3B13A

Crystal structure of the dhr-2 domain of dock2 in complex with rac1 (t17n mutant)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
427
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis for mutual relief of the Rac guanine nucleotide exchange factor DOCK2 and its partner ELMO1 from their autoinhibited forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 139
structure length 427
sequence length 427
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b13A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3b13A01
2WMOA 2WMNA 3VHLA 2WM9A 2YINA 3B13A
chains in the Genus database with same CATH superfamily
3JQ1A 1VRBA 2IOLA 2RFAA 1W0AA 5FQ4A 1DCQA 3ZKRA 4LG6A 4L2YA 2LSYA 5KBAA 4KYOB 4GTRA 4M3OA 3O1HA 2XENA 3S7BA 3DSTA 5FJYA 4A63B 4I1AA 3Q79A 3AAAB 2VGYA 2V7IA 1BI8B 1Z6TA 3CVYA 3L9TA 2CG3A 2XEEA 3AECA 3QUJA 3I1AA 1YQ4A 1HTJF 5F8PA 2J9QA 5KJKA 5L4HA 1DNPA 2WXHA 3U3WA 2WM9A 5JREA 5LGNB 2AXDS 4HFHA 4O2BE 3PJAJ 4LCTA 4FA6A 2R02A 2V5DA 1OEDB 2PL2A 4AXHA 4EZLA 2XQAA 4I9EA 1XNQT 3FTSA 5JJ6A 3DSSA 5FQ8A 3LDQB 3ONXA 5IUXA 5DJQC 5CEAA 4DX2A 2J07A 4B8AA 3GN5B 2WU2A 1QBQA 3CVXA 3MXZA 4ANJA 2JMKA 3DEOA 3EJNA 5JQGE 2BKPA 3MKRA 3GW4A 5HXCA 4FP7A 4RLYA 5FY1A 1DC2A 3ZEFB 5ANRA 3VLFA 5FMNA 5E0OA 3UUXA 4U74A 2V5QC 4C0EA 2L8KA 4BAYB 1OY3D 4HBDA 2Q9QB 4NPPA 4L7TA 3URZA 3RSEG 3B95A 2P9BA 1KLXA 2XQYA 3MZKB 4UQXA 5J08A 3CMLA 1OWAA 5FP3A 4U8HA 3ZYMA 4A3VA 2BG9E 4DR6T 4FU3A 3UMVA 1D1BA 1XNFA 3WXXA 3L16A 1TNUA 2L9BA 2LOPA 3C3OA 2LO6A 5CRUA 3AU4A 4ILGA 4DX1A 3CQGB 3ZXSA 4UVBB 2WMOA 3Q5MA 2BKOA 1E90A 2WDQA 3AEEA 3R9MA 4UF0B 4JLEA 3I0OA 5DQVA 3HYMB 3CGHA 3UPVA 4WWNA 2XASB 4LEUA 2C0SA 2LAHA 3BU8A 2GRQB 2KLQA 3EDUA 2F0YA 3ASOE 4LNUD 3RC8A 4L23A 4BT8A 3ZCIA 5A7DB 2XHEA 2OEVA 3ASNE 1A5EA 3PUXF 2QA7A 1RW2A 4CQIA 4IREA 2ILRA 1QNFA 2WMNA 4H9SE 3MV3B 3ETVA 1SE7A 3DBSA 5LFAA 4U3CA 4U2YA 5JDLA 4Z90A 3G2SA 1N54A 3EI0A 3R6NA 3PURA 4ANUA 3ZT7A 5AARA 4DR2T 4GZ5A 4WNGA 4F1PA 4EEDA 2VTBB 4CZ2D 2VK9A 2Y4UA 5C3JA 4HFCA 5HAXA 4L9PA 2XQ6A 3FEXA 4JZYA 4DV7T 4IE0A 4YTMA 3ZYQA 4B3TT 1I94T 1NP7A 3R7RA 2XY8B 4XZ4A 4ZS2A 1MHQA 2IU1A 2XAHB 4ISSA 4NACA 3FU0A 2FUPA 4OVUA 2LM2A 1O5MA 3U9WA 3UT8A 4AVXA 5FVKA 2W63A 3OPCA 2CWOA 4ILCA 1G8XA 2AXVA 4CDNA 5L3GB 4GYSA 4EQFA 1SQMA 5G05J 5BT1A 1IXVA 4GAAA 4H9NC 4DR3T 3N5LA 4KT6B 4BTBA 3AG4E 3RRWA 2LXLA 3DTOA 5FWQA 4I43A 4PK5A 2H7OA 2JPFA 1TNOA 2V4HC 5AQBA 1OWLA 1TNBA 5DBKA 3PUSA 1WM5A 2EIJE 3UU5A 4LF6T 2JQKA 2X66A 2V7LA 3VHLA 4DMVA 1HS6A 5T3RA 3HXFA 2E9XD 4KZ0A 3KVBA 4UI9C 4FJOA 3T8MA 1FVHA 3PS6A 4Q94A 3AEFA 1KZOA 4RVBA 3SWHA 2FEZA 2ZM6T 5JRCA 3SS1A 3O4XE 5JDHA 5G04C 2XQ0A 4DLOA 4HOTA 3CX6B 2KMFA 3PJAA 4WNKA 3ZJ1A 4G8KA 1IBLT 1U4QA 4GU5A 3AEDA 4V3IA 3TLSA 3OJAA 2YDRA 3L8RA 3LBXB 4APFA 2CLYC 3FUFA 2WDRA 2YHEA 4BWRA 1YQ3A 3I4RB 3OXGA 3FHNA 3N9NA 4WUYA 4IRUA 4U7YA 5AJLA 4JI1T 4XIFA 2BDEA 3N2KE 5C1DA 2L0IA 4HORA 4UUCA 2P9NG 4I50E 2VKHA 1TN8A 4YDOA 3ZU7B 3A5XA 2CMRA 2QYUA 3GYZA 2XAQB 4OK0A 5ETWA 3PRZA 4XE0A 4GK0E 1W9RA 2WCAA 4JUYA 3NZPA 1IHGA 4ACKA 4DI4A 3CKCA 3QB2A 3PEUB 1HFAA 1U3DA 2L0TB 3UTKA 3KEAA 5AQHB 2WBLA 5JDNA 2Y0BG 5JDMA 4K5CA 2WZHA 1IAPA 4NIKA 4IT4A 4MFRA 3RIUC 1GW6A 3HA4A 1H6KA 1R8IA 3Q73A 3KV9A 2BKGA 2E9XB 2V5CA 4K0KT 1L5JA 1SUMB 4DI3A 1WR0A 1XNRT 2C5KT 1KT0A 2CE7A 4KP3C 3UM0A 4V1Av 4G23A 2ZGGA 2C5IT 4AQYT 2E2EA 3T1YT 4DR1T 2V1DB 2UXXB 1MIYA 2X0YA 4CXXA 3LVRE 2ETBA 2ACXA 4YSXA 4ZI3D 5J90A 3TWWA 3T8KA 3KBTA 2W61A 2XUEA 3NVOA 4HWDA 3SRZA 3CVVA 3K3OA 3ASHA 4GIWA 3ULQA 1Z0PA 3IHRA 3UUNA 2VGXB 3U4TA 2I6HA 4JEHB 1V55E 5CHEE 3TLVA 3UT5E 2DCFA 4L5GA 4EYUA 3T1HT 2OCCE 4MRUA 3AAIA 4G2AA 4I55E 2EHOA 3LJ3A 3UQ7A 3ZFWA 5ENRD 4X20E 2IC6A 5F5WA 3FZFB 5AQAA 4EOZB 2WXOA 3ANWA 3M65A 4MALA 2X51A 4PK6A 4U0SA 3TWQA 3AVSA 3OKQA 5AQQB 1N0QA 4HI8A 4EZJA 1HXIA 4AKGA 3ZUVB 2ODVA 2GROB 3HXDA 3ML8A 2JLBA 2H89A 3OXFA 1HG2A 3RYIE 2JMHA 2LEHA 2R03A 4IN3B 3FXDB 3PNLB 2FULA 2X9WA 4QXCB 2PNNA 3CQCB 5KJLA 5L2LA 5CMYA 5L3DB 2J09A 2LAIA 3PU8A 3DP7A 3ZC0A 3RLFF 5F3JA 4XBFB 4HFGA 3FTWA 3LJCA 3LS8A 1KFYA 5D0OD 4BSXA 3OXLA 4UQZA 3MZLB 3BEEA 3FU6A 3JC6D 2UXBT 4AKIA 2XEVA 5AQLB 2VKJA 2CBJA 2MOZA 3CIRA 2XSBA 4ZI2C 1BLXB 4WW0A 2K48A 3NRYA 3E34A 4F1SA 3UULA 2V5FA 5HXHA 3PU3A 4TZ4C 5HXEA 3ASDA 3VLEA 4ZOLE 4ILUA 4E7SA 3UM1A 2RPAA 3FUDA 3OYZA 3QWWA 2XCCA 3A7MA 2YOEA 4BY6A 3ONKA 4N3CA 3AE8A 4JD2G 2X0LB 2WXKA 3UUMA 3TXMA 4C0MA 2CBIA 3QWPA 3TLUA 3DSXA 4QKNA 3AE2A 3EHQA 4U2ZA 3FU5A 3PUVF 1TJFA 3UFEA 3C4XA 2BBHA 2XJ7A 4BX8A 2LM9A 3P4SA 2QYJA 4PW8A 4J7WA 3WAKA 4I6EA 3E22E 3F31A 4AIFA 1TNZA 1S63A 5JR9A 5L3FB 2MYSA 2W0GA 3RF1A 2JRKA 3Q75A 3PZ1A 2DZNA 1N94A 3PVLA 4GYYA 3VU7H 4NQ0A 5BPPA 4YSYA 2UY1A 2VSOE 5AQKB 3B13A 4LNBA 3O48A 3D9KA 2VB6A 4H63V 2X9XA 3LSVA 2WP9A 4TRQA 1O1SA 2CHZA 2P58C 3P4QA 4ILHB 1D0XA 4WWOA 4EPZA 4O1OA 4I0UA 2DLRA 4AI6A 4LMLA 1QLBA 2DWGA 5LBQB 2VWAA 5HWYA 4MHCA 2WU5A 3U3IA 2C0LA 2A3DA 2V7KA 2V26A 4CI3B 5FVLA 2ZM2A 4ZI7E 5AENA 4HEAA 1K1AA 3KBUA 3D9HA 5M72A 3DSWA 4GYOA 2BG9C 1UN9A 3Q7FA 1DVPA 1U5PA 5LJMA 3TG5A 4IE6A 4YJ3E 4DV3T 4L0RA 5JTGA 4P1NA 3TLWA 2H6GA 3D0TA 2KWHA 3J9X1 4YHHT 1G3NB 2LUHA 3SHFA 4GYRA 4CXWA 2QRXA 5L3EB 5AFUL 3VTXA 4DV6T 2CFZA 5H6RB 1NA3A 2X6JA 3MKQA 3ZHEB 3GMIA 2PBIA 2XSAA 2QGSA 2R17C 2P9UG 3ML9A 3ZMUB 1Z8UA 3L82A 2XGOA 4GB9A 4H7XA 4NUUA 5A6CA 4AISA 2NSZA 4HOUA 3C72A 4IDNA 3RIBA 4HWHA 3V2XA 1N33T 5FTPA 1UOHA 2LKHA 2HO1A 3O1JA 1EYHA 4UXNB 2BKNA 4Z68A 4L9IA 5D2MC 2OLTA 1WLXA 4TV3A 1AP7A 4U95D 4QWNB 3MX3A 4ZXLA 1W0BA 3QK0A 4ABNA 5LYJE 2OV8A 3UU6A 3UQ4A 2HM8A 4JC8A 5E75A 1Z3YA 4KMOA 5BUZA 4I6GA 1ZP0A 2B76A 3HVEA 3K1SA 3UI2A 2ETCA 2HR2A 3D3MA 1BR0A 3UX4A 4AOFA 4DX6D 4O2AE 4UV8B 4HN9A 1H6OA 2KC7A 3T9KA 1LTXA 3PE4A 1XZYA 2EQXA 3TKLB 2XQ9A 2YK0A 3V5SA 3L54A 3T8OA 4PUCA 3T5VA 2LSIA 5KWDA 4H9RC 1UN8A 4XKCA 4YDYA 4HOQA 4CN4A 2XZDG 2B6CA 4AY5A 4TX5A 3N9QA 2MRIA 2BVLA 2BBJA 2WQ6A 1XMQT 4D10C 2XAJB 2L6BA 3NRXA 3PUAA 2KZTA 4HE8A 2LSUA 2XS8A 4UQYA 2I1KA 3Q9NC 3CVLA 3RYCE 4ILAA 1UJJA 5HEJA 1N34T 3RRMB 3RYHE 2RA1A 2XPYA 4HFVA 4Q25A 3AE1A 1IQUA 3SFXA 4JEUB 1JCQA 2AJAA 3EU9A 4CYMD 3ISMC 3TWVA 3Q9DA 4DLQA 4GTQA 4B3ST 4HNAD 1I6ZA 2C0MA 2GGFA 4UI9K 2KXPC 5D0QD 5AIJA 1CHUA 3AA6B 4QH4A 3FP3A 4BJNA 1HX8A 5JJTA 4GMJA 3AA0B 1N4SA 4AQFA 4CEMA 5J0ZA 4H9OC 1W09A 2JIWA 1PC2A 4HQDA 2D5UA 5LJNA 2BTDA 3IEGA 5AQ7A 4LMJA 4NIQA 3RPUA 4UEMA 3UM3A 4ATZD 3B57A 3ASFA 4Q96A 1D8DA 3MK7C 4O4IE 5KX5E 3Q5EA 4JI4T 4Y6WA 2WQ7A 1HNWT 4MKTA 4RSYA 4N2QA 2GK9A 4CXYA 2VYIA 5H6QB 2MYOA 3N9OA 2C5JA 5JHBA 4EHMA 4GPKA 2R2LA 4GMRA 5CERB 2D0UA 3TJPA 3QKYA 2DI4A 1HNXT 3R7QA 3SI5A 5EK3A 4KXKB 3CK9A 2IO3C 2ONDA 4U72A 1Y6IA 4U31A 2DBAA 4KBQA 4C48B 1B89A 4OVVA 3EIQC 4WNDA 3AS5A 3B7BA 5LG3A 2ODUA 4CN6A 2HH7A 2VSYA 5FZRA 2I59A 1OXZA 2YEVC 5AQIB 3A8YC 3D9LA 5BW8C 1DCEA 4EAHA 4DR7T 3FXEB 3AE6A 2GRMA 3G2VA 5HEUA 3CVQA 4B94A 2IF4A 2XZEA 4U0UA 3FUMA 4CCAA 5CB4E 3PNTB 4UWKA 3RK6A 1AWCB 4GA1A 4QX7B 3TGOA 4G63A 3SFZA 2WXPA 2Z6EA 3FBLA 3NOGD 1WYBA 3LK3B 1LVFA 4EV6A 2CG2A 3KEZA 3HKEE 3CHRA 4EEBA 4AY6A 4PAGA 3LVQE 2PM6A 3FUKA 4B93B 2FJDA 4TWFA 1N36T 2J08A 3NZSA 1YXRA 4DR5T 3ZMVB 3K3NA 1GQEA 3KINB 4YHJA 1IJ6A 2M63A 1HO8A 3DWLG 5ABEA 1Y01A 1OWOA 2CA5A 3U64A 3OYXA 4ZS3A 3LY8A 2VKOA 3U78A 4XKBA 4PH4B 5AQFB 1JPLA 2YN6A 5HYAA 2KATA 4OHFA 4F53A 3QOFA 2J4BA 5FY7A 4GK5E 2FJBA 3KD7A 2XAGB 3ONLA 1HF8A 2A72A 4LF5T 3LFMA 2ZM0A 1FCHA 3O4ZA 3CVPA 2UXCT 3SFDA 3AG1E 2CLYB 3AE5A 3C98A 5B3SE 3LCAA 2H6IA 1MX6A 2V8SV 3AE3A 2IJGX 4APOA 1XGWA 3G06A 4YT0A 4LF9T 2NR4A 3L17A 2VQET 4DO0A 4UELA 3BK9A 3V2OA 3N9MA 3J7Yq 4CT0A 1U3CA 2IDOB 3RI5A 2BS3A 4ADZA 5ABFA 1JWFA 3V31A 1N52A 3UU4A 4JI8T 3CVNA 5HEOA 5FY0A 2WVIA 5TAOA 4HLEA 5ARFA 1ELRA 4JW1A 3OAWA 2BEDA 1YMPA 4X66T 5CA1E 2W66A 3IHYA 2XTLA 3B7UX 4JA9A 1IQRA 2IIUA 4GOUA 4P29A 2C2LA 2NYJA 3FH5A 1Z3XA 3FTZA 4PS8A 3TXNA 2FJAA 5HCJA 4J8YA 2G0UA 5JH7E 3MYVA 4J8DA 5LNKA 4YDWA 3FDHA 1JNZA 3D9OA 3SBTB 4PJNA 3ZSSA 2YDQA 3FUJA 3B5MA 2IUBA 3FHEA 4GZDA 4B8CB 1E96B 4ZFHA 1MNDA 3CR3A 2QC9A 2WB5A 3HR0A 3FZLB 5JMND 4ILBA 2B0OE 4H63H 1UX5A 3RAUA 4GKKT 1OCCE 4R7LA 2SPCA 1E8ZA 3EIJA 1AJ3A 2EHOC 3DPDA 1KPSB 4U04A 5L4EA 2NTYA 1UURA 2JJ9A 3HIZA 2DCPA 5EYPF 2YNQA 1LRZA 3WAJA 4A5XA 2KT9A 3LG7A 3QARA 4UIGA 4BTAA 4XI9A 1M7KA 3FY4A 2CHNA 3E08A 2PQNA 3P4PA 2PTFA 4ME2A 4X65T 5JHAA 3BQIA 2JQHA 1FT2A 5G05C 2JQ9A 1H0AA 5C2TA 3TLTA 2VSXE 5CMWA 5LP0A 1J5WA 2WS3A 1MIVA 3ZRHA 2XAFB 5G04J 2QZAA 5CBNA 2N2NA 2NWBA 4DUYT 5AQSB 4LNGA 1SA5A 3PV0F 1IBMT 5BMVE 4K5BA 1EF1C 1PAQA 4NRHB 2RP4A 3K3QC 3C4WA 2FF4A 1H2VC 2AVPA 5HS0A 4DV1T 2LSKA 1FEWA 4HWFA 4JV5T 1XMOT 5JDQA 5CFBA 3EHRA 1ELKA 1ZEEA 4IL9A 4OAUC 4JBWF 5T8IA 1QUUA 2HE0A 4TUYE 5JDGA 3TWRA 3BQOA 4UWGA 5HI7A 4CT4A 4AXPA 4CGWA 3PUKA 2OVFA 3GWHA 2VL0A 3ZN3A 3ZJ2A 4OYKA 3AXJA 1JUQA 3SGHA 4G26A 4FLBA 1O1RA 3NBXX 5KDMC 1D0ZA 2YHCA 4EXTA 2J62A 4U8YD 2ZU6B 2E2AA 5AQMB 3KVAA 2JABA 5CRVA 3G2TA 3W15B 1E7VA 2D2SA 2IEJA 2X9HA 3UKUG 1M62A 1X9BA 5HXSA 4PS7A 1OT8A 4IGUA 4HXIA 1IKND 2H6FA 1WAO1 3R9AB 4DUZT 5JR9C 3TWXA 4FLHA 5KXJA 3PUQA 5EN5D 5KJNA 5HRYA 4TWDA 4QXBB 3D9MA 1E7UA 2IONA 4KVMA 3RKVA 3S7JA 2CPTA 5FL0A 2UXDT 4DX5D 4BETA 3ABME 3TL5A 4HWIB 1IZNB 2W4XA 2QFCA 3VRBA 5ENTD 5JJ7A 1E8YA 4GZCA 4TXPA 3ZMSB 4IDQA 3M3ZB 4ANVA 3CHPA 2Q7FA 4G11A 2VJ8A 5CEDB 4P09A 4EECA 1UJKA 3DRAA 3JAEA 3HKDE 4HI9A 3RC3A 2V6YB 1WY6A 4EZHA 5IWAT 3HHMA 4HFEA 3BQLA 3U66A 2LNIA 4AKRB 4HRLA 2HPLA 3N71A 3C50A 2BG9B 3EU5A 4TNWA 1T7SA 1UK5A 1ZB1A 4AQGA 3CHMA 2P2CP 3ABKE 3GN5A 5AAOA 3NWIA 2DZOA 2H88A 5G2NA 4H9QC 1EDUA 5AQ9A 2E5VA 3ZEFA 2E8IA 2R59A 4GYWA 3V5UA 3GZ2A 1H2UA 3LDZA 4URKA 1WRDA 2I0MA 4E6HA 4QHOA 2LKGA 2Q9QA 3AE7A 2ETAA 4DUIA 2NOXA 2BZBA 1WYCA 2IOSA 3FH7A 3ZPJA 4H9PC 3RRCA 3P4WA 5E76A 3IEEA 4I1OB 4XI0A 2M6IA 3CK8A 5CCMA 5FQ7A 2WDVA 5ENNA 4E7ZA 3NQPA 1KEYA 2X67A 3MJXA 4UWHA 3RKGA 4KHZF 1S94A 5HXRA 1Z5SC 3H3MA 4CDRA 2LE8A 2ZMAA 2F4VT 4DV4T 4ZZCA 5EDSA 4QH1A 3QNKA 4YJ2E 4MBGA 1NFIE 2Y69E 1G73A 4IDZA 3L13A 4UF0A 2CRBA 2YU2A 3H37A 3ZT6A 4COFA 5CJ5A 4J8FA 3HG0D 4YSZA 4UR9A 4GTSA 2LOSA 5M4YA 2ACZA 3F57A 3C4ZA 2I1JA 3TWSA 5ENPD 1S70B 1QQEA 3UUXB 3BG1B 1BI7B 1INZA 5KNGA 2DVWA 3QWVA 5CBOA 2KSRA 2GRPB 3PDNA 5ARGA 4YTPA 2XGSA 2V6XA 3AVRA 4ISTA 5LXTE 5CCLA 3OTOT 4O4HE 3ZMZB 1J5ET 4IULA 3F6QA 1TJCA 2H6HA 1OEDE 4P0AA 3ZVVA 2IHR1 2VURA 3AS4A 2L3LA 3QNUA 1T72A 3O9XA 2NW9A 2VTBA 4DIDB 4ATGA 1OCOE 3AA1B 2AE9A 5LOVE 4ERRA 4JXTA 2WB2A 1V9DA 4F6RC 2DL1A 5EK2A 3DJBA 4AQFC 2YQ8A 1OCRE 2P9KG 4AEZC 4U7IA 5DABA 3NAWA 3D9IA 3DPYA 4JB8P 3FZHB 4YLHA 3ZYKA 1N9AA 2KXPB 3CWZB 4WWPA 2XHEB 2ES0A 3C3RA 3UTMA 1MNEA 4FC8A 1JWGA 1IYGA 4U33A 2XRZA 2VSNA 5LMUT 3DXKG 3CX7B 3E0ZA 3LK42 3AE4A 1LKXA 3EABA 2CWYA 5J1GA 2KNDA 3JADA 4HB5A 3D9PA 2CHXA 1HCIA 3ULYA 3V79K 1BD8A 3C64A 3UU3A 4O1PA 5FT9A 2WXFA 3Q78A 5AQOB 2WWUA 3PZ2A 1TEZA 2VL8A 2XPKA 2M6BA 1H2TC 1NEKA 3FTUA 3UIPC 1VCTA 3I3NA 2YU1A 2WXGA 4GA2A 2IMLA 4IDPA 4N3AA 2CM0A 3P8CD 3OBVE 2V4LA 4UWLA 4QX8B 2H7VC 2WY2A 4F8HA 5L47A 1BPOA 4FADA 2X3MA 2LXMA 2PJQA 4I43B 2BUGA 4DBQA 3VTYA 2IY0C 1RZ4A 3LBXA 1KF6A 3ZN1B 4DBRA 2WQYA 5ADXL 4DNDA 4EZKA 3HKBE 3UINC 4IL4A 3C3QA 5EX3A 5ITZF 5BXOA 2FJEA 1LF8A 1EZ3A 2J4GA 3MACA 4Q69A 3AEBA 1IBKT 4EIWA 2WXQA 2XQ4A 2EIME 4HS2A 3C51A 3UFGA 2CHOA 4LF7T 4HFIA 3I4GA 5JVDE 2GRRB 3JUIA 2NW8A 5HQ8A 4GZ6A 5FQ6A 2R6GF 2D0TA 4NXNT 2VASA 2E5LT 3GA8A 3PUWF 1VDYA 5L3BB 3PUZF 4CI1B 1HNZT 1MX2A 1YYHA 3FUNA 5JRCB 1DU2A 2ZM8A 2I2OA 3ONLC 2E9XA 1XDOA 5A23A 2Y3AA 4Z8XA 3TWTA 3CSTA 4CDMA 1TNYA 2L9QA 1D1CA 1TN6A 4NURA 4ZHBA 5AQJB 3Q7AA 2QVAA 2J4DA 3P4RA 3KS2A 4YTNA 2QY7A 2WPVA 4WBOA 3ZGQA 3FWVA 2R5SA 1OXJA 4B3RT 1NZNA 4M1PA 4DJAA 5JA4D 3JCFA 4JYAT 2ZISA 4QXHB 3ZLIA 4GCNA 4HRMB 1ZV4X 3ZMTB 1K1BA 4YNDA 4OAVB 3PZ4A 4N5CA 4JHJA 3LY9A 2EHOD 2P9LG 1ELWA 1WR6A 2H3RA 5CECB 4LERA 2LSVA 1N95A 3NF1A 2VGXA 4JEHA 4HRNA 3JXIA 4AP2A 4DV5T 1N4PA 2X9YA 3ZSTA 4U63A 4BEPA 5LGUB 3SFYA 3C5RA 4GTMA 2KCKA 2PZIA 3MEKA 1UCUA 2MAWA 3SD5A 1D8EA 4K03A 4X5TA 4DMWA 1VOMA 3Q49B 3PUYF 4JI7T 3QK6A 2AWIA 2CCQA 2F8YA 3LY7A 4KUMB 3UT4A 3LEWA 4U7EB 4UV9B 3X2QE 3DSUA 3J5PA 4KVOA 2XM2A 1SHZC 5FYMA 1EPUA 3N2GE 4ZHQE 5LMNT 4TV9E 5EYLA 2J1DG 1YD8G 1UGOA 3VKHA 5T4YA 1BU9A 3FU3A 3UM2A 2LSJA 2CXFA 2WXMA 3PUJA 2K24A 4L1BA 5IYZE 2WXNA 3WG7E 1OWPA 3FZKB 3SBSA 1YA0A 3DXMG 2J47A 4AJWA 3L6AA 2HPJA 3JXJA 5LCWC 2MBGA 3E30A 3Q47B 4GCOA 4EB6E 5C8YE 2MHKA 2W2UA 4HKAA 1D0YA 4X64T 2HN2A 5AN8A 5FZSA 4FHKA 1MIWA 3G2WA 2X6HA 3LKUA 2HHHT 2KBXA 3SZ7A 4HFDA 1XWMA 4IE5A 4NXMT 1HU3A 2XZTG 3RKOA 5LA6E 5ABGA 2EHOB 1QZ2A 4PS3A 3RRNB 4RQIA 5ENSD 1SA4A 3N2OA 5AQRB 2BS4A 5LP6E 3ANWB 1QSDA 4N5QA 5ENQD 4LF8T 3PUGA 3PZDA 1N4QA 3CEQA 4LFAT 4G1TA 1J1JA 2RFMA 3CK7A 3FEYA 1WCRA 3VLDA 5J2UE 3S4UA 3LPZA 4ZEYA 2ZLYA 2BVMA 4J2CA 5ENOD 3J5QB 2XS1A 2YINA 4LF4T 4BA9A 1WFDA 3OTNA 1KNRA 2Y1LE 2VQ2A 3KDSE 4QFVA 3TWUA 2AW6A 4JI2T 3K8PC 3B7TA 3CKDA 5KNHD 2WWVA 3Q4AB 3TG4A 4W9RA 1L0VA 1BR2A 4BERA 5DIZA 2KCVA 3NZQA 4LSZE 3HXCA 3GZ1A 5BR8T 4IHJE 3MA9A 1MX4A 4F3VA 3S7DA 4HFBA 2UUAT 3Q5DA 3IA3A 1TN7A 3AG2E 4DK5A 5HEHA 4WZXA 2R05A 3PH0C 5LOZA 1ZHCA 2IQCA 3QAQA 1OUVA 5AQUB 2NC9A 1IJ5A 4N3BA 5HCMA 4MLKA 5GONE 2X38A 4WNFA 2K3WA 3ENEA 3HI2A 4LFBT 1SZAA 1D9SA 3RU0A 3HKCE 4FHJA 5AQGB 3NOCD 4LFCT 1OWNA 3JUEA 4B6XA 5HWXA 4AM9A 2WAUA 4K0UA 3CSFA 4PJMA 4L2LA 3IKOB 1E8XA 2GRNB 2HYZA 2VGEA 3ONJA 4OYSA 1OCZE 3F2EA 2X6FA 2PG8A 3ZC1A 2L6JA 4N39A 5LG4A 2NXPA 3ASGA 5EZYE 4KI0F 4IDOA 2EIKE 2Y6XA 3ZYLA 4CGVA 2W62A 5JR9B 4OX9T 3I5PA 2YKSA 5A1LA 2X6IA 3P1UA 3QB5A 2WXRA 4DR4T 4C9BB 1S64A 4KBMB 2UY1B 4XEIG 4JI3T 2FBWA 3ZHEA 4CZZB 4YDEA 2DIWA 3L22A 1S35A 2WXLA 3MV2B 3IF8B 5FXZA 4MLPA 3CHQA 3AAAC 3AG3E 1K8KG 4MBQA 3ULEG 3VR9A 3W9GA 3PE0A 2XGMA 3SQVA 3HXEA 5AYWD 3PREA 4AV7A 3RO2A 5EIBE 4ZI2D 2F37A 2J8SD 1ZBPA 4TXRA 3SY2A 4JI0T 3R84B 4KHPT 4WYVA 4UI9J 1YW0A 3AB3B 4KZCA 3E32A 1B7TA 1OEDC 4H7YA 4OFZA 3AE9A 3HL6A 3CVUA 1FPPA 2BF0X 3IV0A 4UVCB 2XCBA 4GTTA 4JHRA 4G25A 5FZQA 3L39A 3RX6A 2HN1A 3S7FA 1T98A 3ZPOA 1UG3A 1W3BA 1H19A 4J8EA 3NKZA 1FIOA 2GRLA 5EILA 1MYOA 4YXDA 4GTVA 3L09A 2P9SG 3JQ0A 1OWMA 4IYPA 3MKQB 1O1TA 5B1AE 1BR1A 5LHGB 5LHHB 4K5AB 2V0PA 2Q9QC 5L3CB 4A3TA 3I0QA 3QC9A 4XZCA 3D9JA 4JI6T 4UWFA 4U0ZA 4EBAG 1D1AA 1JCSA 5FXWA 2PQRA 4I2WA 3IBPA 5KCMA 2W67A 1MMAA 2K5BB 3MGBA 2DNXA 2A4ZA 1LVKA 1CUNA 3BQKA 3E4BA 3KSLA 4X8QA 3MJWA 3O1IA 4F6RD 4GTOA 3ZT5A 2WQHA 1T8BA 4JEUA 2X0HA 3VKGA 4A55A 2WXJA 3HVEB 4KMCA 1NL4A 3Q9UC 2LLYA 2N1GA 5EX0A 4O6FA 2A5EA 3SF4A 4JL0A 2FO7A 2DHRA 4YY3T 3FTVA 1WG0A 2XQ7A 3LXUX 3IXEA 4GMLA 4I1MA 3SOLA 3APFA 2XQ8A 4B89A 4WAFA 3JCKC 5CA0E 4O4JE 4PK4A 2Y48B 3IHVA 3Q5WA 2KZTB 3FFLA 3Q2MA 5HEGA 2UXNB 3KV6A 2OV9A 4X1IE 4G24A 3RJVA 4J6IA 4DV0T 5DQWA 4N2SA 2KINB 2XM1A 2XRYA 4IIJE 3W9FA 3OVUA 3CHOA 3UQ3A 1X79A 3LK2B 4BX9A 3VRAA 1ZU2A 3CIAA 5BNWA 1HG5A 3X1DA 3FUEA 2XQ3A 3D9NA 3ESKA 4XAXB 4AKLA 4P0BA 4A56A 5FL1A 3MCXA 5LGTB 3CQXC 1MZCA 1KZPA 1E8WA 5FNVE 4XX5A 4ANXA 5BV1A 3PTRB 3KFWX 2CEAA 2UWJG 4MS6A 4CI2B 4LMKA 2XPIA 1H7CA 1OEDA 3P7IA 2W00A 3RGLA 4TNVA 5D66A 2JEKA 3EAMA 1HH8A 4YVOA 4ASKA 3PDYA 4JA7A 4GKJT 1FMWA 5FXXA 3V30A 4UVAB 2DWZA 3FH8A 1V54E 1JCRA 4LUNU 5HKPA 3ZCJA 1KK7A 3PEVB 2M67A 2QYWA 4JPSA 1HE8A 4I2ZA 1NENA 2AXZA 3DSVA 3RQUA 4I6JA 4ANWA 4DX7D 2IO2C 3NZUA 2FI7A 4IE7A 3AA7B 2V8SE 3BUAA 1YKHB 1Y8MA 4HTEA 3FTXA 2WSSV 3UT7A 2V7JA 4AIUA 5LHIB 2MTQA 1U2VG 2GW1A 4PDXA 4GPMA 1H6PA 3PZ3A 2A2FX 1SZ9A 5KJMA 1E1HB 1MMNA 1FMVA 1N32T 5J2TE 1MMDA 3B7SA 4CN1A 4GZ3A 1ZOYA 3GZSA 1UW4B 4FJYA 4FJZA 4A98A 3FULA 1MMGA 3EHZA 3JAFA 5AQNB 2KM4A 4HOSA 2RD0A 4E85A 4PJLA 3HRAA 4BFRA 3RH3A 2D9DA 2K9AA 3SFEA 3L3PA 4FI5A 4O4LE 3PE3A 3S2AA 3FB2A 4KX6A 4PFPA 2FBNA 3RO3A 5EK4A 1NA0A 2UU9T 4Y6CA 3QB5K 2CXDA 2IC9A 1KNPA 1S0PA 5AQPB 3N9PA 1VCSA 1Q2ZA 2P9PG 2MOWA 4ILIA 1SW6A 3CHSA 1X81A 3RIFA 3ZKJA 3P2BA 2LT3A 3ZW3A 5EIDA 4BSZB 1HR0T 2ZXWE 4RG6A 2E9XC 3CPZA 4EZ4A 2A5UA 3BG0B 4U07A 3HXBA 4TUMA 4IE4A 3NB2A 2KCLA 4ZZBA 2IFUA 3I9WA 2OOEA 3RRUA 3KV4A 3LJNA 1MQSA 4JVSA 4PJJA 1JNRA 1SA0E 1BR4A 3ZXPA 3RIUA 5KMGP 1Y64B 4X62T 4U8VD 3K9IA 2WXIA 5B1BE 3HDXA 5FINA 3AJIA 4YVQC 3IBEA 4B3MT 3ESLA 1KNZA 5JDFA 4WNEA 3RQWA 3C98B 1IHBA 4BJMA 4Z91A 3L08A 3RIAA 4HVBA 4A97A 2XPZA 5BV0A 4YFSA 4B0ZA 3VR8A 2NTXA 5LCYA 2LRLA 2RKKA 4O8SA 4PNIA 4EBAA 5ABFB 4TXQA 4GTPA 3N9LA 1P5QA 1US7B 1HS7A 2CFUA 2OEWA 2KZ7B 3Q5XA 2NP9A 2ZGDA 4DPRA 2OA5A 4WBNE 4NUVA 3ZN0B 2DWKA 3EVYA 1QYMA 2X6KA 4ACLA 4BESA 3EUVA 2IW5B 2LRKA 1N0RA 4F7AA 3AEGA 3E37A 4C91A 2RG8A 3TAXA 4RG9A 3CVWA 4TWHA 3UUBA 4I4TE 4HLLA 3UKRG 4AKHA 1LD7A 3ZIMA 1O3XA 4DVDA 4PFOA 3CVRA 5C2YA 2E0IA 1HZ4A 2IAKA 5CGMA 4G8LA 4QH5A 3ZNGA 4LRZA 3APCA 4N78D 4GA0A 3I9YA 3FUIA 3G2UA 2A9UA 1YKEB 4ZI3C 2FO1E 3MA5A 3QC1A 3AS8A 5BXUA 1HX1B 2V7MA 2EINE 1ZKEA 3AAEB 1FT1A 3ABVA 5ABHA 1YCSB 5H7PA 5EKQD 2WZIA 3CV0A 5IY5E 1KT1A 5FIOA 4CRWA 3FUHA 4A1GA 5FXVA 4I17A 3APDA 4M7CA 4K0RA 2JQQA 3CK6A 3RYFE 4O60A 4QQIA 5ANLA 3LYAA 3SNXA 1NAFA 1FJGT 3WI3A 3EDVA 1FVFA 4FULA 2AXUA 1N11A 4A1SA 2OVBA 1NWMX 1X5BA 2XEHA 4EGWA 2BKKB 3CKBA 1K3ZD 2VVNA 2EILE 3RHWA 3QJZA 2Y8DA 4OYJA 4J0UA 5AQVB 3JYSA 2N9DA 2DYRE 1LD8A 5LB7B 3FTYA 1MJ0A 3T5XA 2PFVA 1TR4A 1WDYA 2CHWA 3QDNA 2I9CA 3EDTB 3Q15A 4TV8E 2XQ5A 5LBMA 3UU8A 5AJDA 1TYQG 1UUSA 2F8XK 3FBZA 2CXLA 3SO8A 3AEAA 4HWCA 3JC6C 4DV2T 3EHMA 3P50A 4X1KE 3B7RL 4DRXE 3AXJB 2KWIB 3EUHA 2P9IG 4BT9A 1NI1A 2VKDA 3H3AA 2B1EA 3ETUA 4TN7B 3KAEA 3CX8B 5LX8A 3KV5A 4G2VA 3EHNA 3CLJA 4C90A 4X1YE 2Y4TA 1E7PA 4EYYR 2VQFT 3FZMB 4JI5T 5G55A 5FKYA 2ZIRA 1E2AA 2YDSA 3NBNB 3QOUA 3E33A 2UUCT 1UX4A 5IHYA 3UIOC 3UXGA 4TUUA 2V6YA 1PY1A 4HGAA 2X68A 1N4RA 3AU5A 2UUBT 4JHKA 1XDPA 3MKDA 1A17A 3KSQA 2LJLA 5AQTB 2BG9A 2J49A 2BS2A 4I9CA 3ABLE 2NW7A 4J8SA 3DEPA 2MPKA 2LHNA 1SVXA 2LSGA 4U96D 2PM7A 2LHRA 5LCWJ 2DYSE 2VVSA 2Q9QD
chains in the Genus database with same CATH topology
3JQ1A 1VRBA 2IOLA 5FQ4A 4L2YA 2LSYA 4KYOB 4M3OA 3O1HA 3S7BA 5FJYA 4I1AA 3AAAB 2VGYA 2V7IA 1Z6TA 3CVYA 2CG3A 3QUJA 3I1AA 5F8PA 1HTJF 2J9QA 5KJKA 1DNPA 2WXHA 3U3WA 2WM9A 5JREA 5LGNB 4O2BE 4LCTA 4FA6A 2PL2A 4AXHA 4EZLA 4I9EA 3FTSA 5JJ6A 5FQ8A 3ONXA 5DJQC 2J07A 4B8AA 3GN5B 3CVXA 3MXZA 4ANJA 2JMKA 3EJNA 5JQGE 3MKRA 3GW4A 5HXCA 4FP7A 5FY1A 3ZEFB 5ANRA 3VLFA 5FMNA 5E0OA 3UUXA 4U74A 4C0EA 2L8KA 4BAYB 2Q9QB 4L7TA 3URZA 2P9BA 1KLXA 2XQYA 3MZKB 4UQXA 5J08A 3CMLA 1OWAA 5FP3A 4U8HA 3ZYMA 4A3VA 4FU3A 3UMVA 1D1BA 1XNFA 3WXXA 3L16A 2L9BA 2LOPA 2LO6A 3AU4A 4ILGA 3CQGB 3ZXSA 4UVBB 2WMOA 3Q5MA 1E90A 4UF0B 4JLEA 3I0OA 5DQVA 3HYMB 3CGHA 3UPVA 4WWNA 2XASB 4LEUA 2C0SA 2LAHA 2KLQA 3EDUA 3RC8A 4L23A 4BT8A 3ZCIA 5A7DB 2XHEA 2QA7A 4CQIA 2ILRA 1QNFA 2WMNA 4H9SE 3MV3B 3ETVA 3DBSA 5LFAA 5JDLA 3G2SA 1N54A 3R6NA 3PURA 4ANUA 4GZ5A 4WNGA 2VTBB 2VK9A 2Y4UA 5HAXA 3FEXA 4JZYA 4IE0A 3ZYQA 1NP7A 3R7RA 4XZ4A 4ZS2A 1MHQA 2IU1A 2XAHB 4ISSA 4NACA 3FU0A 4OVUA 3U9WA 3UT8A 4AVXA 2W63A 2CWOA 1G8XA 2AXVA 4CDNA 5L3GB 4GYSA 4EQFA 1SQMA 5G05J 5BT1A 4GAAA 4H9NC 3N5LA 4KT6B 4BTBA 5FWQA 3RRWA 3DTOA 4I43A 4PK5A 2H7OA 2JPFA 1OWLA 5DBKA 3PUSA 1WM5A 2X66A 2V7LA 3VHLA 4DMVA 1HS6A 5T3RA 2E9XD 4KZ0A 3KVBA 4UI9C 4FJOA 3T8MA 1FVHA 3PS6A 4Q94A 4RVBA 3SWHA 2FEZA 5JRCA 3SS1A 3O4XE 5JDHA 5G04C 2XQ0A 4DLOA 4HOTA 3CX6B 2KMFA 4WNKA 3ZJ1A 1U4QA 4GU5A 4V3IA 3OJAA 3LBXB 4APFA 2CLYC 3FUFA 2YHEA 4BWRA 3I4RB 3OXGA 3FHNA 3N9NA 4WUYA 4IRUA 5AJLA 4XIFA 2BDEA 3N2KE 5C1DA 2L0IA 4HORA 4I50E 2VKHA 3A5XA 2CMRA 3GYZA 2XAQB 4OK0A 5ETWA 3PRZA 4XE0A 4GK0E 4JUYA 3NZPA 1IHGA 4ACKA 4DI4A 3CKCA 3QB2A 3PEUB 1HFAA 1U3DA 2L0TB 3UTKA 2WBLA 5JDNA 5JDMA 1IAPA 4MFRA 1GW6A 3HA4A 1H6KA 3KV9A 2E9XB 1L5JA 4DI3A 2C5KT 1KT0A 2CE7A 4KP3C 4V1Av 4G23A 2C5IT 2E2EA 2V1DB 2UXXB 1MIYA 4CXXA 3LVRE 2ACXA 4ZI3D 5J90A 3KBTA 2W61A 2XUEA 3SRZA 3CVVA 3K3OA 3ASHA 4GIWA 3ULQA 1Z0PA 3IHRA 3UUNA 2VGXB 3U4TA 2I6HA 4JEHB 5CHEE 3UT5E 2DCFA 4L5GA 4EYUA 4MRUA 3AAIA 4G2AA 4I55E 2EHOA 3LJ3A 3ZFWA 4X20E 2IC6A 4EOZB 2WXOA 3ANWA 3M65A 4MALA 2X51A 4PK6A 4U0SA 3AVSA 3OKQA 4EZJA 1HXIA 4AKGA 2ODVA 3ML8A 2JLBA 3OXFA 1HG2A 3RYIE 2JMHA 2LEHA 4IN3B 3FXDB 3PNLB 2FULA 2X9WA 4QXCB 3CQCB 5KJLA 5L2LA 5CMYA 5L3DB 2J09A 2LAIA 3PU8A 3DP7A 3ZC0A 5F3JA 4XBFB 4HFGA 3FTWA 3LJCA 3LS8A 4BSXA 5D0OD 3OXLA 4UQZA 3MZLB 3BEEA 3FU6A 3JC6D 4AKIA 2XEVA 2VKJA 2MOZA 4ZI2C 4WW0A 2K48A 3NRYA 4F1SA 3UULA 2V5FA 5HXHA 3PU3A 4TZ4C 5HXEA 3ASDA 3VLEA 4ZOLE 4ILUA 4E7SA 3FUDA 3OYZA 3QWWA 2XCCA 4BY6A 3ONKA 4N3CA 2X0LB 2WXKA 3UUMA 3TXMA 4C0MA 3QWPA 4QKNA 3FU5A 1TJFA 3C4XA 3UFEA 4BX8A 2LM9A 4PW8A 3WAKA 4I6EA 3E22E 3F31A 4AIFA 5JR9A 5L3FB 2MYSA 2W0GA 2JRKA 3PVLA 4GYYA 3VU7H 4NQ0A 5BPPA 2UY1A 2VSOE 3B13A 3O48A 3D9KA 2VB6A 4H63V 2X9XA 4TRQA 2CHZA 2P58C 4ILHB 4WWOA 1D0XA 4EPZA 2DLRA 4AI6A 2DWGA 5LBQB 2VWAA 5HWYA 4MHCA 3U3IA 2C0LA 2A3DA 2V7KA 2V26A 4CI3B 2ZM2A 4ZI7E 5AENA 4HEAA 5M72A 3KBUA 4GYOA 1UN9A 1DVPA 1U5PA 5LJMA 3TG5A 4IE6A 4YJ3E 4L0RA 3D0TA 2KWHA 3J9X1 3SHFA 4GYRA 4CXWA 5L3EB 5AFUL 3VTXA 2CFZA 5H6RB 1NA3A 2X6JA 3MKQA 3ZHEB 3GMIA 2PBIA 2QGSA 2R17C 3ML9A 4GB9A 3ZMUB 4H7XA 2XGOA 4NUUA 5A6CA 2NSZA 4HOUA 3RIBA 5FTPA 2HO1A 3O1JA 1EYHA 4UXNB 4L9IA 1WLXA 4TV3A 4QWNB 3MX3A 3QK0A 4ABNA 5LYJE 2OV8A 2HM8A 4JC8A 5E75A 1Z3YA 4KMOA 5BUZA 4I6GA 3HVEA 2HR2A 3D3MA 1BR0A 3UX4A 4AOFA 4O2AE 4UV8B 4HN9A 2KC7A 3PE4A 2EQXA 3TKLB 2YK0A 3V5SA 3L54A 3T8OA 4PUCA 3T5VA 2LSIA 4H9RC 1UN8A 4XKCA 4HOQA 4AY5A 4TX5A 3N9QA 2MRIA 2BVLA 2WQ6A 4D10C 2XAJB 3NRXA 3PUAA 2KZTA 4HE8A 2LSUA 4UQYA 2I1KA 3CVLA 3RYCE 1UJJA 3RRMB 3RYHE 2RA1A 2XPYA 4HFVA 1IQUA 4JEUB 3Q9DA 4DLQA 2C0MA 2GGFA 4UI9K 5D0QD 5AIJA 3AA6B 3FP3A 4BJNA 1HX8A 5JJTA 4GMJA 3AA0B 4AQFA 4CEMA 4H9OC 1PC2A 2D5UA 5LJNA 2BTDA 3IEGA 3RPUA 4UEMA 3B57A 3ASFA 4Q96A 3MK7C 4O4IE 5KX5E 4Y6WA 2WQ7A 4MKTA 4RSYA 4N2QA 2GK9A 4CXYA 2VYIA 5H6QB 3N9OA 2C5JA 5JHBA 4GPKA 2D0UA 3TJPA 3QKYA 2DI4A 3R7QA 3SI5A 5EK3A 4KXKB 3CK9A 2ONDA 4U72A 1Y6IA 2DBAA 4KBQA 1B89A 4OVVA 3EIQC 4WNDA 3AS5A 2ODUA 2HH7A 2VSYA 5FZRA 2I59A 1OXZA 2YEVC 3D9LA 5BW8C 4EAHA 3FXEB 3G2VA 2GRMA 3CVQA 4B94A 2IF4A 4U0UA 3FUMA 4CCAA 5CB4E 3PNTB 4UWKA 3RK6A 4GA1A 4QX7B 3TGOA 4G63A 3SFZA 2WXPA 2Z6EA 3FBLA 1WYBA 3LK3B 1LVFA 2CG2A 3KEZA 3HKEE 3CHRA 4AY6A 4PAGA 3LVQE 2PM6A 3FUKA 2J08A 3NZSA 3ZMVB 3K3NA 3KINB 4YHJA 1IJ6A 2M63A 1HO8A 1OWOA 2CA5A 3U64A 3OYXA 4ZS3A 3LY8A 2VKOA 3U78A 4XKBA 4PH4B 1JPLA 5HYAA 2KATA 4OHFA 4F53A 2J4BA 5FY7A 4GK5E 3KD7A 2XAGB 3ONLA 1HF8A 2A72A 3LFMA 2ZM0A 1FCHA 3O4ZA 3CVPA 2CLYB 3C98A 3LCAA 2IJGX 4APOA 1XGWA 3L17A 4DO0A 4UELA 3BK9A 3N9MA 3J7Yq 4CT0A 1U3CA 4ADZA 1JWFA 1N52A 3CVNA 5FY0A 2WVIA 5TAOA 4HLEA 5ARFA 1ELRA 4JW1A 3OAWA 5CA1E 3IHYA 2XTLA 3B7UX 4JA9A 1IQRA 4GOUA 4P29A 2C2LA 3FH5A 1Z3XA 3FTZA 4PS8A 3TXNA 2G0UA 5JH7E 3MYVA 4J8DA 5LNKA 3FDHA 3D9OA 3SBTB 4PJNA 3FUJA 3FHEA 4GZDA 4B8CB 1E96B 1MNDA 3CR3A 3HR0A 4H63H 1UX5A 4R7LA 2SPCA 1E8ZA 3EIJA 1AJ3A 2EHOC 3DPDA 4U04A 2NTYA 2JJ9A 3HIZA 2DCPA 2YNQA 1LRZA 3WAJA 2KT9A 3LG7A 3QARA 4UIGA 4BTAA 4XI9A 3FY4A 3E08A 2PQNA 4ME2A 5JHAA 3BQIA 5G05C 1H0AA 2VSXE 5CMWA 5LP0A 3ZRHA 1MIVA 2XAFB 5G04J 2N2NA 2NWBA 5BMVE 1EF1C 1PAQA 4NRHB 2RP4A 3K3QC 3C4WA 2FF4A 1H2VC 2AVPA 2LSKA 1FEWA 5JDQA 1ELKA 1ZEEA 5T8IA 1QUUA 4TUYE 5JDGA 4UWGA 5HI7A 4CT4A 4AXPA 4CGWA 3PUKA 2OVFA 3GWHA 3ZN3A 3ZJ2A 4OYKA 1JUQA 3SGHA 4G26A 4FLBA 3NBXX 5KDMC 1D0ZA 2YHCA 4EXTA 2ZU6B 3KVAA 3G2TA 3W15B 1E7VA 2D2SA 2X9HA 5HXSA 4PS7A 4IGUA 4HXIA 1WAO1 3R9AB 5JR9C 4FLHA 3PUQA 5KJNA 4QXBB 3D9MA 1E7UA 2IONA 4KVMA 3RKVA 3S7JA 3TL5A 1IZNB 2QFCA 5JJ7A 1E8YA 4GZCA 3ZMSB 4ANVA 3CHPA 2Q7FA 4G11A 2VJ8A 4P09A 4EECA 1UJKA 3HKDE 3RC3A 1WY6A 4EZHA 3HHMA 3BQLA 3U66A 2LNIA 4AKRB 2HPLA 3N71A 3C50A 4AQGA 3CHMA 3GN5A 5G2NA 4H9QC 1EDUA 3ZEFA 2E8IA 2R59A 4GYWA 3V5UA 3GZ2A 1H2UA 3LDZA 4URKA 1WRDA 4E6HA 4QHOA 2Q9QA 2NOXA 2BZBA 1WYCA 2IOSA 3FH7A 3ZPJA 4H9PC 3RRCA 5E76A 3IEEA 4I1OB 4XI0A 3CK8A 5CCMA 5FQ7A 5ENNA 4E7ZA 3NQPA 2X67A 3MJXA 4UWHA 1S94A 5HXRA 4CDRA 2LE8A 2ZMAA 5EDSA 3QNKA 4YJ2E 1G73A 4IDZA 3L13A 4UF0A 2YU2A 3H37A 4J8FA 2LOSA 5M4YA 3F57A 3C4ZA 2I1JA 1QQEA 3UUXB 3BG1B 1INZA 3QWVA 3PDNA 5ARGA 2XGSA 5LXTE 3AVRA 4ISTA 5CCLA 4O4HE 3ZMZB 4IULA 1TJCA 4P0AA 3ZVVA 3AS4A 2L3LA 3O9XA 2NW9A 2VTBA 4ATGA 3AA1B 5LOVE 4ERRA 4JXTA 2WB2A 1V9DA 4F6RC 5EK2A 3DJBA 4AQFC 2YQ8A 4AEZC 5DABA 3D9IA 4YLHA 3ZYKA 2KXPB 3CWZB 4WWPA 2XHEB 2ES0A 1MNEA 4FC8A 1JWGA 1IYGA 2XRZA 2VSNA 3CX7B 3E0ZA 3LK42 1LKXA 2CWYA 5J1GA 2KNDA 3D9PA 2CHXA 1HCIA 3C64A 5FT9A 2WXFA 2WWUA 1TEZA 2VL8A 1H2TC 3FTUA 3I3NA 2YU1A 2WXGA 4GA2A 4N3AA 2CM0A 3P8CD 3OBVE 2V4LA 4UWLA 4QX8B 2H7VC 1BPOA 4FADA 2X3MA 2PJQA 4I43B 2BUGA 4DBQA 3VTYA 3LBXA 3ZN1B 4DBRA 5ADXL 4DNDA 4EZKA 3HKBE 5EX3A 1LF8A 1EZ3A 4Q69A 3MACA 2WXQA 4EIWA 4HS2A 3C51A 3I4GA 5JVDE 3JUIA 2NW8A 5HQ8A 4GZ6A 5FQ6A 2D0TA 2VASA 3GA8A 1VDYA 5L3BB 4CI1B 3FUNA 5JRCB 2ZM8A 2I2OA 2E9XA 5A23A 2Y3AA 4Z8XA 3CSTA 4CDMA 2L9QA 1D1CA 4NURA 2J4DA 3KS2A 2QY7A 2WPVA 4WBOA 3ZGQA 3FWVA 2R5SA 1NZNA 4M1PA 4DJAA 4QXHB 3ZLIA 4GCNA 1ZV4X 3ZMTB 4YNDA 4N5CA 4JHJA 3LY9A 2EHOD 1ELWA 1WR6A 2H3RA 4LERA 2LSVA 3NF1A 2VGXA 4JEHA 4AP2A 2X9YA 4U63A 5LGUB 2KCKA 2PZIA 3MEKA 1UCUA 3SD5A 4K03A 4DMWA 1VOMA 3Q49B 2AWIA 3QK6A 2CCQA 3LY7A 4KUMB 3UT4A 3LEWA 4UV9B 4KVOA 1SHZC 5FYMA 1EPUA 3N2GE 4ZHQE 4TV9E 2J1DG 1YD8G 5T4YA 3VKHA 3FU3A 2LSJA 2CXFA 2WXMA 3PUJA 2K24A 4L1BA 5IYZE 2WXNA 1OWPA 3SBSA 1YA0A 4AJWA 3L6AA 2HPJA 5LCWC 2MBGA 3Q47B 4GCOA 4EB6E 5C8YE 2MHKA 5FZSA 4HKAA 1D0YA 4FHKA 1MIWA 3G2WA 2X6HA 3LKUA 3SZ7A 4IE5A 1HU3A 3RKOA 5LA6E 1QZ2A 2EHOB 3RRNB 4PS3A 3N2OA 5LP6E 3ANWB 1QSDA 3PZDA 3PUGA 4G1TA 3CEQA 3CK7A 3FEYA 3VLDA 5J2UE 3S4UA 3LPZA 2ZLYA 2BVMA 4J2CA 2YINA 4BA9A 3OTNA 2VQ2A 3KDSE 4QFVA 2AW6A 3K8PC 3B7TA 3CKDA 3Q4AB 3TG4A 4W9RA 1BR2A 5DIZA 2KCVA 3NZQA 3GZ1A 4IHJE 3MA9A 4F3VA 3S7DA 4DK5A 3PH0C 5LOZA 1ZHCA 2IQCA 3QAQA 1OUVA 2NC9A 1IJ5A 4N3BA 4MLKA 5GONE 2X38A 4WNFA 3ENEA 3HI2A 1SZAA 3RU0A 3HKCE 4FHJA 1OWNA 4B6XA 5HWXA 4AM9A 2WAUA 4K0UA 3CSFA 4PJMA 4L2LA 3IKOB 1E8XA 2HYZA 4OYSA 3F2EA 2X6FA 2PG8A 3ZC1A 2L6JA 4N39A 5LG4A 2NXPA 3ASGA 5EZYE 2Y6XA 3ZYLA 4CGVA 2W62A 5JR9B 3I5PA 5A1LA 2X6IA 3P1UA 2WXRA 4C9BB 4KBMB 2UY1B 3ZHEA 4CZZB 2DIWA 3L22A 1S35A 2WXLA 3MV2B 3IF8B 5FXZA 4MLPA 3CHQA 4MBQA 3PE0A 5AYWD 3PREA 4AV7A 3RO2A 4ZI2D 1ZBPA 3R84B 4UI9J 1YW0A 3AB3B 4KZCA 1B7TA 4H7YA 4OFZA 3HL6A 3CVUA 2BF0X 3IV0A 4UVCB 2XCBA 4JHRA 4G25A 5FZQA 3RX6A 3S7FA 1T98A 3ZPOA 1UG3A 1W3BA 1H19A 4J8EA 1FIOA 2GRLA 3L09A 3JQ0A 1OWMA 4IYPA 3MKQB 1BR1A 5LHGB 5LHHB 2V0PA 2Q9QC 5L3CB 4A3TA 3I0QA 3QC9A 4XZCA 3D9JA 4UWFA 4U0ZA 4EBAG 1D1AA 5FXWA 2PQRA 4I2WA 3IBPA 5KCMA 1MMAA 2K5BB 3MGBA 2DNXA 2A4ZA 1LVKA 1CUNA 3BQKA 3E4BA 3MJWA 3O1IA 2WQHA 4JEUA 3VKGA 4A55A 2WXJA 3HVEB 4KMCA 2N1GA 5EX0A 4O6FA 3SF4A 4JL0A 2FO7A 2DHRA 3FTVA 3LXUX 4GMLA 4I1MA 3SOLA 3APFA 4B89A 4WAFA 3JCKC 5CA0E 4O4JE 4PK4A 2Y48B 3IHVA 3Q5WA 2KZTB 3FFLA 3Q2MA 2UXNB 3KV6A 4X1IE 4G24A 3RJVA 4J6IA 5DQWA 4N2SA 2KINB 2XRYA 4IIJE 3CHOA 3UQ3A 1X79A 3LK2B 4BX9A 1ZU2A 3CIAA 5BNWA 1HG5A 3FUEA 3D9NA 3ESKA 4XAXB 4AKLA 4P0BA 4A56A 3MCXA 5LGTB 3CQXC 1E8WA 5FNVE 4XX5A 4ANXA 5BV1A 3PTRB 3KFWX 2CEAA 2UWJG 4MS6A 4CI2B 2XPIA 1H7CA 3P7IA 2W00A 2JEKA 1HH8A 4YVOA 4ASKA 3PDYA 4JA7A 1FMWA 5FXXA 4UVAB 3FH8A 2Q9QD 4LUNU 3ZCJA 1KK7A 3PEVB 2M67A 4JPSA 1HE8A 4I2ZA 2AXZA 4I6JA 4ANWA 3NZUA 2FI7A 4IE7A 3AA7B 2V8SE 1YKHB 1Y8MA 4HTEA 3FTXA 2WSSV 3UT7A 2V7JA 5LHIB 2MTQA 2GW1A 4PDXA 2A2FX 1SZ9A 5KJMA 1E1HB 1MMNA 1FMVA 5J2TE 1MMDA 3B7SA 4GZ3A 3GZSA 1UW4B 4FJYA 4FJZA 3FULA 1MMGA 4HOSA 2KM4A 2RD0A 4E85A 4PJLA 4BFRA 3RH3A 2K9AA 3L3PA 4FI5A 4O4LE 3PE3A 3S2AA 3FB2A 4PFPA 2FBNA 3RO3A 5EK4A 1NA0A 4Y6CA 2CXDA 2IC9A 1S0PA 3N9PA 2MOWA 4ILIA 3CHSA 3P2BA 2LT3A 3ZW3A 4RG6A 2E9XC 3CPZA 4EZ4A 2A5UA 3BG0B 4U07A 4IE4A 2KCLA 2IFUA 3I9WA 2OOEA 3RRUA 3KV4A 1MQSA 4JVSA 4PJJA 1SA0E 1BR4A 5KMGP 1Y64B 3K9IA 2WXIA 3HDXA 4YVQC 3IBEA 3ESLA 1KNZA 5JDFA 4WNEA 3C98B 4BJMA 3L08A 4HVBA 2XPZA 5BV0A 4YFSA 4B0ZA 2NTXA 5LCYA 4O8SA 4PNIA 4EBAA 3N9LA 1P5QA 1US7B 1HS7A 2CFUA 2KZ7B 3Q5XA 2NP9A 4DPRA 2OA5A 4WBNE 4NUVA 3ZN0B 2DWKA 3EVYA 2X6KA 4ACLA 2IW5B 4F7AA 4C91A 2RG8A 3TAXA 4RG9A 3CVWA 4I4TE 4AKHA 3ZIMA 1O3XA 4DVDA 4PFOA 3CVRA 5C2YA 2E0IA 1HZ4A 2IAKA 4LRZA 3APCA 4N78D 4GA0A 3I9YA 3FUIA 3G2UA 4ZI3C 1YKEB 3MA5A 3QC1A 3AS8A 2V7MA 1ZKEA 3AAEB 5EKQD 3CV0A 1KT1A 4CRWA 3FUHA 4A1GA 5FXVA 4I17A 3APDA 4K0RA 2JQQA 3RYFE 5ANLA 3LYAA 3SNXA 1NAFA 3WI3A 3EDVA 1FVFA 4FULA 2AXUA 4A1SA 2OVBA 1NWMX 1X5BA 3CKBA 3QJZA 2Y8DA 4OYJA 4J0UA 3JYSA 2N9DA 3FTYA 3T5XA 2PFVA 2CHWA 3QDNA 2I9CA 3EDTB 3Q15A 4TV8E 5AJDA 5LBMA 3FBZA 2CXLA 3JC6C 3EHMA 4X1KE 3B7RL 2KWIB 3EUHA 4BT9A 2VKDA 3H3AA 2B1EA 3ETUA 4TN7B 3KAEA 3CX8B 5LX8A 3KV5A 4G2VA 3EHNA 3CLJA 4C90A 4X1YE 2Y4TA 4EYYR 5G55A 3QOUA 1UX4A 5IHYA 4TUUA 1PY1A 4HGAA 2X68A 3AU5A 4JHKA 3MKDA 1A17A 2LJLA 2J49A 4I9CA 2NW7A 4J8SA 2LHNA 2LSGA 2PM7A 2LHRA 5LCWJ 2XGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMO A;  2WMN A;  3VHL A;  2WM9 A;  2YIN A;  3B13 A; 
#chains in the Genus database with same CATH topology
 3JQ1 A;  1VRB A;  2IOL A;  2RFA A;  1W0A A;  5FQ4 A;  1DCQ A;  3ZKR A;  4LG6 A;  4L2Y A;  2LSY A;  5KBA A;  4KYO B;  4GTR A;  4M3O A;  3O1H A;  2XEN A;  3S7B A;  3DST A;  5FJY A;  4A63 B;  4I1A A;  3Q79 A;  3AAA B;  2VGY A;  2V7I A;  1BI8 B;  1Z6T A;  3CVY A;  3L9T A;  2CG3 A;  2XEE A;  3AEC A;  3QUJ A;  3I1A A;  1YQ4 A;  1HTJ F;  5F8P A;  2J9Q A;  5KJK A;  5L4H A;  1DNP A;  2WXH A;  3U3W A;  2WM9 A;  5JRE A;  5LGN B;  2AXD S;  4HFH A;  4O2B E;  3PJA J;  4LCT A;  4FA6 A;  2R02 A;  2V5D A;  1OED B;  2PL2 A;  4AXH A;  4EZL A;  2XQA A;  4I9E A;  1XNQ T;  3FTS A;  5JJ6 A;  3DSS A;  5FQ8 A;  3LDQ B;  3ONX A;  5IUX A;  5DJQ C;  5CEA A;  4DX2 A;  2J07 A;  4B8A A;  3GN5 B;  2WU2 A;  1QBQ A;  3CVX A;  3MXZ A;  4ANJ A;  2JMK A;  3DEO A;  3EJN A;  5JQG E;  2BKP A;  3MKR A;  3GW4 A;  5HXC A;  4FP7 A;  4RLY A;  5FY1 A;  1DC2 A;  3ZEF B;  5ANR A;  3VLF A;  5FMN A;  5E0O A;  3UUX A;  4U74 A;  2V5Q C;  4C0E A;  2L8K A;  4BAY B;  1OY3 D;  4HBD A;  2Q9Q B;  4NPP A;  4L7T A;  3URZ A;  3RSE G;  3B95 A;  2P9B A;  1KLX A;  2XQY A;  3MZK B;  4UQX A;  5J08 A;  3CML A;  1OWA A;  5FP3 A;  4U8H A;  3ZYM A;  4A3V A;  2BG9 E;  4DR6 T;  4FU3 A;  3UMV A;  1D1B A;  1XNF A;  3WXX A;  3L16 A;  1TNU A;  2L9B A;  2LOP A;  3C3O A;  2LO6 A;  5CRU A;  3AU4 A;  4ILG A;  4DX1 A;  3CQG B;  3ZXS A;  4UVB B;  2WMO A;  3Q5M A;  2BKO A;  1E90 A;  2WDQ A;  3AEE A;  3R9M A;  4UF0 B;  4JLE A;  3I0O A;  5DQV A;  3HYM B;  3CGH A;  3UPV A;  4WWN A;  2XAS B;  4LEU A;  2C0S A;  2LAH A;  3BU8 A;  2GRQ B;  2KLQ A;  3EDU A;  2F0Y A;  3ASO E;  4LNU D;  3RC8 A;  4L23 A;  4BT8 A;  3ZCI A;  5A7D B;  2XHE A;  2OEV A;  3ASN E;  1A5E A;  3PUX F;  2QA7 A;  1RW2 A;  4CQI A;  4IRE A;  2ILR A;  1QNF A;  2WMN A;  4H9S E;  3MV3 B;  3ETV A;  1SE7 A;  3DBS A;  5LFA A;  4U3C A;  4U2Y A;  5JDL A;  4Z90 A;  3G2S A;  1N54 A;  3EI0 A;  3R6N A;  3PUR A;  4ANU A;  3ZT7 A;  5AAR A;  4DR2 T;  4GZ5 A;  4WNG A;  4F1P A;  4EED A;  2VTB B;  4CZ2 D;  2VK9 A;  2Y4U A;  5C3J A;  4HFC A;  5HAX A;  4L9P A;  2XQ6 A;  3FEX A;  4JZY A;  4DV7 T;  4IE0 A;  4YTM A;  3ZYQ A;  4B3T T;  1I94 T;  1NP7 A;  3R7R A;  2XY8 B;  4XZ4 A;  4ZS2 A;  1MHQ A;  2IU1 A;  2XAH B;  4ISS A;  4NAC A;  3FU0 A;  2FUP A;  4OVU A;  2LM2 A;  1O5M A;  3U9W A;  3UT8 A;  4AVX A;  5FVK A;  2W63 A;  3OPC A;  2CWO A;  4ILC A;  1G8X A;  2AXV A;  4CDN A;  5L3G B;  4GYS A;  4EQF A;  1SQM A;  5G05 J;  5BT1 A;  1IXV A;  4GAA A;  4H9N C;  4DR3 T;  3N5L A;  4KT6 B;  4BTB A;  3AG4 E;  3RRW A;  2LXL A;  3DTO A;  5FWQ A;  4I43 A;  4PK5 A;  2H7O A;  2JPF A;  1TNO A;  2V4H C;  5AQB A;  1OWL A;  1TNB A;  5DBK A;  3PUS A;  1WM5 A;  2EIJ E;  3UU5 A;  4LF6 T;  2JQK A;  2X66 A;  2V7L A;  3VHL A;  4DMV A;  1HS6 A;  5T3R A;  3HXF A;  2E9X D;  4KZ0 A;  3KVB A;  4UI9 C;  4FJO A;  3T8M A;  1FVH A;  3PS6 A;  4Q94 A;  3AEF A;  1KZO A;  4RVB A;  3SWH A;  2FEZ A;  2ZM6 T;  5JRC A;  3SS1 A;  3O4X E;  5JDH A;  5G04 C;  2XQ0 A;  4DLO A;  4HOT A;  3CX6 B;  2KMF A;  3PJA A;  4WNK A;  3ZJ1 A;  4G8K A;  1IBL T;  1U4Q A;  4GU5 A;  3AED A;  4V3I A;  3TLS A;  3OJA A;  2YDR A;  3L8R A;  3LBX B;  4APF A;  2CLY C;  3FUF A;  2WDR A;  2YHE A;  4BWR A;  1YQ3 A;  3I4R B;  3OXG A;  3FHN A;  3N9N A;  4WUY A;  4IRU A;  4U7Y A;  5AJL A;  4JI1 T;  4XIF A;  2BDE A;  3N2K E;  5C1D A;  2L0I A;  4HOR A;  4UUC A;  2P9N G;  4I50 E;  2VKH A;  1TN8 A;  4YDO A;  3ZU7 B;  3A5X A;  2CMR A;  2QYU A;  3GYZ A;  2XAQ B;  4OK0 A;  5ETW A;  3PRZ A;  4XE0 A;  4GK0 E;  1W9R A;  2WCA A;  4JUY A;  3NZP A;  1IHG A;  4ACK A;  4DI4 A;  3CKC A;  3QB2 A;  3PEU B;  1HFA A;  1U3D A;  2L0T B;  3UTK A;  3KEA A;  5AQH B;  2WBL A;  5JDN A;  2Y0B G;  5JDM A;  4K5C A;  2WZH A;  1IAP A;  4NIK A;  4IT4 A;  4MFR A;  3RIU C;  1GW6 A;  3HA4 A;  1H6K A;  1R8I A;  3Q73 A;  3KV9 A;  2BKG A;  2E9X B;  2V5C A;  4K0K T;  1L5J A;  1SUM B;  4DI3 A;  1WR0 A;  1XNR T;  2C5K T;  1KT0 A;  2CE7 A;  4KP3 C;  3UM0 A;  4V1A v;  4G23 A;  2ZGG A;  2C5I T;  4AQY T;  2E2E A;  3T1Y T;  4DR1 T;  2V1D B;  2UXX B;  1MIY A;  2X0Y A;  4CXX A;  3LVR E;  2ETB A;  2ACX A;  4YSX A;  4ZI3 D;  5J90 A;  3TWW A;  3T8K A;  3KBT A;  2W61 A;  2XUE A;  3NVO A;  4HWD A;  3SRZ A;  3CVV A;  3K3O A;  3ASH A;  4GIW A;  3ULQ A;  1Z0P A;  3IHR A;  3UUN A;  2VGX B;  3U4T A;  2I6H A;  4JEH B;  1V55 E;  5CHE E;  3TLV A;  3UT5 E;  2DCF A;  4L5G A;  4EYU A;  3T1H T;  2OCC E;  4MRU A;  3AAI A;  4G2A A;  4I55 E;  2EHO A;  3LJ3 A;  3UQ7 A;  3ZFW A;  5ENR D;  4X20 E;  2IC6 A;  5F5W A;  3FZF B;  5AQA A;  4EOZ B;  2WXO A;  3ANW A;  3M65 A;  4MAL A;  2X51 A;  4PK6 A;  4U0S A;  3TWQ A;  3AVS A;  3OKQ A;  5AQQ B;  1N0Q A;  4HI8 A;  4EZJ A;  1HXI A;  4AKG A;  3ZUV B;  2ODV A;  2GRO B;  3HXD A;  3ML8 A;  2JLB A;  2H89 A;  3OXF A;  1HG2 A;  3RYI E;  2JMH A;  2LEH A;  2R03 A;  4IN3 B;  3FXD B;  3PNL B;  2FUL A;  2X9W A;  4QXC B;  2PNN A;  3CQC B;  5KJL A;  5L2L A;  5CMY A;  5L3D B;  2J09 A;  2LAI A;  3PU8 A;  3DP7 A;  3ZC0 A;  3RLF F;  5F3J A;  4XBF B;  4HFG A;  3FTW A;  3LJC A;  3LS8 A;  1KFY A;  5D0O D;  4BSX A;  3OXL A;  4UQZ A;  3MZL B;  3BEE A;  3FU6 A;  3JC6 D;  2UXB T;  4AKI A;  2XEV A;  5AQL B;  2VKJ A;  2CBJ A;  2MOZ A;  3CIR A;  2XSB A;  4ZI2 C;  1BLX B;  4WW0 A;  2K48 A;  3NRY A;  3E34 A;  4F1S A;  3UUL A;  2V5F A;  5HXH A;  3PU3 A;  4TZ4 C;  5HXE A;  3ASD A;  3VLE A;  4ZOL E;  4ILU A;  4E7S A;  3UM1 A;  2RPA A;  3FUD A;  3OYZ A;  3QWW A;  2XCC A;  3A7M A;  2YOE A;  4BY6 A;  3ONK A;  4N3C A;  3AE8 A;  4JD2 G;  2X0L B;  2WXK A;  3UUM A;  3TXM A;  4C0M A;  2CBI A;  3QWP A;  3TLU A;  3DSX A;  4QKN A;  3AE2 A;  3EHQ A;  4U2Z A;  3FU5 A;  3PUV F;  1TJF A;  3UFE A;  3C4X A;  2BBH A;  2XJ7 A;  4BX8 A;  2LM9 A;  3P4S A;  2QYJ A;  4PW8 A;  4J7W A;  3WAK A;  4I6E A;  3E22 E;  3F31 A;  4AIF A;  1TNZ A;  1S63 A;  5JR9 A;  5L3F B;  2MYS A;  2W0G A;  3RF1 A;  2JRK A;  3Q75 A;  3PZ1 A;  2DZN A;  1N94 A;  3PVL A;  4GYY A;  3VU7 H;  4NQ0 A;  5BPP A;  4YSY A;  2UY1 A;  2VSO E;  5AQK B;  3B13 A;  4LNB A;  3O48 A;  3D9K A;  2VB6 A;  4H63 V;  2X9X A;  3LSV A;  2WP9 A;  4TRQ A;  1O1S A;  2CHZ A;  2P58 C;  3P4Q A;  4ILH B;  1D0X A;  4WWO A;  4EPZ A;  4O1O A;  4I0U A;  2DLR A;  4AI6 A;  4LML A;  1QLB A;  2DWG A;  5LBQ B;  2VWA A;  5HWY A;  4MHC A;  2WU5 A;  3U3I A;  2C0L A;  2A3D A;  2V7K A;  2V26 A;  4CI3 B;  5FVL A;  2ZM2 A;  4ZI7 E;  5AEN A;  4HEA A;  1K1A A;  3KBU A;  3D9H A;  5M72 A;  3DSW A;  4GYO A;  2BG9 C;  1UN9 A;  3Q7F A;  1DVP A;  1U5P A;  5LJM A;  3TG5 A;  4IE6 A;  4YJ3 E;  4DV3 T;  4L0R A;  5JTG A;  4P1N A;  3TLW A;  2H6G A;  3D0T A;  2KWH A;  3J9X 1;  4YHH T;  1G3N B;  2LUH A;  3SHF A;  4GYR A;  4CXW A;  2QRX A;  5L3E B;  5AFU L;  3VTX A;  4DV6 T;  2CFZ A;  5H6R B;  1NA3 A;  2X6J A;  3MKQ A;  3ZHE B;  3GMI A;  2PBI A;  2XSA A;  2QGS A;  2R17 C;  2P9U G;  3ML9 A;  3ZMU B;  1Z8U A;  3L82 A;  2XGO A;  4GB9 A;  4H7X A;  4NUU A;  5A6C A;  4AIS A;  2NSZ A;  4HOU A;  3C72 A;  4IDN A;  3RIB A;  4HWH A;  3V2X A;  1N33 T;  5FTP A;  1UOH A;  2LKH A;  2HO1 A;  3O1J A;  1EYH A;  4UXN B;  2BKN A;  4Z68 A;  4L9I A;  5D2M C;  2OLT A;  1WLX A;  4TV3 A;  1AP7 A;  4U95 D;  4QWN B;  3MX3 A;  4ZXL A;  1W0B A;  3QK0 A;  4ABN A;  5LYJ E;  2OV8 A;  3UU6 A;  3UQ4 A;  2HM8 A;  4JC8 A;  5E75 A;  1Z3Y A;  4KMO A;  5BUZ A;  4I6G A;  1ZP0 A;  2B76 A;  3HVE A;  3K1S A;  3UI2 A;  2ETC A;  2HR2 A;  3D3M A;  1BR0 A;  3UX4 A;  4AOF A;  4DX6 D;  4O2A E;  4UV8 B;  4HN9 A;  1H6O A;  2KC7 A;  3T9K A;  1LTX A;  3PE4 A;  1XZY A;  2EQX A;  3TKL B;  2XQ9 A;  2YK0 A;  3V5S A;  3L54 A;  3T8O A;  4PUC A;  3T5V A;  2LSI A;  5KWD A;  4H9R C;  1UN8 A;  4XKC A;  4YDY A;  4HOQ A;  4CN4 A;  2XZD G;  2B6C A;  4AY5 A;  4TX5 A;  3N9Q A;  2MRI A;  2BVL A;  2BBJ A;  2WQ6 A;  1XMQ T;  4D10 C;  2XAJ B;  2L6B A;  3NRX A;  3PUA A;  2KZT A;  4HE8 A;  2LSU A;  2XS8 A;  4UQY A;  2I1K A;  3Q9N C;  3CVL A;  3RYC E;  4ILA A;  1UJJ A;  5HEJ A;  1N34 T;  3RRM B;  3RYH E;  2RA1 A;  2XPY A;  4HFV A;  4Q25 A;  3AE1 A;  1IQU A;  3SFX A;  4JEU B;  1JCQ A;  2AJA A;  3EU9 A;  4CYM D;  3ISM C;  3TWV A;  3Q9D A;  4DLQ A;  4GTQ A;  4B3S T;  4HNA D;  1I6Z A;  2C0M A;  2GGF A;  4UI9 K;  2KXP C;  5D0Q D;  5AIJ A;  1CHU A;  3AA6 B;  4QH4 A;  3FP3 A;  4BJN A;  1HX8 A;  5JJT A;  4GMJ A;  3AA0 B;  1N4S A;  4AQF A;  4CEM A;  5J0Z A;  4H9O C;  1W09 A;  2JIW A;  1PC2 A;  4HQD A;  2D5U A;  5LJN A;  2BTD A;  3IEG A;  5AQ7 A;  4LMJ A;  4NIQ A;  3RPU A;  4UEM A;  3UM3 A;  4ATZ D;  3B57 A;  3ASF A;  4Q96 A;  1D8D A;  3MK7 C;  4O4I E;  5KX5 E;  3Q5E A;  4JI4 T;  4Y6W A;  2WQ7 A;  1HNW T;  4MKT A;  4RSY A;  4N2Q A;  2GK9 A;  4CXY A;  2VYI A;  5H6Q B;  2MYO A;  3N9O A;  2C5J A;  5JHB A;  4EHM A;  4GPK A;  2R2L A;  4GMR A;  5CER B;  2D0U A;  3TJP A;  3QKY A;  2DI4 A;  1HNX T;  3R7Q A;  3SI5 A;  5EK3 A;  4KXK B;  3CK9 A;  2IO3 C;  2OND A;  4U72 A;  1Y6I A;  4U31 A;  2DBA A;  4KBQ A;  4C48 B;  1B89 A;  4OVV A;  3EIQ C;  4WND A;  3AS5 A;  3B7B A;  5LG3 A;  2ODU A;  4CN6 A;  2HH7 A;  2VSY A;  5FZR A;  2I59 A;  1OXZ A;  2YEV C;  5AQI B;  3A8Y C;  3D9L A;  5BW8 C;  1DCE A;  4EAH A;  4DR7 T;  3FXE B;  3AE6 A;  2GRM A;  3G2V A;  5HEU A;  3CVQ A;  4B94 A;  2IF4 A;  2XZE A;  4U0U A;  3FUM A;  4CCA A;  5CB4 E;  3PNT B;  4UWK A;  3RK6 A;  1AWC B;  4GA1 A;  4QX7 B;  3TGO A;  4G63 A;  3SFZ A;  2WXP A;  2Z6E A;  3FBL A;  3NOG D;  1WYB A;  3LK3 B;  1LVF A;  4EV6 A;  2CG2 A;  3KEZ A;  3HKE E;  3CHR A;  4EEB A;  4AY6 A;  4PAG A;  3LVQ E;  2PM6 A;  3FUK A;  4B93 B;  2FJD A;  4TWF A;  1N36 T;  2J08 A;  3NZS A;  1YXR A;  4DR5 T;  3ZMV B;  3K3N A;  1GQE A;  3KIN B;  4YHJ A;  1IJ6 A;  2M63 A;  1HO8 A;  3DWL G;  5ABE A;  1Y01 A;  1OWO A;  2CA5 A;  3U64 A;  3OYX A;  4ZS3 A;  3LY8 A;  2VKO A;  3U78 A;  4XKB A;  4PH4 B;  5AQF B;  1JPL A;  2YN6 A;  5HYA A;  2KAT A;  4OHF A;  4F53 A;  3QOF A;  2J4B A;  5FY7 A;  4GK5 E;  2FJB A;  3KD7 A;  2XAG B;  3ONL A;  1HF8 A;  2A72 A;  4LF5 T;  3LFM A;  2ZM0 A;  1FCH A;  3O4Z A;  3CVP A;  2UXC T;  3SFD A;  3AG1 E;  2CLY B;  3AE5 A;  3C98 A;  5B3S E;  3LCA A;  2H6I A;  1MX6 A;  2V8S V;  3AE3 A;  2IJG X;  4APO A;  1XGW A;  3G06 A;  4YT0 A;  4LF9 T;  2NR4 A;  3L17 A;  2VQE T;  4DO0 A;  4UEL A;  3BK9 A;  3V2O A;  3N9M A;  3J7Y q;  4CT0 A;  1U3C A;  2IDO B;  3RI5 A;  2BS3 A;  4ADZ A;  5ABF A;  1JWF A;  3V31 A;  1N52 A;  3UU4 A;  4JI8 T;  3CVN A;  5HEO A;  5FY0 A;  2WVI A;  5TAO A;  4HLE A;  5ARF A;  1ELR A;  4JW1 A;  3OAW A;  2BED A;  1YMP A;  4X66 T;  5CA1 E;  2W66 A;  3IHY A;  2XTL A;  3B7U X;  4JA9 A;  1IQR A;  2IIU A;  4GOU A;  4P29 A;  2C2L A;  2NYJ A;  3FH5 A;  1Z3X A;  3FTZ A;  4PS8 A;  3TXN A;  2FJA A;  5HCJ A;  4J8Y A;  2G0U A;  5JH7 E;  3MYV A;  4J8D A;  5LNK A;  4YDW A;  3FDH A;  1JNZ A;  3D9O A;  3SBT B;  4PJN A;  3ZSS A;  2YDQ A;  3FUJ A;  3B5M A;  2IUB A;  3FHE A;  4GZD A;  4B8C B;  1E96 B;  4ZFH A;  1MND A;  3CR3 A;  2QC9 A;  2WB5 A;  3HR0 A;  3FZL B;  5JMN D;  4ILB A;  2B0O E;  4H63 H;  1UX5 A;  3RAU A;  4GKK T;  1OCC E;  4R7L A;  2SPC A;  1E8Z A;  3EIJ A;  1AJ3 A;  2EHO C;  3DPD A;  1KPS B;  4U04 A;  5L4E A;  2NTY A;  1UUR A;  2JJ9 A;  3HIZ A;  2DCP A;  5EYP F;  2YNQ A;  1LRZ A;  3WAJ A;  4A5X A;  2KT9 A;  3LG7 A;  3QAR A;  4UIG A;  4BTA A;  4XI9 A;  1M7K A;  3FY4 A;  2CHN A;  3E08 A;  2PQN A;  3P4P A;  2PTF A;  4ME2 A;  4X65 T;  5JHA A;  3BQI A;  2JQH A;  1FT2 A;  5G05 C;  2JQ9 A;  1H0A A;  5C2T A;  3TLT A;  2VSX E;  5CMW A;  5LP0 A;  1J5W A;  2WS3 A;  1MIV A;  3ZRH A;  2XAF B;  5G04 J;  2QZA A;  5CBN A;  2N2N A;  2NWB A;  4DUY T;  5AQS B;  4LNG A;  1SA5 A;  3PV0 F;  1IBM T;  5BMV E;  4K5B A;  1EF1 C;  1PAQ A;  4NRH B;  2RP4 A;  3K3Q C;  3C4W A;  2FF4 A;  1H2V C;  2AVP A;  5HS0 A;  4DV1 T;  2LSK A;  1FEW A;  4HWF A;  4JV5 T;  1XMO T;  5JDQ A;  5CFB A;  3EHR A;  1ELK A;  1ZEE A;  4IL9 A;  4OAU C;  4JBW F;  5T8I A;  1QUU A;  2HE0 A;  4TUY E;  5JDG A;  3TWR A;  3BQO A;  4UWG A;  5HI7 A;  4CT4 A;  4AXP A;  4CGW A;  3PUK A;  2OVF A;  3GWH A;  2VL0 A;  3ZN3 A;  3ZJ2 A;  4OYK A;  3AXJ A;  1JUQ A;  3SGH A;  4G26 A;  4FLB A;  1O1R A;  3NBX X;  5KDM C;  1D0Z A;  2YHC A;  4EXT A;  2J62 A;  4U8Y D;  2ZU6 B;  2E2A A;  5AQM B;  3KVA A;  2JAB A;  5CRV A;  3G2T A;  3W15 B;  1E7V A;  2D2S A;  2IEJ A;  2X9H A;  3UKU G;  1M62 A;  1X9B A;  5HXS A;  4PS7 A;  1OT8 A;  4IGU A;  4HXI A;  1IKN D;  2H6F A;  1WAO 1;  3R9A B;  4DUZ T;  5JR9 C;  3TWX A;  4FLH A;  5KXJ A;  3PUQ A;  5EN5 D;  5KJN A;  5HRY A;  4TWD A;  4QXB B;  3D9M A;  1E7U A;  2ION A;  4KVM A;  3RKV A;  3S7J A;  2CPT A;  5FL0 A;  2UXD T;  4DX5 D;  4BET A;  3ABM E;  3TL5 A;  4HWI B;  1IZN B;  2W4X A;  2QFC A;  3VRB A;  5ENT D;  5JJ7 A;  1E8Y A;  4GZC A;  4TXP A;  3ZMS B;  4IDQ A;  3M3Z B;  4ANV A;  3CHP A;  2Q7F A;  4G11 A;  2VJ8 A;  5CED B;  4P09 A;  4EEC A;  1UJK A;  3DRA A;  3JAE A;  3HKD E;  4HI9 A;  3RC3 A;  2V6Y B;  1WY6 A;  4EZH A;  5IWA T;  3HHM A;  4HFE A;  3BQL A;  3U66 A;  2LNI A;  4AKR B;  4HRL A;  2HPL A;  3N71 A;  3C50 A;  2BG9 B;  3EU5 A;  4TNW A;  1T7S A;  1UK5 A;  1ZB1 A;  4AQG A;  3CHM A;  2P2C P;  3ABK E;  3GN5 A;  5AAO A;  3NWI A;  2DZO A;  2H88 A;  5G2N A;  4H9Q C;  1EDU A;  5AQ9 A;  2E5V A;  3ZEF A;  2E8I A;  2R59 A;  4GYW A;  3V5U A;  3GZ2 A;  1H2U A;  3LDZ A;  4URK A;  1WRD A;  2I0M A;  4E6H A;  4QHO A;  2LKG A;  2Q9Q A;  3AE7 A;  2ETA A;  4DUI A;  2NOX A;  2BZB A;  1WYC A;  2IOS A;  3FH7 A;  3ZPJ A;  4H9P C;  3RRC A;  3P4W A;  5E76 A;  3IEE A;  4I1O B;  4XI0 A;  2M6I A;  3CK8 A;  5CCM A;  5FQ7 A;  2WDV A;  5ENN A;  4E7Z A;  3NQP A;  1KEY A;  2X67 A;  3MJX A;  4UWH A;  3RKG A;  4KHZ F;  1S94 A;  5HXR A;  1Z5S C;  3H3M A;  4CDR A;  2LE8 A;  2ZMA A;  2F4V T;  4DV4 T;  4ZZC A;  5EDS A;  4QH1 A;  3QNK A;  4YJ2 E;  4MBG A;  1NFI E;  2Y69 E;  1G73 A;  4IDZ A;  3L13 A;  4UF0 A;  2CRB A;  2YU2 A;  3H37 A;  3ZT6 A;  4COF A;  5CJ5 A;  4J8F A;  3HG0 D;  4YSZ A;  4UR9 A;  4GTS A;  2LOS A;  5M4Y A;  2ACZ A;  3F57 A;  3C4Z A;  2I1J A;  3TWS A;  5ENP D;  1S70 B;  1QQE A;  3UUX B;  3BG1 B;  1BI7 B;  1INZ A;  5KNG A;  2DVW A;  3QWV A;  5CBO A;  2KSR A;  2GRP B;  3PDN A;  5ARG A;  4YTP A;  2XGS A;  2V6X A;  3AVR A;  4IST A;  5LXT E;  5CCL A;  3OTO T;  4O4H E;  3ZMZ B;  1J5E T;  4IUL A;  3F6Q A;  1TJC A;  2H6H A;  1OED E;  4P0A A;  3ZVV A;  2IHR 1;  2VUR A;  3AS4 A;  2L3L A;  3QNU A;  1T72 A;  3O9X A;  2NW9 A;  2VTB A;  4DID B;  4ATG A;  1OCO E;  3AA1 B;  2AE9 A;  5LOV E;  4ERR A;  4JXT A;  2WB2 A;  1V9D A;  4F6R C;  2DL1 A;  5EK2 A;  3DJB A;  4AQF C;  2YQ8 A;  1OCR E;  2P9K G;  4AEZ C;  4U7I A;  5DAB A;  3NAW A;  3D9I A;  3DPY A;  4JB8 P;  3FZH B;  4YLH A;  3ZYK A;  1N9A A;  2KXP B;  3CWZ B;  4WWP A;  2XHE B;  2ES0 A;  3C3R A;  3UTM A;  1MNE A;  4FC8 A;  1JWG A;  1IYG A;  4U33 A;  2XRZ A;  2VSN A;  5LMU T;  3DXK G;  3CX7 B;  3E0Z A;  3LK4 2;  3AE4 A;  1LKX A;  3EAB A;  2CWY A;  5J1G A;  2KND A;  3JAD A;  4HB5 A;  3D9P A;  2CHX A;  1HCI A;  3ULY A;  3V79 K;  1BD8 A;  3C64 A;  3UU3 A;  4O1P A;  5FT9 A;  2WXF A;  3Q78 A;  5AQO B;  2WWU A;  3PZ2 A;  1TEZ A;  2VL8 A;  2XPK A;  2M6B A;  1H2T C;  1NEK A;  3FTU A;  3UIP C;  1VCT A;  3I3N A;  2YU1 A;  2WXG A;  4GA2 A;  2IML A;  4IDP A;  4N3A A;  2CM0 A;  3P8C D;  3OBV E;  2V4L A;  4UWL A;  4QX8 B;  2H7V C;  2WY2 A;  4F8H A;  5L47 A;  1BPO A;  4FAD A;  2X3M A;  2LXM A;  2PJQ A;  4I43 B;  2BUG A;  4DBQ A;  3VTY A;  2IY0 C;  1RZ4 A;  3LBX A;  1KF6 A;  3ZN1 B;  4DBR A;  2WQY A;  5ADX L;  4DND A;  4EZK A;  3HKB E;  3UIN C;  4IL4 A;  3C3Q A;  5EX3 A;  5ITZ F;  5BXO A;  2FJE A;  1LF8 A;  1EZ3 A;  2J4G A;  3MAC A;  4Q69 A;  3AEB A;  1IBK T;  4EIW A;  2WXQ A;  2XQ4 A;  2EIM E;  4HS2 A;  3C51 A;  3UFG A;  2CHO A;  4LF7 T;  4HFI A;  3I4G A;  5JVD E;  2GRR B;  3JUI A;  2NW8 A;  5HQ8 A;  4GZ6 A;  5FQ6 A;  2R6G F;  2D0T A;  4NXN T;  2VAS A;  2E5L T;  3GA8 A;  3PUW F;  1VDY A;  5L3B B;  3PUZ F;  4CI1 B;  1HNZ T;  1MX2 A;  1YYH A;  3FUN A;  5JRC B;  1DU2 A;  2ZM8 A;  2I2O A;  3ONL C;  2E9X A;  1XDO A;  5A23 A;  2Y3A A;  4Z8X A;  3TWT A;  3CST A;  4CDM A;  1TNY A;  2L9Q A;  1D1C A;  1TN6 A;  4NUR A;  4ZHB A;  5AQJ B;  3Q7A A;  2QVA A;  2J4D A;  3P4R A;  3KS2 A;  4YTN A;  2QY7 A;  2WPV A;  4WBO A;  3ZGQ A;  3FWV A;  2R5S A;  1OXJ A;  4B3R T;  1NZN A;  4M1P A;  4DJA A;  5JA4 D;  3JCF A;  4JYA T;  2ZIS A;  4QXH B;  3ZLI A;  4GCN A;  4HRM B;  1ZV4 X;  3ZMT B;  1K1B A;  4YND A;  4OAV B;  3PZ4 A;  4N5C A;  4JHJ A;  3LY9 A;  2EHO D;  2P9L G;  1ELW A;  1WR6 A;  2H3R A;  5CEC B;  4LER A;  2LSV A;  1N95 A;  3NF1 A;  2VGX A;  4JEH A;  4HRN A;  3JXI A;  4AP2 A;  4DV5 T;  1N4P A;  2X9Y A;  3ZST A;  4U63 A;  4BEP A;  5LGU B;  3SFY A;  3C5R A;  4GTM A;  2KCK A;  2PZI A;  3MEK A;  1UCU A;  2MAW A;  3SD5 A;  1D8E A;  4K03 A;  4X5T A;  4DMW A;  1VOM A;  3Q49 B;  3PUY F;  4JI7 T;  3QK6 A;  2AWI A;  2CCQ A;  2F8Y A;  3LY7 A;  4KUM B;  3UT4 A;  3LEW A;  4U7E B;  4UV9 B;  3X2Q E;  3DSU A;  3J5P A;  4KVO A;  2XM2 A;  1SHZ C;  5FYM A;  1EPU A;  3N2G E;  4ZHQ E;  5LMN T;  4TV9 E;  5EYL A;  2J1D G;  1YD8 G;  1UGO A;  3VKH A;  5T4Y A;  1BU9 A;  3FU3 A;  3UM2 A;  2LSJ A;  2CXF A;  2WXM A;  3PUJ A;  2K24 A;  4L1B A;  5IYZ E;  2WXN A;  3WG7 E;  1OWP A;  3FZK B;  3SBS A;  1YA0 A;  3DXM G;  2J47 A;  4AJW A;  3L6A A;  2HPJ A;  3JXJ A;  5LCW C;  2MBG A;  3E30 A;  3Q47 B;  4GCO A;  4EB6 E;  5C8Y E;  2MHK A;  2W2U A;  4HKA A;  1D0Y A;  4X64 T;  2HN2 A;  5AN8 A;  5FZS A;  4FHK A;  1MIW A;  3G2W A;  2X6H A;  3LKU A;  2HHH T;  2KBX A;  3SZ7 A;  4HFD A;  1XWM A;  4IE5 A;  4NXM T;  1HU3 A;  2XZT G;  3RKO A;  5LA6 E;  5ABG A;  2EHO B;  1QZ2 A;  4PS3 A;  3RRN B;  4RQI A;  5ENS D;  1SA4 A;  3N2O A;  5AQR B;  2BS4 A;  5LP6 E;  3ANW B;  1QSD A;  4N5Q A;  5ENQ D;  4LF8 T;  3PUG A;  3PZD A;  1N4Q A;  3CEQ A;  4LFA T;  4G1T A;  1J1J A;  2RFM A;  3CK7 A;  3FEY A;  1WCR A;  3VLD A;  5J2U E;  3S4U A;  3LPZ A;  4ZEY A;  2ZLY A;  2BVM A;  4J2C A;  5ENO D;  3J5Q B;  2XS1 A;  2YIN A;  4LF4 T;  4BA9 A;  1WFD A;  3OTN A;  1KNR A;  2Y1L E;  2VQ2 A;  3KDS E;  4QFV A;  3TWU A;  2AW6 A;  4JI2 T;  3K8P C;  3B7T A;  3CKD A;  5KNH D;  2WWV A;  3Q4A B;  3TG4 A;  4W9R A;  1L0V A;  1BR2 A;  4BER A;  5DIZ A;  2KCV A;  3NZQ A;  4LSZ E;  3HXC A;  3GZ1 A;  5BR8 T;  4IHJ E;  3MA9 A;  1MX4 A;  4F3V A;  3S7D A;  4HFB A;  2UUA T;  3Q5D A;  3IA3 A;  1TN7 A;  3AG2 E;  4DK5 A;  5HEH A;  4WZX A;  2R05 A;  3PH0 C;  5LOZ A;  1ZHC A;  2IQC A;  3QAQ A;  1OUV A;  5AQU B;  2NC9 A;  1IJ5 A;  4N3B A;  5HCM A;  4MLK A;  5GON E;  2X38 A;  4WNF A;  2K3W A;  3ENE A;  3HI2 A;  4LFB T;  1SZA A;  1D9S A;  3RU0 A;  3HKC E;  4FHJ A;  5AQG B;  3NOC D;  4LFC T;  1OWN A;  3JUE A;  4B6X A;  5HWX A;  4AM9 A;  2WAU A;  4K0U A;  3CSF A;  4PJM A;  4L2L A;  3IKO B;  1E8X A;  2GRN B;  2HYZ A;  2VGE A;  3ONJ A;  4OYS A;  1OCZ E;  3F2E A;  2X6F A;  2PG8 A;  3ZC1 A;  2L6J A;  4N39 A;  5LG4 A;  2NXP A;  3ASG A;  5EZY E;  4KI0 F;  4IDO A;  2EIK E;  2Y6X A;  3ZYL A;  4CGV A;  2W62 A;  5JR9 B;  4OX9 T;  3I5P A;  2YKS A;  5A1L A;  2X6I A;  3P1U A;  3QB5 A;  2WXR A;  4DR4 T;  4C9B B;  1S64 A;  4KBM B;  2UY1 B;  4XEI G;  4JI3 T;  2FBW A;  3ZHE A;  4CZZ B;  4YDE A;  2DIW A;  3L22 A;  1S35 A;  2WXL A;  3MV2 B;  3IF8 B;  5FXZ A;  4MLP A;  3CHQ A;  3AAA C;  3AG3 E;  1K8K G;  4MBQ A;  3ULE G;  3VR9 A;  3W9G A;  3PE0 A;  2XGM A;  3SQV A;  3HXE A;  5AYW D;  3PRE A;  4AV7 A;  3RO2 A;  5EIB E;  4ZI2 D;  2F37 A;  2J8S D;  1ZBP A;  4TXR A;  3SY2 A;  4JI0 T;  3R84 B;  4KHP T;  4WYV A;  4UI9 J;  1YW0 A;  3AB3 B;  4KZC A;  3E32 A;  1B7T A;  1OED C;  4H7Y A;  4OFZ A;  3AE9 A;  3HL6 A;  3CVU A;  1FPP A;  2BF0 X;  3IV0 A;  4UVC B;  2XCB A;  4GTT A;  4JHR A;  4G25 A;  5FZQ A;  3L39 A;  3RX6 A;  2HN1 A;  3S7F A;  1T98 A;  3ZPO A;  1UG3 A;  1W3B A;  1H19 A;  4J8E A;  3NKZ A;  1FIO A;  2GRL A;  5EIL A;  1MYO A;  4YXD A;  4GTV A;  3L09 A;  2P9S G;  3JQ0 A;  1OWM A;  4IYP A;  3MKQ B;  1O1T A;  5B1A E;  1BR1 A;  5LHG B;  5LHH B;  4K5A B;  2V0P A;  2Q9Q C;  5L3C B;  4A3T A;  3I0Q A;  3QC9 A;  4XZC A;  3D9J A;  4JI6 T;  4UWF A;  4U0Z A;  4EBA G;  1D1A A;  1JCS A;  5FXW A;  2PQR A;  4I2W A;  3IBP A;  5KCM A;  2W67 A;  1MMA A;  2K5B B;  3MGB A;  2DNX A;  2A4Z A;  1LVK A;  1CUN A;  3BQK A;  3E4B A;  3KSL A;  4X8Q A;  3MJW A;  3O1I A;  4F6R D;  4GTO A;  3ZT5 A;  2WQH A;  1T8B A;  4JEU A;  2X0H A;  3VKG A;  4A55 A;  2WXJ A;  3HVE B;  4KMC A;  1NL4 A;  3Q9U C;  2LLY A;  2N1G A;  5EX0 A;  4O6F A;  2A5E A;  3SF4 A;  4JL0 A;  2FO7 A;  2DHR A;  4YY3 T;  3FTV A;  1WG0 A;  2XQ7 A;  3LXU X;  3IXE A;  4GML A;  4I1M A;  3SOL A;  3APF A;  2XQ8 A;  4B89 A;  4WAF A;  3JCK C;  5CA0 E;  4O4J E;  4PK4 A;  2Y48 B;  3IHV A;  3Q5W A;  2KZT B;  3FFL A;  3Q2M A;  5HEG A;  2UXN B;  3KV6 A;  2OV9 A;  4X1I E;  4G24 A;  3RJV A;  4J6I A;  4DV0 T;  5DQW A;  4N2S A;  2KIN B;  2XM1 A;  2XRY A;  4IIJ E;  3W9F A;  3OVU A;  3CHO A;  3UQ3 A;  1X79 A;  3LK2 B;  4BX9 A;  3VRA A;  1ZU2 A;  3CIA A;  5BNW A;  1HG5 A;  3X1D A;  3FUE A;  2XQ3 A;  3D9N A;  3ESK A;  4XAX B;  4AKL A;  4P0B A;  4A56 A;  5FL1 A;  3MCX A;  5LGT B;  3CQX C;  1MZC A;  1KZP A;  1E8W A;  5FNV E;  4XX5 A;  4ANX A;  5BV1 A;  3PTR B;  3KFW X;  2CEA A;  2UWJ G;  4MS6 A;  4CI2 B;  4LMK A;  2XPI A;  1H7C A;  1OED A;  3P7I A;  2W00 A;  3RGL A;  4TNV A;  5D66 A;  2JEK A;  3EAM A;  1HH8 A;  4YVO A;  4ASK A;  3PDY A;  4JA7 A;  4GKJ T;  1FMW A;  5FXX A;  3V30 A;  4UVA B;  2DWZ A;  3FH8 A;  1V54 E;  1JCR A;  4LUN U;  5HKP A;  3ZCJ A;  1KK7 A;  3PEV B;  2M67 A;  2QYW A;  4JPS A;  1HE8 A;  4I2Z A;  1NEN A;  2AXZ A;  3DSV A;  3RQU A;  4I6J A;  4ANW A;  4DX7 D;  2IO2 C;  3NZU A;  2FI7 A;  4IE7 A;  3AA7 B;  2V8S E;  3BUA A;  1YKH B;  1Y8M A;  4HTE A;  3FTX A;  2WSS V;  3UT7 A;  2V7J A;  4AIU A;  5LHI B;  2MTQ A;  1U2V G;  2GW1 A;  4PDX A;  4GPM A;  1H6P A;  3PZ3 A;  2A2F X;  1SZ9 A;  5KJM A;  1E1H B;  1MMN A;  1FMV A;  1N32 T;  5J2T E;  1MMD A;  3B7S A;  4CN1 A;  4GZ3 A;  1ZOY A;  3GZS A;  1UW4 B;  4FJY A;  4FJZ A;  4A98 A;  3FUL A;  1MMG A;  3EHZ A;  3JAF A;  5AQN B;  2KM4 A;  4HOS A;  2RD0 A;  4E85 A;  4PJL A;  3HRA A;  4BFR A;  3RH3 A;  2D9D A;  2K9A A;  3SFE A;  3L3P A;  4FI5 A;  4O4L E;  3PE3 A;  3S2A A;  3FB2 A;  4KX6 A;  4PFP A;  2FBN A;  3RO3 A;  5EK4 A;  1NA0 A;  2UU9 T;  4Y6C A;  3QB5 K;  2CXD A;  2IC9 A;  1KNP A;  1S0P A;  5AQP B;  3N9P A;  1VCS A;  1Q2Z A;  2P9P G;  2MOW A;  4ILI A;  1SW6 A;  3CHS A;  1X81 A;  3RIF A;  3ZKJ A;  3P2B A;  2LT3 A;  3ZW3 A;  5EID A;  4BSZ B;  1HR0 T;  2ZXW E;  4RG6 A;  2E9X C;  3CPZ A;  4EZ4 A;  2A5U A;  3BG0 B;  4U07 A;  3HXB A;  4TUM A;  4IE4 A;  3NB2 A;  2KCL A;  4ZZB A;  2IFU A;  3I9W A;  2OOE A;  3RRU A;  3KV4 A;  3LJN A;  1MQS A;  4JVS A;  4PJJ A;  1JNR A;  1SA0 E;  1BR4 A;  3ZXP A;  3RIU A;  5KMG P;  1Y64 B;  4X62 T;  4U8V D;  3K9I A;  2WXI A;  5B1B E;  3HDX A;  5FIN A;  3AJI A;  4YVQ C;  3IBE A;  4B3M T;  3ESL A;  1KNZ A;  5JDF A;  4WNE A;  3RQW A;  3C98 B;  1IHB A;  4BJM A;  4Z91 A;  3L08 A;  3RIA A;  4HVB A;  4A97 A;  2XPZ A;  5BV0 A;  4YFS A;  4B0Z A;  3VR8 A;  2NTX A;  5LCY A;  2LRL A;  2RKK A;  4O8S A;  4PNI A;  4EBA A;  5ABF B;  4TXQ A;  4GTP A;  3N9L A;  1P5Q A;  1US7 B;  1HS7 A;  2CFU A;  2OEW A;  2KZ7 B;  3Q5X A;  2NP9 A;  2ZGD A;  4DPR A;  2OA5 A;  4WBN E;  4NUV A;  3ZN0 B;  2DWK A;  3EVY A;  1QYM A;  2X6K A;  4ACL A;  4BES A;  3EUV A;  2IW5 B;  2LRK A;  1N0R A;  4F7A A;  3AEG A;  3E37 A;  4C91 A;  2RG8 A;  3TAX A;  4RG9 A;  3CVW A;  4TWH A;  3UUB A;  4I4T E;  4HLL A;  3UKR G;  4AKH A;  1LD7 A;  3ZIM A;  1O3X A;  4DVD A;  4PFO A;  3CVR A;  5C2Y A;  2E0I A;  1HZ4 A;  2IAK A;  5CGM A;  4G8L A;  4QH5 A;  3ZNG A;  4LRZ A;  3APC A;  4N78 D;  4GA0 A;  3I9Y A;  3FUI A;  3G2U A;  2A9U A;  1YKE B;  4ZI3 C;  2FO1 E;  3MA5 A;  3QC1 A;  3AS8 A;  5BXU A;  1HX1 B;  2V7M A;  2EIN E;  1ZKE A;  3AAE B;  1FT1 A;  3ABV A;  5ABH A;  1YCS B;  5H7P A;  5EKQ D;  2WZI A;  3CV0 A;  5IY5 E;  1KT1 A;  5FIO A;  4CRW A;  3FUH A;  4A1G A;  5FXV A;  4I17 A;  3APD A;  4M7C A;  4K0R A;  2JQQ A;  3CK6 A;  3RYF E;  4O60 A;  4QQI A;  5ANL A;  3LYA A;  3SNX A;  1NAF A;  1FJG T;  3WI3 A;  3EDV A;  1FVF A;  4FUL A;  2AXU A;  1N11 A;  4A1S A;  2OVB A;  1NWM X;  1X5B A;  2XEH A;  4EGW A;  2BKK B;  3CKB A;  1K3Z D;  2VVN A;  2EIL E;  3RHW A;  3QJZ A;  2Y8D A;  4OYJ A;  4J0U A;  5AQV B;  3JYS A;  2N9D A;  2DYR E;  1LD8 A;  5LB7 B;  3FTY A;  1MJ0 A;  3T5X A;  2PFV A;  1TR4 A;  1WDY A;  2CHW A;  3QDN A;  2I9C A;  3EDT B;  3Q15 A;  4TV8 E;  2XQ5 A;  5LBM A;  3UU8 A;  5AJD A;  1TYQ G;  1UUS A;  2F8X K;  3FBZ A;  2CXL A;  3SO8 A;  3AEA A;  4HWC A;  3JC6 C;  4DV2 T;  3EHM A;  3P50 A;  4X1K E;  3B7R L;  4DRX E;  3AXJ B;  2KWI B;  3EUH A;  2P9I G;  4BT9 A;  1NI1 A;  2VKD A;  3H3A A;  2B1E A;  3ETU A;  4TN7 B;  3KAE A;  3CX8 B;  5LX8 A;  3KV5 A;  4G2V A;  3EHN A;  3CLJ A;  4C90 A;  4X1Y E;  2Y4T A;  1E7P A;  4EYY R;  2VQF T;  3FZM B;  4JI5 T;  5G55 A;  5FKY A;  2ZIR A;  1E2A A;  2YDS A;  3NBN B;  3QOU A;  3E33 A;  2UUC T;  1UX4 A;  5IHY A;  3UIO C;  3UXG A;  4TUU A;  2V6Y A;  1PY1 A;  4HGA A;  2X68 A;  1N4R A;  3AU5 A;  2UUB T;  4JHK A;  1XDP A;  3MKD A;  1A17 A;  3KSQ A;  2LJL A;  5AQT B;  2BG9 A;  2J49 A;  2BS2 A;  4I9C A;  3ABL E;  2NW7 A;  4J8S A;  3DEP A;  2MPK A;  2LHN A;  1SVX A;  2LSG A;  4U96 D;  2PM7 A;  2LHR A;  5LCW J;  2DYS E;  2VVS A;  2Q9Q D; 
#chains in the Genus database with same CATH homology
 3JQ1 A;  1VRB A;  2IOL A;  5FQ4 A;  4L2Y A;  2LSY A;  4KYO B;  4M3O A;  3O1H A;  3S7B A;  5FJY A;  4I1A A;  3AAA B;  2VGY A;  2V7I A;  1Z6T A;  3CVY A;  2CG3 A;  3QUJ A;  3I1A A;  5F8P A;  1HTJ F;  2J9Q A;  5KJK A;  1DNP A;  2WXH A;  3U3W A;  2WM9 A;  5JRE A;  5LGN B;  4O2B E;  4LCT A;  4FA6 A;  2PL2 A;  4AXH A;  4EZL A;  4I9E A;  3FTS A;  5JJ6 A;  5FQ8 A;  3ONX A;  5DJQ C;  2J07 A;  4B8A A;  3GN5 B;  3CVX A;  3MXZ A;  4ANJ A;  2JMK A;  3EJN A;  5JQG E;  3MKR A;  3GW4 A;  5HXC A;  4FP7 A;  5FY1 A;  3ZEF B;  5ANR A;  3VLF A;  5FMN A;  5E0O A;  3UUX A;  4U74 A;  4C0E A;  2L8K A;  4BAY B;  2Q9Q B;  4L7T A;  3URZ A;  2P9B A;  1KLX A;  2XQY A;  3MZK B;  4UQX A;  5J08 A;  3CML A;  1OWA A;  5FP3 A;  4U8H A;  3ZYM A;  4A3V A;  4FU3 A;  3UMV A;  1D1B A;  1XNF A;  3WXX A;  3L16 A;  2L9B A;  2LOP A;  2LO6 A;  3AU4 A;  4ILG A;  3CQG B;  3ZXS A;  4UVB B;  2WMO A;  3Q5M A;  1E90 A;  4UF0 B;  4JLE A;  3I0O A;  5DQV A;  3HYM B;  3CGH A;  3UPV A;  4WWN A;  2XAS B;  4LEU A;  2C0S A;  2LAH A;  2KLQ A;  3EDU A;  3RC8 A;  4L23 A;  4BT8 A;  3ZCI A;  5A7D B;  2XHE A;  2QA7 A;  4CQI A;  2ILR A;  1QNF A;  2WMN A;  4H9S E;  3MV3 B;  3ETV A;  3DBS A;  5LFA A;  5JDL A;  3G2S A;  1N54 A;  3R6N A;  3PUR A;  4ANU A;  4GZ5 A;  4WNG A;  2VTB B;  2VK9 A;  2Y4U A;  5HAX A;  3FEX A;  4JZY A;  4IE0 A;  3ZYQ A;  1NP7 A;  3R7R A;  4XZ4 A;  4ZS2 A;  1MHQ A;  2IU1 A;  2XAH B;  4ISS A;  4NAC A;  3FU0 A;  4OVU A;  3U9W A;  3UT8 A;  4AVX A;  2W63 A;  2CWO A;  1G8X A;  2AXV A;  4CDN A;  5L3G B;  4GYS A;  4EQF A;  1SQM A;  5G05 J;  5BT1 A;  4GAA A;  4H9N C;  3N5L A;  4KT6 B;  4BTB A;  5FWQ A;  3RRW A;  3DTO A;  4I43 A;  4PK5 A;  2H7O A;  2JPF A;  1OWL A;  5DBK A;  3PUS A;  1WM5 A;  2X66 A;  2V7L A;  3VHL A;  4DMV A;  1HS6 A;  5T3R A;  2E9X D;  4KZ0 A;  3KVB A;  4UI9 C;  4FJO A;  3T8M A;  1FVH A;  3PS6 A;  4Q94 A;  4RVB A;  3SWH A;  2FEZ A;  5JRC A;  3SS1 A;  3O4X E;  5JDH A;  5G04 C;  2XQ0 A;  4DLO A;  4HOT A;  3CX6 B;  2KMF A;  4WNK A;  3ZJ1 A;  1U4Q A;  4GU5 A;  4V3I A;  3OJA A;  3LBX B;  4APF A;  2CLY C;  3FUF A;  2YHE A;  4BWR A;  3I4R B;  3OXG A;  3FHN A;  3N9N A;  4WUY A;  4IRU A;  5AJL A;  4XIF A;  2BDE A;  3N2K E;  5C1D A;  2L0I A;  4HOR A;  4I50 E;  2VKH A;  3A5X A;  2CMR A;  3GYZ A;  2XAQ B;  4OK0 A;  5ETW A;  3PRZ A;  4XE0 A;  4GK0 E;  4JUY A;  3NZP A;  1IHG A;  4ACK A;  4DI4 A;  3CKC A;  3QB2 A;  3PEU B;  1HFA A;  1U3D A;  2L0T B;  3UTK A;  2WBL A;  5JDN A;  5JDM A;  1IAP A;  4MFR A;  1GW6 A;  3HA4 A;  1H6K A;  3KV9 A;  2E9X B;  1L5J A;  4DI3 A;  2C5K T;  1KT0 A;  2CE7 A;  4KP3 C;  4V1A v;  4G23 A;  2C5I T;  2E2E A;  2V1D B;  2UXX B;  1MIY A;  4CXX A;  3LVR E;  2ACX A;  4ZI3 D;  5J90 A;  3KBT A;  2W61 A;  2XUE A;  3SRZ A;  3CVV A;  3K3O A;  3ASH A;  4GIW A;  3ULQ A;  1Z0P A;  3IHR A;  3UUN A;  2VGX B;  3U4T A;  2I6H A;  4JEH B;  5CHE E;  3UT5 E;  2DCF A;  4L5G A;  4EYU A;  4MRU A;  3AAI A;  4G2A A;  4I55 E;  2EHO A;  3LJ3 A;  3ZFW A;  4X20 E;  2IC6 A;  4EOZ B;  2WXO A;  3ANW A;  3M65 A;  4MAL A;  2X51 A;  4PK6 A;  4U0S A;  3AVS A;  3OKQ A;  4EZJ A;  1HXI A;  4AKG A;  2ODV A;  3ML8 A;  2JLB A;  3OXF A;  1HG2 A;  3RYI E;  2JMH A;  2LEH A;  4IN3 B;  3FXD B;  3PNL B;  2FUL A;  2X9W A;  4QXC B;  3CQC B;  5KJL A;  5L2L A;  5CMY A;  5L3D B;  2J09 A;  2LAI A;  3PU8 A;  3DP7 A;  3ZC0 A;  5F3J A;  4XBF B;  4HFG A;  3FTW A;  3LJC A;  3LS8 A;  4BSX A;  5D0O D;  3OXL A;  4UQZ A;  3MZL B;  3BEE A;  3FU6 A;  3JC6 D;  4AKI A;  2XEV A;  2VKJ A;  2MOZ A;  4ZI2 C;  4WW0 A;  2K48 A;  3NRY A;  4F1S A;  3UUL A;  2V5F A;  5HXH A;  3PU3 A;  4TZ4 C;  5HXE A;  3ASD A;  3VLE A;  4ZOL E;  4ILU A;  4E7S A;  3FUD A;  3OYZ A;  3QWW A;  2XCC A;  4BY6 A;  3ONK A;  4N3C A;  2X0L B;  2WXK A;  3UUM A;  3TXM A;  4C0M A;  3QWP A;  4QKN A;  3FU5 A;  1TJF A;  3C4X A;  3UFE A;  4BX8 A;  2LM9 A;  4PW8 A;  3WAK A;  4I6E A;  3E22 E;  3F31 A;  4AIF A;  5JR9 A;  5L3F B;  2MYS A;  2W0G A;  2JRK A;  3PVL A;  4GYY A;  3VU7 H;  4NQ0 A;  5BPP A;  2UY1 A;  2VSO E;  3B13 A;  3O48 A;  3D9K A;  2VB6 A;  4H63 V;  2X9X A;  4TRQ A;  2CHZ A;  2P58 C;  4ILH B;  4WWO A;  1D0X A;  4EPZ A;  2DLR A;  4AI6 A;  2DWG A;  5LBQ B;  2VWA A;  5HWY A;  4MHC A;  3U3I A;  2C0L A;  2A3D A;  2V7K A;  2V26 A;  4CI3 B;  2ZM2 A;  4ZI7 E;  5AEN A;  4HEA A;  5M72 A;  3KBU A;  4GYO A;  1UN9 A;  1DVP A;  1U5P A;  5LJM A;  3TG5 A;  4IE6 A;  4YJ3 E;  4L0R A;  3D0T A;  2KWH A;  3J9X 1;  3SHF A;  4GYR A;  4CXW A;  5L3E B;  5AFU L;  3VTX A;  2CFZ A;  5H6R B;  1NA3 A;  2X6J A;  3MKQ A;  3ZHE B;  3GMI A;  2PBI A;  2QGS A;  2R17 C;  3ML9 A;  4GB9 A;  3ZMU B;  4H7X A;  2XGO A;  4NUU A;  5A6C A;  2NSZ A;  4HOU A;  3RIB A;  5FTP A;  2HO1 A;  3O1J A;  1EYH A;  4UXN B;  4L9I A;  1WLX A;  4TV3 A;  4QWN B;  3MX3 A;  3QK0 A;  4ABN A;  5LYJ E;  2OV8 A;  2HM8 A;  4JC8 A;  5E75 A;  1Z3Y A;  4KMO A;  5BUZ A;  4I6G A;  3HVE A;  2HR2 A;  3D3M A;  1BR0 A;  3UX4 A;  4AOF A;  4O2A E;  4UV8 B;  4HN9 A;  2KC7 A;  3PE4 A;  2EQX A;  3TKL B;  2YK0 A;  3V5S A;  3L54 A;  3T8O A;  4PUC A;  3T5V A;  2LSI A;  4H9R C;  1UN8 A;  4XKC A;  4HOQ A;  4AY5 A;  4TX5 A;  3N9Q A;  2MRI A;  2BVL A;  2WQ6 A;  4D10 C;  2XAJ B;  3NRX A;  3PUA A;  2KZT A;  4HE8 A;  2LSU A;  4UQY A;  2I1K A;  3CVL A;  3RYC E;  1UJJ A;  3RRM B;  3RYH E;  2RA1 A;  2XPY A;  4HFV A;  1IQU A;  4JEU B;  3Q9D A;  4DLQ A;  2C0M A;  2GGF A;  4UI9 K;  5D0Q D;  5AIJ A;  3AA6 B;  3FP3 A;  4BJN A;  1HX8 A;  5JJT A;  4GMJ A;  3AA0 B;  4AQF A;  4CEM A;  4H9O C;  1PC2 A;  2D5U A;  5LJN A;  2BTD A;  3IEG A;  3RPU A;  4UEM A;  3B57 A;  3ASF A;  4Q96 A;  3MK7 C;  4O4I E;  5KX5 E;  4Y6W A;  2WQ7 A;  4MKT A;  4RSY A;  4N2Q A;  2GK9 A;  4CXY A;  2VYI A;  5H6Q B;  3N9O A;  2C5J A;  5JHB A;  4GPK A;  2D0U A;  3TJP A;  3QKY A;  2DI4 A;  3R7Q A;  3SI5 A;  5EK3 A;  4KXK B;  3CK9 A;  2OND A;  4U72 A;  1Y6I A;  2DBA A;  4KBQ A;  1B89 A;  4OVV A;  3EIQ C;  4WND A;  3AS5 A;  2ODU A;  2HH7 A;  2VSY A;  5FZR A;  2I59 A;  1OXZ A;  2YEV C;  3D9L A;  5BW8 C;  4EAH A;  3FXE B;  3G2V A;  2GRM A;  3CVQ A;  4B94 A;  2IF4 A;  4U0U A;  3FUM A;  4CCA A;  5CB4 E;  3PNT B;  4UWK A;  3RK6 A;  4GA1 A;  4QX7 B;  3TGO A;  4G63 A;  3SFZ A;  2WXP A;  2Z6E A;  3FBL A;  1WYB A;  3LK3 B;  1LVF A;  2CG2 A;  3KEZ A;  3HKE E;  3CHR A;  4AY6 A;  4PAG A;  3LVQ E;  2PM6 A;  3FUK A;  2J08 A;  3NZS A;  3ZMV B;  3K3N A;  3KIN B;  4YHJ A;  1IJ6 A;  2M63 A;  1HO8 A;  1OWO A;  2CA5 A;  3U64 A;  3OYX A;  4ZS3 A;  3LY8 A;  2VKO A;  3U78 A;  4XKB A;  4PH4 B;  1JPL A;  5HYA A;  2KAT A;  4OHF A;  4F53 A;  2J4B A;  5FY7 A;  4GK5 E;  3KD7 A;  2XAG B;  3ONL A;  1HF8 A;  2A72 A;  3LFM A;  2ZM0 A;  1FCH A;  3O4Z A;  3CVP A;  2CLY B;  3C98 A;  3LCA A;  2IJG X;  4APO A;  1XGW A;  3L17 A;  4DO0 A;  4UEL A;  3BK9 A;  3N9M A;  3J7Y q;  4CT0 A;  1U3C A;  4ADZ A;  1JWF A;  1N52 A;  3CVN A;  5FY0 A;  2WVI A;  5TAO A;  4HLE A;  5ARF A;  1ELR A;  4JW1 A;  3OAW A;  5CA1 E;  3IHY A;  2XTL A;  3B7U X;  4JA9 A;  1IQR A;  4GOU A;  4P29 A;  2C2L A;  3FH5 A;  1Z3X A;  3FTZ A;  4PS8 A;  3TXN A;  2G0U A;  5JH7 E;  3MYV A;  4J8D A;  5LNK A;  3FDH A;  3D9O A;  3SBT B;  4PJN A;  3FUJ A;  3FHE A;  4GZD A;  4B8C B;  1E96 B;  1MND A;  3CR3 A;  3HR0 A;  4H63 H;  1UX5 A;  4R7L A;  2SPC A;  1E8Z A;  3EIJ A;  1AJ3 A;  2EHO C;  3DPD A;  4U04 A;  2NTY A;  2JJ9 A;  3HIZ A;  2DCP A;  2YNQ A;  1LRZ A;  3WAJ A;  2KT9 A;  3LG7 A;  3QAR A;  4UIG A;  4BTA A;  4XI9 A;  3FY4 A;  3E08 A;  2PQN A;  4ME2 A;  5JHA A;  3BQI A;  5G05 C;  1H0A A;  2VSX E;  5CMW A;  5LP0 A;  3ZRH A;  1MIV A;  2XAF B;  5G04 J;  2N2N A;  2NWB A;  5BMV E;  1EF1 C;  1PAQ A;  4NRH B;  2RP4 A;  3K3Q C;  3C4W A;  2FF4 A;  1H2V C;  2AVP A;  2LSK A;  1FEW A;  5JDQ A;  1ELK A;  1ZEE A;  5T8I A;  1QUU A;  4TUY E;  5JDG A;  4UWG A;  5HI7 A;  4CT4 A;  4AXP A;  4CGW A;  3PUK A;  2OVF A;  3GWH A;  3ZN3 A;  3ZJ2 A;  4OYK A;  1JUQ A;  3SGH A;  4G26 A;  4FLB A;  3NBX X;  5KDM C;  1D0Z A;  2YHC A;  4EXT A;  2ZU6 B;  3KVA A;  3G2T A;  3W15 B;  1E7V A;  2D2S A;  2X9H A;  5HXS A;  4PS7 A;  4IGU A;  4HXI A;  1WAO 1;  3R9A B;  5JR9 C;  4FLH A;  3PUQ A;  5KJN A;  4QXB B;  3D9M A;  1E7U A;  2ION A;  4KVM A;  3RKV A;  3S7J A;  3TL5 A;  1IZN B;  2QFC A;  5JJ7 A;  1E8Y A;  4GZC A;  3ZMS B;  4ANV A;  3CHP A;  2Q7F A;  4G11 A;  2VJ8 A;  4P09 A;  4EEC A;  1UJK A;  3HKD E;  3RC3 A;  1WY6 A;  4EZH A;  3HHM A;  3BQL A;  3U66 A;  2LNI A;  4AKR B;  2HPL A;  3N71 A;  3C50 A;  4AQG A;  3CHM A;  3GN5 A;  5G2N A;  4H9Q C;  1EDU A;  3ZEF A;  2E8I A;  2R59 A;  4GYW A;  3V5U A;  3GZ2 A;  1H2U A;  3LDZ A;  4URK A;  1WRD A;  4E6H A;  4QHO A;  2Q9Q A;  2NOX A;  2BZB A;  1WYC A;  2IOS A;  3FH7 A;  3ZPJ A;  4H9P C;  3RRC A;  5E76 A;  3IEE A;  4I1O B;  4XI0 A;  3CK8 A;  5CCM A;  5FQ7 A;  5ENN A;  4E7Z A;  3NQP A;  2X67 A;  3MJX A;  4UWH A;  1S94 A;  5HXR A;  4CDR A;  2LE8 A;  2ZMA A;  5EDS A;  3QNK A;  4YJ2 E;  1G73 A;  4IDZ A;  3L13 A;  4UF0 A;  2YU2 A;  3H37 A;  4J8F A;  2LOS A;  5M4Y A;  3F57 A;  3C4Z A;  2I1J A;  1QQE A;  3UUX B;  3BG1 B;  1INZ A;  3QWV A;  3PDN A;  5ARG A;  2XGS A;  5LXT E;  3AVR A;  4IST A;  5CCL A;  4O4H E;  3ZMZ B;  4IUL A;  1TJC A;  4P0A A;  3ZVV A;  3AS4 A;  2L3L A;  3O9X A;  2NW9 A;  2VTB A;  4ATG A;  3AA1 B;  5LOV E;  4ERR A;  4JXT A;  2WB2 A;  1V9D A;  4F6R C;  5EK2 A;  3DJB A;  4AQF C;  2YQ8 A;  4AEZ C;  5DAB A;  3D9I A;  4YLH A;  3ZYK A;  2KXP B;  3CWZ B;  4WWP A;  2XHE B;  2ES0 A;  1MNE A;  4FC8 A;  1JWG A;  1IYG A;  2XRZ A;  2VSN A;  3CX7 B;  3E0Z A;  3LK4 2;  1LKX A;  2CWY A;  5J1G A;  2KND A;  3D9P A;  2CHX A;  1HCI A;  3C64 A;  5FT9 A;  2WXF A;  2WWU A;  1TEZ A;  2VL8 A;  1H2T C;  3FTU A;  3I3N A;  2YU1 A;  2WXG A;  4GA2 A;  4N3A A;  2CM0 A;  3P8C D;  3OBV E;  2V4L A;  4UWL A;  4QX8 B;  2H7V C;  1BPO A;  4FAD A;  2X3M A;  2PJQ A;  4I43 B;  2BUG A;  4DBQ A;  3VTY A;  3LBX A;  3ZN1 B;  4DBR A;  5ADX L;  4DND A;  4EZK A;  3HKB E;  5EX3 A;  1LF8 A;  1EZ3 A;  4Q69 A;  3MAC A;  2WXQ A;  4EIW A;  4HS2 A;  3C51 A;  3I4G A;  5JVD E;  3JUI A;  2NW8 A;  5HQ8 A;  4GZ6 A;  5FQ6 A;  2D0T A;  2VAS A;  3GA8 A;  1VDY A;  5L3B B;  4CI1 B;  3FUN A;  5JRC B;  2ZM8 A;  2I2O A;  2E9X A;  5A23 A;  2Y3A A;  4Z8X A;  3CST A;  4CDM A;  2L9Q A;  1D1C A;  4NUR A;  2J4D A;  3KS2 A;  2QY7 A;  2WPV A;  4WBO A;  3ZGQ A;  3FWV A;  2R5S A;  1NZN A;  4M1P A;  4DJA A;  4QXH B;  3ZLI A;  4GCN A;  1ZV4 X;  3ZMT B;  4YND A;  4N5C A;  4JHJ A;  3LY9 A;  2EHO D;  1ELW A;  1WR6 A;  2H3R A;  4LER A;  2LSV A;  3NF1 A;  2VGX A;  4JEH A;  4AP2 A;  2X9Y A;  4U63 A;  5LGU B;  2KCK A;  2PZI A;  3MEK A;  1UCU A;  3SD5 A;  4K03 A;  4DMW A;  1VOM A;  3Q49 B;  2AWI A;  3QK6 A;  2CCQ A;  3LY7 A;  4KUM B;  3UT4 A;  3LEW A;  4UV9 B;  4KVO A;  1SHZ C;  5FYM A;  1EPU A;  3N2G E;  4ZHQ E;  4TV9 E;  2J1D G;  1YD8 G;  5T4Y A;  3VKH A;  3FU3 A;  2LSJ A;  2CXF A;  2WXM A;  3PUJ A;  2K24 A;  4L1B A;  5IYZ E;  2WXN A;  1OWP A;  3SBS A;  1YA0 A;  4AJW A;  3L6A A;  2HPJ A;  5LCW C;  2MBG A;  3Q47 B;  4GCO A;  4EB6 E;  5C8Y E;  2MHK A;  5FZS A;  4HKA A;  1D0Y A;  4FHK A;  1MIW A;  3G2W A;  2X6H A;  3LKU A;  3SZ7 A;  4IE5 A;  1HU3 A;  3RKO A;  5LA6 E;  1QZ2 A;  2EHO B;  3RRN B;  4PS3 A;  3N2O A;  5LP6 E;  3ANW B;  1QSD A;  3PZD A;  3PUG A;  4G1T A;  3CEQ A;  3CK7 A;  3FEY A;  3VLD A;  5J2U E;  3S4U A;  3LPZ A;  2ZLY A;  2BVM A;  4J2C A;  2YIN A;  4BA9 A;  3OTN A;  2VQ2 A;  3KDS E;  4QFV A;  2AW6 A;  3K8P C;  3B7T A;  3CKD A;  3Q4A B;  3TG4 A;  4W9R A;  1BR2 A;  5DIZ A;  2KCV A;  3NZQ A;  3GZ1 A;  4IHJ E;  3MA9 A;  4F3V A;  3S7D A;  4DK5 A;  3PH0 C;  5LOZ A;  1ZHC A;  2IQC A;  3QAQ A;  1OUV A;  2NC9 A;  1IJ5 A;  4N3B A;  4MLK A;  5GON E;  2X38 A;  4WNF A;  3ENE A;  3HI2 A;  1SZA A;  3RU0 A;  3HKC E;  4FHJ A;  1OWN A;  4B6X A;  5HWX A;  4AM9 A;  2WAU A;  4K0U A;  3CSF A;  4PJM A;  4L2L A;  3IKO B;  1E8X A;  2HYZ A;  4OYS A;  3F2E A;  2X6F A;  2PG8 A;  3ZC1 A;  2L6J A;  4N39 A;  5LG4 A;  2NXP A;  3ASG A;  5EZY E;  2Y6X A;  3ZYL A;  4CGV A;  2W62 A;  5JR9 B;  3I5P A;  5A1L A;  2X6I A;  3P1U A;  2WXR A;  4C9B B;  4KBM B;  2UY1 B;  3ZHE A;  4CZZ B;  2DIW A;  3L22 A;  1S35 A;  2WXL A;  3MV2 B;  3IF8 B;  5FXZ A;  4MLP A;  3CHQ A;  4MBQ A;  3PE0 A;  5AYW D;  3PRE A;  4AV7 A;  3RO2 A;  4ZI2 D;  1ZBP A;  3R84 B;  4UI9 J;  1YW0 A;  3AB3 B;  4KZC A;  1B7T A;  4H7Y A;  4OFZ A;  3HL6 A;  3CVU A;  2BF0 X;  3IV0 A;  4UVC B;  2XCB A;  4JHR A;  4G25 A;  5FZQ A;  3RX6 A;  3S7F A;  1T98 A;  3ZPO A;  1UG3 A;  1W3B A;  1H19 A;  4J8E A;  1FIO A;  2GRL A;  3L09 A;  3JQ0 A;  1OWM A;  4IYP A;  3MKQ B;  1BR1 A;  5LHG B;  5LHH B;  2V0P A;  2Q9Q C;  5L3C B;  4A3T A;  3I0Q A;  3QC9 A;  4XZC A;  3D9J A;  4UWF A;  4U0Z A;  4EBA G;  1D1A A;  5FXW A;  2PQR A;  4I2W A;  3IBP A;  5KCM A;  1MMA A;  2K5B B;  3MGB A;  2DNX A;  2A4Z A;  1LVK A;  1CUN A;  3BQK A;  3E4B A;  3MJW A;  3O1I A;  2WQH A;  4JEU A;  3VKG A;  4A55 A;  2WXJ A;  3HVE B;  4KMC A;  2N1G A;  5EX0 A;  4O6F A;  3SF4 A;  4JL0 A;  2FO7 A;  2DHR A;  3FTV A;  3LXU X;  4GML A;  4I1M A;  3SOL A;  3APF A;  4B89 A;  4WAF A;  3JCK C;  5CA0 E;  4O4J E;  4PK4 A;  2Y48 B;  3IHV A;  3Q5W A;  2KZT B;  3FFL A;  3Q2M A;  2UXN B;  3KV6 A;  4X1I E;  4G24 A;  3RJV A;  4J6I A;  5DQW A;  4N2S A;  2KIN B;  2XRY A;  4IIJ E;  3CHO A;  3UQ3 A;  1X79 A;  3LK2 B;  4BX9 A;  1ZU2 A;  3CIA A;  5BNW A;  1HG5 A;  3FUE A;  3D9N A;  3ESK A;  4XAX B;  4AKL A;  4P0B A;  4A56 A;  3MCX A;  5LGT B;  3CQX C;  1E8W A;  5FNV E;  4XX5 A;  4ANX A;  5BV1 A;  3PTR B;  3KFW X;  2CEA A;  2UWJ G;  4MS6 A;  4CI2 B;  2XPI A;  1H7C A;  3P7I A;  2W00 A;  2JEK A;  1HH8 A;  4YVO A;  4ASK A;  3PDY A;  4JA7 A;  1FMW A;  5FXX A;  4UVA B;  3FH8 A;  2Q9Q D;  4LUN U;  3ZCJ A;  1KK7 A;  3PEV B;  2M67 A;  4JPS A;  1HE8 A;  4I2Z A;  2AXZ A;  4I6J A;  4ANW A;  3NZU A;  2FI7 A;  4IE7 A;  3AA7 B;  2V8S E;  1YKH B;  1Y8M A;  4HTE A;  3FTX A;  2WSS V;  3UT7 A;  2V7J A;  5LHI B;  2MTQ A;  2GW1 A;  4PDX A;  2A2F X;  1SZ9 A;  5KJM A;  1E1H B;  1MMN A;  1FMV A;  5J2T E;  1MMD A;  3B7S A;  4GZ3 A;  3GZS A;  1UW4 B;  4FJY A;  4FJZ A;  3FUL A;  1MMG A;  4HOS A;  2KM4 A;  2RD0 A;  4E85 A;  4PJL A;  4BFR A;  3RH3 A;  2K9A A;  3L3P A;  4FI5 A;  4O4L E;  3PE3 A;  3S2A A;  3FB2 A;  4PFP A;  2FBN A;  3RO3 A;  5EK4 A;  1NA0 A;  4Y6C A;  2CXD A;  2IC9 A;  1S0P A;  3N9P A;  2MOW A;  4ILI A;  3CHS A;  3P2B A;  2LT3 A;  3ZW3 A;  4RG6 A;  2E9X C;  3CPZ A;  4EZ4 A;  2A5U A;  3BG0 B;  4U07 A;  4IE4 A;  2KCL A;  2IFU A;  3I9W A;  2OOE A;  3RRU A;  3KV4 A;  1MQS A;  4JVS A;  4PJJ A;  1SA0 E;  1BR4 A;  5KMG P;  1Y64 B;  3K9I A;  2WXI A;  3HDX A;  4YVQ C;  3IBE A;  3ESL A;  1KNZ A;  5JDF A;  4WNE A;  3C98 B;  4BJM A;  3L08 A;  4HVB A;  2XPZ A;  5BV0 A;  4YFS A;  4B0Z A;  2NTX A;  5LCY A;  4O8S A;  4PNI A;  4EBA A;  3N9L A;  1P5Q A;  1US7 B;  1HS7 A;  2CFU A;  2KZ7 B;  3Q5X A;  2NP9 A;  4DPR A;  2OA5 A;  4WBN E;  4NUV A;  3ZN0 B;  2DWK A;  3EVY A;  2X6K A;  4ACL A;  2IW5 B;  4F7A A;  4C91 A;  2RG8 A;  3TAX A;  4RG9 A;  3CVW A;  4I4T E;  4AKH A;  3ZIM A;  1O3X A;  4DVD A;  4PFO A;  3CVR A;  5C2Y A;  2E0I A;  1HZ4 A;  2IAK A;  4LRZ A;  3APC A;  4N78 D;  4GA0 A;  3I9Y A;  3FUI A;  3G2U A;  4ZI3 C;  1YKE B;  3MA5 A;  3QC1 A;  3AS8 A;  2V7M A;  1ZKE A;  3AAE B;  5EKQ D;  3CV0 A;  1KT1 A;  4CRW A;  3FUH A;  4A1G A;  5FXV A;  4I17 A;  3APD A;  4K0R A;  2JQQ A;  3RYF E;  5ANL A;  3LYA A;  3SNX A;  1NAF A;  3WI3 A;  3EDV A;  1FVF A;  4FUL A;  2AXU A;  4A1S A;  2OVB A;  1NWM X;  1X5B A;  3CKB A;  3QJZ A;  2Y8D A;  4OYJ A;  4J0U A;  3JYS A;  2N9D A;  3FTY A;  3T5X A;  2PFV A;  2CHW A;  3QDN A;  2I9C A;  3EDT B;  3Q15 A;  4TV8 E;  5AJD A;  5LBM A;  3FBZ A;  2CXL A;  3JC6 C;  3EHM A;  4X1K E;  3B7R L;  2KWI B;  3EUH A;  4BT9 A;  2VKD A;  3H3A A;  2B1E A;  3ETU A;  4TN7 B;  3KAE A;  3CX8 B;  5LX8 A;  3KV5 A;  4G2V A;  3EHN A;  3CLJ A;  4C90 A;  4X1Y E;  2Y4T A;  4EYY R;  5G55 A;  3QOU A;  1UX4 A;  5IHY A;  4TUU A;  1PY1 A;  4HGA A;  2X68 A;  3AU5 A;  4JHK A;  3MKD A;  1A17 A;  2LJL A;  2J49 A;  4I9C A;  2NW7 A;  4J8S A;  2LHN A;  2LSG A;  2PM7 A;  2LHR A;  5LCW J;  2XGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...