3B13A

Crystal structure of the dhr-2 domain of dock2 in complex with rac1 (t17n mutant)
Total Genus 139
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
139
sequence length
427
structure length
427
Chain Sequence
SKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCASQVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYESIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKNAPGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFVTAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVMGGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLKMKVEKEYGVREM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Dedicator of cytokinesis protein 2
publication title Structural basis for mutual relief of the Rac guanine nucleotide exchange factor DOCK2 and its partner ELMO1 from their autoinhibited forms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding/signaling protein
total genus 139
structure length 427
sequence length 427
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3b13A03
1.25.40.410 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3b13A01
2WMOA 3B13A 3VHLA 2YINA 2WMNA 2WM9A
chains in the Genus database with same CATH superfamily
5ABFA 3BUAA 2ETCA 3DPYA 1OEDA 2RD0A 4I6GA 4WWNA 3DSWA 2CCQA 2YDRA 4IIJE 4N78D 4YLHA 4YSXA 5FKYA 3FDHA 2KCKA 4UEMA 1TNUA 5CCMA 1Q2ZA 5FXVA 2WXPA 2AXVA 5ENRD 2NC9A 3AS5A 2E5VA 4HI9A 3AE5A 4CI2B 2Y4UA 2M63A 1KT1A 2L6JA 4MBGA 1E8WA 4DLQA 2KXPC 3CVXA 2WXFA 4HEAA 3QDNA 3CPZA 3IBEA 2YDQA 5ENQD 3UU6A 4ANXA 2UUAT 3OYZA 3R7QA 5L3BB 4QFVA 3LS8A 5G05C 4JEUB 3C64A 2QRXA 3HKCE 3IEEA 3P4SA 1UG3A 4EHMA 3GZ1A 3HXFA 2BVLA 2Y8DA 2B6CA 3NF1A 2XAHB 3LG7A 3ZPJA 1VCTA 3CKBA 1UCUA 1JCRA 2LO6A 3FTWA 2H7OA 3TWRA 2FO7A 2XY8B 4O4IE 3HXCA 4JHJA 4EYUA 2UXBT 2IUBA 4IN3B 4YDWA 3OTNA 2IW5B 3ASNE 3ENEA 3ONXA 2V1DB 3P4QA 4A1GA 2XM2A 4DUIA 5ABFB 3JCFA 4ZI3C 1UX4A 4G2AA 5CERB 4BJNA 2JQHA 2BG9E 3GA8A 1E7UA 1SA5A 4I6JA 2PTFA 3SGHA 4IE5A 2DIWA 4BWRA 3PDYA 3ZW3A 3O1HA 3KFWX 4FLHA 1D0XA 2CLYB 4DR4T 3WAJA 5HCJA 3FU3A 1HG5A 3T8KA 1E2AA 4I0UA 4MALA 3EHRA 4J0UA 2ONDA 5AQQB 2BTDA 4G8KA 5ETWA 3PZ1A 5LCWC 3GN5A 5ANLA 4GK0E 1YKEB 2OVBA 5A23A 4TUUA 1WDYA 1KNRA 1W9RA 2E2EA 2MYOA 3KVBA 3VHLA 3HVEA 3HKEE 4PS3A 4KHPT 4RLYA 3SOLA 3PZ2A 2H88A 3AEEA 2UXXB 3BK9A 2F37A 1N4SA 1UJJA 2WP9A 2KT9A 3GWHA 3MZLB 5C2YA 2CEAA 4KP3C 3TWXA 5C2TA 4AY6A 1JCSA 3UT7A 5AQTB 4CXXA 3NAWA 2BVMA 1TN8A 3FU0A 4HOSA 2CRBA 1LKXA 1HU3A 4LFCT 2CWYA 2QFCA 4I1AA 2W62A 3UU4A 3URZA 3ISMC 2HHHT 2KWHA 1ELKA 2DCPA 2Q7FA 4GZ6A 1SE7A 3VLFA 2CM0A 2WZIA 2XHEB 2DZNA 2DHRA 2H6IA 4I4TE 2XZDG 3DXMG 3BQLA 1HZ4A 2EHOB 2X0YA 4AQFA 2BEDA 2XEEA 2E9XA 3CQCB 5JDFA 3AAAC 3PUXF 3D9PA 5EYPF 3VU7H 5H6RB 2AXDS 4UR9A 3AA7B 3V31A 1ZEEA 5EK2A 3J7Yq 1SA4A 2CPTA 1K3ZD 3G06A 4AV7A 3J5PA 3R6NA 5EIDA 1S70B 4ANVA 1ZV4X 3MACA 4HGAA 4TWFA 4U7YA 2XQ4A 1IHGA 2B0OE 3E22E 3N71A 3HDXA 2NR4A 4O60A 3D9KA 3FHNA 3MV2B 4HNAD 2K5BB 3KV6A 3HVEB 3MJXA 2CG3A 3B7SA 3RKVA 1WYBA 2IC6A 4DR2T 3Q47B 3EJNA 4N3BA 5FYMA 5FWQA 1M7KA 2L0IA 3CVQA 2VKHA 2OLTA 3EHZA 4OVVA 2WB2A 3ESKA 1LTXA 3D9OA 2AVPA 1D1AA 4JHKA 2OV8A 5AENA 2W0GA 4GZCA 4UQYA 2L6BA 4JI5T 2XEVA 4LNGA 4I1OB 1H0AA 1UUSA 4JI2T 3ONJA 1G8XA 2C2LA 4DV6T 2I59A 3TLVA 3L39A 3L13A 5D2MC 1LVKA 1ELRA 2X6IA 4TXPA 3V79K 2E9XB 5FY1A 5KJKA 1HNZT 4AVXA 3R9AB 1JPLA 1DU2A 5HKPA 3PU3A 4IRUA 4J8EA 4B6XA 1IQRA 1TNOA 4HI8A 1ZP0A 1BD8A 3ZRHA 1KT0A 4LCTA 4U07A 3OYXA 4G11A 3SZ7A 2D9DA 4YFSA 2W63A 4URKA 3RYHE 3LVRE 5JREA 4TXQA 1HR0T 3DPDA 2KCVA 4EEDA 2X0HA 3AVSA 2PM7A 4AOFA 1K1AA 2LE8A 2XAGB 1OCCE 2YK0A 2NOXA 3QNUA 4U74A 2H6HA 3ZT5A 1W0AA 4U3CA 4OAVB 4I6EA 2D0TA 4CDMA 4TXRA 2DBAA 5L3FB 2W66A 3EU9A 2XM1A 1J1JA 3ZMUB 2VWAA 1NWMX 4EEBA 2V8SE 4A55A 5FMNA 4N2QA 1NENA 4IREA 1JWFA 2V6XA 1SZAA 2IO2C 3UIOC 4GYRA 3QK0A 3TWTA 1FMWA 1Y8MA 4K0KT 4GCNA 2XQ8A 1NZNA 2BS2A 5AQBA 4IDPA 4IE0A 1U2VG 1DNPA 4GYSA 5G2NA 3Q7AA 3EDVA 1TNZA 3PH0C 4UWLA 4AKRB 1G73A 4H9SE 2CMRA 4C91A 5AN8A 1Z5SC 2JLBA 2EHOC 4ANWA 4DV1T 3LYAA 3AE9A 2XQAA 3PE4A 1X79A 4ILIA 4GZ3A 3CK6A 3N9OA 1WR0A 3E32A 4XAXB 3PU8A 5JJ6A 2CWOA 3CX7B 2M6IA 3FH5A 1EF1C 4AKIA 3ONKA 5AQMB 5HQ8A 3ZEFA 3FEXA 4ADZA 4EGWA 1O1SA 3L8RA 1LRZA 4X66T 2LSVA 2YINA 3MZKB 1OT8A 3RIBA 1VCSA 4H7YA 3ZFWA 3JCKC 4HKAA 5BNWA 3JUIA 2CBJA 4HBDA 3UM0A 3PRZA 1KK7A 4J8SA 3N2KE 3RIAA 2KBXA 2L0TB 4XE0A 3T1YT 2JMHA 4QKNA 4TX5A 4QQIA 3ZXPA 2AE9A 3A8YC 3D9LA 3PZ3A 2XENA 3AEBA 2C5JA 5JH7E 4WZXA 2J1DG 4Z90A 5AFUL 3S2AA 3AVRA 3R84B 4CDRA 1KFYA 2V5DA 4I43A 2NXPA 4B0ZA 4AKHA 4Q25A 3C51A 1MQSA 1N95A 4HN9A 4A5XA 4IL4A 4YTMA 2YKSA 4FI5A 3QB2A 3SHFA 1FT2A 3PUAA 2BKGA 3NKZA 2DL1A 3ZHEA 4KMOA 4WNKA 4HB5A 2JQQA 4AIFA 4HWCA 4DX2A 3ZIMA 3D9NA 4ZOLE 2ZU6B 4B89A 3HXDA 3Q7FA 4GA0A 3CHPA 3G2UA 5JDQA 3PNTB 3IHRA 3JXJA 4Z68A 1U3CA 3TWSA 4EBAG 1D1BA 5FY7A 3ZN1B 2CFZA 3BU8A 2I2OA 4DJAA 2ZISA 2OEWA 3CIAA 1I6ZA 4PFPA 5DQVA 5JMND 4P29A 3Q15A 4HQDA 3LBXA 5TAOA 3B13A 4JEHA 2DNXA 2XAJB 4CRWA 2BKPA 5JJ7A 5GONE 3HKDE 4LF9T 5JRCA 4JA9A 4L5GA 2QC9A 1WG0A 4B8AA 4DX5D 4IDQA 4GTPA 4RG9A 4NXMT 4JLEA 5AQIB 4DNDA 1CHUA 3OKQA 4AQGA 4YNDA 2XQ3A 3CWZB 4NURA 1LF8A 4BESA 3TWVA 1XDPA 4AP2A 3S7JA 1H2TC 3VRAA 3MA9A 5JDMA 2V0PA 4WUYA 1T72A 2L3LA 3CX8B 4LNBA 2NW9A 3CK7A 1OCRE 3APCA 3PUGA 2CA5A 5JA4D 2YHCA 5HYAA 5KDMC 2XSBA 5FQ6A 4HRMB 4XX5A 2R03A 1MZCA 4GAAA 3APFA 3ZHEB 2JIWA 4IT4A 4WBOA 2MPKA 1MHQA 2WXLA 2BBJA 2LNIA 4DI4A 3RO2A 5KJLA 2PNNA 5CMYA 2FBWA 4AQYT 3LCAA 3LJ3A 2XQ9A 3S4UA 2KMFA 3HXEA 4U7IA 2QYJA 1Z3YA 4DUZT 5LMUT 4G26A 4G24A 2QYWA 1KNZA 4IE4A 1H19A 2NSZA 5B1AE 3L3PA 3OJAA 3LJNA 2PQNA 2VSOE 2WAUA 4IL9A 4JEHB 1H6PA 3MKDA 1TJCA 2ACXA 2V7KA 2CHNA 4DV4T 5F3JA 3C72A 2CHZA 4EZJA 4K5BA 3ML9A 3RX6A 3ZSTA 4GZDA 4IULA 5FP3A 3RRCA 1HTJF 3APDA 2LEHA 4KMCA 4H9NC 5FXWA 2VSNA 3CVWA 1XDOA 4TWDA 4UF0A 1TN6A 3P2BA 3B7BA 2YEVC 1U3DA 5FT9A 3QB5K 1E7PA 4OYSA 5AQOB 4COFA 5LJMA 2XCBA 2VSXE 2I0MA 5ABEA 4J7WA 5H7PA 3C98A 5LYJE 4PAGA 2RG8A 4ZS3A 2EIJE 5JDNA 2FJDA 4PS8A 3AE7A 4AIUA 3MKQA 2VKOA 4MS6A 3TXNA 1D0YA 5AQJB 3I4GA 3EDTB 3UM3A 3FUJA 3HA4A 4H63H 2D0UA 2F0YA 3SBSA 4IDOA 2WQ7A 4L23A 1ZB1A 3TXMA 4YT0A 5AQGB 2AXZA 3L82A 1KNPA 2RA1A 2P2CP 3QUJA 4H9OC 4UWHA 3LJCA 4UQZA 4LNUD 4YDYA 5AQSB 4XBFB 2ZM8A 3RPUA 3JC6D 2RFMA 3DEPA 5AQPB 4HWHA 3CSTA 2GK9A 4F53A 2L8KA 4G25A 2XS8A 4O2AE 4FJZA 3WXXA 4X62T 5T8IA 5DQWA 5DIZA 1T7SA 5LHGB 3ABME 4I9CA 2LXMA 1OEDE 5CFBA 2ZXWE 2IC9A 2XZEA 4GYOA 4DVDA 1XMOT 3AB3B 3OVUA 4I50E 5BXOA 3QC9A 4RSYA 5KCMA 3AJIA 3IEGA 3FU6A 3UKRG 1WRDA 2J62A 2HN2A 1R8IA 1A17A 4JEUA 1TR4A 3MKQB 4OK0A 5BPPA 2J9QA 1MNDA 3RC3A 3VKHA 1YMPA 4HE8A 3K1SA 4HTEA 5HXHA 1EDUA 3FFLA 3FUFA 1V55E 1FIOA 3AAAB 2J08A 1OUVA 4I17A 1MIVA 3DTOA 4QH1A 3B7UX 3RHWA 4G23A 2XAQB 4CXWA 4UVCB 3ZJ1A 3UTKA 1OWAA 3CX6B 3HHMA 2WDQA 3SFEA 4CI3B 1ZOYA 1SA0E 1IBMT 5AAOA 1VRBA 4HWDA 2Y4TA 3E34A 4CZZB 3FH7A 3UU3A 4UV9B 1YQ3A 4GMLA 2GRNB 3P1UA 4ISTA 1QUUA 4CI1B 2WVIA 3TG4A 5HEJA 3V5SA 4GPMA 3E08A 2X67A 3FZHB 3X1DA 2R02A 2A5EA 2UUCT 4PNIA 4ACLA 3B5MA 2UU9T 2JRKA 4EZHA 4BTBA 5EKQD 3ASHA 1ZBPA 4IE6A 4BSZB 3UQ3A 4ZI7E 4YDEA 2CBIA 1QQEA 4EZLA 2R05A 4WW0A 4MLPA 4W9RA 3FUHA 4ZHBA 5ABHA 4AKGA 1WAO1 3D3MA 4PDXA 1YA0A 2WXGA 5ARFA 4R7LA 2EIME 2C0MA 1S63A 4C9BB 3ZC0A 2M67A 2F8XK 3KDSE 1VOMA 1NFIE 4FC8A 4X1KE 3CHQA 3FULA 3MGBA 2VKDA 2X9WA 5ENNA 3ZUVB 2ILRA 1KEYA 3K3QC 1S64A 3LY8A 1WFDA 4KUMB 4AEZC 2J09A 2XHEA 1S94A 3EUVA 2WBLA 4JHRA 4BETA 2RPAA 1OXJA 4UQXA 2EHOA 4GCOA 3UUMA 4MRUA 1KLXA 3U3IA 3AE3A 2ZLYA 5FZSA 4ILBA 3UULA 3U3WA 4PJJA 4EXTA 4B93B 3QOUA 3LSVA 2IO3C 3ABKE 1MIWA 3ZCJA 4P0BA 4LMJA 2IFUA 4YVOA 2VGYA 1BR4A 2FJBA 5ABGA 4GTTA 3NBNB 4LRZA 3SY2A 2AJAA 4ILUA 2WU5A 5LGUB 4TZ4C 4WNFA 3DRAA 2FI7A 3IKOB 3RRUA 3RKOA 2XJ7A 1QSDA 3FTZA 1N32T 2WM9A 5JVDE 3LPZA 3QAQA 1XZYA 5JR9C 3CHSA 4PK5A 3OPCA 2X6FA 4DRXE 3AEAA 2WSSV 1IBLT 3WG7E 2BKNA 2X6KA 2LJLA 2OCCE 4DX6D 3ZJ2A 3P4PA 4DR5T 3Q73A 4L7TA 4OVUA 4F3VA 4XEIG 3L08A 3PZ4A 1OCOE 1D1CA 3PUQA 2J49A 3ESLA 3ZYMA 2WU2A 1E90A 1SZ9A 3GZ2A 2SPCA 1UOHA 2LUHA 4UI9C 5L47A 3TGOA 3PUVF 4WNEA 2ODVA 2P9KG 2P9SG 3TAXA 3FUKA 4JD2G 4BSXA 3LDZA 3AXJB 4HOTA 3Q9NC 1YKHB 4DUYT 2WWVA 4G63A 4LMLA 5CRVA 4LFAT 4GTOA 5J2UE 4DIDB 2HR2A 5B3SE 4ZS2A 3RRMB 3Q5EA 3PJAA 2ODUA 4U0ZA 3KD7A 2ZM2A 2I9CA 3AE4A 4CYMD 4KXKB 1IJ5A 5LP0A 5HXCA 5LG3A 3QB5A 4JZYA 3SFXA 2GRRB 4XZCA 2GRLA 3BEEA 4L1BA 4APFA 4NRHB 4FP7A 5CBNA 2HH7A 2ZM6T 3FH8A 3QKYA 2XCCA 3KV9A 1AWCB 3CHRA 3LEWA 4LF6T 4HRNA 4CQIA 4JXTA 4P1NA 3D0TA 1IBKT 1QYMA 3R9MA 4DX7D 3UUBA 2LXLA 1H6OA 1WLXA 3SFDA 2X38A 4Q96A 4WNDA 2C5IT 5DABA 1X5BA 4CGWA 2DYRE 3NOCD 3NZQA 3AAEB 2JMKA 3I0OA 3IBPA 5ENOD 3T1HT 1S35A 2R5SA 4DV3T 2BG9B 3CK9A 4EZKA 3U78A 3ZCIA 2X9YA 1O1RA 4K03A 2EQXA 3AECA 2LM9A 1WY6A 3H3AA 3U4TA 3CK8A 2PQRA 2KZ7B 4DR1T 3SF4A 3K9IA 3RGLA 5HCMA 2V4HC 3M3ZB 1HX1B 2KC7A 2X9XA 3H37A 2A9UA 3ZLIA 4U8VD 2QGSA 2V7MA 2WDVA 3E0ZA 2X6JA 2YHEA 4PK4A 3UPVA 2GW1A 4H9PC 4UI9K 3RU0A 1HH8A 4HVBA 1JNRA 5BXUA 4TUMA 2D5UA 2ACZA 3DXKG 5L3DB 1E8XA 2HPJA 4DLOA 5FVLA 5EIBE 5CBOA 3AG4E 2J8SD 1HXIA 3BQIA 4LSZE 2LSKA 1I94T 5LOZA 1WR6A 2V7JA 3DP7A 3LDQB 2XQ0A 4BERA 3FBZA 4HLEA 2MTQA 2LLYA 3NQPA 4YSYA 5JDGA 3L09A 2ETAA 2WXOA 4GB9A 4CN4A 1Z3XA 4ZXLA 5LXTE 2EINE 4KVMA 4JI0T 2V6YA 2D2SA 3O1JA 4E85A 5CECB 4DV2T 4HOUA 1UK5A 2XGSA 4UIGA 1MX4A 3KV4A 4O6FA 4HFHA 4PJLA 1KPSB 4JL0A 2WPVA 1N52A 4B8CB 4UELA 5KMGP 3JC6C 3UFEA 4H9QC 2QA7A 4KYOB 3OXLA 2JEKA 1JUQA 4RQIA 2J07A 4NUVA 4O1PA 2XTLA 3O9XA 2VQFT 4N39A 5FY0A 1NA3A 3E4BA 1YD8G 3TL5A 4I2WA 3C3OA 4GTRA 4K5CA 3CHOA 2X51A 4O1OA 3OXFA 5HEGA 4L2YA 1OWOA 3NRYA 4Y6WA 1UJKA 4N3CA 2DWZA 4K0RA 5LJNA 5JHBA 5KJMA 5A6CA 5FZRA 3OAWA 4GMJA 2LSIA 2FF4A 4GOUA 1WCRA 3RLFF 5FIOA 3CVUA 1WYCA 1NA0A 5DJQC 4FLBA 3H3MA 1M62A 3O4XE 4XIFA 2RFAA 4A56A 3AEGA 2F8YA 4WNGA 2H6FA 4C0MA 3FU5A 3GMIA 3VR8A 3C4ZA 2ES0A 3LVQE 5LGTB 1N4PA 4BFRA 3TLUA 3CQXC 5AQUB 3RC8A 4I1MA 3UT4A 4U8HA 4HFIA 2V6YB 3FTSA 2MAWA 2KWIB 2Z6EA 2IOLA 1QLBA 4GTMA 4BX9A 4X20E 4KZCA 2KNDA 3CVYA 2XUEA 2VB6A 3AEFA 3RK6A 3N9NA 2XS1A 3LKUA 5L4HA 1XMQT 3CVRA 1IHBA 3TLTA 1HNWT 2FBNA 3RJVA 1K1BA 3VLDA 2XGOA 4NPPA 4KBQA 3RIFA 4O2BE 3Q4AB 1YCSB 3GZSA 3O48A 5JQGE 2Q9QD 3FWVA 3FUIA 5T3RA 3S7FA 3L9TA 5F5WA 3CVVA 2CXLA 3CIRA 3FTYA 3ANWB 1N4RA 1LVFA 3K3NA 4HOQA 4ZZBA 2BG9C 2A5UA 2B76A 4V1Av 5L3CB 1W0BA 4UVAB 3LFMA 4KBMB 2LSUA 3UX4A 2QYUA 4BJMA 3EUHA 3C3RA 5HI7A 1HFAA 1Y64B 4JB8P 1N94A 2J4DA 5D0OD 4QX8B 4EAHA 1IJ6A 2E5LT 2ZIRA 4MFRA 1UN9A 4ABNA 4QH5A 1J5WA 1EPUA 2L9QA 4H9RC 4KI0F 3AE6A 2A4ZA 2J4BA 3MX3A 2X68A 2DWGA 4AXPA 3N9PA 2ETBA 3CV0A 5LB7B 1SUMB 1OWPA 2VURA 2J4GA 4PJMA 3KSLA 2RKKA 4P09A 1BR1A 2NWBA 1IXVA 1BLXB 1Z0PA 1US7B 1BR0A 1TJFA 1FCHA 1N0RA 4ASKA 2MOZA 4YJ2E 2OVFA 3IV0A 3KSQA 1EYHA 4OFZA 4U72A 3OTOT 3ZN3A 3BQOA 5LG4A 3UM2A 2LOSA 1MIYA 3IHVA 2OA5A 4E6HA 2JQ9A 4M1PA 2R17C 3AEDA 1N36T 4HWFA 5BR8T 2NYJA 1OWLA 2GROB 3AG2E 4NQ0A 1P5QA 2PG8A 3W15B 4JVSA 4LERA 4PH4B 3AA1B 3OXGA 3MJWA 5LGNB 3CKDA 2KM4A 4ANJA 4KZ0A 2Y1LE 2W61A 4O8SA 3KEZA 3FB2A 3QNKA 1J5ET 5ENSD 2LSGA 5AQRB 2LKHA 2H3RA 1MX2A 4JI1T 3PDNA 2XPKA 1HE8A 2A72A 1BR2A 4IHJE 4LF8T 2AW6A 4TRQA 3RRWA 4DR3T 4ZHQE 2XRZA 4EPZA 1MX6A 4BEPA 4OYJA 3PUSA 5A1LA 2XQ5A 3CKCA 4GA1A 2WDRA 5KNHD 5E0OA 1H2VC 1B89A 4YTPA 1RZ4A 3OBVE 5JR9A 3MKRA 2P9PG 3MXZA 3KINB 4NIQA 2WS3A 3N2OA 3C3QA 3HL6A 2CXFA 3ZC1A 1AP7A 1DVPA 5IWAT 1JCQA 1PC2A 3P4WA 4IDZA 2J47A 4N2SA 4HRLA 2VVSA 3ZMSB 1SW6A 3FUEA 4AXHA 5FQ8A 5CRUA 2FULA 3LK42 3F2EA 3EIJA 3N5LA 4TN7B 3PUZF 4CN6A 5EILA 4ZI2D 4TUYE 2C0LA 2LM2A 1D0ZA 1NI1A 3PUKA 5JDHA 2LHNA 4CDNA 3FHEA 5EYLA 3ZMZB 3AA0B 1IAPA 1FEWA 4Q94A 2IY0C 3AU5A 1MMAA 3ML8A 2WXHA 2MHKA 3JXIA 1E1HB 2LT3A 1D9SA 2KZTA 1O3XA 3NZSA 2Q9QB 4WWPA 3NWIA 4CT0A 3HKBE 5ADXL 2IOSA 3IXEA 3ASOE 3T5XA 2XAFB 1OCZE 4GZ5A 4QHOA 4TWHA 5JR9B 3VLEA 3CVLA 2QVAA 3NVOA 1E7VA 5LA6E 5G04J 4HFVA 2WQ6A 2BUGA 5T4YA 5ITZF 2K3WA 5KBAA 3I5PA 5HWYA 3FTXA 1IYGA 4PW8A 3D9MA 3QWWA 2IU1A 3PUWF 2M6BA 3PJAJ 4WAFA 2WXQA 4WBNE 4C0EA 3Q78A 3AS4A 2KLQA 3ZYKA 5AIJA 3B57A 1H7CA 2OV9A 3FZKB 5FINA 4FJYA 4YJ3E 2LAHA 5AQVB 3ASFA 3SI5A 3Q79A 3DBSA 3LK3B 3L16A 3HXBA 3PE3A 4CT4A 3FZFB 3P50A 1JWGA 2QY7A 3ZU7B 4GIWA 1K8KG 1MMDA 3RO3A 4JI3T 1H6KA 2MBGA 5E76A 1A5EA 2LKGA 2Y6XA 4JYAT 2V5QC 2KZTB 2XASB 5FXXA 2FJAA 1XNQT 2JQKA 3NBXX 4GA2A 4RG6A 2N1GA 4FHJA 3KAEA 3W9GA 4O4HE 4DI3A 4DX1A 2K24A 5CA0E 2OEVA 4ME2A 3B7RL 2HYZA 4Q69A 5AYWD 3ULQA 2WZHA 2ZGDA 4I9EA 4U04A 3NRXA 3JYSA 2WMOA 4GU5A 2HO1A 3TLWA 2YQ8A 5LBMA 3KBTA 3FP3A 3UUXB 1W3BA 4F6RD 4F8HA 5FQ4A 2WXNA 3X2QE 2IF4A 4F1SA 2CHOA 4BT9A 3RF1A 3JQ1A 2R59A 1ZKEA 3E33A 4LF7T 2WXKA 4Y6CA 4XKBA 3EAMA 2PFVA 5J2TE 2MOWA 3G2WA 3FXEB 4GTVA 4CCAA 4PK6A 1Y01A 4MBQA 3EU5A 4JBWF 2WMNA 2XPIA 1DCQA 2VGXB 1TNYA 3SFZA 3TWQA 4BAYB 2MRIA 3UT5E 2E9XD 4PFOA 3JAEA 5HXSA 2UY1B 3RYFE 1FT1A 1KF6A 2C0SA 3J5QB 5C1DA 3RIUC 3PZDA 3ZGQA 2DZOA 4U0SA 4IGUA 2N9DA 4BTAA 3AG3E 4EIWA 1TN7A 3LY7A 3AXJA 2VASA 5AQAA 3S7DA 4E7ZA 2NW7A 4JI8T 3CR3A 3DWLG 4YXDA 3EABA 2BKOA 5HWXA 3R7RA 5M72A 4I55E 1T8BA 5LHIB 2YN6A 3QJZA 4ZEYA 4PUCA 5E75A 5IY5E 5CB4E 2W00A 2DI4A 1FMVA 1V54E 3MA5A 2Q9QC 1OEDB 2CHXA 5KWDA 5CJ5A 1N4QA 2IJGX 1QBQA 3EIQC 4JUYA 4MHCA 3G2TA 1NP7A 4H63V 3LK2B 1HO8A 2X3MA 2XQYA 1IZNB 1UN8A 5L2LA 3BG1B 4GKKT 5JJTA 3T8OA 4EYYR 4TNVA 1X9BA 4GKJT 2WCAA 5AQNB 4QXHB 4DBRA 2XGMA 4G2VA 3D9JA 2BBHA 3I9WA 1HCIA 2MYSA 4JPSA 3ZKJA 3F57A 3QWPA 1MNEA 3PNLB 1SHZC 4DR6T 4O4LE 1L0VA 1QZ2A 2WB5A 2WXMA 2E2AA 2DYSE 4CXYA 3ZN0B 3V2OA 1V9DA 4JI4T 3C4WA 4QXBB 4L9PA 2LSJA 4JI7T 4B3MT 4AKLA 3Q5DA 2L9BA 4TV9E 2WXJA 3GYZA 3UTMA 1TEZA 3NZPA 5FL1A 5CEAA 4EOZB 1N9AA 4LUNU 2WQYA 3ONLC 4NXNT 4C90A 1XGWA 3ZSSA 4EV6A 3M65A 3A5XA 3SFYA 1FJGT 2VK9A 2BG9A 4LF5T 2YU1A 2LHRA 3F6QA 3PUYF 4U95D 5FVKA 3W9FA 2V5CA 2Y69E 3SBTB 3DJBA 2VVNA 3K3OA 1FPPA 5FL0A 4F7AA 4AISA 1HS6A 1SVXA 5LHHB 3UIPC 2XQ6A 2FEZA 4UV8B 1GW6A 2X0LB 4B3TT 4O4JE 1VDYA 4DMWA 3CVPA 4QX7B 1IQUA 3MYVA 5CGMA 3SWHA 2XSAA 5JTGA 3U64A 1FVHA 4U63A 5H6QB 2H89A 4TV8E 5JDLA 5AQKB 2LSYA 2G0UA 2LOPA 2LRKA 3Q2MA 5ARGA 4HFCA 3HYMB 3ZMVB 4E7SA 4ILGA 2WWUA 2V8SV 1MMNA 4HFEA 1JNZA 5AJDA 2UXDT 5BT1A 4N3AA 5FTPA 2A2FX 1E96B 3GN5B 4TV3A 1L5JA 5HEUA 3UXGA 4XI9A 2JJ9A 4KT6B 4B94A 2IAKA 3JQ0A 4IE7A 3EHMA 3Q75A 4YDOA 2K48A 4K0UA 4A97A 4EQFA 5IUXA 5AQ7A 1WM5A 2HN1A 2E0IA 1TNBA 3JUEA 2FO1E 4AY5A 5EN5D 2GRMA 2IONA 4U8YD 1ZU2A 2VL8A 3PTRB 2IIUA 3IHYA 3RSEG 4GTQA 3LY9A 4PJNA 1ZHCA 4HLLA 2VKJA 3CHMA 4G8LA 2NTXA 4H7XA 4U31A 3FBLA 5KJNA 4P0AA 5D0QD 1W09A 3CSFA 2GRPB 3VTXA 3FUDA 3AAIA 3PEVB 3FY4A 4JA7A 4A98A 2UWJG 4BT8A 3UUNA 2LRLA 4YSZA 4HORA 5G05J 4L0RA 4N5QA 4NUUA 3SQVA 3PE0A 3ABLE 3ETUA 4JW1A 2VL0A 3MK7C 4ILCA 4XZ4A 2HM8A 1B7TA 3VKGA 5J1GA 2V5FA 3UQ4A 4OHFA 3Q9DA 4ZI2C 3B95A 1OEDC 3GW4A 4OX9T 1ELWA 3E30A 3IA3A 1XNRT 3TJPA 3UINC 3KEAA 4FULA 3AS8A 3N2GE 3Q5XA 4GYWA 2CLYC 3B7TA 3CVNA 5LFAA 3ZXSA 1U4QA 1U5PA 4N5CA 3J9X1 4A63B 1N11A 5BV0A 3SS1A 2R6GF 2X6HA 2KATA 1AJ3A 5HS0A 4RVBA 5IHYA 2ZMAA 4U33A 3Q9UC 4X8QA 3PS6A 5LCWJ 5KNGA 3HR0A 1YQ4A 2P9BA 5CCLA 4BY6A 4EECA 2HE0A 2PZIA 2V26A 2YOEA 3ANWA 1BPOA 5FJYA 2BS3A 2W2UA 2BS4A 3HRAA 5EX3A 4APOA 5AARA 4B3RT 4GYYA 4ILHB 2B1EA 2DVWA 1NAFA 2IEJA 2WXIA 3Q5MA 4HWIB 1CUNA 3CGHA 2K9AA 4ANUA 5EDSA 3DSVA 2C5KT 2I1KA 3UI2A 5CEDB 1S0PA 2P9UG 2VJ8A 4DMVA 5LOVE 4A1SA 5CA1E 3ZVVA 4KHZF 4UI9J 4M3OA 1OXZA 3CLJA 3N9LA 4FU3A 4LF4T 5AJLA 4GK5E 3HG0D 3VRBA 2P58C 3N9MA 2OOEA 2DLRA 4G1TA 2R2LA 3DEOA 2XQ7A 2W4XA 4JV5T 1NL4A 2I1JA 3L22A 5ANRA 2BZBA 2Y3AA 3TWWA 3FXDB 3RH3A 5CMWA 3MEKA 5FNVE 2XRYA 1IKND 5F8PA 3RRNB 3CEQA 2V4LA 3TWUA 3RAUA 3EI0A 3FTVA 4YTNA 4PS7A 2Y48B 1E8ZA 3PREA 4C48B 2VSYA 4ZI3D 1D8DA 3D9HA 2FUPA 2IDOB 1N34T 2P9LG 4F6RC 4QXCB 3E37A 4BX8A 1N54A 4BA9A 3RKGA 3I1AA 4EB6E 5CHEE 1QNFA 2IQCA 4MKTA 1RW2A 5KXJA 5LX8A 1H2UA 3P4RA 4HS2A 3AE2A 3CMLA 4UUCA 1YW0A 3I9YA 3FEYA 1KZPA 2UXCT 3V2XA 1OWNA 1UX5A 3UU8A 4GMRA 2VGEA 5FQ7A 4DV7T 3VTYA 5G04C 3ASDA 1EZ3A 3DSSA 4JC8A 5BW8C 1HS7A 5AQFB 3ZT6A 4ILAA 3WI3A 4AQFC 1LD7A 3AE1A 2E9XC 2P9IG 3AA6B 4UVBB 1GQEA 1HG2A 1UURA 2QZAA 5M4YA 2JPFA 1PY1A 1Z6TA 3L6AA 4IYPA 4U2ZA 3O4ZA 4LFBT 2I6HA 4DV5T 4U2YA 4ATGA 1HF8A 3UMVA 2KSRA 4OYKA 3DSUA 2H7VC 3FZMB 3ZEFB 3AG1E 3UT8A 4ACKA 4F1PA 4UWFA 4UXNB 2XPZA 5HEOA 3KVAA 3FUNA 4UWKA 4FA6A 5HEHA 3IF8B 3U66A 5IYZE 3RYCE 1UW4B 4DV0T 3NZUA 4GTSA 4K5AB 4YY3T 1BI8B 4KVOA 1YXRA 5LCYA 4ZFHA 2GRQB 4UWGA 3ASGA 3A7MA 4DR7T 3KV5A 3QOFA 4DK5A 3PUJA 2V7IA 5LP6E 1DC2A 3UKUG 2E8IA 2V7LA 5LBQB 5EK4A 3O1IA 4IDNA 4CGVA 1PAQA 3RIUA 4HFGA 4OAUC 4AM9A 1FVFA 2ZM0A 4I43B 5KX5E 4J8FA 3D9IA 3Q49B 3UQ7A 2YU2A 2BKKB 5BUZA 3DSTA 4J2CA 2VTBA 2XZTG 4YHHT 4LMKA 5LMNT 2A3DA 4DPRA 1XWMA 2X9HA 4ISSA 2PBIA 4X65T 4FJOA 1MJ0A 3SRZA 1N0QA 1XNFA 2EIKE 3EHNA 3ABVA 4LG6A 5AQ9A 3T5VA 3BG0B 4QWNB 3PURA 3UM1A 2Q9QA 4A3VA 3P8CD 3QARA 5EX0A 4ATZD 3C4XA 4U0UA 3RQWA 1OWMA 2UXNB 3ZPOA 3QWVA 2FJEA 5HXEA 4XI0A 5C8YE 4CEMA 2CHWA 3S7BA 1HX8A 3AU4A 4J8DA 3QC1A 4AJWA 3I4RB 1MYOA 2BF0X 2KCLA 3MCXA 3LBXB 2IHR1 3ZMTB 3V5UA 5FZQA 1OY3D 5L4EA 1T98A 2VQET 4WWOA 2KXPB 4NIKA 2JABA 3FUMA 2RP4A 5HAXA 2XPYA 2KINB 4QH4A 5AQLB 3MV3B 3KBUA 3QK6A 5JRCB 2CG2A 4J8YA 5EK3A 1Y6IA 5HXRA 5A7DB 3RQUA 2AWIA 3I0QA 3ONLA 2UUBT 3ZKRA 4CN1A 4DO0A 2AXUA 3C50A 1BI7B 2PM6A 4HFBA 4ZZCA 2GGFA 4L9IA 5FXZA 4U96D 1O5MA 1TYQG 3HI2A 2WY2A 1HNXT 3SD5A 3G2VA 4FHKA 2N2NA 2VTBB 2IMLA 5ENTD 2X66A 1G3NB 4X1IE 2VQ2A 2VYIA 3T8MA 4A3TA 1UGOA 2WQHA 3CQGB 5BV1A 2CXDA 3ETVA 3ZYLA 3AE8A 4J6IA 2NP9A 3FTUA 3EVYA 3TLSA 2BDEA 3UFGA 2H6GA 3PEUB 3K8PC 5LNKA 3ZT7A 4B3ST 4X5TA 1NEKA 3EDUA 3EHQA 3I3NA 2F4VT 4YHJA 3PV0F 5B1BE 2Y0BG 3JADA 1N33T 2P9NG 3NOGD 1BU9A 4L2LA 5JHAA 5L3GB 3UUXA 3BQKA 3SNXA 2NTYA 4MLKA 1YYHA 3N9QA 4JI6T 1X81A 4NACA 3L54A 4HXIA 2WXRA 5G55A 1Z8UA 3Q5WA 3ZNGA 2YDSA 5EZYE 4WYVA 4EZ4A 5HRYA 1D8EA 5DBKA 3RYIE 5D66A 4M7CA 3TG5A 3L17A 2W67A 5BMVE 4XKCA 3ULYA 4D10C 3NB2A 4Z91A 3G2SA 4TNWA 3HIZA 4UF0B 2PJQA 5AQHB 3RI5A 4KX6A 3KS2A 4EBAA 2HPLA 4I2ZA 3ULEG 5J0ZA 4GPKA 2LAIA 2VGXA 4DBQA 3C5RA 2ZGGA 2EHOD 3UU5A 3JAFA 3FZLB 1KZOA 2NW8A 3ZYQA 4U7EB 3T9KA 4X1YE 4X64T 5C3JA 2UY1A 3PVLA 3C98B 5L3EB 4CZ2D 3U9WA 2EILE 4AI6A 4HFDA 4LEUA 2XEHA 3VR9A 3SO8A 3V30A 1O1TA 4ERRA 1INZA 3P7IA 4Z8XA 2CE7A 5J90A 5J08A 2CFUA 3LXUX 4FADA 2YNQA 2DCFA 3TKLB 3WAKA 4V3IA 2PL2A 3F31A 1LD8A 2DWKA 3DSXA 1SQMA 5ENPD 1E8YA 1MMGA 1DCEA 4YVQC
chains in the Genus database with same CATH topology
2RD0A 4I6GA 4WWNA 2CCQA 4IIJE 4N78D 4YLHA 3FDHA 2KCKA 4UEMA 5CCMA 5FXVA 2WXPA 2AXVA 2NC9A 3AS5A 4CI2B 2Y4UA 2M63A 1KT1A 2L6JA 4DLQA 1E8WA 3CVXA 2WXFA 4HEAA 3QDNA 3CPZA 3IBEA 4ANXA 3OYZA 3R7QA 5L3BB 4QFVA 3LS8A 5G05C 4JEUB 3C64A 1UG3A 3HKCE 3IEEA 3GZ1A 2BVLA 2Y8DA 3NF1A 2XAHB 3LG7A 3ZPJA 3CKBA 1UCUA 2LO6A 3FTWA 2H7OA 2FO7A 4O4IE 4JHJA 4EYUA 4IN3B 3OTNA 2IW5B 3ENEA 3ONXA 2V1DB 4A1GA 4ZI3C 1UX4A 4G2AA 4BJNA 3GA8A 1E7UA 4I6JA 3SGHA 4IE5A 2DIWA 4BWRA 3PDYA 3ZW3A 3O1HA 3KFWX 4FLHA 1D0XA 2CLYB 3WAJA 3FU3A 1HG5A 4MALA 4J0UA 2ONDA 2BTDA 5ETWA 5LCWC 3GN5A 5ANLA 4GK0E 1YKEB 2OVBA 5A23A 4TUUA 2E2EA 3KVBA 3VHLA 3HVEA 3HKEE 4PS3A 3SOLA 2UXXB 3BK9A 1UJJA 3GWHA 2KT9A 3MZLB 5C2YA 2CEAA 4KP3C 4AY6A 3UT7A 4CXXA 2BVMA 3FU0A 4HOSA 1LKXA 1HU3A 2CWYA 2QFCA 4I1AA 2W62A 3URZA 2KWHA 1ELKA 2DCPA 2Q7FA 4GZ6A 3VLFA 2CM0A 2XHEB 2DHRA 4I4TE 3BQLA 1HZ4A 2EHOB 4AQFA 2E9XA 3CQCB 5JDFA 3D9PA 3VU7H 5H6RB 3AA7B 1ZEEA 5EK2A 3J7Yq 4AV7A 3R6NA 4ANVA 1ZV4X 3MACA 4HGAA 3N71A 1IHGA 3E22E 3HDXA 3D9KA 3FHNA 3MV2B 2K5BB 3KV6A 3HVEB 3MJXA 2CG3A 3B7SA 3RKVA 1WYBA 2IC6A 3Q47B 4N3BA 3EJNA 5FYMA 5FWQA 2L0IA 3CVQA 2VKHA 4OVVA 2WB2A 3ESKA 3D9OA 2AVPA 1D1AA 4JHKA 2OV8A 5AENA 2W0GA 4GZCA 4UQYA 2XEVA 4I1OB 1H0AA 1G8XA 2C2LA 2I59A 3L13A 1LVKA 1ELRA 2X6IA 2E9XB 5FY1A 5KJKA 4AVXA 3R9AB 1JPLA 3PU3A 4IRUA 4J8EA 4B6XA 1IQRA 3ZRHA 1KT0A 4LCTA 4U07A 3OYXA 4G11A 3SZ7A 4YFSA 2W63A 4URKA 3RYHE 3LVRE 5JREA 3DPDA 2KCVA 3AVSA 2PM7A 4AOFA 2LE8A 2XAGB 2YK0A 2NOXA 4U74A 4I6EA 2D0TA 4CDMA 2DBAA 5L3FB 3ZMUB 2VWAA 1NWMX 2V8SE 4A55A 5FMNA 4N2QA 1JWFA 1SZAA 4GYRA 3QK0A 1FMWA 1Y8MA 4GCNA 1NZNA 4IE0A 1DNPA 4GYSA 5G2NA 3EDVA 3PH0C 4UWLA 4AKRB 1G73A 4H9SE 2CMRA 4C91A 2JLBA 2EHOC 4ANWA 3LYAA 3PE4A 1X79A 4ILIA 4GZ3A 3N9OA 4XAXB 3PU8A 5JJ6A 2CWOA 3CX7B 3FH5A 1EF1C 4AKIA 3ONKA 5HQ8A 3ZEFA 3FEXA 4ADZA 1LRZA 2LSVA 2YINA 3MZKB 3RIBA 4H7YA 3ZFWA 3JCKC 4HKAA 5BNWA 3JUIA 3PRZA 1KK7A 4J8SA 3N2KE 2L0TB 4XE0A 2JMHA 4QKNA 4TX5A 3D9LA 2C5JA 5JH7E 2J1DG 5AFUL 3S2AA 3AVRA 3R84B 4CDRA 4I43A 2NXPA 4B0ZA 4AKHA 3C51A 1MQSA 4HN9A 4FI5A 3QB2A 3SHFA 3PUAA 3ZHEA 4KMOA 4WNKA 2JQQA 4AIFA 3ZIMA 3D9NA 4ZOLE 2ZU6B 4B89A 4GA0A 3CHPA 3G2UA 5JDQA 3IHRA 1U3CA 4EBAG 1D1BA 5FY7A 3ZN1B 2CFZA 2I2OA 4DJAA 3CIAA 4PFPA 5DQVA 4P29A 3Q15A 3LBXA 5TAOA 3B13A 4JEHA 2DNXA 2XAJB 4CRWA 5JJ7A 5GONE 3HKDE 5JRCA 4JA9A 4L5GA 4B8AA 4RG9A 4JLEA 4DNDA 3OKQA 4AQGA 4YNDA 3CWZB 4NURA 1LF8A 4AP2A 3S7JA 1H2TC 3MA9A 5JDMA 2V0PA 4WUYA 2L3LA 3CX8B 2NW9A 3CK7A 3APCA 3PUGA 2CA5A 2YHCA 5HYAA 5KDMC 5FQ6A 4XX5A 4GAAA 3APFA 3ZHEB 4WBOA 1MHQA 2WXLA 2LNIA 4DI4A 3RO2A 5KJLA 5CMYA 3LJ3A 3LCAA 3S4UA 2KMFA 1Z3YA 4G26A 4G24A 1KNZA 4IE4A 1H19A 2NSZA 3L3PA 3OJAA 2PQNA 2VSOE 2WAUA 4JEHB 3MKDA 1TJCA 2ACXA 2V7KA 5F3JA 2CHZA 4EZJA 3ML9A 3RX6A 4GZDA 4IULA 5FP3A 3RRCA 1HTJF 3APDA 2LEHA 4KMCA 4H9NC 5FXWA 2VSNA 3CVWA 4UF0A 3P2BA 2YEVC 1U3DA 5FT9A 4OYSA 5LJMA 2XCBA 2VSXE 3C98A 5LYJE 4PAGA 2RG8A 4ZS3A 5JDNA 4PS8A 3MKQA 2VKOA 4MS6A 3TXNA 1D0YA 3I4GA 3EDTB 3FUJA 3HA4A 4H63H 2D0UA 3SBSA 2WQ7A 4L23A 3TXMA 2AXZA 2RA1A 4UWHA 3QUJA 4H9OC 3LJCA 4UQZA 4XBFB 2ZM8A 3RPUA 3JC6D 3CSTA 2GK9A 4F53A 2L8KA 4G25A 4O2AE 4FJZA 3WXXA 5T8IA 5DQWA 5DIZA 5LHGB 4I9CA 2IC9A 4GYOA 4DVDA 3AB3B 4I50E 3QC9A 4RSYA 5KCMA 3IEGA 3FU6A 1WRDA 1A17A 4JEUA 3MKQB 4OK0A 5BPPA 2J9QA 1MNDA 3RC3A 3VKHA 4HE8A 5HXHA 4HTEA 1EDUA 3FFLA 3FUFA 1FIOA 3AAAB 2J08A 1OUVA 4I17A 1MIVA 3DTOA 3B7UX 4G23A 2XAQB 4CXWA 4UVCB 3ZJ1A 3UTKA 1OWAA 3CX6B 3HHMA 4CI3B 1SA0E 1VRBA 2Y4TA 4CZZB 3FH7A 4UV9B 4GMLA 3P1UA 4ISTA 1QUUA 4CI1B 2WVIA 3TG4A 3V5SA 3E08A 2X67A 4ACLA 4PNIA 2JRKA 4EZHA 4BTBA 5EKQD 3ASHA 1ZBPA 4IE6A 3UQ3A 4ZI7E 1QQEA 4EZLA 4WW0A 4MLPA 4W9RA 3FUHA 4AKGA 1WAO1 3D3MA 4PDXA 1YA0A 2WXGA 5ARFA 4R7LA 2C0MA 4C9BB 3ZC0A 2M67A 3KDSE 1VOMA 4FC8A 4X1KE 3CHQA 3FULA 3MGBA 2VKDA 2X9WA 5ENNA 2ILRA 3K3QC 3LY8A 4KUMB 4AEZC 2J09A 2XHEA 1S94A 2WBLA 4JHRA 4UQXA 2EHOA 4GCOA 3UUMA 4MRUA 1KLXA 3U3IA 2ZLYA 5FZSA 3U3WA 3UULA 4PJJA 4EXTA 3QOUA 1MIWA 3ZCJA 4P0BA 2IFUA 4YVOA 2VGYA 1BR4A 4LRZA 4ILUA 5LGUB 4TZ4C 4WNFA 2FI7A 3IKOB 3RRUA 3RKOA 1QSDA 3FTZA 2WM9A 5JVDE 3LPZA 3QAQA 5JR9C 3CHSA 4PK5A 2X6FA 2WSSV 2X6KA 2LJLA 3ZJ2A 4L7TA 4OVUA 4F3VA 3L08A 1D1CA 2J49A 3PUQA 3ESLA 3ZYMA 1E90A 1SZ9A 3GZ2A 2SPCA 4UI9C 3TGOA 4WNEA 2ODVA 3TAXA 3FUKA 4BSXA 3LDZA 4HOTA 1YKHB 4G63A 5J2UE 2HR2A 4ZS2A 3RRMB 2ODUA 4U0ZA 3KD7A 2ZM2A 2I9CA 4KXKB 1IJ5A 5LP0A 5HXCA 4JZYA 4XZCA 2GRLA 3BEEA 4L1BA 4APFA 4NRHB 4FP7A 2HH7A 3FH8A 3QKYA 2XCCA 3KV9A 3CHRA 3LEWA 4CQIA 4JXTA 3D0TA 1WLXA 2X38A 4Q96A 4WNDA 2C5IT 5DABA 1X5BA 4CGWA 3NZQA 3AAEB 2JMKA 3I0OA 3IBPA 1S35A 2R5SA 3CK9A 4EZKA 3U78A 3ZCIA 2X9YA 4K03A 2EQXA 2LM9A 1WY6A 3H3AA 3U4TA 3CK8A 2PQRA 2KZ7B 3SF4A 3K9IA 2KC7A 2X9XA 3H37A 3ZLIA 2QGSA 2V7MA 3E0ZA 2X6JA 2YHEA 4PK4A 3UPVA 2GW1A 4H9PC 4UI9K 3RU0A 1HH8A 4HVBA 2D5UA 5L3DB 1E8XA 2HPJA 4DLOA 1HXIA 3BQIA 2LSKA 5LOZA 1WR6A 2V7JA 3DP7A 2XQ0A 3FBZA 4HLEA 2MTQA 3NQPA 5JDGA 3L09A 2WXOA 4GB9A 1Z3XA 5LXTE 4KVMA 2D2SA 3O1JA 4E85A 4HOUA 2XGSA 4UIGA 3KV4A 4O6FA 4PJLA 4JL0A 2WPVA 1N52A 4B8CB 4UELA 5KMGP 3JC6C 3UFEA 4H9QC 2QA7A 4KYOB 3OXLA 2JEKA 1JUQA 2J07A 4NUVA 2XTLA 3O9XA 4N39A 5FY0A 1NA3A 3E4BA 1YD8G 3TL5A 4I2WA 3CHOA 2X51A 3OXFA 4L2YA 1OWOA 3NRYA 4Y6WA 1UJKA 4N3CA 4K0RA 5JHBA 5LJNA 5KJMA 5A6CA 5FZRA 3OAWA 4GMJA 2LSIA 2FF4A 4GOUA 3CVUA 1WYCA 1NA0A 5DJQC 4FLBA 3O4XE 4XIFA 4A56A 4WNGA 4C0MA 3FU5A 3GMIA 3C4ZA 2ES0A 3LVQE 5LGTB 4BFRA 3CQXC 3RC8A 4I1MA 3UT4A 4U8HA 3FTSA 2KWIB 2Z6EA 2IOLA 4BX9A 4X20E 4KZCA 2KNDA 3CVYA 2XUEA 2VB6A 3RK6A 3N9NA 3LKUA 3CVRA 2FBNA 3RJVA 3VLDA 2XGOA 4KBQA 4O2BE 3Q4AB 3GZSA 3O48A 5JQGE 2Q9QD 3FWVA 3FUIA 5T3RA 3S7FA 3CVVA 2CXLA 3FTYA 3ANWB 1LVFA 3K3NA 4HOQA 2A5UA 4V1Av 5L3CB 4UVAB 3LFMA 4KBMB 2LSUA 3UX4A 4BJMA 3EUHA 5HI7A 1HFAA 1Y64B 2J4DA 5D0OD 4QX8B 4EAHA 1IJ6A 4MFRA 1UN9A 4ABNA 1EPUA 2L9QA 4H9RC 2A4ZA 2J4BA 3MX3A 2X68A 2DWGA 4AXPA 3N9PA 3CV0A 1OWPA 4PJMA 4P09A 1BR1A 2NWBA 1Z0PA 1US7B 1BR0A 1TJFA 1FCHA 4ASKA 2MOZA 4YJ2E 2OVFA 3IV0A 1EYHA 4OFZA 4U72A 3ZN3A 5LG4A 2LOSA 1MIYA 3IHVA 2OA5A 4E6HA 4M1PA 2R17C 1OWLA 4NQ0A 1P5QA 2PG8A 3W15B 4JVSA 4LERA 4PH4B 3AA1B 3OXGA 3MJWA 5LGNB 3CKDA 2KM4A 4ANJA 4KZ0A 2W61A 4O8SA 3KEZA 3FB2A 3QNKA 2LSGA 2H3RA 3PDNA 1HE8A 2A72A 1BR2A 4IHJE 2AW6A 4TRQA 3RRWA 2XRZA 4ZHQE 4EPZA 4OYJA 3PUSA 5A1LA 3CKCA 4GA1A 5E0OA 1H2VC 1B89A 3MKRA 3OBVE 5JR9A 3MXZA 3KINB 3N2OA 3HL6A 2CXFA 3ZC1A 1DVPA 1PC2A 4IDZA 4N2SA 3ZMSB 3FUEA 4AXHA 5FQ8A 2FULA 3LK42 3F2EA 3EIJA 3N5LA 4TN7B 4ZI2D 4TUYE 2C0LA 1D0ZA 3PUKA 4CDNA 5JDHA 2LHNA 3FHEA 3ZMZB 3AA0B 1IAPA 1FEWA 4Q94A 3AU5A 1MMAA 3ML8A 2WXHA 2MHKA 1E1HB 2LT3A 2KZTA 1O3XA 3NZSA 2Q9QB 4WWPA 4CT0A 3HKBE 5ADXL 2IOSA 3T5XA 2XAFB 4GZ5A 4QHOA 5JR9B 3VLEA 3CVLA 1E7VA 5LA6E 5G04J 4HFVA 2WQ6A 2BUGA 5T4YA 3I5PA 5HWYA 3FTXA 1IYGA 4PW8A 3D9MA 3QWWA 2IU1A 4WAFA 2WXQA 4WBNE 4C0EA 3AS4A 2KLQA 3ZYKA 5AIJA 3B57A 1H7CA 4FJYA 2LAHA 4YJ3E 3ASFA 3SI5A 3DBSA 3LK3B 3L16A 3PE3A 4CT4A 1JWGA 2QY7A 4GIWA 1MMDA 3RO3A 1H6KA 2MBGA 5E76A 2Y6XA 2KZTB 2XASB 5FXXA 3NBXX 4GA2A 4RG6A 2N1GA 4FHJA 3KAEA 4DI3A 4O4HE 2K24A 5CA0E 4ME2A 3B7RL 2HYZA 4Q69A 5AYWD 3ULQA 4I9EA 4U04A 3NRXA 3JYSA 2WMOA 4GU5A 2HO1A 2YQ8A 5LBMA 3KBTA 3FP3A 3UUXB 1W3BA 5FQ4A 2WXNA 4F1SA 2IF4A 4BT9A 3JQ1A 2R59A 1ZKEA 2WXKA 4Y6CA 4XKBA 2PFVA 5J2TE 2MOWA 3G2WA 3FXEB 4CCAA 4PK6A 4MBQA 2WMNA 2XPIA 2VGXB 3SFZA 4BAYB 2MRIA 3UT5E 2E9XD 4PFOA 5HXSA 2UY1B 3RYFE 2C0SA 5C1DA 3PZDA 3ZGQA 4U0SA 4IGUA 2N9DA 4BTAA 4EIWA 3LY7A 2VASA 3S7DA 4E7ZA 2NW7A 3CR3A 5HWXA 3R7RA 5M72A 4I55E 5LHIB 3QJZA 4PUCA 5E75A 5CB4E 2W00A 2DI4A 3MA5A 1FMVA 2Q9QC 2CHXA 2IJGX 3EIQC 4JUYA 4MHCA 3G2TA 1NP7A 4H63V 3LK2B 1HO8A 2X3MA 2XQYA 1IZNB 1UN8A 5L2LA 3BG1B 5JJTA 3T8OA 4EYYR 4QXHB 4DBRA 2XGMA 4G2VA 3D9JA 3I9WA 1HCIA 2MYSA 4JPSA 3F57A 3QWPA 1MNEA 3PNLB 1SHZC 4O4LE 1QZ2A 2WXMA 4CXYA 3ZN0B 1V9DA 3C4WA 4QXBB 2LSJA 2WXJA 4AKLA 3GYZA 2L9BA 4TV9E 1TEZA 3NZPA 4EOZB 4LUNU 4C90A 1XGWA 3M65A 3A5XA 2VK9A 2YU1A 2LHRA 3SBTB 3DJBA 3K3OA 4F7AA 1HS6A 5LHHB 2FEZA 4UV8B 1GW6A 2X0LB 4O4JE 1VDYA 4DMWA 3CVPA 4QX7B 1IQUA 3MYVA 3SWHA 3U64A 1FVHA 4U63A 5H6QB 4TV8E 5JDLA 2LSYA 2G0UA 2LOPA 3Q2MA 5ARGA 3HYMB 3ZMVB 4E7SA 4ILGA 2WWUA 1MMNA 5AJDA 5BT1A 4N3AA 5FTPA 2A2FX 1E96B 3GN5B 4TV3A 1L5JA 4XI9A 2JJ9A 4KT6B 4B94A 2IAKA 3JQ0A 4IE7A 3EHMA 2K48A 4K0UA 4EQFA 1WM5A 2E0IA 4AY5A 2GRMA 2IONA 1ZU2A 2VL8A 3PTRB 3IHYA 3LY9A 4PJNA 1ZHCA 2VKJA 3CHMA 4H7XA 2NTXA 3FBLA 5KJNA 4P0AA 5D0QD 3CSFA 3VTXA 3FUDA 3AAIA 3PEVB 3FY4A 4JA7A 2UWJG 4BT8A 3UUNA 4HORA 5G05J 4L0RA 4NUUA 3PE0A 3ETUA 4JW1A 3MK7C 4XZ4A 2HM8A 1B7TA 3VKGA 5J1GA 2V5FA 4ZI2C 4OHFA 3Q9DA 3GW4A 1ELWA 3TJPA 4FULA 3AS8A 3N2GE 3Q5XA 4GYWA 2CLYC 3B7TA 3CVNA 5LFAA 3ZXSA 1U4QA 1U5PA 4N5CA 3J9X1 5BV0A 3SS1A 2X6HA 2KATA 1AJ3A 4RVBA 5IHYA 2ZMAA 3PS6A 5LCWJ 3HR0A 2P9BA 5CCLA 4BY6A 4EECA 2PZIA 2V26A 3ANWA 1BPOA 5FJYA 5EX3A 4APOA 4GYYA 4ILHB 2B1EA 1NAFA 2WXIA 3Q5MA 1CUNA 3CGHA 2K9AA 4ANUA 5EDSA 2C5KT 2I1KA 1S0PA 2VJ8A 4DMVA 5LOVE 4A1SA 5CA1E 3ZVVA 4UI9J 4M3OA 1OXZA 3CLJA 3N9LA 4FU3A 5AJLA 4GK5E 2P58C 3N9MA 2OOEA 2DLRA 4G1TA 2I1JA 3L22A 5ANRA 2BZBA 2Y3AA 3FXDB 3RH3A 5CMWA 3MEKA 5FNVE 2XRYA 5F8PA 3RRNB 3CEQA 2V4LA 3FTVA 4PS7A 2Y48B 1E8ZA 3PREA 2VSYA 4ZI3D 4F6RC 4QXCB 4BX8A 1N54A 4BA9A 3I1AA 4EB6E 5CHEE 1QNFA 2IQCA 4MKTA 5LX8A 1H2UA 4HS2A 3CMLA 1YW0A 3I9YA 3FEYA 1OWNA 1UX5A 5FQ7A 3VTYA 5G04C 3ASDA 1EZ3A 4JC8A 5BW8C 1HS7A 3WI3A 4AQFC 2E9XC 3AA6B 4UVBB 1HG2A 5M4YA 2JPFA 1PY1A 1Z6TA 3L6AA 4IYPA 3O4ZA 2I6HA 4ATGA 1HF8A 3UMVA 4OYKA 2H7VC 3ZEFB 3UT8A 4ACKA 4UWFA 4UXNB 2XPZA 3KVAA 3FUNA 4UWKA 4FA6A 3IF8B 3U66A 5IYZE 3RYCE 1UW4B 3NZUA 4KVOA 5LCYA 4UWGA 3ASGA 3KV5A 4DK5A 3PUJA 2V7IA 5LP6E 2E8IA 2V7LA 5LBQB 5EK4A 3O1IA 1PAQA 4HFGA 4AM9A 1FVFA 2ZM0A 4I43B 5KX5E 4J8FA 3D9IA 3Q49B 2YU2A 5BUZA 4J2CA 2VTBA 2A3DA 4DPRA 2X9HA 4ISSA 2PBIA 1XNFA 4FJOA 3PNTB 3SRZA 3EHNA 4CGVA 3T5VA 3BG0B 4QWNB 3PURA 2Q9QA 4A3VA 3P8CD 3QARA 5EX0A 3C4XA 4U0UA 1OWMA 2UXNB 3ZPOA 3QWVA 5HXEA 4XI0A 5C8YE 4CEMA 2CHWA 3S7BA 1HX8A 3AU4A 4J8DA 3QC1A 4AJWA 3I4RB 2BF0X 2KCLA 3MCXA 3LBXB 3ZMTB 3V5UA 5FZQA 1T98A 4WWOA 2KXPB 3FUMA 2RP4A 5HAXA 2XPYA 2KINB 3MV3B 3KBUA 3QK6A 5JRCB 2CG2A 5EK3A 1Y6IA 5HXRA 5A7DB 2AWIA 3I0QA 3ONLA 4DO0A 2AXUA 3C50A 2PM6A 2GGFA 4L9IA 5FXZA 3HI2A 3SD5A 3G2VA 4FHKA 2N2NA 2VTBB 2X66A 2VQ2A 4X1IE 2VYIA 3T8MA 4A3TA 2WQHA 3CQGB 5BV1A 2CXDA 3ETVA 3ZYLA 4J6IA 2NP9A 3FTUA 3EVYA 2BDEA 3PEUB 3K8PC 5LNKA 3EDUA 3I3NA 4YHJA 4L2LA 5JHAA 5L3GB 3UUXA 3BQKA 3SNXA 2NTYA 4MLKA 3N9QA 4NACA 3L54A 4HXIA 2WXRA 5G55A 3Q5WA 5EZYE 4EZ4A 5DBKA 3RYIE 3TG5A 3L17A 5BMVE 4XKCA 4D10C 3G2SA 3HIZA 4UF0B 2PJQA 3KS2A 4EBAA 2HPLA 4I2ZA 4GPKA 2LAIA 2VGXA 4DBQA 2EHOD 2NW8A 3ZYQA 4X1YE 2UY1A 3PVLA 3C98B 5L3EB 3U9WA 4AI6A 4LEUA 4ERRA 1INZA 3P7IA 4Z8XA 2CE7A 5J90A 5J08A 2CFUA 3LXUX 4FADA 2YNQA 2DCFA 3TKLB 3WAKA 4V3IA 2PL2A 3F31A 2DWKA 1SQMA 1E8YA 1MMGA 4YVQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WMO A;  3B13 A;  3VHL A;  2YIN A;  2WMN A;  2WM9 A; 
#chains in the Genus database with same CATH topology
 5ABF A;  3BUA A;  2ETC A;  3DPY A;  1OED A;  2RD0 A;  4I6G A;  4WWN A;  3DSW A;  2CCQ A;  2YDR A;  4IIJ E;  4N78 D;  4YLH A;  4YSX A;  5FKY A;  3FDH A;  2KCK A;  4UEM A;  1TNU A;  5CCM A;  1Q2Z A;  5FXV A;  2WXP A;  2AXV A;  5ENR D;  2NC9 A;  3AS5 A;  2E5V A;  4HI9 A;  3AE5 A;  4CI2 B;  2Y4U A;  2M63 A;  1KT1 A;  2L6J A;  4MBG A;  1E8W A;  4DLQ A;  2KXP C;  3CVX A;  2WXF A;  4HEA A;  3QDN A;  3CPZ A;  3IBE A;  2YDQ A;  5ENQ D;  3UU6 A;  4ANX A;  2UUA T;  3OYZ A;  3R7Q A;  5L3B B;  4QFV A;  3LS8 A;  5G05 C;  4JEU B;  3C64 A;  2QRX A;  3HKC E;  3IEE A;  3P4S A;  1UG3 A;  4EHM A;  3GZ1 A;  3HXF A;  2BVL A;  2Y8D A;  2B6C A;  3NF1 A;  2XAH B;  3LG7 A;  3ZPJ A;  1VCT A;  3CKB A;  1UCU A;  1JCR A;  2LO6 A;  3FTW A;  2H7O A;  3TWR A;  2FO7 A;  2XY8 B;  4O4I E;  3HXC A;  4JHJ A;  4EYU A;  2UXB T;  2IUB A;  4IN3 B;  4YDW A;  3OTN A;  2IW5 B;  3ASN E;  3ENE A;  3ONX A;  2V1D B;  3P4Q A;  4A1G A;  2XM2 A;  4DUI A;  5ABF B;  3JCF A;  4ZI3 C;  1UX4 A;  4G2A A;  5CER B;  4BJN A;  2JQH A;  2BG9 E;  3GA8 A;  1E7U A;  1SA5 A;  4I6J A;  2PTF A;  3SGH A;  4IE5 A;  2DIW A;  4BWR A;  3PDY A;  3ZW3 A;  3O1H A;  3KFW X;  4FLH A;  1D0X A;  2CLY B;  4DR4 T;  3WAJ A;  5HCJ A;  3FU3 A;  1HG5 A;  3T8K A;  1E2A A;  4I0U A;  4MAL A;  3EHR A;  4J0U A;  2OND A;  5AQQ B;  2BTD A;  4G8K A;  5ETW A;  3PZ1 A;  5LCW C;  3GN5 A;  5ANL A;  4GK0 E;  1YKE B;  2OVB A;  5A23 A;  4TUU A;  1WDY A;  1KNR A;  1W9R A;  2E2E A;  2MYO A;  3KVB A;  3VHL A;  3HVE A;  3HKE E;  4PS3 A;  4KHP T;  4RLY A;  3SOL A;  3PZ2 A;  2H88 A;  3AEE A;  2UXX B;  3BK9 A;  2F37 A;  1N4S A;  1UJJ A;  2WP9 A;  2KT9 A;  3GWH A;  3MZL B;  5C2Y A;  2CEA A;  4KP3 C;  3TWX A;  5C2T A;  4AY6 A;  1JCS A;  3UT7 A;  5AQT B;  4CXX A;  3NAW A;  2BVM A;  1TN8 A;  3FU0 A;  4HOS A;  2CRB A;  1LKX A;  1HU3 A;  4LFC T;  2CWY A;  2QFC A;  4I1A A;  2W62 A;  3UU4 A;  3URZ A;  3ISM C;  2HHH T;  2KWH A;  1ELK A;  2DCP A;  2Q7F A;  4GZ6 A;  1SE7 A;  3VLF A;  2CM0 A;  2WZI A;  2XHE B;  2DZN A;  2DHR A;  2H6I A;  4I4T E;  2XZD G;  3DXM G;  3BQL A;  1HZ4 A;  2EHO B;  2X0Y A;  4AQF A;  2BED A;  2XEE A;  2E9X A;  3CQC B;  5JDF A;  3AAA C;  3PUX F;  3D9P A;  5EYP F;  3VU7 H;  5H6R B;  2AXD S;  4UR9 A;  3AA7 B;  3V31 A;  1ZEE A;  5EK2 A;  3J7Y q;  1SA4 A;  2CPT A;  1K3Z D;  3G06 A;  4AV7 A;  3J5P A;  3R6N A;  5EID A;  1S70 B;  4ANV A;  1ZV4 X;  3MAC A;  4HGA A;  4TWF A;  4U7Y A;  2XQ4 A;  1IHG A;  2B0O E;  3E22 E;  3N71 A;  3HDX A;  2NR4 A;  4O60 A;  3D9K A;  3FHN A;  3MV2 B;  4HNA D;  2K5B B;  3KV6 A;  3HVE B;  3MJX A;  2CG3 A;  3B7S A;  3RKV A;  1WYB A;  2IC6 A;  4DR2 T;  3Q47 B;  3EJN A;  4N3B A;  5FYM A;  5FWQ A;  1M7K A;  2L0I A;  3CVQ A;  2VKH A;  2OLT A;  3EHZ A;  4OVV A;  2WB2 A;  3ESK A;  1LTX A;  3D9O A;  2AVP A;  1D1A A;  4JHK A;  2OV8 A;  5AEN A;  2W0G A;  4GZC A;  4UQY A;  2L6B A;  4JI5 T;  2XEV A;  4LNG A;  4I1O B;  1H0A A;  1UUS A;  4JI2 T;  3ONJ A;  1G8X A;  2C2L A;  4DV6 T;  2I59 A;  3TLV A;  3L39 A;  3L13 A;  5D2M C;  1LVK A;  1ELR A;  2X6I A;  4TXP A;  3V79 K;  2E9X B;  5FY1 A;  5KJK A;  1HNZ T;  4AVX A;  3R9A B;  1JPL A;  1DU2 A;  5HKP A;  3PU3 A;  4IRU A;  4J8E A;  4B6X A;  1IQR A;  1TNO A;  4HI8 A;  1ZP0 A;  1BD8 A;  3ZRH A;  1KT0 A;  4LCT A;  4U07 A;  3OYX A;  4G11 A;  3SZ7 A;  2D9D A;  4YFS A;  2W63 A;  4URK A;  3RYH E;  3LVR E;  5JRE A;  4TXQ A;  1HR0 T;  3DPD A;  2KCV A;  4EED A;  2X0H A;  3AVS A;  2PM7 A;  4AOF A;  1K1A A;  2LE8 A;  2XAG B;  1OCC E;  2YK0 A;  2NOX A;  3QNU A;  4U74 A;  2H6H A;  3ZT5 A;  1W0A A;  4U3C A;  4OAV B;  4I6E A;  2D0T A;  4CDM A;  4TXR A;  2DBA A;  5L3F B;  2W66 A;  3EU9 A;  2XM1 A;  1J1J A;  3ZMU B;  2VWA A;  1NWM X;  4EEB A;  2V8S E;  4A55 A;  5FMN A;  4N2Q A;  1NEN A;  4IRE A;  1JWF A;  2V6X A;  1SZA A;  2IO2 C;  3UIO C;  4GYR A;  3QK0 A;  3TWT A;  1FMW A;  1Y8M A;  4K0K T;  4GCN A;  2XQ8 A;  1NZN A;  2BS2 A;  5AQB A;  4IDP A;  4IE0 A;  1U2V G;  1DNP A;  4GYS A;  5G2N A;  3Q7A A;  3EDV A;  1TNZ A;  3PH0 C;  4UWL A;  4AKR B;  1G73 A;  4H9S E;  2CMR A;  4C91 A;  5AN8 A;  1Z5S C;  2JLB A;  2EHO C;  4ANW A;  4DV1 T;  3LYA A;  3AE9 A;  2XQA A;  3PE4 A;  1X79 A;  4ILI A;  4GZ3 A;  3CK6 A;  3N9O A;  1WR0 A;  3E32 A;  4XAX B;  3PU8 A;  5JJ6 A;  2CWO A;  3CX7 B;  2M6I A;  3FH5 A;  1EF1 C;  4AKI A;  3ONK A;  5AQM B;  5HQ8 A;  3ZEF A;  3FEX A;  4ADZ A;  4EGW A;  1O1S A;  3L8R A;  1LRZ A;  4X66 T;  2LSV A;  2YIN A;  3MZK B;  1OT8 A;  3RIB A;  1VCS A;  4H7Y A;  3ZFW A;  3JCK C;  4HKA A;  5BNW A;  3JUI A;  2CBJ A;  4HBD A;  3UM0 A;  3PRZ A;  1KK7 A;  4J8S A;  3N2K E;  3RIA A;  2KBX A;  2L0T B;  4XE0 A;  3T1Y T;  2JMH A;  4QKN A;  4TX5 A;  4QQI A;  3ZXP A;  2AE9 A;  3A8Y C;  3D9L A;  3PZ3 A;  2XEN A;  3AEB A;  2C5J A;  5JH7 E;  4WZX A;  2J1D G;  4Z90 A;  5AFU L;  3S2A A;  3AVR A;  3R84 B;  4CDR A;  1KFY A;  2V5D A;  4I43 A;  2NXP A;  4B0Z A;  4AKH A;  4Q25 A;  3C51 A;  1MQS A;  1N95 A;  4HN9 A;  4A5X A;  4IL4 A;  4YTM A;  2YKS A;  4FI5 A;  3QB2 A;  3SHF A;  1FT2 A;  3PUA A;  2BKG A;  3NKZ A;  2DL1 A;  3ZHE A;  4KMO A;  4WNK A;  4HB5 A;  2JQQ A;  4AIF A;  4HWC A;  4DX2 A;  3ZIM A;  3D9N A;  4ZOL E;  2ZU6 B;  4B89 A;  3HXD A;  3Q7F A;  4GA0 A;  3CHP A;  3G2U A;  5JDQ A;  3PNT B;  3IHR A;  3JXJ A;  4Z68 A;  1U3C A;  3TWS A;  4EBA G;  1D1B A;  5FY7 A;  3ZN1 B;  2CFZ A;  3BU8 A;  2I2O A;  4DJA A;  2ZIS A;  2OEW A;  3CIA A;  1I6Z A;  4PFP A;  5DQV A;  5JMN D;  4P29 A;  3Q15 A;  4HQD A;  3LBX A;  5TAO A;  3B13 A;  4JEH A;  2DNX A;  2XAJ B;  4CRW A;  2BKP A;  5JJ7 A;  5GON E;  3HKD E;  4LF9 T;  5JRC A;  4JA9 A;  4L5G A;  2QC9 A;  1WG0 A;  4B8A A;  4DX5 D;  4IDQ A;  4GTP A;  4RG9 A;  4NXM T;  4JLE A;  5AQI B;  4DND A;  1CHU A;  3OKQ A;  4AQG A;  4YND A;  2XQ3 A;  3CWZ B;  4NUR A;  1LF8 A;  4BES A;  3TWV A;  1XDP A;  4AP2 A;  3S7J A;  1H2T C;  3VRA A;  3MA9 A;  5JDM A;  2V0P A;  4WUY A;  1T72 A;  2L3L A;  3CX8 B;  4LNB A;  2NW9 A;  3CK7 A;  1OCR E;  3APC A;  3PUG A;  2CA5 A;  5JA4 D;  2YHC A;  5HYA A;  5KDM C;  2XSB A;  5FQ6 A;  4HRM B;  4XX5 A;  2R03 A;  1MZC A;  4GAA A;  3APF A;  3ZHE B;  2JIW A;  4IT4 A;  4WBO A;  2MPK A;  1MHQ A;  2WXL A;  2BBJ A;  2LNI A;  4DI4 A;  3RO2 A;  5KJL A;  2PNN A;  5CMY A;  2FBW A;  4AQY T;  3LCA A;  3LJ3 A;  2XQ9 A;  3S4U A;  2KMF A;  3HXE A;  4U7I A;  2QYJ A;  1Z3Y A;  4DUZ T;  5LMU T;  4G26 A;  4G24 A;  2QYW A;  1KNZ A;  4IE4 A;  1H19 A;  2NSZ A;  5B1A E;  3L3P A;  3OJA A;  3LJN A;  2PQN A;  2VSO E;  2WAU A;  4IL9 A;  4JEH B;  1H6P A;  3MKD A;  1TJC A;  2ACX A;  2V7K A;  2CHN A;  4DV4 T;  5F3J A;  3C72 A;  2CHZ A;  4EZJ A;  4K5B A;  3ML9 A;  3RX6 A;  3ZST A;  4GZD A;  4IUL A;  5FP3 A;  3RRC A;  1HTJ F;  3APD A;  2LEH A;  4KMC A;  4H9N C;  5FXW A;  2VSN A;  3CVW A;  1XDO A;  4TWD A;  4UF0 A;  1TN6 A;  3P2B A;  3B7B A;  2YEV C;  1U3D A;  5FT9 A;  3QB5 K;  1E7P A;  4OYS A;  5AQO B;  4COF A;  5LJM A;  2XCB A;  2VSX E;  2I0M A;  5ABE A;  4J7W A;  5H7P A;  3C98 A;  5LYJ E;  4PAG A;  2RG8 A;  4ZS3 A;  2EIJ E;  5JDN A;  2FJD A;  4PS8 A;  3AE7 A;  4AIU A;  3MKQ A;  2VKO A;  4MS6 A;  3TXN A;  1D0Y A;  5AQJ B;  3I4G A;  3EDT B;  3UM3 A;  3FUJ A;  3HA4 A;  4H63 H;  2D0U A;  2F0Y A;  3SBS A;  4IDO A;  2WQ7 A;  4L23 A;  1ZB1 A;  3TXM A;  4YT0 A;  5AQG B;  2AXZ A;  3L82 A;  1KNP A;  2RA1 A;  2P2C P;  3QUJ A;  4H9O C;  4UWH A;  3LJC A;  4UQZ A;  4LNU D;  4YDY A;  5AQS B;  4XBF B;  2ZM8 A;  3RPU A;  3JC6 D;  2RFM A;  3DEP A;  5AQP B;  4HWH A;  3CST A;  2GK9 A;  4F53 A;  2L8K A;  4G25 A;  2XS8 A;  4O2A E;  4FJZ A;  3WXX A;  4X62 T;  5T8I A;  5DQW A;  5DIZ A;  1T7S A;  5LHG B;  3ABM E;  4I9C A;  2LXM A;  1OED E;  5CFB A;  2ZXW E;  2IC9 A;  2XZE A;  4GYO A;  4DVD A;  1XMO T;  3AB3 B;  3OVU A;  4I50 E;  5BXO A;  3QC9 A;  4RSY A;  5KCM A;  3AJI A;  3IEG A;  3FU6 A;  3UKR G;  1WRD A;  2J62 A;  2HN2 A;  1R8I A;  1A17 A;  4JEU A;  1TR4 A;  3MKQ B;  4OK0 A;  5BPP A;  2J9Q A;  1MND A;  3RC3 A;  3VKH A;  1YMP A;  4HE8 A;  3K1S A;  4HTE A;  5HXH A;  1EDU A;  3FFL A;  3FUF A;  1V55 E;  1FIO A;  3AAA B;  2J08 A;  1OUV A;  4I17 A;  1MIV A;  3DTO A;  4QH1 A;  3B7U X;  3RHW A;  4G23 A;  2XAQ B;  4CXW A;  4UVC B;  3ZJ1 A;  3UTK A;  1OWA A;  3CX6 B;  3HHM A;  2WDQ A;  3SFE A;  4CI3 B;  1ZOY A;  1SA0 E;  1IBM T;  5AAO A;  1VRB A;  4HWD A;  2Y4T A;  3E34 A;  4CZZ B;  3FH7 A;  3UU3 A;  4UV9 B;  1YQ3 A;  4GML A;  2GRN B;  3P1U A;  4IST A;  1QUU A;  4CI1 B;  2WVI A;  3TG4 A;  5HEJ A;  3V5S A;  4GPM A;  3E08 A;  2X67 A;  3FZH B;  3X1D A;  2R02 A;  2A5E A;  2UUC T;  4PNI A;  4ACL A;  3B5M A;  2UU9 T;  2JRK A;  4EZH A;  4BTB A;  5EKQ D;  3ASH A;  1ZBP A;  4IE6 A;  4BSZ B;  3UQ3 A;  4ZI7 E;  4YDE A;  2CBI A;  1QQE A;  4EZL A;  2R05 A;  4WW0 A;  4MLP A;  4W9R A;  3FUH A;  4ZHB A;  5ABH A;  4AKG A;  1WAO 1;  3D3M A;  4PDX A;  1YA0 A;  2WXG A;  5ARF A;  4R7L A;  2EIM E;  2C0M A;  1S63 A;  4C9B B;  3ZC0 A;  2M67 A;  2F8X K;  3KDS E;  1VOM A;  1NFI E;  4FC8 A;  4X1K E;  3CHQ A;  3FUL A;  3MGB A;  2VKD A;  2X9W A;  5ENN A;  3ZUV B;  2ILR A;  1KEY A;  3K3Q C;  1S64 A;  3LY8 A;  1WFD A;  4KUM B;  4AEZ C;  2J09 A;  2XHE A;  1S94 A;  3EUV A;  2WBL A;  4JHR A;  4BET A;  2RPA A;  1OXJ A;  4UQX A;  2EHO A;  4GCO A;  3UUM A;  4MRU A;  1KLX A;  3U3I A;  3AE3 A;  2ZLY A;  5FZS A;  4ILB A;  3UUL A;  3U3W A;  4PJJ A;  4EXT A;  4B93 B;  3QOU A;  3LSV A;  2IO3 C;  3ABK E;  1MIW A;  3ZCJ A;  4P0B A;  4LMJ A;  2IFU A;  4YVO A;  2VGY A;  1BR4 A;  2FJB A;  5ABG A;  4GTT A;  3NBN B;  4LRZ A;  3SY2 A;  2AJA A;  4ILU A;  2WU5 A;  5LGU B;  4TZ4 C;  4WNF A;  3DRA A;  2FI7 A;  3IKO B;  3RRU A;  3RKO A;  2XJ7 A;  1QSD A;  3FTZ A;  1N32 T;  2WM9 A;  5JVD E;  3LPZ A;  3QAQ A;  1XZY A;  5JR9 C;  3CHS A;  4PK5 A;  3OPC A;  2X6F A;  4DRX E;  3AEA A;  2WSS V;  1IBL T;  3WG7 E;  2BKN A;  2X6K A;  2LJL A;  2OCC E;  4DX6 D;  3ZJ2 A;  3P4P A;  4DR5 T;  3Q73 A;  4L7T A;  4OVU A;  4F3V A;  4XEI G;  3L08 A;  3PZ4 A;  1OCO E;  1D1C A;  3PUQ A;  2J49 A;  3ESL A;  3ZYM A;  2WU2 A;  1E90 A;  1SZ9 A;  3GZ2 A;  2SPC A;  1UOH A;  2LUH A;  4UI9 C;  5L47 A;  3TGO A;  3PUV F;  4WNE A;  2ODV A;  2P9K G;  2P9S G;  3TAX A;  3FUK A;  4JD2 G;  4BSX A;  3LDZ A;  3AXJ B;  4HOT A;  3Q9N C;  1YKH B;  4DUY T;  2WWV A;  4G63 A;  4LML A;  5CRV A;  4LFA T;  4GTO A;  5J2U E;  4DID B;  2HR2 A;  5B3S E;  4ZS2 A;  3RRM B;  3Q5E A;  3PJA A;  2ODU A;  4U0Z A;  3KD7 A;  2ZM2 A;  2I9C A;  3AE4 A;  4CYM D;  4KXK B;  1IJ5 A;  5LP0 A;  5HXC A;  5LG3 A;  3QB5 A;  4JZY A;  3SFX A;  2GRR B;  4XZC A;  2GRL A;  3BEE A;  4L1B A;  4APF A;  4NRH B;  4FP7 A;  5CBN A;  2HH7 A;  2ZM6 T;  3FH8 A;  3QKY A;  2XCC A;  3KV9 A;  1AWC B;  3CHR A;  3LEW A;  4LF6 T;  4HRN A;  4CQI A;  4JXT A;  4P1N A;  3D0T A;  1IBK T;  1QYM A;  3R9M A;  4DX7 D;  3UUB A;  2LXL A;  1H6O A;  1WLX A;  3SFD A;  2X38 A;  4Q96 A;  4WND A;  2C5I T;  5DAB A;  1X5B A;  4CGW A;  2DYR E;  3NOC D;  3NZQ A;  3AAE B;  2JMK A;  3I0O A;  3IBP A;  5ENO D;  3T1H T;  1S35 A;  2R5S A;  4DV3 T;  2BG9 B;  3CK9 A;  4EZK A;  3U78 A;  3ZCI A;  2X9Y A;  1O1R A;  4K03 A;  2EQX A;  3AEC A;  2LM9 A;  1WY6 A;  3H3A A;  3U4T A;  3CK8 A;  2PQR A;  2KZ7 B;  4DR1 T;  3SF4 A;  3K9I A;  3RGL A;  5HCM A;  2V4H C;  3M3Z B;  1HX1 B;  2KC7 A;  2X9X A;  3H37 A;  2A9U A;  3ZLI A;  4U8V D;  2QGS A;  2V7M A;  2WDV A;  3E0Z A;  2X6J A;  2YHE A;  4PK4 A;  3UPV A;  2GW1 A;  4H9P C;  4UI9 K;  3RU0 A;  1HH8 A;  4HVB A;  1JNR A;  5BXU A;  4TUM A;  2D5U A;  2ACZ A;  3DXK G;  5L3D B;  1E8X A;  2HPJ A;  4DLO A;  5FVL A;  5EIB E;  5CBO A;  3AG4 E;  2J8S D;  1HXI A;  3BQI A;  4LSZ E;  2LSK A;  1I94 T;  5LOZ A;  1WR6 A;  2V7J A;  3DP7 A;  3LDQ B;  2XQ0 A;  4BER A;  3FBZ A;  4HLE A;  2MTQ A;  2LLY A;  3NQP A;  4YSY A;  5JDG A;  3L09 A;  2ETA A;  2WXO A;  4GB9 A;  4CN4 A;  1Z3X A;  4ZXL A;  5LXT E;  2EIN E;  4KVM A;  4JI0 T;  2V6Y A;  2D2S A;  3O1J A;  4E85 A;  5CEC B;  4DV2 T;  4HOU A;  1UK5 A;  2XGS A;  4UIG A;  1MX4 A;  3KV4 A;  4O6F A;  4HFH A;  4PJL A;  1KPS B;  4JL0 A;  2WPV A;  1N52 A;  4B8C B;  4UEL A;  5KMG P;  3JC6 C;  3UFE A;  4H9Q C;  2QA7 A;  4KYO B;  3OXL A;  2JEK A;  1JUQ A;  4RQI A;  2J07 A;  4NUV A;  4O1P A;  2XTL A;  3O9X A;  2VQF T;  4N39 A;  5FY0 A;  1NA3 A;  3E4B A;  1YD8 G;  3TL5 A;  4I2W A;  3C3O A;  4GTR A;  4K5C A;  3CHO A;  2X51 A;  4O1O A;  3OXF A;  5HEG A;  4L2Y A;  1OWO A;  3NRY A;  4Y6W A;  1UJK A;  4N3C A;  2DWZ A;  4K0R A;  5LJN A;  5JHB A;  5KJM A;  5A6C A;  5FZR A;  3OAW A;  4GMJ A;  2LSI A;  2FF4 A;  4GOU A;  1WCR A;  3RLF F;  5FIO A;  3CVU A;  1WYC A;  1NA0 A;  5DJQ C;  4FLB A;  3H3M A;  1M62 A;  3O4X E;  4XIF A;  2RFA A;  4A56 A;  3AEG A;  2F8Y A;  4WNG A;  2H6F A;  4C0M A;  3FU5 A;  3GMI A;  3VR8 A;  3C4Z A;  2ES0 A;  3LVQ E;  5LGT B;  1N4P A;  4BFR A;  3TLU A;  3CQX C;  5AQU B;  3RC8 A;  4I1M A;  3UT4 A;  4U8H A;  4HFI A;  2V6Y B;  3FTS A;  2MAW A;  2KWI B;  2Z6E A;  2IOL A;  1QLB A;  4GTM A;  4BX9 A;  4X20 E;  4KZC A;  2KND A;  3CVY A;  2XUE A;  2VB6 A;  3AEF A;  3RK6 A;  3N9N A;  2XS1 A;  3LKU A;  5L4H A;  1XMQ T;  3CVR A;  1IHB A;  3TLT A;  1HNW T;  2FBN A;  3RJV A;  1K1B A;  3VLD A;  2XGO A;  4NPP A;  4KBQ A;  3RIF A;  4O2B E;  3Q4A B;  1YCS B;  3GZS A;  3O48 A;  5JQG E;  2Q9Q D;  3FWV A;  3FUI A;  5T3R A;  3S7F A;  3L9T A;  5F5W A;  3CVV A;  2CXL A;  3CIR A;  3FTY A;  3ANW B;  1N4R A;  1LVF A;  3K3N A;  4HOQ A;  4ZZB A;  2BG9 C;  2A5U A;  2B76 A;  4V1A v;  5L3C B;  1W0B A;  4UVA B;  3LFM A;  4KBM B;  2LSU A;  3UX4 A;  2QYU A;  4BJM A;  3EUH A;  3C3R A;  5HI7 A;  1HFA A;  1Y64 B;  4JB8 P;  1N94 A;  2J4D A;  5D0O D;  4QX8 B;  4EAH A;  1IJ6 A;  2E5L T;  2ZIR A;  4MFR A;  1UN9 A;  4ABN A;  4QH5 A;  1J5W A;  1EPU A;  2L9Q A;  4H9R C;  4KI0 F;  3AE6 A;  2A4Z A;  2J4B A;  3MX3 A;  2X68 A;  2DWG A;  4AXP A;  3N9P A;  2ETB A;  3CV0 A;  5LB7 B;  1SUM B;  1OWP A;  2VUR A;  2J4G A;  4PJM A;  3KSL A;  2RKK A;  4P09 A;  1BR1 A;  2NWB A;  1IXV A;  1BLX B;  1Z0P A;  1US7 B;  1BR0 A;  1TJF A;  1FCH A;  1N0R A;  4ASK A;  2MOZ A;  4YJ2 E;  2OVF A;  3IV0 A;  3KSQ A;  1EYH A;  4OFZ A;  4U72 A;  3OTO T;  3ZN3 A;  3BQO A;  5LG4 A;  3UM2 A;  2LOS A;  1MIY A;  3IHV A;  2OA5 A;  4E6H A;  2JQ9 A;  4M1P A;  2R17 C;  3AED A;  1N36 T;  4HWF A;  5BR8 T;  2NYJ A;  1OWL A;  2GRO B;  3AG2 E;  4NQ0 A;  1P5Q A;  2PG8 A;  3W15 B;  4JVS A;  4LER A;  4PH4 B;  3AA1 B;  3OXG A;  3MJW A;  5LGN B;  3CKD A;  2KM4 A;  4ANJ A;  4KZ0 A;  2Y1L E;  2W61 A;  4O8S A;  3KEZ A;  3FB2 A;  3QNK A;  1J5E T;  5ENS D;  2LSG A;  5AQR B;  2LKH A;  2H3R A;  1MX2 A;  4JI1 T;  3PDN A;  2XPK A;  1HE8 A;  2A72 A;  1BR2 A;  4IHJ E;  4LF8 T;  2AW6 A;  4TRQ A;  3RRW A;  4DR3 T;  4ZHQ E;  2XRZ A;  4EPZ A;  1MX6 A;  4BEP A;  4OYJ A;  3PUS A;  5A1L A;  2XQ5 A;  3CKC A;  4GA1 A;  2WDR A;  5KNH D;  5E0O A;  1H2V C;  1B89 A;  4YTP A;  1RZ4 A;  3OBV E;  5JR9 A;  3MKR A;  2P9P G;  3MXZ A;  3KIN B;  4NIQ A;  2WS3 A;  3N2O A;  3C3Q A;  3HL6 A;  2CXF A;  3ZC1 A;  1AP7 A;  1DVP A;  5IWA T;  1JCQ A;  1PC2 A;  3P4W A;  4IDZ A;  2J47 A;  4N2S A;  4HRL A;  2VVS A;  3ZMS B;  1SW6 A;  3FUE A;  4AXH A;  5FQ8 A;  5CRU A;  2FUL A;  3LK4 2;  3F2E A;  3EIJ A;  3N5L A;  4TN7 B;  3PUZ F;  4CN6 A;  5EIL A;  4ZI2 D;  4TUY E;  2C0L A;  2LM2 A;  1D0Z A;  1NI1 A;  3PUK A;  5JDH A;  2LHN A;  4CDN A;  3FHE A;  5EYL A;  3ZMZ B;  3AA0 B;  1IAP A;  1FEW A;  4Q94 A;  2IY0 C;  3AU5 A;  1MMA A;  3ML8 A;  2WXH A;  2MHK A;  3JXI A;  1E1H B;  2LT3 A;  1D9S A;  2KZT A;  1O3X A;  3NZS A;  2Q9Q B;  4WWP A;  3NWI A;  4CT0 A;  3HKB E;  5ADX L;  2IOS A;  3IXE A;  3ASO E;  3T5X A;  2XAF B;  1OCZ E;  4GZ5 A;  4QHO A;  4TWH A;  5JR9 B;  3VLE A;  3CVL A;  2QVA A;  3NVO A;  1E7V A;  5LA6 E;  5G04 J;  4HFV A;  2WQ6 A;  2BUG A;  5T4Y A;  5ITZ F;  2K3W A;  5KBA A;  3I5P A;  5HWY A;  3FTX A;  1IYG A;  4PW8 A;  3D9M A;  3QWW A;  2IU1 A;  3PUW F;  2M6B A;  3PJA J;  4WAF A;  2WXQ A;  4WBN E;  4C0E A;  3Q78 A;  3AS4 A;  2KLQ A;  3ZYK A;  5AIJ A;  3B57 A;  1H7C A;  2OV9 A;  3FZK B;  5FIN A;  4FJY A;  4YJ3 E;  2LAH A;  5AQV B;  3ASF A;  3SI5 A;  3Q79 A;  3DBS A;  3LK3 B;  3L16 A;  3HXB A;  3PE3 A;  4CT4 A;  3FZF B;  3P50 A;  1JWG A;  2QY7 A;  3ZU7 B;  4GIW A;  1K8K G;  1MMD A;  3RO3 A;  4JI3 T;  1H6K A;  2MBG A;  5E76 A;  1A5E A;  2LKG A;  2Y6X A;  4JYA T;  2V5Q C;  2KZT B;  2XAS B;  5FXX A;  2FJA A;  1XNQ T;  2JQK A;  3NBX X;  4GA2 A;  4RG6 A;  2N1G A;  4FHJ A;  3KAE A;  3W9G A;  4O4H E;  4DI3 A;  4DX1 A;  2K24 A;  5CA0 E;  2OEV A;  4ME2 A;  3B7R L;  2HYZ A;  4Q69 A;  5AYW D;  3ULQ A;  2WZH A;  2ZGD A;  4I9E A;  4U04 A;  3NRX A;  3JYS A;  2WMO A;  4GU5 A;  2HO1 A;  3TLW A;  2YQ8 A;  5LBM A;  3KBT A;  3FP3 A;  3UUX B;  1W3B A;  4F6R D;  4F8H A;  5FQ4 A;  2WXN A;  3X2Q E;  2IF4 A;  4F1S A;  2CHO A;  4BT9 A;  3RF1 A;  3JQ1 A;  2R59 A;  1ZKE A;  3E33 A;  4LF7 T;  2WXK A;  4Y6C A;  4XKB A;  3EAM A;  2PFV A;  5J2T E;  2MOW A;  3G2W A;  3FXE B;  4GTV A;  4CCA A;  4PK6 A;  1Y01 A;  4MBQ A;  3EU5 A;  4JBW F;  2WMN A;  2XPI A;  1DCQ A;  2VGX B;  1TNY A;  3SFZ A;  3TWQ A;  4BAY B;  2MRI A;  3UT5 E;  2E9X D;  4PFO A;  3JAE A;  5HXS A;  2UY1 B;  3RYF E;  1FT1 A;  1KF6 A;  2C0S A;  3J5Q B;  5C1D A;  3RIU C;  3PZD A;  3ZGQ A;  2DZO A;  4U0S A;  4IGU A;  2N9D A;  4BTA A;  3AG3 E;  4EIW A;  1TN7 A;  3LY7 A;  3AXJ A;  2VAS A;  5AQA A;  3S7D A;  4E7Z A;  2NW7 A;  4JI8 T;  3CR3 A;  3DWL G;  4YXD A;  3EAB A;  2BKO A;  5HWX A;  3R7R A;  5M72 A;  4I55 E;  1T8B A;  5LHI B;  2YN6 A;  3QJZ A;  4ZEY A;  4PUC A;  5E75 A;  5IY5 E;  5CB4 E;  2W00 A;  2DI4 A;  1FMV A;  1V54 E;  3MA5 A;  2Q9Q C;  1OED B;  2CHX A;  5KWD A;  5CJ5 A;  1N4Q A;  2IJG X;  1QBQ A;  3EIQ C;  4JUY A;  4MHC A;  3G2T A;  1NP7 A;  4H63 V;  3LK2 B;  1HO8 A;  2X3M A;  2XQY A;  1IZN B;  1UN8 A;  5L2L A;  3BG1 B;  4GKK T;  5JJT A;  3T8O A;  4EYY R;  4TNV A;  1X9B A;  4GKJ T;  2WCA A;  5AQN B;  4QXH B;  4DBR A;  2XGM A;  4G2V A;  3D9J A;  2BBH A;  3I9W A;  1HCI A;  2MYS A;  4JPS A;  3ZKJ A;  3F57 A;  3QWP A;  1MNE A;  3PNL B;  1SHZ C;  4DR6 T;  4O4L E;  1L0V A;  1QZ2 A;  2WB5 A;  2WXM A;  2E2A A;  2DYS E;  4CXY A;  3ZN0 B;  3V2O A;  1V9D A;  4JI4 T;  3C4W A;  4QXB B;  4L9P A;  2LSJ A;  4JI7 T;  4B3M T;  4AKL A;  3Q5D A;  2L9B A;  4TV9 E;  2WXJ A;  3GYZ A;  3UTM A;  1TEZ A;  3NZP A;  5FL1 A;  5CEA A;  4EOZ B;  1N9A A;  4LUN U;  2WQY A;  3ONL C;  4NXN T;  4C90 A;  1XGW A;  3ZSS A;  4EV6 A;  3M65 A;  3A5X A;  3SFY A;  1FJG T;  2VK9 A;  2BG9 A;  4LF5 T;  2YU1 A;  2LHR A;  3F6Q A;  3PUY F;  4U95 D;  5FVK A;  3W9F A;  2V5C A;  2Y69 E;  3SBT B;  3DJB A;  2VVN A;  3K3O A;  1FPP A;  5FL0 A;  4F7A A;  4AIS A;  1HS6 A;  1SVX A;  5LHH B;  3UIP C;  2XQ6 A;  2FEZ A;  4UV8 B;  1GW6 A;  2X0L B;  4B3T T;  4O4J E;  1VDY A;  4DMW A;  3CVP A;  4QX7 B;  1IQU A;  3MYV A;  5CGM A;  3SWH A;  2XSA A;  5JTG A;  3U64 A;  1FVH A;  4U63 A;  5H6Q B;  2H89 A;  4TV8 E;  5JDL A;  5AQK B;  2LSY A;  2G0U A;  2LOP A;  2LRK A;  3Q2M A;  5ARG A;  4HFC A;  3HYM B;  3ZMV B;  4E7S A;  4ILG A;  2WWU A;  2V8S V;  1MMN A;  4HFE A;  1JNZ A;  5AJD A;  2UXD T;  5BT1 A;  4N3A A;  5FTP A;  2A2F X;  1E96 B;  3GN5 B;  4TV3 A;  1L5J A;  5HEU A;  3UXG A;  4XI9 A;  2JJ9 A;  4KT6 B;  4B94 A;  2IAK A;  3JQ0 A;  4IE7 A;  3EHM A;  3Q75 A;  4YDO A;  2K48 A;  4K0U A;  4A97 A;  4EQF A;  5IUX A;  5AQ7 A;  1WM5 A;  2HN1 A;  2E0I A;  1TNB A;  3JUE A;  2FO1 E;  4AY5 A;  5EN5 D;  2GRM A;  2ION A;  4U8Y D;  1ZU2 A;  2VL8 A;  3PTR B;  2IIU A;  3IHY A;  3RSE G;  4GTQ A;  3LY9 A;  4PJN A;  1ZHC A;  4HLL A;  2VKJ A;  3CHM A;  4G8L A;  2NTX A;  4H7X A;  4U31 A;  3FBL A;  5KJN A;  4P0A A;  5D0Q D;  1W09 A;  3CSF A;  2GRP B;  3VTX A;  3FUD A;  3AAI A;  3PEV B;  3FY4 A;  4JA7 A;  4A98 A;  2UWJ G;  4BT8 A;  3UUN A;  2LRL A;  4YSZ A;  4HOR A;  5G05 J;  4L0R A;  4N5Q A;  4NUU A;  3SQV A;  3PE0 A;  3ABL E;  3ETU A;  4JW1 A;  2VL0 A;  3MK7 C;  4ILC A;  4XZ4 A;  2HM8 A;  1B7T A;  3VKG A;  5J1G A;  2V5F A;  3UQ4 A;  4OHF A;  3Q9D A;  4ZI2 C;  3B95 A;  1OED C;  3GW4 A;  4OX9 T;  1ELW A;  3E30 A;  3IA3 A;  1XNR T;  3TJP A;  3UIN C;  3KEA A;  4FUL A;  3AS8 A;  3N2G E;  3Q5X A;  4GYW A;  2CLY C;  3B7T A;  3CVN A;  5LFA A;  3ZXS A;  1U4Q A;  1U5P A;  4N5C A;  3J9X 1;  4A63 B;  1N11 A;  5BV0 A;  3SS1 A;  2R6G F;  2X6H A;  2KAT A;  1AJ3 A;  5HS0 A;  4RVB A;  5IHY A;  2ZMA A;  4U33 A;  3Q9U C;  4X8Q A;  3PS6 A;  5LCW J;  5KNG A;  3HR0 A;  1YQ4 A;  2P9B A;  5CCL A;  4BY6 A;  4EEC A;  2HE0 A;  2PZI A;  2V26 A;  2YOE A;  3ANW A;  1BPO A;  5FJY A;  2BS3 A;  2W2U A;  2BS4 A;  3HRA A;  5EX3 A;  4APO A;  5AAR A;  4B3R T;  4GYY A;  4ILH B;  2B1E A;  2DVW A;  1NAF A;  2IEJ A;  2WXI A;  3Q5M A;  4HWI B;  1CUN A;  3CGH A;  2K9A A;  4ANU A;  5EDS A;  3DSV A;  2C5K T;  2I1K A;  3UI2 A;  5CED B;  1S0P A;  2P9U G;  2VJ8 A;  4DMV A;  5LOV E;  4A1S A;  5CA1 E;  3ZVV A;  4KHZ F;  4UI9 J;  4M3O A;  1OXZ A;  3CLJ A;  3N9L A;  4FU3 A;  4LF4 T;  5AJL A;  4GK5 E;  3HG0 D;  3VRB A;  2P58 C;  3N9M A;  2OOE A;  2DLR A;  4G1T A;  2R2L A;  3DEO A;  2XQ7 A;  2W4X A;  4JV5 T;  1NL4 A;  2I1J A;  3L22 A;  5ANR A;  2BZB A;  2Y3A A;  3TWW A;  3FXD B;  3RH3 A;  5CMW A;  3MEK A;  5FNV E;  2XRY A;  1IKN D;  5F8P A;  3RRN B;  3CEQ A;  2V4L A;  3TWU A;  3RAU A;  3EI0 A;  3FTV A;  4YTN A;  4PS7 A;  2Y48 B;  1E8Z A;  3PRE A;  4C48 B;  2VSY A;  4ZI3 D;  1D8D A;  3D9H A;  2FUP A;  2IDO B;  1N34 T;  2P9L G;  4F6R C;  4QXC B;  3E37 A;  4BX8 A;  1N54 A;  4BA9 A;  3RKG A;  3I1A A;  4EB6 E;  5CHE E;  1QNF A;  2IQC A;  4MKT A;  1RW2 A;  5KXJ A;  5LX8 A;  1H2U A;  3P4R A;  4HS2 A;  3AE2 A;  3CML A;  4UUC A;  1YW0 A;  3I9Y A;  3FEY A;  1KZP A;  2UXC T;  3V2X A;  1OWN A;  1UX5 A;  3UU8 A;  4GMR A;  2VGE A;  5FQ7 A;  4DV7 T;  3VTY A;  5G04 C;  3ASD A;  1EZ3 A;  3DSS A;  4JC8 A;  5BW8 C;  1HS7 A;  5AQF B;  3ZT6 A;  4ILA A;  3WI3 A;  4AQF C;  1LD7 A;  3AE1 A;  2E9X C;  2P9I G;  3AA6 B;  4UVB B;  1GQE A;  1HG2 A;  1UUR A;  2QZA A;  5M4Y A;  2JPF A;  1PY1 A;  1Z6T A;  3L6A A;  4IYP A;  4U2Z A;  3O4Z A;  4LFB T;  2I6H A;  4DV5 T;  4U2Y A;  4ATG A;  1HF8 A;  3UMV A;  2KSR A;  4OYK A;  3DSU A;  2H7V C;  3FZM B;  3ZEF B;  3AG1 E;  3UT8 A;  4ACK A;  4F1P A;  4UWF A;  4UXN B;  2XPZ A;  5HEO A;  3KVA A;  3FUN A;  4UWK A;  4FA6 A;  5HEH A;  3IF8 B;  3U66 A;  5IYZ E;  3RYC E;  1UW4 B;  4DV0 T;  3NZU A;  4GTS A;  4K5A B;  4YY3 T;  1BI8 B;  4KVO A;  1YXR A;  5LCY A;  4ZFH A;  2GRQ B;  4UWG A;  3ASG A;  3A7M A;  4DR7 T;  3KV5 A;  3QOF A;  4DK5 A;  3PUJ A;  2V7I A;  5LP6 E;  1DC2 A;  3UKU G;  2E8I A;  2V7L A;  5LBQ B;  5EK4 A;  3O1I A;  4IDN A;  4CGV A;  1PAQ A;  3RIU A;  4HFG A;  4OAU C;  4AM9 A;  1FVF A;  2ZM0 A;  4I43 B;  5KX5 E;  4J8F A;  3D9I A;  3Q49 B;  3UQ7 A;  2YU2 A;  2BKK B;  5BUZ A;  3DST A;  4J2C A;  2VTB A;  2XZT G;  4YHH T;  4LMK A;  5LMN T;  2A3D A;  4DPR A;  1XWM A;  2X9H A;  4ISS A;  2PBI A;  4X65 T;  4FJO A;  1MJ0 A;  3SRZ A;  1N0Q A;  1XNF A;  2EIK E;  3EHN A;  3ABV A;  4LG6 A;  5AQ9 A;  3T5V A;  3BG0 B;  4QWN B;  3PUR A;  3UM1 A;  2Q9Q A;  4A3V A;  3P8C D;  3QAR A;  5EX0 A;  4ATZ D;  3C4X A;  4U0U A;  3RQW A;  1OWM A;  2UXN B;  3ZPO A;  3QWV A;  2FJE A;  5HXE A;  4XI0 A;  5C8Y E;  4CEM A;  2CHW A;  3S7B A;  1HX8 A;  3AU4 A;  4J8D A;  3QC1 A;  4AJW A;  3I4R B;  1MYO A;  2BF0 X;  2KCL A;  3MCX A;  3LBX B;  2IHR 1;  3ZMT B;  3V5U A;  5FZQ A;  1OY3 D;  5L4E A;  1T98 A;  2VQE T;  4WWO A;  2KXP B;  4NIK A;  2JAB A;  3FUM A;  2RP4 A;  5HAX A;  2XPY A;  2KIN B;  4QH4 A;  5AQL B;  3MV3 B;  3KBU A;  3QK6 A;  5JRC B;  2CG2 A;  4J8Y A;  5EK3 A;  1Y6I A;  5HXR A;  5A7D B;  3RQU A;  2AWI A;  3I0Q A;  3ONL A;  2UUB T;  3ZKR A;  4CN1 A;  4DO0 A;  2AXU A;  3C50 A;  1BI7 B;  2PM6 A;  4HFB A;  4ZZC A;  2GGF A;  4L9I A;  5FXZ A;  4U96 D;  1O5M A;  1TYQ G;  3HI2 A;  2WY2 A;  1HNX T;  3SD5 A;  3G2V A;  4FHK A;  2N2N A;  2VTB B;  2IML A;  5ENT D;  2X66 A;  1G3N B;  4X1I E;  2VQ2 A;  2VYI A;  3T8M A;  4A3T A;  1UGO A;  2WQH A;  3CQG B;  5BV1 A;  2CXD A;  3ETV A;  3ZYL A;  3AE8 A;  4J6I A;  2NP9 A;  3FTU A;  3EVY A;  3TLS A;  2BDE A;  3UFG A;  2H6G A;  3PEU B;  3K8P C;  5LNK A;  3ZT7 A;  4B3S T;  4X5T A;  1NEK A;  3EDU A;  3EHQ A;  3I3N A;  2F4V T;  4YHJ A;  3PV0 F;  5B1B E;  2Y0B G;  3JAD A;  1N33 T;  2P9N G;  3NOG D;  1BU9 A;  4L2L A;  5JHA A;  5L3G B;  3UUX A;  3BQK A;  3SNX A;  2NTY A;  4MLK A;  1YYH A;  3N9Q A;  4JI6 T;  1X81 A;  4NAC A;  3L54 A;  4HXI A;  2WXR A;  5G55 A;  1Z8U A;  3Q5W A;  3ZNG A;  2YDS A;  5EZY E;  4WYV A;  4EZ4 A;  5HRY A;  1D8E A;  5DBK A;  3RYI E;  5D66 A;  4M7C A;  3TG5 A;  3L17 A;  2W67 A;  5BMV E;  4XKC A;  3ULY A;  4D10 C;  3NB2 A;  4Z91 A;  3G2S A;  4TNW A;  3HIZ A;  4UF0 B;  2PJQ A;  5AQH B;  3RI5 A;  4KX6 A;  3KS2 A;  4EBA A;  2HPL A;  4I2Z A;  3ULE G;  5J0Z A;  4GPK A;  2LAI A;  2VGX A;  4DBQ A;  3C5R A;  2ZGG A;  2EHO D;  3UU5 A;  3JAF A;  3FZL B;  1KZO A;  2NW8 A;  3ZYQ A;  4U7E B;  3T9K A;  4X1Y E;  4X64 T;  5C3J A;  2UY1 A;  3PVL A;  3C98 B;  5L3E B;  4CZ2 D;  3U9W A;  2EIL E;  4AI6 A;  4HFD A;  4LEU A;  2XEH A;  3VR9 A;  3SO8 A;  3V30 A;  1O1T A;  4ERR A;  1INZ A;  3P7I A;  4Z8X A;  2CE7 A;  5J90 A;  5J08 A;  2CFU A;  3LXU X;  4FAD A;  2YNQ A;  2DCF A;  3TKL B;  3WAK A;  4V3I A;  2PL2 A;  3F31 A;  1LD8 A;  2DWK A;  3DSX A;  1SQM A;  5ENP D;  1E8Y A;  1MMG A;  1DCE A;  4YVQ C; 
#chains in the Genus database with same CATH homology
 2RD0 A;  4I6G A;  4WWN A;  2CCQ A;  4IIJ E;  4N78 D;  4YLH A;  3FDH A;  2KCK A;  4UEM A;  5CCM A;  5FXV A;  2WXP A;  2AXV A;  2NC9 A;  3AS5 A;  4CI2 B;  2Y4U A;  2M63 A;  1KT1 A;  2L6J A;  4DLQ A;  1E8W A;  3CVX A;  2WXF A;  4HEA A;  3QDN A;  3CPZ A;  3IBE A;  4ANX A;  3OYZ A;  3R7Q A;  5L3B B;  4QFV A;  3LS8 A;  5G05 C;  4JEU B;  3C64 A;  1UG3 A;  3HKC E;  3IEE A;  3GZ1 A;  2BVL A;  2Y8D A;  3NF1 A;  2XAH B;  3LG7 A;  3ZPJ A;  3CKB A;  1UCU A;  2LO6 A;  3FTW A;  2H7O A;  2FO7 A;  4O4I E;  4JHJ A;  4EYU A;  4IN3 B;  3OTN A;  2IW5 B;  3ENE A;  3ONX A;  2V1D B;  4A1G A;  4ZI3 C;  1UX4 A;  4G2A A;  4BJN A;  3GA8 A;  1E7U A;  4I6J A;  3SGH A;  4IE5 A;  2DIW A;  4BWR A;  3PDY A;  3ZW3 A;  3O1H A;  3KFW X;  4FLH A;  1D0X A;  2CLY B;  3WAJ A;  3FU3 A;  1HG5 A;  4MAL A;  4J0U A;  2OND A;  2BTD A;  5ETW A;  5LCW C;  3GN5 A;  5ANL A;  4GK0 E;  1YKE B;  2OVB A;  5A23 A;  4TUU A;  2E2E A;  3KVB A;  3VHL A;  3HVE A;  3HKE E;  4PS3 A;  3SOL A;  2UXX B;  3BK9 A;  1UJJ A;  3GWH A;  2KT9 A;  3MZL B;  5C2Y A;  2CEA A;  4KP3 C;  4AY6 A;  3UT7 A;  4CXX A;  2BVM A;  3FU0 A;  4HOS A;  1LKX A;  1HU3 A;  2CWY A;  2QFC A;  4I1A A;  2W62 A;  3URZ A;  2KWH A;  1ELK A;  2DCP A;  2Q7F A;  4GZ6 A;  3VLF A;  2CM0 A;  2XHE B;  2DHR A;  4I4T E;  3BQL A;  1HZ4 A;  2EHO B;  4AQF A;  2E9X A;  3CQC B;  5JDF A;  3D9P A;  3VU7 H;  5H6R B;  3AA7 B;  1ZEE A;  5EK2 A;  3J7Y q;  4AV7 A;  3R6N A;  4ANV A;  1ZV4 X;  3MAC A;  4HGA A;  3N71 A;  1IHG A;  3E22 E;  3HDX A;  3D9K A;  3FHN A;  3MV2 B;  2K5B B;  3KV6 A;  3HVE B;  3MJX A;  2CG3 A;  3B7S A;  3RKV A;  1WYB A;  2IC6 A;  3Q47 B;  4N3B A;  3EJN A;  5FYM A;  5FWQ A;  2L0I A;  3CVQ A;  2VKH A;  4OVV A;  2WB2 A;  3ESK A;  3D9O A;  2AVP A;  1D1A A;  4JHK A;  2OV8 A;  5AEN A;  2W0G A;  4GZC A;  4UQY A;  2XEV A;  4I1O B;  1H0A A;  1G8X A;  2C2L A;  2I59 A;  3L13 A;  1LVK A;  1ELR A;  2X6I A;  2E9X B;  5FY1 A;  5KJK A;  4AVX A;  3R9A B;  1JPL A;  3PU3 A;  4IRU A;  4J8E A;  4B6X A;  1IQR A;  3ZRH A;  1KT0 A;  4LCT A;  4U07 A;  3OYX A;  4G11 A;  3SZ7 A;  4YFS A;  2W63 A;  4URK A;  3RYH E;  3LVR E;  5JRE A;  3DPD A;  2KCV A;  3AVS A;  2PM7 A;  4AOF A;  2LE8 A;  2XAG B;  2YK0 A;  2NOX A;  4U74 A;  4I6E A;  2D0T A;  4CDM A;  2DBA A;  5L3F B;  3ZMU B;  2VWA A;  1NWM X;  2V8S E;  4A55 A;  5FMN A;  4N2Q A;  1JWF A;  1SZA A;  4GYR A;  3QK0 A;  1FMW A;  1Y8M A;  4GCN A;  1NZN A;  4IE0 A;  1DNP A;  4GYS A;  5G2N A;  3EDV A;  3PH0 C;  4UWL A;  4AKR B;  1G73 A;  4H9S E;  2CMR A;  4C91 A;  2JLB A;  2EHO C;  4ANW A;  3LYA A;  3PE4 A;  1X79 A;  4ILI A;  4GZ3 A;  3N9O A;  4XAX B;  3PU8 A;  5JJ6 A;  2CWO A;  3CX7 B;  3FH5 A;  1EF1 C;  4AKI A;  3ONK A;  5HQ8 A;  3ZEF A;  3FEX A;  4ADZ A;  1LRZ A;  2LSV A;  2YIN A;  3MZK B;  3RIB A;  4H7Y A;  3ZFW A;  3JCK C;  4HKA A;  5BNW A;  3JUI A;  3PRZ A;  1KK7 A;  4J8S A;  3N2K E;  2L0T B;  4XE0 A;  2JMH A;  4QKN A;  4TX5 A;  3D9L A;  2C5J A;  5JH7 E;  2J1D G;  5AFU L;  3S2A A;  3AVR A;  3R84 B;  4CDR A;  4I43 A;  2NXP A;  4B0Z A;  4AKH A;  3C51 A;  1MQS A;  4HN9 A;  4FI5 A;  3QB2 A;  3SHF A;  3PUA A;  3ZHE A;  4KMO A;  4WNK A;  2JQQ A;  4AIF A;  3ZIM A;  3D9N A;  4ZOL E;  2ZU6 B;  4B89 A;  4GA0 A;  3CHP A;  3G2U A;  5JDQ A;  3IHR A;  1U3C A;  4EBA G;  1D1B A;  5FY7 A;  3ZN1 B;  2CFZ A;  2I2O A;  4DJA A;  3CIA A;  4PFP A;  5DQV A;  4P29 A;  3Q15 A;  3LBX A;  5TAO A;  3B13 A;  4JEH A;  2DNX A;  2XAJ B;  4CRW A;  5JJ7 A;  5GON E;  3HKD E;  5JRC A;  4JA9 A;  4L5G A;  4B8A A;  4RG9 A;  4JLE A;  4DND A;  3OKQ A;  4AQG A;  4YND A;  3CWZ B;  4NUR A;  1LF8 A;  4AP2 A;  3S7J A;  1H2T C;  3MA9 A;  5JDM A;  2V0P A;  4WUY A;  2L3L A;  3CX8 B;  2NW9 A;  3CK7 A;  3APC A;  3PUG A;  2CA5 A;  2YHC A;  5HYA A;  5KDM C;  5FQ6 A;  4XX5 A;  4GAA A;  3APF A;  3ZHE B;  4WBO A;  1MHQ A;  2WXL A;  2LNI A;  4DI4 A;  3RO2 A;  5KJL A;  5CMY A;  3LJ3 A;  3LCA A;  3S4U A;  2KMF A;  1Z3Y A;  4G26 A;  4G24 A;  1KNZ A;  4IE4 A;  1H19 A;  2NSZ A;  3L3P A;  3OJA A;  2PQN A;  2VSO E;  2WAU A;  4JEH B;  3MKD A;  1TJC A;  2ACX A;  2V7K A;  5F3J A;  2CHZ A;  4EZJ A;  3ML9 A;  3RX6 A;  4GZD A;  4IUL A;  5FP3 A;  3RRC A;  1HTJ F;  3APD A;  2LEH A;  4KMC A;  4H9N C;  5FXW A;  2VSN A;  3CVW A;  4UF0 A;  3P2B A;  2YEV C;  1U3D A;  5FT9 A;  4OYS A;  5LJM A;  2XCB A;  2VSX E;  3C98 A;  5LYJ E;  4PAG A;  2RG8 A;  4ZS3 A;  5JDN A;  4PS8 A;  3MKQ A;  2VKO A;  4MS6 A;  3TXN A;  1D0Y A;  3I4G A;  3EDT B;  3FUJ A;  3HA4 A;  4H63 H;  2D0U A;  3SBS A;  2WQ7 A;  4L23 A;  3TXM A;  2AXZ A;  2RA1 A;  4UWH A;  3QUJ A;  4H9O C;  3LJC A;  4UQZ A;  4XBF B;  2ZM8 A;  3RPU A;  3JC6 D;  3CST A;  2GK9 A;  4F53 A;  2L8K A;  4G25 A;  4O2A E;  4FJZ A;  3WXX A;  5T8I A;  5DQW A;  5DIZ A;  5LHG B;  4I9C A;  2IC9 A;  4GYO A;  4DVD A;  3AB3 B;  4I50 E;  3QC9 A;  4RSY A;  5KCM A;  3IEG A;  3FU6 A;  1WRD A;  1A17 A;  4JEU A;  3MKQ B;  4OK0 A;  5BPP A;  2J9Q A;  1MND A;  3RC3 A;  3VKH A;  4HE8 A;  5HXH A;  4HTE A;  1EDU A;  3FFL A;  3FUF A;  1FIO A;  3AAA B;  2J08 A;  1OUV A;  4I17 A;  1MIV A;  3DTO A;  3B7U X;  4G23 A;  2XAQ B;  4CXW A;  4UVC B;  3ZJ1 A;  3UTK A;  1OWA A;  3CX6 B;  3HHM A;  4CI3 B;  1SA0 E;  1VRB A;  2Y4T A;  4CZZ B;  3FH7 A;  4UV9 B;  4GML A;  3P1U A;  4IST A;  1QUU A;  4CI1 B;  2WVI A;  3TG4 A;  3V5S A;  3E08 A;  2X67 A;  4ACL A;  4PNI A;  2JRK A;  4EZH A;  4BTB A;  5EKQ D;  3ASH A;  1ZBP A;  4IE6 A;  3UQ3 A;  4ZI7 E;  1QQE A;  4EZL A;  4WW0 A;  4MLP A;  4W9R A;  3FUH A;  4AKG A;  1WAO 1;  3D3M A;  4PDX A;  1YA0 A;  2WXG A;  5ARF A;  4R7L A;  2C0M A;  4C9B B;  3ZC0 A;  2M67 A;  3KDS E;  1VOM A;  4FC8 A;  4X1K E;  3CHQ A;  3FUL A;  3MGB A;  2VKD A;  2X9W A;  5ENN A;  2ILR A;  3K3Q C;  3LY8 A;  4KUM B;  4AEZ C;  2J09 A;  2XHE A;  1S94 A;  2WBL A;  4JHR A;  4UQX A;  2EHO A;  4GCO A;  3UUM A;  4MRU A;  1KLX A;  3U3I A;  2ZLY A;  5FZS A;  3U3W A;  3UUL A;  4PJJ A;  4EXT A;  3QOU A;  1MIW A;  3ZCJ A;  4P0B A;  2IFU A;  4YVO A;  2VGY A;  1BR4 A;  4LRZ A;  4ILU A;  5LGU B;  4TZ4 C;  4WNF A;  2FI7 A;  3IKO B;  3RRU A;  3RKO A;  1QSD A;  3FTZ A;  2WM9 A;  5JVD E;  3LPZ A;  3QAQ A;  5JR9 C;  3CHS A;  4PK5 A;  2X6F A;  2WSS V;  2X6K A;  2LJL A;  3ZJ2 A;  4L7T A;  4OVU A;  4F3V A;  3L08 A;  1D1C A;  2J49 A;  3PUQ A;  3ESL A;  3ZYM A;  1E90 A;  1SZ9 A;  3GZ2 A;  2SPC A;  4UI9 C;  3TGO A;  4WNE A;  2ODV A;  3TAX A;  3FUK A;  4BSX A;  3LDZ A;  4HOT A;  1YKH B;  4G63 A;  5J2U E;  2HR2 A;  4ZS2 A;  3RRM B;  2ODU A;  4U0Z A;  3KD7 A;  2ZM2 A;  2I9C A;  4KXK B;  1IJ5 A;  5LP0 A;  5HXC A;  4JZY A;  4XZC A;  2GRL A;  3BEE A;  4L1B A;  4APF A;  4NRH B;  4FP7 A;  2HH7 A;  3FH8 A;  3QKY A;  2XCC A;  3KV9 A;  3CHR A;  3LEW A;  4CQI A;  4JXT A;  3D0T A;  1WLX A;  2X38 A;  4Q96 A;  4WND A;  2C5I T;  5DAB A;  1X5B A;  4CGW A;  3NZQ A;  3AAE B;  2JMK A;  3I0O A;  3IBP A;  1S35 A;  2R5S A;  3CK9 A;  4EZK A;  3U78 A;  3ZCI A;  2X9Y A;  4K03 A;  2EQX A;  2LM9 A;  1WY6 A;  3H3A A;  3U4T A;  3CK8 A;  2PQR A;  2KZ7 B;  3SF4 A;  3K9I A;  2KC7 A;  2X9X A;  3H37 A;  3ZLI A;  2QGS A;  2V7M A;  3E0Z A;  2X6J A;  2YHE A;  4PK4 A;  3UPV A;  2GW1 A;  4H9P C;  4UI9 K;  3RU0 A;  1HH8 A;  4HVB A;  2D5U A;  5L3D B;  1E8X A;  2HPJ A;  4DLO A;  1HXI A;  3BQI A;  2LSK A;  5LOZ A;  1WR6 A;  2V7J A;  3DP7 A;  2XQ0 A;  3FBZ A;  4HLE A;  2MTQ A;  3NQP A;  5JDG A;  3L09 A;  2WXO A;  4GB9 A;  1Z3X A;  5LXT E;  4KVM A;  2D2S A;  3O1J A;  4E85 A;  4HOU A;  2XGS A;  4UIG A;  3KV4 A;  4O6F A;  4PJL A;  4JL0 A;  2WPV A;  1N52 A;  4B8C B;  4UEL A;  5KMG P;  3JC6 C;  3UFE A;  4H9Q C;  2QA7 A;  4KYO B;  3OXL A;  2JEK A;  1JUQ A;  2J07 A;  4NUV A;  2XTL A;  3O9X A;  4N39 A;  5FY0 A;  1NA3 A;  3E4B A;  1YD8 G;  3TL5 A;  4I2W A;  3CHO A;  2X51 A;  3OXF A;  4L2Y A;  1OWO A;  3NRY A;  4Y6W A;  1UJK A;  4N3C A;  4K0R A;  5JHB A;  5LJN A;  5KJM A;  5A6C A;  5FZR A;  3OAW A;  4GMJ A;  2LSI A;  2FF4 A;  4GOU A;  3CVU A;  1WYC A;  1NA0 A;  5DJQ C;  4FLB A;  3O4X E;  4XIF A;  4A56 A;  4WNG A;  4C0M A;  3FU5 A;  3GMI A;  3C4Z A;  2ES0 A;  3LVQ E;  5LGT B;  4BFR A;  3CQX C;  3RC8 A;  4I1M A;  3UT4 A;  4U8H A;  3FTS A;  2KWI B;  2Z6E A;  2IOL A;  4BX9 A;  4X20 E;  4KZC A;  2KND A;  3CVY A;  2XUE A;  2VB6 A;  3RK6 A;  3N9N A;  3LKU A;  3CVR A;  2FBN A;  3RJV A;  3VLD A;  2XGO A;  4KBQ A;  4O2B E;  3Q4A B;  3GZS A;  3O48 A;  5JQG E;  2Q9Q D;  3FWV A;  3FUI A;  5T3R A;  3S7F A;  3CVV A;  2CXL A;  3FTY A;  3ANW B;  1LVF A;  3K3N A;  4HOQ A;  2A5U A;  4V1A v;  5L3C B;  4UVA B;  3LFM A;  4KBM B;  2LSU A;  3UX4 A;  4BJM A;  3EUH A;  5HI7 A;  1HFA A;  1Y64 B;  2J4D A;  5D0O D;  4QX8 B;  4EAH A;  1IJ6 A;  4MFR A;  1UN9 A;  4ABN A;  1EPU A;  2L9Q A;  4H9R C;  2A4Z A;  2J4B A;  3MX3 A;  2X68 A;  2DWG A;  4AXP A;  3N9P A;  3CV0 A;  1OWP A;  4PJM A;  4P09 A;  1BR1 A;  2NWB A;  1Z0P A;  1US7 B;  1BR0 A;  1TJF A;  1FCH A;  4ASK A;  2MOZ A;  4YJ2 E;  2OVF A;  3IV0 A;  1EYH A;  4OFZ A;  4U72 A;  3ZN3 A;  5LG4 A;  2LOS A;  1MIY A;  3IHV A;  2OA5 A;  4E6H A;  4M1P A;  2R17 C;  1OWL A;  4NQ0 A;  1P5Q A;  2PG8 A;  3W15 B;  4JVS A;  4LER A;  4PH4 B;  3AA1 B;  3OXG A;  3MJW A;  5LGN B;  3CKD A;  2KM4 A;  4ANJ A;  4KZ0 A;  2W61 A;  4O8S A;  3KEZ A;  3FB2 A;  3QNK A;  2LSG A;  2H3R A;  3PDN A;  1HE8 A;  2A72 A;  1BR2 A;  4IHJ E;  2AW6 A;  4TRQ A;  3RRW A;  2XRZ A;  4ZHQ E;  4EPZ A;  4OYJ A;  3PUS A;  5A1L A;  3CKC A;  4GA1 A;  5E0O A;  1H2V C;  1B89 A;  3MKR A;  3OBV E;  5JR9 A;  3MXZ A;  3KIN B;  3N2O A;  3HL6 A;  2CXF A;  3ZC1 A;  1DVP A;  1PC2 A;  4IDZ A;  4N2S A;  3ZMS B;  3FUE A;  4AXH A;  5FQ8 A;  2FUL A;  3LK4 2;  3F2E A;  3EIJ A;  3N5L A;  4TN7 B;  4ZI2 D;  4TUY E;  2C0L A;  1D0Z A;  3PUK A;  4CDN A;  5JDH A;  2LHN A;  3FHE A;  3ZMZ B;  3AA0 B;  1IAP A;  1FEW A;  4Q94 A;  3AU5 A;  1MMA A;  3ML8 A;  2WXH A;  2MHK A;  1E1H B;  2LT3 A;  2KZT A;  1O3X A;  3NZS A;  2Q9Q B;  4WWP A;  4CT0 A;  3HKB E;  5ADX L;  2IOS A;  3T5X A;  2XAF B;  4GZ5 A;  4QHO A;  5JR9 B;  3VLE A;  3CVL A;  1E7V A;  5LA6 E;  5G04 J;  4HFV A;  2WQ6 A;  2BUG A;  5T4Y A;  3I5P A;  5HWY A;  3FTX A;  1IYG A;  4PW8 A;  3D9M A;  3QWW A;  2IU1 A;  4WAF A;  2WXQ A;  4WBN E;  4C0E A;  3AS4 A;  2KLQ A;  3ZYK A;  5AIJ A;  3B57 A;  1H7C A;  4FJY A;  2LAH A;  4YJ3 E;  3ASF A;  3SI5 A;  3DBS A;  3LK3 B;  3L16 A;  3PE3 A;  4CT4 A;  1JWG A;  2QY7 A;  4GIW A;  1MMD A;  3RO3 A;  1H6K A;  2MBG A;  5E76 A;  2Y6X A;  2KZT B;  2XAS B;  5FXX A;  3NBX X;  4GA2 A;  4RG6 A;  2N1G A;  4FHJ A;  3KAE A;  4DI3 A;  4O4H E;  2K24 A;  5CA0 E;  4ME2 A;  3B7R L;  2HYZ A;  4Q69 A;  5AYW D;  3ULQ A;  4I9E A;  4U04 A;  3NRX A;  3JYS A;  2WMO A;  4GU5 A;  2HO1 A;  2YQ8 A;  5LBM A;  3KBT A;  3FP3 A;  3UUX B;  1W3B A;  5FQ4 A;  2WXN A;  4F1S A;  2IF4 A;  4BT9 A;  3JQ1 A;  2R59 A;  1ZKE A;  2WXK A;  4Y6C A;  4XKB A;  2PFV A;  5J2T E;  2MOW A;  3G2W A;  3FXE B;  4CCA A;  4PK6 A;  4MBQ A;  2WMN A;  2XPI A;  2VGX B;  3SFZ A;  4BAY B;  2MRI A;  3UT5 E;  2E9X D;  4PFO A;  5HXS A;  2UY1 B;  3RYF E;  2C0S A;  5C1D A;  3PZD A;  3ZGQ A;  4U0S A;  4IGU A;  2N9D A;  4BTA A;  4EIW A;  3LY7 A;  2VAS A;  3S7D A;  4E7Z A;  2NW7 A;  3CR3 A;  5HWX A;  3R7R A;  5M72 A;  4I55 E;  5LHI B;  3QJZ A;  4PUC A;  5E75 A;  5CB4 E;  2W00 A;  2DI4 A;  3MA5 A;  1FMV A;  2Q9Q C;  2CHX A;  2IJG X;  3EIQ C;  4JUY A;  4MHC A;  3G2T A;  1NP7 A;  4H63 V;  3LK2 B;  1HO8 A;  2X3M A;  2XQY A;  1IZN B;  1UN8 A;  5L2L A;  3BG1 B;  5JJT A;  3T8O A;  4EYY R;  4QXH B;  4DBR A;  2XGM A;  4G2V A;  3D9J A;  3I9W A;  1HCI A;  2MYS A;  4JPS A;  3F57 A;  3QWP A;  1MNE A;  3PNL B;  1SHZ C;  4O4L E;  1QZ2 A;  2WXM A;  4CXY A;  3ZN0 B;  1V9D A;  3C4W A;  4QXB B;  2LSJ A;  2WXJ A;  4AKL A;  3GYZ A;  2L9B A;  4TV9 E;  1TEZ A;  3NZP A;  4EOZ B;  4LUN U;  4C90 A;  1XGW A;  3M65 A;  3A5X A;  2VK9 A;  2YU1 A;  2LHR A;  3SBT B;  3DJB A;  3K3O A;  4F7A A;  1HS6 A;  5LHH B;  2FEZ A;  4UV8 B;  1GW6 A;  2X0L B;  4O4J E;  1VDY A;  4DMW A;  3CVP A;  4QX7 B;  1IQU A;  3MYV A;  3SWH A;  3U64 A;  1FVH A;  4U63 A;  5H6Q B;  4TV8 E;  5JDL A;  2LSY A;  2G0U A;  2LOP A;  3Q2M A;  5ARG A;  3HYM B;  3ZMV B;  4E7S A;  4ILG A;  2WWU A;  1MMN A;  5AJD A;  5BT1 A;  4N3A A;  5FTP A;  2A2F X;  1E96 B;  3GN5 B;  4TV3 A;  1L5J A;  4XI9 A;  2JJ9 A;  4KT6 B;  4B94 A;  2IAK A;  3JQ0 A;  4IE7 A;  3EHM A;  2K48 A;  4K0U A;  4EQF A;  1WM5 A;  2E0I A;  4AY5 A;  2GRM A;  2ION A;  1ZU2 A;  2VL8 A;  3PTR B;  3IHY A;  3LY9 A;  4PJN A;  1ZHC A;  2VKJ A;  3CHM A;  4H7X A;  2NTX A;  3FBL A;  5KJN A;  4P0A A;  5D0Q D;  3CSF A;  3VTX A;  3FUD A;  3AAI A;  3PEV B;  3FY4 A;  4JA7 A;  2UWJ G;  4BT8 A;  3UUN A;  4HOR A;  5G05 J;  4L0R A;  4NUU A;  3PE0 A;  3ETU A;  4JW1 A;  3MK7 C;  4XZ4 A;  2HM8 A;  1B7T A;  3VKG A;  5J1G A;  2V5F A;  4ZI2 C;  4OHF A;  3Q9D A;  3GW4 A;  1ELW A;  3TJP A;  4FUL A;  3AS8 A;  3N2G E;  3Q5X A;  4GYW A;  2CLY C;  3B7T A;  3CVN A;  5LFA A;  3ZXS A;  1U4Q A;  1U5P A;  4N5C A;  3J9X 1;  5BV0 A;  3SS1 A;  2X6H A;  2KAT A;  1AJ3 A;  4RVB A;  5IHY A;  2ZMA A;  3PS6 A;  5LCW J;  3HR0 A;  2P9B A;  5CCL A;  4BY6 A;  4EEC A;  2PZI A;  2V26 A;  3ANW A;  1BPO A;  5FJY A;  5EX3 A;  4APO A;  4GYY A;  4ILH B;  2B1E A;  1NAF A;  2WXI A;  3Q5M A;  1CUN A;  3CGH A;  2K9A A;  4ANU A;  5EDS A;  2C5K T;  2I1K A;  1S0P A;  2VJ8 A;  4DMV A;  5LOV E;  4A1S A;  5CA1 E;  3ZVV A;  4UI9 J;  4M3O A;  1OXZ A;  3CLJ A;  3N9L A;  4FU3 A;  5AJL A;  4GK5 E;  2P58 C;  3N9M A;  2OOE A;  2DLR A;  4G1T A;  2I1J A;  3L22 A;  5ANR A;  2BZB A;  2Y3A A;  3FXD B;  3RH3 A;  5CMW A;  3MEK A;  5FNV E;  2XRY A;  5F8P A;  3RRN B;  3CEQ A;  2V4L A;  3FTV A;  4PS7 A;  2Y48 B;  1E8Z A;  3PRE A;  2VSY A;  4ZI3 D;  4F6R C;  4QXC B;  4BX8 A;  1N54 A;  4BA9 A;  3I1A A;  4EB6 E;  5CHE E;  1QNF A;  2IQC A;  4MKT A;  5LX8 A;  1H2U A;  4HS2 A;  3CML A;  1YW0 A;  3I9Y A;  3FEY A;  1OWN A;  1UX5 A;  5FQ7 A;  3VTY A;  5G04 C;  3ASD A;  1EZ3 A;  4JC8 A;  5BW8 C;  1HS7 A;  3WI3 A;  4AQF C;  2E9X C;  3AA6 B;  4UVB B;  1HG2 A;  5M4Y A;  2JPF A;  1PY1 A;  1Z6T A;  3L6A A;  4IYP A;  3O4Z A;  2I6H A;  4ATG A;  1HF8 A;  3UMV A;  4OYK A;  2H7V C;  3ZEF B;  3UT8 A;  4ACK A;  4UWF A;  4UXN B;  2XPZ A;  3KVA A;  3FUN A;  4UWK A;  4FA6 A;  3IF8 B;  3U66 A;  5IYZ E;  3RYC E;  1UW4 B;  3NZU A;  4KVO A;  5LCY A;  4UWG A;  3ASG A;  3KV5 A;  4DK5 A;  3PUJ A;  2V7I A;  5LP6 E;  2E8I A;  2V7L A;  5LBQ B;  5EK4 A;  3O1I A;  1PAQ A;  4HFG A;  4AM9 A;  1FVF A;  2ZM0 A;  4I43 B;  5KX5 E;  4J8F A;  3D9I A;  3Q49 B;  2YU2 A;  5BUZ A;  4J2C A;  2VTB A;  2A3D A;  4DPR A;  2X9H A;  4ISS A;  2PBI A;  1XNF A;  4FJO A;  3PNT B;  3SRZ A;  3EHN A;  4CGV A;  3T5V A;  3BG0 B;  4QWN B;  3PUR A;  2Q9Q A;  4A3V A;  3P8C D;  3QAR A;  5EX0 A;  3C4X A;  4U0U A;  1OWM A;  2UXN B;  3ZPO A;  3QWV A;  5HXE A;  4XI0 A;  5C8Y E;  4CEM A;  2CHW A;  3S7B A;  1HX8 A;  3AU4 A;  4J8D A;  3QC1 A;  4AJW A;  3I4R B;  2BF0 X;  2KCL A;  3MCX A;  3LBX B;  3ZMT B;  3V5U A;  5FZQ A;  1T98 A;  4WWO A;  2KXP B;  3FUM A;  2RP4 A;  5HAX A;  2XPY A;  2KIN B;  3MV3 B;  3KBU A;  3QK6 A;  5JRC B;  2CG2 A;  5EK3 A;  1Y6I A;  5HXR A;  5A7D B;  2AWI A;  3I0Q A;  3ONL A;  4DO0 A;  2AXU A;  3C50 A;  2PM6 A;  2GGF A;  4L9I A;  5FXZ A;  3HI2 A;  3SD5 A;  3G2V A;  4FHK A;  2N2N A;  2VTB B;  2X66 A;  2VQ2 A;  4X1I E;  2VYI A;  3T8M A;  4A3T A;  2WQH A;  3CQG B;  5BV1 A;  2CXD A;  3ETV A;  3ZYL A;  4J6I A;  2NP9 A;  3FTU A;  3EVY A;  2BDE A;  3PEU B;  3K8P C;  5LNK A;  3EDU A;  3I3N A;  4YHJ A;  4L2L A;  5JHA A;  5L3G B;  3UUX A;  3BQK A;  3SNX A;  2NTY A;  4MLK A;  3N9Q A;  4NAC A;  3L54 A;  4HXI A;  2WXR A;  5G55 A;  3Q5W A;  5EZY E;  4EZ4 A;  5DBK A;  3RYI E;  3TG5 A;  3L17 A;  5BMV E;  4XKC A;  4D10 C;  3G2S A;  3HIZ A;  4UF0 B;  2PJQ A;  3KS2 A;  4EBA A;  2HPL A;  4I2Z A;  4GPK A;  2LAI A;  2VGX A;  4DBQ A;  2EHO D;  2NW8 A;  3ZYQ A;  4X1Y E;  2UY1 A;  3PVL A;  3C98 B;  5L3E B;  3U9W A;  4AI6 A;  4LEU A;  4ERR A;  1INZ A;  3P7I A;  4Z8X A;  2CE7 A;  5J90 A;  5J08 A;  2CFU A;  3LXU X;  4FAD A;  2YNQ A;  2DCF A;  3TKL B;  3WAK A;  4V3I A;  2PL2 A;  3F31 A;  2DWK A;  1SQM A;  1E8Y A;  1MMG A;  4YVQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...