4CGVA

First tpr of spaghetti (rpap3) bound to hsp90 peptide srmeevd
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
125
structure length
125
Chain Sequence
b'HVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA POLYMERASE II-ASSOCIATED PROTEIN 3
publication title Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 50
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cgvA00
3TGOA 4YVOA 5JJTA 5LCWJ 1ZU2A 2E2EA 2WPVA 2VGXB 3LY9A 2XCBA 4WNEA 3ZPJA 3PE3A 3QKYA 3N71A 3QDNA 4UQXA 4YNDA 3CKBA 3Q4AB 5FT9A 4JA7A 3PE4A 3VTYA 5DBKA 4GPKA 2PQRA 2GW1A 1Y8MA 1KT1A 5G05J 2KC7A 4B94A 3OXGA 3UPVA 1NA0A 3RIBA 3ZGQA 4HOQA 3ZN3A 3K9IA 2QFCA 4KYOB 2FBNA 3O48A 4WUYA 3GYZA 4AY6A 4N3CA 4N3AA 3ZHEA 4JA9A 2XPIA 4IN3B 2XCCA 4UI9C 2XEVA 3ZHEB 4U07A 3AS5A 3ASDA 4W9RA 4UQZA 3U3WA 1QQEA 2HR2A 2C0MA 1W3BA 3LY7A 3CK9A 4I17A 5JJ6A 2Q7FA 1A17A 3FFLA 3MV3B 5JJ7A 4NQ0A 3JYSA 2KATA 3CVLA 4GZ6A 3OXLA 5G04C 2IFUA 4N2QA 3S7BA 4NRHB 1NA3A 1ELRA 4F3VA 4GZ5A 3RU0A 4KXKB 2FO7A 5HQ8A 3UUXA 5CCLA 4UI9J 3KAEA 4G2VA 5EX0A 2LNIA 2XGMA 2Y4TA 4GA2A 2XGSA 1ZBPA 4XI0A 3QOUA 4XI9A 4BT8A 2WQHA 3KD7A 3ASGA 4G25A 5FTPA 4GYWA 2HYZA 3QWVA 4HORA 2BUGA 1QZ2A 2VGYA 1HZ4A 3FP3A 3LCAA 4N39A 3OXFA 3HYMB 3U4TA 3Q5MA 5AYWD 4GA0A 3VTXA 2VYIA 2KCKA 4GZ3A 3AS4A 5G04J 4G23A 4UQYA 4EQFA 4LEUA 3MV2B 5FZQA 4I9CA 4AM9A 2YHCA 3PDNA 2UY1A 2DBAA 3LY8A 3KS2A 4N3BA 5KJKA 5M72A 4U0ZA 4J8DA 2PL2A 3Q49B 4I9EA 1PC2A 5A7DB 4BT9A 1P5QA 3S7JA 2KCVA 1HXIA 4WNFA 4UI9K 4CDRA 4G1TA 1HH8A 3LPZA 4CGWA 5BW8C 3RO3A 5D0QD 2L6JA 3S7FA 4GA1A 5A6CA 4HOTA 4JHRA 2YQ8A 2C0LA 3LKUA 4Y6WA 4N5CA 3R9AB 3CEQA 5KJMA 3SF4A 3Q15A 3WXXA 5ARGA 3LYAA 3MA5A 2JLBA 4G24A 3NF1A 5FJYA 4GCOA 4YVQC 4CGVA 2VSNA 5BT1A 4GYYA 4ABNA 4U0UA 5DIZA 1IHGA 1XNFA 2I6HA 3TG4A 3CK7A 4U04A 2UWJG 5HI7A 4AIFA 5FZRA 3ESKA 3MEKA 3RO2A 4XIFA 4BWRA 4A1SA 3FWVA 2KCLA 1E96B 3BEEA 5EX3A 2VGXA 2NC9A 4AY5A 5ARFA 3CVPA 2OOEA 4I2WA 2IF4A 4WNGA 2R5SA 3ZFWA 3EDTB 4BTAA 1TJCA 5CHEE 4BTBA 1WAO1 4J8EA 4APOA 2J9QA 4JL0A 3E4BA 3ULQA 3QWPA 2XGOA 3IEGA 4I2ZA 3SZ7A 4ME2A 5KJLA 1WM5A 3CK8A 3RJVA 3CVQA 2UY1B 2VQ2A 5D0OD 5KJNA 1B89A 2PQNA 2FF4A 4H7XA 1IYGA 2MHKA 3URZA 3TG5A 4J0UA 4H7YA 3RKVA 2FI7A 4HOUA 2V5FA 3QWWA 4KBQA 1KT0A 1YA0A 4U0SA 5LCWC 3AS8A 4N2SA 3Q47B 2ONDA 3S7DA 4Y6CA 1OUVA 1FCHA 2LSUA 3CV0A 3GZ2A 2P58C 4RG6A 2AVPA 5BNWA 4GYOA 4G26A 5CCMA 2HO1A 2LSVA 4RG9A 1NZNA 4O6FA 3ASFA 3GW4A 3CKCA 4HOSA 2PZIA 3UQ3A 2C2LA 3MKRA 3TAXA 5C1DA 4I1AA 3GZ1A 4J8FA 2Y4UA 3CVNA 4WNDA 1KLXA 5G05C 1ELWA 4GCNA 5FZSA 5EKQD 3ASHA 2VSYA 2FEZA
chains in the Genus database with same CATH superfamily
3D9LA 5HS0A 3TGOA 3ML9A 4YVOA 3Q78A 3MGBA 2AXZA 2L0TB 2CHZA 2GRPB 4WNEA 4J8SA 3ZPJA 3B95A 4L2YA 2DZNA 4YNDA 4C0MA 4CRWA 5D66A 3DSXA 2WXGA 4NURA 4C9BB 4GPKA 3D9HA 2PQRA 2GW1A 1DC2A 1KT1A 3IHVA 3OTNA 4FLBA 1EPUA 3PZ3A 4DX2A 2WXJA 3ASNE 5EIBE 3ZN3A 3C3QA 2QFCA 4MLPA 3JQ0A 3O48A 2BKKB 4JA9A 1TN7A 3BUAA 2F37A 5FIOA 2XRZA 2GRMA 2V0PA 4YDWA 3ZHEB 1U3DA 3OAWA 1HO8A 3AS5A 2A5UA 2A5EA 4W9RA 2CFUA 4UWFA 3FTVA 2HR2A 4HRLA 4JHKA 2MRIA 4YDOA 3GZSA 1A17A 3FU0A 2J08A 2IU1A 1H6KA 3LJNA 5AQAA 4DX6D 4HVBA 3SGHA 4F7AA 2WXOA 5J90A 1AP7A 2CG2A 3CVLA 1E8WA 1NA3A 2OVFA 3NOCD 4KXKB 5HQ8A 3AG4E 3X2QE 1TJFA 2DIWA 4A3TA 1HU3A 2AXVA 3R7QA 1UG3A 2J09A 1TEZA 3CHPA 2LAIA 3MYVA 4HI8A 4F6RD 5E75A 2XGSA 2NXPA 4XE0A 5AJDA 4XI9A 3PZ2A 3U66A 4WWNA 4G25A 3EU9A 2R03A 2HYZA 4JXTA 2CG3A 4IRUA 1YYHA 1QZ2A 3FP3A 1OCZE 1YMPA 3LCAA 1E90A 3ENEA 1GW6A 4N39A 4HLEA 1XGWA 5LFAA 3CVVA 5AYWD 4GA0A 3VTXA 2KCKA 3SBTB 3AS4A 4G23A 3P1UA 4AOFA 4UQYA 3AJIA 1N95A 4LEUA 2J4DA 4I1OB 3B13A 3FH5A 3IBEA 4JPSA 5AQ7A 2DBAA 3LY8A 3ZVVA 3ZW3A 4BETA 5JA4D 1OWLA 3PEUB 5AENA 2XEHA 3CLJA 1NI1A 2KXPC 3EHRA 4GTMA 4L2LA 2RKKA 3UIOC 4I43A 4BT9A 1FVHA 3SFXA 1BPOA 4G1TA 1HH8A 5HRYA 1H2UA 3S7FA 1DCEA 3PUKA 4GA1A 4HOTA 3APDA 4JHRA 3ZEFA 2XZTG 3ESLA 4EBAG 4FJYA 2Y3AA 5JHBA 4ACLA 2X3MA 2OCCE 3RRNB 3E33A 1K3ZD 4XKBA 3CEQA 1O5MA 5KJMA 1FPPA 3Q15A 2WXQA 2HE0A 4G24A 5FJYA 4GCOA 4CGVA 2VSNA 4CYMD 3C98A 4V3IA 3T8KA 3AAAC 4QFVA 1MZCA 4GYYA 5CERB 3KEAA 4ABNA 4GTRA 1E8XA 4FJZA 4GTSA 1Y6IA 4ANVA 5ANLA 3TG4A 3DEPA 3L13A 3L54A 3CHMA 5HI7A 3UIPC 3LXUX 3Q7AA 1JWGA 3HDXA 4XEIG 1EF1C 2I1JA 4F1PA 5ARFA 3I4GA 4L1BA 3V2XA 3FUEA 2X38A 2LO6A 3EUVA 4LG6A 2R5SA 3EDTB 5T4YA 3DPDA 3JUIA 4TXQA 4JL0A 3ULQA 4EZKA 5G55A 2I9CA 4U63A 4ME2A 3T5VA 4HLLA 3MZLB 3UI2A 3NZSA 2X6FA 3PRZA 3CK8A 4GMJA 4KVMA 3DSVA 2VQ2A 5KJNA 4R7LA 3PREA 5LOZA 4LSZE 3NBNB 4H7XA 2DCPA 4Q69A 2LAHA 1IYGA 2RFMA 3HRAA 4X8QA 5EDSA 5CBOA 3QAQA 2V5FA 3ZRHA 3CQCB 3VLFA 4KBQA 5KNHD 3DWLG 1YA0A 4RLYA 2ZISA 5LCWC 3AS8A 2P9NG 4BFRA 3LEWA 2V4LA 3KSQA 3UXGA 4RG6A 2B0OE 3E34A 4KZ0A 3P2BA 3DPYA 2LSVA 3HXEA 2PZIA 3FULA 2CHWA 2R17C 4J8FA 2XPZA 4WNDA 4BX8A 1H6OA 1KLXA 4J7WA 5G05C 2IQCA 1ELWA 4GU5A 3ASHA 2FO1E 2VSYA 3FUNA 4JVSA 4LRZA 2WXNA 1OWPA 5JJTA 4K5AB 1ZU2A 2E2EA 2WPVA 2OEWA 3LY9A 2GRLA 2XCBA 4A1GA 1NFIE 3DSUA 2MOWA 2I1KA 3N71A 3ZYQA 3QDNA 4EZLA 5FT9A 1MJ0A 4JA7A 4FC8A 4GTOA 3SI5A 4K5CA 3RK6A 3ULEG 3FUIA 1OCRE 4JB8P 3FUFA 1E7VA 3HHMA 1Y8MA 4HNAD 2KC7A 1FT2A 3UPVA 5B1AE 3RIBA 1V55E 2R59A 4DX7D 1DNPA 4KT6B 3K9IA 2EIME 4KYOB 3CIAA 3CHOA 3LS8A 4F53A 4PUCA 1TN8A 4M7CA 4N3CA 4AY6A 4E6HA 1LF8A 3ZHEA 3BQOA 1OT8A 2WM9A 3MCXA 4IN3B 3DXMG 4UI9C 5ENSD 2XEVA 4FHKA 1SW6A 3QB2A 4U07A 3PNTB 5JMND 3U64A 3IV0A 3U3WA 3VLDA 1QQEA 3B7SA 3LY7A 3UM0A 4GTQA 4GMRA 3TWVA 2DVWA 5FQ7A 3CK9A 4PH4B 3RRMB 4HRNA 3FH8A 1AWCB 3TWSA 1A5EA 2LXMA 3PVLA 4F1SA 5ENRD 3ONLA 4YDYA 3JYSA 3PH0C 4AV7A 4G11A 3IHYA 3OXLA 5G04C 1X5BA 3C72A 3S7BA 1H6PA 4NRHB 3RU0A 2WXRA 3IKOB 2CHXA 3PZ1A 3KAEA 4I6GA 1HG5A 3TL5A 4G2VA 4CEMA 3UT7A 2QYUA 5EX0A 2CFZA 2Y4TA 3UM1A 2IO3C 3Q9UC 2XS8A 3QOUA 5J08A 3UM3A 4BT8A 1X81A 2ETAA 3KD7A 4GMLA 3ZXSA 3UT8A 5FTPA 1EYHA 4DI3A 3DBSA 1HZ4A 2WXKA 4B8AA 3LDZA 4MKTA 2ZU6B 3L16A 3TWRA 2VYIA 2R05A 5CRVA 2AWIA 2V4HC 5FQ4A 5FQ6A 2XS1A 3CSTA 5FZQA 4I9CA 3FEYA 4JD2G 2YHCA 5BXOA 2LXLA 2XQ0A 4MRUA 2WMNA 4IYPA 3CHRA 3DSWA 5KJKA 4KVOA 4AEZC 1JCQA 4U0ZA 2XENA 4CDMA 1QYMA 3QARA 4A55A 3AG3E 1OCOE 2KZTB 4U7EB 2KCVA 3S7JA 4CDNA 4WNFA 4UI9K 4LNUD 5T3RA 4CDRA 3LPZA 2BF0X 5CEDB 3LJ3A 5AQ9A 4K0RA 4J6IA 2L6JA 4B8CB 4URKA 5ENTD 3ONKA 2C0LA 3LKUA 4P29A 2P9LG 1H0AA 1V54E 3TXMA 4XX5A 3NF1A 1K1AA 3HXBA 3SY2A 2QC9A 5BT1A 3V79K 3T9KA 3DSTA 3ZIMA 1OXJA 3FTWA 4GZDA 4ILIA 5DIZA 4WAFA 5KBAA 4EPZA 2UWJG 5AQBA 2P9KG 1OWNA 2GRRB 3ESKA 3MEKA 4UWGA 3ZYKA 4BWRA 2IONA 4GZCA 2KCLA 1E96B 5EX3A 2ZGDA 2VGXA 5BV1A 2NC9A 2I2OA 2EIJE 2IF4A 3APCA 4HFGA 3UINC 2Y1LE 4XKCA 3TJPA 3ZFWA 1HF8A 1KZPA 4AVXA 3APFA 4Q96A 5ENPD 4BTAA 2PM7A 2V8SE 3CVYA 3UT4A 2YHEA 3UTMA 1TN6A 2QYJA 1MQSA 4TUMA 3R9MA 2WXPA 2GROB 3ZU7B 2FF4A 3E30A 3D9OA 4DX5D 4KZCA 5AARA 5KNGA 4EECA 3TWQA 4RSYA 4QQIA 3SFZA 2OV8A 4J0UA 4HOUA 2P9SG 3QWWA 1JUQA 3D9PA 3D9KA 1KT0A 3CGHA 3PEVB 4Z68A 3DEOA 1WDYA 1FCHA 3E32A 2J8SD 4FLHA 3CV0A 3ABKE 3C3OA 4G26A 4PS8A 2GGFA 3QK0A 4AXHA 3WG7E 3ASFA 3DRAA 1FT1A 3TAXA 4FHJA 3GZ1A 5G2NA 4JZYA 4YDEA 4ANUA 3SQVA 5FZSA 3UM2A 4L23A 3CR3A 3D9JA 3FTYA 2FEZA 5AIJA 1N9AA 2WMOA 4B89A 4WWPA 3EHQA 1HS6A 4FADA 4PDXA 3LVQE 2VGXB 4C48B 4L7TA 3HG0D 2P2CP 2YINA 3PE3A 1H2TC 2P9UG 2ZXWE 3CKBA 5A23A 3Q4AB 3G2VA 3ZXPA 2J07A 3PE4A 2Y69E 4B93B 4BY6A 3FTXA 3RAUA 1IQUA 1UN8A 4B0ZA 3Q79A 3JXIA 1TNUA 2A4ZA 4B94A 3OXGA 4CT4A 3ZGQA 4HOQA 1K1BA 1Z3YA 1N4RA 2R2LA 2EINE 2FBNA 2QY7A 3QC1A 1H19A 5D2MC 2VSOE 4N3AA 3I5PA 2XPIA 5FINA 4G8LA 2XCCA 3MKQA 2XZDG 3W9FA 1Z6TA 3CVUA 2F8YA 5AN8A 3AU5A 1SA5A 1G3NB 2C0MA 1W3BA 2EIKE 3L22A 4LUNU 4HBDA 3B7BA 4I17A 2DZOA 5JJ6A 2Q7FA 3FFLA 4FULA 3FTSA 4NQ0A 4DLQA 3BG0B 2GRQB 3RRUA 4XZ4A 2M63A 3EIQC 2KATA 3PNLB 3ZNGA 4LCTA 2FO7A 2XHEA 3Q75A 2V5QC 3FUDA 2AJAA 1BLXB 2LNIA 3Q7FA 2L6BA 4BESA 3PUJA 4GA2A 2X6IA 3NQPA 5FQ8A 2WQHA 3G2WA 2XRYA 5IY5E 3NB2A 1OY3D 4GYWA 4BSZB 4HORA 1MX2A 5CECB 4EHMA 4BSXA 2PNNA 5ENOD 2BUGA 3SHFA 5ENQD 1Z5SC 1BD8A 3HIZA 3OXFA 4GTTA 4HRMB 3U4TA 4WWOA 3FU6A 4GZ3A 1N4SA 5EYPF 1RW2A 5HKPA 4DPRA 1N94A 2H6HA 1BU9A 3PS6A 4DUIA 1IXVA 4TXPA 4EQFA 1U2VG 1DCQA 4AM9A 2WXLA 2YNQA 3PDNA 2UY1A 5BUZA 2AXUA 3V30A 2KZTA 5M72A 4JC8A 3ASOE 1E8YA 4A63B 4CCAA 2PL2A 4I9EA 1PC2A 3Q9NC 1P5QA 1Z3XA 3MX3A 1FVFA 1N4PA 3MKQB 4CGWA 3AG1E 2IOSA 3S2AA 2VTBA 3RO3A 4FA6A 4U95D 4RQIA 4GTVA 3FEXA 3VLEA 1UJKA 2L9BA 3CHSA 2ZIRA 3W9GA 2YQ8A 2WVIA 2J49A 4Y6WA 4JEHA 2VGEA 1MX4A 2DYSE 2LUHA 5KCMA 3FHEA 3LYAA 1OCCE 3MA5A 2JLBA 3TXNA 2X6KA 1HG2A 3T5XA 4YVQC 2ETBA 2X6JA 1OWMA 4U0UA 3L82A 4O60A 3E37A 1BI8B 2I6HA 3CK7A 5H7PA 5B3SE 4U04A 1N0QA 4AIFA 2MYOA 3RO2A 1N54A 3FTZA 2XEEA 4U96D 4A1SA 4HS2A 4C0EA 4UWLA 2VSXE 3FWVA 3BEEA 3L9TA 4AY5A 1N11A 1VDYA 1SQMA 3R7RA 4I2WA 3Q73A 1O1SA 1U3CA 2NYJA 2GRNB 1HX8A 4OAUC 1NL4A 4K03A 3EHMA 1QBQA 5CHEE 2WXIA 4BTBA 2ILRA 4APOA 4ACKA 4PS7A 4Q94A 4TRQA 1WY6A 4ZFHA 2JABA 2XGOA 4I2ZA 3SZ7A 3ML8A 5KJLA 3CQGB 1WG0A 4NACA 4HQDA 3CVXA 3TWTA 3RJVA 1OWOA 3D3MA 2UY1B 5D0OD 1SZ9A 1B89A 2PQNA 1INZA 1TNOA 3ABLE 4MS6A 3D9MA 1UW4B 2MHKA 5ANRA 4OAVB 2F8XK 3TG5A 3L17A 3KSLA 3ABME 1JCSA 4DX1A 4LERA 3AU4A 2RG8A 4J8YA 1LTXA 5B1BE 3J5QB 3NZUA 2VTBB 4U0SA 4U8HA 2FULA 4N2SA 2ONDA 2LSUA 4O1PA 3B7UX 4KMOA 4DJAA 4M3OA 3GZ2A 2P58C 1ZB1A 4JW1A 4OVUA 1S0PA 5CBNA 2AW6A 3PZ4A 5CRUA 4A3VA 5CCMA 3B7TA 2PM6A 2HO1A 1NZNA 4O6FA 4PS3A 1L5JA 3CKCA 4HOSA 4EZJA 2C2LA 5AJLA 4I1AA 2WB2A 3CVNA 4GB9A 2IJGX 4TUUA 1O1TA 3CSFA 4GCNA 2QZAA 3ZYMA 5EKQD 3D9IA 3ZKJA 4FU3A 2H6GA 5CEAA 3FTUA 4GTPA 5LCWJ 4MBGA 4LNBA 2WXFA 3IXEA 3QKYA 2H6FA 3FUJA 4UQXA 5EN5D 4GAAA 4HI9A 1UOHA 2JEKA 2R02A 3ISMC 1N52A 3VTYA 3MJWA 2E0IA 5DBKA 4O1OA 5G05J 1DVPA 4DI4A 2P9IG 4I1MA 1NA0A 1D9SA 3FUHA 3TWUA 4ANXA 4WUYA 2OVBA 3GYZA 3CVWA 1PAQA 1O1RA 1KPSB 4ZHBA 2F0YA 4BERA 4HB5A 4N5QA 2KM4A 1E8ZA 1HFAA 3ASDA 1MYOA 4UQZA 5EILA 5T8IA 5KWDA 2B6CA 1LD8A 3ULYA 3G2UA 4JHJA 2J4BA 5BXUA 4L9PA 4JEUA 5CMYA 4CT0A 3MV3B 1BI7B 4UWKA 5JJ7A 3G2SA 2WXMA 1SVXA 2DWZA 1YCSB 4GZ6A 3HVEA 2IFUA 4N2QA 3FU3A 2VJ8A 3TWWA 4UWHA 3FH7A 1ELRA 1TNZA 4F3VA 4GZ5A 3C5RA 3I3NA 3UUXA 5CCLA 3JUEA 4UI9J 2XPYA 2RD0A 3SO8A 3NOGD 3L08A 2XGMA 5AAOA 4ANWA 1H2VC 1ZBPA 4XI0A 4I6EA 3ASGA 5E76A 3DXKG 3QWVA 3HXDA 4E85A 4BEPA 4UUCA 3V2OA 2RFAA 2VGYA 3JQ1A 3ZYLA 1ELKA 3HYMB 3CHQA 4LNGA 3Q5MA 4I6JA 2DYRE 5G04J 2ETCA 3UX4A 5ITZF 4ILGA 3MV2B 3UKRG 4DK5A 4NIKA 3JCKC 3G2TA 3KS2A 4N3BA 2EQXA 2KBXA 1RZ4A 3V31A 3EJNA 4J8DA 3LVRE 3Q49B 5A7DB 4EBAA 3RSEG 3QJZA 5EYLA 2IOLA 1MX6A 3BG1B 1HXIA 1IKND 2X6HA 2HM8A 3SFYA 4K5BA 5BW8C 4ILHB 3FY4A 4U8VD 5D0QD 2IY0C 1UJJA 5A6CA 1UN9A 5ENNA 4APFA 1KZOA 4ATGA 3KEZA 3DSSA 4U8YD 3BU8A 4N5CA 3R9AB 3SF4A 1TR4A 3HXCA 1S63A 5FWQA 5ARGA 3WXXA 2WQ7A 3UKUG 4AJWA 1E7UA 3FDHA 4D10C 1HE8A 1JCRA 1D8EA 3HVEB 4AP2A 4RVBA 1IHGA 1XNFA 2EILE 3FUMA 4FP7A 5FZRA 1N0RA 2WXHA 3PZDA 4XIFA 1D8DA 4DRXE 3F6QA 2OEVA 3CVPA 2OOEA 4GPMA 3O4ZA 3HXFA 1Q2ZA 3EIJA 1IHBA 1S64A 4WNGA 2WQ6A 1LD7A 1TJCA 1TNBA 3NAWA 4ATZD 1WAO1 4J8EA 2J9QA 5JHAA 1K8KG 3E4BA 1TYQG 3QWPA 3C3RA 3IEGA 3D9NA 4HXIA 5LX8A 5EIDA 4OVVA 1WM5A 1PY1A 3I4RB 3CVQA 3SNXA 2H6IA 2NSZA 1EDUA 1QNFA 2IEJA 1NP7A 5C2YA 3URZA 1IQRA 4H7YA 3RKVA 2FI7A 1N4QA 3FUKA 3UMVA 3FU5A 1S70B 3EHNA 4G8KA 5BPPA 2IO2C 1JPLA 2L0IA 2Y0BG 3EU5A 2BEDA 3Q47B 2P9PG 3B7RL 1SA4A 3S7DA 4Y6CA 1OUVA 3U9WA 1SZAA 2AVPA 5BNWA 4GYOA 3T8MA 5LP0A 4TXRA 2BTDA 4RG9A 4DLOA 3GW4A 2BKGA 3ZUVB 3UQ3A 3J5PA 5CMWA 5BV0A 3SD5A 3MKRA 4CZ2D 3QNKA 5C1DA 1MHQA 3JXJA 3TWXA 2Y4UA 4IULA 3AG2E 2ZGGA 1TNYA 4BX9A 4OYSA 3SBSA 1JWFA 3L6AA 4TV3A
chains in the Genus database with same CATH topology
2WMOA 3D9LA 4B89A 4WWPA 3TGOA 3FTUA 2WXNA 3ML9A 4LRZA 4YVOA 1OWPA 5JJTA 1HS6A 5LCWJ 1ZU2A 2E2EA 3MGBA 2WPVA 4FADA 2AXZA 2L0TB 2CHZA 4PDXA 2WXFA 3LVQE 2VGXB 3LY9A 2GRLA 2XCBA 4L7TA 4A1GA 4WNEA 4J8SA 3ZPJA 2YINA 4L2YA 3PE3A 2MOWA 2I1KA 3QKYA 1H2TC 3N71A 3ZYQA 3QDNA 4EZLA 3FUJA 4UQXA 4YNDA 4C0MA 4CRWA 3CKBA 5A23A 4GAAA 3Q4AB 5FT9A 4JA7A 4FC8A 3G2VA 2JEKA 2J07A 3PE4A 3SI5A 4FU3A 1N52A 3RK6A 3VTYA 2WXGA 4NURA 3MJWA 2E0IA 5DBKA 3FUIA 4C9BB 4BY6A 4GPKA 3FTXA 1IQUA 1UN8A 3FUFA 2PQRA 1E7VA 3HHMA 2GW1A 1Y8MA 4B0ZA 1KT1A 3IHVA 3OTNA 2A4ZA 2KC7A 4FLBA 5G05J 4B94A 1DVPA 1EPUA 3OXGA 4DI4A 3UPVA 4CT4A 4I1MA 1NA0A 3RIBA 2WXJA 3ZGQA 2R59A 4HOQA 1Z3YA 1DNPA 3ZN3A 4KT6B 3K9IA 2QFCA 4KYOB 3CIAA 3CHOA 3FUHA 3LS8A 2FBNA 4F53A 4ANXA 2QY7A 4MLPA 3JQ0A 3O48A 4WUYA 2OVBA 3QC1A 3GYZA 1H19A 4PUCA 4N3CA 4AY6A 3CVWA 2VSOE 4N3AA 1PAQA 4E6HA 1LF8A 3ZHEA 3I5PA 4JA9A 2XPIA 2WM9A 3MCXA 4IN3B 2XRZA 2GRMA 2XCCA 4UI9C 2V0PA 2XEVA 4FHKA 3MKQA 3QB2A 3ZHEB 1U3DA 2KM4A 3OAWA 1HO8A 4U07A 3PNTB 3AS5A 2A5UA 1Z6TA 3U64A 1E8ZA 1HFAA 2CFUA 3ASDA 3IV0A 4W9RA 3CVUA 4UQZA 3U3WA 4UWFA 3AU5A 5T8IA 3VLDA 1QQEA 3FTVA 3B7SA 2HR2A 2C0MA 1W3BA 3LY7A 3L22A 4JHKA 4LUNU 3G2UA 5FQ7A 2MRIA 3CK9A 4PH4B 4I17A 3RRMB 4JHJA 2J4BA 3GZSA 5JJ6A 3FH8A 2Q7FA 1A17A 3FFLA 3FU0A 2J08A 4JEUA 5CMYA 2IU1A 1H6KA 3PVLA 4F1SA 4FULA 3FTSA 4CT0A 3MV3B 4UWKA 5JJ7A 4NQ0A 3G2SA 2WXMA 4HVBA 3ONLA 3SGHA 4F7AA 3JYSA 4DLQA 3PH0C 2WXOA 3BG0B 5J90A 3RRUA 4XZ4A 4G11A 4AV7A 2CG2A 3IHYA 2M63A 3EIQC 2KATA 3CVLA 4GZ6A 3OXLA 3PNLB 1E8WA 3HVEA 5G04C 1X5BA 2IFUA 4N2QA 3FU3A 2VJ8A 3S7BA 4NRHB 4UWHA 1NA3A 3FH7A 1ELRA 2OVFA 4F3VA 4GZ5A 4LCTA 3RU0A 2WXRA 2FO7A 2XHEA 3I3NA 3IKOB 4KXKB 5HQ8A 3UUXA 2CHXA 3FUDA 5CCLA 1TJFA 2DIWA 4UI9J 4A3TA 1HU3A 3KAEA 4I6GA 1HG5A 2XPYA 2RD0A 2AXVA 3TL5A 3R7QA 1UG3A 2J09A 4G2VA 3CHPA 2LAIA 3MYVA 3UT7A 4CEMA 5EX0A 1TEZA 2CFZA 2LNIA 3L08A 2XGMA 2Y4TA 3PUJA 5E75A 4ANWA 1H2VC 4GA2A 2XGSA 1ZBPA 2NXPA 4XI0A 2X6IA 3QOUA 3NQPA 4XE0A 5FQ8A 4I6EA 5J08A 5AJDA 4XI9A 4BT8A 2WQHA 3KD7A 4GMLA 3ASGA 3G2WA 2XRYA 5E76A 3ZXSA 4WWNA 3U66A 3UT8A 4G25A 5FTPA 4GYWA 1EYHA 2HYZA 3QWVA 4JXTA 4HORA 4E85A 4DI3A 2CG3A 4BSXA 3DBSA 4IRUA 2BUGA 1QZ2A 3SHFA 2VGYA 1HZ4A 3FP3A 3LCAA 3JQ1A 1E90A 3ENEA 3ZYLA 1ELKA 2WXKA 1GW6A 4B8AA 3LDZA 3HIZA 4MKTA 3OXFA 4N39A 3HYMB 1XGWA 2ZU6B 4HLEA 3L16A 5LFAA 3CHQA 3CVVA 3Q5MA 5AYWD 3U4TA 4GA0A 3VTXA 4I6JA 2VYIA 2KCKA 4WWOA 3FU6A 4GZ3A 3SBTB 3AS4A 5G04J 2AWIA 4G23A 4DPRA 5FQ4A 5FQ6A 3P1UA 3CSTA 3PS6A 3UX4A 4ILGA 4UQYA 4AOFA 4EQFA 4LEUA 3MV2B 2J4DA 5FZQA 4I9CA 3FEYA 4AM9A 2YHCA 4DK5A 2WXLA 4I1OB 2YNQA 3B13A 3PDNA 2UY1A 3FH5A 3JCKC 5BUZA 3IBEA 4JPSA 2XQ0A 3G2TA 2AXUA 4MRUA 2DBAA 3LY8A 3ZVVA 3ZW3A 2WMNA 4IYPA 3CHRA 3KS2A 1OWLA 2EQXA 4N3BA 5KJKA 3PEUB 4KVOA 4AEZC 5AENA 3CLJA 2KZTA 5M72A 4JC8A 4U0ZA 3EJNA 4J8DA 1E8YA 3LVRE 4CDMA 4L2LA 4I43A 4CCAA 2PL2A 3Q49B 4I9EA 1PC2A 5A7DB 4EBAA 4BT9A 3QARA 3QJZA 4A55A 2IOLA 1P5QA 3BG1B 1Z3XA 1FVHA 2KZTB 3S7JA 2KCVA 1HXIA 4CDNA 4WNFA 4UI9K 1BPOA 2X6HA 2HM8A 5T3RA 4G1TA 4CDRA 1HH8A 3MX3A 3LPZA 1FVFA 3MKQB 2BF0X 4CGWA 2IOSA 3S2AA 3LJ3A 2VTBA 5BW8C 1H2UA 3RO3A 4FA6A 4ILHB 4K0RA 3FY4A 4J6IA 5D0QD 2L6JA 3S7FA 4B8CB 3PUKA 3FEXA 3VLEA 4URKA 1UJKA 4GA1A 1UJJA 2L9BA 5A6CA 1UN9A 3APDA 5ENNA 3CHSA 4JHRA 4APFA 3ZEFA 4HOTA 3ONKA 3ESLA 4EBAG 4FJYA 4ATGA 3KEZA 2YQ8A 2C0LA 2Y3AA 3LKUA 4P29A 5JHBA 4ACLA 2WVIA 2J49A 2X3MA 4Y6WA 1H0AA 4JEHA 3RRNB 4XKBA 4N5CA 3R9AB 3CEQA 5KCMA 5KJMA 3SF4A 3TXMA 3Q15A 3FHEA 5FWQA 3WXXA 2WXQA 5ARGA 2WQ7A 3LYAA 3MA5A 4XX5A 2JLBA 4G24A 3TXNA 2X6KA 3NF1A 5FJYA 1HG2A 4GCOA 3T5XA 4YVQC 4CGVA 2VSNA 4AJWA 3C98A 4V3IA 5BT1A 1E7UA 4QFVA 3FDHA 2X6JA 4GYYA 3ZIMA 4D10C 1HE8A 1OWMA 4ABNA 3FTWA 3HVEB 4GZDA 4U0UA 1E8XA 4FJZA 4ILIA 4AP2A 1Y6IA 4RVBA 5DIZA 1IHGA 1XNFA 4ANVA 4WAFA 2I6HA 5ANLA 3TG4A 3CK7A 3L13A 3FUMA 4FP7A 3L54A 4EPZA 4U04A 2UWJG 3CHMA 5HI7A 4AIFA 5FZRA 1OWNA 3ESKA 3MEKA 4UWGA 2WXHA 3PZDA 3RO2A 3ZYKA 1N54A 3LXUX 4XIFA 3FTZA 4BWRA 4A1SA 2IONA 4HS2A 4C0EA 1JWGA 4GZCA 3HDXA 4UWLA 2VSXE 3FWVA 2KCLA 1E96B 5AIJA 3BEEA 5EX3A 2VGXA 1EF1C 2NC9A 5BV1A 2I1JA 2I2OA 4AY5A 5ARFA 1VDYA 3CVPA 1SQMA 2OOEA 3I4GA 4I2WA 3R7RA 2IF4A 1U3CA 4L1BA 3APCA 3FUEA 3O4ZA 3EIJA 2X38A 4HFGA 2LO6A 4XKCA 3TJPA 1HX8A 4WNGA 2R5SA 3ZFWA 1HF8A 2WQ6A 3EDTB 4AVXA 3APFA 4K03A 5T4YA 3DPDA 3EHMA 4Q96A 4BTAA 1TJCA 5CHEE 2WXIA 3JUIA 4BTBA 1WAO1 2ILRA 4J8EA 4APOA 2PM7A 4ACKA 2J9QA 4JL0A 2V8SE 4Q94A 4PS7A 5JHAA 4TRQA 1WY6A 3E4BA 3ULQA 3QWPA 4EZKA 2XGOA 3IEGA 4I2ZA 3SZ7A 5G55A 2I9CA 4U63A 4ME2A 3T5VA 3CVYA 3D9NA 3UT4A 4HXIA 3ML8A 5LX8A 5KJLA 2YHEA 3CQGB 3MZLB 4OVVA 1WM5A 1PY1A 3NZSA 2X6FA 4NACA 3CVXA 3PRZA 3I4RB 3CK8A 3RJVA 4GMJA 1OWOA 1MQSA 4KVMA 3CVQA 3D3MA 2UY1B 2VQ2A 5D0OD 5KJNA 1SZ9A 2WXPA 1B89A 2PQNA 4R7LA 3SNXA 3PREA 5LOZA 2FF4A 1INZA 2NSZA 1EDUA 1QNFA 1NP7A 4H7XA 4MS6A 2DCPA 3D9OA 3D9MA 4Q69A 1UW4B 2LAHA 4KZCA 1IYGA 5C2YA 2MHKA 5ANRA 4EECA 3URZA 4RSYA 3SFZA 3L17A 3TG5A 2OV8A 1IQRA 4H7YA 4J0UA 3RKVA 2FI7A 3QAQA 5EDSA 4HOUA 2V5FA 3FUKA 3UMVA 3QWWA 1JUQA 3CQCB 3D9PA 4LERA 4KBQA 3VLFA 3ZRHA 3AU4A 2RG8A 3D9KA 3FU5A 1KT0A 3NZUA 3CGHA 3PEVB 1YA0A 2VTBB 3EHNA 4U0SA 5BPPA 4U8HA 5LCWC 3AS8A 2FULA 1JPLA 2L0IA 4N2SA 3Q47B 4BFRA 2ONDA 3B7RL 3LEWA 3S7DA 4Y6CA 1OUVA 1FCHA 2LSUA 2V4LA 3U9WA 3B7UX 4FLHA 4KMOA 3CV0A 4M3OA 4DJAA 3GZ2A 1SZAA 2P58C 4JW1A 4OVUA 1S0PA 4RG6A 2AVPA 5BNWA 2AW6A 4KZ0A 4A3VA 3FTYA 3P2BA 4GYOA 4G26A 3T8MA 4PS8A 2GGFA 5CCMA 5LP0A 3B7TA 2BTDA 2HO1A 2LSVA 2PM6A 3QK0A 1NZNA 4O6FA 4PS3A 4RG9A 4AXHA 1L5JA 4DLOA 3ASFA 3GW4A 3CKCA 4HOSA 2PZIA 4EZJA 3UQ3A 3FULA 2CHWA 5CMWA 5BV0A 2C2LA 2R17C 3MKRA 3SD5A 3TAXA 3QNKA 4FHJA 5C1DA 1MHQA 5AJLA 4I1AA 3GZ1A 4J8FA 2XPZA 5G2NA 2WB2A 2Y4UA 3CVNA 4GB9A 4JZYA 4ANUA 2IJGX 4TUUA 4WNDA 4IULA 4BX8A 1KLXA 5G05C 2IQCA 1ELWA 3CSFA 4GCNA 3ZYMA 4BX9A 5FZSA 4GU5A 5EKQD 4OYSA 3SBSA 4L23A 3D9IA 1JWFA 3ASHA 3L6AA 3CR3A 3D9JA 2VSYA 3FUNA 2FEZA 4JVSA 4TV3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGO A;  4YVO A;  5JJT A;  5LCW J;  1ZU2 A;  2E2E A;  2WPV A;  2VGX B;  3LY9 A;  2XCB A;  4WNE A;  3ZPJ A;  3PE3 A;  3QKY A;  3N71 A;  3QDN A;  4UQX A;  4YND A;  3CKB A;  3Q4A B;  5FT9 A;  4JA7 A;  3PE4 A;  3VTY A;  5DBK A;  4GPK A;  2PQR A;  2GW1 A;  1Y8M A;  1KT1 A;  5G05 J;  2KC7 A;  4B94 A;  3OXG A;  3UPV A;  1NA0 A;  3RIB A;  3ZGQ A;  4HOQ A;  3ZN3 A;  3K9I A;  2QFC A;  4KYO B;  2FBN A;  3O48 A;  4WUY A;  3GYZ A;  4AY6 A;  4N3C A;  4N3A A;  3ZHE A;  4JA9 A;  2XPI A;  4IN3 B;  2XCC A;  4UI9 C;  2XEV A;  3ZHE B;  4U07 A;  3AS5 A;  3ASD A;  4W9R A;  4UQZ A;  3U3W A;  1QQE A;  2HR2 A;  2C0M A;  1W3B A;  3LY7 A;  3CK9 A;  4I17 A;  5JJ6 A;  2Q7F A;  1A17 A;  3FFL A;  3MV3 B;  5JJ7 A;  4NQ0 A;  3JYS A;  2KAT A;  3CVL A;  4GZ6 A;  3OXL A;  5G04 C;  2IFU A;  4N2Q A;  3S7B A;  4NRH B;  1NA3 A;  1ELR A;  4F3V A;  4GZ5 A;  3RU0 A;  4KXK B;  2FO7 A;  5HQ8 A;  3UUX A;  5CCL A;  4UI9 J;  3KAE A;  4G2V A;  5EX0 A;  2LNI A;  2XGM A;  2Y4T A;  4GA2 A;  2XGS A;  1ZBP A;  4XI0 A;  3QOU A;  4XI9 A;  4BT8 A;  2WQH A;  3KD7 A;  3ASG A;  4G25 A;  5FTP A;  4GYW A;  2HYZ A;  3QWV A;  4HOR A;  2BUG A;  1QZ2 A;  2VGY A;  1HZ4 A;  3FP3 A;  3LCA A;  4N39 A;  3OXF A;  3HYM B;  3U4T A;  3Q5M A;  5AYW D;  4GA0 A;  3VTX A;  2VYI A;  2KCK A;  4GZ3 A;  3AS4 A;  5G04 J;  4G23 A;  4UQY A;  4EQF A;  4LEU A;  3MV2 B;  5FZQ A;  4I9C A;  4AM9 A;  2YHC A;  3PDN A;  2UY1 A;  2DBA A;  3LY8 A;  3KS2 A;  4N3B A;  5KJK A;  5M72 A;  4U0Z A;  4J8D A;  2PL2 A;  3Q49 B;  4I9E A;  1PC2 A;  5A7D B;  4BT9 A;  1P5Q A;  3S7J A;  2KCV A;  1HXI A;  4WNF A;  4UI9 K;  4CDR A;  4G1T A;  1HH8 A;  3LPZ A;  4CGW A;  5BW8 C;  3RO3 A;  5D0Q D;  2L6J A;  3S7F A;  4GA1 A;  5A6C A;  4HOT A;  4JHR A;  2YQ8 A;  2C0L A;  3LKU A;  4Y6W A;  4N5C A;  3R9A B;  3CEQ A;  5KJM A;  3SF4 A;  3Q15 A;  3WXX A;  5ARG A;  3LYA A;  3MA5 A;  2JLB A;  4G24 A;  3NF1 A;  5FJY A;  4GCO A;  4YVQ C;  4CGV A;  2VSN A;  5BT1 A;  4GYY A;  4ABN A;  4U0U A;  5DIZ A;  1IHG A;  1XNF A;  2I6H A;  3TG4 A;  3CK7 A;  4U04 A;  2UWJ G;  5HI7 A;  4AIF A;  5FZR A;  3ESK A;  3MEK A;  3RO2 A;  4XIF A;  4BWR A;  4A1S A;  3FWV A;  2KCL A;  1E96 B;  3BEE A;  5EX3 A;  2VGX A;  2NC9 A;  4AY5 A;  5ARF A;  3CVP A;  2OOE A;  4I2W A;  2IF4 A;  4WNG A;  2R5S A;  3ZFW A;  3EDT B;  4BTA A;  1TJC A;  5CHE E;  4BTB A;  1WAO 1;  4J8E A;  4APO A;  2J9Q A;  4JL0 A;  3E4B A;  3ULQ A;  3QWP A;  2XGO A;  3IEG A;  4I2Z A;  3SZ7 A;  4ME2 A;  5KJL A;  1WM5 A;  3CK8 A;  3RJV A;  3CVQ A;  2UY1 B;  2VQ2 A;  5D0O D;  5KJN A;  1B89 A;  2PQN A;  2FF4 A;  4H7X A;  1IYG A;  2MHK A;  3URZ A;  3TG5 A;  4J0U A;  4H7Y A;  3RKV A;  2FI7 A;  4HOU A;  2V5F A;  3QWW A;  4KBQ A;  1KT0 A;  1YA0 A;  4U0S A;  5LCW C;  3AS8 A;  4N2S A;  3Q47 B;  2OND A;  3S7D A;  4Y6C A;  1OUV A;  1FCH A;  2LSU A;  3CV0 A;  3GZ2 A;  2P58 C;  4RG6 A;  2AVP A;  5BNW A;  4GYO A;  4G26 A;  5CCM A;  2HO1 A;  2LSV A;  4RG9 A;  1NZN A;  4O6F A;  3ASF A;  3GW4 A;  3CKC A;  4HOS A;  2PZI A;  3UQ3 A;  2C2L A;  3MKR A;  3TAX A;  5C1D A;  4I1A A;  3GZ1 A;  4J8F A;  2Y4U A;  3CVN A;  4WND A;  1KLX A;  5G05 C;  1ELW A;  4GCN A;  5FZS A;  5EKQ D;  3ASH A;  2VSY A;  2FEZ A; 
#chains in the Genus database with same CATH topology
 3D9L A;  5HS0 A;  3TGO A;  3ML9 A;  4YVO A;  3Q78 A;  3MGB A;  2AXZ A;  2L0T B;  2CHZ A;  2GRP B;  4WNE A;  4J8S A;  3ZPJ A;  3B95 A;  4L2Y A;  2DZN A;  4YND A;  4C0M A;  4CRW A;  5D66 A;  3DSX A;  2WXG A;  4NUR A;  4C9B B;  4GPK A;  3D9H A;  2PQR A;  2GW1 A;  1DC2 A;  1KT1 A;  3IHV A;  3OTN A;  4FLB A;  1EPU A;  3PZ3 A;  4DX2 A;  2WXJ A;  3ASN E;  5EIB E;  3ZN3 A;  3C3Q A;  2QFC A;  4MLP A;  3JQ0 A;  3O48 A;  2BKK B;  4JA9 A;  1TN7 A;  3BUA A;  2F37 A;  5FIO A;  2XRZ A;  2GRM A;  2V0P A;  4YDW A;  3ZHE B;  1U3D A;  3OAW A;  1HO8 A;  3AS5 A;  2A5U A;  2A5E A;  4W9R A;  2CFU A;  4UWF A;  3FTV A;  2HR2 A;  4HRL A;  4JHK A;  2MRI A;  4YDO A;  3GZS A;  1A17 A;  3FU0 A;  2J08 A;  2IU1 A;  1H6K A;  3LJN A;  5AQA A;  4DX6 D;  4HVB A;  3SGH A;  4F7A A;  2WXO A;  5J90 A;  1AP7 A;  2CG2 A;  3CVL A;  1E8W A;  1NA3 A;  2OVF A;  3NOC D;  4KXK B;  5HQ8 A;  3AG4 E;  3X2Q E;  1TJF A;  2DIW A;  4A3T A;  1HU3 A;  2AXV A;  3R7Q A;  1UG3 A;  2J09 A;  1TEZ A;  3CHP A;  2LAI A;  3MYV A;  4HI8 A;  4F6R D;  5E75 A;  2XGS A;  2NXP A;  4XE0 A;  5AJD A;  4XI9 A;  3PZ2 A;  3U66 A;  4WWN A;  4G25 A;  3EU9 A;  2R03 A;  2HYZ A;  4JXT A;  2CG3 A;  4IRU A;  1YYH A;  1QZ2 A;  3FP3 A;  1OCZ E;  1YMP A;  3LCA A;  1E90 A;  3ENE A;  1GW6 A;  4N39 A;  4HLE A;  1XGW A;  5LFA A;  3CVV A;  5AYW D;  4GA0 A;  3VTX A;  2KCK A;  3SBT B;  3AS4 A;  4G23 A;  3P1U A;  4AOF A;  4UQY A;  3AJI A;  1N95 A;  4LEU A;  2J4D A;  4I1O B;  3B13 A;  3FH5 A;  3IBE A;  4JPS A;  5AQ7 A;  2DBA A;  3LY8 A;  3ZVV A;  3ZW3 A;  4BET A;  5JA4 D;  1OWL A;  3PEU B;  5AEN A;  2XEH A;  3CLJ A;  1NI1 A;  2KXP C;  3EHR A;  4GTM A;  4L2L A;  2RKK A;  3UIO C;  4I43 A;  4BT9 A;  1FVH A;  3SFX A;  1BPO A;  4G1T A;  1HH8 A;  5HRY A;  1H2U A;  3S7F A;  1DCE A;  3PUK A;  4GA1 A;  4HOT A;  3APD A;  4JHR A;  3ZEF A;  2XZT G;  3ESL A;  4EBA G;  4FJY A;  2Y3A A;  5JHB A;  4ACL A;  2X3M A;  2OCC E;  3RRN B;  3E33 A;  1K3Z D;  4XKB A;  3CEQ A;  1O5M A;  5KJM A;  1FPP A;  3Q15 A;  2WXQ A;  2HE0 A;  4G24 A;  5FJY A;  4GCO A;  4CGV A;  2VSN A;  4CYM D;  3C98 A;  4V3I A;  3T8K A;  3AAA C;  4QFV A;  1MZC A;  4GYY A;  5CER B;  3KEA A;  4ABN A;  4GTR A;  1E8X A;  4FJZ A;  4GTS A;  1Y6I A;  4ANV A;  5ANL A;  3TG4 A;  3DEP A;  3L13 A;  3L54 A;  3CHM A;  5HI7 A;  3UIP C;  3LXU X;  3Q7A A;  1JWG A;  3HDX A;  4XEI G;  1EF1 C;  2I1J A;  4F1P A;  5ARF A;  3I4G A;  4L1B A;  3V2X A;  3FUE A;  2X38 A;  2LO6 A;  3EUV A;  4LG6 A;  2R5S A;  3EDT B;  5T4Y A;  3DPD A;  3JUI A;  4TXQ A;  4JL0 A;  3ULQ A;  4EZK A;  5G55 A;  2I9C A;  4U63 A;  4ME2 A;  3T5V A;  4HLL A;  3MZL B;  3UI2 A;  3NZS A;  2X6F A;  3PRZ A;  3CK8 A;  4GMJ A;  4KVM A;  3DSV A;  2VQ2 A;  5KJN A;  4R7L A;  3PRE A;  5LOZ A;  4LSZ E;  3NBN B;  4H7X A;  2DCP A;  4Q69 A;  2LAH A;  1IYG A;  2RFM A;  3HRA A;  4X8Q A;  5EDS A;  5CBO A;  3QAQ A;  2V5F A;  3ZRH A;  3CQC B;  3VLF A;  4KBQ A;  5KNH D;  3DWL G;  1YA0 A;  4RLY A;  2ZIS A;  5LCW C;  3AS8 A;  2P9N G;  4BFR A;  3LEW A;  2V4L A;  3KSQ A;  3UXG A;  4RG6 A;  2B0O E;  3E34 A;  4KZ0 A;  3P2B A;  3DPY A;  2LSV A;  3HXE A;  2PZI A;  3FUL A;  2CHW A;  2R17 C;  4J8F A;  2XPZ A;  4WND A;  4BX8 A;  1H6O A;  1KLX A;  4J7W A;  5G05 C;  2IQC A;  1ELW A;  4GU5 A;  3ASH A;  2FO1 E;  2VSY A;  3FUN A;  4JVS A;  4LRZ A;  2WXN A;  1OWP A;  5JJT A;  4K5A B;  1ZU2 A;  2E2E A;  2WPV A;  2OEW A;  3LY9 A;  2GRL A;  2XCB A;  4A1G A;  1NFI E;  3DSU A;  2MOW A;  2I1K A;  3N71 A;  3ZYQ A;  3QDN A;  4EZL A;  5FT9 A;  1MJ0 A;  4JA7 A;  4FC8 A;  4GTO A;  3SI5 A;  4K5C A;  3RK6 A;  3ULE G;  3FUI A;  1OCR E;  4JB8 P;  3FUF A;  1E7V A;  3HHM A;  1Y8M A;  4HNA D;  2KC7 A;  1FT2 A;  3UPV A;  5B1A E;  3RIB A;  1V55 E;  2R59 A;  4DX7 D;  1DNP A;  4KT6 B;  3K9I A;  2EIM E;  4KYO B;  3CIA A;  3CHO A;  3LS8 A;  4F53 A;  4PUC A;  1TN8 A;  4M7C A;  4N3C A;  4AY6 A;  4E6H A;  1LF8 A;  3ZHE A;  3BQO A;  1OT8 A;  2WM9 A;  3MCX A;  4IN3 B;  3DXM G;  4UI9 C;  5ENS D;  2XEV A;  4FHK A;  1SW6 A;  3QB2 A;  4U07 A;  3PNT B;  5JMN D;  3U64 A;  3IV0 A;  3U3W A;  3VLD A;  1QQE A;  3B7S A;  3LY7 A;  3UM0 A;  4GTQ A;  4GMR A;  3TWV A;  2DVW A;  5FQ7 A;  3CK9 A;  4PH4 B;  3RRM B;  4HRN A;  3FH8 A;  1AWC B;  3TWS A;  1A5E A;  2LXM A;  3PVL A;  4F1S A;  5ENR D;  3ONL A;  4YDY A;  3JYS A;  3PH0 C;  4AV7 A;  4G11 A;  3IHY A;  3OXL A;  5G04 C;  1X5B A;  3C72 A;  3S7B A;  1H6P A;  4NRH B;  3RU0 A;  2WXR A;  3IKO B;  2CHX A;  3PZ1 A;  3KAE A;  4I6G A;  1HG5 A;  3TL5 A;  4G2V A;  4CEM A;  3UT7 A;  2QYU A;  5EX0 A;  2CFZ A;  2Y4T A;  3UM1 A;  2IO3 C;  3Q9U C;  2XS8 A;  3QOU A;  5J08 A;  3UM3 A;  4BT8 A;  1X81 A;  2ETA A;  3KD7 A;  4GML A;  3ZXS A;  3UT8 A;  5FTP A;  1EYH A;  4DI3 A;  3DBS A;  1HZ4 A;  2WXK A;  4B8A A;  3LDZ A;  4MKT A;  2ZU6 B;  3L16 A;  3TWR A;  2VYI A;  2R05 A;  5CRV A;  2AWI A;  2V4H C;  5FQ4 A;  5FQ6 A;  2XS1 A;  3CST A;  5FZQ A;  4I9C A;  3FEY A;  4JD2 G;  2YHC A;  5BXO A;  2LXL A;  2XQ0 A;  4MRU A;  2WMN A;  4IYP A;  3CHR A;  3DSW A;  5KJK A;  4KVO A;  4AEZ C;  1JCQ A;  4U0Z A;  2XEN A;  4CDM A;  1QYM A;  3QAR A;  4A55 A;  3AG3 E;  1OCO E;  2KZT B;  4U7E B;  2KCV A;  3S7J A;  4CDN A;  4WNF A;  4UI9 K;  4LNU D;  5T3R A;  4CDR A;  3LPZ A;  2BF0 X;  5CED B;  3LJ3 A;  5AQ9 A;  4K0R A;  4J6I A;  2L6J A;  4B8C B;  4URK A;  5ENT D;  3ONK A;  2C0L A;  3LKU A;  4P29 A;  2P9L G;  1H0A A;  1V54 E;  3TXM A;  4XX5 A;  3NF1 A;  1K1A A;  3HXB A;  3SY2 A;  2QC9 A;  5BT1 A;  3V79 K;  3T9K A;  3DST A;  3ZIM A;  1OXJ A;  3FTW A;  4GZD A;  4ILI A;  5DIZ A;  4WAF A;  5KBA A;  4EPZ A;  2UWJ G;  5AQB A;  2P9K G;  1OWN A;  2GRR B;  3ESK A;  3MEK A;  4UWG A;  3ZYK A;  4BWR A;  2ION A;  4GZC A;  2KCL A;  1E96 B;  5EX3 A;  2ZGD A;  2VGX A;  5BV1 A;  2NC9 A;  2I2O A;  2EIJ E;  2IF4 A;  3APC A;  4HFG A;  3UIN C;  2Y1L E;  4XKC A;  3TJP A;  3ZFW A;  1HF8 A;  1KZP A;  4AVX A;  3APF A;  4Q96 A;  5ENP D;  4BTA A;  2PM7 A;  2V8S E;  3CVY A;  3UT4 A;  2YHE A;  3UTM A;  1TN6 A;  2QYJ A;  1MQS A;  4TUM A;  3R9M A;  2WXP A;  2GRO B;  3ZU7 B;  2FF4 A;  3E30 A;  3D9O A;  4DX5 D;  4KZC A;  5AAR A;  5KNG A;  4EEC A;  3TWQ A;  4RSY A;  4QQI A;  3SFZ A;  2OV8 A;  4J0U A;  4HOU A;  2P9S G;  3QWW A;  1JUQ A;  3D9P A;  3D9K A;  1KT0 A;  3CGH A;  3PEV B;  4Z68 A;  3DEO A;  1WDY A;  1FCH A;  3E32 A;  2J8S D;  4FLH A;  3CV0 A;  3ABK E;  3C3O A;  4G26 A;  4PS8 A;  2GGF A;  3QK0 A;  4AXH A;  3WG7 E;  3ASF A;  3DRA A;  1FT1 A;  3TAX A;  4FHJ A;  3GZ1 A;  5G2N A;  4JZY A;  4YDE A;  4ANU A;  3SQV A;  5FZS A;  3UM2 A;  4L23 A;  3CR3 A;  3D9J A;  3FTY A;  2FEZ A;  5AIJ A;  1N9A A;  2WMO A;  4B89 A;  4WWP A;  3EHQ A;  1HS6 A;  4FAD A;  4PDX A;  3LVQ E;  2VGX B;  4C48 B;  4L7T A;  3HG0 D;  2P2C P;  2YIN A;  3PE3 A;  1H2T C;  2P9U G;  2ZXW E;  3CKB A;  5A23 A;  3Q4A B;  3G2V A;  3ZXP A;  2J07 A;  3PE4 A;  2Y69 E;  4B93 B;  4BY6 A;  3FTX A;  3RAU A;  1IQU A;  1UN8 A;  4B0Z A;  3Q79 A;  3JXI A;  1TNU A;  2A4Z A;  4B94 A;  3OXG A;  4CT4 A;  3ZGQ A;  4HOQ A;  1K1B A;  1Z3Y A;  1N4R A;  2R2L A;  2EIN E;  2FBN A;  2QY7 A;  3QC1 A;  1H19 A;  5D2M C;  2VSO E;  4N3A A;  3I5P A;  2XPI A;  5FIN A;  4G8L A;  2XCC A;  3MKQ A;  2XZD G;  3W9F A;  1Z6T A;  3CVU A;  2F8Y A;  5AN8 A;  3AU5 A;  1SA5 A;  1G3N B;  2C0M A;  1W3B A;  2EIK E;  3L22 A;  4LUN U;  4HBD A;  3B7B A;  4I17 A;  2DZO A;  5JJ6 A;  2Q7F A;  3FFL A;  4FUL A;  3FTS A;  4NQ0 A;  4DLQ A;  3BG0 B;  2GRQ B;  3RRU A;  4XZ4 A;  2M63 A;  3EIQ C;  2KAT A;  3PNL B;  3ZNG A;  4LCT A;  2FO7 A;  2XHE A;  3Q75 A;  2V5Q C;  3FUD A;  2AJA A;  1BLX B;  2LNI A;  3Q7F A;  2L6B A;  4BES A;  3PUJ A;  4GA2 A;  2X6I A;  3NQP A;  5FQ8 A;  2WQH A;  3G2W A;  2XRY A;  5IY5 E;  3NB2 A;  1OY3 D;  4GYW A;  4BSZ B;  4HOR A;  1MX2 A;  5CEC B;  4EHM A;  4BSX A;  2PNN A;  5ENO D;  2BUG A;  3SHF A;  5ENQ D;  1Z5S C;  1BD8 A;  3HIZ A;  3OXF A;  4GTT A;  4HRM B;  3U4T A;  4WWO A;  3FU6 A;  4GZ3 A;  1N4S A;  5EYP F;  1RW2 A;  5HKP A;  4DPR A;  1N94 A;  2H6H A;  1BU9 A;  3PS6 A;  4DUI A;  1IXV A;  4TXP A;  4EQF A;  1U2V G;  1DCQ A;  4AM9 A;  2WXL A;  2YNQ A;  3PDN A;  2UY1 A;  5BUZ A;  2AXU A;  3V30 A;  2KZT A;  5M72 A;  4JC8 A;  3ASO E;  1E8Y A;  4A63 B;  4CCA A;  2PL2 A;  4I9E A;  1PC2 A;  3Q9N C;  1P5Q A;  1Z3X A;  3MX3 A;  1FVF A;  1N4P A;  3MKQ B;  4CGW A;  3AG1 E;  2IOS A;  3S2A A;  2VTB A;  3RO3 A;  4FA6 A;  4U95 D;  4RQI A;  4GTV A;  3FEX A;  3VLE A;  1UJK A;  2L9B A;  3CHS A;  2ZIR A;  3W9G A;  2YQ8 A;  2WVI A;  2J49 A;  4Y6W A;  4JEH A;  2VGE A;  1MX4 A;  2DYS E;  2LUH A;  5KCM A;  3FHE A;  3LYA A;  1OCC E;  3MA5 A;  2JLB A;  3TXN A;  2X6K A;  1HG2 A;  3T5X A;  4YVQ C;  2ETB A;  2X6J A;  1OWM A;  4U0U A;  3L82 A;  4O60 A;  3E37 A;  1BI8 B;  2I6H A;  3CK7 A;  5H7P A;  5B3S E;  4U04 A;  1N0Q A;  4AIF A;  2MYO A;  3RO2 A;  1N54 A;  3FTZ A;  2XEE A;  4U96 D;  4A1S A;  4HS2 A;  4C0E A;  4UWL A;  2VSX E;  3FWV A;  3BEE A;  3L9T A;  4AY5 A;  1N11 A;  1VDY A;  1SQM A;  3R7R A;  4I2W A;  3Q73 A;  1O1S A;  1U3C A;  2NYJ A;  2GRN B;  1HX8 A;  4OAU C;  1NL4 A;  4K03 A;  3EHM A;  1QBQ A;  5CHE E;  2WXI A;  4BTB A;  2ILR A;  4APO A;  4ACK A;  4PS7 A;  4Q94 A;  4TRQ A;  1WY6 A;  4ZFH A;  2JAB A;  2XGO A;  4I2Z A;  3SZ7 A;  3ML8 A;  5KJL A;  3CQG B;  1WG0 A;  4NAC A;  4HQD A;  3CVX A;  3TWT A;  3RJV A;  1OWO A;  3D3M A;  2UY1 B;  5D0O D;  1SZ9 A;  1B89 A;  2PQN A;  1INZ A;  1TNO A;  3ABL E;  4MS6 A;  3D9M A;  1UW4 B;  2MHK A;  5ANR A;  4OAV B;  2F8X K;  3TG5 A;  3L17 A;  3KSL A;  3ABM E;  1JCS A;  4DX1 A;  4LER A;  3AU4 A;  2RG8 A;  4J8Y A;  1LTX A;  5B1B E;  3J5Q B;  3NZU A;  2VTB B;  4U0S A;  4U8H A;  2FUL A;  4N2S A;  2OND A;  2LSU A;  4O1P A;  3B7U X;  4KMO A;  4DJA A;  4M3O A;  3GZ2 A;  2P58 C;  1ZB1 A;  4JW1 A;  4OVU A;  1S0P A;  5CBN A;  2AW6 A;  3PZ4 A;  5CRU A;  4A3V A;  5CCM A;  3B7T A;  2PM6 A;  2HO1 A;  1NZN A;  4O6F A;  4PS3 A;  1L5J A;  3CKC A;  4HOS A;  4EZJ A;  2C2L A;  5AJL A;  4I1A A;  2WB2 A;  3CVN A;  4GB9 A;  2IJG X;  4TUU A;  1O1T A;  3CSF A;  4GCN A;  2QZA A;  3ZYM A;  5EKQ D;  3D9I A;  3ZKJ A;  4FU3 A;  2H6G A;  5CEA A;  3FTU A;  4GTP A;  5LCW J;  4MBG A;  4LNB A;  2WXF A;  3IXE A;  3QKY A;  2H6F A;  3FUJ A;  4UQX A;  5EN5 D;  4GAA A;  4HI9 A;  1UOH A;  2JEK A;  2R02 A;  3ISM C;  1N52 A;  3VTY A;  3MJW A;  2E0I A;  5DBK A;  4O1O A;  5G05 J;  1DVP A;  4DI4 A;  2P9I G;  4I1M A;  1NA0 A;  1D9S A;  3FUH A;  3TWU A;  4ANX A;  4WUY A;  2OVB A;  3GYZ A;  3CVW A;  1PAQ A;  1O1R A;  1KPS B;  4ZHB A;  2F0Y A;  4BER A;  4HB5 A;  4N5Q A;  2KM4 A;  1E8Z A;  1HFA A;  3ASD A;  1MYO A;  4UQZ A;  5EIL A;  5T8I A;  5KWD A;  2B6C A;  1LD8 A;  3ULY A;  3G2U A;  4JHJ A;  2J4B A;  5BXU A;  4L9P A;  4JEU A;  5CMY A;  4CT0 A;  3MV3 B;  1BI7 B;  4UWK A;  5JJ7 A;  3G2S A;  2WXM A;  1SVX A;  2DWZ A;  1YCS B;  4GZ6 A;  3HVE A;  2IFU A;  4N2Q A;  3FU3 A;  2VJ8 A;  3TWW A;  4UWH A;  3FH7 A;  1ELR A;  1TNZ A;  4F3V A;  4GZ5 A;  3C5R A;  3I3N A;  3UUX A;  5CCL A;  3JUE A;  4UI9 J;  2XPY A;  2RD0 A;  3SO8 A;  3NOG D;  3L08 A;  2XGM A;  5AAO A;  4ANW A;  1H2V C;  1ZBP A;  4XI0 A;  4I6E A;  3ASG A;  5E76 A;  3DXK G;  3QWV A;  3HXD A;  4E85 A;  4BEP A;  4UUC A;  3V2O A;  2RFA A;  2VGY A;  3JQ1 A;  3ZYL A;  1ELK A;  3HYM B;  3CHQ A;  4LNG A;  3Q5M A;  4I6J A;  2DYR E;  5G04 J;  2ETC A;  3UX4 A;  5ITZ F;  4ILG A;  3MV2 B;  3UKR G;  4DK5 A;  4NIK A;  3JCK C;  3G2T A;  3KS2 A;  4N3B A;  2EQX A;  2KBX A;  1RZ4 A;  3V31 A;  3EJN A;  4J8D A;  3LVR E;  3Q49 B;  5A7D B;  4EBA A;  3RSE G;  3QJZ A;  5EYL A;  2IOL A;  1MX6 A;  3BG1 B;  1HXI A;  1IKN D;  2X6H A;  2HM8 A;  3SFY A;  4K5B A;  5BW8 C;  4ILH B;  3FY4 A;  4U8V D;  5D0Q D;  2IY0 C;  1UJJ A;  5A6C A;  1UN9 A;  5ENN A;  4APF A;  1KZO A;  4ATG A;  3KEZ A;  3DSS A;  4U8Y D;  3BU8 A;  4N5C A;  3R9A B;  3SF4 A;  1TR4 A;  3HXC A;  1S63 A;  5FWQ A;  5ARG A;  3WXX A;  2WQ7 A;  3UKU G;  4AJW A;  1E7U A;  3FDH A;  4D10 C;  1HE8 A;  1JCR A;  1D8E A;  3HVE B;  4AP2 A;  4RVB A;  1IHG A;  1XNF A;  2EIL E;  3FUM A;  4FP7 A;  5FZR A;  1N0R A;  2WXH A;  3PZD A;  4XIF A;  1D8D A;  4DRX E;  3F6Q A;  2OEV A;  3CVP A;  2OOE A;  4GPM A;  3O4Z A;  3HXF A;  1Q2Z A;  3EIJ A;  1IHB A;  1S64 A;  4WNG A;  2WQ6 A;  1LD7 A;  1TJC A;  1TNB A;  3NAW A;  4ATZ D;  1WAO 1;  4J8E A;  2J9Q A;  5JHA A;  1K8K G;  3E4B A;  1TYQ G;  3QWP A;  3C3R A;  3IEG A;  3D9N A;  4HXI A;  5LX8 A;  5EID A;  4OVV A;  1WM5 A;  1PY1 A;  3I4R B;  3CVQ A;  3SNX A;  2H6I A;  2NSZ A;  1EDU A;  1QNF A;  2IEJ A;  1NP7 A;  5C2Y A;  3URZ A;  1IQR A;  4H7Y A;  3RKV A;  2FI7 A;  1N4Q A;  3FUK A;  3UMV A;  3FU5 A;  1S70 B;  3EHN A;  4G8K A;  5BPP A;  2IO2 C;  1JPL A;  2L0I A;  2Y0B G;  3EU5 A;  2BED A;  3Q47 B;  2P9P G;  3B7R L;  1SA4 A;  3S7D A;  4Y6C A;  1OUV A;  3U9W A;  1SZA A;  2AVP A;  5BNW A;  4GYO A;  3T8M A;  5LP0 A;  4TXR A;  2BTD A;  4RG9 A;  4DLO A;  3GW4 A;  2BKG A;  3ZUV B;  3UQ3 A;  3J5P A;  5CMW A;  5BV0 A;  3SD5 A;  3MKR A;  4CZ2 D;  3QNK A;  5C1D A;  1MHQ A;  3JXJ A;  3TWX A;  2Y4U A;  4IUL A;  3AG2 E;  2ZGG A;  1TNY A;  4BX9 A;  4OYS A;  3SBS A;  1JWF A;  3L6A A;  4TV3 A; 
#chains in the Genus database with same CATH homology
 2WMO A;  3D9L A;  4B89 A;  4WWP A;  3TGO A;  3FTU A;  2WXN A;  3ML9 A;  4LRZ A;  4YVO A;  1OWP A;  5JJT A;  1HS6 A;  5LCW J;  1ZU2 A;  2E2E A;  3MGB A;  2WPV A;  4FAD A;  2AXZ A;  2L0T B;  2CHZ A;  4PDX A;  2WXF A;  3LVQ E;  2VGX B;  3LY9 A;  2GRL A;  2XCB A;  4L7T A;  4A1G A;  4WNE A;  4J8S A;  3ZPJ A;  2YIN A;  4L2Y A;  3PE3 A;  2MOW A;  2I1K A;  3QKY A;  1H2T C;  3N71 A;  3ZYQ A;  3QDN A;  4EZL A;  3FUJ A;  4UQX A;  4YND A;  4C0M A;  4CRW A;  3CKB A;  5A23 A;  4GAA A;  3Q4A B;  5FT9 A;  4JA7 A;  4FC8 A;  3G2V A;  2JEK A;  2J07 A;  3PE4 A;  3SI5 A;  4FU3 A;  1N52 A;  3RK6 A;  3VTY A;  2WXG A;  4NUR A;  3MJW A;  2E0I A;  5DBK A;  3FUI A;  4C9B B;  4BY6 A;  4GPK A;  3FTX A;  1IQU A;  1UN8 A;  3FUF A;  2PQR A;  1E7V A;  3HHM A;  2GW1 A;  1Y8M A;  4B0Z A;  1KT1 A;  3IHV A;  3OTN A;  2A4Z A;  2KC7 A;  4FLB A;  5G05 J;  4B94 A;  1DVP A;  1EPU A;  3OXG A;  4DI4 A;  3UPV A;  4CT4 A;  4I1M A;  1NA0 A;  3RIB A;  2WXJ A;  3ZGQ A;  2R59 A;  4HOQ A;  1Z3Y A;  1DNP A;  3ZN3 A;  4KT6 B;  3K9I A;  2QFC A;  4KYO B;  3CIA A;  3CHO A;  3FUH A;  3LS8 A;  2FBN A;  4F53 A;  4ANX A;  2QY7 A;  4MLP A;  3JQ0 A;  3O48 A;  4WUY A;  2OVB A;  3QC1 A;  3GYZ A;  1H19 A;  4PUC A;  4N3C A;  4AY6 A;  3CVW A;  2VSO E;  4N3A A;  1PAQ A;  4E6H A;  1LF8 A;  3ZHE A;  3I5P A;  4JA9 A;  2XPI A;  2WM9 A;  3MCX A;  4IN3 B;  2XRZ A;  2GRM A;  2XCC A;  4UI9 C;  2V0P A;  2XEV A;  4FHK A;  3MKQ A;  3QB2 A;  3ZHE B;  1U3D A;  2KM4 A;  3OAW A;  1HO8 A;  4U07 A;  3PNT B;  3AS5 A;  2A5U A;  1Z6T A;  3U64 A;  1E8Z A;  1HFA A;  2CFU A;  3ASD A;  3IV0 A;  4W9R A;  3CVU A;  4UQZ A;  3U3W A;  4UWF A;  3AU5 A;  5T8I A;  3VLD A;  1QQE A;  3FTV A;  3B7S A;  2HR2 A;  2C0M A;  1W3B A;  3LY7 A;  3L22 A;  4JHK A;  4LUN U;  3G2U A;  5FQ7 A;  2MRI A;  3CK9 A;  4PH4 B;  4I17 A;  3RRM B;  4JHJ A;  2J4B A;  3GZS A;  5JJ6 A;  3FH8 A;  2Q7F A;  1A17 A;  3FFL A;  3FU0 A;  2J08 A;  4JEU A;  5CMY A;  2IU1 A;  1H6K A;  3PVL A;  4F1S A;  4FUL A;  3FTS A;  4CT0 A;  3MV3 B;  4UWK A;  5JJ7 A;  4NQ0 A;  3G2S A;  2WXM A;  4HVB A;  3ONL A;  3SGH A;  4F7A A;  3JYS A;  4DLQ A;  3PH0 C;  2WXO A;  3BG0 B;  5J90 A;  3RRU A;  4XZ4 A;  4G11 A;  4AV7 A;  2CG2 A;  3IHY A;  2M63 A;  3EIQ C;  2KAT A;  3CVL A;  4GZ6 A;  3OXL A;  3PNL B;  1E8W A;  3HVE A;  5G04 C;  1X5B A;  2IFU A;  4N2Q A;  3FU3 A;  2VJ8 A;  3S7B A;  4NRH B;  4UWH A;  1NA3 A;  3FH7 A;  1ELR A;  2OVF A;  4F3V A;  4GZ5 A;  4LCT A;  3RU0 A;  2WXR A;  2FO7 A;  2XHE A;  3I3N A;  3IKO B;  4KXK B;  5HQ8 A;  3UUX A;  2CHX A;  3FUD A;  5CCL A;  1TJF A;  2DIW A;  4UI9 J;  4A3T A;  1HU3 A;  3KAE A;  4I6G A;  1HG5 A;  2XPY A;  2RD0 A;  2AXV A;  3TL5 A;  3R7Q A;  1UG3 A;  2J09 A;  4G2V A;  3CHP A;  2LAI A;  3MYV A;  3UT7 A;  4CEM A;  5EX0 A;  1TEZ A;  2CFZ A;  2LNI A;  3L08 A;  2XGM A;  2Y4T A;  3PUJ A;  5E75 A;  4ANW A;  1H2V C;  4GA2 A;  2XGS A;  1ZBP A;  2NXP A;  4XI0 A;  2X6I A;  3QOU A;  3NQP A;  4XE0 A;  5FQ8 A;  4I6E A;  5J08 A;  5AJD A;  4XI9 A;  4BT8 A;  2WQH A;  3KD7 A;  4GML A;  3ASG A;  3G2W A;  2XRY A;  5E76 A;  3ZXS A;  4WWN A;  3U66 A;  3UT8 A;  4G25 A;  5FTP A;  4GYW A;  1EYH A;  2HYZ A;  3QWV A;  4JXT A;  4HOR A;  4E85 A;  4DI3 A;  2CG3 A;  4BSX A;  3DBS A;  4IRU A;  2BUG A;  1QZ2 A;  3SHF A;  2VGY A;  1HZ4 A;  3FP3 A;  3LCA A;  3JQ1 A;  1E90 A;  3ENE A;  3ZYL A;  1ELK A;  2WXK A;  1GW6 A;  4B8A A;  3LDZ A;  3HIZ A;  4MKT A;  3OXF A;  4N39 A;  3HYM B;  1XGW A;  2ZU6 B;  4HLE A;  3L16 A;  5LFA A;  3CHQ A;  3CVV A;  3Q5M A;  5AYW D;  3U4T A;  4GA0 A;  3VTX A;  4I6J A;  2VYI A;  2KCK A;  4WWO A;  3FU6 A;  4GZ3 A;  3SBT B;  3AS4 A;  5G04 J;  2AWI A;  4G23 A;  4DPR A;  5FQ4 A;  5FQ6 A;  3P1U A;  3CST A;  3PS6 A;  3UX4 A;  4ILG A;  4UQY A;  4AOF A;  4EQF A;  4LEU A;  3MV2 B;  2J4D A;  5FZQ A;  4I9C A;  3FEY A;  4AM9 A;  2YHC A;  4DK5 A;  2WXL A;  4I1O B;  2YNQ A;  3B13 A;  3PDN A;  2UY1 A;  3FH5 A;  3JCK C;  5BUZ A;  3IBE A;  4JPS A;  2XQ0 A;  3G2T A;  2AXU A;  4MRU A;  2DBA A;  3LY8 A;  3ZVV A;  3ZW3 A;  2WMN A;  4IYP A;  3CHR A;  3KS2 A;  1OWL A;  2EQX A;  4N3B A;  5KJK A;  3PEU B;  4KVO A;  4AEZ C;  5AEN A;  3CLJ A;  2KZT A;  5M72 A;  4JC8 A;  4U0Z A;  3EJN A;  4J8D A;  1E8Y A;  3LVR E;  4CDM A;  4L2L A;  4I43 A;  4CCA A;  2PL2 A;  3Q49 B;  4I9E A;  1PC2 A;  5A7D B;  4EBA A;  4BT9 A;  3QAR A;  3QJZ A;  4A55 A;  2IOL A;  1P5Q A;  3BG1 B;  1Z3X A;  1FVH A;  2KZT B;  3S7J A;  2KCV A;  1HXI A;  4CDN A;  4WNF A;  4UI9 K;  1BPO A;  2X6H A;  2HM8 A;  5T3R A;  4G1T A;  4CDR A;  1HH8 A;  3MX3 A;  3LPZ A;  1FVF A;  3MKQ B;  2BF0 X;  4CGW A;  2IOS A;  3S2A A;  3LJ3 A;  2VTB A;  5BW8 C;  1H2U A;  3RO3 A;  4FA6 A;  4ILH B;  4K0R A;  3FY4 A;  4J6I A;  5D0Q D;  2L6J A;  3S7F A;  4B8C B;  3PUK A;  3FEX A;  3VLE A;  4URK A;  1UJK A;  4GA1 A;  1UJJ A;  2L9B A;  5A6C A;  1UN9 A;  3APD A;  5ENN A;  3CHS A;  4JHR A;  4APF A;  3ZEF A;  4HOT A;  3ONK A;  3ESL A;  4EBA G;  4FJY A;  4ATG A;  3KEZ A;  2YQ8 A;  2C0L A;  2Y3A A;  3LKU A;  4P29 A;  5JHB A;  4ACL A;  2WVI A;  2J49 A;  2X3M A;  4Y6W A;  1H0A A;  4JEH A;  3RRN B;  4XKB A;  4N5C A;  3R9A B;  3CEQ A;  5KCM A;  5KJM A;  3SF4 A;  3TXM A;  3Q15 A;  3FHE A;  5FWQ A;  3WXX A;  2WXQ A;  5ARG A;  2WQ7 A;  3LYA A;  3MA5 A;  4XX5 A;  2JLB A;  4G24 A;  3TXN A;  2X6K A;  3NF1 A;  5FJY A;  1HG2 A;  4GCO A;  3T5X A;  4YVQ C;  4CGV A;  2VSN A;  4AJW A;  3C98 A;  4V3I A;  5BT1 A;  1E7U A;  4QFV A;  3FDH A;  2X6J A;  4GYY A;  3ZIM A;  4D10 C;  1HE8 A;  1OWM A;  4ABN A;  3FTW A;  3HVE B;  4GZD A;  4U0U A;  1E8X A;  4FJZ A;  4ILI A;  4AP2 A;  1Y6I A;  4RVB A;  5DIZ A;  1IHG A;  1XNF A;  4ANV A;  4WAF A;  2I6H A;  5ANL A;  3TG4 A;  3CK7 A;  3L13 A;  3FUM A;  4FP7 A;  3L54 A;  4EPZ A;  4U04 A;  2UWJ G;  3CHM A;  5HI7 A;  4AIF A;  5FZR A;  1OWN A;  3ESK A;  3MEK A;  4UWG A;  2WXH A;  3PZD A;  3RO2 A;  3ZYK A;  1N54 A;  3LXU X;  4XIF A;  3FTZ A;  4BWR A;  4A1S A;  2ION A;  4HS2 A;  4C0E A;  1JWG A;  4GZC A;  3HDX A;  4UWL A;  2VSX E;  3FWV A;  2KCL A;  1E96 B;  5AIJ A;  3BEE A;  5EX3 A;  2VGX A;  1EF1 C;  2NC9 A;  5BV1 A;  2I1J A;  2I2O A;  4AY5 A;  5ARF A;  1VDY A;  3CVP A;  1SQM A;  2OOE A;  3I4G A;  4I2W A;  3R7R A;  2IF4 A;  1U3C A;  4L1B A;  3APC A;  3FUE A;  3O4Z A;  3EIJ A;  2X38 A;  4HFG A;  2LO6 A;  4XKC A;  3TJP A;  1HX8 A;  4WNG A;  2R5S A;  3ZFW A;  1HF8 A;  2WQ6 A;  3EDT B;  4AVX A;  3APF A;  4K03 A;  5T4Y A;  3DPD A;  3EHM A;  4Q96 A;  4BTA A;  1TJC A;  5CHE E;  2WXI A;  3JUI A;  4BTB A;  1WAO 1;  2ILR A;  4J8E A;  4APO A;  2PM7 A;  4ACK A;  2J9Q A;  4JL0 A;  2V8S E;  4Q94 A;  4PS7 A;  5JHA A;  4TRQ A;  1WY6 A;  3E4B A;  3ULQ A;  3QWP A;  4EZK A;  2XGO A;  3IEG A;  4I2Z A;  3SZ7 A;  5G55 A;  2I9C A;  4U63 A;  4ME2 A;  3T5V A;  3CVY A;  3D9N A;  3UT4 A;  4HXI A;  3ML8 A;  5LX8 A;  5KJL A;  2YHE A;  3CQG B;  3MZL B;  4OVV A;  1WM5 A;  1PY1 A;  3NZS A;  2X6F A;  4NAC A;  3CVX A;  3PRZ A;  3I4R B;  3CK8 A;  3RJV A;  4GMJ A;  1OWO A;  1MQS A;  4KVM A;  3CVQ A;  3D3M A;  2UY1 B;  2VQ2 A;  5D0O D;  5KJN A;  1SZ9 A;  2WXP A;  1B89 A;  2PQN A;  4R7L A;  3SNX A;  3PRE A;  5LOZ A;  2FF4 A;  1INZ A;  2NSZ A;  1EDU A;  1QNF A;  1NP7 A;  4H7X A;  4MS6 A;  2DCP A;  3D9O A;  3D9M A;  4Q69 A;  1UW4 B;  2LAH A;  4KZC A;  1IYG A;  5C2Y A;  2MHK A;  5ANR A;  4EEC A;  3URZ A;  4RSY A;  3SFZ A;  3L17 A;  3TG5 A;  2OV8 A;  1IQR A;  4H7Y A;  4J0U A;  3RKV A;  2FI7 A;  3QAQ A;  5EDS A;  4HOU A;  2V5F A;  3FUK A;  3UMV A;  3QWW A;  1JUQ A;  3CQC B;  3D9P A;  4LER A;  4KBQ A;  3VLF A;  3ZRH A;  3AU4 A;  2RG8 A;  3D9K A;  3FU5 A;  1KT0 A;  3NZU A;  3CGH A;  3PEV B;  1YA0 A;  2VTB B;  3EHN A;  4U0S A;  5BPP A;  4U8H A;  5LCW C;  3AS8 A;  2FUL A;  1JPL A;  2L0I A;  4N2S A;  3Q47 B;  4BFR A;  2OND A;  3B7R L;  3LEW A;  3S7D A;  4Y6C A;  1OUV A;  1FCH A;  2LSU A;  2V4L A;  3U9W A;  3B7U X;  4FLH A;  4KMO A;  3CV0 A;  4M3O A;  4DJA A;  3GZ2 A;  1SZA A;  2P58 C;  4JW1 A;  4OVU A;  1S0P A;  4RG6 A;  2AVP A;  5BNW A;  2AW6 A;  4KZ0 A;  4A3V A;  3FTY A;  3P2B A;  4GYO A;  4G26 A;  3T8M A;  4PS8 A;  2GGF A;  5CCM A;  5LP0 A;  3B7T A;  2BTD A;  2HO1 A;  2LSV A;  2PM6 A;  3QK0 A;  1NZN A;  4O6F A;  4PS3 A;  4RG9 A;  4AXH A;  1L5J A;  4DLO A;  3ASF A;  3GW4 A;  3CKC A;  4HOS A;  2PZI A;  4EZJ A;  3UQ3 A;  3FUL A;  2CHW A;  5CMW A;  5BV0 A;  2C2L A;  2R17 C;  3MKR A;  3SD5 A;  3TAX A;  3QNK A;  4FHJ A;  5C1D A;  1MHQ A;  5AJL A;  4I1A A;  3GZ1 A;  4J8F A;  2XPZ A;  5G2N A;  2WB2 A;  2Y4U A;  3CVN A;  4GB9 A;  4JZY A;  4ANU A;  2IJG X;  4TUU A;  4WND A;  4IUL A;  4BX8 A;  1KLX A;  5G05 C;  2IQC A;  1ELW A;  3CSF A;  4GCN A;  3ZYM A;  4BX9 A;  5FZS A;  4GU5 A;  5EKQ D;  4OYS A;  3SBS A;  4L23 A;  3D9I A;  1JWF A;  3ASH A;  3L6A A;  3CR3 A;  3D9J A;  2VSY A;  3FUN A;  2FEZ A;  4JVS A;  4TV3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...