9A 2XAHB 4ANUA 2OA5A 5FNVE 2LM9A 2MOWA 2XPZA 2CXLA 5DBKA 5A23A 2RP4A 3CK7A 4ISTA 4UI9K 4EBAA 4PFPA 1OWPA 3PDYA 5HXRA 4DNDA 5H6QB 1MMNA 3AA1B 4I50E 5LJNA 2P58C 2WMNA 4IN3B 2CCQA 3RRWA 2CEAA 1E7UA 2GRLA 4GMLA 3SRZA 5LYJE 3CHRA 1TEZA 5FZSA 3KV4A 3ZHEA 3EHNA 4WBNE 4MFRA 4IYPA 3FEXA 3UFEA 2VL8A 3CSTA 2PM7A 3ZIMA 4C0MA 3FTVA 3ZXSA 2WXJA 2L9QA 4MLPA 4ILGA 1U4QA 2E8IA 1PAQA 5IHYA 5FY0A 5J90A 3GW4A 3R7QA 4HTEA 3IHYA 4V3IA 3U4TA 4WW0A 4JL0A 4DLOA 3D9KA 3GMIA 3QUJA 3DBSA 4WAFA 4TZ4C 1FMVA 3C98B 4F7AA 2WXGA 2UY1B 4ZOLE 4UXNB 1D1AA 4PFOA 3UT5E 4XIFA 1NZNA 3KINB 1Z0PA 1LKXA 2W63A 2ODVA 4EZKA 4UWHA 3O4ZA 1YKHB 3PEVB 3UT7A 2NTYA 3P8CD 3JC6C 3QWWA 3JQ1A 2J1DG 4CXWA 5CMWA 4G63A 2CXFA 3OXLA 4JUYA 3FTWA 4UWKA 2V5FA 3KV9A 1D0XA 2K9AA 3ENEA 5EZYE 3CMLA 4KZCA 1A17A 4GZ5A 3B7RL 3ZJ1A 3L54A 3RIBA 2YEVC 4GIWA 2X68A 5AIJA 2WXFA 5JDGA 3CKCA 2A4ZA 1TJCA 4IGUA 2E9XC 3I3NA 4L23A 3AU5A 4YJ3E 3CHSA 4AEZC 5G2NA 2X6IA 1DVPA 1EF1C 3I1AA 2PBIA 1OUVA 2L8KA 5LCWC 2XAGB 2VGXA 3LY9A 4H9RC 4CQIA 3ZMTB 3FUKA 3O48A 2EHOC 3CVUA 4UEMA 2YK0A 3EDUA 4OHFA 2L0IA 4GAAA 4L5GA 4YHJA 3ANWB 3A5XA 1U3CA 4J6IA 4H63V 2WM9A 3NBXX 2HYZA 3ZJ2A 4AQFA 1E8ZA 1NAFA 3PE0A 4UI9J 5FT9A 5EDSA 3FBLA 4Y6WA 1JWGA 3FEYA 4HFVA 4J8FA 4UF0B 4B8CB 2KZ7B 5H6RB 3TJPA 3U9WA 3PE4A 5FQ8A 5JR9C 4AJWA 4GB9A 2V4LA 3KEZA 3E08A 1MMAA 3D9LA 3IKOB 3BQLA 4ANWA 1UJKA 2UY1A 4FULA 1ZU2A 3K8PC 3I9WA 2HPJA 3FXDB 5AYWD 4O6FA 3D9NA 3APFA 2YINA 4KUMB 2ILRA 5AJDA 5AJLA 3HDXA 1S94A 5IYZE 3HHMA 5DQWA 1QNFA 2LSVA 3APDA 1H2TC 1ELKA 4JPSA 3OYZA 1HXIA 4MRUA 5LJMA 4I6JA 3ZMSB 5LXTE 1IJ6A 3HKCE 3RPUA 3PURA 4L0RA 5HAXA 4FA6A 4XKCA 3L3PA 4H7XA 5LG4A 3LJ3A 1S0PA 4EB6E 3IHVA 3WXXA 4I6EA 4NACA 3ZFWA 4HLEA 2IAKA 2V7KA 2V26A 4GYSA 3JUIA 5LGTB 4MALA 1LVFA 4KYOB 3QWPA 4WNDA 3M65A 4GA1A 4LERA 3MCXA 4U04A 2WQHA 4UELA 3ANWA 5JVDE 5F3JA 3MXZA 5FY1A 2CG3A 4XX5A 1BPOA 3CHQA 5LGUB 5E75A 4UF0A 4UVBB 2HO1A 1N52A 3FTYA 4TV3A 3TXMA 1E8YA 2A2FX 3RYCE 3CHOA 5FXXA 3SHFA 5C2YA 4ABNA 4GPKA 2KM4A 4KP3C 3SBSA 3LXUX 3RRNB 5BV1A 4O2BE 4QX7B 4PJMA 5KJKA 4A55A 5G04C 3FTUA 3PEUB 5E0OA 5J08A 2VKJA 1UW4B 2W62A 3LEWA 1IQRA 4LRZA 4GOUA 4RSYA 2R5SA 3Q4AB 2JLBA 3C50A 3I5PA 1EPUA 1KK7A 4JW1A 2WPVA 1XGWA 4I4TE 3PUGA 3FWVA 3HVEB 4XI0A 3MKQB 5LHIB 3W15B 3FY4A 5ANRA 3FU0A 4G26A 1FEWA 3ZYKA 2D0TA 3ZN1B 2DCPA 4CXYA 1B89A 4ANJA 1YKEB 1UJJA 3N5LA 1G8XA 2FF4A 4G23A 3GWHA 2LSIA 5A7DB 3FUMA 4YLHA 1YA0A 2XQYA 2IW5B 2WXPA 3CVYA 4GYOA 1QUUA 2K24A 3KBTA 3S7FA 2CLYB 2J49A 1YW0A 4DVDA 2KATA 3R84B 5CA1E 1BR0A 1E8WA 3G2WA 5JRCB 4EAHA 3PUQA 1HS7A 4MLKA 4I1OB 3ZCJA 2NSZA 5CHEE 2LO6A 2LSGA 5T3RA 3GZ2A 4F3VA 2M63A 3VU7H 4EIWA 3FU6A 2VB6A 3SOLA 3ULQA 4AP2A 4D10C 2LOSA 3MACA 2WQ6A 3LY7A 1HH8A 2IONA 4I43B 4ANXA 2YHCA 4Y6CA 4AXHA 5D0OD 3Q2MA 1IZNB 2XCBA 3MA9A 3FH7A 3C4ZA 5KJLA 5EX0A 3GZSA 3IEGA 2XGSA 3C64A 2DLRA 2LSUA 4U63A 3PDNA 2LAIA 2E9XD 4NQ0A 1MIVA 2DHRA 2YNQA 5BT1A 3KS2A 3QJZA 4DMVA 5G55A 4B94A 2PQNA 4CDMA 4ANVA 4KVMA 2LHNA 3L13A 4V1Av 4FADA 5HWXA 4WNEA 4C90A 2E9XB 1WRDA 3CVRA 2X66A 3EDTB 3UTKA 1JUQA 2EHOD 3AA7B 1PY1A 4IRUA 3ZMZB 1HO8A 3D9IA 4PJNA 3T5VA 3HVEA 2W0GA 3MKQA 4I9CA 4CI1B 5DQVA 1OWLA 4UQYA 2EHOB 4J8DA 5LX8A 3U3IA 3E22E 3HYMB 5CMYA 4RG9A 4B8AA 5HWYA 2ZM2A 3MZLB 4TRQA 3UQ3A 2NP9A 4O4HE 5FQ6A 3F57A 5JRCA 3ONKA 3O1HA 4W9RA 3ZGQA 2J4BA 4M3OA 1ZBPA 1NWMX 4P09A 4GYWA 3B7TA 3P2BA 3AS4A 3AS5A 3LPZA 2IF4A 3OXGA 4Q94A 3QKYA 4FJYA 5EK4A 3OTNA 3CK8A 5LP6E 1UCUA 3CKBA 4P29A 2MOZA 5FTPA 2L9BA 5JDFA 1KT0A 2UWJG 3AAEB 4TV8E 2SPCA 1INZA 4X1YE 1U3DA 2VGYA 5DJQC 3LBXB 4H9SE 3LG7A 4ACLA 3KAEA 3KVBA 3R9AB 1WLXA 2C0LA 4QXHB 2KZTB 3ZCIA 2IC6A 2WXLA 4AKRB 2D0UA 3AS8A 3ZYQA 3UULA 3ASGA 3EIJA 3PRZA 2E9XA 3C4XA 5A1LA 3FBZA 3SGHA 3FUEA 4U07A 4KZ0A 3FULA 4PUCA 1YD8G 2X9YA 4C91A 4ZS3A 1E7VA 3L08A 4QKNA 2JRKA 3L16A 5FJYA 2C0MA 4N2SA 2PG8A 4N2QA 2EHOA 1OWNA 2QY7A 4JVSA 4ZHQE 4PK4A 1QQEA 2VSXE 5F8PA 4JHKA 2AXZA 1VOMA 5JJ6A 3D9MA 4UQZA 3J9X1 5BW8C 1H7CA 4B89A 3NRXA 4IE0A 4N5CA 4GCNA 2R17C 3ZN3A 3OBVE 3NRYA 3ASDA 4F53A 4EECA 2NC9A 2KT9A 2CLYC 5LHGB 5JR9A 3G2SA 5HQ8A 2KCVA 3G2TA 4I2ZA 3SD5A 2XAQB 3ESLA 2LHRA 1MHQA 2WXOA 2Q7FA 3FFLA 1Z3XA 1MNDA 4DLQA 1ZKEA 3HI2A 4GZCA 1FVHA 3FUIA 4FI5A 2XEVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMN A;  2WM9 A;  3B13 A;  3VHL A;  2WMO A;  2YIN A; 
#chains in the Genus database with same CATH topology
 5LFA A;  5IUX A;  4LF5 T;  5D66 A;  1NI1 A;  1N33 T;  3E37 A;  5C8Y E;  4AQG A;  5CA0 E;  2JMH A;  5AQK B;  3EUH A;  2F8Y A;  1TNB A;  4JBW F;  4K0U A;  3Q73 A;  3RYI E;  3TLU A;  3QWV A;  3E32 A;  4IUL A;  4BY6 A;  4JXT A;  2RD0 A;  4U72 A;  4U8Y D;  2MBG A;  4KX6 A;  3FTS A;  2DBA A;  2Y0B G;  2KZT A;  1Y6I A;  1AP7 A;  5KXJ A;  4F1S A;  5JJ7 A;  1H2V C;  4N3B A;  4HI9 A;  3KBU A;  4F6R C;  5BPP A;  3VKH A;  5LCW J;  5C3J A;  2MYO A;  1E1H B;  4N5Q A;  2CPT A;  4JEH B;  2CM0 A;  3LJC A;  4YSY A;  2IU1 A;  2YU2 A;  2CHZ A;  3HKE E;  5ENS D;  4EBA G;  4G25 A;  3N9P A;  3N2O A;  3PZD A;  4BTB A;  2GGF A;  1NA0 A;  4FHK A;  2VKO A;  4YFS A;  3CX8 B;  3AE8 A;  2J8S D;  4I1M A;  4HOU A;  3KSL A;  4ADZ A;  2IOS A;  4U0Z A;  2VSY A;  4GA0 A;  1W3B A;  4EYY R;  4XI9 A;  5FQ7 A;  2P9K G;  2KMF A;  4A1G A;  2ZM6 T;  2J4D A;  3Q9D A;  3ZN0 B;  5HXE A;  1MQS A;  3L6A A;  5ENR D;  3QC9 A;  1BR1 A;  2LAH A;  2KIN B;  3KDS E;  1EDU A;  2KWH A;  5ETW A;  2XS8 A;  2OND A;  3DSS A;  3KEA A;  4BSX A;  2L3L A;  2NOX A;  2Q9Q D;  4N39 A;  2M6B A;  4DR4 T;  3GN5 B;  3HXF A;  5G05 C;  4DJA A;  4PS7 A;  3UT8 A;  1OCR E;  1DC2 A;  3I4G A;  3ONL A;  4CDR A;  5ITZ F;  3KFW X;  2WAU A;  4WWO A;  2XAJ B;  3CQC B;  2AXV A;  2W4X A;  3BK9 A;  3RI5 A;  1FJG T;  2XGO A;  3QC1 A;  2BG9 C;  2RG8 A;  2WQY A;  4CN1 A;  3EHZ A;  4PAG A;  4BA9 A;  1HNX T;  5EN5 D;  2Q9Q B;  5EK2 A;  4YDY A;  5LCY A;  3CQX C;  4NUV A;  1WDY A;  4LEU A;  2NR4 A;  4L9I A;  4IL4 A;  1MX2 A;  3ONJ A;  3ZU7 B;  2UUA T;  3L9T A;  3NKZ A;  3MKD A;  3TAX A;  2G0U A;  4QH1 A;  5J1G A;  2Y6X A;  1IBM T;  2CFU A;  5M4Y A;  1OED A;  4ZXL A;  4ZZC A;  3C98 A;  3Q5W A;  2CE7 A;  3FUN A;  3SI5 A;  1UX5 A;  1BR4 A;  3N2K E;  3WI3 A;  5FL1 A;  5LOZ A;  3DWL G;  1OCZ E;  3HXD A;  3FUJ A;  4EYU A;  3VKG A;  3R7R A;  3TLW A;  5AQ9 A;  3DSV A;  5EIL A;  2PL2 A;  5L4H A;  3B13 A;  4DX5 D;  3B7S A;  1LVK A;  2NTX A;  3HKB E;  4B3R T;  3D3M A;  1W0A A;  2FJB A;  2XM1 A;  1XZY A;  3LFM A;  4AIU A;  3T8M A;  3NAW A;  4FC8 A;  5BNW A;  4YND A;  4IE4 A;  3K3O A;  2YDS A;  1BR2 A;  3DJB A;  4ZI2 D;  3AE1 A;  3T8O A;  3G2V A;  3CWZ B;  3K3N A;  1MJ0 A;  1TNY A;  1B7T A;  4JC8 A;  1Z3Y A;  5L3G B;  5LB7 B;  3I0O A;  2P9N G;  2XS1 A;  4HOS A;  4L2L A;  5ENQ D;  1LD7 A;  3N2G E;  3Q5X A;  3IBE A;  2W66 A;  1QSD A;  4GYY A;  4DUI A;  4U7Y A;  3PE3 A;  3D9J A;  3CR3 A;  3DEP A;  2WVI A;  2CG2 A;  2WMO A;  3V79 K;  4H9Q C;  4Z68 A;  3TGO A;  4HOQ A;  2JQQ A;  2GK9 A;  1WYC A;  2C5J A;  2NYJ A;  3O9X A;  4XE0 A;  3DP7 A;  3E33 A;  4LUN U;  4YY3 T;  3PH0 C;  3ZT7 A;  3SFZ A;  4HWC A;  5CER B;  3PU8 A;  2OV8 A;  1GW6 A;  4CXX A;  1N9A A;  4DK5 A;  4A63 B;  4Q69 A;  1N34 T;  2BTD A;  4P1N A;  2OOE A;  2QFC A;  4MHC A;  4U74 A;  1WAO 1;  4CZZ B;  3LKU A;  4JI8 T;  3ZC1 A;  4KBM B;  1JCQ A;  3JXI A;  3GN5 A;  4DX7 D;  5JH7 E;  4KI0 F;  4LFC T;  2BS4 A;  4AKG A;  4GZD A;  3CVQ A;  2WXM A;  4TUY E;  2I6H A;  5FYM A;  3EJN A;  3QB2 A;  3UU8 A;  3EHR A;  4EPZ A;  3MZK B;  1GQE A;  3VR8 A;  4HFE A;  2DYS E;  3GYZ A;  3PNL B;  3U3W A;  4PJL A;  4OAV B;  3IHR A;  4FJO A;  3JQ0 A;  2HE0 A;  3C5R A;  4GTQ A;  2Q9Q A;  3AVR A;  1N4S A;  1K1A A;  1NFI E;  2LUH A;  1Y64 B;  3OJA A;  1NEN A;  5G04 J;  4J8E A;  1TJF A;  4GCO A;  4YTP A;  1FMW A;  2XJ7 A;  1YMP A;  2GW1 A;  3MEK A;  2D2S A;  3E4B A;  1T98 A;  3SO8 A;  3L82 A;  3I0Q A;  2J07 A;  3FZF B;  1SVX A;  3B7U X;  3PRE A;  3FZL B;  4TX5 A;  2LE8 A;  4Q96 A;  2V7M A;  4U95 D;  3A8Y C;  1SZ9 A;  3JAD A;  2BZB A;  3UT4 A;  5FZQ A;  4HRM B;  2Z6E A;  3S4U A;  4YTM A;  3CIR A;  3FUD A;  3I4R B;  2WXQ A;  4PW8 A;  3CX7 B;  4BX9 A;  4I1A A;  3SBT B;  3RHW A;  3MX3 A;  3QNK A;  1VDY A;  3CX6 B;  4GTO A;  5JRE A;  3C72 A;  1HNZ T;  3ULE G;  4GZ6 A;  3PUA A;  4WWP A;  2WB2 A;  3RGL A;  4WWN A;  3EVY A;  2KXP B;  1BU9 A;  4X1I E;  4APO A;  2AVP A;  5B1A E;  4CCA A;  4RLY A;  5LMN T;  1DCQ A;  1TN7 A;  2ZLY A;  4PK6 A;  3DEO A;  5KDM C;  5CGM A;  3UUM A;  4TWH A;  5LBQ B;  2DL1 A;  2DI4 A;  4DX2 A;  3NWI A;  2I1K A;  5CBN A;  3ML9 A;  1T72 A;  2LRL A;  3FHE A;  2XUE A;  5HYA A;  3F2E A;  2HN2 A;  2NW8 A;  3LY8 A;  1EYH A;  4DPR A;  1UOH A;  3N9L A;  4DBQ A;  4ERR A;  1TNZ A;  2CFZ A;  4JI6 T;  3ETU A;  2CMR A;  3EIQ C;  2C5K T;  3AA6 B;  2A3D A;  4EOZ B;  1N11 A;  4O8S A;  3LVQ E;  4X5T A;  1UN8 A;  4Z8X A;  1D1B A;  2A9U A;  1UN9 A;  3C51 A;  3T9K A;  1ZEE A;  3ZRH A;  2NXP A;  3URZ A;  5EYL A;  3V5U A;  4EGW A;  4PDX A;  3MA5 A;  2LKG A;  4XBF B;  3FP3 A;  4J7W A;  3LYA A;  3ULY A;  2BKO A;  3JAE A;  5CCM A;  4DI3 A;  4PJJ A;  2WDV A;  2XZT G;  3JCK C;  1VRB A;  1WFD A;  5LGN B;  3AXJ B;  4C48 B;  3K9I A;  1HF8 A;  4TV9 E;  2GRN B;  2X6K A;  3HIZ A;  5ENO D;  4XZC A;  4AVX A;  3QK0 A;  3RIU A;  3ABL E;  2XQ3 A;  4AV7 A;  2PJQ A;  5ARG A;  2MAW A;  2XRY A;  5ADX L;  4G2A A;  5FIO A;  5AAR A;  2Q9Q C;  4F6R D;  2ZM8 A;  3N9N A;  5FWQ A;  3TWT A;  2XRZ A;  2I59 A;  2KWI B;  3JYS A;  1HX1 B;  2WXK A;  5AQL B;  1N32 T;  2VKD A;  1TYQ G;  3RYH E;  3S7D A;  3N9O A;  5M72 A;  4GA2 A;  2Y3A A;  2KND A;  4XKB A;  2FJE A;  4FJZ A;  1G73 A;  4QXC B;  4ZS2 A;  1XNF A;  2ZIR A;  4P0A A;  4LF7 T;  1EZ3 A;  2HPL A;  4APF A;  3LDQ B;  1D8E A;  1N4R A;  4B3M T;  1TNU A;  3RQW A;  4DRX E;  5FMN A;  2A5U A;  1FIO A;  4ZFH A;  4UWF A;  1SA0 E;  2R59 A;  3HR0 A;  1H19 A;  1WM5 A;  4G1T A;  3ZW3 A;  4TUM A;  4HRL A;  3H37 A;  4WBO A;  4TNV A;  3L39 A;  1IAP A;  3CV0 A;  4COF A;  1X79 A;  1OT8 A;  5AQF B;  1FT1 A;  2F8X K;  4E7S A;  3CVN A;  2BKK B;  1T7S A;  2UXN B;  4XEI G;  2LKH A;  2IY0 C;  5AEN A;  3IV0 A;  4KMC A;  4OFZ A;  5FP3 A;  1ELW A;  1V55 E;  4CGV A;  2ACX A;  5TAO A;  3ZVV A;  4H9P C;  2V5Q C;  4HOT A;  4QX8 B;  4BX8 A;  2YQ8 A;  2E0I A;  1HTJ F;  2KSR A;  5E76 A;  3PNT B;  3V2X A;  2R02 A;  4QHO A;  4J8S A;  5CFB A;  4I17 A;  4JV5 T;  4OYS A;  4QFV A;  3ZPJ A;  4ZI2 C;  3B7B A;  3LK3 B;  1M62 A;  4FHJ A;  1Z8U A;  2BG9 B;  3P4W A;  5L3B B;  5JDN A;  2XQ5 A;  4CN4 A;  1I6Z A;  2CWO A;  4YVQ C;  3FH5 A;  1KT1 A;  2ZMA A;  3BQK A;  4IE6 A;  2E2E A;  3PJA J;  2BVM A;  2XSA A;  2N9D A;  5CCL A;  3NQP A;  2BF0 X;  2I2O A;  5J2T E;  2FBW A;  4AY5 A;  4A3V A;  3Q79 A;  2QA7 A;  4IE7 A;  3EAB A;  3NZP A;  4CI3 B;  3DTO A;  3ML8 A;  2X6H A;  2XEV A;  2X0H A;  3P7I A;  2JMK A;  4I43 A;  4JHJ A;  5AQO B;  5ENN A;  2H7V C;  4P0B A;  4HBD A;  3ZNG A;  2Y48 B;  4JHR A;  2FI7 A;  2LRK A;  3TWW A;  3AXJ A;  4BT8 A;  3L17 A;  5T4Y A;  3U78 A;  5HXC A;  2QYW A;  2XTL A;  3HL6 A;  1SZA A;  2LSY A;  3JAF A;  1XMQ T;  2M67 A;  1M7K A;  2D9D A;  4TUU A;  3UM3 A;  1AJ3 A;  4DR5 T;  3NF1 A;  4WZX A;  1LRZ A;  2D5U A;  4DV3 T;  4EED A;  3Q49 B;  1IBK T;  1DU2 A;  3ZT6 A;  1SQM A;  3N9M A;  4NRH B;  4HOR A;  1HCI A;  3O4X E;  4U2Z A;  3MGB A;  4AY6 A;  1A5E A;  2GRM A;  2DVW A;  1OWO A;  4TWF A;  2XPY A;  4HLL A;  3O1I A;  4ATG A;  4DMW A;  5JTG A;  3ASN E;  2BVL A;  4PS3 A;  2X3M A;  2VQ2 A;  3TLS A;  4U7E B;  2IML A;  2C2L A;  1BLX B;  4ILI A;  3UUX B;  1KZO A;  3CIA A;  3Q9N C;  2WWU A;  1H6K A;  2J09 A;  3LVR E;  3ZMV B;  3FXE B;  4GMR A;  2MRI A;  1S35 A;  1WYB A;  3UKU G;  2ODU A;  3FH8 A;  1IQU A;  5AQJ B;  2BUG A;  5HEG A;  3RO3 A;  4L2Y A;  3FHN A;  4UWG A;  4LFA T;  4TWD A;  5CEA A;  1DNP A;  4HS2 A;  4IDZ A;  3LDZ A;  4GTR A;  2WSS V;  4UIG A;  3CEQ A;  4DR2 T;  2JQ9 A;  4H9O C;  5CED B;  4U8V D;  2FUP A;  4GYR A;  5HXS A;  3RJV A;  2DNX A;  3O1J A;  4IIJ E;  1J5E T;  3BG0 B;  4U96 D;  2WDQ A;  2WDR A;  5JJT A;  4NPP A;  2KXP C;  2XGM A;  1TR4 A;  5EX3 A;  4UVC B;  2KCK A;  4EZJ A;  5LBM A;  3DPD A;  3MKR A;  4KVO A;  3RSE G;  4EXT A;  5JQG E;  3UX4 A;  4GKK T;  2KCL A;  5LOV E;  3V2O A;  4ACK A;  3TXN A;  4DX6 D;  4LF9 T;  4JI4 T;  3Q7F A;  3H3M A;  3UPV A;  5L47 A;  2NWB A;  2VSN A;  4FP7 A;  5JDH A;  3D0T A;  2WQ7 A;  2V4H C;  3B95 A;  3MJX A;  2BG9 A;  5AQV B;  4AKH A;  4LCT A;  2VGX B;  4JI5 T;  3RK6 A;  1E96 B;  2QVA A;  2WU5 A;  2JQK A;  3AAI A;  2DZN A;  3T5X A;  4UWL A;  2IQC A;  1MNE A;  3MK7 C;  4HEA A;  3PUK A;  4ZI3 D;  3UUB A;  2RFM A;  5D2M C;  4G24 A;  4QXB B;  3Q47 B;  4RQI A;  2EIM E;  2V7J A;  3VLF A;  3PTR B;  3VLD A;  5AQM B;  2AJA A;  2EQX A;  1MIW A;  1D0Z A;  2LSK A;  2MTQ A;  2XQ4 A;  3U64 A;  3SNX A;  5CRV A;  2N1G A;  3K3Q C;  2XHE B;  2DWG A;  4MS6 A;  2PM6 A;  3CVX A;  3ONX A;  3B57 A;  3C4W A;  4WNK A;  4OX9 T;  5LHH B;  3HKD E;  1SHZ C;  4A56 A;  2X9H A;  5AQG B;  1D9S A;  4J2C A;  4F8H A;  3EHM A;  3S7J A;  2NW7 A;  1CUN A;  3FTZ A;  4JEU B;  3X2Q E;  4NUU A;  3BG1 B;  1V9D A;  4BES A;  4BJM A;  2VUR A;  3RC3 A;  3B5M A;  3ZEF B;  3ISM C;  1YQ4 A;  4GK0 E;  3PUS A;  1JPL A;  3ZSS A;  1HZ4 A;  1D0Y A;  3LBX A;  4HFC A;  2IEJ A;  4URK A;  3NZU A;  4GTT A;  4CT0 A;  4EZ4 A;  2QYU A;  5LG3 A;  4MKT A;  1W09 A;  2C5I T;  4WNF A;  2NW9 A;  3UM0 A;  4CDN A;  3IBP A;  4E6H A;  3UUX A;  5HEO A;  4OVU A;  3PUZ F;  3OYX A;  3CVV A;  2YKS A;  2H88 A;  4PH4 B;  3CPZ A;  2LLY A;  2P9P G;  3LK4 2;  1QBQ A;  3AE7 A;  2BKN A;  2YHE A;  3OXF A;  5L3C B;  1OXZ A;  3C3O A;  3TKL B;  4HGA A;  2IC9 A;  3Q5E A;  4NUR A;  2X51 A;  2I0M A;  1UUS A;  1US7 B;  3AE9 A;  5KX5 E;  5G05 J;  5JHA A;  4HFB A;  2RFA A;  3MJW A;  2V8S E;  2XQ6 A;  5L2L A;  5DAB A;  4TN7 B;  3L09 A;  1HE8 A;  2X6J A;  3CLJ A;  3IF8 B;  4AKL A;  3ETV A;  2XQ7 A;  2EIJ E;  4ATZ D;  3ZMU B;  1MMG A;  4CT4 A;  4X65 T;  2BS2 A;  1MIY A;  1PC2 A;  4EHM A;  5BXU A;  2BS3 A;  1LF8 A;  2XCC A;  4O1O A;  3UIO C;  5KWD A;  1Y8M A;  4FU3 A;  3RKO A;  3RU0 A;  4N78 D;  3PZ4 A;  4H7Y A;  4JZY A;  4WNG A;  5FXV A;  1NL4 A;  3PUV F;  5C1D A;  5AQB A;  2VWA A;  5D0Q D;  1KLX A;  3QOF A;  3AG1 E;  4IE5 A;  4X62 T;  1WR0 A;  2FBN A;  1WCR A;  2XEE A;  4QWN B;  2X9X A;  2P9B A;  3E34 A;  3WAJ A;  2BDE A;  1BD8 A;  3CKD A;  3BEE A;  4J0U A;  3W9F A;  2CWY A;  3P1U A;  1X9B A;  3ASF A;  5KJN A;  3ZKJ A;  3V5S A;  2V0P A;  3KV5 A;  2X67 A;  1E2A A;  2XQ0 A;  4BSZ B;  2XHE A;  2VKH A;  4KBQ A;  5FXZ A;  2W67 A;  3RYF E;  2RPA A;  4L1B A;  3ZC0 A;  5CJ5 A;  4QH5 A;  2ZXW E;  5ARF A;  3UU3 A;  4DBR A;  4C0E A;  2WZH A;  3H3A A;  3LK2 B;  4DR1 T;  2CHX A;  3D9O A;  4LML A;  3WAK A;  3LS8 A;  2P9S G;  4BWR A;  3ABK E;  4JEU A;  4CRW A;  4OK0 A;  2LOP A;  4UI9 C;  3HA4 A;  3ZEF A;  4KMO A;  4U0S A;  2PQR A;  5DIZ A;  1QZ2 A;  4NXM T;  4EEB A;  4HQD A;  1L5J A;  3AU4 A;  1OED E;  4IDQ A;  5KJM A;  2JJ9 A;  1DCE A;  4HVB A;  2LSJ A;  3ZLI A;  3D9P A;  5JDQ A;  3ESK A;  2WS3 A;  4HWF A;  3ZPO A;  5JDL A;  3VHL A;  2FO7 A;  4BFR A;  3Q15 A;  2V7I A;  1V54 E;  1HG5 A;  1HU3 A;  4JEH A;  3G2U A;  2DCF A;  5L3D B;  2H89 A;  3AVS A;  2IUB A;  4JA7 A;  5HXH A;  3AEA A;  2V7L A;  5KBA A;  4UV9 B;  1IYG A;  3VTY A;  2ZGG A;  5AQP B;  4XZ4 A;  1XMO T;  3ZST A;  2XPI A;  3UMV A;  2WXR A;  5BMV E;  3AE2 A;  1UK5 A;  2LNI A;  3PZ3 A;  4X8Q A;  3RRU A;  3DXK G;  4I9E A;  1OY3 D;  3QOU A;  2A72 A;  4I6G A;  4KXK B;  5FL0 A;  3VLE A;  3KVA A;  3PZ1 A;  4YTN A;  2X6F A;  2LEH A;  2FUL A;  3FU5 A;  2AXU A;  4HB5 A;  4J8Y A;  4LSZ E;  4G8K A;  4GU5 A;  5HI7 A;  2LT3 A;  4GMJ A;  4OYJ A;  3S2A A;  5LNK A;  3GA8 A;  5AQQ B;  1S70 B;  1QLB A;  2CRB A;  4CI2 B;  4JLE A;  1UX4 A;  3T8K A;  4X20 E;  2L6J A;  2VSO E;  2WXH A;  1OCC E;  4GTS A;  4UR9 A;  1SA5 A;  4K03 A;  1O1T A;  1X5B A;  1OWA A;  2X38 A;  1ZP0 A;  5BUZ A;  3SS1 A;  1MMD A;  2FJA A;  2R05 A;  4AIF A;  2I9C A;  2WY2 A;  1SW6 A;  2H7O A;  5B1B E;  2L0T B;  2Y4T A;  3TL5 A;  3BQI A;  2VJ8 A;  4FLH A;  2B1E A;  3UUN A;  5CRU A;  2L6B A;  4OVV A;  2X9W A;  2Y8D A;  4AQF C;  3VTX A;  2B0O E;  2VQE T;  2ZIS A;  5BXO A;  1O5M A;  3OAW A;  3AG4 E;  4O4J E;  1N4Q A;  4ZI7 E;  2VVS A;  3DSW A;  3KD7 A;  2QGS A;  3MYV A;  1UG3 A;  4ZI3 C;  2CHO A;  2OVF A;  3RLF F;  2KC7 A;  2IFU A;  2VYI A;  3K1S A;  3ABM E;  4DV1 T;  4HXI A;  4EQF A;  3NZQ A;  3QB5 A;  4O4I E;  4BTA A;  2WP9 A;  3RKV A;  3EU5 A;  3UIP C;  4HN9 A;  1XNR T;  3UU5 A;  4ILB A;  2MYS A;  4ASK A;  5EIB E;  1HG2 A;  3QAR A;  2UXX B;  2W00 A;  3CVP A;  2YDQ A;  3MV3 B;  3EUV A;  4Z90 A;  1ZHC A;  3KV6 A;  5CB4 E;  5BR8 T;  2XAF B;  1Z6T A;  3FZK B;  1YXR A;  2J9Q A;  2JEK A;  1WR6 A;  3CVL A;  4O2A E;  2XAS B;  2DIW A;  4AOF A;  5KNG A;  2X0L B;  3CQG B;  5L3F B;  4HKA A;  4UQX A;  5H7P A;  4DV6 T;  5BV0 A;  3R6N A;  5HRY A;  3P4P A;  4GTV A;  2PTF A;  3BQO A;  3RX6 A;  2WWV A;  4BAY B;  2XSB A;  1HX8 A;  3AEG A;  3FTX A;  4IL9 A;  4M1P A;  3QK6 A;  4CZ2 D;  5FZR A;  3L22 A;  2LJL A;  3GZ1 A;  2IO3 C;  4WUY A;  3N71 A;  3CVW A;  1N54 A;  2PFV A;  4G2V A;  3SFY A;  1H6O A;  3ZYL A;  1E7P A;  3TG5 A;  2K5B B;  5L3E B;  5JHB A;  3FZH B;  2V5C A;  3P4Q A;  1FPP A;  3RAU A;  4PK5 A;  3EDV A;  4XAX B;  2UU9 T;  2F0Y A;  2CBI A;  1VCS A;  2VK9 A;  2IOL A;  5FY7 A;  2VTB B;  3J7Y q;  3RIF A;  3RH3 A;  2FEZ A;  4AM9 A;  4DUY T;  1NA3 A;  3L8R A;  2IJG X;  2QZA A;  4ISS A;  4BJN A;  4O4L E;  2V1D B;  3RRC A;  4JYA T;  2JAB A;  2CHW A;  1JWF A;  3SF4 A;  4G11 A;  3P4S A;  5GON E;  3PS6 A;  4OYK A;  3UXG A;  4JI0 T;  1S64 A;  3JC6 D;  4HWH A;  1OWM A;  3RRM B;  3CGH A;  1IHG A;  2VAS A;  2EIN E;  1E8X A;  1P5Q A;  3PUJ A;  3QNU A;  2K48 A;  3IEE A;  5A6C A;  4AXP A;  3PVL A;  5FQ4 A;  1WY6 A;  3AEF A;  1YQ3 A;  4I0U A;  3PU3 A;  4IRE A;  2J08 A;  4ILU A;  2AXD S;  1LTX A;  2ES0 A;  1H2U A;  3E0Z A;  1MZC A;  3ASH A;  1H6P A;  3N9Q A;  2WXI A;  4UV8 B;  4YJ2 E;  3NZS A;  3RO2 A;  3LCA A;  3FDH A;  2PZI A;  3AE4 A;  4DV7 T;  4GZ3 A;  5AQ7 A;  2IO2 C;  1NP7 A;  2ZU6 B;  4AKI A;  1ELR A;  5EKQ D;  4R7L A;  2OLT A;  4I55 E;  2H6G A;  4HFG A;  1FCH A;  3SWH A;  4ILH B;  5KCM A;  2V8S V;  3AA0 B;  3V30 A;  3AB3 B;  1E90 A;  2CA5 A;  5KMG P;  3ZXP A;  4TNW A;  3APC A;  2FJD A;  3PUX F;  3FUH A;  4LNG A;  1YYH A;  4U8H A;  2HH7 A;  1FT2 A;  4N3C A;  3S7B A;  2WBL A;  4U7I A;  1ZB1 A;  1TNO A;  2HR2 A;  4L7T A;  5JA4 D;  2XQ8 A;  3AE3 A;  4PNI A;  5B3S E;  3QDN A;  4K0R A;  3TWU A;  3AAA B;  3RC8 A;  4Q25 A;  4ME2 A;  4RG6 A;  2CXD A;  4YDO A;  2X0Y A;  4H9N C;  2EIK E;  4EZL A;  3UQ4 A;  3P50 A;  3P4R A;  4JA9 A;  4B0Z A;  3HRA A;  1RW2 A;  2OEV A;  1RZ4 A;  5ENP D;  1Y01 A;  4N3A A;  4RVB A;  2H3R A;  4U0U A;  3U66 A;  4KT6 B;  2LXM A;  5ANL A;  2J47 A;  2LM2 A;  2E5V A;  2K3W A;  1KNR A;  3ZYM A;  3OVU A;  2YU1 A;  3ZHE B;  5AQA A;  2WXN A;  4UVA B;  2GRP B;  2W61 A;  2HN1 A;  3CHP A;  3DST A;  1D1C A;  2WU2 A;  4A98 A;  1MX4 A;  4X1K E;  4HE8 A;  4E85 A;  2VTB A;  2RA1 A;  4EZH A;  4A1S A;  5HS0 A;  4A5X A;  5EK3 A;  2OVB A;  2ZM0 A;  4DI4 A;  3F31 A;  2XZE A;  4DO0 A;  3OTO T;  2MHK A;  2HM8 A;  5JR9 B;  3ZT5 A;  4YVO A;  3PUY F;  2C0S A;  2AE9 A;  4GK5 E;  5LMU T;  2F4V T;  5AFU L;  2AWI A;  1ZV4 X;  3TG4 A;  1FVF A;  1HS6 A;  1KFY A;  4PS8 A;  5LA6 E;  4CEM A;  4KHZ F;  1O3X A;  5FXW A;  1HFA A;  5JDM A;  1IJ5 A;  4IHJ E;  2JPF A;  2N2N A;  1H0A A;  2DWK A;  3UM1 A;  4CGW A;  3FU3 A;  4A3T A;  3CSF A;  1KNP A;  4E7Z A;  1MX6 A;  2Y4U A;  3G06 A;  2KLQ A;  4YDE A;  5J2U E;  2I1J A;  3SZ7 A;  5LP0 A;  1U5P A;  3MV2 B;  3OKQ A;  4AI6 A;  3FB2 A;  4H63 H;  3C3R A;  1KNZ A;  4U3C A;  5T8I A;  3I9Y A;  3Q5M A;  3FUF A;  2QRX A;  1SUM B;  1OXJ A;  4I2W A;  4BT9 A;  2RKK A;  3TWQ A;  4FLB A;  1Q2Z A;  2AW6 A;  3QAQ A;  2DYR E;  4MBQ A;  3CHM A;  3CK9 A;  2OCC E;  2XAH B;  5FKY A;  3UM2 A;  4ANU A;  2OA5 A;  5FNV E;  2LM9 A;  2MOW A;  2XPZ A;  1BI8 B;  1TN6 A;  2CXL A;  5DBK A;  5A23 A;  1T8B A;  1AWC B;  3AE6 A;  2RP4 A;  2A5E A;  3CK7 A;  4IST A;  4K5C A;  4UI9 K;  3UU6 A;  1J5W A;  3Q7A A;  4EBA A;  4PFP A;  1QYM A;  1OWP A;  3PDY A;  5HXR A;  4DND A;  4BET A;  1CHU A;  5H6Q B;  1XNQ T;  3RKG A;  5AQN B;  1MMN A;  4DV4 T;  3AA1 B;  4I50 E;  5LJN A;  2P58 C;  1XDO A;  2WMN A;  4IN3 B;  1Z5S C;  2P9U G;  2P2C P;  2CCQ A;  4HFD A;  4DV5 T;  3RRW A;  2CEA A;  1E7U A;  4ZZB A;  2GRL A;  4UUC A;  4GML A;  5IY5 E;  3SRZ A;  4K0K T;  2CHN A;  4LG6 A;  5LYJ E;  2YOE A;  3CHR A;  4A97 A;  1TEZ A;  5FZS A;  3KV4 A;  4GTM A;  3ZHE A;  4LF6 T;  3EHN A;  4LF4 T;  4WBN E;  1K8K G;  4MFR A;  4IYP A;  3FEX A;  4O60 A;  3UFE A;  2VL8 A;  3CST A;  4DR7 T;  2PM7 A;  3ZIM A;  4C0M A;  3FTV A;  2BG9 E;  4LNB A;  3NOC D;  3UI2 A;  3ZXS A;  3BUA A;  3C3Q A;  2WXJ A;  2L9Q A;  4MLP A;  4ILG A;  1U4Q A;  1XWM A;  2E8I A;  1PAQ A;  5IHY A;  5FY0 A;  3DXM G;  5J90 A;  3GW4 A;  3R7Q A;  4HTE A;  4LFB T;  3IHY A;  4V3I A;  3U4T A;  4WW0 A;  4JL0 A;  2FO1 E;  3FZM B;  4DLO A;  3D9K A;  3GMI A;  3QUJ A;  3DBS A;  4WAF A;  4TZ4 C;  1FMV A;  3C98 B;  5KNH D;  4F7A A;  2WXG A;  2UY1 B;  3TWV A;  4OAU C;  4ZOL E;  4UXN B;  1D1A A;  4PFO A;  3UT5 E;  3ZKR A;  4XIF A;  1NZN A;  3KIN B;  1Z0P A;  4C9B B;  1LKX A;  2W63 A;  4QQI A;  5FVK A;  2ODV A;  4EZK A;  4IDN A;  2ETC A;  2HHH T;  4WYV A;  4UWH A;  3O4Z A;  3AG2 E;  4YDW A;  2R03 A;  3IA3 A;  1YKH B;  3PEV B;  3J5Q B;  3UT7 A;  2NTY A;  3P8C D;  3JC6 C;  2MPK A;  2GRQ B;  3QWW A;  3JQ1 A;  2J1D G;  4CXW A;  3NB2 A;  3UIN C;  5CMW A;  4G63 A;  2CXF A;  5F5W A;  4JUY A;  3OXL A;  3FTW A;  4UWK A;  1W0B A;  1KZP A;  2V5F A;  3KV9 A;  3NOG D;  1ZOY A;  1D0X A;  5EYP F;  3V31 A;  2K9A A;  3ENE A;  5EZY E;  3CML A;  4KZC A;  5C2T A;  1A17 A;  3B7R L;  4GZ5 A;  3IXE A;  3ZJ1 A;  4EV6 A;  3L54 A;  3HG0 D;  3JXJ A;  2YEV C;  4GIW A;  2X68 A;  3RIB A;  2WXF A;  5AIJ A;  4HFI A;  5JDG A;  4LMJ A;  3VRA A;  3CKC A;  2A4Z A;  3JCF A;  3R9M A;  1TJC A;  4IGU A;  2E9X C;  3I3N A;  4GPM A;  2VL0 A;  4JI3 T;  4AIS A;  2VGE A;  4L23 A;  3AU5 A;  4YJ3 E;  3CK6 A;  3CHS A;  4G8L A;  3HXE A;  2IDO B;  3LSV A;  4AEZ C;  3RQU A;  1N0Q A;  3AAA C;  3PV0 F;  5G2N A;  3TWS A;  2X6I A;  1DVP A;  1EF1 C;  3I1A A;  2E2A A;  2PBI A;  3HXC A;  1OUV A;  2L8K A;  5LCW C;  2XAG B;  2VGX A;  3LY9 A;  4H9R C;  4CQI A;  3ZMT B;  2ZGD A;  4HWI B;  3FUK A;  3O48 A;  1WG0 A;  2EHO C;  3CVU A;  4UEM A;  2YK0 A;  3EDU A;  4OHF A;  2L0I A;  4GAA A;  4L5G A;  4YHJ A;  2BKP A;  3ANW B;  2ETB A;  2E5L T;  3A5X A;  1U3C A;  3EI0 A;  4J6I A;  4H63 V;  2WM9 A;  3NBX X;  2HYZ A;  5CBO A;  3SFX A;  3ZJ2 A;  5JMN D;  4AQF A;  1E8Z A;  2V6Y B;  1NAF A;  3PE0 A;  4UI9 J;  5FT9 A;  5EDS A;  3FBL A;  4Y6W A;  1JWG A;  2QC9 A;  3FEY A;  4HFV A;  4YT0 A;  4J8F A;  4UF0 B;  5AQS B;  4DUZ T;  4B8C B;  2KZ7 B;  1SA4 A;  5H6R B;  3TJP A;  3U9W A;  3PE4 A;  4DR3 T;  5FQ8 A;  5JR9 C;  4AJW A;  4GB9 A;  2V4L A;  3RF1 A;  3KEZ A;  3E08 A;  1MMA A;  5HEJ A;  3D9L A;  3IKO B;  3BQL A;  4YSX A;  4ANW A;  5AQU B;  1X81 A;  3UFG A;  1UJK A;  2UY1 A;  4FUL A;  4B3T T;  3ZUV B;  2UUB T;  3K8P C;  1ZU2 A;  3I9W A;  2HPJ A;  3FXD B;  4DR6 T;  4HFH A;  4HI8 A;  5AYW D;  3TWX A;  4O6F A;  4LF8 T;  3D9N A;  3APF A;  2YIN A;  4KUM B;  2ILR A;  5AJD A;  4X64 T;  5AJL A;  3HDX A;  1S94 A;  5IYZ E;  4GKJ T;  3HHM A;  3A7M A;  5DQW A;  1QNF A;  4QH4 A;  2LSV A;  5ABG A;  3APD A;  3M3Z B;  1H2T C;  1ELK A;  4JPS A;  3OYZ A;  1HXI A;  4MRU A;  5LJM A;  4I6J A;  3ZMS B;  5LXT E;  1IJ6 A;  1JCS A;  3HKC E;  2IIU A;  3RPU A;  3PUR A;  4L0R A;  5HAX A;  4FA6 A;  1KEY A;  4XKC A;  3L3P A;  4H7X A;  5LG4 A;  3TLV A;  2XY8 B;  3LJ3 A;  3PZ2 A;  4HNA D;  1S0P A;  4EB6 E;  3IHV A;  3WXX A;  3QB5 K;  2P9I G;  4I6E A;  3SFD A;  4NAC A;  2JQH A;  3AE5 A;  3ZFW A;  4HLE A;  1JNZ A;  2IAK A;  2V7K A;  2V26 A;  3AEC A;  4GYS A;  5EID A;  2ACZ A;  3Q78 A;  3JUI A;  5LGT B;  4HWD A;  4MAL A;  1LVF A;  4KYO B;  3QWP A;  4WND A;  5FIN A;  3M65 A;  4GA1 A;  4LER A;  3MCX A;  2R2L A;  4DID B;  4U04 A;  1I94 T;  2WQH A;  4UEL A;  3ANW A;  3KSQ A;  4TXR A;  2P9L G;  1N4P A;  5JVD E;  5F3J A;  2V6Y A;  1K1B A;  3MXZ A;  5FY1 A;  3T1Y T;  5HEU A;  2CG3 A;  4XX5 A;  1BPO A;  3ONL C;  3CHQ A;  5LGU B;  5E75 A;  4UF0 A;  4UVB B;  2HO1 A;  5AQR B;  1N52 A;  3FTY A;  2QYJ A;  4TV3 A;  5AN8 A;  3TXM A;  4CYM D;  1E8Y A;  3ASO E;  2A2F X;  3RYC E;  3CHO A;  5FXX A;  4YXD A;  3X1D A;  3SHF A;  5C2Y A;  3ABV A;  3NBN B;  4BER A;  2LXL A;  4ABN A;  4GPK A;  2XM2 A;  3VRB A;  5HCM A;  2KM4 A;  2BBH A;  4KP3 C;  3SBS A;  3LXU X;  3RRN B;  5BV1 A;  4O2B E;  4QX7 B;  1OED C;  4PJM A;  4JI1 T;  5KJK A;  4A55 A;  3Q5D A;  5G04 C;  3FTU A;  3PEU B;  5E0O A;  2Y69 E;  5J08 A;  2VKJ A;  2J4G A;  1UW4 B;  2W62 A;  3LEW A;  3SFE A;  4F1P A;  2XZD G;  1IQR A;  4LRZ A;  4GOU A;  4RSY A;  2R5S A;  3Q4A B;  2JLB A;  3C50 A;  3I5P A;  1EPU A;  1KK7 A;  2XQA A;  4JW1 A;  2WPV A;  1XGW A;  1MYO A;  4I4T E;  3PUG A;  3FWV A;  3HVE B;  4XI0 A;  3MKQ B;  5LHI B;  3W15 B;  2YN6 A;  2YDR A;  3FY4 A;  2H6I A;  5ANR A;  3EAM A;  3FU0 A;  2CBJ A;  4JD2 G;  4L9P A;  5ENT D;  4G26 A;  1FEW A;  3ZYK A;  2D0T A;  3ZN1 B;  1W9R A;  2DCP A;  4CXY A;  4X66 T;  1B89 A;  4MBG A;  1KPS B;  4ANJ A;  1YKE B;  1UJJ A;  3N5L A;  1G8X A;  2FF4 A;  4G23 A;  3GWH A;  2LSI A;  5A7D B;  3FUM A;  4YLH A;  4U2Y A;  1YA0 A;  1IXV A;  2XQY A;  2IW5 B;  2WXP A;  3CVY A;  4GYO A;  1N36 T;  3SQV A;  1QUU A;  2K24 A;  3TLT A;  3KBT A;  3S7F A;  2M6I A;  2CLY B;  4YHH T;  2J49 A;  1YW0 A;  4DVD A;  5CA1 E;  3R84 B;  1LD8 A;  1BR0 A;  1E8W A;  2KAT A;  3G2W A;  5JRC B;  5ABH A;  3UTM A;  4EAH A;  3PUQ A;  1U2V G;  1HS7 A;  1TN8 A;  2GRO B;  2WB5 A;  4MLK A;  4YSZ A;  3ZCJ A;  4I1O B;  2NSZ A;  5CHE E;  2LO6 A;  2LSG A;  5T3R A;  3GZ2 A;  4F3V A;  2M63 A;  3VU7 H;  2UXC T;  4EIW A;  3FU6 A;  2VB6 A;  3SOL A;  3ULQ A;  3PJA A;  4AP2 A;  4D10 C;  2LOS A;  3MAC A;  1D8D A;  4M7C A;  2WQ6 A;  4NIK A;  5ABF B;  4JI7 T;  1HH8 A;  3LY7 A;  4JI2 T;  4I43 B;  1R8I A;  2ION A;  2YHC A;  4ANX A;  4Y6C A;  4AXH A;  4U31 A;  5D0O D;  4Z91 A;  3Q2M A;  1IZN B;  2XCB A;  3MA9 A;  3FH7 A;  3C4Z A;  4NIQ A;  2XEN A;  5KJL A;  5AQT B;  5EX0 A;  3GZS A;  2R6G F;  3IEG A;  2XGS A;  2B76 A;  2JIW A;  4BEP A;  3C64 A;  2DLR A;  2LSU A;  4U63 A;  3PDN A;  4GTP A;  3OPC A;  2LAI A;  2E9X D;  2XEH A;  4NQ0 A;  2B6C A;  3PUW F;  3LJN A;  1MIV A;  1K3Z D;  2DHR A;  1HNW T;  2YNQ A;  5BT1 A;  3KS2 A;  3QJZ A;  2OV9 A;  4DMV A;  3J5P A;  5HCJ A;  5G55 A;  4B94 A;  2PQN A;  4CDM A;  3UQ7 A;  1XDP A;  4ANV A;  1G3N B;  2LHN A;  4KVM A;  3L13 A;  4V1A v;  4FAD A;  5HWX A;  4WNE A;  4C90 A;  2E9X B;  2BBJ A;  1N94 A;  1WRD A;  3CVR A;  2X66 A;  1N0R A;  1VCT A;  3EDT B;  3UTK A;  1JUQ A;  2EHO D;  3AA7 B;  3AEE A;  1PY1 A;  4TXP A;  2DWZ A;  4IRU A;  2PNN A;  3ZMZ B;  1HO8 A;  3D9I A;  4U33 A;  4PJN A;  5AQI B;  3T5V A;  3AED A;  3HVE A;  4O1P A;  2W0G A;  2EIL E;  3MKQ A;  2BKG A;  4I9C A;  4CI1 B;  5DQV A;  4DV2 T;  1OWL A;  1SE7 A;  2EHO B;  4UQY A;  4J8D A;  5LX8 A;  4AQY T;  5FVL A;  3U3I A;  3E22 E;  4K5B A;  3HYM B;  5CMY A;  2VVN A;  4RG9 A;  1N95 A;  4B8A A;  2UXB T;  5HKP A;  1IHB A;  5HWY A;  4JB8 P;  2ZM2 A;  3MZL B;  4TRQ A;  3Q75 A;  1OCO E;  3UQ3 A;  4IDO A;  2NP9 A;  5ABE A;  4IDP A;  4O4H E;  5FQ6 A;  3F57 A;  2KBX A;  5JRC A;  3RIA A;  3O1H A;  3ONK A;  4DX1 A;  4W9R A;  2UXD T;  3ZGQ A;  2J4B A;  4M3O A;  1ZBP A;  3UU4 A;  2W2U A;  1NWM X;  4P09 A;  4GYW A;  5J0Z A;  3B7T A;  3P2B A;  3AS4 A;  3AS5 A;  3LPZ A;  2IF4 A;  3OXG A;  4Q94 A;  3TWR A;  2ETA A;  5ABF A;  3QKY A;  4ILC A;  1BI7 B;  4FJY A;  5EK4 A;  3DSX A;  3W9G A;  2H6H A;  3T1H T;  3OTN A;  3CK8 A;  5AAO A;  4TXQ A;  5LP6 E;  1UCU A;  2OEW A;  1IKN D;  3CKB A;  4P29 A;  2MOZ A;  5FTP A;  2L9B A;  5JDF A;  3RIU C;  1KT0 A;  2UWJ G;  3AAE B;  4TV8 E;  3F6Q A;  2SPC A;  1INZ A;  4X1Y E;  1U3D A;  3BU8 A;  2VGY A;  5DJQ C;  2V5D A;  3AG3 E;  3UKR G;  3LBX B;  4H9S E;  3LG7 A;  4ACL A;  2WZI A;  3KAE A;  3KVB A;  3R9A B;  1WLX A;  2C0L A;  4QXH B;  3DSU A;  2KZT B;  3ZCI A;  2IC6 A;  3AEB A;  2WXL A;  4ZHB A;  4AKR B;  2D0U A;  3AS8 A;  4KHP T;  3UUL A;  3ASG A;  3ZYQ A;  3EIJ A;  2VQF T;  3PRZ A;  2E9X A;  3C4X A;  5A1L A;  3FBZ A;  3AJI A;  1O1S A;  2XQ9 A;  1UGO A;  3VR9 A;  3SGH A;  2UUC T;  3FUE A;  5HEH A;  4U07 A;  4KZ0 A;  3FUL A;  4PUC A;  1YD8 G;  1JCR A;  4ILA A;  2X9Y A;  4C91 A;  1UUR A;  4ZS3 A;  1L0V A;  1E7V A;  4IT4 A;  3L08 A;  4QKN A;  4CN6 A;  2JRK A;  2BED A;  3L16 A;  2J62 A;  1IBL T;  5FJY A;  2C0M A;  4LMK A;  4N2S A;  2PG8 A;  4N2Q A;  4B93 B;  2EHO A;  2F37 A;  1OWN A;  2QY7 A;  4JVS A;  4ZHQ E;  3E30 A;  3NVO A;  4PK4 A;  1QQE A;  2VSX E;  5F8P A;  4JHK A;  4NXN T;  2WCA A;  5L4E A;  2AXZ A;  3HXB A;  1VOM A;  5JJ6 A;  1KF6 A;  5AQH B;  4HRN A;  3D9M A;  2V6X A;  4DV0 T;  4UQZ A;  3J9X 1;  1HR0 T;  3WG7 E;  5BW8 C;  1S63 A;  1H7C A;  1J1J A;  4B89 A;  2IHR 1;  3EU9 A;  3NRX A;  3JUE A;  4IE0 A;  1JNR A;  4N5C A;  4GCN A;  2R17 C;  3ZN3 A;  4K5A B;  3OBV E;  3NRY A;  2Y1L E;  3ASD A;  4ZEY A;  3Q9U C;  4EEC A;  2NC9 A;  4LNU D;  2KT9 A;  2CLY C;  4F53 A;  5LHG B;  5JR9 A;  3G2S A;  4B3S T;  5HQ8 A;  2KCV A;  3EHQ A;  3G2T A;  4I2Z A;  3SD5 A;  5CEC B;  2XAQ B;  3ESL A;  5IWA T;  1O1R A;  2LHR A;  1MHQ A;  2XPK A;  2WXO A;  3D9H A;  3DPY A;  1YCS B;  2Q7F A;  1OED B;  2H6F A;  3FFL A;  1NEK A;  1Z3X A;  1MND A;  4DLQ A;  3SY2 A;  1ZKE A;  3HI2 A;  4GZC A;  1FVH A;  2DZO A;  3FUI A;  2GRR B;  3DRA A;  4FI5 A;  4B6X A; 
#chains in the Genus database with same CATH homology
 5LFA A;  5C8Y E;  4AQG A;  5CA0 E;  2JMH A;  3EUH A;  4K0U A;  3RYI E;  3QWV A;  4IUL A;  4BY6 A;  4JXT A;  2RD0 A;  4U72 A;  2MBG A;  3FTS A;  2DBA A;  2KZT A;  1Y6I A;  4F1S A;  5JJ7 A;  1H2V C;  4N3B A;  3KBU A;  4F6R C;  5BPP A;  3VKH A;  5LCW J;  1E1H B;  4JEH B;  2CM0 A;  3LJC A;  2IU1 A;  2YU2 A;  2CHZ A;  3HKE E;  4EBA G;  4G25 A;  3N9P A;  3N2O A;  3PZD A;  4BTB A;  2GGF A;  1NA0 A;  4FHK A;  2VKO A;  4YFS A;  3CX8 B;  4I1M A;  4HOU A;  4ADZ A;  2IOS A;  4B6X A;  4U0Z A;  2VSY A;  4GA0 A;  1W3B A;  4EYY R;  4XI9 A;  5FQ7 A;  2KMF A;  4A1G A;  2J4D A;  3Q9D A;  3ZN0 B;  5HXE A;  1MQS A;  3L6A A;  3QC9 A;  1BR1 A;  2LAH A;  2KIN B;  3KDS E;  1EDU A;  2KWH A;  5ETW A;  2OND A;  4BSX A;  2L3L A;  2NOX A;  2Q9Q D;  4N39 A;  5G05 C;  4C9B B;  3GN5 B;  4DJA A;  4PS7 A;  3UT8 A;  3I4G A;  3ONL A;  4CDR A;  3KFW X;  2WAU A;  4WWO A;  2XAJ B;  3CQC B;  2AXV A;  3BK9 A;  2XGO A;  3QC1 A;  2RG8 A;  4PAG A;  4BA9 A;  2Q9Q B;  5EK2 A;  5LCY A;  3CQX C;  4NUV A;  4LEU A;  4L9I A;  3MKD A;  3TAX A;  2G0U A;  5J1G A;  2Y6X A;  2CFU A;  5M4Y A;  3C98 A;  3Q5W A;  2CE7 A;  3FUN A;  3SI5 A;  1UX5 A;  1BR4 A;  3N2K E;  3WI3 A;  5LOZ A;  3FUJ A;  4EYU A;  3VKG A;  3R7R A;  2PL2 A;  3B13 A;  3B7S A;  1LVK A;  2NTX A;  3HKB E;  3D3M A;  3LFM A;  3T8M A;  4FC8 A;  5BNW A;  4YND A;  4IE4 A;  3K3O A;  1BR2 A;  3DJB A;  4ZI2 D;  3T8O A;  3G2V A;  3CWZ B;  3K3N A;  1B7T A;  4JC8 A;  1Z3Y A;  5L3G B;  3I0O A;  4HOS A;  4L2L A;  3N2G E;  3Q5X A;  3IBE A;  1QSD A;  4GYY A;  3PE3 A;  3D9J A;  3CR3 A;  2WVI A;  2CG2 A;  2WMO A;  4H9Q C;  3TGO A;  4HOQ A;  2JQQ A;  2GK9 A;  1WYC A;  2C5J A;  3O9X A;  4XE0 A;  3DP7 A;  4LUN U;  3PH0 C;  3SFZ A;  3PU8 A;  2OV8 A;  1GW6 A;  4CXX A;  4DK5 A;  4Q69 A;  2BTD A;  2OOE A;  2QFC A;  4MHC A;  4U74 A;  1WAO 1;  4CZZ B;  3LKU A;  3ZC1 A;  4KBM B;  3GN5 A;  5JH7 E;  4AKG A;  4GZD A;  3CVQ A;  2WXM A;  4TUY E;  5FYM A;  2I6H A;  3EJN A;  3QB2 A;  4EPZ A;  3MZK B;  3U3W A;  3GYZ A;  3PNL B;  4PJL A;  3IHR A;  4FJO A;  3JQ0 A;  2Q9Q A;  3AVR A;  1Y64 B;  3OJA A;  5G04 J;  4J8E A;  1TJF A;  4GCO A;  2GW1 A;  1FMW A;  3MEK A;  2D2S A;  3E4B A;  1T98 A;  3I0Q A;  2J07 A;  3B7U X;  3PRE A;  4TX5 A;  2LE8 A;  4Q96 A;  2V7M A;  1SZ9 A;  2BZB A;  3UT4 A;  5FZQ A;  2Z6E A;  3S4U A;  3FUD A;  3I4R B;  2WXQ A;  4PW8 A;  3CX7 B;  4BX9 A;  4I1A A;  3SBT B;  3MX3 A;  3QNK A;  1VDY A;  3CX6 B;  5JRE A;  4GZ6 A;  3PUA A;  4WWP A;  2WB2 A;  4WWN A;  3EVY A;  2KXP B;  4X1I E;  4APO A;  2AVP A;  4CCA A;  2ZLY A;  4PK6 A;  5KDM C;  3UUM A;  5LBQ B;  2DI4 A;  2I1K A;  3ML9 A;  3FHE A;  2XUE A;  5HYA A;  3F2E A;  2NW8 A;  3LY8 A;  1EYH A;  4DPR A;  3N9L A;  4DBQ A;  4ERR A;  2CFZ A;  3ETU A;  2CMR A;  3EIQ C;  2C5K T;  3AA6 B;  2A3D A;  4EOZ B;  4O8S A;  3LVQ E;  1UN8 A;  4Z8X A;  1D1B A;  1UN9 A;  3C51 A;  1ZEE A;  3ZRH A;  2NXP A;  3URZ A;  3V5U A;  4PDX A;  3MA5 A;  4XBF B;  3FP3 A;  3LYA A;  5CCM A;  4DI3 A;  4PJJ A;  3JCK C;  1VRB A;  5LGN B;  3K9I A;  1HF8 A;  4TV9 E;  2X6K A;  3HIZ A;  4XZC A;  4AVX A;  3QK0 A;  4AV7 A;  2PJQ A;  5ARG A;  2XRY A;  5ADX L;  4G2A A;  2Q9Q C;  2ZM8 A;  3N9N A;  5FWQ A;  2XRZ A;  2I59 A;  2KWI B;  3JYS A;  2WXK A;  2VKD A;  3RYH E;  3S7D A;  3N9O A;  5M72 A;  4GA2 A;  2Y3A A;  2KND A;  4XKB A;  4FJZ A;  1G73 A;  4QXC B;  4ZS2 A;  1XNF A;  4P0A A;  1EZ3 A;  2HPL A;  4APF A;  5FMN A;  2A5U A;  1FIO A;  4UWF A;  1SA0 E;  2R59 A;  3HR0 A;  1H19 A;  1WM5 A;  4G1T A;  3ZW3 A;  3H37 A;  4WBO A;  1IAP A;  3CV0 A;  1X79 A;  4E7S A;  3CVN A;  2UXN B;  5AEN A;  3IV0 A;  4KMC A;  4OFZ A;  5FP3 A;  1ELW A;  4CGV A;  2ACX A;  5TAO A;  3ZVV A;  4H9P C;  4HOT A;  4QX8 B;  4BX8 A;  2YQ8 A;  2E0I A;  1HTJ F;  5E76 A;  3PNT B;  4QHO A;  4J8S A;  4OYS A;  4I17 A;  4QFV A;  3ZPJ A;  4ZI2 C;  3LK3 B;  4FHJ A;  5L3B B;  5JDN A;  2CWO A;  4YVQ C;  3FH5 A;  1KT1 A;  2ZMA A;  3BQK A;  4IE6 A;  2E2E A;  2BVM A;  2N9D A;  5CCL A;  3NQP A;  2BF0 X;  2I2O A;  5J2T E;  4AY5 A;  4A3V A;  2QA7 A;  4IE7 A;  3NZP A;  4CI3 B;  3DTO A;  3ML8 A;  2X6H A;  3P7I A;  2JMK A;  4I43 A;  4JHJ A;  5ENN A;  2H7V C;  4P0B A;  2Y48 B;  4JHR A;  2FI7 A;  4BT8 A;  3L17 A;  5T4Y A;  3U78 A;  5HXC A;  1SZA A;  2XTL A;  3HL6 A;  2LSY A;  2M67 A;  4TUU A;  1AJ3 A;  3NF1 A;  1LRZ A;  2D5U A;  3Q49 B;  1SQM A;  3N9M A;  4NRH B;  4HOR A;  1HCI A;  3O4X E;  3MGB A;  4AY6 A;  2GRM A;  1OWO A;  2XPY A;  3O1I A;  4ATG A;  4DMW A;  2BVL A;  4PS3 A;  2X3M A;  2VQ2 A;  2C2L A;  4ILI A;  3UUX B;  3CIA A;  2WWU A;  1H6K A;  2J09 A;  3LVR E;  3ZMV B;  3FXE B;  2MRI A;  1S35 A;  1WYB A;  2ODU A;  3FH8 A;  1IQU A;  2BUG A;  3RO3 A;  4L2Y A;  3FHN A;  4UWG A;  1DNP A;  4HS2 A;  4IDZ A;  3LDZ A;  2WSS V;  4UIG A;  3CEQ A;  4H9O C;  4GYR A;  5HXS A;  3RJV A;  2DNX A;  3O1J A;  4IIJ E;  3BG0 B;  5JJT A;  2XGM A;  5EX3 A;  4UVC B;  2KCK A;  4EZJ A;  5LBM A;  3DPD A;  3MKR A;  4KVO A;  4EXT A;  5JQG E;  3UX4 A;  2KCL A;  5LOV E;  4ACK A;  3TXN A;  3UPV A;  2NWB A;  2VSN A;  4FP7 A;  5JDH A;  3D0T A;  2WQ7 A;  3MJX A;  4AKH A;  4LCT A;  2VGX B;  3RK6 A;  1E96 B;  3AAI A;  3T5X A;  4UWL A;  2IQC A;  1MNE A;  3MK7 C;  4HEA A;  3PUK A;  4ZI3 D;  4G24 A;  4QXB B;  3Q47 B;  2V7J A;  3VLF A;  3PTR B;  3VLD A;  2EQX A;  1MIW A;  1D0Z A;  2LSK A;  2MTQ A;  3U64 A;  3SNX A;  2N1G A;  3K3Q C;  2XHE B;  2DWG A;  4MS6 A;  2PM6 A;  3CVX A;  3ONX A;  3B57 A;  3C4W A;  4WNK A;  5LHH B;  3HKD E;  1SHZ C;  4A56 A;  2X9H A;  4J2C A;  3EHM A;  3S7J A;  2NW7 A;  1CUN A;  3FTZ A;  4JEU B;  4NUU A;  3BG1 B;  1V9D A;  4BJM A;  3RC3 A;  3ZEF B;  4GK0 E;  3PUS A;  1JPL A;  1HZ4 A;  1D0Y A;  3LBX A;  4URK A;  3NZU A;  4CT0 A;  4EZ4 A;  4MKT A;  2C5I T;  4WNF A;  2NW9 A;  4CDN A;  3IBP A;  4E6H A;  3UUX A;  4OVU A;  3OYX A;  3CVV A;  4PH4 B;  3CPZ A;  3LK4 2;  2YHE A;  3OXF A;  5L3C B;  1OXZ A;  3TKL B;  4HGA A;  2IC9 A;  4NUR A;  2X51 A;  1US7 B;  5KX5 E;  5G05 J;  5JHA A;  3MJW A;  2V8S E;  5L2L A;  5DAB A;  4TN7 B;  3L09 A;  1HE8 A;  2X6J A;  3CLJ A;  3IF8 B;  4AKL A;  3ETV A;  3ZMU B;  1MMG A;  4CT4 A;  1MIY A;  1PC2 A;  1LF8 A;  2XCC A;  1Y8M A;  4FU3 A;  3RKO A;  3RU0 A;  4N78 D;  4H7Y A;  4JZY A;  4WNG A;  5FXV A;  5C1D A;  2VWA A;  5D0Q D;  1KLX A;  4IE5 A;  2FBN A;  4QWN B;  2X9X A;  2P9B A;  3WAJ A;  2BDE A;  3CKD A;  3BEE A;  4J0U A;  2CWY A;  3P1U A;  3ASF A;  5KJN A;  3V5S A;  2V0P A;  3KV5 A;  2X67 A;  2XQ0 A;  2XHE A;  2VKH A;  4KBQ A;  5FXZ A;  3RYF E;  4L1B A;  3ZC0 A;  5ARF A;  4DBR A;  4C0E A;  3H3A A;  3LK2 B;  2CHX A;  3D9O A;  3WAK A;  3LS8 A;  4BWR A;  4JEU A;  4CRW A;  4OK0 A;  2LOP A;  4UI9 C;  3HA4 A;  3ZEF A;  4KMO A;  4U0S A;  2PQR A;  5DIZ A;  1QZ2 A;  1L5J A;  3AU4 A;  5KJM A;  2JJ9 A;  4HVB A;  2LSJ A;  3ZLI A;  3D9P A;  5JDQ A;  3ESK A;  3ZPO A;  5JDL A;  3VHL A;  2FO7 A;  4BFR A;  3Q15 A;  2V7I A;  1HG5 A;  1HU3 A;  4JEH A;  3G2U A;  2DCF A;  5L3D B;  3AVS A;  4JA7 A;  5HXH A;  2V7L A;  4UV9 B;  1IYG A;  3VTY A;  4XZ4 A;  2XPI A;  3UMV A;  2WXR A;  5BMV E;  2LNI A;  3RRU A;  4I9E A;  3QOU A;  2A72 A;  4I6G A;  4KXK B;  3VLE A;  3KVA A;  2X6F A;  2LEH A;  2FUL A;  3FU5 A;  2AXU A;  4GU5 A;  5HI7 A;  2LT3 A;  4GMJ A;  4OYJ A;  3S2A A;  5LNK A;  3GA8 A;  4CI2 B;  4JLE A;  1UX4 A;  4X20 E;  2L6J A;  2VSO E;  2WXH A;  4K03 A;  1X5B A;  1OWA A;  2X38 A;  5BUZ A;  3SS1 A;  1MMD A;  4AIF A;  2I9C A;  2H7O A;  2L0T B;  2Y4T A;  3TL5 A;  3BQI A;  2VJ8 A;  4FLH A;  2B1E A;  3UUN A;  4OVV A;  2X9W A;  2Y8D A;  4AQF C;  3VTX A;  3OAW A;  4O4J E;  4ZI7 E;  3KD7 A;  2QGS A;  3MYV A;  1UG3 A;  4ZI3 C;  2OVF A;  2KC7 A;  2IFU A;  2VYI A;  4HXI A;  4EQF A;  3NZQ A;  4O4I E;  4BTA A;  3RKV A;  4HN9 A;  2MYS A;  4ASK A;  1HG2 A;  3QAR A;  2UXX B;  2W00 A;  3CVP A;  3MV3 B;  1ZHC A;  3KV6 A;  5CB4 E;  2XAF B;  1Z6T A;  2JEK A;  2J9Q A;  1WR6 A;  3CVL A;  4O2A E;  2XAS B;  2DIW A;  4AOF A;  2X0L B;  3CQG B;  5L3F B;  4HKA A;  4UQX A;  5BV0 A;  3R6N A;  3RX6 A;  4BAY B;  1HX8 A;  3FTX A;  4M1P A;  3QK6 A;  5FZR A;  3L22 A;  2LJL A;  3GZ1 A;  4WUY A;  3N71 A;  3CVW A;  1N54 A;  2PFV A;  4G2V A;  3ZYL A;  3TG5 A;  2K5B B;  5L3E B;  5JHB A;  4PK5 A;  3EDV A;  4XAX B;  2VK9 A;  2IOL A;  5FY7 A;  2VTB B;  3J7Y q;  3RH3 A;  2FEZ A;  4AM9 A;  1NA3 A;  2IJG X;  4ISS A;  4BJN A;  4O4L E;  2V1D B;  3RRC A;  2CHW A;  1JWF A;  3SF4 A;  4G11 A;  5GON E;  3PS6 A;  4OYK A;  3JC6 D;  1OWM A;  3RRM B;  3CGH A;  1IHG A;  2VAS A;  1E8X A;  1P5Q A;  3PUJ A;  2K48 A;  3IEE A;  5A6C A;  4AXP A;  3PVL A;  5FQ4 A;  1WY6 A;  3PU3 A;  2J08 A;  4ILU A;  2ES0 A;  1H2U A;  3E0Z A;  3ASH A;  3N9Q A;  2WXI A;  4UV8 B;  4YJ2 E;  3NZS A;  3RO2 A;  3LCA A;  3FDH A;  2PZI A;  4GZ3 A;  1NP7 A;  2ZU6 B;  4AKI A;  1ELR A;  5EKQ D;  4R7L A;  4I55 E;  4HFG A;  1FCH A;  3SWH A;  4ILH B;  5KCM A;  3AA0 B;  3AB3 B;  1E90 A;  2CA5 A;  5KMG P;  3APC A;  3FUH A;  4U8H A;  2HH7 A;  4N3C A;  3S7B A;  2WBL A;  4L7T A;  2HR2 A;  4PNI A;  3QDN A;  4K0R A;  3AAA B;  3RC8 A;  4ME2 A;  4RG6 A;  2CXD A;  4H9N C;  4EZL A;  4JA9 A;  4B0Z A;  4N3A A;  4RVB A;  2H3R A;  4U0U A;  3U66 A;  4KT6 B;  5ANL A;  3ZYM A;  2YU1 A;  3ZHE B;  2WXN A;  4UVA B;  2W61 A;  3CHP A;  1D1C A;  4X1K E;  4HE8 A;  4E85 A;  2VTB A;  2RA1 A;  4EZH A;  4A1S A;  5EK3 A;  2OVB A;  2ZM0 A;  4DI4 A;  3F31 A;  4DO0 A;  2MHK A;  2HM8 A;  5JR9 B;  4YVO A;  2C0S A;  4GK5 E;  5AFU L;  2AWI A;  1ZV4 X;  3TG4 A;  1FVF A;  1HS6 A;  4PS8 A;  5LA6 E;  4CEM A;  1O3X A;  5FXW A;  1HFA A;  5JDM A;  1IJ5 A;  4IHJ E;  2JPF A;  2N2N A;  1H0A A;  2DWK A;  4CGW A;  3FU3 A;  4A3T A;  3CSF A;  4E7Z A;  2Y4U A;  2KLQ A;  5J2U E;  2I1J A;  3SZ7 A;  5LP0 A;  1U5P A;  3MV2 B;  3OKQ A;  4AI6 A;  3FB2 A;  4H63 H;  1KNZ A;  5T8I A;  3I9Y A;  3Q5M A;  3FUF A;  4BT9 A;  4I2W A;  4FLB A;  2AW6 A;  3QAQ A;  4MBQ A;  3CHM A;  3CK9 A;  2XAH B;  4ANU A;  2OA5 A;  5FNV E;  2LM9 A;  2MOW A;  2XPZ A;  2CXL A;  5DBK A;  5A23 A;  2RP4 A;  3CK7 A;  4IST A;  4UI9 K;  4EBA A;  4PFP A;  1OWP A;  3PDY A;  5HXR A;  4DND A;  5H6Q B;  1MMN A;  3AA1 B;  4I50 E;  5LJN A;  2P58 C;  2WMN A;  4IN3 B;  2CCQ A;  3RRW A;  2CEA A;  1E7U A;  2GRL A;  4GML A;  3SRZ A;  5LYJ E;  3CHR A;  1TEZ A;  5FZS A;  3KV4 A;  3ZHE A;  3EHN A;  4WBN E;  4MFR A;  4IYP A;  3FEX A;  3UFE A;  2VL8 A;  3CST A;  2PM7 A;  3ZIM A;  4C0M A;  3FTV A;  3ZXS A;  2WXJ A;  2L9Q A;  4MLP A;  4ILG A;  1U4Q A;  2E8I A;  1PAQ A;  5IHY A;  5FY0 A;  5J90 A;  3GW4 A;  3R7Q A;  4HTE A;  3IHY A;  4V3I A;  3U4T A;  4WW0 A;  4JL0 A;  4DLO A;  3D9K A;  3GMI A;  3QUJ A;  3DBS A;  4WAF A;  4TZ4 C;  1FMV A;  3C98 B;  4F7A A;  2WXG A;  2UY1 B;  4ZOL E;  4UXN B;  1D1A A;  4PFO A;  3UT5 E;  4XIF A;  1NZN A;  3KIN B;  1Z0P A;  1LKX A;  2W63 A;  2ODV A;  4EZK A;  4UWH A;  3O4Z A;  1YKH B;  3PEV B;  3UT7 A;  2NTY A;  3P8C D;  3JC6 C;  3QWW A;  3JQ1 A;  2J1D G;  4CXW A;  5CMW A;  4G63 A;  2CXF A;  3OXL A;  4JUY A;  3FTW A;  4UWK A;  2V5F A;  3KV9 A;  1D0X A;  2K9A A;  3ENE A;  5EZY E;  3CML A;  4KZC A;  1A17 A;  4GZ5 A;  3B7R L;  3ZJ1 A;  3L54 A;  3RIB A;  2YEV C;  4GIW A;  2X68 A;  5AIJ A;  2WXF A;  5JDG A;  3CKC A;  2A4Z A;  1TJC A;  4IGU A;  2E9X C;  3I3N A;  4L23 A;  3AU5 A;  4YJ3 E;  3CHS A;  4AEZ C;  5G2N A;  2X6I A;  1DVP A;  1EF1 C;  3I1A A;  2PBI A;  1OUV A;  2L8K A;  5LCW C;  2XAG B;  2VGX A;  3LY9 A;  4H9R C;  4CQI A;  3ZMT B;  3FUK A;  3O48 A;  2EHO C;  3CVU A;  4UEM A;  2YK0 A;  3EDU A;  4OHF A;  2L0I A;  4GAA A;  4L5G A;  4YHJ A;  3ANW B;  3A5X A;  1U3C A;  4J6I A;  4H63 V;  2WM9 A;  3NBX X;  2HYZ A;  3ZJ2 A;  4AQF A;  1E8Z A;  1NAF A;  3PE0 A;  4UI9 J;  5FT9 A;  5EDS A;  3FBL A;  4Y6W A;  1JWG A;  3FEY A;  4HFV A;  4J8F A;  4UF0 B;  4B8C B;  2KZ7 B;  5H6R B;  3TJP A;  3U9W A;  3PE4 A;  5FQ8 A;  5JR9 C;  4AJW A;  4GB9 A;  2V4L A;  3KEZ A;  3E08 A;  1MMA A;  3D9L A;  3IKO B;  3BQL A;  4ANW A;  1UJK A;  2UY1 A;  4FUL A;  1ZU2 A;  3K8P C;  3I9W A;  2HPJ A;  3FXD B;  5AYW D;  4O6F A;  3D9N A;  3APF A;  2YIN A;  4KUM B;  2ILR A;  5AJD A;  5AJL A;  3HDX A;  1S94 A;  5IYZ E;  3HHM A;  5DQW A;  1QNF A;  2LSV A;  3APD A;  1H2T C;  1ELK A;  4JPS A;  3OYZ A;  1HXI A;  4MRU A;  5LJM A;  4I6J A;  3ZMS B;  5LXT E;  1IJ6 A;  3HKC E;  3RPU A;  3PUR A;  4L0R A;  5HAX A;  4FA6 A;  4XKC A;  3L3P A;  4H7X A;  5LG4 A;  3LJ3 A;  1S0P A;  4EB6 E;  3IHV A;  3WXX A;  4I6E A;  4NAC A;  3ZFW A;  4HLE A;  2IAK A;  2V7K A;  2V26 A;  4GYS A;  3JUI A;  5LGT B;  4MAL A;  1LVF A;  4KYO B;  3QWP A;  4WND A;  3M65 A;  4GA1 A;  4LER A;  3MCX A;  4U04 A;  2WQH A;  4UEL A;  3ANW A;  5JVD E;  5F3J A;  3MXZ A;  5FY1 A;  2CG3 A;  4XX5 A;  1BPO A;  3CHQ A;  5LGU B;  5E75 A;  4UF0 A;  4UVB B;  2HO1 A;  1N52 A;  3FTY A;  4TV3 A;  3TXM A;  1E8Y A;  2A2F X;  3RYC E;  3CHO A;  5FXX A;  3SHF A;  5C2Y A;  4ABN A;  4GPK A;  2KM4 A;  4KP3 C;  3SBS A;  3LXU X;  3RRN B;  5BV1 A;  4O2B E;  4QX7 B;  4PJM A;  5KJK A;  4A55 A;  5G04 C;  3FTU A;  3PEU B;  5E0O A;  5J08 A;  2VKJ A;  1UW4 B;  2W62 A;  3LEW A;  1IQR A;  4LRZ A;  4GOU A;  4RSY A;  2R5S A;  3Q4A B;  2JLB A;  3C50 A;  3I5P A;  1EPU A;  1KK7 A;  4JW1 A;  2WPV A;  1XGW A;  4I4T E;  3PUG A;  3FWV A;  3HVE B;  4XI0 A;  3MKQ B;  5LHI B;  3W15 B;  3FY4 A;  5ANR A;  3FU0 A;  4G26 A;  1FEW A;  3ZYK A;  2D0T A;  3ZN1 B;  2DCP A;  4CXY A;  1B89 A;  4ANJ A;  1YKE B;  1UJJ A;  3N5L A;  1G8X A;  2FF4 A;  4G23 A;  3GWH A;  2LSI A;  5A7D B;  3FUM A;  4YLH A;  1YA0 A;  2XQY A;  2IW5 B;  2WXP A;  3CVY A;  4GYO A;  1QUU A;  2K24 A;  3KBT A;  3S7F A;  2CLY B;  2J49 A;  1YW0 A;  4DVD A;  2KAT A;  3R84 B;  5CA1 E;  1BR0 A;  1E8W A;  3G2W A;  5JRC B;  4EAH A;  3PUQ A;  1HS7 A;  4MLK A;  4I1O B;  3ZCJ A;  2NSZ A;  5CHE E;  2LO6 A;  2LSG A;  5T3R A;  3GZ2 A;  4F3V A;  2M63 A;  3VU7 H;  4EIW A;  3FU6 A;  2VB6 A;  3SOL A;  3ULQ A;  4AP2 A;  4D10 C;  2LOS A;  3MAC A;  2WQ6 A;  3LY7 A;  1HH8 A;  2ION A;  4I43 B;  4ANX A;  2YHC A;  4Y6C A;  4AXH A;  5D0O D;  3Q2M A;  1IZN B;  2XCB A;  3MA9 A;  3FH7 A;  3C4Z A;  5KJL A;  5EX0 A;  3GZS A;  3IEG A;  2XGS A;  3C64 A;  2DLR A;  2LSU A;  4U63 A;  3PDN A;  2LAI A;  2E9X D;  4NQ0 A;  1MIV A;  2DHR A;  2YNQ A;  5BT1 A;  3KS2 A;  3QJZ A;  4DMV A;  5G55 A;  4B94 A;  2PQN A;  4CDM A;  4ANV A;  4KVM A;  2LHN A;  3L13 A;  4V1A v;  4FAD A;  5HWX A;  4WNE A;  4C90 A;  2E9X B;  1WRD A;  3CVR A;  2X66 A;  3EDT B;  3UTK A;  1JUQ A;  2EHO D;  3AA7 B;  1PY1 A;  4IRU A;  3ZMZ B;  1HO8 A;  3D9I A;  4PJN A;  3T5V A;  3HVE A;  2W0G A;  3MKQ A;  4I9C A;  4CI1 B;  5DQV A;  1OWL A;  4UQY A;  2EHO B;  4J8D A;  5LX8 A;  3U3I A;  3E22 E;  3HYM B;  5CMY A;  4RG9 A;  4B8A A;  5HWY A;  2ZM2 A;  3MZL B;  4TRQ A;  3UQ3 A;  2NP9 A;  4O4H E;  5FQ6 A;  3F57 A;  5JRC A;  3ONK A;  3O1H A;  4W9R A;  3ZGQ A;  2J4B A;  4M3O A;  1ZBP A;  1NWM X;  4P09 A;  4GYW A;  3B7T A;  3P2B A;  3AS4 A;  3AS5 A;  3LPZ A;  2IF4 A;  3OXG A;  4Q94 A;  3QKY A;  4FJY A;  5EK4 A;  3OTN A;  3CK8 A;  5LP6 E;  1UCU A;  3CKB A;  4P29 A;  2MOZ A;  5FTP A;  2L9B A;  5JDF A;  1KT0 A;  2UWJ G;  3AAE B;  4TV8 E;  2SPC A;  1INZ A;  4X1Y E;  1U3D A;  2VGY A;  5DJQ C;  3LBX B;  4H9S E;  3LG7 A;  4ACL A;  3KAE A;  3KVB A;  3R9A B;  1WLX A;  2C0L A;  4QXH B;  2KZT B;  3ZCI A;  2IC6 A;  2WXL A;  4AKR B;  2D0U A;  3AS8 A;  3ZYQ A;  3UUL A;  3ASG A;  3EIJ A;  3PRZ A;  2E9X A;  3C4X A;  5A1L A;  3FBZ A;  3SGH A;  3FUE A;  4U07 A;  4KZ0 A;  3FUL A;  4PUC A;  1YD8 G;  2X9Y A;  4C91 A;  4ZS3 A;  1E7V A;  3L08 A;  4QKN A;  2JRK A;  3L16 A;  5FJY A;  2C0M A;  4N2S A;  2PG8 A;  4N2Q A;  2EHO A;  1OWN A;  2QY7 A;  4JVS A;  4ZHQ E;  4PK4 A;  1QQE A;  2VSX E;  5F8P A;  4JHK A;  2AXZ A;  1VOM A;  5JJ6 A;  3D9M A;  4UQZ A;  3J9X 1;  5BW8 C;  1H7C A;  4B89 A;  3NRX A;  4IE0 A;  4N5C A;  4GCN A;  2R17 C;  3ZN3 A;  3OBV E;  3NRY A;  3ASD A;  4F53 A;  4EEC A;  2NC9 A;  2KT9 A;  2CLY C;  5LHG B;  5JR9 A;  3G2S A;  5HQ8 A;  2KCV A;  3G2T A;  4I2Z A;  3SD5 A;  2XAQ B;  3ESL A;  2LHR A;  1MHQ A;  2WXO A;  2Q7F A;  3FFL A;  1Z3X A;  1MND A;  4DLQ A;  1ZKE A;  3HI2 A;  4GZC A;  1FVH A;  3FUI A;  4FI5 A;  2XEV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...