4CGVA

First tpr of spaghetti (rpap3) bound to hsp90 peptide srmeevd
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
125
structure length
125
Chain Sequence
HVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords RNA POLYMERASE II-ASSOCIATED PROTEIN 3
total genus 50
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cgvA00
4I9EA 4U0SA 1OUVA 2JLBA 3MV2B 3Q15A 4JA9A 3RO2A 5KJNA 2C2LA 2YHCA 3ASHA 3GZ2A 3QKYA 5CHEE 3VTXA 4I1AA 4H7XA 4CGVA 1XNFA 4N5CA 4RG9A 3R9AB 3S7JA 4WNDA 4YNDA 2VGXA 4BTAA 5KJKA 5D0OD 2LNIA 2MHKA 5FJYA 3CVPA 2FF4A 4GCOA 3LY7A 4J8DA 4NQ0A 3E4BA 3TG4A 4N3AA 3ZGQA 3LY9A 5JJ6A 2PL2A 3JYSA 4WNGA 3RU0A 3MA5A 2KCKA 4I9CA 5JJTA 2VSNA 2LSUA 2VGYA 5CCMA 4HOSA 2VGXB 5HI7A 4J8EA 3ASFA 3TG5A 3MKRA 2Q7FA 4I17A 4GCNA 4ABNA 3LKUA 4BTBA 5JJ7A 1ZU2A 3PE3A 3PE4A 4WNFA 4Y6CA 5DIZA 3ZPJA 5G04J 5AYWD 1NA3A 1NZNA 5G04C 5BT1A 2QFCA 2XGSA 3RO3A 2LSVA 4GZ3A 4G26A 3CKCA 3QDNA 4KBQA 1YA0A 4YVQC 5A7DB 2FBNA 3SZ7A 4AY5A 4IN3B 3CK8A 5CCLA 3GZ1A 3CVLA 4CGWA 3UPVA 1KT0A 5FZRA 3U4TA 4KXKB 5EKQD 4HORA 4AY6A 4N39A 2UY1A 3ESKA 2HO1A 2VYIA 1ZBPA 5EX0A 2E2EA 3CK9A 3MV3B 4GZ6A 3PDNA 4JL0A 3LY8A 4GA0A 3QWPA 4G23A 3TAXA 3URZA 3ZHEB 4GYYA 3KS2A 3ASGA 4U04A 3S7DA 3NF1A 2ONDA 3MEKA 3QOUA 4XI9A 3VTYA 2IF4A 3OXGA 3N71A 4WNEA 4BT9A 3FP3A 5LCWJ 1HXIA 3GYZA 4U0ZA 4A1SA 2J9QA 3FFLA 2VSYA 3IEGA 3KAEA 1ELRA 1NA0A 2AVPA 2GW1A 4GA1A 4GYWA 4N3CA 2FO7A 4XI0A 1P5QA 2UWJG 4ME2A 3LYAA 3QWWA 4UQXA 2XEVA 3KD7A 5KJLA 2Y4TA 2PQNA 1WAO1 3S7BA 3TGOA 3ZN3A 2YQ8A 4UI9K 4G2VA 5KJMA 3LPZA 4JHRA 3CV0A 2BUGA 3OXLA 4W9RA 5DBKA 3UQ3A 4CDRA 3FWVA 1W3BA 3RKVA 5EX3A 4U0UA 2WPVA 5LCWC 4B94A 2VQ2A 2XGOA 2UY1B 3CK7A 3Q49B 4G24A 5D0QD 4Y6WA 3OXFA 4YVOA 2L6JA 3S7FA 1PC2A 3O48A 3ASDA 2XCBA 4UQZA 2XGMA 4BT8A 1KT1A 5A6CA 3U3WA 4N2SA 4G1TA 4N2QA 3CEQA 2V5FA 1E96B 3SF4A 3CVQA 5ARGA 2HR2A 4GPKA 1IYGA 1Y8MA 3Q4AB 4UQYA 5FT9A 5C1DA 1B89A 2XPIA 2IFUA 2OOEA 4HOUA 4JA7A 3EDTB 4GYOA 4LEUA 4UI9J 5ARFA 2DBAA 1A17A 3Q47B 4GZ5A 2KCVA 3K9IA 3RIBA 2KATA 4AIFA 1ELWA 1WM5A 2FI7A 4EQFA 5BNWA 1QQEA 2R5SA 2KCLA 1FCHA 5HQ8A 2XCCA 4G25A 5FZSA 5G05J 4NRHB 4N3BA 5FZQA 2HYZA 3CVNA 3BEEA 3LCAA 3QWVA 2C0LA 2I6HA 4KYOB 5FTPA 4J0UA 2P58C 4H7YA 4UI9C 4APOA 1HH8A 1HZ4A 1KLXA 3RJVA 5BW8C 3Q5MA 4O6FA 3AS5A 2KC7A 3ULQA 5M72A 3AS8A 3CKBA 3ZFWA 4WUYA 2FEZA 3ZHEA 2PZIA 4RG6A 1TJCA 2NC9A 2Y4UA 4AM9A 2WQHA 1QZ2A 4HOQA 4BWRA 3AS4A 4I2ZA 4F3VA 4HOTA 2PQRA 4I2WA 2C0MA 3GW4A 3HYMB 4J8FA 4U07A 3WXXA 3UUXA 5G05C 4GA2A 1IHGA 4XIFA
chains in the Genus database with same CATH superfamily
2WM9A 4ANWA 3UM3A 3MKQA 4RG9A 4YNDA 2LNIA 2LAHA 3JYSA 3MA5A 3UT7A 2WXIA 2KZTB 2VGYA 4JHKA 1Z3YA 4YVQC 3SZ7A 3C3QA 3EU9A 3CK8A 1BI8B 1H2VC 2YINA 3AAAC 1JWGA 4BESA 2P9PG 3CK9A 2EIJE 2F37A 3DPDA 1DC2A 3OXGA 4DK5A 1UG3A 4A1SA 2J08A 4XI0A 4ATGA 5AIJA 3IHVA 2XQ0A 3ZN3A 3UMVA 3VLDA 5DBKA 4I1OB 3R9MA 3Q78A 2KZTA 1NFIE 2IEJA 4MKTA 4BT8A 1HX8A 3L22A 5BV0A 3D9HA 5KNHD 5ARFA 5CEAA 1QQEA 4AJWA 3Q7AA 4TUUA 3Q5MA 3D9JA 3ZXPA 2R02A 1E8YA 4BY6A 2PQRA 3EU5A 1O1SA 4LRZA 3QB2A 1D8EA 1OUVA 3RO2A 5KJNA 4WWPA 3QKYA 1EPUA 3DSWA 1UJJA 2QYUA 3TWSA 3PZ1A 3TG4A 1DVPA 3S2AA 3UM0A 5JJ6A 1QYMA 4I9CA 5JJTA 4B93B 4J8EA 3MKRA 4DJAA 3PE3A 4QFVA 3E33A 3UIOC 3QAQA 5CCLA 4XKBA 5FZRA 3SD5A 5EIBE 4APFA 2E2EA 3MV3B 3TAXA 1O1TA 3ASGA 4HI8A 1K8KG 2XS1A 2XRZA 3GYZA 1EF1C 5EILA 3PRZA 3ULYA 4TXQA 3DXKG 3T5VA 5KWDA 4UQXA 5KJLA 4I6JA 3DRAA 3CVVA 2BUGA 3QK0A 3FUKA 4UWGA 2XGMA 3EUVA 2KXPC 1KT1A 2WMOA 2L9BA 2XS8A 4JA7A 2LO6A 4LEUA 4GTRA 1OCZE 3E34A 4IULA 1SW6A 2XCCA 4G25A 5ENNA 4KYOB 2P58C 5M72A 4B8CB 4YDWA 1OWMA 3RSEG 2ETAA 2WXKA 5ENQD 2RG8A 4F6RD 3L54A 4C9BB 2YNQA 2DCPA 5AQ7A 2FO1E 3RK6A 5CERB 3VTXA 1XNFA 3HXFA 3C3OA 5T8IA 2FF4A 1X5BA 1UJKA 4Q94A 4WNGA 3RU0A 1WG0A 3MGBA 2ETBA 2VSNA 5CCMA 5HS0A 4I17A 1OWNA 3J5PA 3ZPJA 5G04J 3RO3A 1YA0A 3KSLA 4JC8A 2X3MA 4KVMA 4AXHA 2WXFA 2VYIA 2RFAA 4BERA 4LNGA 1HG2A 2XEHA 3QOUA 3L08A 2Y3AA 5LCWJ 4B89A 3IEGA 2PNNA 3SY2A 4GYWA 3JQ0A 4ME2A 3HIZA 2Y4TA 2P2CP 1UN8A 2CFZA 3D9LA 1SZ9A 1JWFA 2UY1B 2V4HC 2WXQA 4AP2A 2XCBA 4UQZA 4F53A 4EZKA 4A63B 4N2QA 2MOWA 4TUMA 3SQVA 4UQYA 4OVVA 4A1GA 2L0TB 3V79K 3C72A 4FA6A 1MX6A 4GTPA 4JW1A 1JPLA 2I6HA 1HH8A 3DSUA 4U63A 4WWNA 3ZHEA 5LX8A 1N4RA 3ABKE 4HOQA 3UI2A 1V54E 3APDA 2JLBA 5KNGA 2PM7A 1AP7A 2OEVA 3ZU7B 4I1AA 4NIKA 3WG7E 2VGXA 4WWOA 4A3VA 4ANXA 2EINE 1UN9A 1LF8A 2P9NG 2ZIRA 5ENSD 3EHMA 2WXNA 2VSOE 3PZ2A 4AY5A 5FWQA 3IKOB 2E0IA 3UINC 5EKQD 3F6QA 1MQSA 4LSZE 2XENA 3TWXA 3LY8A 2AXUA 3R7RA 3FFLA 3KAEA 4J8SA 1NA0A 1VDYA 1ELKA 1U2VG 5KBAA 4CDNA 4A3TA 3PH0C 3CHPA 2QZAA 1H2TC 4ILIA 2VQ2A 5G2NA 3V2XA 1E7VA 4GMJA 4N2SA 2A4ZA 4G1TA 3SF4A 2HR2A 2OV8A 1N0RA 3FHEA 5C1DA 1B89A 4UUCA 3FH7A 3RIBA 4GPMA 4RVBA 3PZ3A 5FZSA 3CHSA 1UOHA 1XGWA 1E8WA 3FUEA 4N5QA 3CVUA 2WVIA 4DX2A 2WQHA 3ULEG 4U07A 2QC9A 2P9KG 3PUJA 5EIDA 4U95D 2J4DA 2R03A 4TXPA 1D9SA 3AU5A 4N5CA 3D3MA 4B8AA 2MHKA 4IRUA 3LVRE 2AWIA 2B6CA 4TRQA 5AARA 4GCNA 3UX4A 3MCXA 4P29A 4G26A 3T9KA 3LJNA 4OYSA 5ENPD 4AY6A 2HO1A 3QARA 5B1BE 4I6GA 4FLBA 3MEKA 4ZHBA 1MHQA 2EIME 2ZGDA 2XEVA 2PQNA 3JXIA 3BU8A 3VLFA 5KJMA 4G8LA 3ZKJA 3KSQA 2DYRE 3RKVA 3KEZA 3B7BA 4JB8P 5D66A 3S7FA 1BD8A 1OCOE 4ANVA 4FP7A 5BXUA 1E96B 1OCCE 3DPYA 4A55A 3ABLE 2XPIA 2GRNB 4HB5A 4GYOA 4GZ5A 2FI7A 1IQUA 4N3BA 3L9TA 2GGFA 1HZ4A 3G2WA 4FC8A 1QNFA 4MBGA 4GTQA 1YMPA 4M3OA 1N4SA 4I2ZA 3SGHA 2DWZA 1SQMA 1MZCA 3LJ3A 2OCCE 1BI7B 2Y0BG 3Q75A 4DUIA 2NSZA 3R9AB 2DZOA 2VJ8A 5ENOD 3UT8A 4LNBA 5HRYA 2BEDA 2HE0A 3RRUA 3FUHA 5LOZA 4PDXA 4HFGA 2ZU6B 5JJ7A 1TNOA 4Y6CA 3ESLA 4YDEA 3LEWA 5G04C 4EQFA 5JHAA 5FQ8A 3TWRA 1DNPA 1KT0A 2X6HA 3T8MA 2A5UA 2J49A 1N54A 3PDNA 1INZA 2I1JA 3URZA 1Z3XA 3TXMA 4Q69A 4I6EA 2VSYA 3W9GA 4ATZD 3PUKA 3T8KA 4GTVA 1RW2A 3OXLA 1HE8A 4UWHA 2JEKA 4JXTA 4B94A 4FULA 1Y6IA 2JABA 3RRMB 5A6CA 2HM8A 3ISMC 3JXJA 3MZLB 3Q4AB 2XPZA 3G2UA 2AXZA 4UWLA 4JZYA 3EDTB 2XEEA 4KVOA 3K9IA 4DRXE 3B7SA 2HYZA 5FQ7A 3LCAA 2IOSA 4J0UA 1KLXA 4E6HA 4K5AB 5A23A 3AG4E 1IKND 2I1KA 3AS4A 3Q79A 3B7TA 3ML9A 3UUXA 3AJIA 2EQXA 3B7UX 5CHEE 3G2VA 1H0AA 4UWKA 4L7TA 4LG6A 3APFA 1N9AA 4I43A 2LSUA 3T5XA 4BTBA 2CHZA 4FJZA 1PY1A 2ILRA 3NOGD 5A7DB 2FBNA 4IN3B 4N39A 4KZ0A 3G2TA 4G23A 4JEUA 2WXMA 4JEHA 5AAOA 3CVWA 2GW1A 2FO7A 3I4RB 1WAO1 3W9FA 4C48B 1W3BA 2XPYA 4DLQA 3V30A 2CHWA 4G24A 4XZ4A 1PC2A 3O48A 3JUIA 3NZSA 3B13A 1LTXA 3Q9NC 1H6KA 3UM2A 4X8QA 3LXUX 4AIFA 2IO2C 3DSXA 5FZQA 1HF8A 1KPSB 2L6BA 4UI9C 3AS5A 1JCRA 4WUYA 1TJCA 2Y4UA 2WMNA 4F3VA 3ZYLA 3EHRA 4J8FA 2R59A 1OT8A 3MV2B 4CGVA 1KZOA 3S7JA 4WNDA 5KJKA 5G55A 5AENA 4GCOA 3LY7A 3UM1A 3ASFA 1E90A 3LKUA 5EDSA 1NZNA 2QFCA 3HXCA 4KBQA 3BG1B 3U4TA 1H6OA 1ZBPA 2XZDG 3NF1A 3EHNA 3FP3A 2B0OE 1E8ZA 3RRNB 1SZAA 1OXJA 1U3CA 2OEWA 1SVXA 3KD7A 1N11A 4JPSA 3SBTB 2KBXA 3CLJA 3MX3A 2X6IA 2V8SE 5LP0A 3E32A 4DPRA 4C0MA 3ASDA 4R7LA 3G2SA 3TXNA 3FTWA 3QJZA 5BV1A 3FUIA 1H2UA 2KCVA 4GMRA 2WQ6A 1SA5A 1V55E 4CYMD 3I3NA 4G11A 1HS6A 3NZUA 3HVEA 4JVSA 4EBAA 3ULQA 2QYJA 3OAWA 4LUNU 4UWFA 2FULA 1FPPA 3PEVB 4BWRA 4OAUC 1DCQA 3ZYMA 3FUMA 3Q73A 1SA4A 1IHGA 4XIFA 3CQCB 3Q15A 1FVFA 2J07A 1LD7A 3JUEA 4YDOA 3DSSA 1O5MA 2QY7A 4HOSA 4KT6B 3B95A 2KM4A 5BT1A 3ZYKA 2BKGA 3CKCA 2LXLA 4GU5A 3D9NA 2H6GA 4B0ZA 2WXLA 3CVLA 4MRUA 5B3SE 1U3DA 3C98A 3UT4A 4JL0A 3QNKA 3TWUA 5ENTD 4GPKA 5AQBA 4DI4A 5AQ9A 2GRRB 2AVPA 2NXPA 1L5JA 1TNZA 2GRMA 3CGHA 1BPOA 1TNBA 4F7AA 2IJGX 5CMWA 1TN8A 3SNXA 2ZXWE 4O60A 3FU5A 4CEMA 2WQ7A 2V5FA 3HXBA 4GAAA 2XRYA 4ILHB 2GRLA 1K1AA 3L17A 1E8XA 2AXVA 2GROB 4QQIA 2WXGA 1A17A 4HBDA 3CHMA 5BNWA 2VGEA 2KCLA 1FCHA 5B1AE 2X6FA 4NRHB 4K5CA 4H7YA 2KC7A 3CKBA 3TWVA 5BXOA 3ZNGA 4MS6A 3I5PA 3X2QE 3HVEB 4DX1A 3D9KA 4J8YA 4G8KA 2I9CA 2V4LA 4DX6D 4GTMA 3V31A 2VTBB 1X81A 2OVBA 2KCKA 1JUQA 3ASNE 3L82A 1ZU2A 3FH8A 3ZFWA 3PZ4A 3L6AA 1N4PA 2H6IA 1S0PA 5J90A 3UIPC 4GZ6A 4U04A 4PS7A 3R7QA 3ZXSA 1TN7A 1TR4A 3Q7FA 4BFRA 3CVYA 2CHXA 3UQ3A 1IXVA 4Y6WA 3CHQA 4HI9A 3FEXA 4O1OA 2WXRA 4AOFA 5E75A 3CVQA 4Z68A 3P1UA 5EYLA 2IFUA 3FU6A 1G3NB 2KATA 1WM5A 3MJWA 2P9LG 3I4GA 3BQOA 2WXHA 2XHEA 4CT4A 3FY4A 5BUZA 3SI5A 3DSVA 3RJVA 4O6FA 1Z5SC 3LS8A 4DLOA 2FEZA 1BLXB 2WXPA 4HS2A 4AM9A 4HQDA 5T3RA 5JA4D 3D9MA 3CSTA 3TWWA 4J7WA 4ACKA 3GZ2A 3HXEA 4BTAA 3ML8A 3EIQC 4FU3A 5E76A 3O4ZA 3ZGQA 4FHJA 2OVFA 1E7UA 3TG5A 4ABNA 3SFZA 2Q7FA 4WNFA 1BU9A 4IYPA 5D2MC 2WXOA 1NA3A 2LSVA 3QDNA 5J08A 5FINA 3FTVA 4HORA 2UY1A 3ESKA 2NYJA 4CZ2D 3VTYA 1HFAA 1S63A 4LCTA 3CQGB 3DWLG 3FUJA 2AJAA 2UWJG 2YQ8A 3LPZA 2J09A 2VSXE 3FWVA 4EHMA 5EX3A 1KZPA 3FH5A 5CRVA 4YVOA 2L6JA 4L1BA 3DEPA 3SHFA 4K0RA 2DZNA 1HU3A 3APCA 5JMND 3E30A 3EHQA 2P9UG 2R05A 1Y8MA 4CT0A 1TEZA 4BSXA 4HOUA 4ACLA 3Q47B 3NB2A 5AJLA 5AN8A 1Q2ZA 4HVBA 3BEEA 3P2BA 2RKKA 4YDYA 3PS6A 3FDHA 1RZ4A 3WXXA 4GZCA 4GMLA 4GA2A 2VTBA 2YHCA 4BSZB 2F8XK 4H7XA 3FTUA 3FTZA 3CHRA 3LY9A 1OY3D 2ETCA 3UTMA 4GB9A 5CBNA 2BTDA 4HRLA 3BG0B 2XGSA 4L2LA 4K5BA 5ENRD 3QC1A 3GZ1A 1MX4A 2L0IA 3ONLA 3UPVA 3FTXA 1AWCB 3AG3E 2IQCA 5EX0A 1Z6TA 3QWPA 5FQ6A 1ZB1A 3KS2A 2ONDA 4FADA 2IF4A 4BT9A 3TWQA 1JCSA 5ANLA 2X6JA 4AEZC 3ZW3A 4GTTA 4F1PA 5CEDB 3FEYA 4Q96A 4JHJA 3S7BA 3PNTB 1IQRA 3ZEFA 4JHRA 3IV0A 5LCWC 3HRAA 3PNLB 3KEAA 3OXFA 3LVQE 3TWTA 1NP7A 1A5EA 1TNYA 3CEQA 3D9PA 5ARGA 2R2LA 2M63A 1FVHA 3DEOA 4UI9J 1NI1A 3UXGA 1ELWA 2PM6A 4E85A 4HXIA 3ABME 5FQ4A 2C0LA 4WAFA 4U8HA 3CIAA 3NBNB 3ZUVB 3GW4A 3MYVA 2P9SG 4CCAA 5G05C 3DBSA 3NOCD 4DX5D 3ASHA 4XE0A 2CFUA 5KCMA 5FJYA 4NQ0A 4PS8A 1D8DA 4RLYA 3C3RA 2LXMA 4HNAD 2ZGGA 3PE4A 4GZ3A 2BF0X 4EECA 2RD0A 1TYQG 4CGWA 3ZRHA 3FU3A 4KXKB 5CRUA 3PVLA 3VLEA 4GA0A 4D10C 4GYYA 4HRMB 2R17C 4WNEA 2J9QA 1K1BA 5IY5E 1OWPA 3NAWA 3B7RL 1P5QA 3NQPA 4ZFHA 3QWWA 3TGOA 3J5QB 3ZIMA 4W9RA 1N94A 2WPVA 4J6IA 4RSYA 3MKQB 1YCSB 4GTOA 4ILGA 1OWOA 3SBSA 4L23A 2WB2A 2BKKB 3V2OA 1EYHA 2R5SA 5LFAA 4MLPA 3FUFA 3CVNA 5FTPA 4L2YA 3CVXA 2YHEA 4GZDA 3RAUA 2PZIA 4GTSA 3HDXA 3Q9UC 2AW6A 1NL4A 4PUCA 3UKUG 5EYPF 3HXDA 4I2WA 2C0MA 3HYMB 3AG2E 1PAQA 4U0SA 4K03A 2J4BA 3U66A 3CVPA 5CMYA 1TJFA 3E4BA 3TJPA 3FU0A 3DSTA 3OTNA 2X38A 5DIZA 4HOTA 4L9PA 3IBEA 5BPPA 4PH4B 4AV7A 5CECB 1MX2A 1O1RA 4U96D 2ZISA 2IOLA 2X6KA 2H6HA 4EZJA 1S64A 2IY0C 3ASOE 3N71A 1HXIA 4BX8A 2WXJA 4N3CA 3EIJA 2F0YA 2Y1LE 5AJDA 4HLLA 4FHKA 3FTSA 2XGOA 3CK7A 5HKPA 3PREA 2CG2A 3ENEA 4OVUA 4AVXA 1IYGA 4OAVB 1JCQA 1DCEA 2OOEA 2EIKE 5CBOA 4ANUA 4XKCA 4XEIG 3AG1E 4DI3A 3QWVA 3FULA 1GW6A 5H7PA 4U8YD 4CDMA 1FT1A 3EJNA 4LNUD 1EDUA 3E37A 3IHYA 4RQIA 3U64A 3FTYA 2C2LA 4NACA 3TL5A 4BETA 4J8DA 3PZDA 4N3AA 3SO8A 2VGXB 5HI7A 4XX5A 3C5RA 1HO8A 3IXEA 3CHOA 2GRQB 1S70B 4F1SA 3ONKA 1N52A 4EBAG 3ZHEB 5ANRA 3L13A 2DVWA 4U0ZA 4JD2G 1ELRA 1HG5A 1LD8A 3CSFA 3LYAA 1WDYA 2GRPB 2IO3C 2XZTG 4UI9K 4G2VA 3CV0A 3LDZA 3D9OA 4CDRA 1QBQA 3Q49B 5D0QD 1N0QA 2DIWA 2P9IG 4O1PA 2I2OA 5T4YA 3FUDA 4KZCA 3U3WA 1TNUA 1FT2A 2EILE 4URKA 4HLEA 4U7EB 1WY6A 4FJYA 2DBAA 1MJ0A 4BEPA 1YYHA 3SFXA 4TXRA 5HQ8A 1MYOA 1H19A 3HHMA 5BW8C 3AS8A 4TV3A 1OCRE 1K3ZD 2Y69E 3PEUB 4EPZA 2NC9A 3UKRG 2V5QC 1TN6A 1QZ2A 4LERA 5AQAA 4I9EA 4U8VD 1N4QA 4JA9A 3DXMG 4V3IA 3L16A 5D0OD 3JQ1A 2MYOA 2PL2A 4HRNA 3ZVVA 5AYWD 2LUHA 5FIOA 3ZYQA 3JCKC 3D9IA 4CRWA 1UW4B 3S7DA 3HG0D 4XI9A 2IU1A 5JHBA 4GA1A 4BX9A 4U0UA 4EZLA 5ITZF 3SFYA 2LAIA 5C2YA 4I1MA 5FT9A 4DX7D 2A5EA 3U9WA 2H6FA 4NURA 2J8SD 1N95A 4C0EA 5G05J 2V0PA 3CR3A 1IHBA 2F8YA 4APOA 2IONA 2CG3A 2DYSE 2MRIA 4PS3A 4RG6A 4FLHA 1OWLA 1H6PA 3AU4A 3GZSA 3FUNA 5EN5D 4M7CA 2RFMA 4KMOA 3BUAA
chains in the Genus database with same CATH topology
3CQCB 3DBSA 3PUJA 2WM9A 4ANWA 3Q15A 1FVFA 3MKQA 3ASHA 2J07A 4XE0A 2J4DA 4RG9A 3AU5A 4N5CA 2CFUA 3D3MA 4YNDA 5KCMA 4B8AA 2LNIA 2MHKA 5FJYA 4IRUA 4NQ0A 2LAHA 3LVRE 4PS8A 2AWIA 3JYSA 4TRQA 2QY7A 3MA5A 3UT7A 2WXIA 4HOSA 2KZTB 2VGYA 4KT6B 4GCNA 3UX4A 3MCXA 2KM4A 3PE4A 4JHKA 4P29A 3ZYKA 1Z3YA 5BT1A 4GZ3A 4G26A 3CKCA 4YVQC 3SZ7A 3CK8A 2BF0X 3D9NA 4GU5A 4OYSA 4B0ZA 2WXLA 3CVLA 4MRUA 2RD0A 4EECA 4CGWA 1H2VC 2YINA 3ZRHA 3FU3A 4KXKB 1JWGA 4AY6A 1U3DA 3C98A 2HO1A 3PVLA 3VLEA 3CK9A 3UT4A 4JL0A 3QARA 4GA0A 4D10C 3DPDA 4GYYA 4I6GA 3QNKA 4FLBA 3MEKA 2R17C 4GPKA 4WNEA 1MHQA 3OXGA 4DI4A 4DK5A 1UG3A 4A1SA 2J9QA 2J08A 1OWPA 2AVPA 2NXPA 4XI0A 3B7RL 1P5QA 3NQPA 4ATGA 1L5JA 2GRMA 5AIJA 3QWWA 2XEVA 2PQNA 3IHVA 3TGOA 3VLFA 2XQ0A 3ZN3A 3CGHA 3UMVA 5KJMA 3VLDA 1BPOA 3ZIMA 5DBKA 4W9RA 4I1OB 3RKVA 4F7AA 3KEZA 2IJGX 5CMWA 2WPVA 3SNXA 4J6IA 4RSYA 3MKQB 3FU5A 3S7FA 2KZTA 4CEMA 4ANVA 4FP7A 4MKTA 4ILGA 4BT8A 2WQ7A 1OWOA 2V5FA 1E96B 1HX8A 4GAAA 3SBSA 2XRYA 3L22A 4ILHB 4A55A 5BV0A 2GRLA 4L23A 3L17A 2XPIA 1E8XA 2AXVA 2WB2A 5ARFA 4GYOA 2WXGA 1A17A 4GZ5A 1EYHA 2FI7A 3CHMA 5BNWA 1QQEA 2R5SA 2KCLA 1FCHA 4AJWA 5LFAA 4MLPA 1IQUA 2X6FA 4NRHB 3FUFA 4N3BA 3CVNA 4TUUA 5FTPA 4H7YA 2GGFA 4L2YA 1HZ4A 3G2WA 4FC8A 3Q5MA 2KC7A 3CVXA 3CKBA 2YHEA 3D9JA 4GZDA 2PZIA 1QNFA 4MS6A 3HDXA 3I5PA 2AW6A 4M3OA 4PUCA 3HVEB 4I2ZA 1E8YA 4BY6A 2PQRA 3D9KA 4I2WA 3SGHA 1SQMA 2C0MA 3HYMB 4LRZA 1PAQA 3QB2A 2I9CA 3LJ3A 4U0SA 1OUVA 3RO2A 5KJNA 4WWPA 3QKYA 1EPUA 4K03A 2J4BA 2NSZA 1UJJA 3R9AB 2V4LA 2VJ8A 3UT8A 3U66A 3CVPA 5CMYA 1TJFA 3TG4A 3E4BA 1DVPA 3S2AA 5JJ6A 2VTBB 3RRUA 2OVBA 2KCKA 1JUQA 3FU0A 3FUHA 4I9CA 5LOZA 3TJPA 5JJTA 4PDXA 4HFGA 4J8EA 2ZU6B 3MKRA 5JJ7A 3OTNA 4DJAA 1ZU2A 3PE3A 3ESLA 2X38A 4Y6CA 4QFVA 5DIZA 3FH8A 3LEWA 5G04C 4HOTA 3ZFWA 4EQFA 3L6AA 3IBEA 3QAQA 5JHAA 5FQ8A 5BPPA 5CCLA 4PH4B 4AV7A 1S0PA 1DNPA 4XKBA 1KT0A 5FZRA 5J90A 3SD5A 2IOLA 2X6HA 2X6KA 3T8MA 4APFA 2E2EA 2A5UA 2J49A 3MV3B 1N54A 3PDNA 4GZ6A 4EZJA 2I1JA 3TAXA 1INZA 3URZA 3ASGA 4U04A 4PS7A 3R7QA 1Z3XA 3ZXSA 3N71A 3TXMA 2XRZA 1HXIA 1EF1C 3GYZA 4BX8A 4Q69A 2WXJA 3PRZA 4I6EA 2VSYA 4N3CA 3T5VA 4UQXA 3EIJA 4BFRA 5KJLA 3PUKA 4I6JA 3CVYA 2CHXA 3CVVA 5AJDA 3OXLA 2BUGA 3UQ3A 3QK0A 1HE8A 4FHKA 4UWHA 2JEKA 4JXTA 3FTSA 3FUKA 4B94A 2XGOA 4UWGA 3CK7A 4FULA 4Y6WA 3CHQA 3PREA 2CG2A 3FEXA 3ENEA 1Y6IA 2WXRA 2XGMA 4OVUA 3RRMB 1KT1A 5A6CA 2HM8A 2WMOA 5E75A 4AOFA 4AVXA 3CVQA 2L9BA 1IYGA 3MZLB 3Q4AB 2XPZA 3G2UA 3P1UA 2AXZA 4UWLA 2IFUA 2OOEA 4JZYA 4JA7A 3EDTB 2LO6A 4LEUA 5FQ7A 3FU6A 4KVOA 3K9IA 2KATA 1WM5A 3MJWA 4IULA 2XCCA 4G25A 4XKCA 5ENNA 4ANUA 3B7SA 2HYZA 3I4GA 4DI3A 3LCAA 3QWVA 2WXHA 2IOSA 2XHEA 4KYOB 3FY4A 4J0UA 2P58C 3FULA 4CT4A 3SI5A 5BUZA 1KLXA 3RJVA 5M72A 4O6FA 4B8CB 3LS8A 1OWMA 4DLOA 4E6HA 2FEZA 2WXKA 2WXPA 1GW6A 4HS2A 4CDMA 5A23A 4AM9A 3EJNA 2RG8A 2I1KA 3AS4A 1EDUA 5T3RA 3L54A 3B7TA 3IHYA 3ML9A 3D9MA 3UUXA 4C9BB 2YNQA 3CSTA 2DCPA 3U64A 2EQXA 3FTYA 4ACKA 2C2LA 3RK6A 3GZ2A 3B7UX 5CHEE 4NACA 3VTXA 1XNFA 4BTAA 3ML8A 3G2VA 3EIQC 1H0AA 4FU3A 5T8IA 3TL5A 4UWKA 2FF4A 1X5BA 1UJKA 4J8DA 3PZDA 5E76A 4N3AA 3O4ZA 3ZGQA 4Q94A 4L7TA 4FHJA 4WNGA 3APFA 3RU0A 3MGBA 4I43A 2VSNA 2LSUA 5CCMA 2OVFA 1E7UA 2VGXB 5HI7A 3T5XA 3TG5A 3SFZA 4ABNA 2Q7FA 4I17A 4BTBA 1OWNA 2CHZA 4FJZA 4WNFA 4XX5A 4IYPA 1PY1A 2WXOA 1NA3A 5G04J 3ZPJA 3RO3A 2ILRA 2LSVA 3QDNA 1YA0A 5A7DB 2FBNA 1HO8A 5J08A 4IN3B 3FTVA 3CHOA 4JC8A 4HORA 4F1SA 2X3MA 4KVMA 3ONKA 4AXHA 4N39A 2UY1A 2WXFA 3ESKA 1N52A 2VYIA 4KZ0A 4EBAG 3ZHEB 3G2TA 4G23A 5ANRA 3L13A 1HG2A 3QOUA 4JEUA 3VTYA 2WXMA 4JEHA 3L08A 2Y3AA 5LCWJ 4U0ZA 1HFAA 3CVWA 4B89A 3IEGA 1ELRA 1HG5A 2GW1A 3CQGB 3FUJA 4GYWA 4LCTA 2FO7A 3JQ0A 2UWJG 4ME2A 3CSFA 3I4RB 3LYAA 3HIZA 2Y4TA 1WAO1 1UN8A 2YQ8A 4UI9K 4G2VA 2CFZA 3LPZA 3CV0A 3LDZA 2J09A 2VSXE 3D9OA 4CDRA 3FWVA 1W3BA 2XPYA 5EX3A 4DLQA 3D9LA 3FH5A 1SZ9A 2CHWA 1JWFA 2UY1B 4G24A 3Q49B 4XZ4A 5D0QD 4YVOA 2L6JA 4L1BA 2DIWA 1PC2A 2WXQA 3O48A 4AP2A 2I2OA 2XCBA 3JUIA 4UQZA 5T4YA 3SHFA 4F53A 4EZKA 3FUDA 4K0RA 3NZSA 3B13A 1HU3A 4KZCA 3APCA 3U3WA 4N2QA 2MOWA 4URKA 1Y8MA 4HLEA 4UQYA 4CT0A 1WY6A 1TEZA 4OVVA 4A1GA 4BSXA 4FJYA 4HOUA 2L0TB 4ACLA 1H6KA 2DBAA 3Q47B 4FA6A 3LXUX 4AIFA 5AJLA 5HQ8A 4JW1A 4HVBA 5FZQA 1HF8A 3BEEA 1JPLA 2I6HA 1H19A 3P2BA 4UI9C 3HHMA 1HH8A 5BW8C 3AS5A 4U63A 3AS8A 4TV3A 4WUYA 4WWNA 3ZHEA 5LX8A 3PS6A 3PEUB 4EPZA 1TJCA 2NC9A 2Y4UA 1QZ2A 2WMNA 4HOQA 3FDHA 4F3VA 3ZYLA 4LERA 4J8FA 2R59A 3WXXA 4GZCA 3APDA 4GMLA 4GA2A 4I9EA 3MV2B 2JLBA 4JA9A 2VTBA 2PM7A 2YHCA 4V3IA 4I1AA 4H7XA 4CGVA 3FTUA 3S7JA 4WNDA 5KJKA 2VGXA 4WWOA 5G55A 3FTZA 3L16A 5D0OD 4A3VA 3JQ1A 4ANXA 5AENA 4GCOA 3LY7A 1UN9A 3CHRA 3LY9A 1LF8A 2PL2A 3EHMA 2WXNA 4GB9A 2BTDA 2VSOE 3ASFA 3ZVVA 1E90A 3LKUA 3BG0B 5EDSA 5AYWD 1NZNA 2QFCA 2XGSA 4L2LA 4KBQA 3ZYQA 4AY5A 5FWQA 3IKOB 3QC1A 3JCKC 3BG1B 3GZ1A 2E0IA 2L0IA 3D9IA 4CRWA 3ONLA 3UPVA 3U4TA 5EKQD 1MQSA 3FTXA 1ZBPA 2IQCA 5EX0A 1UW4B 1Z6TA 3LY8A 3QWPA 5FQ6A 2AXUA 3KS2A 3S7DA 3NF1A 2ONDA 4XI9A 4FADA 2IF4A 2IU1A 3EHNA 4BT9A 3FP3A 5JHBA 3R7RA 1E8ZA 3FFLA 3KAEA 4J8SA 5ANLA 1NA0A 3RRNB 2X6JA 4GA1A 1SZAA 4AEZC 3ZW3A 1VDYA 1ELKA 1U3CA 3FEYA 3KD7A 4Q96A 4JHJA 3S7BA 3PNTB 4CDNA 1IQRA 3ZEFA 3PH0C 4JPSA 3SBTB 3CHPA 4JHRA 4A3TA 4BX9A 3CLJA 3MX3A 3IV0A 2X6IA 1H2TC 4ILIA 4U0UA 5LCWC 2V8SE 3PNLB 5LP0A 2VQ2A 5G2NA 4DPRA 3OXFA 4EZLA 4C0MA 3LVQE 1E7VA 3ASDA 4R7LA 1NP7A 4GMJA 4N2SA 2A4ZA 2LAIA 4G1TA 3CEQA 5C2YA 3SF4A 3D9PA 2HR2A 5ARGA 3G2SA 2OV8A 3FHEA 3TXNA 3FTWA 2M63A 4I1MA 5FT9A 5C1DA 3QJZA 1FVHA 1B89A 5BV1A 3FH7A 3FUIA 3U9WA 4UI9J 1H2UA 2KCVA 3RIBA 4NURA 1ELWA 2WQ6A 2PM6A 4RVBA 3I3NA 4G11A 1HS6A 4C0EA 5FZSA 5G05J 4E85A 4HXIA 3CHSA 2V0PA 5FQ4A 3NZUA 2C0LA 3CR3A 3HVEA 4APOA 2IONA 4JVSA 4EBAA 4WAFA 1XGWA 3ULQA 2CG3A 1E8WA 2MRIA 3OAWA 4PS3A 4LUNU 3FUEA 3CVUA 4RG6A 4UWFA 2FULA 4FLHA 1OWLA 2WVIA 4U8HA 3CIAA 2WQHA 3PEVB 4BWRA 3AU4A 3GZSA 3FUNA 3GW4A 3MYVA 4U07A 3ZYMA 3FUMA 4CCAA 4KMOA 5G05C 1IHGA 4XIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I9E A;  4U0S A;  1OUV A;  2JLB A;  3MV2 B;  3Q15 A;  4JA9 A;  3RO2 A;  5KJN A;  2C2L A;  2YHC A;  3ASH A;  3GZ2 A;  3QKY A;  5CHE E;  3VTX A;  4I1A A;  4H7X A;  4CGV A;  1XNF A;  4N5C A;  4RG9 A;  3R9A B;  3S7J A;  4WND A;  4YND A;  2VGX A;  4BTA A;  5KJK A;  5D0O D;  2LNI A;  2MHK A;  5FJY A;  3CVP A;  2FF4 A;  4GCO A;  3LY7 A;  4J8D A;  4NQ0 A;  3E4B A;  3TG4 A;  4N3A A;  3ZGQ A;  3LY9 A;  5JJ6 A;  2PL2 A;  3JYS A;  4WNG A;  3RU0 A;  3MA5 A;  2KCK A;  4I9C A;  5JJT A;  2VSN A;  2LSU A;  2VGY A;  5CCM A;  4HOS A;  2VGX B;  5HI7 A;  4J8E A;  3ASF A;  3TG5 A;  3MKR A;  2Q7F A;  4I17 A;  4GCN A;  4ABN A;  3LKU A;  4BTB A;  5JJ7 A;  1ZU2 A;  3PE3 A;  3PE4 A;  4WNF A;  4Y6C A;  5DIZ A;  3ZPJ A;  5G04 J;  5AYW D;  1NA3 A;  1NZN A;  5G04 C;  5BT1 A;  2QFC A;  2XGS A;  3RO3 A;  2LSV A;  4GZ3 A;  4G26 A;  3CKC A;  3QDN A;  4KBQ A;  1YA0 A;  4YVQ C;  5A7D B;  2FBN A;  3SZ7 A;  4AY5 A;  4IN3 B;  3CK8 A;  5CCL A;  3GZ1 A;  3CVL A;  4CGW A;  3UPV A;  1KT0 A;  5FZR A;  3U4T A;  4KXK B;  5EKQ D;  4HOR A;  4AY6 A;  4N39 A;  2UY1 A;  3ESK A;  2HO1 A;  2VYI A;  1ZBP A;  5EX0 A;  2E2E A;  3CK9 A;  3MV3 B;  4GZ6 A;  3PDN A;  4JL0 A;  3LY8 A;  4GA0 A;  3QWP A;  4G23 A;  3TAX A;  3URZ A;  3ZHE B;  4GYY A;  3KS2 A;  3ASG A;  4U04 A;  3S7D A;  3NF1 A;  2OND A;  3MEK A;  3QOU A;  4XI9 A;  3VTY A;  2IF4 A;  3OXG A;  3N71 A;  4WNE A;  4BT9 A;  3FP3 A;  5LCW J;  1HXI A;  3GYZ A;  4U0Z A;  4A1S A;  2J9Q A;  3FFL A;  2VSY A;  3IEG A;  3KAE A;  1ELR A;  1NA0 A;  2AVP A;  2GW1 A;  4GA1 A;  4GYW A;  4N3C A;  2FO7 A;  4XI0 A;  1P5Q A;  2UWJ G;  4ME2 A;  3LYA A;  3QWW A;  4UQX A;  2XEV A;  3KD7 A;  5KJL A;  2Y4T A;  2PQN A;  1WAO 1;  3S7B A;  3TGO A;  3ZN3 A;  2YQ8 A;  4UI9 K;  4G2V A;  5KJM A;  3LPZ A;  4JHR A;  3CV0 A;  2BUG A;  3OXL A;  4W9R A;  5DBK A;  3UQ3 A;  4CDR A;  3FWV A;  1W3B A;  3RKV A;  5EX3 A;  4U0U A;  2WPV A;  5LCW C;  4B94 A;  2VQ2 A;  2XGO A;  2UY1 B;  3CK7 A;  3Q49 B;  4G24 A;  5D0Q D;  4Y6W A;  3OXF A;  4YVO A;  2L6J A;  3S7F A;  1PC2 A;  3O48 A;  3ASD A;  2XCB A;  4UQZ A;  2XGM A;  4BT8 A;  1KT1 A;  5A6C A;  3U3W A;  4N2S A;  4G1T A;  4N2Q A;  3CEQ A;  2V5F A;  1E96 B;  3SF4 A;  3CVQ A;  5ARG A;  2HR2 A;  4GPK A;  1IYG A;  1Y8M A;  3Q4A B;  4UQY A;  5FT9 A;  5C1D A;  1B89 A;  2XPI A;  2IFU A;  2OOE A;  4HOU A;  4JA7 A;  3EDT B;  4GYO A;  4LEU A;  4UI9 J;  5ARF A;  2DBA A;  1A17 A;  3Q47 B;  4GZ5 A;  2KCV A;  3K9I A;  3RIB A;  2KAT A;  4AIF A;  1ELW A;  1WM5 A;  2FI7 A;  4EQF A;  5BNW A;  1QQE A;  2R5S A;  2KCL A;  1FCH A;  5HQ8 A;  2XCC A;  4G25 A;  5FZS A;  5G05 J;  4NRH B;  4N3B A;  5FZQ A;  2HYZ A;  3CVN A;  3BEE A;  3LCA A;  3QWV A;  2C0L A;  2I6H A;  4KYO B;  5FTP A;  4J0U A;  2P58 C;  4H7Y A;  4UI9 C;  4APO A;  1HH8 A;  1HZ4 A;  1KLX A;  3RJV A;  5BW8 C;  3Q5M A;  4O6F A;  3AS5 A;  2KC7 A;  3ULQ A;  5M72 A;  3AS8 A;  3CKB A;  3ZFW A;  4WUY A;  2FEZ A;  3ZHE A;  2PZI A;  4RG6 A;  1TJC A;  2NC9 A;  2Y4U A;  4AM9 A;  2WQH A;  1QZ2 A;  4HOQ A;  4BWR A;  3AS4 A;  4I2Z A;  4F3V A;  4HOT A;  2PQR A;  4I2W A;  2C0M A;  3GW4 A;  3HYM B;  4J8F A;  4U07 A;  3WXX A;  3UUX A;  5G05 C;  4GA2 A;  1IHG A;  4XIF A; 
#chains in the Genus database with same CATH topology
 2WM9 A;  4ANW A;  3UM3 A;  3MKQ A;  4RG9 A;  4YND A;  2LNI A;  2LAH A;  3JYS A;  3MA5 A;  3UT7 A;  2WXI A;  2KZT B;  2VGY A;  4JHK A;  1Z3Y A;  4YVQ C;  3SZ7 A;  3C3Q A;  3EU9 A;  3CK8 A;  1BI8 B;  1H2V C;  2YIN A;  3AAA C;  1JWG A;  4BES A;  2P9P G;  3CK9 A;  2EIJ E;  2F37 A;  3DPD A;  1DC2 A;  3OXG A;  4DK5 A;  1UG3 A;  4A1S A;  2J08 A;  4XI0 A;  4ATG A;  5AIJ A;  3IHV A;  2XQ0 A;  3ZN3 A;  3UMV A;  3VLD A;  5DBK A;  4I1O B;  3R9M A;  3Q78 A;  2KZT A;  1NFI E;  2IEJ A;  4MKT A;  4BT8 A;  1HX8 A;  3L22 A;  5BV0 A;  3D9H A;  5KNH D;  5ARF A;  5CEA A;  1QQE A;  4AJW A;  3Q7A A;  4TUU A;  3Q5M A;  3D9J A;  3ZXP A;  2R02 A;  1E8Y A;  4BY6 A;  2PQR A;  3EU5 A;  1O1S A;  4LRZ A;  3QB2 A;  1D8E A;  1OUV A;  3RO2 A;  5KJN A;  4WWP A;  3QKY A;  1EPU A;  3DSW A;  1UJJ A;  2QYU A;  3TWS A;  3PZ1 A;  3TG4 A;  1DVP A;  3S2A A;  3UM0 A;  5JJ6 A;  1QYM A;  4I9C A;  5JJT A;  4B93 B;  4J8E A;  3MKR A;  4DJA A;  3PE3 A;  4QFV A;  3E33 A;  3UIO C;  3QAQ A;  5CCL A;  4XKB A;  5FZR A;  3SD5 A;  5EIB E;  4APF A;  2E2E A;  3MV3 B;  3TAX A;  1O1T A;  3ASG A;  4HI8 A;  1K8K G;  2XS1 A;  2XRZ A;  3GYZ A;  1EF1 C;  5EIL A;  3PRZ A;  3ULY A;  4TXQ A;  3DXK G;  3T5V A;  5KWD A;  4UQX A;  5KJL A;  4I6J A;  3DRA A;  3CVV A;  2BUG A;  3QK0 A;  3FUK A;  4UWG A;  2XGM A;  3EUV A;  2KXP C;  1KT1 A;  2WMO A;  2L9B A;  2XS8 A;  4JA7 A;  2LO6 A;  4LEU A;  4GTR A;  1OCZ E;  3E34 A;  4IUL A;  1SW6 A;  2XCC A;  4G25 A;  5ENN A;  4KYO B;  2P58 C;  5M72 A;  4B8C B;  4YDW A;  1OWM A;  3RSE G;  2ETA A;  2WXK A;  5ENQ D;  2RG8 A;  4F6R D;  3L54 A;  4C9B B;  2YNQ A;  2DCP A;  5AQ7 A;  2FO1 E;  3RK6 A;  5CER B;  3VTX A;  1XNF A;  3HXF A;  3C3O A;  5T8I A;  2FF4 A;  1X5B A;  1UJK A;  4Q94 A;  4WNG A;  3RU0 A;  1WG0 A;  3MGB A;  2ETB A;  2VSN A;  5CCM A;  5HS0 A;  4I17 A;  1OWN A;  3J5P A;  3ZPJ A;  5G04 J;  3RO3 A;  1YA0 A;  3KSL A;  4JC8 A;  2X3M A;  4KVM A;  4AXH A;  2WXF A;  2VYI A;  2RFA A;  4BER A;  4LNG A;  1HG2 A;  2XEH A;  3QOU A;  3L08 A;  2Y3A A;  5LCW J;  4B89 A;  3IEG A;  2PNN A;  3SY2 A;  4GYW A;  3JQ0 A;  4ME2 A;  3HIZ A;  2Y4T A;  2P2C P;  1UN8 A;  2CFZ A;  3D9L A;  1SZ9 A;  1JWF A;  2UY1 B;  2V4H C;  2WXQ A;  4AP2 A;  2XCB A;  4UQZ A;  4F53 A;  4EZK A;  4A63 B;  4N2Q A;  2MOW A;  4TUM A;  3SQV A;  4UQY A;  4OVV A;  4A1G A;  2L0T B;  3V79 K;  3C72 A;  4FA6 A;  1MX6 A;  4GTP A;  4JW1 A;  1JPL A;  2I6H A;  1HH8 A;  3DSU A;  4U63 A;  4WWN A;  3ZHE A;  5LX8 A;  1N4R A;  3ABK E;  4HOQ A;  3UI2 A;  1V54 E;  3APD A;  2JLB A;  5KNG A;  2PM7 A;  1AP7 A;  2OEV A;  3ZU7 B;  4I1A A;  4NIK A;  3WG7 E;  2VGX A;  4WWO A;  4A3V A;  4ANX A;  2EIN E;  1UN9 A;  1LF8 A;  2P9N G;  2ZIR A;  5ENS D;  3EHM A;  2WXN A;  2VSO E;  3PZ2 A;  4AY5 A;  5FWQ A;  3IKO B;  2E0I A;  3UIN C;  5EKQ D;  3F6Q A;  1MQS A;  4LSZ E;  2XEN A;  3TWX A;  3LY8 A;  2AXU A;  3R7R A;  3FFL A;  3KAE A;  4J8S A;  1NA0 A;  1VDY A;  1ELK A;  1U2V G;  5KBA A;  4CDN A;  4A3T A;  3PH0 C;  3CHP A;  2QZA A;  1H2T C;  4ILI A;  2VQ2 A;  5G2N A;  3V2X A;  1E7V A;  4GMJ A;  4N2S A;  2A4Z A;  4G1T A;  3SF4 A;  2HR2 A;  2OV8 A;  1N0R A;  3FHE A;  5C1D A;  1B89 A;  4UUC A;  3FH7 A;  3RIB A;  4GPM A;  4RVB A;  3PZ3 A;  5FZS A;  3CHS A;  1UOH A;  1XGW A;  1E8W A;  3FUE A;  4N5Q A;  3CVU A;  2WVI A;  4DX2 A;  2WQH A;  3ULE G;  4U07 A;  2QC9 A;  2P9K G;  3PUJ A;  5EID A;  4U95 D;  2J4D A;  2R03 A;  4TXP A;  1D9S A;  3AU5 A;  4N5C A;  3D3M A;  4B8A A;  2MHK A;  4IRU A;  3LVR E;  2AWI A;  2B6C A;  4TRQ A;  5AAR A;  4GCN A;  3UX4 A;  3MCX A;  4P29 A;  4G26 A;  3T9K A;  3LJN A;  4OYS A;  5ENP D;  4AY6 A;  2HO1 A;  3QAR A;  5B1B E;  4I6G A;  4FLB A;  3MEK A;  4ZHB A;  1MHQ A;  2EIM E;  2ZGD A;  2XEV A;  2PQN A;  3JXI A;  3BU8 A;  3VLF A;  5KJM A;  4G8L A;  3ZKJ A;  3KSQ A;  2DYR E;  3RKV A;  3KEZ A;  3B7B A;  4JB8 P;  5D66 A;  3S7F A;  1BD8 A;  1OCO E;  4ANV A;  4FP7 A;  5BXU A;  1E96 B;  1OCC E;  3DPY A;  4A55 A;  3ABL E;  2XPI A;  2GRN B;  4HB5 A;  4GYO A;  4GZ5 A;  2FI7 A;  1IQU A;  4N3B A;  3L9T A;  2GGF A;  1HZ4 A;  3G2W A;  4FC8 A;  1QNF A;  4MBG A;  4GTQ A;  1YMP A;  4M3O A;  1N4S A;  4I2Z A;  3SGH A;  2DWZ A;  1SQM A;  1MZC A;  3LJ3 A;  2OCC E;  1BI7 B;  2Y0B G;  3Q75 A;  4DUI A;  2NSZ A;  3R9A B;  2DZO A;  2VJ8 A;  5ENO D;  3UT8 A;  4LNB A;  5HRY A;  2BED A;  2HE0 A;  3RRU A;  3FUH A;  5LOZ A;  4PDX A;  4HFG A;  2ZU6 B;  5JJ7 A;  1TNO A;  4Y6C A;  3ESL A;  4YDE A;  3LEW A;  5G04 C;  4EQF A;  5JHA A;  5FQ8 A;  3TWR A;  1DNP A;  1KT0 A;  2X6H A;  3T8M A;  2A5U A;  2J49 A;  1N54 A;  3PDN A;  1INZ A;  2I1J A;  3URZ A;  1Z3X A;  3TXM A;  4Q69 A;  4I6E A;  2VSY A;  3W9G A;  4ATZ D;  3PUK A;  3T8K A;  4GTV A;  1RW2 A;  3OXL A;  1HE8 A;  4UWH A;  2JEK A;  4JXT A;  4B94 A;  4FUL A;  1Y6I A;  2JAB A;  3RRM B;  5A6C A;  2HM8 A;  3ISM C;  3JXJ A;  3MZL B;  3Q4A B;  2XPZ A;  3G2U A;  2AXZ A;  4UWL A;  4JZY A;  3EDT B;  2XEE A;  4KVO A;  3K9I A;  4DRX E;  3B7S A;  2HYZ A;  5FQ7 A;  3LCA A;  2IOS A;  4J0U A;  1KLX A;  4E6H A;  4K5A B;  5A23 A;  3AG4 E;  1IKN D;  2I1K A;  3AS4 A;  3Q79 A;  3B7T A;  3ML9 A;  3UUX A;  3AJI A;  2EQX A;  3B7U X;  5CHE E;  3G2V A;  1H0A A;  4UWK A;  4L7T A;  4LG6 A;  3APF A;  1N9A A;  4I43 A;  2LSU A;  3T5X A;  4BTB A;  2CHZ A;  4FJZ A;  1PY1 A;  2ILR A;  3NOG D;  5A7D B;  2FBN A;  4IN3 B;  4N39 A;  4KZ0 A;  3G2T A;  4G23 A;  4JEU A;  2WXM A;  4JEH A;  5AAO A;  3CVW A;  2GW1 A;  2FO7 A;  3I4R B;  1WAO 1;  3W9F A;  4C48 B;  1W3B A;  2XPY A;  4DLQ A;  3V30 A;  2CHW A;  4G24 A;  4XZ4 A;  1PC2 A;  3O48 A;  3JUI A;  3NZS A;  3B13 A;  1LTX A;  3Q9N C;  1H6K A;  3UM2 A;  4X8Q A;  3LXU X;  4AIF A;  2IO2 C;  3DSX A;  5FZQ A;  1HF8 A;  1KPS B;  2L6B A;  4UI9 C;  3AS5 A;  1JCR A;  4WUY A;  1TJC A;  2Y4U A;  2WMN A;  4F3V A;  3ZYL A;  3EHR A;  4J8F A;  2R59 A;  1OT8 A;  3MV2 B;  4CGV A;  1KZO A;  3S7J A;  4WND A;  5KJK A;  5G55 A;  5AEN A;  4GCO A;  3LY7 A;  3UM1 A;  3ASF A;  1E90 A;  3LKU A;  5EDS A;  1NZN A;  2QFC A;  3HXC A;  4KBQ A;  3BG1 B;  3U4T A;  1H6O A;  1ZBP A;  2XZD G;  3NF1 A;  3EHN A;  3FP3 A;  2B0O E;  1E8Z A;  3RRN B;  1SZA A;  1OXJ A;  1U3C A;  2OEW A;  1SVX A;  3KD7 A;  1N11 A;  4JPS A;  3SBT B;  2KBX A;  3CLJ A;  3MX3 A;  2X6I A;  2V8S E;  5LP0 A;  3E32 A;  4DPR A;  4C0M A;  3ASD A;  4R7L A;  3G2S A;  3TXN A;  3FTW A;  3QJZ A;  5BV1 A;  3FUI A;  1H2U A;  2KCV A;  4GMR A;  2WQ6 A;  1SA5 A;  1V55 E;  4CYM D;  3I3N A;  4G11 A;  1HS6 A;  3NZU A;  3HVE A;  4JVS A;  4EBA A;  3ULQ A;  2QYJ A;  3OAW A;  4LUN U;  4UWF A;  2FUL A;  1FPP A;  3PEV B;  4BWR A;  4OAU C;  1DCQ A;  3ZYM A;  3FUM A;  3Q73 A;  1SA4 A;  1IHG A;  4XIF A;  3CQC B;  3Q15 A;  1FVF A;  2J07 A;  1LD7 A;  3JUE A;  4YDO A;  3DSS A;  1O5M A;  2QY7 A;  4HOS A;  4KT6 B;  3B95 A;  2KM4 A;  5BT1 A;  3ZYK A;  2BKG A;  3CKC A;  2LXL A;  4GU5 A;  3D9N A;  2H6G A;  4B0Z A;  2WXL A;  3CVL A;  4MRU A;  5B3S E;  1U3D A;  3C98 A;  3UT4 A;  4JL0 A;  3QNK A;  3TWU A;  5ENT D;  4GPK A;  5AQB A;  4DI4 A;  5AQ9 A;  2GRR B;  2AVP A;  2NXP A;  1L5J A;  1TNZ A;  2GRM A;  3CGH A;  1BPO A;  1TNB A;  4F7A A;  2IJG X;  5CMW A;  1TN8 A;  3SNX A;  2ZXW E;  4O60 A;  3FU5 A;  4CEM A;  2WQ7 A;  2V5F A;  3HXB A;  4GAA A;  2XRY A;  4ILH B;  2GRL A;  1K1A A;  3L17 A;  1E8X A;  2AXV A;  2GRO B;  4QQI A;  2WXG A;  1A17 A;  4HBD A;  3CHM A;  5BNW A;  2VGE A;  2KCL A;  1FCH A;  5B1A E;  2X6F A;  4NRH B;  4K5C A;  4H7Y A;  2KC7 A;  3CKB A;  3TWV A;  5BXO A;  3ZNG A;  4MS6 A;  3I5P A;  3X2Q E;  3HVE B;  4DX1 A;  3D9K A;  4J8Y A;  4G8K A;  2I9C A;  2V4L A;  4DX6 D;  4GTM A;  3V31 A;  2VTB B;  1X81 A;  2OVB A;  2KCK A;  1JUQ A;  3ASN E;  3L82 A;  1ZU2 A;  3FH8 A;  3ZFW A;  3PZ4 A;  3L6A A;  1N4P A;  2H6I A;  1S0P A;  5J90 A;  3UIP C;  4GZ6 A;  4U04 A;  4PS7 A;  3R7Q A;  3ZXS A;  1TN7 A;  1TR4 A;  3Q7F A;  4BFR A;  3CVY A;  2CHX A;  3UQ3 A;  1IXV A;  4Y6W A;  3CHQ A;  4HI9 A;  3FEX A;  4O1O A;  2WXR A;  4AOF A;  5E75 A;  3CVQ A;  4Z68 A;  3P1U A;  5EYL A;  2IFU A;  3FU6 A;  1G3N B;  2KAT A;  1WM5 A;  3MJW A;  2P9L G;  3I4G A;  3BQO A;  2WXH A;  2XHE A;  4CT4 A;  3FY4 A;  5BUZ A;  3SI5 A;  3DSV A;  3RJV A;  4O6F A;  1Z5S C;  3LS8 A;  4DLO A;  2FEZ A;  1BLX B;  2WXP A;  4HS2 A;  4AM9 A;  4HQD A;  5T3R A;  5JA4 D;  3D9M A;  3CST A;  3TWW A;  4J7W A;  4ACK A;  3GZ2 A;  3HXE A;  4BTA A;  3ML8 A;  3EIQ C;  4FU3 A;  5E76 A;  3O4Z A;  3ZGQ A;  4FHJ A;  2OVF A;  1E7U A;  3TG5 A;  4ABN A;  3SFZ A;  2Q7F A;  4WNF A;  1BU9 A;  4IYP A;  5D2M C;  2WXO A;  1NA3 A;  2LSV A;  3QDN A;  5J08 A;  5FIN A;  3FTV A;  4HOR A;  2UY1 A;  3ESK A;  2NYJ A;  4CZ2 D;  3VTY A;  1HFA A;  1S63 A;  4LCT A;  3CQG B;  3DWL G;  3FUJ A;  2AJA A;  2UWJ G;  2YQ8 A;  3LPZ A;  2J09 A;  2VSX E;  3FWV A;  4EHM A;  5EX3 A;  1KZP A;  3FH5 A;  5CRV A;  4YVO A;  2L6J A;  4L1B A;  3DEP A;  3SHF A;  4K0R A;  2DZN A;  1HU3 A;  3APC A;  5JMN D;  3E30 A;  3EHQ A;  2P9U G;  2R05 A;  1Y8M A;  4CT0 A;  1TEZ A;  4BSX A;  4HOU A;  4ACL A;  3Q47 B;  3NB2 A;  5AJL A;  5AN8 A;  1Q2Z A;  4HVB A;  3BEE A;  3P2B A;  2RKK A;  4YDY A;  3PS6 A;  3FDH A;  1RZ4 A;  3WXX A;  4GZC A;  4GML A;  4GA2 A;  2VTB A;  2YHC A;  4BSZ B;  2F8X K;  4H7X A;  3FTU A;  3FTZ A;  3CHR A;  3LY9 A;  1OY3 D;  2ETC A;  3UTM A;  4GB9 A;  5CBN A;  2BTD A;  4HRL A;  3BG0 B;  2XGS A;  4L2L A;  4K5B A;  5ENR D;  3QC1 A;  3GZ1 A;  1MX4 A;  2L0I A;  3ONL A;  3UPV A;  3FTX A;  1AWC B;  3AG3 E;  2IQC A;  5EX0 A;  1Z6T A;  3QWP A;  5FQ6 A;  1ZB1 A;  3KS2 A;  2OND A;  4FAD A;  2IF4 A;  4BT9 A;  3TWQ A;  1JCS A;  5ANL A;  2X6J A;  4AEZ C;  3ZW3 A;  4GTT A;  4F1P A;  5CED B;  3FEY A;  4Q96 A;  4JHJ A;  3S7B A;  3PNT B;  1IQR A;  3ZEF A;  4JHR A;  3IV0 A;  5LCW C;  3HRA A;  3PNL B;  3KEA A;  3OXF A;  3LVQ E;  3TWT A;  1NP7 A;  1A5E A;  1TNY A;  3CEQ A;  3D9P A;  5ARG A;  2R2L A;  2M63 A;  1FVH A;  3DEO A;  4UI9 J;  1NI1 A;  3UXG A;  1ELW A;  2PM6 A;  4E85 A;  4HXI A;  3ABM E;  5FQ4 A;  2C0L A;  4WAF A;  4U8H A;  3CIA A;  3NBN B;  3ZUV B;  3GW4 A;  3MYV A;  2P9S G;  4CCA A;  5G05 C;  3DBS A;  3NOC D;  4DX5 D;  3ASH A;  4XE0 A;  2CFU A;  5KCM A;  5FJY A;  4NQ0 A;  4PS8 A;  1D8D A;  4RLY A;  3C3R A;  2LXM A;  4HNA D;  2ZGG A;  3PE4 A;  4GZ3 A;  2BF0 X;  4EEC A;  2RD0 A;  1TYQ G;  4CGW A;  3ZRH A;  3FU3 A;  4KXK B;  5CRU A;  3PVL A;  3VLE A;  4GA0 A;  4D10 C;  4GYY A;  4HRM B;  2R17 C;  4WNE A;  2J9Q A;  1K1B A;  5IY5 E;  1OWP A;  3NAW A;  3B7R L;  1P5Q A;  3NQP A;  4ZFH A;  3QWW A;  3TGO A;  3J5Q B;  3ZIM A;  4W9R A;  1N94 A;  2WPV A;  4J6I A;  4RSY A;  3MKQ B;  1YCS B;  4GTO A;  4ILG A;  1OWO A;  3SBS A;  4L23 A;  2WB2 A;  2BKK B;  3V2O A;  1EYH A;  2R5S A;  5LFA A;  4MLP A;  3FUF A;  3CVN A;  5FTP A;  4L2Y A;  3CVX A;  2YHE A;  4GZD A;  3RAU A;  2PZI A;  4GTS A;  3HDX A;  3Q9U C;  2AW6 A;  1NL4 A;  4PUC A;  3UKU G;  5EYP F;  3HXD A;  4I2W A;  2C0M A;  3HYM B;  3AG2 E;  1PAQ A;  4U0S A;  4K03 A;  2J4B A;  3U66 A;  3CVP A;  5CMY A;  1TJF A;  3E4B A;  3TJP A;  3FU0 A;  3DST A;  3OTN A;  2X38 A;  5DIZ A;  4HOT A;  4L9P A;  3IBE A;  5BPP A;  4PH4 B;  4AV7 A;  5CEC B;  1MX2 A;  1O1R A;  4U96 D;  2ZIS A;  2IOL A;  2X6K A;  2H6H A;  4EZJ A;  1S64 A;  2IY0 C;  3ASO E;  3N71 A;  1HXI A;  4BX8 A;  2WXJ A;  4N3C A;  3EIJ A;  2F0Y A;  2Y1L E;  5AJD A;  4HLL A;  4FHK A;  3FTS A;  2XGO A;  3CK7 A;  5HKP A;  3PRE A;  2CG2 A;  3ENE A;  4OVU A;  4AVX A;  1IYG A;  4OAV B;  1JCQ A;  1DCE A;  2OOE A;  2EIK E;  5CBO A;  4ANU A;  4XKC A;  4XEI G;  3AG1 E;  4DI3 A;  3QWV A;  3FUL A;  1GW6 A;  5H7P A;  4U8Y D;  4CDM A;  1FT1 A;  3EJN A;  4LNU D;  1EDU A;  3E37 A;  3IHY A;  4RQI A;  3U64 A;  3FTY A;  2C2L A;  4NAC A;  3TL5 A;  4BET A;  4J8D A;  3PZD A;  4N3A A;  3SO8 A;  2VGX B;  5HI7 A;  4XX5 A;  3C5R A;  1HO8 A;  3IXE A;  3CHO A;  2GRQ B;  1S70 B;  4F1S A;  3ONK A;  1N52 A;  4EBA G;  3ZHE B;  5ANR A;  3L13 A;  2DVW A;  4U0Z A;  4JD2 G;  1ELR A;  1HG5 A;  1LD8 A;  3CSF A;  3LYA A;  1WDY A;  2GRP B;  2IO3 C;  2XZT G;  4UI9 K;  4G2V A;  3CV0 A;  3LDZ A;  3D9O A;  4CDR A;  1QBQ A;  3Q49 B;  5D0Q D;  1N0Q A;  2DIW A;  2P9I G;  4O1P A;  2I2O A;  5T4Y A;  3FUD A;  4KZC A;  3U3W A;  1TNU A;  1FT2 A;  2EIL E;  4URK A;  4HLE A;  4U7E B;  1WY6 A;  4FJY A;  2DBA A;  1MJ0 A;  4BEP A;  1YYH A;  3SFX A;  4TXR A;  5HQ8 A;  1MYO A;  1H19 A;  3HHM A;  5BW8 C;  3AS8 A;  4TV3 A;  1OCR E;  1K3Z D;  2Y69 E;  3PEU B;  4EPZ A;  2NC9 A;  3UKR G;  2V5Q C;  1TN6 A;  1QZ2 A;  4LER A;  5AQA A;  4I9E A;  4U8V D;  1N4Q A;  4JA9 A;  3DXM G;  4V3I A;  3L16 A;  5D0O D;  3JQ1 A;  2MYO A;  2PL2 A;  4HRN A;  3ZVV A;  5AYW D;  2LUH A;  5FIO A;  3ZYQ A;  3JCK C;  3D9I A;  4CRW A;  1UW4 B;  3S7D A;  3HG0 D;  4XI9 A;  2IU1 A;  5JHB A;  4GA1 A;  4BX9 A;  4U0U A;  4EZL A;  5ITZ F;  3SFY A;  2LAI A;  5C2Y A;  4I1M A;  5FT9 A;  4DX7 D;  2A5E A;  3U9W A;  2H6F A;  4NUR A;  2J8S D;  1N95 A;  4C0E A;  5G05 J;  2V0P A;  3CR3 A;  1IHB A;  2F8Y A;  4APO A;  2ION A;  2CG3 A;  2DYS E;  2MRI A;  4PS3 A;  4RG6 A;  4FLH A;  1OWL A;  1H6P A;  3AU4 A;  3GZS A;  3FUN A;  5EN5 D;  4M7C A;  2RFM A;  4KMO A;  3BUA A; 
#chains in the Genus database with same CATH homology
 3CQC B;  3DBS A;  3PUJ A;  2WM9 A;  4ANW A;  3Q15 A;  1FVF A;  3MKQ A;  3ASH A;  2J07 A;  4XE0 A;  2J4D A;  4RG9 A;  3AU5 A;  4N5C A;  2CFU A;  3D3M A;  4YND A;  5KCM A;  4B8A A;  2LNI A;  2MHK A;  5FJY A;  4IRU A;  4NQ0 A;  2LAH A;  3LVR E;  4PS8 A;  2AWI A;  3JYS A;  4TRQ A;  2QY7 A;  3MA5 A;  3UT7 A;  2WXI A;  4HOS A;  2KZT B;  2VGY A;  4KT6 B;  4GCN A;  3UX4 A;  3MCX A;  2KM4 A;  3PE4 A;  4JHK A;  4P29 A;  3ZYK A;  1Z3Y A;  5BT1 A;  4GZ3 A;  4G26 A;  3CKC A;  4YVQ C;  3SZ7 A;  3CK8 A;  2BF0 X;  3D9N A;  4GU5 A;  4OYS A;  4B0Z A;  2WXL A;  3CVL A;  4MRU A;  2RD0 A;  4EEC A;  4CGW A;  1H2V C;  2YIN A;  3ZRH A;  3FU3 A;  4KXK B;  1JWG A;  4AY6 A;  1U3D A;  3C98 A;  2HO1 A;  3PVL A;  3VLE A;  3CK9 A;  3UT4 A;  4JL0 A;  3QAR A;  4GA0 A;  4D10 C;  3DPD A;  4GYY A;  4I6G A;  3QNK A;  4FLB A;  3MEK A;  2R17 C;  4GPK A;  4WNE A;  1MHQ A;  3OXG A;  4DI4 A;  4DK5 A;  1UG3 A;  4A1S A;  2J9Q A;  2J08 A;  1OWP A;  2AVP A;  2NXP A;  4XI0 A;  3B7R L;  1P5Q A;  3NQP A;  4ATG A;  1L5J A;  2GRM A;  5AIJ A;  3QWW A;  2XEV A;  2PQN A;  3IHV A;  3TGO A;  3VLF A;  2XQ0 A;  3ZN3 A;  3CGH A;  3UMV A;  5KJM A;  3VLD A;  1BPO A;  3ZIM A;  5DBK A;  4W9R A;  4I1O B;  3RKV A;  4F7A A;  3KEZ A;  2IJG X;  5CMW A;  2WPV A;  3SNX A;  4J6I A;  4RSY A;  3MKQ B;  3FU5 A;  3S7F A;  2KZT A;  4CEM A;  4ANV A;  4FP7 A;  4MKT A;  4ILG A;  4BT8 A;  2WQ7 A;  1OWO A;  2V5F A;  1E96 B;  1HX8 A;  4GAA A;  3SBS A;  2XRY A;  3L22 A;  4ILH B;  4A55 A;  5BV0 A;  2GRL A;  4L23 A;  3L17 A;  2XPI A;  1E8X A;  2AXV A;  2WB2 A;  5ARF A;  4GYO A;  2WXG A;  1A17 A;  4GZ5 A;  1EYH A;  2FI7 A;  3CHM A;  5BNW A;  1QQE A;  2R5S A;  2KCL A;  1FCH A;  4AJW A;  5LFA A;  4MLP A;  1IQU A;  2X6F A;  4NRH B;  3FUF A;  4N3B A;  3CVN A;  4TUU A;  5FTP A;  4H7Y A;  2GGF A;  4L2Y A;  1HZ4 A;  3G2W A;  4FC8 A;  3Q5M A;  2KC7 A;  3CVX A;  3CKB A;  2YHE A;  3D9J A;  4GZD A;  2PZI A;  1QNF A;  4MS6 A;  3HDX A;  3I5P A;  2AW6 A;  4M3O A;  4PUC A;  3HVE B;  4I2Z A;  1E8Y A;  4BY6 A;  2PQR A;  3D9K A;  4I2W A;  3SGH A;  1SQM A;  2C0M A;  3HYM B;  4LRZ A;  1PAQ A;  3QB2 A;  2I9C A;  3LJ3 A;  4U0S A;  1OUV A;  3RO2 A;  5KJN A;  4WWP A;  3QKY A;  1EPU A;  4K03 A;  2J4B A;  2NSZ A;  1UJJ A;  3R9A B;  2V4L A;  2VJ8 A;  3UT8 A;  3U66 A;  3CVP A;  5CMY A;  1TJF A;  3TG4 A;  3E4B A;  1DVP A;  3S2A A;  5JJ6 A;  2VTB B;  3RRU A;  2OVB A;  2KCK A;  1JUQ A;  3FU0 A;  3FUH A;  4I9C A;  5LOZ A;  3TJP A;  5JJT A;  4PDX A;  4HFG A;  4J8E A;  2ZU6 B;  3MKR A;  5JJ7 A;  3OTN A;  4DJA A;  1ZU2 A;  3PE3 A;  3ESL A;  2X38 A;  4Y6C A;  4QFV A;  5DIZ A;  3FH8 A;  3LEW A;  5G04 C;  4HOT A;  3ZFW A;  4EQF A;  3L6A A;  3IBE A;  3QAQ A;  5JHA A;  5FQ8 A;  5BPP A;  5CCL A;  4PH4 B;  4AV7 A;  1S0P A;  1DNP A;  4XKB A;  1KT0 A;  5FZR A;  5J90 A;  3SD5 A;  2IOL A;  2X6H A;  2X6K A;  3T8M A;  4APF A;  2E2E A;  2A5U A;  2J49 A;  3MV3 B;  1N54 A;  3PDN A;  4GZ6 A;  4EZJ A;  2I1J A;  3TAX A;  1INZ A;  3URZ A;  3ASG A;  4U04 A;  4PS7 A;  3R7Q A;  1Z3X A;  3ZXS A;  3N71 A;  3TXM A;  2XRZ A;  1HXI A;  1EF1 C;  3GYZ A;  4BX8 A;  4Q69 A;  2WXJ A;  3PRZ A;  4I6E A;  2VSY A;  4N3C A;  3T5V A;  4UQX A;  3EIJ A;  4BFR A;  5KJL A;  3PUK A;  4I6J A;  3CVY A;  2CHX A;  3CVV A;  5AJD A;  3OXL A;  2BUG A;  3UQ3 A;  3QK0 A;  1HE8 A;  4FHK A;  4UWH A;  2JEK A;  4JXT A;  3FTS A;  3FUK A;  4B94 A;  2XGO A;  4UWG A;  3CK7 A;  4FUL A;  4Y6W A;  3CHQ A;  3PRE A;  2CG2 A;  3FEX A;  3ENE A;  1Y6I A;  2WXR A;  2XGM A;  4OVU A;  3RRM B;  1KT1 A;  5A6C A;  2HM8 A;  2WMO A;  5E75 A;  4AOF A;  4AVX A;  3CVQ A;  2L9B A;  1IYG A;  3MZL B;  3Q4A B;  2XPZ A;  3G2U A;  3P1U A;  2AXZ A;  4UWL A;  2IFU A;  2OOE A;  4JZY A;  4JA7 A;  3EDT B;  2LO6 A;  4LEU A;  5FQ7 A;  3FU6 A;  4KVO A;  3K9I A;  2KAT A;  1WM5 A;  3MJW A;  4IUL A;  2XCC A;  4G25 A;  4XKC A;  5ENN A;  4ANU A;  3B7S A;  2HYZ A;  3I4G A;  4DI3 A;  3LCA A;  3QWV A;  2WXH A;  2IOS A;  2XHE A;  4KYO B;  3FY4 A;  4J0U A;  2P58 C;  3FUL A;  4CT4 A;  3SI5 A;  5BUZ A;  1KLX A;  3RJV A;  5M72 A;  4O6F A;  4B8C B;  3LS8 A;  1OWM A;  4DLO A;  4E6H A;  2FEZ A;  2WXK A;  2WXP A;  1GW6 A;  4HS2 A;  4CDM A;  5A23 A;  4AM9 A;  3EJN A;  2RG8 A;  2I1K A;  3AS4 A;  1EDU A;  5T3R A;  3L54 A;  3B7T A;  3IHY A;  3ML9 A;  3D9M A;  3UUX A;  4C9B B;  2YNQ A;  3CST A;  2DCP A;  3U64 A;  2EQX A;  3FTY A;  4ACK A;  2C2L A;  3RK6 A;  3GZ2 A;  3B7U X;  5CHE E;  4NAC A;  3VTX A;  1XNF A;  4BTA A;  3ML8 A;  3G2V A;  3EIQ C;  1H0A A;  4FU3 A;  5T8I A;  3TL5 A;  4UWK A;  2FF4 A;  1X5B A;  1UJK A;  4J8D A;  3PZD A;  5E76 A;  4N3A A;  3O4Z A;  3ZGQ A;  4Q94 A;  4L7T A;  4FHJ A;  4WNG A;  3APF A;  3RU0 A;  3MGB A;  4I43 A;  2VSN A;  2LSU A;  5CCM A;  2OVF A;  1E7U A;  2VGX B;  5HI7 A;  3T5X A;  3TG5 A;  3SFZ A;  4ABN A;  2Q7F A;  4I17 A;  4BTB A;  1OWN A;  2CHZ A;  4FJZ A;  4WNF A;  4XX5 A;  4IYP A;  1PY1 A;  2WXO A;  1NA3 A;  5G04 J;  3ZPJ A;  3RO3 A;  2ILR A;  2LSV A;  3QDN A;  1YA0 A;  5A7D B;  2FBN A;  1HO8 A;  5J08 A;  4IN3 B;  3FTV A;  3CHO A;  4JC8 A;  4HOR A;  4F1S A;  2X3M A;  4KVM A;  3ONK A;  4AXH A;  4N39 A;  2UY1 A;  2WXF A;  3ESK A;  1N52 A;  2VYI A;  4KZ0 A;  4EBA G;  3ZHE B;  3G2T A;  4G23 A;  5ANR A;  3L13 A;  1HG2 A;  3QOU A;  4JEU A;  3VTY A;  2WXM A;  4JEH A;  3L08 A;  2Y3A A;  5LCW J;  4U0Z A;  1HFA A;  3CVW A;  4B89 A;  3IEG A;  1ELR A;  1HG5 A;  2GW1 A;  3CQG B;  3FUJ A;  4GYW A;  4LCT A;  2FO7 A;  3JQ0 A;  2UWJ G;  4ME2 A;  3CSF A;  3I4R B;  3LYA A;  3HIZ A;  2Y4T A;  1WAO 1;  1UN8 A;  2YQ8 A;  4UI9 K;  4G2V A;  2CFZ A;  3LPZ A;  3CV0 A;  3LDZ A;  2J09 A;  2VSX E;  3D9O A;  4CDR A;  3FWV A;  1W3B A;  2XPY A;  5EX3 A;  4DLQ A;  3D9L A;  3FH5 A;  1SZ9 A;  2CHW A;  1JWF A;  2UY1 B;  4G24 A;  3Q49 B;  4XZ4 A;  5D0Q D;  4YVO A;  2L6J A;  4L1B A;  2DIW A;  1PC2 A;  2WXQ A;  3O48 A;  4AP2 A;  2I2O A;  2XCB A;  3JUI A;  4UQZ A;  5T4Y A;  3SHF A;  4F53 A;  4EZK A;  3FUD A;  4K0R A;  3NZS A;  3B13 A;  1HU3 A;  4KZC A;  3APC A;  3U3W A;  4N2Q A;  2MOW A;  4URK A;  1Y8M A;  4HLE A;  4UQY A;  4CT0 A;  1WY6 A;  1TEZ A;  4OVV A;  4A1G A;  4BSX A;  4FJY A;  4HOU A;  2L0T B;  4ACL A;  1H6K A;  2DBA A;  3Q47 B;  4FA6 A;  3LXU X;  4AIF A;  5AJL A;  5HQ8 A;  4JW1 A;  4HVB A;  5FZQ A;  1HF8 A;  3BEE A;  1JPL A;  2I6H A;  1H19 A;  3P2B A;  4UI9 C;  3HHM A;  1HH8 A;  5BW8 C;  3AS5 A;  4U63 A;  3AS8 A;  4TV3 A;  4WUY A;  4WWN A;  3ZHE A;  5LX8 A;  3PS6 A;  3PEU B;  4EPZ A;  1TJC A;  2NC9 A;  2Y4U A;  1QZ2 A;  2WMN A;  4HOQ A;  3FDH A;  4F3V A;  3ZYL A;  4LER A;  4J8F A;  2R59 A;  3WXX A;  4GZC A;  3APD A;  4GML A;  4GA2 A;  4I9E A;  3MV2 B;  2JLB A;  4JA9 A;  2VTB A;  2PM7 A;  2YHC A;  4V3I A;  4I1A A;  4H7X A;  4CGV A;  3FTU A;  3S7J A;  4WND A;  5KJK A;  2VGX A;  4WWO A;  5G55 A;  3FTZ A;  3L16 A;  5D0O D;  4A3V A;  3JQ1 A;  4ANX A;  5AEN A;  4GCO A;  3LY7 A;  1UN9 A;  3CHR A;  3LY9 A;  1LF8 A;  2PL2 A;  3EHM A;  2WXN A;  4GB9 A;  2BTD A;  2VSO E;  3ASF A;  3ZVV A;  1E90 A;  3LKU A;  3BG0 B;  5EDS A;  5AYW D;  1NZN A;  2QFC A;  2XGS A;  4L2L A;  4KBQ A;  3ZYQ A;  4AY5 A;  5FWQ A;  3IKO B;  3QC1 A;  3JCK C;  3BG1 B;  3GZ1 A;  2E0I A;  2L0I A;  3D9I A;  4CRW A;  3ONL A;  3UPV A;  3U4T A;  5EKQ D;  1MQS A;  3FTX A;  1ZBP A;  2IQC A;  5EX0 A;  1UW4 B;  1Z6T A;  3LY8 A;  3QWP A;  5FQ6 A;  2AXU A;  3KS2 A;  3S7D A;  3NF1 A;  2OND A;  4XI9 A;  4FAD A;  2IF4 A;  2IU1 A;  3EHN A;  4BT9 A;  3FP3 A;  5JHB A;  3R7R A;  1E8Z A;  3FFL A;  3KAE A;  4J8S A;  5ANL A;  1NA0 A;  3RRN B;  2X6J A;  4GA1 A;  1SZA A;  4AEZ C;  3ZW3 A;  1VDY A;  1ELK A;  1U3C A;  3FEY A;  3KD7 A;  4Q96 A;  4JHJ A;  3S7B A;  3PNT B;  4CDN A;  1IQR A;  3ZEF A;  3PH0 C;  4JPS A;  3SBT B;  3CHP A;  4JHR A;  4A3T A;  4BX9 A;  3CLJ A;  3MX3 A;  3IV0 A;  2X6I A;  1H2T C;  4ILI A;  4U0U A;  5LCW C;  2V8S E;  3PNL B;  5LP0 A;  2VQ2 A;  5G2N A;  4DPR A;  3OXF A;  4EZL A;  4C0M A;  3LVQ E;  1E7V A;  3ASD A;  4R7L A;  1NP7 A;  4GMJ A;  4N2S A;  2A4Z A;  2LAI A;  4G1T A;  3CEQ A;  5C2Y A;  3SF4 A;  3D9P A;  2HR2 A;  5ARG A;  3G2S A;  2OV8 A;  3FHE A;  3TXN A;  3FTW A;  2M63 A;  4I1M A;  5FT9 A;  5C1D A;  3QJZ A;  1FVH A;  1B89 A;  5BV1 A;  3FH7 A;  3FUI A;  3U9W A;  4UI9 J;  1H2U A;  2KCV A;  3RIB A;  4NUR A;  1ELW A;  2WQ6 A;  2PM6 A;  4RVB A;  3I3N A;  4G11 A;  1HS6 A;  4C0E A;  5FZS A;  5G05 J;  4E85 A;  4HXI A;  3CHS A;  2V0P A;  5FQ4 A;  3NZU A;  2C0L A;  3CR3 A;  3HVE A;  4APO A;  2ION A;  4JVS A;  4EBA A;  4WAF A;  1XGW A;  3ULQ A;  2CG3 A;  1E8W A;  2MRI A;  3OAW A;  4PS3 A;  4LUN U;  3FUE A;  3CVU A;  4RG6 A;  4UWF A;  2FUL A;  4FLH A;  1OWL A;  2WVI A;  4U8H A;  3CIA A;  2WQH A;  3PEV B;  4BWR A;  3AU4 A;  3GZS A;  3FUN A;  3GW4 A;  3MYV A;  4U07 A;  3ZYM A;  3FUM A;  4CCA A;  4KMO A;  5G05 C;  1IHG A;  4XIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...