4CGVA

First tpr of spaghetti (rpap3) bound to hsp90 peptide srmeevd
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
125
structure length
125
Chain Sequence
HVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords RNA POLYMERASE II-ASSOCIATED PROTEIN 3
publication title Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cgvA00
3VTYA 5A7DB 2PQRA 3LY8A 3MA5A 3QDNA 3UQ3A 1YA0A 4I2WA 3ZFWA 5FTPA 3LPZA 2VSYA 4U04A 3ULQA 3OXLA 4I17A 4HOTA 5KJKA 4GYYA 3O48A 4WNFA 4H7YA 4ABNA 4GCNA 4J8FA 4U0ZA 4BTBA 4JL0A 2UWJG 5FJYA 4WNDA 3GZ2A 3QOUA 5FZQA 4APOA 1ZU2A 4B94A 3CVLA 2R5SA 2V5FA 4N2SA 1HZ4A 3IEGA 4HOQA 2PQNA 4O6FA 4J8DA 4A1SA 4G26A 3UPVA 3GYZA 2I6HA 3ASGA 1IHGA 3QKYA 4N3CA 3NF1A 3E4BA 3U3WA 3Q4AB 4AIFA 2PL2A 2XCBA 4KXKB 5CHEE 3AS5A 3S7DA 3Q15A 1WAO1 3S7JA 4UI9K 3QWVA 4HOUA 2E2EA 2VSNA 4Y6WA 2GW1A 5JJ7A 1IYGA 1A17A 3ZN3A 4N39A 2P58C 4ME2A 5LCWJ 4GZ3A 4BWRA 1KT1A 3CEQA 4F3VA 3LYAA 3ASHA 2JLBA 2LSUA 3U4TA 2WQHA 2YHCA 3JYSA 2XGSA 4GA2A 4RG9A 5D0QD 4U07A 1Y8MA 3QWPA 4UQZA 4BT8A 3UUXA 4JA7A 4GYWA 4GCOA 3TAXA 3ZGQA 1TJCA 3HYMB 5DIZA 2VGXA 3ZHEB 4I9CA 4I9EA 5BNWA 2KCLA 5AYWD 4N3BA 5CCLA 4GYOA 3CK9A 2FEZA 5LCWC 2FBNA 3RO2A 1ELWA 2Y4TA 3BEEA 3ASFA 3CKBA 2XPIA 3PE3A 2ONDA 3SZ7A 3CVNA 4Y6CA 4G23A 4EQFA 1PC2A 5FT9A 2XGOA 5ARFA 4CDRA 5G05J 3LY9A 3RKVA 3CV0A 1B89A 4CGWA 5ARGA 5HQ8A 3AS4A 3ZPJA 4YNDA 5A6CA 2KCVA 4GA0A 5FZSA 5KJLA 1XNFA 1QZ2A 3GW4A 3CK7A 4AY6A 5BT1A 2VGXB 3MV3B 3GZ1A 3TG5A 2WPVA 3EDTB 5G04J 4LEUA 3ZHEA 2FO7A 1ZBPA 4HORA 4XI0A 4G2VA 4WNGA 3RIBA 2IF4A 1OUVA 2BUGA 5G05C 5JJ6A 3FFLA 2FF4A 2QFCA 5EKQD 3ESKA 3KD7A 1HXIA 4WNEA 4NRHB 3OXGA 1E96B 4N3AA 4U0SA 4U0UA 2IFUA 4JA9A 4UI9C 2OOEA 2NC9A 2J9QA 3MKRA 4G24A 4XI9A 5G04C 4G25A 4NQ0A 4AM9A 2HR2A 4BTAA 2LNIA 1NA0A 4H7XA 4BT9A 3MEKA 3Q5MA 1NA3A 4YVQC 1FCHA 3S7FA 2KCKA 4I2ZA 3RU0A 2VYIA 3FP3A 2XCCA 5EX3A 3Q49B 3CVQA 5HI7A 4GZ6A 2UY1A 2L6JA 4AY5A 1W3BA 5C1DA 3AS8A 2LSVA 5BW8C 4KBQA 4YVOA 5KJMA 1KLXA 2HYZA 4N5CA 4N2QA 1WM5A 4KYOB 5FZRA 2AVPA 2YQ8A 5DBKA 2FI7A 3LY7A 3MV2B 4UI9J 5M72A 4GPKA 2C0LA 5EX0A 3N71A 4IN3B 3CVPA 4JHRA 5D0OD 4WUYA 3S7BA 4CGVA 2DBAA 3PDNA 2Q7FA 2VQ2A 3RO3A 3QWWA 3VTXA 1P5QA 3TGOA 2UY1B 3KAEA 3LCAA 3FWVA 3LKUA 2MHKA 4UQXA 3URZA 4G1TA 1ELRA 1KT0A 2KC7A 1HH8A 3KS2A 2XEVA 3Q47B 5KJNA 2C0MA 3RJVA 1QQEA 4GA1A 3WXXA 2KATA 4I1AA 3K9IA 4GZ5A 4HOSA 2Y4UA 3CKCA 3TG4A 3ASDA 1NZNA 4J0UA 3PE4A 2XGMA 2VGYA 5JJTA 2HO1A 3OXFA 2PZIA 4RG6A 4XIFA 3CK8A 3SF4A 4J8EA 2C2LA 4W9RA 4UQYA 5CCMA 3R9AB
chains in the Genus database with same CATH superfamily
2PQRA 3MA5A 3ZFWA 2RFAA 1N0RA 2XS8A 4MRUA 1JWFA 1UG3A 4I17A 4K5AB 5KJKA 3E33A 1DVPA 1EF1C 4BESA 4JPSA 2GROB 3C98A 4ANVA 4K5CA 2WXGA 3MKQB 3Q79A 4APOA 5AAOA 2Y1LE 4CEMA 5J90A 3L22A 5AARA 5AENA 1DCQA 3UIPC 4TRQA 2V4LA 4A1SA 2P9PG 2P9IG 3UPVA 3DSSA 4B0ZA 2I6HA 4N3CA 4DJAA 1N52A 3NF1A 3CVWA 1FT2A 4JEHA 1H6OA 4AIFA 3W9GA 5JMND 4C48B 2IOSA 2WMNA 4FLHA 3Q15A 3UM3A 3G2SA 4HB5A 1TNYA 4HOUA 4GTOA 4TUUA 2OEWA 1DC2A 4DPRA 3R7QA 3JUEA 4A3TA 4N39A 1N4QA 3T8KA 3SQVA 2P58C 5LCWJ 4DLOA 4P29A 1D8EA 1N11A 1KT1A 2L0TB 1EYHA 1HG2A 3TWQA 4BEPA 5FQ4A 1U3CA 3U4TA 3RRUA 2IY0C 3BG0B 4RG9A 3CSTA 4OVUA 5D0QD 3ZXSA 2QC9A 3QWPA 4RVBA 3HG0D 4UQZA 5BUZA 4BT8A 3UUXA 2CFUA 1JUQA 2NSZA 1YMPA 4FHJA 4GCOA 3TAXA 2R03A 3ZGQA 3ZYLA 3CQCB 3AG4E 5BNWA 3DSWA 4JB8P 3UI2A 4F6RD 4L2YA 1NI1A 5LCWC 5JA4D 3BEEA 3CKBA 5KBAA 2ONDA 4HXIA 3UMVA 3CVNA 2X6HA 2HM8A 3SHFA 3HXCA 1PC2A 1TNBA 3P2BA 2XGOA 5ARFA 3B95A 1BPOA 2FO1E 5D66A 4GB9A 4GMRA 4FU3A 1OCRE 3BG1B 5ARGA 5A6CA 2KCVA 4GTTA 4V3IA 1BLXB 2WQ7A 2WVIA 4TV3A 5LP0A 2WXPA 2OVFA 4G8LA 5BT1A 3V79K 3RSEG 3B13A 5LX8A 3VLEA 3UINC 2H6GA 2WPVA 5AQ7A 5G04J 2LO6A 2FO7A 4HORA 4G2VA 3FFLA 3ABME 3ESKA 1OWPA 3KD7A 5H7PA 3OXGA 5ENPD 4U0UA 1H2UA 2XEEA 4DX7D 3IV0A 4UI9C 3L9TA 3WG7E 3FTYA 1TJFA 2J9QA 4G24A 3EHRA 3ZVVA 4XI9A 3TWVA 2J4BA 1H6KA 2P9KG 1NL4A 2V5QC 4PH4B 2KBXA 5G04C 4XKCA 4NQ0A 1NA0A 3FUMA 5EDSA 1KPSB 4OVVA 1KZPA 1NA3A 3CGHA 4LG6A 4LNGA 2WXKA 4AV7A 2F37A 3MZLB 1Z6TA 1Q2ZA 3V30A 3UKRG 3DPDA 3B7SA 5HI7A 4U96D 3EHMA 1DNPA 4GZ6A 1L5JA 3E32A 2L6JA 3Q78A 3AS8A 5C1DA 1H0AA 4BY6A 5BW8C 3PZDA 2H6HA 4KBQA 3FEXA 5EYPF 1N4SA 4N5CA 5AJDA 4KYOB 2I1JA 5FZRA 2ETBA 4WWNA 2FI7A 2XEHA 4DLQA 1K1AA 4HI9A 1UN9A 3MV2B 3Q75A 4IRUA 4B8AA 5M72A 4GPKA 3GZSA 3PZ3A 3UT7A 4I1MA 3AG3E 3CVPA 4WUYA 3S7BA 4CGVA 3DBSA 1JPLA 4ACLA 2EIKE 2DBAA 2Q7FA 1BI8B 3SI5A 1MX4A 4GMLA 2P9NG 3VTXA 3E30A 4DUIA 3TGOA 1E8ZA 2XPZA 3T9KA 3KAEA 1HFAA 3CQGB 3AG1E 2MHKA 2R17C 4G1TA 2YNQA 3NAWA 2PM7A 1KT0A 1HU3A 3KS2A 1TN6A 3Q47B 4L23A 3B7TA 3UM2A 3E34A 4GA1A 2V4HC 2KATA 4B93B 3EHNA 3MGBA 3TL5A 1SA5A 4GZ5A 4ANUA 3TG4A 1N54A 4GTRA 2HO1A 2QY7A 5CEDB 3SF4A 2A4ZA 1OWMA 2Y69E 3HXFA 1HG5A 3ABKE 5CRVA 3FH8A 2A5UA 2CFZA 3I4GA 3EIJA 3CHQA 3BU8A 3TWXA 1G3NB 3NOCD 4UWKA 4DX5D 1QBQA 4BFRA 1Z3XA 1RW2A 3CHRA 4CDMA 5IY5E 5T4YA 4MBGA 2H6IA 3QDNA 3UQ3A 2V0PA 3TWTA 2ETCA 4XKBA 5FTPA 4I1OB 4KVOA 4HOTA 3G2WA 4DX2A 4WNFA 4H7YA 4ABNA 3DWLG 4GCNA 4J8FA 1H2VC 1U3DA 2WM9A 2DWZA 5FJYA 3UT8A 4ILHB 2WXIA 4AJWA 1WDYA 4BX9A 1H2TC 3PVLA 2OV8A 3TJPA 4UUCA 4G11A 1HZ4A 4L1BA 3IEGA 5KNGA 2KM4A 4K03A 5BV0A 3ZIMA 4LERA 4MS6A 4NIKA 3V2XA 2QZAA 4A63B 4FADA 3OTNA 2WXOA 2BKGA 3ML9A 1K8KG 3E4BA 2PL2A 1JCQA 3OAWA 3QNKA 2ILRA 3S7DA 3S7JA 3QJZA 4XX5A 3QWVA 1H19A 4HLEA 4Y6WA 2ZXWE 2V8SE 1TYQG 3U9WA 4ANWA 2JABA 2GRLA 3QARA 2CHXA 5B1AE 1U2VG 3FUEA 3LJNA 4ME2A 5E76A 4GZ3A 2OVBA 1MQSA 4YDOA 3VLFA 3ZW3A 4Q69A 1FVHA 1OWNA 5HRYA 3UX4A 3ASHA 4JZYA 1N9AA 2JLBA 4YDWA 3TXMA 3D9OA 3CVUA 2WQHA 2YHCA 4HVBA 4UWFA 4AEZC 2IJGX 2I9CA 3CHSA 3HXEA 1O1TA 4YDYA 4GYWA 4OYSA 3EUVA 1FVFA 4A55A 4DK5A 2X3MA 2EIJE 5DIZA 1Z5SC 4R7LA 2CHZA 3HRAA 5AYWD 3P1UA 4N3BA 4UWLA 5FIOA 5T8IA 4EPZA 2WXJA 2L0IA 4U8YD 2Y4TA 1OWLA 4B8CB 3T8MA 3PE3A 1OCOE 1YYHA 4GPMA 1INZA 2EQXA 3LS8A 4RSYA 4EZLA 3L54A 4KMOA 1NFIE 3ASOE 4BSZB 4O60A 3C3RA 2VSXE 2VJ8A 3CV0A 4WAFA 1B89A 3NQPA 2J07A 3ZPJA 4U63A 3LEWA 4I43A 5FZSA 3SFYA 1XNFA 3GW4A 3NZUA 4AY6A 1RZ4A 2B6CA 4QFVA 3GZ1A 4BSXA 3ENEA 3JQ1A 4O1PA 3APFA 4LEUA 4MKTA 3L17A 2IF4A 2BUGA 3I4RB 5JJ6A 1E8XA 4ATGA 4GTSA 4WNEA 3E37A 4U0SA 2F0YA 5AQ9A 1E8WA 3PS6A 2X6FA 3RRNB 3G2TA 3CVVA 4CCAA 2NC9A 3J5PA 3KEZA 3MKRA 3ULEG 1OXJA 3I5PA 3ASNE 2FULA 1LD7A 3Q7FA 4AP2A 5CERB 1UJKA 1O1SA 3CLJA 4BTAA 2LNIA 3T5XA 3FTZA 1X5BA 3DEOA 2GGFA 3FH5A 3Q5MA 1LD8A 2DZNA 3PEUB 4IULA 3HIZA 3R9MA 4FJZA 4LCTA 1VDYA 1TNUA 2XENA 3QAQA 2XZDG 3HXBA 3FTWA 3FP3A 2ZIRA 5EX3A 2X6JA 4GMJA 3Q49B 2WXNA 3TWSA 2WXLA 3KSLA 4U8HA 3AU5A 3PUKA 2LSVA 5KJMA 4J8YA 1KLXA 3D9KA 2HYZA 1UJJA 4CT4A 1WM5A 2YQ8A 2YINA 3FU0A 4UI9J 5EIDA 2WMOA 4ILIA 3UT4A 4OAVB 4EBAG 3ESLA 1TR4A 1PAQA 4X8QA 2L9BA 1JCRA 3DSVA 3ONLA 4HBDA 2WB2A 3RO3A 3QWWA 3SO8A 3NB2A 3G2VA 3QK0A 4LRZA 1OT8A 4CRWA 3U64A 4UQXA 1HH8A 1V54E 5KJNA 3EHQA 2X38A 3DRAA 4WWPA 2ZU6B 3K9IA 4Q96A 4FP7A 4HOSA 4O1OA 3CKCA 3CSFA 3D9NA 2VGYA 2ZISA 5JJTA 3T5VA 3OXFA 1A5EA 4XIFA 3CK8A 3CHPA 3LXUX 4ANXA 3F6QA 1E7VA 2C2LA 2MRIA 3UXGA 4HI8A 3NZSA 4WWOA 3C72A 3CIAA 4MLPA 4EHMA 2CG3A 3DEPA 1ZB1A 1FPPA 3DSXA 4FJYA 1JWGA 4J6IA 1SZ9A 2VSYA 4LSZE 4U04A 3ULQA 3OXLA 1BU9A 4GYYA 3O48A 4ATZD 3SNXA 3AG2E 1MX6A 4FA6A 3FTVA 4GTQA 1BI7B 4JL0A 2UWJG 3AAAC 3D9MA 5HKPA 3ABLE 3GZ2A 2IO3C 3QOUA 1HF8A 2J09A 4NURA 3RAUA 3C3OA 3CVLA 4B94A 3BUAA 3V31A 1X81A 3SFZA 4J8SA 2V5FA 3L82A 4N2SA 5ENRD 3FY4A 4O6FA 3B7BA 4J8DA 3EIQC 4PS7A 4G26A 3Q9UC 3D3MA 3GYZA 1E7UA 3ASGA 4TXQA 4UWGA 1WY6A 1IHGA 1AWCB 2AXZA 2LXMA 3U3WA 2A5EA 1KZOA 3D9LA 3Q4AB 5T3RA 2XCBA 2CHWA 5CHEE 1ELKA 4C9BB 2XQ0A 3AS5A 4EBAA 1S63A 1WAO1 2AJAA 2Y0BG 4F1PA 2GRRB 3UIOC 2BKKB 2IOLA 2VSNA 5G55A 2GW1A 1IKND 3HVEB 1SW6A 4XEIG 5JJ7A 1IYGA 3ZN3A 2IONA 2QYJA 3L16A 5AQAA 3CEQA 4F53A 3D9HA 4F7AA 3DPYA 4I6JA 2LSUA 2VGEA 2GRNB 2IO2C 4GTPA 2JEKA 4DX6D 3AJIA 3IBEA 5C2YA 4U07A 1Y8MA 3BQOA 4C0MA 4DI3A 2DVWA 2J08A 3ML8A 1S0PA 3PZ1A 4KZ0A 5AQBA 1TJCA 3ZHEB 4I9CA 4I9EA 1S64A 2LUHA 5CCLA 3CK9A 2FEZA 2PM6A 2FBNA 1TN7A 4DX1A 3ASFA 1WG0A 3SZ7A 2KZTA 4Y6CA 4EQFA 4CDRA 1HS6A 3FEYA 3LY9A 4ZFHA 2DIWA 3ZUVB 3RKVA 3FTXA 1BD8A 1JCSA 4CGWA 4JEUA 3TXNA 5HQ8A 5CBOA 3NBNB 3V2OA 2WXRA 2MOWA 1K1BA 5KJLA 4OAUC 1LTXA 3PREA 3CR3A 3FTSA 4AVXA 1N4RA 3MV3B 2F8XK 4JW1A 3TG5A 3ULYA 2ZGGA 3ZEFA 1V55E 3JXIA 2OCCE 1ZBPA 5ENSD 5ITZF 4XI0A 4J7WA 1OUVA 3C5RA 3SBSA 4CYMD 3LJ3A 5BV1A 2KZTB 4L7TA 5EKQD 1HXIA 3LVQE 2KXPC 4ZHBA 2AWIA 4NRHB 3LVRE 1E96B 4N3AA 4HNAD 2IFUA 2WXMA 1Y6IA 4KVMA 5B1BE 3CVXA 3FUNA 4HRMB 5EILA 3D9PA 2EINE 3UM0A 1HO8A 3SFXA 4CZ2D 1Z3YA 1E90A 4GZCA 4AOFA 5CMWA 3J5QB 4B89A 1MHQA 3QC1A 3DSTA 4FC8A 3KEAA 3Q9NC 3FUFA 4HLLA 1TNOA 4YVQC 3FUKA 3RRMB 1FCHA 5LFAA 2KCKA 3FHEA 4LUNU 4Q94A 3HDXA 2HE0A 1OCZE 4I2ZA 2ETAA 3DXKG 3UM1A 4FLBA 1DCEA 3EJNA 5FQ8A 5AIJA 4I6GA 2IU1A 2WQ6A 2UY1A 2XRZA 1MJ0A 4AY5A 4BERA 4RLYA 1SVXA 2BEDA 3PNLB 4YVOA 4YDEA 2J8SD 4N2QA 4G8KA 5DBKA 1O1RA 3LY7A 3LDZA 4HRLA 3C3QA 1E8YA 1IHBA 5ANRA 2C0LA 3CVYA 3N71A 1QNFA 3ZYKA 4IN3B 4JHRA 4HFGA 5D0OD 4PS3A 4U95D 5FQ7A 5KNHD 2VQ2A 4JD2G 4GTMA 4M7CA 1P5QA 2R2LA 2X6KA 3X2QE 2UY1B 4C0EA 3ZXPA 4URKA 4BETA 2IQCA 3URZA 2WXHA 5FQ6A 3D9IA 5CBNA 5CRUA 4F1SA 2KC7A 2XEVA 3SBTB 1UW4B 5E75A 4I1AA 4U7EB 1FT1A 5B3SE 2XZTG 2Y4UA 3ASDA 1NZNA 4J0UA 2GRMA 2XGMA 5JHBA 3JXJA 4HQDA 2PZIA 5J08A 4J8EA 4HRNA 1XGWA 3ZKJA 3DSUA 4W9RA 4KT6B 4Z68A 3ZYQA 3FU3A 3CHMA 2Y3AA 3L08A 3Q73A 3VTYA 1SQMA 5A7DB 3LY8A 4TXRA 5ENOD 1D9SA 4FHKA 3R7RA 3MX3A 1K3ZD 1YA0A 3MYVA 3APCA 4I2WA 2NYJA 3SGHA 3LPZA 1LF8A 2XRYA 5ANLA 2DCPA 4U0ZA 2AW6A 4BTBA 4PS8A 3SY2A 4WNDA 3UTMA 1MX2A 5FZQA 1ZU2A 3FUHA 2X6IA 2R5SA 2I1KA 3Q7AA 4TXPA 3APDA 2H6FA 2B0OE 4HOQA 2PQNA 3ONKA 3U66A 2OEVA 4DRXE 4PUCA 3VLDA 3QKYA 2F8YA 3L6AA 3O4ZA 2XHEA 3MCXA 4EZJA 2RG8A 3B7RL 4KXKB 5FWQA 3EU5A 1OWOA 3FUIA 4A3VA 3JQ0A 4UI9K 2E2EA 5G2NA 1N0QA 2VTBA 4XZ4A 4K5BA 2LAHA 1A17A 2M63A 4IYPA 3FULA 4BWRA 2DYSE 3TWWA 2RKKA 4F3VA 5HS0A 3LYAA 2GRQB 4GAAA 4GZDA 3JYSA 2XGSA 4GA2A 5LOZA 3KSQA 4LNBA 3IKOB 4CT0A 4JA7A 1OCCE 1H6PA 3HYMB 3PEVB 2AXUA 1D8DA 2VGXA 5KWDA 3SD5A 1SA4A 3ZU7B 2KCLA 1TEZA 1PY1A 4GYOA 4I6EA 5CEAA 2VTBB 3RO2A 1ELWA 5CMYA 2WXQA 3G2UA 3AU4A 2XPIA 4APFA 1IQUA 2XS1A 2PNNA 3HVEA 4G23A 5FT9A 5AJLA 1EPUA 3MJWA 5G05J 3ZYMA 1UN8A 3RK6A 4D10C 1UOHA 3PZ2A 2MYOA 2ZGDA 3AS4A 4YNDA 4U8VD 4GA0A 5ENNA 5BXUA 1QZ2A 4N5QA 3CK7A 2VGXB 4EECA 4E6HA 4LNUD 3EDTB 3DXMG 3ZHEA 3ZNGA 3ZRHA 4WNGA 3RIBA 5BXOA 1N95A 3HHMA 5G05C 2LXLA 2FF4A 2QFCA 3EU9A 5EYLA 2CG2A 2NXPA 5BPPA 1HX8A 4JXTA 4GTVA 4JA9A 1GW6A 4L2LA 1TNZA 4QQIA 3FTUA 4M3OA 2P9LG 2OOEA 3NOGD 2BF0X 2J4DA 2WXFA 4ACKA 3FU6A 4ILGA 2L6BA 1SZAA 5ENQD 1O5MA 3FDHA 2I2OA 4G25A 4AM9A 1MYOA 2HR2A 4JHKA 2E0IA 4H7XA 1QYMA 4BT9A 3MEKA 1TN8A 5AN8A 3S7FA 2EIME 3L13A 3I3NA 4RQIA 3RU0A 2VYIA 3CHOA 2XCCA 3UKUG 3CVQA 2YHEA 3PRZA 1S70B 2XPYA 3W9FA 1W3BA 3TWUA 3JCKC 2P2CP 4KZCA 3PUJA 4XE0A 1AP7A 3B7UX 4UWHA 3ISMC 3PH0C 1N94A 2AVPA 3S2AA 2R05A 5EN5D 4GU5A 3PNTB 4CDNA 2GRPB 5ENTD 4JVSA 5KCMA 5EIBE 4L9PA 5EX0A 3FU5A 5CECB 4K0RA 3JUIA 5D2MC 4PDXA 1NP7A 3PDNA 3PZ4A 2J49A 2DYRE 1IXVA 3QB2A 3IXEA 2LAIA 3LCAA 4NACA 3FWVA 3LKUA 2QYUA 1ELRA 1YCSB 2R02A 4E85A 1IQRA 1MZCA 2EILE 5FINA 2P9SG 3TWRA 2C0MA 1HE8A 2AXVA 3RJVA 1QQEA 3WXXA 3HXDA 4HS2A 4FULA 2P9UG 3FUDA 2DZOA 2RFMA 4TUMA 4BX8A 3PE4A 5JHAA 3MKQA 2RD0A 5A23A 4RG6A 2VSOE 4AXHA 4DI4A 4JC8A 3FH7A 2R59A 4EZKA 2BTDA 4UQYA 4A1GA 2IEJA 3IHYA 1EDUA 5CCMA 1OY3D 3R9AB 3D9JA 3IHVA 1N4PA 4JHJA 3FUJA
chains in the Genus database with same CATH topology
3VTYA 1SQMA 5A7DB 2PQRA 3LY8A 3MA5A 3QDNA 1JWGA 4FHKA 4FJYA 4J6IA 2V0PA 3R7RA 3MX3A 3UQ3A 1SZ9A 1YA0A 3MYVA 3APCA 4XKBA 4I2WA 3ZFWA 5FTPA 4I1OB 3SGHA 3LPZA 2VSYA 4U04A 1LF8A 2XRYA 3ULQA 4MRUA 1JWFA 1UG3A 3OXLA 4I17A 4KVOA 4HOTA 5KJKA 3G2WA 4GYYA 3O48A 4WNFA 1DVPA 4H7YA 5ANLA 4ABNA 1EF1C 3SNXA 2DCPA 4GCNA 4J8FA 4JPSA 4U0ZA 1H2VC 2AW6A 4BTBA 3C98A 3FTVA 4FA6A 1U3DA 4JL0A 2UWJG 4PS8A 3D9MA 2WM9A 5FJYA 4ANVA 3UT8A 4WNDA 2WXGA 3GZ2A 3MKQB 4ILHB 2WXIA 3QOUA 1HF8A 2J09A 5FZQA 4NURA 4AJWA 4APOA 1ZU2A 4B94A 3CVLA 3FUHA 4BX9A 1H2TC 3PVLA 3SFZA 2X6IA 4CEMA 2OV8A 2R5SA 2I1KA 4J8SA 5J90A 3TJPA 2V5FA 3APDA 3L22A 4N2SA 4G11A 1HZ4A 4L1BA 5AENA 3IEGA 4HOQA 2PQNA 4TRQA 3ONKA 3FY4A 4O6FA 3U66A 2V4LA 4J8DA 2KM4A 3EIQC 4K03A 4PS7A 4A1SA 4G26A 5BV0A 3ZIMA 4LERA 4MS6A 3D3MA 3UPVA 3GYZA 4B0ZA 1E7UA 2I6HA 3ASGA 4PUCA 3VLDA 4UWGA 4FADA 3OTNA 1WY6A 2WXOA 1IHGA 3QKYA 3ML9A 4N3CA 4DJAA 1N52A 3NF1A 2AXZA 3L6AA 3O4ZA 2XHEA 3E4BA 3CVWA 3U3WA 3MCXA 4JEHA 3Q4AB 3D9LA 5T3RA 4AIFA 2PL2A 4EZJA 2XCBA 2RG8A 3B7RL 2CHWA 3OAWA 3QNKA 4KXKB 5CHEE 2ILRA 1ELKA 2IOSA 2WMNA 4FLHA 5FWQA 4C9BB 2XQ0A 3AS5A 3S7DA 1OWOA 4EBAA 3Q15A 1WAO1 3FUIA 4A3VA 3JQ0A 3S7JA 3QJZA 4UI9K 4XX5A 3QWVA 3G2SA 1H19A 4HOUA 2E2EA 4HLEA 4TUUA 2IOLA 2VSNA 4Y6WA 5G55A 4DPRA 5G2NA 2V8SE 2VTBA 2GW1A 3R7QA 3HVEB 3U9WA 4XZ4A 4ANWA 2LAHA 5JJ7A 1IYGA 1A17A 2GRLA 3ZN3A 2M63A 2IONA 4IYPA 3FULA 4A3TA 3QARA 2CHXA 4N39A 3FUEA 2P58C 4ME2A 3L16A 4DLOA 5LCWJ 4P29A 4GZ3A 2OVBA 5E76A 4BWRA 1KT1A 2L0TB 1MQSA 1EYHA 3VLFA 3ZW3A 4Q69A 1HG2A 3CEQA 4F53A 5FQ4A 1FVHA 1OWNA 4F3VA 3UX4A 4F7AA 1U3CA 3LYAA 4GAAA 4I6JA 3ASHA 4GZDA 4JZYA 3TXMA 2JLBA 2LSUA 3U4TA 3D9OA 3CVUA 2WQHA 2YHCA 4HVBA 4UWFA 3JYSA 2XGSA 4GA2A 3RRUA 4AEZC 2JEKA 3BG0B 2IJGX 4RG9A 3IBEA 3CSTA 4OVUA 5D0QD 5C2YA 4U07A 1Y8MA 3ZXSA 2I9CA 3QWPA 4RVBA 3CHSA 5LOZA 4C0MA 4DI3A 4UQZA 2J08A 4BT8A 3ML8A 3IKOB 5BUZA 3UUXA 4CT0A 2CFUA 1JUQA 2NSZA 4JA7A 4GYWA 1S0PA 4OYSA 4FHJA 4KZ0A 1FVFA 4GCOA 4A55A 3TAXA 4DK5A 2X3MA 3ZGQA 1TJCA 3HYMB 3PEVB 2AXUA 2VGXA 5DIZA 3ZYLA 3CQCB 3ZHEB 4I9CA 4I9EA 5BNWA 3SD5A 4R7LA 2CHZA 2KCLA 5AYWD 3P1UA 4N3BA 1PY1A 4UWLA 5CCLA 1TEZA 4GYOA 5T8IA 4EPZA 3CK9A 4I6EA 4L2YA 2FEZA 5LCWC 2PM6A 2WXJA 2VTBB 2FBNA 2L0IA 3RO2A 1ELWA 5CMYA 2WXQA 1OWLA 2Y4TA 3G2UA 3BEEA 4B8CB 3ASFA 3AU4A 3CKBA 3T8MA 2XPIA 4APFA 1IQUA 3PE3A 2ONDA 4HXIA 3SZ7A 3HVEA 3UMVA 3CVNA 2X6HA 2HM8A 2KZTA 4Y6CA 3SHFA 4G23A 4EQFA 1INZA 1PC2A 2EQXA 3P2BA 5FT9A 2XGOA 3LS8A 4RSYA 5AJLA 5ARFA 1EPUA 3L54A 1HS6A 3FEYA 3MJWA 4CDRA 4EZLA 1BPOA 4KMOA 5G05J 3ZYMA 3LY9A 1UN8A 3RK6A 4D10C 2DIWA 3RKVA 3FTXA 4GB9A 2VSXE 2VJ8A 4FU3A 3CV0A 4WAFA 1B89A 4CGWA 3BG1B 5ARGA 4JEUA 3TXNA 5HQ8A 3NQPA 2J07A 3AS4A 3ZPJA 4YNDA 5A6CA 2KCVA 2WXRA 4V3IA 2WQ7A 4U63A 4GA0A 3LEWA 2MOWA 5ENNA 4I43A 2WVIA 4TV3A 5FZSA 5KJLA 1XNFA 1QZ2A 5LP0A 3GW4A 2WXPA 3NZUA 3PREA 3CK7A 4AY6A 2OVFA 5BT1A 2VGXB 3B13A 3CR3A 3FTSA 4AVXA 5LX8A 3MV3B 4QFVA 3VLEA 4EECA 3GZ1A 4JW1A 4BSXA 3TG5A 4E6HA 3ENEA 3JQ1A 2WPVA 3EDTB 3ZEFA 5G04J 2LO6A 3APFA 4LEUA 3ZHEA 2FO7A 4MKTA 1ZBPA 3L17A 4HORA 4XI0A 4G2VA 3ZRHA 4WNGA 3RIBA 2IF4A 1OUVA 2BUGA 3I4RB 3HHMA 5G05C 5JJ6A 3SBSA 3FFLA 3LJ3A 2FF4A 2QFCA 5BV1A 2KZTB 3ESKA 4L7TA 1E8XA 1OWPA 5EKQD 3KD7A 4ATGA 2CG2A 2NXPA 1HXIA 3LVQE 4WNEA 2AWIA 5BPPA 1HX8A 4JXTA 4NRHB 3OXGA 3LVRE 1E96B 4N3AA 4U0SA 4U0UA 1E8WA 3PS6A 2IFUA 2X6FA 4JA9A 1GW6A 1H2UA 3RRNB 2WXMA 4L2LA 3FTUA 1Y6IA 3IV0A 4KVMA 4UI9C 3CVXA 4M3OA 3FUNA 3G2TA 2OOEA 3CVVA 3FTYA 4CCAA 2NC9A 1TJFA 2BF0X 3KEZA 2J9QA 3MKRA 4G24A 2J4DA 2WXFA 3I5PA 4XI9A 3ZVVA 2J4BA 3D9PA 1HO8A 1H6KA 2FULA 4ACKA 1Z3YA 1E90A 3FU6A 4GZCA 4AOFA 4ILGA 4PH4B 1SZAA 5G04C 5CMWA 4XKCA 4AP2A 3FDHA 2I2OA 4G25A 4B89A 1MHQA 1UJKA 3QC1A 4NQ0A 4FC8A 2HR2A 4AM9A 4JHKA 3CLJA 4BTAA 2LNIA 3T5XA 3FTZA 1NA0A 2E0IA 1X5BA 3FUMA 2GGFA 3FH5A 4H7XA 4BT9A 3FUFA 3MEKA 3Q5MA 5EDSA 3CGHA 4OVVA 1NA3A 4YVQC 3FUKA 3PEUB 3RRMB 1FCHA 2WXKA 2KCKA 3FHEA 4IULA 3S7FA 4LUNU 5LFAA 3HIZA 4Q94A 3HDXA 4AV7A 4FJZA 3L13A 3I3NA 4LCTA 1VDYA 4I2ZA 3QAQA 3MZLB 3RU0A 1Z6TA 2VYIA 3FTWA 3FP3A 3CHOA 2XCCA 5EX3A 2X6JA 4GMJA 4FLBA 3EJNA 3Q49B 5FQ8A 3DPDA 5AIJA 3B7SA 3CVQA 4I6GA 5HI7A 2YHEA 2WXNA 3PRZA 3EHMA 1DNPA 2IU1A 4GZ6A 2WQ6A 2UY1A 1L5JA 2XRZA 2L6JA 4AY5A 2WXLA 2XPYA 4U8HA 1W3BA 3JCKC 3AS8A 5C1DA 3AU5A 4KZCA 3PUKA 3PUJA 1H0AA 4XE0A 2LSVA 4BY6A 5BW8C 3PZDA 4KBQA 3FEXA 3PNLB 4YVOA 5KJMA 1KLXA 3D9KA 2HYZA 4N5CA 5AJDA 4N2QA 1UJJA 3B7UX 4CT4A 4UWHA 1WM5A 4KYOB 2I1JA 3PH0C 5FZRA 2AVPA 3S2AA 2YQ8A 5DBKA 4GU5A 4WWNA 2FI7A 3LY7A 4DLQA 2YINA 3PNTB 1UN9A 3MV2B 3LDZA 3FU0A 4UI9J 4CDNA 2WMOA 4IRUA 4ILIA 1E8YA 4B8AA 3UT4A 4JVSA 5ANRA 5M72A 4GPKA 3GZSA 5KCMA 2C0LA 3CVYA 5EX0A 3N71A 4EBAG 3ESLA 4I1MA 3FU5A 3UT7A 1QNFA 3ZYKA 4IN3B 1PAQA 3CVPA 4JHRA 4K0RA 4HFGA 5D0OD 3JUIA 4WUYA 4PS3A 3S7BA 2L9BA 4CGVA 3DBSA 5FQ7A 1JPLA 4PDXA 4ACLA 3ONLA 1NP7A 2DBAA 2WB2A 3PDNA 2Q7FA 3SI5A 2VQ2A 4GMLA 3RO3A 2J49A 3QWWA 3VTXA 1P5QA 2X6KA 3QB2A 3TGOA 2UY1B 4C0EA 3G2VA 3QK0A 1E8ZA 2LAIA 2XPZA 4LRZA 3KAEA 1HFAA 3LCAA 4NACA 4URKA 3FWVA 3LKUA 3CQGB 4CRWA 2MHKA 2IQCA 3U64A 2R17C 4UQXA 3URZA 4G1TA 1ELRA 2WXHA 5FQ6A 3D9IA 2YNQA 4E85A 1IQRA 2PM7A 1KT0A 1HU3A 4F1SA 2KC7A 1HH8A 3KS2A 2XEVA 3Q47B 5KJNA 3SBTB 4L23A 3B7TA 2C0MA 1HE8A 2AXVA 3RJVA 1QQEA 2X38A 1UW4B 4GA1A 3WXXA 2KATA 4HS2A 4FULA 5E75A 4WWPA 3EHNA 4I1AA 2ZU6B 3K9IA 3MGBA 3FUDA 3TL5A 4GZ5A 4ANUA 4Q96A 4FP7A 4BX8A 4HOSA 2Y4UA 3CKCA 3ASDA 1NZNA 3CSFA 4J0UA 2GRMA 1N54A 3D9NA 3PE4A 3TG4A 2XGMA 5JHBA 2VGYA 3MKQA 5JJTA 5JHAA 2HO1A 2QY7A 3T5VA 3OXFA 2PZIA 2RD0A 5A23A 4RG6A 4XIFA 3CK8A 3SF4A 2VSOE 5J08A 2A4ZA 1OWMA 4J8EA 3CHPA 1XGWA 3LXUX 4ANXA 1HG5A 4AXHA 4DI4A 3FH8A 1E7VA 2A5UA 2CFZA 2C2LA 3I4GA 3EIJA 3CHQA 3FH7A 4JC8A 4W9RA 2MRIA 4KT6B 2R59A 4EZKA 2BTDA 4UQYA 4UWKA 4A1GA 3ZYQA 3NZSA 4BFRA 3FU3A 4WWOA 3IHYA 1EDUA 1Z3XA 3CHMA 3CIAA 5CCMA 3CHRA 4MLPA 2CG3A 4CDMA 3R9AB 5T4YA 3D9JA 2Y3AA 3IHVA 3L08A 4JHJA 3FUJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTY A;  5A7D B;  2PQR A;  3LY8 A;  3MA5 A;  3QDN A;  3UQ3 A;  1YA0 A;  4I2W A;  3ZFW A;  5FTP A;  3LPZ A;  2VSY A;  4U04 A;  3ULQ A;  3OXL A;  4I17 A;  4HOT A;  5KJK A;  4GYY A;  3O48 A;  4WNF A;  4H7Y A;  4ABN A;  4GCN A;  4J8F A;  4U0Z A;  4BTB A;  4JL0 A;  2UWJ G;  5FJY A;  4WND A;  3GZ2 A;  3QOU A;  5FZQ A;  4APO A;  1ZU2 A;  4B94 A;  3CVL A;  2R5S A;  2V5F A;  4N2S A;  1HZ4 A;  3IEG A;  4HOQ A;  2PQN A;  4O6F A;  4J8D A;  4A1S A;  4G26 A;  3UPV A;  3GYZ A;  2I6H A;  3ASG A;  1IHG A;  3QKY A;  4N3C A;  3NF1 A;  3E4B A;  3U3W A;  3Q4A B;  4AIF A;  2PL2 A;  2XCB A;  4KXK B;  5CHE E;  3AS5 A;  3S7D A;  3Q15 A;  1WAO 1;  3S7J A;  4UI9 K;  3QWV A;  4HOU A;  2E2E A;  2VSN A;  4Y6W A;  2GW1 A;  5JJ7 A;  1IYG A;  1A17 A;  3ZN3 A;  4N39 A;  2P58 C;  4ME2 A;  5LCW J;  4GZ3 A;  4BWR A;  1KT1 A;  3CEQ A;  4F3V A;  3LYA A;  3ASH A;  2JLB A;  2LSU A;  3U4T A;  2WQH A;  2YHC A;  3JYS A;  2XGS A;  4GA2 A;  4RG9 A;  5D0Q D;  4U07 A;  1Y8M A;  3QWP A;  4UQZ A;  4BT8 A;  3UUX A;  4JA7 A;  4GYW A;  4GCO A;  3TAX A;  3ZGQ A;  1TJC A;  3HYM B;  5DIZ A;  2VGX A;  3ZHE B;  4I9C A;  4I9E A;  5BNW A;  2KCL A;  5AYW D;  4N3B A;  5CCL A;  4GYO A;  3CK9 A;  2FEZ A;  5LCW C;  2FBN A;  3RO2 A;  1ELW A;  2Y4T A;  3BEE A;  3ASF A;  3CKB A;  2XPI A;  3PE3 A;  2OND A;  3SZ7 A;  3CVN A;  4Y6C A;  4G23 A;  4EQF A;  1PC2 A;  5FT9 A;  2XGO A;  5ARF A;  4CDR A;  5G05 J;  3LY9 A;  3RKV A;  3CV0 A;  1B89 A;  4CGW A;  5ARG A;  5HQ8 A;  3AS4 A;  3ZPJ A;  4YND A;  5A6C A;  2KCV A;  4GA0 A;  5FZS A;  5KJL A;  1XNF A;  1QZ2 A;  3GW4 A;  3CK7 A;  4AY6 A;  5BT1 A;  2VGX B;  3MV3 B;  3GZ1 A;  3TG5 A;  2WPV A;  3EDT B;  5G04 J;  4LEU A;  3ZHE A;  2FO7 A;  1ZBP A;  4HOR A;  4XI0 A;  4G2V A;  4WNG A;  3RIB A;  2IF4 A;  1OUV A;  2BUG A;  5G05 C;  5JJ6 A;  3FFL A;  2FF4 A;  2QFC A;  5EKQ D;  3ESK A;  3KD7 A;  1HXI A;  4WNE A;  4NRH B;  3OXG A;  1E96 B;  4N3A A;  4U0S A;  4U0U A;  2IFU A;  4JA9 A;  4UI9 C;  2OOE A;  2NC9 A;  2J9Q A;  3MKR A;  4G24 A;  4XI9 A;  5G04 C;  4G25 A;  4NQ0 A;  4AM9 A;  2HR2 A;  4BTA A;  2LNI A;  1NA0 A;  4H7X A;  4BT9 A;  3MEK A;  3Q5M A;  1NA3 A;  4YVQ C;  1FCH A;  3S7F A;  2KCK A;  4I2Z A;  3RU0 A;  2VYI A;  3FP3 A;  2XCC A;  5EX3 A;  3Q49 B;  3CVQ A;  5HI7 A;  4GZ6 A;  2UY1 A;  2L6J A;  4AY5 A;  1W3B A;  5C1D A;  3AS8 A;  2LSV A;  5BW8 C;  4KBQ A;  4YVO A;  5KJM A;  1KLX A;  2HYZ A;  4N5C A;  4N2Q A;  1WM5 A;  4KYO B;  5FZR A;  2AVP A;  2YQ8 A;  5DBK A;  2FI7 A;  3LY7 A;  3MV2 B;  4UI9 J;  5M72 A;  4GPK A;  2C0L A;  5EX0 A;  3N71 A;  4IN3 B;  3CVP A;  4JHR A;  5D0O D;  4WUY A;  3S7B A;  4CGV A;  2DBA A;  3PDN A;  2Q7F A;  2VQ2 A;  3RO3 A;  3QWW A;  3VTX A;  1P5Q A;  3TGO A;  2UY1 B;  3KAE A;  3LCA A;  3FWV A;  3LKU A;  2MHK A;  4UQX A;  3URZ A;  4G1T A;  1ELR A;  1KT0 A;  2KC7 A;  1HH8 A;  3KS2 A;  2XEV A;  3Q47 B;  5KJN A;  2C0M A;  3RJV A;  1QQE A;  4GA1 A;  3WXX A;  2KAT A;  4I1A A;  3K9I A;  4GZ5 A;  4HOS A;  2Y4U A;  3CKC A;  3TG4 A;  3ASD A;  1NZN A;  4J0U A;  3PE4 A;  2XGM A;  2VGY A;  5JJT A;  2HO1 A;  3OXF A;  2PZI A;  4RG6 A;  4XIF A;  3CK8 A;  3SF4 A;  4J8E A;  2C2L A;  4W9R A;  4UQY A;  5CCM A;  3R9A B; 
#chains in the Genus database with same CATH topology
 2PQR A;  3MA5 A;  3ZFW A;  2RFA A;  1N0R A;  2XS8 A;  4MRU A;  1JWF A;  1UG3 A;  4I17 A;  4K5A B;  5KJK A;  3E33 A;  1DVP A;  1EF1 C;  4BES A;  4JPS A;  2GRO B;  3C98 A;  4ANV A;  4K5C A;  2WXG A;  3MKQ B;  3Q79 A;  4APO A;  5AAO A;  2Y1L E;  4CEM A;  5J90 A;  3L22 A;  5AAR A;  5AEN A;  1DCQ A;  3UIP C;  4TRQ A;  2V4L A;  4A1S A;  2P9P G;  2P9I G;  3UPV A;  3DSS A;  4B0Z A;  2I6H A;  4N3C A;  4DJA A;  1N52 A;  3NF1 A;  3CVW A;  1FT2 A;  4JEH A;  1H6O A;  4AIF A;  3W9G A;  5JMN D;  4C48 B;  2IOS A;  2WMN A;  4FLH A;  3Q15 A;  3UM3 A;  3G2S A;  4HB5 A;  1TNY A;  4HOU A;  4GTO A;  4TUU A;  2OEW A;  1DC2 A;  4DPR A;  3R7Q A;  3JUE A;  4A3T A;  4N39 A;  1N4Q A;  3T8K A;  3SQV A;  2P58 C;  5LCW J;  4DLO A;  4P29 A;  1D8E A;  1N11 A;  1KT1 A;  2L0T B;  1EYH A;  1HG2 A;  3TWQ A;  4BEP A;  5FQ4 A;  1U3C A;  3U4T A;  3RRU A;  2IY0 C;  3BG0 B;  4RG9 A;  3CST A;  4OVU A;  5D0Q D;  3ZXS A;  2QC9 A;  3QWP A;  4RVB A;  3HG0 D;  4UQZ A;  5BUZ A;  4BT8 A;  3UUX A;  2CFU A;  1JUQ A;  2NSZ A;  1YMP A;  4FHJ A;  4GCO A;  3TAX A;  2R03 A;  3ZGQ A;  3ZYL A;  3CQC B;  3AG4 E;  5BNW A;  3DSW A;  4JB8 P;  3UI2 A;  4F6R D;  4L2Y A;  1NI1 A;  5LCW C;  5JA4 D;  3BEE A;  3CKB A;  5KBA A;  2OND A;  4HXI A;  3UMV A;  3CVN A;  2X6H A;  2HM8 A;  3SHF A;  3HXC A;  1PC2 A;  1TNB A;  3P2B A;  2XGO A;  5ARF A;  3B95 A;  1BPO A;  2FO1 E;  5D66 A;  4GB9 A;  4GMR A;  4FU3 A;  1OCR E;  3BG1 B;  5ARG A;  5A6C A;  2KCV A;  4GTT A;  4V3I A;  1BLX B;  2WQ7 A;  2WVI A;  4TV3 A;  5LP0 A;  2WXP A;  2OVF A;  4G8L A;  5BT1 A;  3V79 K;  3RSE G;  3B13 A;  5LX8 A;  3VLE A;  3UIN C;  2H6G A;  2WPV A;  5AQ7 A;  5G04 J;  2LO6 A;  2FO7 A;  4HOR A;  4G2V A;  3FFL A;  3ABM E;  3ESK A;  1OWP A;  3KD7 A;  5H7P A;  3OXG A;  5ENP D;  4U0U A;  1H2U A;  2XEE A;  4DX7 D;  3IV0 A;  4UI9 C;  3L9T A;  3WG7 E;  3FTY A;  1TJF A;  2J9Q A;  4G24 A;  3EHR A;  3ZVV A;  4XI9 A;  3TWV A;  2J4B A;  1H6K A;  2P9K G;  1NL4 A;  2V5Q C;  4PH4 B;  2KBX A;  5G04 C;  4XKC A;  4NQ0 A;  1NA0 A;  3FUM A;  5EDS A;  1KPS B;  4OVV A;  1KZP A;  1NA3 A;  3CGH A;  4LG6 A;  4LNG A;  2WXK A;  4AV7 A;  2F37 A;  3MZL B;  1Z6T A;  1Q2Z A;  3V30 A;  3UKR G;  3DPD A;  3B7S A;  5HI7 A;  4U96 D;  3EHM A;  1DNP A;  4GZ6 A;  1L5J A;  3E32 A;  2L6J A;  3Q78 A;  3AS8 A;  5C1D A;  1H0A A;  4BY6 A;  5BW8 C;  3PZD A;  2H6H A;  4KBQ A;  3FEX A;  5EYP F;  1N4S A;  4N5C A;  5AJD A;  4KYO B;  2I1J A;  5FZR A;  2ETB A;  4WWN A;  2FI7 A;  2XEH A;  4DLQ A;  1K1A A;  4HI9 A;  1UN9 A;  3MV2 B;  3Q75 A;  4IRU A;  4B8A A;  5M72 A;  4GPK A;  3GZS A;  3PZ3 A;  3UT7 A;  4I1M A;  3AG3 E;  3CVP A;  4WUY A;  3S7B A;  4CGV A;  3DBS A;  1JPL A;  4ACL A;  2EIK E;  2DBA A;  2Q7F A;  1BI8 B;  3SI5 A;  1MX4 A;  4GML A;  2P9N G;  3VTX A;  3E30 A;  4DUI A;  3TGO A;  1E8Z A;  2XPZ A;  3T9K A;  3KAE A;  1HFA A;  3CQG B;  3AG1 E;  2MHK A;  2R17 C;  4G1T A;  2YNQ A;  3NAW A;  2PM7 A;  1KT0 A;  1HU3 A;  3KS2 A;  1TN6 A;  3Q47 B;  4L23 A;  3B7T A;  3UM2 A;  3E34 A;  4GA1 A;  2V4H C;  2KAT A;  4B93 B;  3EHN A;  3MGB A;  3TL5 A;  1SA5 A;  4GZ5 A;  4ANU A;  3TG4 A;  1N54 A;  4GTR A;  2HO1 A;  2QY7 A;  5CED B;  3SF4 A;  2A4Z A;  1OWM A;  2Y69 E;  3HXF A;  1HG5 A;  3ABK E;  5CRV A;  3FH8 A;  2A5U A;  2CFZ A;  3I4G A;  3EIJ A;  3CHQ A;  3BU8 A;  3TWX A;  1G3N B;  3NOC D;  4UWK A;  4DX5 D;  1QBQ A;  4BFR A;  1Z3X A;  1RW2 A;  3CHR A;  4CDM A;  5IY5 E;  5T4Y A;  4MBG A;  2H6I A;  3QDN A;  3UQ3 A;  2V0P A;  3TWT A;  2ETC A;  4XKB A;  5FTP A;  4I1O B;  4KVO A;  4HOT A;  3G2W A;  4DX2 A;  4WNF A;  4H7Y A;  4ABN A;  3DWL G;  4GCN A;  4J8F A;  1H2V C;  1U3D A;  2WM9 A;  2DWZ A;  5FJY A;  3UT8 A;  4ILH B;  2WXI A;  4AJW A;  1WDY A;  4BX9 A;  1H2T C;  3PVL A;  2OV8 A;  3TJP A;  4UUC A;  4G11 A;  1HZ4 A;  4L1B A;  3IEG A;  5KNG A;  2KM4 A;  4K03 A;  5BV0 A;  3ZIM A;  4LER A;  4MS6 A;  4NIK A;  3V2X A;  2QZA A;  4A63 B;  4FAD A;  3OTN A;  2WXO A;  2BKG A;  3ML9 A;  1K8K G;  3E4B A;  2PL2 A;  1JCQ A;  3OAW A;  3QNK A;  2ILR A;  3S7D A;  3S7J A;  3QJZ A;  4XX5 A;  3QWV A;  1H19 A;  4HLE A;  4Y6W A;  2ZXW E;  2V8S E;  1TYQ G;  3U9W A;  4ANW A;  2JAB A;  2GRL A;  3QAR A;  2CHX A;  5B1A E;  1U2V G;  3FUE A;  3LJN A;  4ME2 A;  5E76 A;  4GZ3 A;  2OVB A;  1MQS A;  4YDO A;  3VLF A;  3ZW3 A;  4Q69 A;  1FVH A;  1OWN A;  5HRY A;  3UX4 A;  3ASH A;  4JZY A;  1N9A A;  2JLB A;  4YDW A;  3TXM A;  3D9O A;  3CVU A;  2WQH A;  2YHC A;  4HVB A;  4UWF A;  4AEZ C;  2IJG X;  2I9C A;  3CHS A;  3HXE A;  1O1T A;  4YDY A;  4GYW A;  4OYS A;  3EUV A;  1FVF A;  4A55 A;  4DK5 A;  2X3M A;  2EIJ E;  5DIZ A;  1Z5S C;  4R7L A;  2CHZ A;  3HRA A;  5AYW D;  3P1U A;  4N3B A;  4UWL A;  5FIO A;  5T8I A;  4EPZ A;  2WXJ A;  2L0I A;  4U8Y D;  2Y4T A;  1OWL A;  4B8C B;  3T8M A;  3PE3 A;  1OCO E;  1YYH A;  4GPM A;  1INZ A;  2EQX A;  3LS8 A;  4RSY A;  4EZL A;  3L54 A;  4KMO A;  1NFI E;  3ASO E;  4BSZ B;  4O60 A;  3C3R A;  2VSX E;  2VJ8 A;  3CV0 A;  4WAF A;  1B89 A;  3NQP A;  2J07 A;  3ZPJ A;  4U63 A;  3LEW A;  4I43 A;  5FZS A;  3SFY A;  1XNF A;  3GW4 A;  3NZU A;  4AY6 A;  1RZ4 A;  2B6C A;  4QFV A;  3GZ1 A;  4BSX A;  3ENE A;  3JQ1 A;  4O1P A;  3APF A;  4LEU A;  4MKT A;  3L17 A;  2IF4 A;  2BUG A;  3I4R B;  5JJ6 A;  1E8X A;  4ATG A;  4GTS A;  4WNE A;  3E37 A;  4U0S A;  2F0Y A;  5AQ9 A;  1E8W A;  3PS6 A;  2X6F A;  3RRN B;  3G2T A;  3CVV A;  4CCA A;  2NC9 A;  3J5P A;  3KEZ A;  3MKR A;  3ULE G;  1OXJ A;  3I5P A;  3ASN E;  2FUL A;  1LD7 A;  3Q7F A;  4AP2 A;  5CER B;  1UJK A;  1O1S A;  3CLJ A;  4BTA A;  2LNI A;  3T5X A;  3FTZ A;  1X5B A;  3DEO A;  2GGF A;  3FH5 A;  3Q5M A;  1LD8 A;  2DZN A;  3PEU B;  4IUL A;  3HIZ A;  3R9M A;  4FJZ A;  4LCT A;  1VDY A;  1TNU A;  2XEN A;  3QAQ A;  2XZD G;  3HXB A;  3FTW A;  3FP3 A;  2ZIR A;  5EX3 A;  2X6J A;  4GMJ A;  3Q49 B;  2WXN A;  3TWS A;  2WXL A;  3KSL A;  4U8H A;  3AU5 A;  3PUK A;  2LSV A;  5KJM A;  4J8Y A;  1KLX A;  3D9K A;  2HYZ A;  1UJJ A;  4CT4 A;  1WM5 A;  2YQ8 A;  2YIN A;  3FU0 A;  4UI9 J;  5EID A;  2WMO A;  4ILI A;  3UT4 A;  4OAV B;  4EBA G;  3ESL A;  1TR4 A;  1PAQ A;  4X8Q A;  2L9B A;  1JCR A;  3DSV A;  3ONL A;  4HBD A;  2WB2 A;  3RO3 A;  3QWW A;  3SO8 A;  3NB2 A;  3G2V A;  3QK0 A;  4LRZ A;  1OT8 A;  4CRW A;  3U64 A;  4UQX A;  1HH8 A;  1V54 E;  5KJN A;  3EHQ A;  2X38 A;  3DRA A;  4WWP A;  2ZU6 B;  3K9I A;  4Q96 A;  4FP7 A;  4HOS A;  4O1O A;  3CKC A;  3CSF A;  3D9N A;  2VGY A;  2ZIS A;  5JJT A;  3T5V A;  3OXF A;  1A5E A;  4XIF A;  3CK8 A;  3CHP A;  3LXU X;  4ANX A;  3F6Q A;  1E7V A;  2C2L A;  2MRI A;  3UXG A;  4HI8 A;  3NZS A;  4WWO A;  3C72 A;  3CIA A;  4MLP A;  4EHM A;  2CG3 A;  3DEP A;  1ZB1 A;  1FPP A;  3DSX A;  4FJY A;  1JWG A;  4J6I A;  1SZ9 A;  2VSY A;  4LSZ E;  4U04 A;  3ULQ A;  3OXL A;  1BU9 A;  4GYY A;  3O48 A;  4ATZ D;  3SNX A;  3AG2 E;  1MX6 A;  4FA6 A;  3FTV A;  4GTQ A;  1BI7 B;  4JL0 A;  2UWJ G;  3AAA C;  3D9M A;  5HKP A;  3ABL E;  3GZ2 A;  2IO3 C;  3QOU A;  1HF8 A;  2J09 A;  4NUR A;  3RAU A;  3C3O A;  3CVL A;  4B94 A;  3BUA A;  3V31 A;  1X81 A;  3SFZ A;  4J8S A;  2V5F A;  3L82 A;  4N2S A;  5ENR D;  3FY4 A;  4O6F A;  3B7B A;  4J8D A;  3EIQ C;  4PS7 A;  4G26 A;  3Q9U C;  3D3M A;  3GYZ A;  1E7U A;  3ASG A;  4TXQ A;  4UWG A;  1WY6 A;  1IHG A;  1AWC B;  2AXZ A;  2LXM A;  3U3W A;  2A5E A;  1KZO A;  3D9L A;  3Q4A B;  5T3R A;  2XCB A;  2CHW A;  5CHE E;  1ELK A;  4C9B B;  2XQ0 A;  3AS5 A;  4EBA A;  1S63 A;  1WAO 1;  2AJA A;  2Y0B G;  4F1P A;  2GRR B;  3UIO C;  2BKK B;  2IOL A;  2VSN A;  5G55 A;  2GW1 A;  1IKN D;  3HVE B;  1SW6 A;  4XEI G;  5JJ7 A;  1IYG A;  3ZN3 A;  2ION A;  2QYJ A;  3L16 A;  5AQA A;  3CEQ A;  4F53 A;  3D9H A;  4F7A A;  3DPY A;  4I6J A;  2LSU A;  2VGE A;  2GRN B;  2IO2 C;  4GTP A;  2JEK A;  4DX6 D;  3AJI A;  3IBE A;  5C2Y A;  4U07 A;  1Y8M A;  3BQO A;  4C0M A;  4DI3 A;  2DVW A;  2J08 A;  3ML8 A;  1S0P A;  3PZ1 A;  4KZ0 A;  5AQB A;  1TJC A;  3ZHE B;  4I9C A;  4I9E A;  1S64 A;  2LUH A;  5CCL A;  3CK9 A;  2FEZ A;  2PM6 A;  2FBN A;  1TN7 A;  4DX1 A;  3ASF A;  1WG0 A;  3SZ7 A;  2KZT A;  4Y6C A;  4EQF A;  4CDR A;  1HS6 A;  3FEY A;  3LY9 A;  4ZFH A;  2DIW A;  3ZUV B;  3RKV A;  3FTX A;  1BD8 A;  1JCS A;  4CGW A;  4JEU A;  3TXN A;  5HQ8 A;  5CBO A;  3NBN B;  3V2O A;  2WXR A;  2MOW A;  1K1B A;  5KJL A;  4OAU C;  1LTX A;  3PRE A;  3CR3 A;  3FTS A;  4AVX A;  1N4R A;  3MV3 B;  2F8X K;  4JW1 A;  3TG5 A;  3ULY A;  2ZGG A;  3ZEF A;  1V55 E;  3JXI A;  2OCC E;  1ZBP A;  5ENS D;  5ITZ F;  4XI0 A;  4J7W A;  1OUV A;  3C5R A;  3SBS A;  4CYM D;  3LJ3 A;  5BV1 A;  2KZT B;  4L7T A;  5EKQ D;  1HXI A;  3LVQ E;  2KXP C;  4ZHB A;  2AWI A;  4NRH B;  3LVR E;  1E96 B;  4N3A A;  4HNA D;  2IFU A;  2WXM A;  1Y6I A;  4KVM A;  5B1B E;  3CVX A;  3FUN A;  4HRM B;  5EIL A;  3D9P A;  2EIN E;  3UM0 A;  1HO8 A;  3SFX A;  4CZ2 D;  1Z3Y A;  1E90 A;  4GZC A;  4AOF A;  5CMW A;  3J5Q B;  4B89 A;  1MHQ A;  3QC1 A;  3DST A;  4FC8 A;  3KEA A;  3Q9N C;  3FUF A;  4HLL A;  1TNO A;  4YVQ C;  3FUK A;  3RRM B;  1FCH A;  5LFA A;  2KCK A;  3FHE A;  4LUN U;  4Q94 A;  3HDX A;  2HE0 A;  1OCZ E;  4I2Z A;  2ETA A;  3DXK G;  3UM1 A;  4FLB A;  1DCE A;  3EJN A;  5FQ8 A;  5AIJ A;  4I6G A;  2IU1 A;  2WQ6 A;  2UY1 A;  2XRZ A;  1MJ0 A;  4AY5 A;  4BER A;  4RLY A;  1SVX A;  2BED A;  3PNL B;  4YVO A;  4YDE A;  2J8S D;  4N2Q A;  4G8K A;  5DBK A;  1O1R A;  3LY7 A;  3LDZ A;  4HRL A;  3C3Q A;  1E8Y A;  1IHB A;  5ANR A;  2C0L A;  3CVY A;  3N71 A;  1QNF A;  3ZYK A;  4IN3 B;  4JHR A;  4HFG A;  5D0O D;  4PS3 A;  4U95 D;  5FQ7 A;  5KNH D;  2VQ2 A;  4JD2 G;  4GTM A;  4M7C A;  1P5Q A;  2R2L A;  2X6K A;  3X2Q E;  2UY1 B;  4C0E A;  3ZXP A;  4URK A;  4BET A;  2IQC A;  3URZ A;  2WXH A;  5FQ6 A;  3D9I A;  5CBN A;  5CRU A;  4F1S A;  2KC7 A;  2XEV A;  3SBT B;  1UW4 B;  5E75 A;  4I1A A;  4U7E B;  1FT1 A;  5B3S E;  2XZT G;  2Y4U A;  3ASD A;  1NZN A;  4J0U A;  2GRM A;  2XGM A;  5JHB A;  3JXJ A;  4HQD A;  2PZI A;  5J08 A;  4J8E A;  4HRN A;  1XGW A;  3ZKJ A;  3DSU A;  4W9R A;  4KT6 B;  4Z68 A;  3ZYQ A;  3FU3 A;  3CHM A;  2Y3A A;  3L08 A;  3Q73 A;  3VTY A;  1SQM A;  5A7D B;  3LY8 A;  4TXR A;  5ENO D;  1D9S A;  4FHK A;  3R7R A;  3MX3 A;  1K3Z D;  1YA0 A;  3MYV A;  3APC A;  4I2W A;  2NYJ A;  3SGH A;  3LPZ A;  1LF8 A;  2XRY A;  5ANL A;  2DCP A;  4U0Z A;  2AW6 A;  4BTB A;  4PS8 A;  3SY2 A;  4WND A;  3UTM A;  1MX2 A;  5FZQ A;  1ZU2 A;  3FUH A;  2X6I A;  2R5S A;  2I1K A;  3Q7A A;  4TXP A;  3APD A;  2H6F A;  2B0O E;  4HOQ A;  2PQN A;  3ONK A;  3U66 A;  2OEV A;  4DRX E;  4PUC A;  3VLD A;  3QKY A;  2F8Y A;  3L6A A;  3O4Z A;  2XHE A;  3MCX A;  4EZJ A;  2RG8 A;  3B7R L;  4KXK B;  5FWQ A;  3EU5 A;  1OWO A;  3FUI A;  4A3V A;  3JQ0 A;  4UI9 K;  2E2E A;  5G2N A;  1N0Q A;  2VTB A;  4XZ4 A;  4K5B A;  2LAH A;  1A17 A;  2M63 A;  4IYP A;  3FUL A;  4BWR A;  2DYS E;  3TWW A;  2RKK A;  4F3V A;  5HS0 A;  3LYA A;  2GRQ B;  4GAA A;  4GZD A;  3JYS A;  2XGS A;  4GA2 A;  5LOZ A;  3KSQ A;  4LNB A;  3IKO B;  4CT0 A;  4JA7 A;  1OCC E;  1H6P A;  3HYM B;  3PEV B;  2AXU A;  1D8D A;  2VGX A;  5KWD A;  3SD5 A;  1SA4 A;  3ZU7 B;  2KCL A;  1TEZ A;  1PY1 A;  4GYO A;  4I6E A;  5CEA A;  2VTB B;  3RO2 A;  1ELW A;  5CMY A;  2WXQ A;  3G2U A;  3AU4 A;  2XPI A;  4APF A;  1IQU A;  2XS1 A;  2PNN A;  3HVE A;  4G23 A;  5FT9 A;  5AJL A;  1EPU A;  3MJW A;  5G05 J;  3ZYM A;  1UN8 A;  3RK6 A;  4D10 C;  1UOH A;  3PZ2 A;  2MYO A;  2ZGD A;  3AS4 A;  4YND A;  4U8V D;  4GA0 A;  5ENN A;  5BXU A;  1QZ2 A;  4N5Q A;  3CK7 A;  2VGX B;  4EEC A;  4E6H A;  4LNU D;  3EDT B;  3DXM G;  3ZHE A;  3ZNG A;  3ZRH A;  4WNG A;  3RIB A;  5BXO A;  1N95 A;  3HHM A;  5G05 C;  2LXL A;  2FF4 A;  2QFC A;  3EU9 A;  5EYL A;  2CG2 A;  2NXP A;  5BPP A;  1HX8 A;  4JXT A;  4GTV A;  4JA9 A;  1GW6 A;  4L2L A;  1TNZ A;  4QQI A;  3FTU A;  4M3O A;  2P9L G;  2OOE A;  3NOG D;  2BF0 X;  2J4D A;  2WXF A;  4ACK A;  3FU6 A;  4ILG A;  2L6B A;  1SZA A;  5ENQ D;  1O5M A;  3FDH A;  2I2O A;  4G25 A;  4AM9 A;  1MYO A;  2HR2 A;  4JHK A;  2E0I A;  4H7X A;  1QYM A;  4BT9 A;  3MEK A;  1TN8 A;  5AN8 A;  3S7F A;  2EIM E;  3L13 A;  3I3N A;  4RQI A;  3RU0 A;  2VYI A;  3CHO A;  2XCC A;  3UKU G;  3CVQ A;  2YHE A;  3PRZ A;  1S70 B;  2XPY A;  3W9F A;  1W3B A;  3TWU A;  3JCK C;  2P2C P;  4KZC A;  3PUJ A;  4XE0 A;  1AP7 A;  3B7U X;  4UWH A;  3ISM C;  3PH0 C;  1N94 A;  2AVP A;  3S2A A;  2R05 A;  5EN5 D;  4GU5 A;  3PNT B;  4CDN A;  2GRP B;  5ENT D;  4JVS A;  5KCM A;  5EIB E;  4L9P A;  5EX0 A;  3FU5 A;  5CEC B;  4K0R A;  3JUI A;  5D2M C;  4PDX A;  1NP7 A;  3PDN A;  3PZ4 A;  2J49 A;  2DYR E;  1IXV A;  3QB2 A;  3IXE A;  2LAI A;  3LCA A;  4NAC A;  3FWV A;  3LKU A;  2QYU A;  1ELR A;  1YCS B;  2R02 A;  4E85 A;  1IQR A;  1MZC A;  2EIL E;  5FIN A;  2P9S G;  3TWR A;  2C0M A;  1HE8 A;  2AXV A;  3RJV A;  1QQE A;  3WXX A;  3HXD A;  4HS2 A;  4FUL A;  2P9U G;  3FUD A;  2DZO A;  2RFM A;  4TUM A;  4BX8 A;  3PE4 A;  5JHA A;  3MKQ A;  2RD0 A;  5A23 A;  4RG6 A;  2VSO E;  4AXH A;  4DI4 A;  4JC8 A;  3FH7 A;  2R59 A;  4EZK A;  2BTD A;  4UQY A;  4A1G A;  2IEJ A;  3IHY A;  1EDU A;  5CCM A;  1OY3 D;  3R9A B;  3D9J A;  3IHV A;  1N4P A;  4JHJ A;  3FUJ A; 
#chains in the Genus database with same CATH homology
 3VTY A;  1SQM A;  5A7D B;  2PQR A;  3LY8 A;  3MA5 A;  3QDN A;  1JWG A;  4FHK A;  4FJY A;  4J6I A;  2V0P A;  3R7R A;  3MX3 A;  3UQ3 A;  1SZ9 A;  1YA0 A;  3MYV A;  3APC A;  4XKB A;  4I2W A;  3ZFW A;  5FTP A;  4I1O B;  3SGH A;  3LPZ A;  2VSY A;  4U04 A;  1LF8 A;  2XRY A;  3ULQ A;  4MRU A;  1JWF A;  1UG3 A;  3OXL A;  4I17 A;  4KVO A;  4HOT A;  5KJK A;  3G2W A;  4GYY A;  3O48 A;  4WNF A;  1DVP A;  4H7Y A;  5ANL A;  4ABN A;  1EF1 C;  3SNX A;  2DCP A;  4GCN A;  4J8F A;  4JPS A;  4U0Z A;  1H2V C;  2AW6 A;  4BTB A;  3C98 A;  3FTV A;  4FA6 A;  1U3D A;  4JL0 A;  2UWJ G;  4PS8 A;  3D9M A;  2WM9 A;  5FJY A;  4ANV A;  3UT8 A;  4WND A;  2WXG A;  3GZ2 A;  3MKQ B;  4ILH B;  2WXI A;  3QOU A;  1HF8 A;  2J09 A;  5FZQ A;  4NUR A;  4AJW A;  4APO A;  1ZU2 A;  4B94 A;  3CVL A;  3FUH A;  4BX9 A;  1H2T C;  3PVL A;  3SFZ A;  2X6I A;  4CEM A;  2OV8 A;  2R5S A;  2I1K A;  4J8S A;  5J90 A;  3TJP A;  2V5F A;  3APD A;  3L22 A;  4N2S A;  4G11 A;  1HZ4 A;  4L1B A;  5AEN A;  3IEG A;  4HOQ A;  2PQN A;  4TRQ A;  3ONK A;  3FY4 A;  4O6F A;  3U66 A;  2V4L A;  4J8D A;  2KM4 A;  3EIQ C;  4K03 A;  4PS7 A;  4A1S A;  4G26 A;  5BV0 A;  3ZIM A;  4LER A;  4MS6 A;  3D3M A;  3UPV A;  3GYZ A;  4B0Z A;  1E7U A;  2I6H A;  3ASG A;  4PUC A;  3VLD A;  4UWG A;  4FAD A;  3OTN A;  1WY6 A;  2WXO A;  1IHG A;  3QKY A;  3ML9 A;  4N3C A;  4DJA A;  1N52 A;  3NF1 A;  2AXZ A;  3L6A A;  3O4Z A;  2XHE A;  3E4B A;  3CVW A;  3U3W A;  3MCX A;  4JEH A;  3Q4A B;  3D9L A;  5T3R A;  4AIF A;  2PL2 A;  4EZJ A;  2XCB A;  2RG8 A;  3B7R L;  2CHW A;  3OAW A;  3QNK A;  4KXK B;  5CHE E;  2ILR A;  1ELK A;  2IOS A;  2WMN A;  4FLH A;  5FWQ A;  4C9B B;  2XQ0 A;  3AS5 A;  3S7D A;  1OWO A;  4EBA A;  3Q15 A;  1WAO 1;  3FUI A;  4A3V A;  3JQ0 A;  3S7J A;  3QJZ A;  4UI9 K;  4XX5 A;  3QWV A;  3G2S A;  1H19 A;  4HOU A;  2E2E A;  4HLE A;  4TUU A;  2IOL A;  2VSN A;  4Y6W A;  5G55 A;  4DPR A;  5G2N A;  2V8S E;  2VTB A;  2GW1 A;  3R7Q A;  3HVE B;  3U9W A;  4XZ4 A;  4ANW A;  2LAH A;  5JJ7 A;  1IYG A;  1A17 A;  2GRL A;  3ZN3 A;  2M63 A;  2ION A;  4IYP A;  3FUL A;  4A3T A;  3QAR A;  2CHX A;  4N39 A;  3FUE A;  2P58 C;  4ME2 A;  3L16 A;  4DLO A;  5LCW J;  4P29 A;  4GZ3 A;  2OVB A;  5E76 A;  4BWR A;  1KT1 A;  2L0T B;  1MQS A;  1EYH A;  3VLF A;  3ZW3 A;  4Q69 A;  1HG2 A;  3CEQ A;  4F53 A;  5FQ4 A;  1FVH A;  1OWN A;  4F3V A;  3UX4 A;  4F7A A;  1U3C A;  3LYA A;  4GAA A;  4I6J A;  3ASH A;  4GZD A;  4JZY A;  3TXM A;  2JLB A;  2LSU A;  3U4T A;  3D9O A;  3CVU A;  2WQH A;  2YHC A;  4HVB A;  4UWF A;  3JYS A;  2XGS A;  4GA2 A;  3RRU A;  4AEZ C;  2JEK A;  3BG0 B;  2IJG X;  4RG9 A;  3IBE A;  3CST A;  4OVU A;  5D0Q D;  5C2Y A;  4U07 A;  1Y8M A;  3ZXS A;  2I9C A;  3QWP A;  4RVB A;  3CHS A;  5LOZ A;  4C0M A;  4DI3 A;  4UQZ A;  2J08 A;  4BT8 A;  3ML8 A;  3IKO B;  5BUZ A;  3UUX A;  4CT0 A;  2CFU A;  1JUQ A;  2NSZ A;  4JA7 A;  4GYW A;  1S0P A;  4OYS A;  4FHJ A;  4KZ0 A;  1FVF A;  4GCO A;  4A55 A;  3TAX A;  4DK5 A;  2X3M A;  3ZGQ A;  1TJC A;  3HYM B;  3PEV B;  2AXU A;  2VGX A;  5DIZ A;  3ZYL A;  3CQC B;  3ZHE B;  4I9C A;  4I9E A;  5BNW A;  3SD5 A;  4R7L A;  2CHZ A;  2KCL A;  5AYW D;  3P1U A;  4N3B A;  1PY1 A;  4UWL A;  5CCL A;  1TEZ A;  4GYO A;  5T8I A;  4EPZ A;  3CK9 A;  4I6E A;  4L2Y A;  2FEZ A;  5LCW C;  2PM6 A;  2WXJ A;  2VTB B;  2FBN A;  2L0I A;  3RO2 A;  1ELW A;  5CMY A;  2WXQ A;  1OWL A;  2Y4T A;  3G2U A;  3BEE A;  4B8C B;  3ASF A;  3AU4 A;  3CKB A;  3T8M A;  2XPI A;  4APF A;  1IQU A;  3PE3 A;  2OND A;  4HXI A;  3SZ7 A;  3HVE A;  3UMV A;  3CVN A;  2X6H A;  2HM8 A;  2KZT A;  4Y6C A;  3SHF A;  4G23 A;  4EQF A;  1INZ A;  1PC2 A;  2EQX A;  3P2B A;  5FT9 A;  2XGO A;  3LS8 A;  4RSY A;  5AJL A;  5ARF A;  1EPU A;  3L54 A;  1HS6 A;  3FEY A;  3MJW A;  4CDR A;  4EZL A;  1BPO A;  4KMO A;  5G05 J;  3ZYM A;  3LY9 A;  1UN8 A;  3RK6 A;  4D10 C;  2DIW A;  3RKV A;  3FTX A;  4GB9 A;  2VSX E;  2VJ8 A;  4FU3 A;  3CV0 A;  4WAF A;  1B89 A;  4CGW A;  3BG1 B;  5ARG A;  4JEU A;  3TXN A;  5HQ8 A;  3NQP A;  2J07 A;  3AS4 A;  3ZPJ A;  4YND A;  5A6C A;  2KCV A;  2WXR A;  4V3I A;  2WQ7 A;  4U63 A;  4GA0 A;  3LEW A;  2MOW A;  5ENN A;  4I43 A;  2WVI A;  4TV3 A;  5FZS A;  5KJL A;  1XNF A;  1QZ2 A;  5LP0 A;  3GW4 A;  2WXP A;  3NZU A;  3PRE A;  3CK7 A;  4AY6 A;  2OVF A;  5BT1 A;  2VGX B;  3B13 A;  3CR3 A;  3FTS A;  4AVX A;  5LX8 A;  3MV3 B;  4QFV A;  3VLE A;  4EEC A;  3GZ1 A;  4JW1 A;  4BSX A;  3TG5 A;  4E6H A;  3ENE A;  3JQ1 A;  2WPV A;  3EDT B;  3ZEF A;  5G04 J;  2LO6 A;  3APF A;  4LEU A;  3ZHE A;  2FO7 A;  4MKT A;  1ZBP A;  3L17 A;  4HOR A;  4XI0 A;  4G2V A;  3ZRH A;  4WNG A;  3RIB A;  2IF4 A;  1OUV A;  2BUG A;  3I4R B;  3HHM A;  5G05 C;  5JJ6 A;  3SBS A;  3FFL A;  3LJ3 A;  2FF4 A;  2QFC A;  5BV1 A;  2KZT B;  3ESK A;  4L7T A;  1E8X A;  1OWP A;  5EKQ D;  3KD7 A;  4ATG A;  2CG2 A;  2NXP A;  1HXI A;  3LVQ E;  4WNE A;  2AWI A;  5BPP A;  1HX8 A;  4JXT A;  4NRH B;  3OXG A;  3LVR E;  1E96 B;  4N3A A;  4U0S A;  4U0U A;  1E8W A;  3PS6 A;  2IFU A;  2X6F A;  4JA9 A;  1GW6 A;  1H2U A;  3RRN B;  2WXM A;  4L2L A;  3FTU A;  1Y6I A;  3IV0 A;  4KVM A;  4UI9 C;  3CVX A;  4M3O A;  3FUN A;  3G2T A;  2OOE A;  3CVV A;  3FTY A;  4CCA A;  2NC9 A;  1TJF A;  2BF0 X;  3KEZ A;  2J9Q A;  3MKR A;  4G24 A;  2J4D A;  2WXF A;  3I5P A;  4XI9 A;  3ZVV A;  2J4B A;  3D9P A;  1HO8 A;  1H6K A;  2FUL A;  4ACK A;  1Z3Y A;  1E90 A;  3FU6 A;  4GZC A;  4AOF A;  4ILG A;  4PH4 B;  1SZA A;  5G04 C;  5CMW A;  4XKC A;  4AP2 A;  3FDH A;  2I2O A;  4G25 A;  4B89 A;  1MHQ A;  1UJK A;  3QC1 A;  4NQ0 A;  4FC8 A;  2HR2 A;  4AM9 A;  4JHK A;  3CLJ A;  4BTA A;  2LNI A;  3T5X A;  3FTZ A;  1NA0 A;  2E0I A;  1X5B A;  3FUM A;  2GGF A;  3FH5 A;  4H7X A;  4BT9 A;  3FUF A;  3MEK A;  3Q5M A;  5EDS A;  3CGH A;  4OVV A;  1NA3 A;  4YVQ C;  3FUK A;  3PEU B;  3RRM B;  1FCH A;  2WXK A;  2KCK A;  3FHE A;  4IUL A;  3S7F A;  4LUN U;  5LFA A;  3HIZ A;  4Q94 A;  3HDX A;  4AV7 A;  4FJZ A;  3L13 A;  3I3N A;  4LCT A;  1VDY A;  4I2Z A;  3QAQ A;  3MZL B;  3RU0 A;  1Z6T A;  2VYI A;  3FTW A;  3FP3 A;  3CHO A;  2XCC A;  5EX3 A;  2X6J A;  4GMJ A;  4FLB A;  3EJN A;  3Q49 B;  5FQ8 A;  3DPD A;  5AIJ A;  3B7S A;  3CVQ A;  4I6G A;  5HI7 A;  2YHE A;  2WXN A;  3PRZ A;  3EHM A;  1DNP A;  2IU1 A;  4GZ6 A;  2WQ6 A;  2UY1 A;  1L5J A;  2XRZ A;  2L6J A;  4AY5 A;  2WXL A;  2XPY A;  4U8H A;  1W3B A;  3JCK C;  3AS8 A;  5C1D A;  3AU5 A;  4KZC A;  3PUK A;  3PUJ A;  1H0A A;  4XE0 A;  2LSV A;  4BY6 A;  5BW8 C;  3PZD A;  4KBQ A;  3FEX A;  3PNL B;  4YVO A;  5KJM A;  1KLX A;  3D9K A;  2HYZ A;  4N5C A;  5AJD A;  4N2Q A;  1UJJ A;  3B7U X;  4CT4 A;  4UWH A;  1WM5 A;  4KYO B;  2I1J A;  3PH0 C;  5FZR A;  2AVP A;  3S2A A;  2YQ8 A;  5DBK A;  4GU5 A;  4WWN A;  2FI7 A;  3LY7 A;  4DLQ A;  2YIN A;  3PNT B;  1UN9 A;  3MV2 B;  3LDZ A;  3FU0 A;  4UI9 J;  4CDN A;  2WMO A;  4IRU A;  4ILI A;  1E8Y A;  4B8A A;  3UT4 A;  4JVS A;  5ANR A;  5M72 A;  4GPK A;  3GZS A;  5KCM A;  2C0L A;  3CVY A;  5EX0 A;  3N71 A;  4EBA G;  3ESL A;  4I1M A;  3FU5 A;  3UT7 A;  1QNF A;  3ZYK A;  4IN3 B;  1PAQ A;  3CVP A;  4JHR A;  4K0R A;  4HFG A;  5D0O D;  3JUI A;  4WUY A;  4PS3 A;  3S7B A;  2L9B A;  4CGV A;  3DBS A;  5FQ7 A;  1JPL A;  4PDX A;  4ACL A;  3ONL A;  1NP7 A;  2DBA A;  2WB2 A;  3PDN A;  2Q7F A;  3SI5 A;  2VQ2 A;  4GML A;  3RO3 A;  2J49 A;  3QWW A;  3VTX A;  1P5Q A;  2X6K A;  3QB2 A;  3TGO A;  2UY1 B;  4C0E A;  3G2V A;  3QK0 A;  1E8Z A;  2LAI A;  2XPZ A;  4LRZ A;  3KAE A;  1HFA A;  3LCA A;  4NAC A;  4URK A;  3FWV A;  3LKU A;  3CQG B;  4CRW A;  2MHK A;  2IQC A;  3U64 A;  2R17 C;  4UQX A;  3URZ A;  4G1T A;  1ELR A;  2WXH A;  5FQ6 A;  3D9I A;  2YNQ A;  4E85 A;  1IQR A;  2PM7 A;  1KT0 A;  1HU3 A;  4F1S A;  2KC7 A;  1HH8 A;  3KS2 A;  2XEV A;  3Q47 B;  5KJN A;  3SBT B;  4L23 A;  3B7T A;  2C0M A;  1HE8 A;  2AXV A;  3RJV A;  1QQE A;  2X38 A;  1UW4 B;  4GA1 A;  3WXX A;  2KAT A;  4HS2 A;  4FUL A;  5E75 A;  4WWP A;  3EHN A;  4I1A A;  2ZU6 B;  3K9I A;  3MGB A;  3FUD A;  3TL5 A;  4GZ5 A;  4ANU A;  4Q96 A;  4FP7 A;  4BX8 A;  4HOS A;  2Y4U A;  3CKC A;  3ASD A;  1NZN A;  3CSF A;  4J0U A;  2GRM A;  1N54 A;  3D9N A;  3PE4 A;  3TG4 A;  2XGM A;  5JHB A;  2VGY A;  3MKQ A;  5JJT A;  5JHA A;  2HO1 A;  2QY7 A;  3T5V A;  3OXF A;  2PZI A;  2RD0 A;  5A23 A;  4RG6 A;  4XIF A;  3CK8 A;  3SF4 A;  2VSO E;  5J08 A;  2A4Z A;  1OWM A;  4J8E A;  3CHP A;  1XGW A;  3LXU X;  4ANX A;  1HG5 A;  4AXH A;  4DI4 A;  3FH8 A;  1E7V A;  2A5U A;  2CFZ A;  2C2L A;  3I4G A;  3EIJ A;  3CHQ A;  3FH7 A;  4JC8 A;  4W9R A;  2MRI A;  4KT6 B;  2R59 A;  4EZK A;  2BTD A;  4UQY A;  4UWK A;  4A1G A;  3ZYQ A;  3NZS A;  4BFR A;  3FU3 A;  4WWO A;  3IHY A;  1EDU A;  1Z3X A;  3CHM A;  3CIA A;  5CCM A;  3CHR A;  4MLP A;  2CG3 A;  4CDM A;  3R9A B;  5T4Y A;  3D9J A;  2Y3A A;  3IHV A;  3L08 A;  4JHJ A;  3FUJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...