4HQDA

Crystal structure of engineered protein. northeast structural genomics consortium target or265.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
163
structure length
161
Chain Sequence
SELGKRLIEAAENGNKDRVKDLIENGADVNASDSDGRTPLHYAAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYAAKEGHKEIVKLLISKGADVNAKDSDGRTPLHYAAKEGHKEIVKLLISKGADVNTSDSDGRTPLDLARGNEEIVKLLEKQGGWLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Engineered Protein OR265
publication title Crystal Structure of Engineered Protein OR265.
rcsb
source organism Synthetic construct
total genus 52
structure length 161
sequence length 163
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4hqdA00
1QYMA 2V5QC 4ATZD 5ENOD 5ENTD 2L6BA 5ENRD 3HRAA 4HB5A 2XENA 3JXIA 4K5CA 3AAAC 2ZGDA 3J5QB 2Y1LE 3JXJA 2DZOA 1SVXA 4K5AB 1TR4A 3EU9A 4GPMA 5EIBE 3D9HA 1IXVA 4GMRA 1N0RA 4HBDA 2J8SD 4HRNA 4O1PA 1OY3D 4C48B 1OT8A 3EHRA 3HG0D 3TWRA 3V31A 2JABA 4A63B 5AARA 4O1OA 3T8KA 4DX6D 3ZU7B 3B95A 1YCSB 1DCQA 1WDYA 3ZNGA 2ETAA 5ENSD 4RLYA 1MYOA 3UTMA 4BESA 4U95D 5CERB 2AJAA 4U8YD 5EIDA 3TWUA 4F1PA 4TUMA 3C5RA 4CZ2D 4QQIA 1N11A 2ETBA 2QC9A 2ZGGA 1MX4A 2DVWA 4HI9A 1YMPA 4LNUD 3UXGA 3W9FA 4DX5D 4Z68A 4DX7D 3T9KA 4LSZE 1UOHA 2XEEA 2P2CP 2QYJA 3Q9NC 5AQ7A 1S70B 5AQBA 4J8YA 4HI8A 4U8VD 4UUCA 3W9GA 2F37A 3J5PA 2KXPC 2RFAA 4O60A 3Q9UC 5FINA 4QFVA 3B7BA 3V2OA 2KBXA 4G8KA 4F6RD 4K5BA 1DC2A 2B0OE 3LJNA 4BSZB 4OAVB 3TWWA 2FO1E 2HE0A 3NOCD 5FIOA 1NFIE 3JUEA 5BXOA 3ZUVB 5CECB 1D9SA 4YDYA 2PNNA 2RFMA 1G3NB 2XZTG 4YDWA 5AAOA 3V30A 3UI2A 4DRXE 3TWVA 2Y0BG 5HS0A 3TWQA 1YYHA 1BI7B 4U96D 5CEAA 2F8XK 3TWTA 3KEAA 4HRMB 1AWCB 2ETCA 5KNGA 1AP7A 1MJ0A 3NOGD 5AN8A 1BLXB 5AQAA 2F8YA 4ZFHA 3AJIA 4HRLA 2BKGA 1K3ZD 4DX1A 1SW6A 2MYOA 5EYLA 2V4HC 3NBNB 1N0QA 1K1AA 5D66A 5KBAA 5KWDA 2BKKB 5CEDB 4LG6A 3SO8A 1BU9A 3ZKJA 1A5EA 3DEPA 5EN5D 5CBOA 1IKND 1MX2A 2XZDG 5ENPD 3TWXA 4N5QA 5EILA 1MX6A 4BERA 4JB8P 4CYMD 1K1BA 1IHBA 5KNHD 4NIKA 4BEPA 5AQ9A 5JMND 4DX2A 5HRYA 4HQDA 4BETA 5JA4D 4J7WA 4HLLA 2VGEA 4B93B 3V79K 2XEHA 4G8LA 3TWSA 3IXEA 5BXUA 5CBNA 3F6QA 1BD8A 4ZHBA 5ITZF 2DWZA 3EHQA 2DZNA 5EYPF 4DUIA 2NYJA 3DEOA 2A5EA 4HNAD 5ENQD 1BI8B 4OAUC 3V2XA 1WG0A 5HKPA
chains in the Genus database with same CATH superfamily
2CHWA 3G2WA 3CGHA 1TJCA 4L23A 3SHFA 5B3SE 2IJGX 3ZVVA 1YA0A 3MCXA 3GZSA 3OXFA 5KJNA 4Y6WA 4XE0A 5LX8A 3TWRA 1WM5A 3T8KA 5T4YA 4X8QA 3CVLA 3CQCB 3CQGB 3GW4A 3ASHA 4N39A 1EPUA 5FQ8A 2ZGGA 4Z68A 3ZYQA 2I1JA 4U63A 1LF8A 2QYJA 5BW8C 1PC2A 4N3AA 2BEDA 2WVIA 1SZAA 2P9LG 1ZBPA 3FU0A 3CVYA 3TAXA 4N3CA 5G04C 2PNNA 1TN6A 3ABKE 1TJFA 4NQ0A 2F8XK 3TWTA 3KEAA 3ESKA 2PQNA 3Q75A 3NB2A 4XIFA 1EF1C 5D2MC 1HG5A 3UM2A 1A5EA 3DEPA 1MX2A 3CEQA 2P9NG 4ILIA 4M3OA 1MZCA 3PEUB 2J4DA 5CBNA 3UINC 3R9AB 4OAUC 4Q94A 4EECA 1P5QA 1QYMA 3Q79A 3R9MA 4GMJA 3JXIA 1N4SA 3J5QB 4L2LA 3UUXA 3RKVA 1KZOA 3DWLG 3OTNA 3I4GA 4KVOA 3EHRA 1TNUA 3TL5A 3G2SA 3UKRG 3O48A 3ZN3A 4KVMA 2AJAA 1E8XA 4P29A 4LERA 2FBNA 4AXHA 3D9LA 2ZXWE 3ASGA 3CHPA 4UWGA 2OEVA 3W9FA 3T5XA 1S70B 3QAQA 4WWPA 1E8ZA 4J8EA 3V2OA 4I2ZA 4V3IA 1N52A 4JC8A 2X6KA 4B8CB 3SBSA 3KD7A 1X5BA 2WQ6A 2XZTG 2CHXA 2YHCA 4AJWA 3ML9A 3FUDA 4LNGA 3UM1A 3G2UA 3RSEG 5EYLA 1IHGA 2IEJA 2J49A 3ESLA 3DSUA 2BKKB 5EN5D 1JWFA 3SFZA 1MX6A 2FF4A 5AQ9A 3D9JA 5ITZF 4PS8A 3EHQA 3Q78A 1KT0A 2XEVA 4HNAD 4D10C 4C0MA 3UT4A 3JQ0A 3RRUA 2V5QC 2GRMA 4APFA 5T3RA 1V54E 4FJYA 4BT9A 2QZAA 3BUAA 1E7VA 2XS1A 5HQ8A 1FVHA 2IO3C 4J8FA 2J8SD 4WNDA 4ANUA 1S63A 3ZNGA 1FVFA 3HYMB 3MJWA 3LKUA 3SFXA 4AVXA 1N11A 2XGOA 3EIQC 3PH0C 4BTAA 3W9GA 4HI8A 3TXMA 4TXQA 5LOZA 1EDUA 2BF0X 2H6GA 1JUQA 4HOQA 5LP0A 1FPPA 1QZ2A 2MRIA 3TWVA 3TWQA 3B13A 3ULEG 5EDSA 2H6HA 3DBSA 4BTBA 2YHEA 2WB2A 2CFZA 2UWJG 2ONDA 1OCRE 2GRNB 4BX9A 3PE3A 4Y6CA 2Y4UA 4DI4A 3G2VA 4N5QA 3QJZA 2MOWA 3PS6A 5DIZA 3LDZA 5FQ6A 3EUVA 4KZ0A 1BD8A 2EIJE 2V0PA 3RK6A 5ENOD 1U3CA 4FHJA 3ONKA 3FY4A 5B1AE 4K5AB 2BTDA 5G04J 5E76A 1D8DA 2WXOA 4G26A 4MRUA 3B95A 2IQCA 2XGSA 3DSVA 3AS4A 2KM4A 3RRMB 1MX4A 3Q49B 2I2OA 3IBEA 3Q9NC 2P2CP 4J8YA 3DRAA 4JA7A 3CHMA 4JVSA 2GRLA 4G8KA 1OCCE 4A3TA 4K5BA 3I4RB 4MBGA 3DSWA 5FIOA 5AAOA 3MYVA 4EZJA 2WMNA 3HIZA 3FUEA 1HE8A 4CDNA 4IN3B 3RIBA 1MJ0A 2GGFA 1HG2A 1LD8A 2V4LA 4LUNU 1SW6A 3NBNB 2AXVA 1NI1A 2VSNA 1TNBA 2ILRA 5JJTA 3KS2A 2ZIRA 4APOA 3HHMA 3ASDA 4HQDA 4FJZA 1GW6A 3TWSA 3D9KA 3I5PA 4UWKA 4DUIA 4H7YA 2NYJA 2HM8A 2HR2A 1WG0A 1VDYA 1OWLA 4L7TA 2R17C 2P9UG 3CIAA 3FP3A 1Z3XA 3FTZA 1E8YA 3Q15A 3FDHA 1EYHA 3URZA 4JL0A 2X6IA 5AARA 3BG0B 5CMYA 1HX8A 3GZ1A 2YINA 3QK0A 2X3MA 1OCOE 2L0IA 2L6JA 4YDEA 3EHNA 3NZSA 2OV8A 4UWFA 2Y3AA 3ULQA 2C2LA 3UT8A 4XX5A 2KCVA 3CKBA 1DC2A 4BSZB 1RZ4A 3JUEA 2GW1A 1PAQA 2OVFA 3Q7AA 5A6CA 2UY1A 4U96D 4HRMB 4HS2A 2R05A 5AN8A 2GRRB 4ME2A 4HOSA 1JPLA 3UKUG 5FZQA 4U04A 2MYOA 1UN9A 3AS5A 4GAAA 4LNBA 4I1AA 5DBKA 3TWXA 2XPZA 4BERA 4LEUA 1IHBA 2GRPB 4J6IA 2C0LA 3B7RL 4GZ5A 2XEHA 4GA1A 3PZ2A 3FUHA 4ANXA 4E6HA 1ELWA 3T5VA 3DSSA 3EHMA 4GCOA 2FO7A 5KJKA 5FJYA 4GPMA 3ZGQA 4KYOB 3D9HA 1OY3D 3L54A 2WQ7A 1IQRA 3SQVA 1DVPA 2MHKA 4GZ6A 4RG9A 5AJLA 4YDOA 1OWPA 4CZ2D 4UWLA 3RJVA 5JHBA 4AY6A 2DVWA 4LNUD 5CHEE 2IONA 3LPZA 2DIWA 2C0MA 5FINA 4KXKB 2LUHA 3R7RA 3NF1A 3AU4A 4KMOA 3LJNA 2PZIA 2XCCA 4EPZA 1FT2A 4EHMA 2WXKA 2Y0BG 4ACKA 3CV0A 1FT1A 2WXPA 1QQEA 4CCAA 3PNLB 3B7UX 5EKQD 3Q47B 4U0SA 2RD0A 3UM0A 1U2VG 5ANRA 3ZEFA 3C3QA 4RVBA 4WWOA 5EILA 2WPVA 3L6AA 3FH5A 1ELKA 4AV7A 1HZ4A 3VLDA 4NURA 1KPSB 2QY7A 3FTSA 2RG8A 4K5CA 4GTPA 2DBAA 2Y1LE 2M63A 3JXJA 3MGBA 1NA3A 4ATGA 3CHOA 4GU5A 3ZFWA 1TEZA 2VQ2A 1UJKA 4IRUA 3QWVA 4JPSA 3S7DA 4HOUA 2GROB 5BUZA 3G2TA 2VGXB 4L1BA 3SF4A 4RLYA 4F53A 4KZCA 1N4RA 4TUMA 3P2BA 1IYGA 3PRZA 4XKBA 5FQ4A 4U8HA 1OUVA 3CSFA 4TXRA 1FCHA 3X2QE 3Q73A 4WNEA 3FTYA 3Q9UC 3NQPA 3FUJA 2KCKA 1HFAA 4K03A 4WAFA 2PM7A 2YNQA 4WNFA 2KATA 1D9SA 2LXLA 4YDYA 2WXMA 1TYQG 3V30A 2EILE 1TN8A 2LSVA 1X81A 4LCTA 2AXUA 3PZ4A 4KBQA 3R7QA 4XZ4A 5CEDB 4JEUA 4EZLA 4JHJA 4C9BB 1IKND 4GA0A 3LY7A 3SGHA 4NIKA 5FZSA 3L17A 2EINE 2WQHA 4U7EB 5CRVA 1TNZA 3LJ3A 2GRQB 3ZHEB 1HO8A 1D8EA 3ZRHA 5ENRD 2OOEA 5KJLA 1Y6IA 4XI0A 2Q7FA 3U4TA 5JJ7A 3CVUA 4JZYA 3MKRA 4O1PA 2YQ8A 4B8AA 3HG0D 2LXMA 3ASOE 3LY8A 4UQZA 1MYOA 3MV3B 5A23A 3B7TA 5BNWA 5FTPA 1JCSA 4GYWA 2ZU6B 3LS8A 2XPYA 1KT1A 2WM9A 2RFAA 3E32A 1Q2ZA 3B7BA 1W3BA 2RKKA 2VYIA 2J08A 3KEZA 3ZUVB 1LD7A 1DCEA 3BQOA 4OYSA 3UI2A 3UIOC 3JCKC 4UQYA 4IYPA 1S0PA 3CVXA 3SZ7A 3ABME 5T8IA 2CHZA 3PE4A 2XRYA 5G55A 2J07A 5D66A 1TNYA 3ONLA 4CYMD 1K1BA 4JW1A 4N5CA 3TG5A 2JEKA 5JA4D 4CT4A 4FA6A 1SA4A 4ILHB 5H7PA 1O1RA 2DWZA 1BI8B 4RQIA 2LSUA 2P9KG 3WG7E 5BPPA 5CCMA 3CR3A 1H2TC 3RO2A 4W9RA 3NAWA 4K0RA 3QWPA 3BG1B 3IHVA 4JXTA 4JD2G 2EQXA 3CK7A 3MA5A 4DX6D 3TGOA 2I6HA 5CERB 5AIJA 2J9QA 2AVPA 4DPRA 4JHKA 2LAHA 2R03A 3CVVA 4HORA 3S7BA 5D0OD 1XGWA 3HDXA 1QNFA 2PQRA 4QFVA 4EQFA 1INZA 4TRQA 3SI5A 5J90A 4CGWA 1RW2A 3HVEB 5ARFA 3DPYA 3B7SA 1N54A 3PEVB 3PZDA 5CEAA 2LO6A 4G25A 3L08A 4JHRA 2F8YA 3AJIA 4J8SA 3SBTB 1K1AA 5JJ6A 3LY9A 3ZKJA 1SA5A 5CBOA 2XZDG 3CLJA 4FLHA 4UQXA 3C72A 3UIPC 3CVNA 3HXBA 4HLLA 3ZYMA 5KJMA 4I6EA 3ABLE 3EIJA 3TJPA 3NZUA 5HKPA 3FTXA 4YVQC 2IY0C 2L6BA 2X38A 2FEZA 2KZTB 3AU5A 3ISMC 1H6KA 4DLOA 3D9PA 3LVRE 4WNGA 3OXGA 3UMVA 2R59A 5E75A 3IKOB 3FUKA 4OVUA 2VSYA 3V31A 4GTQA 3ZYLA 3PVLA 3TWUA 2IOSA 4F1PA 2R02A 3HXEA 4QQIA 4PDXA 4N2QA 3JYSA 5IY5E 4AY5A 1IQUA 3SD5A 3T8MA 4HLEA 5AQ7A 5FWQA 3QARA 4UUCA 2PL2A 3J5PA 1MQSA 4F6RD 2VJ8A 1Z5SC 4I9CA 4CT0A 2CFUA 2LAIA 1BI7B 3Q5MA 1N4QA 1AWCB 4G24A 2QYUA 2VSOE 1E7UA 2WXHA 4ACLA 2BKGA 3QDNA 4CDRA 3E34A 1HH8A 5JHAA 4DLQA 2NSZA 5KBAA 3ML8A 3AG4E 1TNOA 3FTVA 2VTBB 3AG3E 3HXCA 2XRZA 4RG6A 5HRYA 2AW6A 4HFGA 4AOFA 3V79K 4U0UA 4G1TA 4UI9C 2XPIA 2DZNA 5LCWC 4WWNA 3O4ZA 2PM6A 2X6HA 1MHQA 1H2VC 3QKYA 3DSXA 2E0IA 3L16A 2F0YA 2XHEA 1OWOA 4UWHA 4B94A 3ZU7B 5CMWA 1HXIA 5B1BE 3I3NA 5FQ7A 1B89A 1N95A 2HYZA 4HI9A 1YMPA 3PNTB 3FTUA 3T9KA 1BPOA 1K8KG 4G11A 1DNPA 5HI7A 3MEKA 2VTBA 4O60A 4UI9K 3PUJA 3ASNE 1Z6TA 2B0OE 3LCAA 5CRUA 4XEIG 3UT7A 1G3NB 5G05C 2OVBA 5HS0A 4NACA 5BV0A 3MX3A 4H7XA 4NRHB 4F1SA 5CCLA 1OXJA 4R7LA 4ZFHA 3P1UA 4AEZC 2IOLA 4DX1A 4GYOA 1H2UA 1UJJA 4LG6A 3SO8A 4I2WA 3S2AA 2XQ0A 5JMND 2Y4TA 2DCPA 4I43A 5BXUA 4G23A 3KSLA 2L0TB 1JWGA 4EBAA 3APCA 2A5EA 3KAEA 3U64A 3V2XA 1UG3A 1L5JA 3JQ1A 4PS3A 4FHKA 3RO3A 2FULA 4MKTA 2DZOA 2H6FA 4XI9A 3K9IA 4GMLA 3Q4AB 4GMRA 4KT6B 3U9WA 3U66A 4GTTA 1N0RA 3PREA 3S7JA 5G2NA 5J08A 3ENEA 3D9MA 4N2SA 4MLPA 4FADA 4BWRA 3UTMA 2WXGA 3D9OA 2X6JA 1UW4B 1LTXA 2QC9A 3FH7A 3UXGA 4DX5D 1Y8MA 2VGYA 4CGVA 1SZ9A 2XEEA 1JCRA 2KXPC 3L9TA 3APDA 4PH4B 3FFLA 3SFYA 4F7AA 2HE0A 3PDNA 1NFIE 5CECB 3CKCA 3LEWA 4ILGA 4E85A 3HXDA 4I1OB 2KCLA 5D0QD 4GB9A 5KNGA 3NOGD 3L22A 1E90A 4GCNA 1S64A 4GZCA 4OVVA 3N71A 4GZDA 2XGMA 4ANWA 4PS7A 4DI3A 3OXLA 1BU9A 1UN8A 3QOUA 3CK9A 4F3VA 3CK8A 4I17A 4I6GA 5C1DA 4B0ZA 1TN7A 3F6QA 3VLFA 2EIME 4DJAA 1NZNA 4J0UA 4TUUA 3AAAC 2ZGDA 1Z3YA 1E8WA 1TR4A 1WAO1 4I6JA 2VGXA 2J09A 4FLBA 4JEHA 4HRNA 1H6OA 1JCQA 2WXRA 1XNFA 4A63B 2LNIA 4O1OA 3VTXA 3CHSA 1DCQA 4FC8A 2R5SA 4U8YD 5EIDA 3DPDA 1PY1A 3MKQB 5BV1A 3ZXSA 4GZ3A 3ZW3A 5ANLA 5A7DB 3DSTA 5AQBA 3FUNA 2H6IA 1N9AA 3ZXPA 2KBXA 5AENA 1U3DA 3C3OA 4UI9J 3FU6A 1OWNA 4JA9A 3TWWA 5LCWJ 1QBQA 4YDWA 4BSXA 1OWMA 1YYHA 4GTVA 3SNXA 2FI7A 4HRLA 2A5UA 5BT1A 2XCBA 2NXPA 3APFA 2VSXE 5KCMA 2BUGA 4Q96A 5KWDA 3ZHEA 3FULA 4AM9A 3D9IA 2VGEA 3C98A 2L9BA 3FTWA 3MKQA 4URKA 4GYYA 4ZHBA 5EYPF 5ENQD 3IV0A 4CDMA 3ZPJA 4ATZD 3HRAA 4HB5A 3U3WA 4C0EA 3WXXA 3FHEA 4EBAG 4AIFA 4B89A 2NC9A 3FEXA 5EIBE 4O6FA 4PUCA 5G05J 4C48B 2P9PG 1HS6A 3AG1E 4A1SA 3CVQA 2X6FA 2ETAA 5ENSD 2P9IG 1ZU2A 4AP2A 3FWVA 3E30A 3PZ3A 4I9EA 2IU1A 2ETBA 5C2YA 2KC7A 3DXKG 4DK5A 3FUIA 1ZB1A 4U8VD 1NL4A 3ULYA 2I9CA 3FU3A 3QB2A 3FUFA 1KZPA 4ABNA 3C3RA 1O1TA 2A4ZA 3FUMA 4L2YA 4I1MA 2RFMA 3UM3A 2DYRE 4WUYA 4Q69A 2WXIA 2IO2C 1AP7A 5FZRA 1H19A 5AQAA 3LYAA 1K3ZD 2AWIA 2WXLA 2WXQA 3EDTB 4FP7A 4A1GA 1N0QA 4GTRA 2V5FA 5KNHD 1V55E 2JLBA 3OAWA 4B93B 1HF8A 4L9PA 2XS8A 2P9SG 3DEOA 2WXJA 5ARGA 1A17A 3BU8A 2HO1A 2WMOA 3IHYA 3E33A 2XENA 3UX4A 3RRNB 1SVXA 3BEEA 3LXUX 3EU9A 4HBDA 2P58C 4HVBA 1OT8A 2JABA 5M72A 5LFAA 3Q7FA 1YCSB 1NP7A 4YVOA 5EX0A 3FU5A 3CHQA 2WXNA 4FULA 4BESA 5FT9A 3AG2E 3IEGA 5AYWD 4BX8A 4TXPA 4DX7D 4LSZE 4GTMA 1N94A 1O5MA 3HVEA 3L82A 3DXMG 4BT8A 1H0AA 4BY6A 2Y69E 3KSQA 5EX3A 1NA0A 1WY6A 2IFUA 3QC1A 3TG4A 3CSTA 4OAVB 2FO1E 4EZKA 4DRXE 2WXFA 3VLEA 2B6CA 3EU5A 1H6PA 2IF4A 2ETCA 2AXZA 2I1KA 3GZ2A 4GA2A 2OCCE 5AJDA 2V4HC 2UY1B 4FU3A 3VTYA 2CG2A 1OCZE 5ENPD 2R2LA 3CVPA 2E2EA 3PZ1A 3E4BA 4G2VA 3UPVA 3SY2A 2KZTA 3ZIMA 4BETA 4U0ZA 5ENNA 1E96B 4XKCA 3EJNA 3QWWA 3IXEA 4ANVA 5ENTD 1HU3A 3QNKA 1SQMA 2CG3A 3RU0A 3S7FA 3PUKA 3ASFA 4N3BA 4A55A 1IXVA 3HXFA 3CVWA 3JUIA 3ZYKA 4GPKA 4MS6A 1O1SA 4J8DA 1WDYA 3CHRA 3D3MA 4GTOA 4U95D 2EIKE 3C5RA 4LRZA 3GYZA 2QFCA 1UOHA 2DYSE 2F37A 2ZISA 3FH8A 4TV3A 3FEYA 4HXIA 3NOCD 5BXOA 3MZLB 2OEWA 3L13A 3MV2B 4CEMA 1BLXB 4YNDA 3TXNA 4RSYA 4IULA 2J4BA 3AS8A 3LVQE 4CRWA 4HOTA 1N4PA 4M7CA 3RAUA 3D9NA 4JB8P 1KLXA 4BEPA 4DX2A 4J7WA 3E37A 4U07A 4GTSA 4G8LA 2V8SE 3UQ3A 1ELRA 4BFRA 4A3VA
chains in the Genus database with same CATH topology
1QYMA 2V5QC 4ATZD 5ENOD 5ENTD 2L6BA 5ENRD 3HRAA 4HB5A 2XENA 3JXIA 4K5CA 3AAAC 2ZGDA 3J5QB 2Y1LE 3JXJA 2DZOA 1SVXA 4K5AB 1TR4A 3EU9A 4GPMA 5EIBE 3D9HA 1IXVA 4GMRA 1N0RA 4HBDA 2J8SD 4HRNA 4O1PA 1OY3D 4C48B 1OT8A 3EHRA 3HG0D 3TWRA 3V31A 2JABA 4A63B 5AARA 4O1OA 3T8KA 4DX6D 3ZU7B 3B95A 1YCSB 1DCQA 1WDYA 3ZNGA 2ETAA 5ENSD 4RLYA 1MYOA 3UTMA 4BESA 4U95D 5CERB 2AJAA 4U8YD 5EIDA 3TWUA 4F1PA 4TUMA 3C5RA 4CZ2D 4QQIA 1N11A 2ETBA 2QC9A 2ZGGA 1MX4A 2DVWA 4HI9A 1YMPA 4LNUD 3UXGA 3W9FA 4DX5D 4Z68A 4DX7D 3T9KA 4LSZE 1UOHA 2XEEA 2P2CP 2QYJA 3Q9NC 5AQ7A 1S70B 5AQBA 4J8YA 4HI8A 4U8VD 4UUCA 3W9GA 2F37A 3J5PA 2KXPC 2RFAA 4O60A 3Q9UC 5FINA 4QFVA 3B7BA 3V2OA 2KBXA 4G8KA 4F6RD 4K5BA 1DC2A 2B0OE 3LJNA 4BSZB 4OAVB 3TWWA 2FO1E 2HE0A 3NOCD 5FIOA 1NFIE 3JUEA 5BXOA 3ZUVB 5CECB 1D9SA 4YDYA 2PNNA 2RFMA 1G3NB 2XZTG 4YDWA 5AAOA 3V30A 3UI2A 4DRXE 3TWVA 2Y0BG 5HS0A 3TWQA 1YYHA 1BI7B 4U96D 5CEAA 2F8XK 3TWTA 3KEAA 4HRMB 1AWCB 2ETCA 5KNGA 1AP7A 1MJ0A 3NOGD 5AN8A 1BLXB 5AQAA 2F8YA 4ZFHA 3AJIA 4HRLA 2BKGA 1K3ZD 4DX1A 1SW6A 2MYOA 5EYLA 2V4HC 3NBNB 1N0QA 1K1AA 5D66A 5KBAA 5KWDA 2BKKB 5CEDB 4LG6A 3SO8A 1BU9A 3ZKJA 1A5EA 3DEPA 5EN5D 5CBOA 1IKND 1MX2A 2XZDG 5ENPD 3TWXA 4N5QA 5EILA 1MX6A 4BERA 4JB8P 4CYMD 1K1BA 1IHBA 5KNHD 4NIKA 4BEPA 5AQ9A 5JMND 4DX2A 5HRYA 4HQDA 4BETA 5JA4D 4J7WA 4HLLA 2VGEA 4B93B 3V79K 2XEHA 4G8LA 3TWSA 3IXEA 5BXUA 5CBNA 3F6QA 1BD8A 4ZHBA 5ITZF 2DWZA 3EHQA 2DZNA 5EYPF 4DUIA 2NYJA 3DEOA 2A5EA 4HNAD 5ENQD 1BI8B 4OAUC 3V2XA 1WG0A 5HKPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QYM A;  2V5Q C;  4ATZ D;  5ENO D;  5ENT D;  2L6B A;  5ENR D;  3HRA A;  4HB5 A;  2XEN A;  3JXI A;  4K5C A;  3AAA C;  2ZGD A;  3J5Q B;  2Y1L E;  3JXJ A;  2DZO A;  1SVX A;  4K5A B;  1TR4 A;  3EU9 A;  4GPM A;  5EIB E;  3D9H A;  1IXV A;  4GMR A;  1N0R A;  4HBD A;  2J8S D;  4HRN A;  4O1P A;  1OY3 D;  4C48 B;  1OT8 A;  3EHR A;  3HG0 D;  3TWR A;  3V31 A;  2JAB A;  4A63 B;  5AAR A;  4O1O A;  3T8K A;  4DX6 D;  3ZU7 B;  3B95 A;  1YCS B;  1DCQ A;  1WDY A;  3ZNG A;  2ETA A;  5ENS D;  4RLY A;  1MYO A;  3UTM A;  4BES A;  4U95 D;  5CER B;  2AJA A;  4U8Y D;  5EID A;  3TWU A;  4F1P A;  4TUM A;  3C5R A;  4CZ2 D;  4QQI A;  1N11 A;  2ETB A;  2QC9 A;  2ZGG A;  1MX4 A;  2DVW A;  4HI9 A;  1YMP A;  4LNU D;  3UXG A;  3W9F A;  4DX5 D;  4Z68 A;  4DX7 D;  3T9K A;  4LSZ E;  1UOH A;  2XEE A;  2P2C P;  2QYJ A;  3Q9N C;  5AQ7 A;  1S70 B;  5AQB A;  4J8Y A;  4HI8 A;  4U8V D;  4UUC A;  3W9G A;  2F37 A;  3J5P A;  2KXP C;  2RFA A;  4O60 A;  3Q9U C;  5FIN A;  4QFV A;  3B7B A;  3V2O A;  2KBX A;  4G8K A;  4F6R D;  4K5B A;  1DC2 A;  2B0O E;  3LJN A;  4BSZ B;  4OAV B;  3TWW A;  2FO1 E;  2HE0 A;  3NOC D;  5FIO A;  1NFI E;  3JUE A;  5BXO A;  3ZUV B;  5CEC B;  1D9S A;  4YDY A;  2PNN A;  2RFM A;  1G3N B;  2XZT G;  4YDW A;  5AAO A;  3V30 A;  3UI2 A;  4DRX E;  3TWV A;  2Y0B G;  5HS0 A;  3TWQ A;  1YYH A;  1BI7 B;  4U96 D;  5CEA A;  2F8X K;  3TWT A;  3KEA A;  4HRM B;  1AWC B;  2ETC A;  5KNG A;  1AP7 A;  1MJ0 A;  3NOG D;  5AN8 A;  1BLX B;  5AQA A;  2F8Y A;  4ZFH A;  3AJI A;  4HRL A;  2BKG A;  1K3Z D;  4DX1 A;  1SW6 A;  2MYO A;  5EYL A;  2V4H C;  3NBN B;  1N0Q A;  1K1A A;  5D66 A;  5KBA A;  5KWD A;  2BKK B;  5CED B;  4LG6 A;  3SO8 A;  1BU9 A;  3ZKJ A;  1A5E A;  3DEP A;  5EN5 D;  5CBO A;  1IKN D;  1MX2 A;  2XZD G;  5ENP D;  3TWX A;  4N5Q A;  5EIL A;  1MX6 A;  4BER A;  4JB8 P;  4CYM D;  1K1B A;  1IHB A;  5KNH D;  4NIK A;  4BEP A;  5AQ9 A;  5JMN D;  4DX2 A;  5HRY A;  4HQD A;  4BET A;  5JA4 D;  4J7W A;  4HLL A;  2VGE A;  4B93 B;  3V79 K;  2XEH A;  4G8L A;  3TWS A;  3IXE A;  5BXU A;  5CBN A;  3F6Q A;  1BD8 A;  4ZHB A;  5ITZ F;  2DWZ A;  3EHQ A;  2DZN A;  5EYP F;  4DUI A;  2NYJ A;  3DEO A;  2A5E A;  4HNA D;  5ENQ D;  1BI8 B;  4OAU C;  3V2X A;  1WG0 A;  5HKP A; 
#chains in the Genus database with same CATH topology
 2CHW A;  3G2W A;  3CGH A;  1TJC A;  4L23 A;  3SHF A;  5B3S E;  2IJG X;  3ZVV A;  1YA0 A;  3MCX A;  3GZS A;  3OXF A;  5KJN A;  4Y6W A;  4XE0 A;  5LX8 A;  3TWR A;  1WM5 A;  3T8K A;  5T4Y A;  4X8Q A;  3CVL A;  3CQC B;  3CQG B;  3GW4 A;  3ASH A;  4N39 A;  1EPU A;  5FQ8 A;  2ZGG A;  4Z68 A;  3ZYQ A;  2I1J A;  4U63 A;  1LF8 A;  2QYJ A;  5BW8 C;  1PC2 A;  4N3A A;  2BED A;  2WVI A;  1SZA A;  2P9L G;  1ZBP A;  3FU0 A;  3CVY A;  3TAX A;  4N3C A;  5G04 C;  2PNN A;  1TN6 A;  3ABK E;  1TJF A;  4NQ0 A;  2F8X K;  3TWT A;  3KEA A;  3ESK A;  2PQN A;  3Q75 A;  3NB2 A;  4XIF A;  1EF1 C;  5D2M C;  1HG5 A;  3UM2 A;  1A5E A;  3DEP A;  1MX2 A;  3CEQ A;  2P9N G;  4ILI A;  4M3O A;  1MZC A;  3PEU B;  2J4D A;  5CBN A;  3UIN C;  3R9A B;  4OAU C;  4Q94 A;  4EEC A;  1P5Q A;  1QYM A;  3Q79 A;  3R9M A;  4GMJ A;  3JXI A;  1N4S A;  3J5Q B;  4L2L A;  3UUX A;  3RKV A;  1KZO A;  3DWL G;  3OTN A;  3I4G A;  4KVO A;  3EHR A;  1TNU A;  3TL5 A;  3G2S A;  3UKR G;  3O48 A;  3ZN3 A;  4KVM A;  2AJA A;  1E8X A;  4P29 A;  4LER A;  2FBN A;  4AXH A;  3D9L A;  2ZXW E;  3ASG A;  3CHP A;  4UWG A;  2OEV A;  3W9F A;  3T5X A;  1S70 B;  3QAQ A;  4WWP A;  1E8Z A;  4J8E A;  3V2O A;  4I2Z A;  4V3I A;  1N52 A;  4JC8 A;  2X6K A;  4B8C B;  3SBS A;  3KD7 A;  1X5B A;  2WQ6 A;  2XZT G;  2CHX A;  2YHC A;  4AJW A;  3ML9 A;  3FUD A;  4LNG A;  3UM1 A;  3G2U A;  3RSE G;  5EYL A;  1IHG A;  2IEJ A;  2J49 A;  3ESL A;  3DSU A;  2BKK B;  5EN5 D;  1JWF A;  3SFZ A;  1MX6 A;  2FF4 A;  5AQ9 A;  3D9J A;  5ITZ F;  4PS8 A;  3EHQ A;  3Q78 A;  1KT0 A;  2XEV A;  4HNA D;  4D10 C;  4C0M A;  3UT4 A;  3JQ0 A;  3RRU A;  2V5Q C;  2GRM A;  4APF A;  5T3R A;  1V54 E;  4FJY A;  4BT9 A;  2QZA A;  3BUA A;  1E7V A;  2XS1 A;  5HQ8 A;  1FVH A;  2IO3 C;  4J8F A;  2J8S D;  4WND A;  4ANU A;  1S63 A;  3ZNG A;  1FVF A;  3HYM B;  3MJW A;  3LKU A;  3SFX A;  4AVX A;  1N11 A;  2XGO A;  3EIQ C;  3PH0 C;  4BTA A;  3W9G A;  4HI8 A;  3TXM A;  4TXQ A;  5LOZ A;  1EDU A;  2BF0 X;  2H6G A;  1JUQ A;  4HOQ A;  5LP0 A;  1FPP A;  1QZ2 A;  2MRI A;  3TWV A;  3TWQ A;  3B13 A;  3ULE G;  5EDS A;  2H6H A;  3DBS A;  4BTB A;  2YHE A;  2WB2 A;  2CFZ A;  2UWJ G;  2OND A;  1OCR E;  2GRN B;  4BX9 A;  3PE3 A;  4Y6C A;  2Y4U A;  4DI4 A;  3G2V A;  4N5Q A;  3QJZ A;  2MOW A;  3PS6 A;  5DIZ A;  3LDZ A;  5FQ6 A;  3EUV A;  4KZ0 A;  1BD8 A;  2EIJ E;  2V0P A;  3RK6 A;  5ENO D;  1U3C A;  4FHJ A;  3ONK A;  3FY4 A;  5B1A E;  4K5A B;  2BTD A;  5G04 J;  5E76 A;  1D8D A;  2WXO A;  4G26 A;  4MRU A;  3B95 A;  2IQC A;  2XGS A;  3DSV A;  3AS4 A;  2KM4 A;  3RRM B;  1MX4 A;  3Q49 B;  2I2O A;  3IBE A;  3Q9N C;  2P2C P;  4J8Y A;  3DRA A;  4JA7 A;  3CHM A;  4JVS A;  2GRL A;  4G8K A;  1OCC E;  4A3T A;  4K5B A;  3I4R B;  4MBG A;  3DSW A;  5FIO A;  5AAO A;  3MYV A;  4EZJ A;  2WMN A;  3HIZ A;  3FUE A;  1HE8 A;  4CDN A;  4IN3 B;  3RIB A;  1MJ0 A;  2GGF A;  1HG2 A;  1LD8 A;  2V4L A;  4LUN U;  1SW6 A;  3NBN B;  2AXV A;  1NI1 A;  2VSN A;  1TNB A;  2ILR A;  5JJT A;  3KS2 A;  2ZIR A;  4APO A;  3HHM A;  3ASD A;  4HQD A;  4FJZ A;  1GW6 A;  3TWS A;  3D9K A;  3I5P A;  4UWK A;  4DUI A;  4H7Y A;  2NYJ A;  2HM8 A;  2HR2 A;  1WG0 A;  1VDY A;  1OWL A;  4L7T A;  2R17 C;  2P9U G;  3CIA A;  3FP3 A;  1Z3X A;  3FTZ A;  1E8Y A;  3Q15 A;  3FDH A;  1EYH A;  3URZ A;  4JL0 A;  2X6I A;  5AAR A;  3BG0 B;  5CMY A;  1HX8 A;  3GZ1 A;  2YIN A;  3QK0 A;  2X3M A;  1OCO E;  2L0I A;  2L6J A;  4YDE A;  3EHN A;  3NZS A;  2OV8 A;  4UWF A;  2Y3A A;  3ULQ A;  2C2L A;  3UT8 A;  4XX5 A;  2KCV A;  3CKB A;  1DC2 A;  4BSZ B;  1RZ4 A;  3JUE A;  2GW1 A;  1PAQ A;  2OVF A;  3Q7A A;  5A6C A;  2UY1 A;  4U96 D;  4HRM B;  4HS2 A;  2R05 A;  5AN8 A;  2GRR B;  4ME2 A;  4HOS A;  1JPL A;  3UKU G;  5FZQ A;  4U04 A;  2MYO A;  1UN9 A;  3AS5 A;  4GAA A;  4LNB A;  4I1A A;  5DBK A;  3TWX A;  2XPZ A;  4BER A;  4LEU A;  1IHB A;  2GRP B;  4J6I A;  2C0L A;  3B7R L;  4GZ5 A;  2XEH A;  4GA1 A;  3PZ2 A;  3FUH A;  4ANX A;  4E6H A;  1ELW A;  3T5V A;  3DSS A;  3EHM A;  4GCO A;  2FO7 A;  5KJK A;  5FJY A;  4GPM A;  3ZGQ A;  4KYO B;  3D9H A;  1OY3 D;  3L54 A;  2WQ7 A;  1IQR A;  3SQV A;  1DVP A;  2MHK A;  4GZ6 A;  4RG9 A;  5AJL A;  4YDO A;  1OWP A;  4CZ2 D;  4UWL A;  3RJV A;  5JHB A;  4AY6 A;  2DVW A;  4LNU D;  5CHE E;  2ION A;  3LPZ A;  2DIW A;  2C0M A;  5FIN A;  4KXK B;  2LUH A;  3R7R A;  3NF1 A;  3AU4 A;  4KMO A;  3LJN A;  2PZI A;  2XCC A;  4EPZ A;  1FT2 A;  4EHM A;  2WXK A;  2Y0B G;  4ACK A;  3CV0 A;  1FT1 A;  2WXP A;  1QQE A;  4CCA A;  3PNL B;  3B7U X;  5EKQ D;  3Q47 B;  4U0S A;  2RD0 A;  3UM0 A;  1U2V G;  5ANR A;  3ZEF A;  3C3Q A;  4RVB A;  4WWO A;  5EIL A;  2WPV A;  3L6A A;  3FH5 A;  1ELK A;  4AV7 A;  1HZ4 A;  3VLD A;  4NUR A;  1KPS B;  2QY7 A;  3FTS A;  2RG8 A;  4K5C A;  4GTP A;  2DBA A;  2Y1L E;  2M63 A;  3JXJ A;  3MGB A;  1NA3 A;  4ATG A;  3CHO A;  4GU5 A;  3ZFW A;  1TEZ A;  2VQ2 A;  1UJK A;  4IRU A;  3QWV A;  4JPS A;  3S7D A;  4HOU A;  2GRO B;  5BUZ A;  3G2T A;  2VGX B;  4L1B A;  3SF4 A;  4RLY A;  4F53 A;  4KZC A;  1N4R A;  4TUM A;  3P2B A;  1IYG A;  3PRZ A;  4XKB A;  5FQ4 A;  4U8H A;  1OUV A;  3CSF A;  4TXR A;  1FCH A;  3X2Q E;  3Q73 A;  4WNE A;  3FTY A;  3Q9U C;  3NQP A;  3FUJ A;  2KCK A;  1HFA A;  4K03 A;  4WAF A;  2PM7 A;  2YNQ A;  4WNF A;  2KAT A;  1D9S A;  2LXL A;  4YDY A;  2WXM A;  1TYQ G;  3V30 A;  2EIL E;  1TN8 A;  2LSV A;  1X81 A;  4LCT A;  2AXU A;  3PZ4 A;  4KBQ A;  3R7Q A;  4XZ4 A;  5CED B;  4JEU A;  4EZL A;  4JHJ A;  4C9B B;  1IKN D;  4GA0 A;  3LY7 A;  3SGH A;  4NIK A;  5FZS A;  3L17 A;  2EIN E;  2WQH A;  4U7E B;  5CRV A;  1TNZ A;  3LJ3 A;  2GRQ B;  3ZHE B;  1HO8 A;  1D8E A;  3ZRH A;  5ENR D;  2OOE A;  5KJL A;  1Y6I A;  4XI0 A;  2Q7F A;  3U4T A;  5JJ7 A;  3CVU A;  4JZY A;  3MKR A;  4O1P A;  2YQ8 A;  4B8A A;  3HG0 D;  2LXM A;  3ASO E;  3LY8 A;  4UQZ A;  1MYO A;  3MV3 B;  5A23 A;  3B7T A;  5BNW A;  5FTP A;  1JCS A;  4GYW A;  2ZU6 B;  3LS8 A;  2XPY A;  1KT1 A;  2WM9 A;  2RFA A;  3E32 A;  1Q2Z A;  3B7B A;  1W3B A;  2RKK A;  2VYI A;  2J08 A;  3KEZ A;  3ZUV B;  1LD7 A;  1DCE A;  3BQO A;  4OYS A;  3UI2 A;  3UIO C;  3JCK C;  4UQY A;  4IYP A;  1S0P A;  3CVX A;  3SZ7 A;  3ABM E;  5T8I A;  2CHZ A;  3PE4 A;  2XRY A;  5G55 A;  2J07 A;  5D66 A;  1TNY A;  3ONL A;  4CYM D;  1K1B A;  4JW1 A;  4N5C A;  3TG5 A;  2JEK A;  5JA4 D;  4CT4 A;  4FA6 A;  1SA4 A;  4ILH B;  5H7P A;  1O1R A;  2DWZ A;  1BI8 B;  4RQI A;  2LSU A;  2P9K G;  3WG7 E;  5BPP A;  5CCM A;  3CR3 A;  1H2T C;  3RO2 A;  4W9R A;  3NAW A;  4K0R A;  3QWP A;  3BG1 B;  3IHV A;  4JXT A;  4JD2 G;  2EQX A;  3CK7 A;  3MA5 A;  4DX6 D;  3TGO A;  2I6H A;  5CER B;  5AIJ A;  2J9Q A;  2AVP A;  4DPR A;  4JHK A;  2LAH A;  2R03 A;  3CVV A;  4HOR A;  3S7B A;  5D0O D;  1XGW A;  3HDX A;  1QNF A;  2PQR A;  4QFV A;  4EQF A;  1INZ A;  4TRQ A;  3SI5 A;  5J90 A;  4CGW A;  1RW2 A;  3HVE B;  5ARF A;  3DPY A;  3B7S A;  1N54 A;  3PEV B;  3PZD A;  5CEA A;  2LO6 A;  4G25 A;  3L08 A;  4JHR A;  2F8Y A;  3AJI A;  4J8S A;  3SBT B;  1K1A A;  5JJ6 A;  3LY9 A;  3ZKJ A;  1SA5 A;  5CBO A;  2XZD G;  3CLJ A;  4FLH A;  4UQX A;  3C72 A;  3UIP C;  3CVN A;  3HXB A;  4HLL A;  3ZYM A;  5KJM A;  4I6E A;  3ABL E;  3EIJ A;  3TJP A;  3NZU A;  5HKP A;  3FTX A;  4YVQ C;  2IY0 C;  2L6B A;  2X38 A;  2FEZ A;  2KZT B;  3AU5 A;  3ISM C;  1H6K A;  4DLO A;  3D9P A;  3LVR E;  4WNG A;  3OXG A;  3UMV A;  2R59 A;  5E75 A;  3IKO B;  3FUK A;  4OVU A;  2VSY A;  3V31 A;  4GTQ A;  3ZYL A;  3PVL A;  3TWU A;  2IOS A;  4F1P A;  2R02 A;  3HXE A;  4QQI A;  4PDX A;  4N2Q A;  3JYS A;  5IY5 E;  4AY5 A;  1IQU A;  3SD5 A;  3T8M A;  4HLE A;  5AQ7 A;  5FWQ A;  3QAR A;  4UUC A;  2PL2 A;  3J5P A;  1MQS A;  4F6R D;  2VJ8 A;  1Z5S C;  4I9C A;  4CT0 A;  2CFU A;  2LAI A;  1BI7 B;  3Q5M A;  1N4Q A;  1AWC B;  4G24 A;  2QYU A;  2VSO E;  1E7U A;  2WXH A;  4ACL A;  2BKG A;  3QDN A;  4CDR A;  3E34 A;  1HH8 A;  5JHA A;  4DLQ A;  2NSZ A;  5KBA A;  3ML8 A;  3AG4 E;  1TNO A;  3FTV A;  2VTB B;  3AG3 E;  3HXC A;  2XRZ A;  4RG6 A;  5HRY A;  2AW6 A;  4HFG A;  4AOF A;  3V79 K;  4U0U A;  4G1T A;  4UI9 C;  2XPI A;  2DZN A;  5LCW C;  4WWN A;  3O4Z A;  2PM6 A;  2X6H A;  1MHQ A;  1H2V C;  3QKY A;  3DSX A;  2E0I A;  3L16 A;  2F0Y A;  2XHE A;  1OWO A;  4UWH A;  4B94 A;  3ZU7 B;  5CMW A;  1HXI A;  5B1B E;  3I3N A;  5FQ7 A;  1B89 A;  1N95 A;  2HYZ A;  4HI9 A;  1YMP A;  3PNT B;  3FTU A;  3T9K A;  1BPO A;  1K8K G;  4G11 A;  1DNP A;  5HI7 A;  3MEK A;  2VTB A;  4O60 A;  4UI9 K;  3PUJ A;  3ASN E;  1Z6T A;  2B0O E;  3LCA A;  5CRU A;  4XEI G;  3UT7 A;  1G3N B;  5G05 C;  2OVB A;  5HS0 A;  4NAC A;  5BV0 A;  3MX3 A;  4H7X A;  4NRH B;  4F1S A;  5CCL A;  1OXJ A;  4R7L A;  4ZFH A;  3P1U A;  4AEZ C;  2IOL A;  4DX1 A;  4GYO A;  1H2U A;  1UJJ A;  4LG6 A;  3SO8 A;  4I2W A;  3S2A A;  2XQ0 A;  5JMN D;  2Y4T A;  2DCP A;  4I43 A;  5BXU A;  4G23 A;  3KSL A;  2L0T B;  1JWG A;  4EBA A;  3APC A;  2A5E A;  3KAE A;  3U64 A;  3V2X A;  1UG3 A;  1L5J A;  3JQ1 A;  4PS3 A;  4FHK A;  3RO3 A;  2FUL A;  4MKT A;  2DZO A;  2H6F A;  4XI9 A;  3K9I A;  4GML A;  3Q4A B;  4GMR A;  4KT6 B;  3U9W A;  3U66 A;  4GTT A;  1N0R A;  3PRE A;  3S7J A;  5G2N A;  5J08 A;  3ENE A;  3D9M A;  4N2S A;  4MLP A;  4FAD A;  4BWR A;  3UTM A;  2WXG A;  3D9O A;  2X6J A;  1UW4 B;  1LTX A;  2QC9 A;  3FH7 A;  3UXG A;  4DX5 D;  1Y8M A;  2VGY A;  4CGV A;  1SZ9 A;  2XEE A;  1JCR A;  2KXP C;  3L9T A;  3APD A;  4PH4 B;  3FFL A;  3SFY A;  4F7A A;  2HE0 A;  3PDN A;  1NFI E;  5CEC B;  3CKC A;  3LEW A;  4ILG A;  4E85 A;  3HXD A;  4I1O B;  2KCL A;  5D0Q D;  4GB9 A;  5KNG A;  3NOG D;  3L22 A;  1E90 A;  4GCN A;  1S64 A;  4GZC A;  4OVV A;  3N71 A;  4GZD A;  2XGM A;  4ANW A;  4PS7 A;  4DI3 A;  3OXL A;  1BU9 A;  1UN8 A;  3QOU A;  3CK9 A;  4F3V A;  3CK8 A;  4I17 A;  4I6G A;  5C1D A;  4B0Z A;  1TN7 A;  3F6Q A;  3VLF A;  2EIM E;  4DJA A;  1NZN A;  4J0U A;  4TUU A;  3AAA C;  2ZGD A;  1Z3Y A;  1E8W A;  1TR4 A;  1WAO 1;  4I6J A;  2VGX A;  2J09 A;  4FLB A;  4JEH A;  4HRN A;  1H6O A;  1JCQ A;  2WXR A;  1XNF A;  4A63 B;  2LNI A;  4O1O A;  3VTX A;  3CHS A;  1DCQ A;  4FC8 A;  2R5S A;  4U8Y D;  5EID A;  3DPD A;  1PY1 A;  3MKQ B;  5BV1 A;  3ZXS A;  4GZ3 A;  3ZW3 A;  5ANL A;  5A7D B;  3DST A;  5AQB A;  3FUN A;  2H6I A;  1N9A A;  3ZXP A;  2KBX A;  5AEN A;  1U3D A;  3C3O A;  4UI9 J;  3FU6 A;  1OWN A;  4JA9 A;  3TWW A;  5LCW J;  1QBQ A;  4YDW A;  4BSX A;  1OWM A;  1YYH A;  4GTV A;  3SNX A;  2FI7 A;  4HRL A;  2A5U A;  5BT1 A;  2XCB A;  2NXP A;  3APF A;  2VSX E;  5KCM A;  2BUG A;  4Q96 A;  5KWD A;  3ZHE A;  3FUL A;  4AM9 A;  3D9I A;  2VGE A;  3C98 A;  2L9B A;  3FTW A;  3MKQ A;  4URK A;  4GYY A;  4ZHB A;  5EYP F;  5ENQ D;  3IV0 A;  4CDM A;  3ZPJ A;  4ATZ D;  3HRA A;  4HB5 A;  3U3W A;  4C0E A;  3WXX A;  3FHE A;  4EBA G;  4AIF A;  4B89 A;  2NC9 A;  3FEX A;  5EIB E;  4O6F A;  4PUC A;  5G05 J;  4C48 B;  2P9P G;  1HS6 A;  3AG1 E;  4A1S A;  3CVQ A;  2X6F A;  2ETA A;  5ENS D;  2P9I G;  1ZU2 A;  4AP2 A;  3FWV A;  3E30 A;  3PZ3 A;  4I9E A;  2IU1 A;  2ETB A;  5C2Y A;  2KC7 A;  3DXK G;  4DK5 A;  3FUI A;  1ZB1 A;  4U8V D;  1NL4 A;  3ULY A;  2I9C A;  3FU3 A;  3QB2 A;  3FUF A;  1KZP A;  4ABN A;  3C3R A;  1O1T A;  2A4Z A;  3FUM A;  4L2Y A;  4I1M A;  2RFM A;  3UM3 A;  2DYR E;  4WUY A;  4Q69 A;  2WXI A;  2IO2 C;  1AP7 A;  5FZR A;  1H19 A;  5AQA A;  3LYA A;  1K3Z D;  2AWI A;  2WXL A;  2WXQ A;  3EDT B;  4FP7 A;  4A1G A;  1N0Q A;  4GTR A;  2V5F A;  5KNH D;  1V55 E;  2JLB A;  3OAW A;  4B93 B;  1HF8 A;  4L9P A;  2XS8 A;  2P9S G;  3DEO A;  2WXJ A;  5ARG A;  1A17 A;  3BU8 A;  2HO1 A;  2WMO A;  3IHY A;  3E33 A;  2XEN A;  3UX4 A;  3RRN B;  1SVX A;  3BEE A;  3LXU X;  3EU9 A;  4HBD A;  2P58 C;  4HVB A;  1OT8 A;  2JAB A;  5M72 A;  5LFA A;  3Q7F A;  1YCS B;  1NP7 A;  4YVO A;  5EX0 A;  3FU5 A;  3CHQ A;  2WXN A;  4FUL A;  4BES A;  5FT9 A;  3AG2 E;  3IEG A;  5AYW D;  4BX8 A;  4TXP A;  4DX7 D;  4LSZ E;  4GTM A;  1N94 A;  1O5M A;  3HVE A;  3L82 A;  3DXM G;  4BT8 A;  1H0A A;  4BY6 A;  2Y69 E;  3KSQ A;  5EX3 A;  1NA0 A;  1WY6 A;  2IFU A;  3QC1 A;  3TG4 A;  3CST A;  4OAV B;  2FO1 E;  4EZK A;  4DRX E;  2WXF A;  3VLE A;  2B6C A;  3EU5 A;  1H6P A;  2IF4 A;  2ETC A;  2AXZ A;  2I1K A;  3GZ2 A;  4GA2 A;  2OCC E;  5AJD A;  2V4H C;  2UY1 B;  4FU3 A;  3VTY A;  2CG2 A;  1OCZ E;  5ENP D;  2R2L A;  3CVP A;  2E2E A;  3PZ1 A;  3E4B A;  4G2V A;  3UPV A;  3SY2 A;  2KZT A;  3ZIM A;  4BET A;  4U0Z A;  5ENN A;  1E96 B;  4XKC A;  3EJN A;  3QWW A;  3IXE A;  4ANV A;  5ENT D;  1HU3 A;  3QNK A;  1SQM A;  2CG3 A;  3RU0 A;  3S7F A;  3PUK A;  3ASF A;  4N3B A;  4A55 A;  1IXV A;  3HXF A;  3CVW A;  3JUI A;  3ZYK A;  4GPK A;  4MS6 A;  1O1S A;  4J8D A;  1WDY A;  3CHR A;  3D3M A;  4GTO A;  4U95 D;  2EIK E;  3C5R A;  4LRZ A;  3GYZ A;  2QFC A;  1UOH A;  2DYS E;  2F37 A;  2ZIS A;  3FH8 A;  4TV3 A;  3FEY A;  4HXI A;  3NOC D;  5BXO A;  3MZL B;  2OEW A;  3L13 A;  3MV2 B;  4CEM A;  1BLX B;  4YND A;  3TXN A;  4RSY A;  4IUL A;  2J4B A;  3AS8 A;  3LVQ E;  4CRW A;  4HOT A;  1N4P A;  4M7C A;  3RAU A;  3D9N A;  4JB8 P;  1KLX A;  4BEP A;  4DX2 A;  4J7W A;  3E37 A;  4U07 A;  4GTS A;  4G8L A;  2V8S E;  3UQ3 A;  1ELR A;  4BFR A;  4A3V A; 
#chains in the Genus database with same CATH homology
 1QYM A;  2V5Q C;  4ATZ D;  5ENO D;  5ENT D;  2L6B A;  5ENR D;  3HRA A;  4HB5 A;  2XEN A;  3JXI A;  4K5C A;  3AAA C;  2ZGD A;  3J5Q B;  2Y1L E;  3JXJ A;  2DZO A;  1SVX A;  4K5A B;  1TR4 A;  3EU9 A;  4GPM A;  5EIB E;  3D9H A;  1IXV A;  4GMR A;  1N0R A;  4HBD A;  2J8S D;  4HRN A;  4O1P A;  1OY3 D;  4C48 B;  1OT8 A;  3EHR A;  3HG0 D;  3TWR A;  3V31 A;  2JAB A;  4A63 B;  5AAR A;  4O1O A;  3T8K A;  4DX6 D;  3ZU7 B;  3B95 A;  1YCS B;  1DCQ A;  1WDY A;  3ZNG A;  2ETA A;  5ENS D;  4RLY A;  1MYO A;  3UTM A;  4BES A;  4U95 D;  5CER B;  2AJA A;  4U8Y D;  5EID A;  3TWU A;  4F1P A;  4TUM A;  3C5R A;  4CZ2 D;  4QQI A;  1N11 A;  2ETB A;  2QC9 A;  2ZGG A;  1MX4 A;  2DVW A;  4HI9 A;  1YMP A;  4LNU D;  3UXG A;  3W9F A;  4DX5 D;  4Z68 A;  4DX7 D;  3T9K A;  4LSZ E;  1UOH A;  2XEE A;  2P2C P;  2QYJ A;  3Q9N C;  5AQ7 A;  1S70 B;  5AQB A;  4J8Y A;  4HI8 A;  4U8V D;  4UUC A;  3W9G A;  2F37 A;  3J5P A;  2KXP C;  2RFA A;  4O60 A;  3Q9U C;  5FIN A;  4QFV A;  3B7B A;  3V2O A;  2KBX A;  4G8K A;  4F6R D;  4K5B A;  1DC2 A;  2B0O E;  3LJN A;  4BSZ B;  4OAV B;  3TWW A;  2FO1 E;  2HE0 A;  3NOC D;  5FIO A;  1NFI E;  3JUE A;  5BXO A;  3ZUV B;  5CEC B;  1D9S A;  4YDY A;  2PNN A;  2RFM A;  1G3N B;  2XZT G;  4YDW A;  5AAO A;  3V30 A;  3UI2 A;  4DRX E;  3TWV A;  2Y0B G;  5HS0 A;  3TWQ A;  1YYH A;  1BI7 B;  4U96 D;  5CEA A;  2F8X K;  3TWT A;  3KEA A;  4HRM B;  1AWC B;  2ETC A;  5KNG A;  1AP7 A;  1MJ0 A;  3NOG D;  5AN8 A;  1BLX B;  5AQA A;  2F8Y A;  4ZFH A;  3AJI A;  4HRL A;  2BKG A;  1K3Z D;  4DX1 A;  1SW6 A;  2MYO A;  5EYL A;  2V4H C;  3NBN B;  1N0Q A;  1K1A A;  5D66 A;  5KBA A;  5KWD A;  2BKK B;  5CED B;  4LG6 A;  3SO8 A;  1BU9 A;  3ZKJ A;  1A5E A;  3DEP A;  5EN5 D;  5CBO A;  1IKN D;  1MX2 A;  2XZD G;  5ENP D;  3TWX A;  4N5Q A;  5EIL A;  1MX6 A;  4BER A;  4JB8 P;  4CYM D;  1K1B A;  1IHB A;  5KNH D;  4NIK A;  4BEP A;  5AQ9 A;  5JMN D;  4DX2 A;  5HRY A;  4HQD A;  4BET A;  5JA4 D;  4J7W A;  4HLL A;  2VGE A;  4B93 B;  3V79 K;  2XEH A;  4G8L A;  3TWS A;  3IXE A;  5BXU A;  5CBN A;  3F6Q A;  1BD8 A;  4ZHB A;  5ITZ F;  2DWZ A;  3EHQ A;  2DZN A;  5EYP F;  4DUI A;  2NYJ A;  3DEO A;  2A5E A;  4HNA D;  5ENQ D;  1BI8 B;  4OAU C;  3V2X A;  1WG0 A;  5HKP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...