4CGVA

First tpr of spaghetti (rpap3) bound to hsp90 peptide srmeevd
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
125
structure length
125
Chain Sequence
HVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA POLYMERASE II-ASSOCIATED PROTEIN 3
publication title Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 50
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cgvA00
2Y4TA 3KD7A 4F3VA 2PL2A 5JJ7A 1QQEA 5EX0A 1QZ2A 2VGYA 4GYWA 3RKVA 4EQFA 3EDTB 3ZHEA 4AY5A 3ASFA 3JYSA 2C0MA 4UI9K 4N3AA 4YNDA 3SF4A 3QWPA 2PQNA 4KBQA 2GW1A 3TG4A 2VQ2A 4NQ0A 3TGOA 1YA0A 3QWWA 4I17A 4G1TA 5FT9A 5FJYA 4HOTA 1WM5A 3LY9A 4GPKA 2XCBA 4KYOB 1XNFA 5KJKA 3ASHA 2PZIA 4WNGA 3OXLA 4BWRA 1FCHA 3CKBA 3CVNA 3CV0A 2XPIA 1B89A 3N71A 4W9RA 4O6FA 5A6CA 4GCNA 4AM9A 1HH8A 1IYGA 4CGVA 3IEGA 2LSVA 4CDRA 4GA2A 2Q7FA 1ELWA 4APOA 2XEVA 1A17A 3RO3A 1ZU2A 4N3BA 3OXFA 4WNDA 5G05J 4H7XA 3WXXA 2KCLA 3PDNA 5C1DA 4BTAA 4G26A 4U0UA 3ESKA 4GYYA 3Q4AB 4B94A 4BT8A 2UY1B 4WNEA 5FTPA 3Q15A 2E2EA 3LPZA 4UQYA 2C2LA 4BTBA 4JHRA 5HI7A 5BW8C 5FZSA 5G05C 3AS4A 4ME2A 3ZHEB 1TJCA 2HR2A 2HYZA 3U4TA 1PC2A 3S7JA 3HYMB 3Q49B 3MKRA 2YQ8A 5KJNA 3OXGA 3ZN3A 1ZBPA 4J8FA 4I1AA 3CVQA 3NF1A 3SZ7A 4HOQA 4Y6CA 5CCLA 3K9IA 4AY6A 3QDNA 3LYAA 1HXIA 3CEQA 4XI9A 3PE4A 1E96B 4GZ5A 5KJLA 1IHGA 4AIFA 5EX3A 3VTXA 3RO2A 3KS2A 4N5CA 3ZPJA 4CGWA 4J0UA 4J8EA 3QKYA 4JA9A 4I2WA 5M72A 5ARFA 5D0QD 1NA0A 4JL0A 2VSYA 2VGXA 4U07A 4RG6A 4YVOA 2VSNA 3QOUA 4WNFA 1OUVA 4N2SA 3AS5A 3R9AB 5KJMA 3CK9A 4Y6WA 1NZNA 4I2ZA 2P58C 5BNWA 2FI7A 3ASGA 4U0ZA 4GA1A 4N2QA 1ELRA 4NRHB 3UPVA 3CKCA 5AYWD 4G24A 2WPVA 3E4BA 2JLBA 4GA0A 2I6HA 2WQHA 2XGMA 4GCOA 2Y4UA 4UI9J 3FFLA 4I9EA 3AS8A 3CVPA 2FF4A 4GZ3A 3URZA 2QFCA 5LCWJ 5HQ8A 2FO7A 2PQRA 2MHKA 5JJTA 1WAO1 3RIBA 2UWJG 2HO1A 4N3CA 3MEKA 2VYIA 2C0LA 1Y8MA 4G25A 3CVLA 5CHEE 3LY8A 4UI9C 4YVQC 5JJ6A 4KXKB 3TG5A 2OOEA 2DBAA 3KAEA 5BT1A 1HZ4A 2KCKA 4A1SA 3ZGQA 4UQZA 4GYOA 3PE3A 5LCWC 4JA7A 4N39A 4RG9A 2YHCA 2FBNA 2J9QA 4BT9A 3CK7A 3VTYA 2AVPA 4UQXA 1W3BA 3RJVA 3Q47B 2XGSA 3BEEA 4IN3B 4G2VA 3QWVA 4GZ6A 2IF4A 1KT1A 2VGXB 3MV3B 5D0OD 5FZQA 1KLXA 3RU0A 3ZFWA 4U04A 4HOSA 2FEZA 4HOUA 5A7DB 4ABNA 1KT0A 2NC9A 3Q5MA 3GZ1A 5G04J 2XGOA 3UUXA 4H7YA 2LNIA 5DIZA 2KATA 2V5FA 3S7FA 3U3WA 5FZRA 3O48A 4LEUA 4J8DA 4G23A 2KC7A 4XI0A 3MV2B 2XCCA 1NA3A 4U0SA 2R5SA 3TAXA 3ASDA 3S7DA 3ULQA 3GW4A 3MA5A 3GYZA 3CK8A 3LY7A 1P5QA 3LKUA 4XIFA 3FWVA 5CCMA 4WUYA 3FP3A 3LCAA 5G04C 3UQ3A 2LSUA 2BUGA 3S7BA 2L6JA 2UY1A 5ARGA 5EKQD 4I9CA 2ONDA 2IFUA 5DBKA 4HORA 2KCVA 3GZ2A
chains in the Genus database with same CATH superfamily
5ANLA 2IEJA 2EILE 2WMOA 4GMJA 4DX2A 1BLXB 4AVXA 2XHEA 3RKVA 4EQFA 3CHPA 3EDTB 3ZHEA 4EBAA 4OVUA 1V55E 1S0PA 3FTYA 3SFYA 1Y6IA 5CEAA 2C0MA 4F6RD 5LFAA 4PUCA 4CT4A 4YNDA 4M7CA 1N94A 3ABME 3AJIA 1G3NB 4KBQA 5J90A 3B7UX 3SBTB 4EZJA 4KZ0A 3TL5A 3V79K 4I17A 4GMLA 3IHYA 1YYHA 4HOTA 5JA4D 4DPRA 1XNFA 3ASHA 3I5PA 3BG1B 1DNPA 1HU3A 4Q94A 3TWRA 3CVNA 1IQRA 2XPIA 3SY2A 4LSZE 3CR3A 4G8KA 4FULA 5A6CA 3Q7AA 3R7RA 2VTBA 3TWVA 3DWLG 3FUIA 5EDSA 3AG1E 1IYGA 5D2MC 1Z5SC 4JW1A 4DX6D 2Q7FA 4APOA 3L54A 4CZ2D 5AIJA 4WNDA 2MRIA 3NZSA 5G05J 4H7XA 3WXXA 3ENEA 4FLHA 3G2TA 4BFRA 5CBOA 2KCLA 2CFZA 3E32A 2WXNA 2XENA 4LCTA 1LF8A 5T4YA 1TR4A 4NIKA 1N52A 1S64A 1TNYA 4GMRA 4BSXA 5G2NA 4B93B 2P2CP 4WNEA 2XEHA 4ANWA 3BU8A 2E0IA 3R9MA 2R03A 3RSEG 4LNGA 4U8VD 5HI7A 4XE0A 3FU0A 4ILHB 1E8YA 3UM0A 1K1AA 5G05C 4BSZB 4MLPA 2GRNB 1H19A 4B89A 2V4LA 2PNNA 2R17C 2I2OA 2P9UG 5KJNA 1BI7B 1N11A 3FH5A 3D9KA 3FY4A 4F1SA 3DPYA 4DK5A 2AW6A 4I1AA 1O5MA 4JEUA 5FQ7A 5CRVA 2RD0A 5CECB 3AG2E 4YDOA 1U2VG 3CHRA 1DCQA 4GTMA 1MZCA 1E7UA 3V31A 2OEVA 2H6FA 2M63A 1Z3YA 1UN9A 3PVLA 5ENSD 3RO2A 4L2YA 2P9NG 3ZYQA 4J0UA 4I2WA 1N4PA 4XKBA 4ATGA 2VSNA 5BV1A 1PAQA 1QNFA 2P58C 2FULA 2FI7A 4TV3A 3NZUA 2IOSA 3UPVA 3F6QA 2XS1A 1X5BA 2JLBA 3DXKG 3V2XA 2WXPA 2QYUA 3RRMB 3PH0C 2HM8A 2QFCA 2I9CA 4AEZC 5HQ8A 2B0OE 2I1KA 2FO7A 1FVHA 2VSOE 2MHKA 3DSWA 2BKKB 1WAO1 2CHZA 1MJ0A 2WXIA 3V2OA 1AWCB 4HI8A 4C0EA 2MYOA 2X3MA 1N4RA 2C0LA 1SVXA 4GB9A 3T5XA 1E8XA 3LY8A 4FJZA 3E37A 2J49A 5JJ6A 4I1OB 4QQIA 4GPMA 3VLEA 3ULYA 3KAEA 1UJJA 4TRQA 5BT1A 4FLBA 1E90A 1WDYA 4BEPA 1NL4A 4A3TA 2DCPA 2CHWA 2FBNA 4FHKA 4L23A 3ZYMA 1W3BA 3MKQA 5HKPA 2NSZA 3TWWA 4GZ6A 4CDMA 3FH8A 3HDXA 2VGXB 3IXEA 5FZQA 2WXHA 3PS6A 4IULA 4HOSA 2FEZA 1QBQA 3EHRA 3OAWA 3CVWA 4HLEA 4ABNA 2V5QC 3L82A 3ZVVA 3Q78A 2L6BA 2XZTG 4ZHBA 2KATA 3C3QA 3S7FA 3J5QB 2BEDA 1TN8A 4BESA 1TNBA 4FP7A 3W9GA 3R7QA 4U0SA 2R5SA 1IKND 4F1PA 3ULQA 3FTVA 3GW4A 3MA5A 4LERA 2ETAA 1P5QA 4XIFA 3FWVA 3I4GA 5B1AE 1OCOE 1S70B 4L9PA 2AWIA 4ILIA 5ARGA 5EKQD 1OCCE 3FTSA 2MOWA 4K5BA 1IHBA 4UWFA 4CYMD 3FEYA 2WXJA 5JHAA 2BF0X 5JJ7A 1QQEA 2J4BA 3ML8A 3QAQA 1UW4B 3T5VA 3UKUG 3DSXA 3ASFA 2XPZA 1HX8A 1SZ9A 4GTOA 4HRNA 4MRUA 2L0IA 3T8KA 1AP7A 3LVRE 4UI9K 4N3AA 4RVBA 1SA5A 2ILRA 3TG4A 4K5CA 1OXJA 3ZEFA 4NQ0A 3TGOA 1YA0A 3L16A 1MX2A 5FJYA 3UMVA 3KEAA 5BV0A 4U96D 4I6GA 2GRPB 4GTPA 4O60A 2WXGA 2A5EA 4HRMB 3OXLA 1X81A 3CKBA 1L5JA 4CRWA 3BUAA 4YDWA 4O1PA 5B1BE 3D9LA 4W9RA 2VTBB 4O6FA 5KNHD 3TWSA 4GCNA 4AM9A 3IEGA 2BTDA 4JZYA 4JD2G 1TNOA 1TNUA 3SNXA 1EYHA 3ZIMA 1KZOA 2X6FA 4AV7A 3D3MA 4BTAA 3NOCD 4G26A 4KVOA 3Q4AB 5KCMA 3ZRHA 3L22A 3NOGD 5ENNA 2UY1B 2I1JA 2P9SG 3CVYA 1XGWA 3Q9NC 3B7TA 2E2EA 3EHMA 3LPZA 1UN8A 2WXRA 2A5UA 3DBSA 4JHRA 3I3NA 3UX4A 4K0RA 1N0RA 2IOLA 1N95A 2VJ8A 4R7LA 5ENTD 2LXLA 3DEOA 3S7JA 2GROB 1OY3D 3RK6A 2NXPA 3SO8A 3ZN3A 4C0MA 4LG6A 2XRYA 3FUDA 2QY7A 4FU3A 3CVQA 3NF1A 4G8LA 3SZ7A 2P9KG 4HOQA 4Y6CA 1VDYA 1N4SA 1TN7A 3NBNB 1HXIA 4XI9A 3TWQA 1H6OA 1OWNA 5KJLA 4B8CB 3Q73A 2R02A 5FQ8A 2ZU6B 3AU5A 3I4RB 5AN8A 3PZ4A 3VTXA 2LUHA 3SFXA 3KS2A 3ZPJA 2EIME 1JPLA 4CGWA 3APFA 3QKYA 4JA9A 1ZB1A 4UWLA 5ARFA 1H2UA 2KBXA 2X38A 2VSYA 2QZAA 5AENA 3B13A 4KVMA 5KJMA 4Y6WA 4I2ZA 2YNQA 4U0ZA 3ZKJA 4GA1A 4N2QA 1ELRA 4A55A 1FVFA 3CQGB 5AYWD 4HRLA 3QC1A 4APFA 3E4BA 4GA0A 2I6HA 3ZYLA 1FT1A 2WQHA 2XGMA 3DSVA 4GCOA 4YDEA 1JWGA 2WQ6A 5FQ6A 4I9EA 1EPUA 2J4DA 3ONKA 2XPYA 3CVPA 3TXNA 2AJAA 4MKTA 3URZA 3J5PA 3FTUA 4YDYA 4ANUA 1U3DA 2PQRA 5T8IA 2ZISA 1FT2A 5JJTA 4CCAA 3RIBA 4EZLA 2UWJG 3PRZA 4CDNA 1UJKA 1QYMA 4RLYA 3DXMG 2RFMA 3ZUVB 4PDXA 4EHMA 1Y8MA 4G25A 1LTXA 3ASOE 4EECA 3CQCB 3BG0B 3FTWA 3QNKA 2DBAA 2KCKA 3ZGQA 4GYOA 3B7RL 3UIPC 1A5EA 5LP0A 4QFVA 4DI4A 2H6HA 4RG9A 4K5AB 4A1GA 3CHOA 3RAUA 1N9AA 5EYPF 3VTYA 3MKQB 3ABLE 2OV8A 3RJVA 4U8YD 3ABKE 3PNLB 4IN3B 4U95D 3TJPA 1JCQA 1KT1A 4J7WA 4XKCA 2GGFA 3KEZA 5D0OD 1LD8A 2JEKA 1KLXA 1E8WA 2P9LG 3CSTA 3RU0A 3HXFA 3L9TA 4Q96A 5AQ9A 1INZA 1H6KA 2BKGA 3D9JA 5FWQA 3UUXA 4H7YA 5DIZA 3JUEA 2IJGX 4GTSA 1NI1A 2V5FA 4G23A 2DZNA 2KC7A 3LJ3A 1OCRE 2EIKE 1H2TC 1YCSB 1JCSA 4EBAG 3TAXA 4OAUC 3UTMA 3WG7E 3GYZA 3LY7A 4J8YA 4WUYA 2GRRB 3DSTA 4LRZA 5AQAA 3C3RA 2LSUA 2BUGA 4FHJA 2QC9A 5J08A 2ONDA 4BETA 1OWMA 5DBKA 3CIAA 3GZ2A 4HB5A 3TWXA 2Y4TA 4HLLA 2V0PA 4F3VA 2PL2A 5EX0A 5CERB 2VGYA 5ENQD 4GYWA 5ANRA 3HXBA 5H7PA 2X6IA 3B95A 5B3SE 2DWZA 2Y0BG 2Y3AA 2WXFA 3O4ZA 2VSXE 4NACA 4IYPA 4P29A 5ENOD 1RW2A 1OWOA 1MX4A 4RQIA 4GTVA 2CG3A 4FA6A 4DX7D 2GW1A 5IY5E 4UUCA 4GZDA 3ML9A 3JUIA 2VQ2A 1V54E 3QB2A 2XZDG 3QWWA 5AJDA 3NB2A 4A63B 5FT9A 1MQSA 1UOHA 2X6JA 1LD7A 4GPKA 2XCBA 4KYOB 4DRXE 3HXEA 2IONA 4WNGA 1FCHA 3FUHA 3UT7A 3CV0A 3VLFA 1BU9A 4FADA 2AXUA 4GU5A 3HXDA 4CDRA 4GA2A 1ELWA 2XEVA 3RO3A 2XQ0A 4D10C 1MHQA 3MJWA 4AP2A 2DVWA 4BX9A 3G2SA 2PM6A 3E34A 4AJWA 1HO8A 2P9IG 4GTQA 2L9BA 3PDNA 4BX8A 5KBAA 1HF8A 3PZDA 2WXKA 3ESKA 3BQOA 4HXIA 2ZXWE 4L7TA 2OVFA 2R59A 3IHVA 3FTXA 4B94A 5JHBA 3TWTA 2F8YA 5AQ7A 5D66A 3Q15A 4UQYA 2C2LA 3ISMC 3ZXPA 2J09A 1PY1A 1BI8B 5AARA 2XS8A 1OT8A 5BW8C 2B6CA 1GW6A 3U9WA 2QYJA 3AS4A 3ZHEB 3OTNA 4KMOA 3UM2A 2HR2A 2HYZA 3E33A 3U4TA 4F53A 4JHKA 1ELKA 2OCCE 3MKRA 2YQ8A 3OXGA 4OAVB 3L13A 2RFAA 3HG0D 4HS2A 2ZIRA 3RRNB 5CCLA 1OWPA 4A3VA 3QDNA 2X6HA 4UWGA 3LYAA 2H6GA 5CMYA 4AOFA 1TJFA 1N54A 1IXVA 1E96B 4GZ5A 4Z68A 3AAAC 3GZSA 3VLDA 1IHGA 3JXJA 3U66A 4FC8A 2J8SD 2R2LA 4OYSA 3LVQE 5EN5D 4PH4B 1HS6A 2IU1A 4N5CA 5ENRD 1E7VA 4J8EA 3FUNA 3CVVA 4DJAA 3PZ1A 5M72A 5D0QD 1S63A 4JL0A 1HE8A 1HG5A 3UI2A 2VGXA 3MGBA 4CEMA 4U07A 4URKA 4RG6A 4DLQA 4LNUD 4WNFA 2F8XK 4N2SA 3AS5A 3R9AB 3UT8A 1NZNA 5BNWA 1D9SA 1EDUA 4NRHB 5FINA 3CGHA 4L1BA 4HVBA 1MX6A 3KSLA 3DRAA 4WWPA 1WY6A 2AXVA 3SGHA 1D8EA 3CHQA 1MYOA 3LDZA 4X8QA 4GZ3A 3FU3A 4HNAD 4LUNU 5LCWJ 4I43A 4J8SA 1EF1C 2YINA 3P1UA 3JXIA 2LAIA 2WXLA 3HVEA 4OVVA 4TUMA 3ZW3A 3UT4A 1O1SA 4XZ4A 3LS8A 4UWKA 2HO1A 4N3CA 1JUQA 3MEKA 2PM7A 1N0QA 5C2YA 5KWDA 3CVLA 3FUJA 5CHEE 4U63A 4YVQC 3C5RA 4KXKB 3TG5A 2OOEA 4I6JA 5JMND 2WVIA 1BPOA 4A1SA 3EU9A 4K03A 3IV0A 3FU5A 3PE3A 5LCWC 3DEPA 4JA7A 4N39A 2KZTA 3FUEA 2GRQB 2J9QA 4DX1A 1OCZE 4BT9A 3CK7A 1TEZA 1D8DA 3D9MA 4EZKA 4FJYA 4ATZD 2LXMA 1OWLA 2XGSA 1SZAA 3ZNGA 4ANXA 5FIOA 4G2VA 3QWVA 3CVXA 5EIBE 5BUZA 3V30A 4M3OA 3FUKA 2GRMA 4B8AA 1YMPA 4I6EA 3ZFWA 4ZFHA 2XEEA 2AXZA 3EJNA 3FTZA 5EIDA 2ZGDA 3Q75A 1KT0A 2IQCA 3JQ0A 3E30A 3GZ1A 2DYSE 2Y1LE 5G04J 3HHMA 5BXUA 2LNIA 4ACKA 1E8ZA 3KSQA 2HE0A 4BY6A 4J6IA 4U8HA 3U3WA 4RSYA 3ESLA 5FZRA 3SQVA 3O48A 1UG3A 4LNBA 4DI3A 4LEUA 4Q69A 1BD8A 4XI0A 3PUJA 3MV2B 3TXMA 3EHQA 3G2UA 2XCCA 3ZU7B 5CEDB 3S7DA 2WM9A 3CK8A 1H0AA 3LKUA 4G11A 1TNZA 5CCMA 1DCEA 3FP3A 3LCAA 5G04C 3UQ3A 3S7BA 3SBSA 5CRUA 2UY1A 3IBEA 2ETCA 2FO1E 4HORA 3CSFA 3FHEA 4JB8P 1KZPA 3DSUA 1KPSB 3KD7A 1QZ2A 4MS6A 4L2LA 5LOZA 2KM4A 3T9KA 3ASNE 4AY5A 2OEWA 3QARA 1WG0A 2DZOA 3FEXA 1Z3XA 1Q2ZA 3JYSA 3PREA 2WXMA 3S2AA 4HI9A 2P9PG 3SF4A 3QWPA 4IRUA 2PQNA 5EYLA 3MX3A 3SI5A 4MBGA 3T8MA 1Z6TA 4G1TA 3Q7FA 4JXTA 4V3IA 1HG2A 1WM5A 3LY9A 3PNTB 4U7EB 4BERA 5KJKA 2PZIA 5AAOA 4GZCA 4BWRA 4ILGA 2X6KA 1B89A 3N71A 3FH7A 1HH8A 4CGVA 1U3CA 2LSVA 2LAHA 2VGEA 3FUMA 3JQ1A 4JEHA 5HRYA 2ETBA 4UWHA 3FDHA 1A17A 3UKRG 1ZU2A 4N3BA 3RRUA 3OXFA 2F0YA 3ULEG 2NYJA 5C1DA 3EIQC 3EIJA 4U0UA 3L6AA 3FUFA 4GYYA 4I1MA 1O1RA 3LEWA 4BT8A 3APDA 4ANVA 3MCXA 2V8SE 3EU5A 5FTPA 4TUUA 3AU4A 4BTBA 2J07A 2WXQA 1HFAA 2IO2C 3D9OA 5FZSA 3PEVB 4ME2A 1TJCA 3UM3A 3UINC 5E75A 4HQDA 1PC2A 3CHMA 4WWOA 3HYMB 3Q49B 2J08A 4WWNA 4GTTA 1H2VC 3L08A 4KZCA 1ZBPA 4J8FA 4AXHA 3SHFA 3K9IA 4AY6A 2CG2A 3CEQA 3PE4A 2RG8A 4JHJA 2WMNA 4CT0A 4AIFA 1O1TA 5EX3A 3D9HA 1SQMA 5CMWA 3UXGA 3C98A 2WXOA 2IY0C 4NURA 1JCRA 4DX5D 1NA0A 2F37A 4JPSA 5T3RA 4YVOA 1TYQG 4N5QA 3QOUA 2CHXA 1OUVA 3CK9A 1SA4A 3QJZA 3ASGA 3B7BA 3CKCA 3Q79A 5EILA 4ACLA 4GAAA 4G24A 4O1OA 3CVUA 2WPVA 2EINE 3U64A 5A23A 2OVBA 2A4ZA 2Y4UA 4UI9J 3FFLA 5AJLA 3AS8A 1JWFA 2FF4A 4DLOA 1IQUA 1DC2A 4JVSA 4TXPA 4B0ZA 4PS8A 2YHEA 4XEIG 2GRLA 3C72A 1NP7A 3AG3E 5ENPD 3D9PA 2Y69E 3G2WA 4C48B 2WQ7A 3HRAA 1DVPA 4C9BB 3HVEB 3B7SA 3ZYKA 3FU6A 3EHNA 2L0TB 3D9NA 3APCA 3W9FA 2ZGGA 2VYIA 3MYVA 5FQ4A 1K1BA 4UI9C 2CFUA 3D9IA 4TXQA 4EPZA 3Q9UC 5CBNA 2JABA 1HZ4A 1K8KG 4UQZA 3HXCA 5BPPA 5AQBA 1TN6A 2H6IA 3NQPA 2KZTB 4GTRA 2YHCA 3CLJA 3HIZA 3PZ3A 3JCKC 3P2BA 2DIWA 1RZ4A 4DUIA 4TXRA 3NAWA 3FULA 2AVPA 4UQXA 2R05A 4PS7A 3Q47B 4JC8A 3BEEA 5G55A 4HFGA 5LX8A 3G2VA 2IF4A 3PUKA 2EIJE 4E6HA 3SD5A 3MZLB 3MV3B 2V4HC 2KXPC 2WB2A 3DSSA 4U04A 4HOUA 3SFZA 5A7DB 5BXOA 3PZ2A 3IKOB 2NC9A 3Q5MA 4XX5A 1NFIE 2XGOA 1SW6A 2DYRE 2RKKA 4KT6B 5KNGA 2EQXA 5HS0A 2LO6A 3L17A 3PEUB 4E85A 3UM1A 5E76A 3DPDA 4J8DA 3LXUX 3AG4E 5ITZF 4HBDA 3EUVA 3C3OA 1H6PA 1NA3A 1K3ZD 3UIOC 1N4QA 3ASDA 4F7AA 3LJNA 3CHSA 2IO3C 4WAFA 2L6JA 4PS3A 3X2QE 3QK0A 4I9CA 2IFUA 3ZXSA 3TWUA 1FPPA 2KCVA 2XRZA 3ONLA
chains in the Genus database with same CATH topology
5ANLA 2Y4TA 3FEYA 2WXJA 3KD7A 5JHAA 2V0PA 4F3VA 2BF0X 2PL2A 5JJ7A 1QQEA 2WMOA 5EX0A 2J4BA 1QZ2A 2VGYA 3ML8A 4GMJA 4MS6A 4GYWA 5ANRA 3QAQA 4L2LA 5LOZA 4AVXA 2XHEA 1UW4B 3RKVA 4EQFA 3T5VA 3CHPA 2KM4A 3EDTB 3ZHEA 4AY5A 3ASFA 2X6IA 2XPZA 3QARA 3FEXA 1HX8A 4EBAA 1SZ9A 2Y3AA 4OVUA 1Z3XA 3JYSA 2WXFA 4MRUA 3PREA 2L0IA 2WXMA 3O4ZA 1S0PA 2VSXE 3S2AA 4NACA 3FTYA 4IYPA 4P29A 3LVRE 1Y6IA 2C0MA 1OWOA 4UI9K 5LFAA 4PUCA 4CT4A 4N3AA 4RVBA 4YNDA 2CG3A 3SF4A 3QWPA 4FA6A 4IRUA 2PQNA 4KBQA 2GW1A 2ILRA 4GZDA 3MX3A 3ML9A 5J90A 3SI5A 3JUIA 2VQ2A 3B7UX 3TG4A 3SBTB 3ZEFA 4EZJA 4NQ0A 3QB2A 3ONLA 4KZ0A 3TGOA 3T8MA 3TL5A 1YA0A 1Z6TA 3QWWA 3L16A 5AJDA 4I17A 4GMLA 4G1TA 5FT9A 4JXTA 3IHYA 1MQSA 5FJYA 2X6JA 1HG2A 4V3IA 3UMVA 4HOTA 5BV0A 1WM5A 3LY9A 4I6GA 4GPKA 3PNTB 2XCBA 2WXGA 4KYOB 4DPRA 1XNFA 5KJKA 3ASHA 2PZIA 3I5PA 2IONA 3OXLA 4WNGA 3BG1B 1DNPA 4GZCA 4BWRA 1HU3A 4Q94A 1FCHA 3CKBA 1L5JA 4ILGA 3CVNA 3FUHA 4CRWA 1IQRA 3UT7A 3CV0A 2X6KA 3VLFA 2XPIA 1B89A 3D9LA 3N71A 4W9RA 4FADA 3CR3A 4FULA 4O6FA 5A6CA 3R7RA 2VTBB 3FH7A 2VTBA 3FUIA 5EDSA 4GCNA 2AXUA 4AM9A 1HH8A 1IYGA 4GU5A 4CGVA 3IEGA 2BTDA 4JZYA 1U3CA 2LSVA 4JW1A 2LAHA 3FUMA 4CDRA 3JQ1A 4GA2A 4JEHA 3SNXA 2Q7FA 1ELWA 4APOA 1EYHA 4UWHA 3FDHA 3L54A 2XEVA 3ZIMA 1A17A 3RO3A 2XQ0A 4D10C 1MHQA 3MJWA 1ZU2A 4N3BA 3RRUA 5AIJA 4AP2A 2X6FA 3OXFA 4WNDA 2MRIA 3NZSA 5G05J 4H7XA 4AV7A 3WXXA 3ENEA 4FLHA 3G2SA 4BX9A 2PM6A 4AJWA 1HO8A 3G2TA 4BFRA 2KCLA 2CFZA 2WXNA 2L9BA 3PDNA 4BX8A 3D3MA 5C1DA 1HF8A 3EIQC 4BTAA 3EIJA 3PZDA 2WXKA 4G26A 4LCTA 1LF8A 4U0UA 3L6AA 3ESKA 3FUFA 4GYYA 5T4YA 4KVOA 3Q4AB 5KCMA 4HXIA 4L7TA 4I1MA 2OVFA 2R59A 3IHVA 3ZRHA 3FTXA 3L22A 1N52A 4B94A 3LEWA 4BT8A 4BSXA 5JHBA 5ENNA 5G2NA 3APDA 2UY1B 4WNEA 4ANVA 2I1JA 2V8SE 3MCXA 3CVYA 1XGWA 4ANWA 3B7TA 5FTPA 2E0IA 3Q15A 2E2EA 3EHMA 3LPZA 4TUUA 4UQYA 1UN8A 2C2LA 2WXRA 3AU4A 2A5UA 3DBSA 4BTBA 2J07A 4JHRA 2J09A 1PY1A 2WXQA 3I3NA 5HI7A 1HFAA 4XE0A 5BW8C 3FU0A 4K0RA 3UX4A 4ILHB 1E8YA 3D9OA 5FZSA 2IOLA 5G05C 1GW6A 3PEVB 4MLPA 3U9WA 1H19A 2VJ8A 3AS4A 4ME2A 3ZHEB 3OTNA 1TJCA 4KMOA 4R7LA 2HR2A 2HYZA 3U4TA 4F53A 5E75A 1PC2A 3CHMA 4JHKA 4WWOA 4B89A 2V4LA 1ELKA 3S7JA 3HYMB 2R17C 2I2OA 3Q49B 3RK6A 3MKRA 2NXPA 2J08A 2YQ8A 5KJNA 3OXGA 4WWNA 3ZN3A 3FH5A 3D9KA 3FY4A 4C0MA 4F1SA 4DK5A 2XRYA 3L13A 1H2VC 2AW6A 3L08A 4KZCA 1ZBPA 3FUDA 4J8FA 2QY7A 4I1AA 4AXHA 4FU3A 4HS2A 3CVQA 4JEUA 3NF1A 5FQ7A 3SZ7A 2RD0A 4HOQA 4Y6CA 3SHFA 1VDYA 5CCLA 3K9IA 3RRNB 4AY6A 1OWPA 4A3VA 3CHRA 2CG2A 2X6HA 3QDNA 4UWGA 3LYAA 1HXIA 3CEQA 4XI9A 5CMYA 3PE4A 4AOFA 1TJFA 1N54A 2RG8A 1E7UA 1E96B 4GZ5A 4JHJA 2WMNA 1OWNA 3GZSA 4CT0A 5KJLA 3VLDA 1IHGA 4AIFA 4B8CB 3U66A 2M63A 4FC8A 1Z3YA 1UN9A 3PVLA 5EX3A 5FQ8A 2ZU6B 3AU5A 3I4RB 4OYSA 1SQMA 3LVQE 3VTXA 4PH4B 1HS6A 2IU1A 3RO2A 4L2YA 3KS2A 4N5CA 3ZPJA 3ZYQA 1JPLA 3C98A 4J0UA 3APFA 1E7VA 2WXOA 4J8EA 4CGWA 3FUNA 3QKYA 4NURA 3CVVA 4DJAA 4JA9A 4I2WA 4XKBA 4UWLA 5M72A 5ARFA 4ATGA 5D0QD 1NA0A 1H2UA 4JL0A 1HE8A 2X38A 1HG5A 4JPSA 2VSYA 5AENA 2VGXA 3MGBA 4CEMA 4U07A 4URKA 4RG6A 5T3RA 4YVOA 4DLQA 2VSNA 5BV1A 3QOUA 2CHXA 3B13A 4WNFA 1OUVA 4N2SA 3AS5A 4KVMA 3R9AB 1PAQA 1QNFA 3UT8A 5KJMA 3CK9A 3QJZA 4Y6WA 1NZNA 4I2ZA 2P58C 5BNWA 2FULA 2FI7A 2YNQA 3ASGA 4U0ZA 4TV3A 4GA1A 3NZUA 4N2QA 1ELRA 1EDUA 4NRHB 2IOSA 4A55A 3UPVA 1FVFA 3CKCA 3CGHA 3CQGB 5AYWD 4L1BA 4ACLA 4GAAA 4HVBA 4G24A 3CVUA 4WWPA 1WY6A 2WPVA 3QC1A 4APFA 1X5BA 3E4BA 2JLBA 4GA0A 2I6HA 2AXVA 3U64A 3SGHA 2WQHA 2OVBA 2XGMA 2A4ZA 4GCOA 3ZYLA 5A23A 2Y4UA 1JWGA 4UI9J 2WQ6A 3FFLA 5AJLA 3CHQA 5FQ6A 3LDZA 4I9EA 1EPUA 2J4DA 3ONKA 2WXPA 2XPYA 3AS8A 1JWFA 3CVPA 2FF4A 4DLOA 1IQUA 3TXNA 4GZ3A 3RRMB 3FU3A 4MKTA 3URZA 4JVSA 4B0ZA 3PH0C 4PS8A 3FTUA 2HM8A 2QFCA 2YHEA 4I43A 4LUNU 5LCWJ 2I9CA 4AEZC 4J8SA 2GRLA 1NP7A 4ANUA 1EF1C 5HQ8A 2I1KA 2FO7A 1FVHA 3D9PA 2VSOE 1U3DA 2MHKA 2PQRA 2YINA 3G2WA 3P1UA 5T8IA 2WQ7A 1DVPA 5JJTA 1WAO1 4C9BB 3HVEB 4CCAA 2LAIA 3RIBA 2CHZA 2WXLA 3B7SA 3HVEA 4OVVA 4EZLA 3ZW3A 3UT4A 2UWJG 2WXIA 3PRZA 3ZYKA 4CDNA 1UJKA 3FU6A 4C0EA 3EHNA 2L0TB 3D9NA 4XZ4A 3LS8A 2HO1A 3APCA 4N3CA 4UWKA 1JUQA 2X3MA 3MEKA 3MYVA 2VYIA 2C0LA 4PDXA 2PM7A 5C2YA 4GB9A 1Y8MA 4G25A 3CVLA 3FUJA 5FQ4A 3T5XA 1E8XA 5CHEE 3LY8A 4FJZA 4UI9C 2CFUA 2J49A 4U63A 4EECA 4YVQC 5JJ6A 3CQCB 3BG0B 3FTWA 3D9IA 4I1OB 4KXKB 3TG5A 2OOEA 3VLEA 4EPZA 3QNKA 4I6JA 2DBAA 3KAEA 1UJJA 4TRQA 2WVIA 5BT1A 4FLBA 1BPOA 1HZ4A 1E90A 2KCKA 4A1SA 3ZGQA 4UQZA 4K03A 4GYOA 3B7RL 5BPPA 3IV0A 3FU5A 3PE3A 5LCWC 5LP0A 4QFVA 4DI4A 4JA7A 3NQPA 2KZTB 4N39A 4RG9A 4A3TA 2KZTA 2DCPA 2YHCA 3CLJA 3FUEA 3HIZA 4A1GA 3JCKC 3P2BA 2DIWA 2CHWA 2FBNA 3CHOA 2J9QA 4BT9A 4FHKA 4L23A 3CK7A 3VTYA 3ZYMA 3FULA 2AVPA 3MKQB 4UQXA 1TEZA 1W3BA 4PS7A 2OV8A 3MKQA 3RJVA 4EZKA 3D9MA 4FJYA 3Q47B 4JC8A 2XGSA 1OWLA 3PNLB 1SZAA 3BEEA 5G55A 4IN3B 3TJPA 4ANXA 2NSZA 4G2VA 3QWVA 4HFGA 5LX8A 4GZ6A 3G2VA 4CDMA 3CVXA 2IF4A 3FH8A 3PUKA 3HDXA 5BUZA 1KT1A 4E6HA 2VGXB 4M3OA 3FUKA 3MZLB 2GGFA 4XKCA 3SD5A 3KEZA 3MV3B 2GRMA 5D0OD 5FZQA 4B8AA 2JEKA 2WXHA 1KLXA 4I6EA 1E8WA 2WB2A 3CSTA 3RU0A 3PS6A 3ZFWA 4Q96A 4U04A 4IULA 4HOSA 1INZA 2FEZA 2AXZA 3EJNA 3OAWA 3FTZA 4HOUA 5A7DB 3SFZA 3CVWA 1H6KA 4HLEA 4ABNA 1KT0A 2IQCA 3ZVVA 3IKOB 2NC9A 3JQ0A 3Q5MA 3D9JA 3GZ1A 4XX5A 5G04J 2XGOA 3HHMA 5FWQA 3UUXA 4H7YA 2LNIA 5DIZA 4ACKA 2KATA 1E8ZA 4KT6B 2IJGX 4BY6A 2EQXA 2V5FA 4J6IA 2LO6A 3L17A 4U8HA 3S7FA 3U3WA 4RSYA 3ESLA 5FZRA 3O48A 3PEUB 4E85A 1UG3A 5E76A 3DPDA 4DI3A 4LEUA 4J8DA 4Q69A 3LXUX 4G23A 2KC7A 4XI0A 3PUJA 3MV2B 3LJ3A 3TXMA 4FP7A 3G2UA 2XCCA 1NA3A 3R7QA 4U0SA 2R5SA 1H2TC 4EBAG 3TAXA 3ASDA 3S7DA 3ULQA 3FTVA 4F7AA 3GW4A 2WM9A 3MA5A 4LERA 3GYZA 5CMWA 3CK8A 1H0AA 3LY7A 1P5QA 3LKUA 3CHSA 4XIFA 3FWVA 4G11A 5CCMA 4WUYA 4WAFA 4LRZA 3FP3A 3I4GA 3LCAA 5G04C 3UQ3A 2LSUA 2BUGA 4FHJA 3S7BA 3SBSA 2L6JA 4PS3A 2AWIA 2UY1A 5J08A 3IBEA 4ILIA 5ARGA 3QK0A 4I9CA 5EKQD 2ONDA 1OWMA 2IFUA 3ZXSA 3FTSA 2MOWA 5DBKA 3CIAA 4HORA 3CSFA 3FHEA 4UWFA 2KCVA 2XRZA 3GZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4T A;  3KD7 A;  4F3V A;  2PL2 A;  5JJ7 A;  1QQE A;  5EX0 A;  1QZ2 A;  2VGY A;  4GYW A;  3RKV A;  4EQF A;  3EDT B;  3ZHE A;  4AY5 A;  3ASF A;  3JYS A;  2C0M A;  4UI9 K;  4N3A A;  4YND A;  3SF4 A;  3QWP A;  2PQN A;  4KBQ A;  2GW1 A;  3TG4 A;  2VQ2 A;  4NQ0 A;  3TGO A;  1YA0 A;  3QWW A;  4I17 A;  4G1T A;  5FT9 A;  5FJY A;  4HOT A;  1WM5 A;  3LY9 A;  4GPK A;  2XCB A;  4KYO B;  1XNF A;  5KJK A;  3ASH A;  2PZI A;  4WNG A;  3OXL A;  4BWR A;  1FCH A;  3CKB A;  3CVN A;  3CV0 A;  2XPI A;  1B89 A;  3N71 A;  4W9R A;  4O6F A;  5A6C A;  4GCN A;  4AM9 A;  1HH8 A;  1IYG A;  4CGV A;  3IEG A;  2LSV A;  4CDR A;  4GA2 A;  2Q7F A;  1ELW A;  4APO A;  2XEV A;  1A17 A;  3RO3 A;  1ZU2 A;  4N3B A;  3OXF A;  4WND A;  5G05 J;  4H7X A;  3WXX A;  2KCL A;  3PDN A;  5C1D A;  4BTA A;  4G26 A;  4U0U A;  3ESK A;  4GYY A;  3Q4A B;  4B94 A;  4BT8 A;  2UY1 B;  4WNE A;  5FTP A;  3Q15 A;  2E2E A;  3LPZ A;  4UQY A;  2C2L A;  4BTB A;  4JHR A;  5HI7 A;  5BW8 C;  5FZS A;  5G05 C;  3AS4 A;  4ME2 A;  3ZHE B;  1TJC A;  2HR2 A;  2HYZ A;  3U4T A;  1PC2 A;  3S7J A;  3HYM B;  3Q49 B;  3MKR A;  2YQ8 A;  5KJN A;  3OXG A;  3ZN3 A;  1ZBP A;  4J8F A;  4I1A A;  3CVQ A;  3NF1 A;  3SZ7 A;  4HOQ A;  4Y6C A;  5CCL A;  3K9I A;  4AY6 A;  3QDN A;  3LYA A;  1HXI A;  3CEQ A;  4XI9 A;  3PE4 A;  1E96 B;  4GZ5 A;  5KJL A;  1IHG A;  4AIF A;  5EX3 A;  3VTX A;  3RO2 A;  3KS2 A;  4N5C A;  3ZPJ A;  4CGW A;  4J0U A;  4J8E A;  3QKY A;  4JA9 A;  4I2W A;  5M72 A;  5ARF A;  5D0Q D;  1NA0 A;  4JL0 A;  2VSY A;  2VGX A;  4U07 A;  4RG6 A;  4YVO A;  2VSN A;  3QOU A;  4WNF A;  1OUV A;  4N2S A;  3AS5 A;  3R9A B;  5KJM A;  3CK9 A;  4Y6W A;  1NZN A;  4I2Z A;  2P58 C;  5BNW A;  2FI7 A;  3ASG A;  4U0Z A;  4GA1 A;  4N2Q A;  1ELR A;  4NRH B;  3UPV A;  3CKC A;  5AYW D;  4G24 A;  2WPV A;  3E4B A;  2JLB A;  4GA0 A;  2I6H A;  2WQH A;  2XGM A;  4GCO A;  2Y4U A;  4UI9 J;  3FFL A;  4I9E A;  3AS8 A;  3CVP A;  2FF4 A;  4GZ3 A;  3URZ A;  2QFC A;  5LCW J;  5HQ8 A;  2FO7 A;  2PQR A;  2MHK A;  5JJT A;  1WAO 1;  3RIB A;  2UWJ G;  2HO1 A;  4N3C A;  3MEK A;  2VYI A;  2C0L A;  1Y8M A;  4G25 A;  3CVL A;  5CHE E;  3LY8 A;  4UI9 C;  4YVQ C;  5JJ6 A;  4KXK B;  3TG5 A;  2OOE A;  2DBA A;  3KAE A;  5BT1 A;  1HZ4 A;  2KCK A;  4A1S A;  3ZGQ A;  4UQZ A;  4GYO A;  3PE3 A;  5LCW C;  4JA7 A;  4N39 A;  4RG9 A;  2YHC A;  2FBN A;  2J9Q A;  4BT9 A;  3CK7 A;  3VTY A;  2AVP A;  4UQX A;  1W3B A;  3RJV A;  3Q47 B;  2XGS A;  3BEE A;  4IN3 B;  4G2V A;  3QWV A;  4GZ6 A;  2IF4 A;  1KT1 A;  2VGX B;  3MV3 B;  5D0O D;  5FZQ A;  1KLX A;  3RU0 A;  3ZFW A;  4U04 A;  4HOS A;  2FEZ A;  4HOU A;  5A7D B;  4ABN A;  1KT0 A;  2NC9 A;  3Q5M A;  3GZ1 A;  5G04 J;  2XGO A;  3UUX A;  4H7Y A;  2LNI A;  5DIZ A;  2KAT A;  2V5F A;  3S7F A;  3U3W A;  5FZR A;  3O48 A;  4LEU A;  4J8D A;  4G23 A;  2KC7 A;  4XI0 A;  3MV2 B;  2XCC A;  1NA3 A;  4U0S A;  2R5S A;  3TAX A;  3ASD A;  3S7D A;  3ULQ A;  3GW4 A;  3MA5 A;  3GYZ A;  3CK8 A;  3LY7 A;  1P5Q A;  3LKU A;  4XIF A;  3FWV A;  5CCM A;  4WUY A;  3FP3 A;  3LCA A;  5G04 C;  3UQ3 A;  2LSU A;  2BUG A;  3S7B A;  2L6J A;  2UY1 A;  5ARG A;  5EKQ D;  4I9C A;  2OND A;  2IFU A;  5DBK A;  4HOR A;  2KCV A;  3GZ2 A; 
#chains in the Genus database with same CATH topology
 5ANL A;  2IEJ A;  2EIL E;  2WMO A;  4GMJ A;  4DX2 A;  1BLX B;  4AVX A;  2XHE A;  3RKV A;  4EQF A;  3CHP A;  3EDT B;  3ZHE A;  4EBA A;  4OVU A;  1V55 E;  1S0P A;  3FTY A;  3SFY A;  1Y6I A;  5CEA A;  2C0M A;  4F6R D;  5LFA A;  4PUC A;  4CT4 A;  4YND A;  4M7C A;  1N94 A;  3ABM E;  3AJI A;  1G3N B;  4KBQ A;  5J90 A;  3B7U X;  3SBT B;  4EZJ A;  4KZ0 A;  3TL5 A;  3V79 K;  4I17 A;  4GML A;  3IHY A;  1YYH A;  4HOT A;  5JA4 D;  4DPR A;  1XNF A;  3ASH A;  3I5P A;  3BG1 B;  1DNP A;  1HU3 A;  4Q94 A;  3TWR A;  3CVN A;  1IQR A;  2XPI A;  3SY2 A;  4LSZ E;  3CR3 A;  4G8K A;  4FUL A;  5A6C A;  3Q7A A;  3R7R A;  2VTB A;  3TWV A;  3DWL G;  3FUI A;  5EDS A;  3AG1 E;  1IYG A;  5D2M C;  1Z5S C;  4JW1 A;  4DX6 D;  2Q7F A;  4APO A;  3L54 A;  4CZ2 D;  5AIJ A;  4WND A;  2MRI A;  3NZS A;  5G05 J;  4H7X A;  3WXX A;  3ENE A;  4FLH A;  3G2T A;  4BFR A;  5CBO A;  2KCL A;  2CFZ A;  3E32 A;  2WXN A;  2XEN A;  4LCT A;  1LF8 A;  5T4Y A;  1TR4 A;  4NIK A;  1N52 A;  1S64 A;  1TNY A;  4GMR A;  4BSX A;  5G2N A;  4B93 B;  2P2C P;  4WNE A;  2XEH A;  4ANW A;  3BU8 A;  2E0I A;  3R9M A;  2R03 A;  3RSE G;  4LNG A;  4U8V D;  5HI7 A;  4XE0 A;  3FU0 A;  4ILH B;  1E8Y A;  3UM0 A;  1K1A A;  5G05 C;  4BSZ B;  4MLP A;  2GRN B;  1H19 A;  4B89 A;  2V4L A;  2PNN A;  2R17 C;  2I2O A;  2P9U G;  5KJN A;  1BI7 B;  1N11 A;  3FH5 A;  3D9K A;  3FY4 A;  4F1S A;  3DPY A;  4DK5 A;  2AW6 A;  4I1A A;  1O5M A;  4JEU A;  5FQ7 A;  5CRV A;  2RD0 A;  5CEC B;  3AG2 E;  4YDO A;  1U2V G;  3CHR A;  1DCQ A;  4GTM A;  1MZC A;  1E7U A;  3V31 A;  2OEV A;  2H6F A;  2M63 A;  1Z3Y A;  1UN9 A;  3PVL A;  5ENS D;  3RO2 A;  4L2Y A;  2P9N G;  3ZYQ A;  4J0U A;  4I2W A;  1N4P A;  4XKB A;  4ATG A;  2VSN A;  5BV1 A;  1PAQ A;  1QNF A;  2P58 C;  2FUL A;  2FI7 A;  4TV3 A;  3NZU A;  2IOS A;  3UPV A;  3F6Q A;  2XS1 A;  1X5B A;  2JLB A;  3DXK G;  3V2X A;  2WXP A;  2QYU A;  3RRM B;  3PH0 C;  2HM8 A;  2QFC A;  2I9C A;  4AEZ C;  5HQ8 A;  2B0O E;  2I1K A;  2FO7 A;  1FVH A;  2VSO E;  2MHK A;  3DSW A;  2BKK B;  1WAO 1;  2CHZ A;  1MJ0 A;  2WXI A;  3V2O A;  1AWC B;  4HI8 A;  4C0E A;  2MYO A;  2X3M A;  1N4R A;  2C0L A;  1SVX A;  4GB9 A;  3T5X A;  1E8X A;  3LY8 A;  4FJZ A;  3E37 A;  2J49 A;  5JJ6 A;  4I1O B;  4QQI A;  4GPM A;  3VLE A;  3ULY A;  3KAE A;  1UJJ A;  4TRQ A;  5BT1 A;  4FLB A;  1E90 A;  1WDY A;  4BEP A;  1NL4 A;  4A3T A;  2DCP A;  2CHW A;  2FBN A;  4FHK A;  4L23 A;  3ZYM A;  1W3B A;  3MKQ A;  5HKP A;  2NSZ A;  3TWW A;  4GZ6 A;  4CDM A;  3FH8 A;  3HDX A;  2VGX B;  3IXE A;  5FZQ A;  2WXH A;  3PS6 A;  4IUL A;  4HOS A;  2FEZ A;  1QBQ A;  3EHR A;  3OAW A;  3CVW A;  4HLE A;  4ABN A;  2V5Q C;  3L82 A;  3ZVV A;  3Q78 A;  2L6B A;  2XZT G;  4ZHB A;  2KAT A;  3C3Q A;  3S7F A;  3J5Q B;  2BED A;  1TN8 A;  4BES A;  1TNB A;  4FP7 A;  3W9G A;  3R7Q A;  4U0S A;  2R5S A;  1IKN D;  4F1P A;  3ULQ A;  3FTV A;  3GW4 A;  3MA5 A;  4LER A;  2ETA A;  1P5Q A;  4XIF A;  3FWV A;  3I4G A;  5B1A E;  1OCO E;  1S70 B;  4L9P A;  2AWI A;  4ILI A;  5ARG A;  5EKQ D;  1OCC E;  3FTS A;  2MOW A;  4K5B A;  1IHB A;  4UWF A;  4CYM D;  3FEY A;  2WXJ A;  5JHA A;  2BF0 X;  5JJ7 A;  1QQE A;  2J4B A;  3ML8 A;  3QAQ A;  1UW4 B;  3T5V A;  3UKU G;  3DSX A;  3ASF A;  2XPZ A;  1HX8 A;  1SZ9 A;  4GTO A;  4HRN A;  4MRU A;  2L0I A;  3T8K A;  1AP7 A;  3LVR E;  4UI9 K;  4N3A A;  4RVB A;  1SA5 A;  2ILR A;  3TG4 A;  4K5C A;  1OXJ A;  3ZEF A;  4NQ0 A;  3TGO A;  1YA0 A;  3L16 A;  1MX2 A;  5FJY A;  3UMV A;  3KEA A;  5BV0 A;  4U96 D;  4I6G A;  2GRP B;  4GTP A;  4O60 A;  2WXG A;  2A5E A;  4HRM B;  3OXL A;  1X81 A;  3CKB A;  1L5J A;  4CRW A;  3BUA A;  4YDW A;  4O1P A;  5B1B E;  3D9L A;  4W9R A;  2VTB B;  4O6F A;  5KNH D;  3TWS A;  4GCN A;  4AM9 A;  3IEG A;  2BTD A;  4JZY A;  4JD2 G;  1TNO A;  1TNU A;  3SNX A;  1EYH A;  3ZIM A;  1KZO A;  2X6F A;  4AV7 A;  3D3M A;  4BTA A;  3NOC D;  4G26 A;  4KVO A;  3Q4A B;  5KCM A;  3ZRH A;  3L22 A;  3NOG D;  5ENN A;  2UY1 B;  2I1J A;  2P9S G;  3CVY A;  1XGW A;  3Q9N C;  3B7T A;  2E2E A;  3EHM A;  3LPZ A;  1UN8 A;  2WXR A;  2A5U A;  3DBS A;  4JHR A;  3I3N A;  3UX4 A;  4K0R A;  1N0R A;  2IOL A;  1N95 A;  2VJ8 A;  4R7L A;  5ENT D;  2LXL A;  3DEO A;  3S7J A;  2GRO B;  1OY3 D;  3RK6 A;  2NXP A;  3SO8 A;  3ZN3 A;  4C0M A;  4LG6 A;  2XRY A;  3FUD A;  2QY7 A;  4FU3 A;  3CVQ A;  3NF1 A;  4G8L A;  3SZ7 A;  2P9K G;  4HOQ A;  4Y6C A;  1VDY A;  1N4S A;  1TN7 A;  3NBN B;  1HXI A;  4XI9 A;  3TWQ A;  1H6O A;  1OWN A;  5KJL A;  4B8C B;  3Q73 A;  2R02 A;  5FQ8 A;  2ZU6 B;  3AU5 A;  3I4R B;  5AN8 A;  3PZ4 A;  3VTX A;  2LUH A;  3SFX A;  3KS2 A;  3ZPJ A;  2EIM E;  1JPL A;  4CGW A;  3APF A;  3QKY A;  4JA9 A;  1ZB1 A;  4UWL A;  5ARF A;  1H2U A;  2KBX A;  2X38 A;  2VSY A;  2QZA A;  5AEN A;  3B13 A;  4KVM A;  5KJM A;  4Y6W A;  4I2Z A;  2YNQ A;  4U0Z A;  3ZKJ A;  4GA1 A;  4N2Q A;  1ELR A;  4A55 A;  1FVF A;  3CQG B;  5AYW D;  4HRL A;  3QC1 A;  4APF A;  3E4B A;  4GA0 A;  2I6H A;  3ZYL A;  1FT1 A;  2WQH A;  2XGM A;  3DSV A;  4GCO A;  4YDE A;  1JWG A;  2WQ6 A;  5FQ6 A;  4I9E A;  1EPU A;  2J4D A;  3ONK A;  2XPY A;  3CVP A;  3TXN A;  2AJA A;  4MKT A;  3URZ A;  3J5P A;  3FTU A;  4YDY A;  4ANU A;  1U3D A;  2PQR A;  5T8I A;  2ZIS A;  1FT2 A;  5JJT A;  4CCA A;  3RIB A;  4EZL A;  2UWJ G;  3PRZ A;  4CDN A;  1UJK A;  1QYM A;  4RLY A;  3DXM G;  2RFM A;  3ZUV B;  4PDX A;  4EHM A;  1Y8M A;  4G25 A;  1LTX A;  3ASO E;  4EEC A;  3CQC B;  3BG0 B;  3FTW A;  3QNK A;  2DBA A;  2KCK A;  3ZGQ A;  4GYO A;  3B7R L;  3UIP C;  1A5E A;  5LP0 A;  4QFV A;  4DI4 A;  2H6H A;  4RG9 A;  4K5A B;  4A1G A;  3CHO A;  3RAU A;  1N9A A;  5EYP F;  3VTY A;  3MKQ B;  3ABL E;  2OV8 A;  3RJV A;  4U8Y D;  3ABK E;  3PNL B;  4IN3 B;  4U95 D;  3TJP A;  1JCQ A;  1KT1 A;  4J7W A;  4XKC A;  2GGF A;  3KEZ A;  5D0O D;  1LD8 A;  2JEK A;  1KLX A;  1E8W A;  2P9L G;  3CST A;  3RU0 A;  3HXF A;  3L9T A;  4Q96 A;  5AQ9 A;  1INZ A;  1H6K A;  2BKG A;  3D9J A;  5FWQ A;  3UUX A;  4H7Y A;  5DIZ A;  3JUE A;  2IJG X;  4GTS A;  1NI1 A;  2V5F A;  4G23 A;  2DZN A;  2KC7 A;  3LJ3 A;  1OCR E;  2EIK E;  1H2T C;  1YCS B;  1JCS A;  4EBA G;  3TAX A;  4OAU C;  3UTM A;  3WG7 E;  3GYZ A;  3LY7 A;  4J8Y A;  4WUY A;  2GRR B;  3DST A;  4LRZ A;  5AQA A;  3C3R A;  2LSU A;  2BUG A;  4FHJ A;  2QC9 A;  5J08 A;  2OND A;  4BET A;  1OWM A;  5DBK A;  3CIA A;  3GZ2 A;  4HB5 A;  3TWX A;  2Y4T A;  4HLL A;  2V0P A;  4F3V A;  2PL2 A;  5EX0 A;  5CER B;  2VGY A;  5ENQ D;  4GYW A;  5ANR A;  3HXB A;  5H7P A;  2X6I A;  3B95 A;  5B3S E;  2DWZ A;  2Y0B G;  2Y3A A;  2WXF A;  3O4Z A;  2VSX E;  4NAC A;  4IYP A;  4P29 A;  5ENO D;  1RW2 A;  1OWO A;  1MX4 A;  4RQI A;  4GTV A;  2CG3 A;  4FA6 A;  4DX7 D;  2GW1 A;  5IY5 E;  4UUC A;  4GZD A;  3ML9 A;  3JUI A;  2VQ2 A;  1V54 E;  3QB2 A;  2XZD G;  3QWW A;  5AJD A;  3NB2 A;  4A63 B;  5FT9 A;  1MQS A;  1UOH A;  2X6J A;  1LD7 A;  4GPK A;  2XCB A;  4KYO B;  4DRX E;  3HXE A;  2ION A;  4WNG A;  1FCH A;  3FUH A;  3UT7 A;  3CV0 A;  3VLF A;  1BU9 A;  4FAD A;  2AXU A;  4GU5 A;  3HXD A;  4CDR A;  4GA2 A;  1ELW A;  2XEV A;  3RO3 A;  2XQ0 A;  4D10 C;  1MHQ A;  3MJW A;  4AP2 A;  2DVW A;  4BX9 A;  3G2S A;  2PM6 A;  3E34 A;  4AJW A;  1HO8 A;  2P9I G;  4GTQ A;  2L9B A;  3PDN A;  4BX8 A;  5KBA A;  1HF8 A;  3PZD A;  2WXK A;  3ESK A;  3BQO A;  4HXI A;  2ZXW E;  4L7T A;  2OVF A;  2R59 A;  3IHV A;  3FTX A;  4B94 A;  5JHB A;  3TWT A;  2F8Y A;  5AQ7 A;  5D66 A;  3Q15 A;  4UQY A;  2C2L A;  3ISM C;  3ZXP A;  2J09 A;  1PY1 A;  1BI8 B;  5AAR A;  2XS8 A;  1OT8 A;  5BW8 C;  2B6C A;  1GW6 A;  3U9W A;  2QYJ A;  3AS4 A;  3ZHE B;  3OTN A;  4KMO A;  3UM2 A;  2HR2 A;  2HYZ A;  3E33 A;  3U4T A;  4F53 A;  4JHK A;  1ELK A;  2OCC E;  3MKR A;  2YQ8 A;  3OXG A;  4OAV B;  3L13 A;  2RFA A;  3HG0 D;  4HS2 A;  2ZIR A;  3RRN B;  5CCL A;  1OWP A;  4A3V A;  3QDN A;  2X6H A;  4UWG A;  3LYA A;  2H6G A;  5CMY A;  4AOF A;  1TJF A;  1N54 A;  1IXV A;  1E96 B;  4GZ5 A;  4Z68 A;  3AAA C;  3GZS A;  3VLD A;  1IHG A;  3JXJ A;  3U66 A;  4FC8 A;  2J8S D;  2R2L A;  4OYS A;  3LVQ E;  5EN5 D;  4PH4 B;  1HS6 A;  2IU1 A;  4N5C A;  5ENR D;  1E7V A;  4J8E A;  3FUN A;  3CVV A;  4DJA A;  3PZ1 A;  5M72 A;  5D0Q D;  1S63 A;  4JL0 A;  1HE8 A;  1HG5 A;  3UI2 A;  2VGX A;  3MGB A;  4CEM A;  4U07 A;  4URK A;  4RG6 A;  4DLQ A;  4LNU D;  4WNF A;  2F8X K;  4N2S A;  3AS5 A;  3R9A B;  3UT8 A;  1NZN A;  5BNW A;  1D9S A;  1EDU A;  4NRH B;  5FIN A;  3CGH A;  4L1B A;  4HVB A;  1MX6 A;  3KSL A;  3DRA A;  4WWP A;  1WY6 A;  2AXV A;  3SGH A;  1D8E A;  3CHQ A;  1MYO A;  3LDZ A;  4X8Q A;  4GZ3 A;  3FU3 A;  4HNA D;  4LUN U;  5LCW J;  4I43 A;  4J8S A;  1EF1 C;  2YIN A;  3P1U A;  3JXI A;  2LAI A;  2WXL A;  3HVE A;  4OVV A;  4TUM A;  3ZW3 A;  3UT4 A;  1O1S A;  4XZ4 A;  3LS8 A;  4UWK A;  2HO1 A;  4N3C A;  1JUQ A;  3MEK A;  2PM7 A;  1N0Q A;  5C2Y A;  5KWD A;  3CVL A;  3FUJ A;  5CHE E;  4U63 A;  4YVQ C;  3C5R A;  4KXK B;  3TG5 A;  2OOE A;  4I6J A;  5JMN D;  2WVI A;  1BPO A;  4A1S A;  3EU9 A;  4K03 A;  3IV0 A;  3FU5 A;  3PE3 A;  5LCW C;  3DEP A;  4JA7 A;  4N39 A;  2KZT A;  3FUE A;  2GRQ B;  2J9Q A;  4DX1 A;  1OCZ E;  4BT9 A;  3CK7 A;  1TEZ A;  1D8D A;  3D9M A;  4EZK A;  4FJY A;  4ATZ D;  2LXM A;  1OWL A;  2XGS A;  1SZA A;  3ZNG A;  4ANX A;  5FIO A;  4G2V A;  3QWV A;  3CVX A;  5EIB E;  5BUZ A;  3V30 A;  4M3O A;  3FUK A;  2GRM A;  4B8A A;  1YMP A;  4I6E A;  3ZFW A;  4ZFH A;  2XEE A;  2AXZ A;  3EJN A;  3FTZ A;  5EID A;  2ZGD A;  3Q75 A;  1KT0 A;  2IQC A;  3JQ0 A;  3E30 A;  3GZ1 A;  2DYS E;  2Y1L E;  5G04 J;  3HHM A;  5BXU A;  2LNI A;  4ACK A;  1E8Z A;  3KSQ A;  2HE0 A;  4BY6 A;  4J6I A;  4U8H A;  3U3W A;  4RSY A;  3ESL A;  5FZR A;  3SQV A;  3O48 A;  1UG3 A;  4LNB A;  4DI3 A;  4LEU A;  4Q69 A;  1BD8 A;  4XI0 A;  3PUJ A;  3MV2 B;  3TXM A;  3EHQ A;  3G2U A;  2XCC A;  3ZU7 B;  5CED B;  3S7D A;  2WM9 A;  3CK8 A;  1H0A A;  3LKU A;  4G11 A;  1TNZ A;  5CCM A;  1DCE A;  3FP3 A;  3LCA A;  5G04 C;  3UQ3 A;  3S7B A;  3SBS A;  5CRU A;  2UY1 A;  3IBE A;  2ETC A;  2FO1 E;  4HOR A;  3CSF A;  3FHE A;  4JB8 P;  1KZP A;  3DSU A;  1KPS B;  3KD7 A;  1QZ2 A;  4MS6 A;  4L2L A;  5LOZ A;  2KM4 A;  3T9K A;  3ASN E;  4AY5 A;  2OEW A;  3QAR A;  1WG0 A;  2DZO A;  3FEX A;  1Z3X A;  1Q2Z A;  3JYS A;  3PRE A;  2WXM A;  3S2A A;  4HI9 A;  2P9P G;  3SF4 A;  3QWP A;  4IRU A;  2PQN A;  5EYL A;  3MX3 A;  3SI5 A;  4MBG A;  3T8M A;  1Z6T A;  4G1T A;  3Q7F A;  4JXT A;  4V3I A;  1HG2 A;  1WM5 A;  3LY9 A;  3PNT B;  4U7E B;  4BER A;  5KJK A;  2PZI A;  5AAO A;  4GZC A;  4BWR A;  4ILG A;  2X6K A;  1B89 A;  3N71 A;  3FH7 A;  1HH8 A;  4CGV A;  1U3C A;  2LSV A;  2LAH A;  2VGE A;  3FUM A;  3JQ1 A;  4JEH A;  5HRY A;  2ETB A;  4UWH A;  3FDH A;  1A17 A;  3UKR G;  1ZU2 A;  4N3B A;  3RRU A;  3OXF A;  2F0Y A;  3ULE G;  2NYJ A;  5C1D A;  3EIQ C;  3EIJ A;  4U0U A;  3L6A A;  3FUF A;  4GYY A;  4I1M A;  1O1R A;  3LEW A;  4BT8 A;  3APD A;  4ANV A;  3MCX A;  2V8S E;  3EU5 A;  5FTP A;  4TUU A;  3AU4 A;  4BTB A;  2J07 A;  2WXQ A;  1HFA A;  2IO2 C;  3D9O A;  5FZS A;  3PEV B;  4ME2 A;  1TJC A;  3UM3 A;  3UIN C;  5E75 A;  4HQD A;  1PC2 A;  3CHM A;  4WWO A;  3HYM B;  3Q49 B;  2J08 A;  4WWN A;  4GTT A;  1H2V C;  3L08 A;  4KZC A;  1ZBP A;  4J8F A;  4AXH A;  3SHF A;  3K9I A;  4AY6 A;  2CG2 A;  3CEQ A;  3PE4 A;  2RG8 A;  4JHJ A;  2WMN A;  4CT0 A;  4AIF A;  1O1T A;  5EX3 A;  3D9H A;  1SQM A;  5CMW A;  3UXG A;  3C98 A;  2WXO A;  2IY0 C;  4NUR A;  1JCR A;  4DX5 D;  1NA0 A;  2F37 A;  4JPS A;  5T3R A;  4YVO A;  1TYQ G;  4N5Q A;  3QOU A;  2CHX A;  1OUV A;  3CK9 A;  1SA4 A;  3QJZ A;  3ASG A;  3B7B A;  3CKC A;  3Q79 A;  5EIL A;  4ACL A;  4GAA A;  4G24 A;  4O1O A;  3CVU A;  2WPV A;  2EIN E;  3U64 A;  5A23 A;  2OVB A;  2A4Z A;  2Y4U A;  4UI9 J;  3FFL A;  5AJL A;  3AS8 A;  1JWF A;  2FF4 A;  4DLO A;  1IQU A;  1DC2 A;  4JVS A;  4TXP A;  4B0Z A;  4PS8 A;  2YHE A;  4XEI G;  2GRL A;  3C72 A;  1NP7 A;  3AG3 E;  5ENP D;  3D9P A;  2Y69 E;  3G2W A;  4C48 B;  2WQ7 A;  3HRA A;  1DVP A;  4C9B B;  3HVE B;  3B7S A;  3ZYK A;  3FU6 A;  3EHN A;  2L0T B;  3D9N A;  3APC A;  3W9F A;  2ZGG A;  2VYI A;  3MYV A;  5FQ4 A;  1K1B A;  4UI9 C;  2CFU A;  3D9I A;  4TXQ A;  4EPZ A;  3Q9U C;  5CBN A;  2JAB A;  1HZ4 A;  1K8K G;  4UQZ A;  3HXC A;  5BPP A;  5AQB A;  1TN6 A;  2H6I A;  3NQP A;  2KZT B;  4GTR A;  2YHC A;  3CLJ A;  3HIZ A;  3PZ3 A;  3JCK C;  3P2B A;  2DIW A;  1RZ4 A;  4DUI A;  4TXR A;  3NAW A;  3FUL A;  2AVP A;  4UQX A;  2R05 A;  4PS7 A;  3Q47 B;  4JC8 A;  3BEE A;  5G55 A;  4HFG A;  5LX8 A;  3G2V A;  2IF4 A;  3PUK A;  2EIJ E;  4E6H A;  3SD5 A;  3MZL B;  3MV3 B;  2V4H C;  2KXP C;  2WB2 A;  3DSS A;  4U04 A;  4HOU A;  3SFZ A;  5A7D B;  5BXO A;  3PZ2 A;  3IKO B;  2NC9 A;  3Q5M A;  4XX5 A;  1NFI E;  2XGO A;  1SW6 A;  2DYR E;  2RKK A;  4KT6 B;  5KNG A;  2EQX A;  5HS0 A;  2LO6 A;  3L17 A;  3PEU B;  4E85 A;  3UM1 A;  5E76 A;  3DPD A;  4J8D A;  3LXU X;  3AG4 E;  5ITZ F;  4HBD A;  3EUV A;  3C3O A;  1H6P A;  1NA3 A;  1K3Z D;  3UIO C;  1N4Q A;  3ASD A;  4F7A A;  3LJN A;  3CHS A;  2IO3 C;  4WAF A;  2L6J A;  4PS3 A;  3X2Q E;  3QK0 A;  4I9C A;  2IFU A;  3ZXS A;  3TWU A;  1FPP A;  2KCV A;  2XRZ A;  3ONL A; 
#chains in the Genus database with same CATH homology
 5ANL A;  2Y4T A;  3FEY A;  2WXJ A;  3KD7 A;  5JHA A;  2V0P A;  4F3V A;  2BF0 X;  2PL2 A;  5JJ7 A;  1QQE A;  2WMO A;  5EX0 A;  2J4B A;  1QZ2 A;  2VGY A;  3ML8 A;  4GMJ A;  4MS6 A;  4GYW A;  5ANR A;  3QAQ A;  4L2L A;  5LOZ A;  4AVX A;  2XHE A;  1UW4 B;  3RKV A;  4EQF A;  3T5V A;  3CHP A;  2KM4 A;  3EDT B;  3ZHE A;  4AY5 A;  3ASF A;  2X6I A;  2XPZ A;  3QAR A;  3FEX A;  1HX8 A;  4EBA A;  1SZ9 A;  2Y3A A;  4OVU A;  1Z3X A;  3JYS A;  2WXF A;  4MRU A;  3PRE A;  2L0I A;  2WXM A;  3O4Z A;  1S0P A;  2VSX E;  3S2A A;  4NAC A;  3FTY A;  4IYP A;  4P29 A;  3LVR E;  1Y6I A;  2C0M A;  1OWO A;  4UI9 K;  5LFA A;  4PUC A;  4CT4 A;  4N3A A;  4RVB A;  4YND A;  2CG3 A;  3SF4 A;  3QWP A;  4FA6 A;  4IRU A;  2PQN A;  4KBQ A;  2GW1 A;  2ILR A;  4GZD A;  3MX3 A;  3ML9 A;  5J90 A;  3SI5 A;  3JUI A;  2VQ2 A;  3B7U X;  3TG4 A;  3SBT B;  3ZEF A;  4EZJ A;  4NQ0 A;  3QB2 A;  3ONL A;  4KZ0 A;  3TGO A;  3T8M A;  3TL5 A;  1YA0 A;  1Z6T A;  3QWW A;  3L16 A;  5AJD A;  4I17 A;  4GML A;  4G1T A;  5FT9 A;  4JXT A;  3IHY A;  1MQS A;  5FJY A;  2X6J A;  1HG2 A;  4V3I A;  3UMV A;  4HOT A;  5BV0 A;  1WM5 A;  3LY9 A;  4I6G A;  4GPK A;  3PNT B;  2XCB A;  2WXG A;  4KYO B;  4DPR A;  1XNF A;  5KJK A;  3ASH A;  2PZI A;  3I5P A;  2ION A;  3OXL A;  4WNG A;  3BG1 B;  1DNP A;  4GZC A;  4BWR A;  1HU3 A;  4Q94 A;  1FCH A;  3CKB A;  1L5J A;  4ILG A;  3CVN A;  3FUH A;  4CRW A;  1IQR A;  3UT7 A;  3CV0 A;  2X6K A;  3VLF A;  2XPI A;  1B89 A;  3D9L A;  3N71 A;  4W9R A;  4FAD A;  3CR3 A;  4FUL A;  4O6F A;  5A6C A;  3R7R A;  2VTB B;  3FH7 A;  2VTB A;  3FUI A;  5EDS A;  4GCN A;  2AXU A;  4AM9 A;  1HH8 A;  1IYG A;  4GU5 A;  4CGV A;  3IEG A;  2BTD A;  4JZY A;  1U3C A;  2LSV A;  4JW1 A;  2LAH A;  3FUM A;  4CDR A;  3JQ1 A;  4GA2 A;  4JEH A;  3SNX A;  2Q7F A;  1ELW A;  4APO A;  1EYH A;  4UWH A;  3FDH A;  3L54 A;  2XEV A;  3ZIM A;  1A17 A;  3RO3 A;  2XQ0 A;  4D10 C;  1MHQ A;  3MJW A;  1ZU2 A;  4N3B A;  3RRU A;  5AIJ A;  4AP2 A;  2X6F A;  3OXF A;  4WND A;  2MRI A;  3NZS A;  5G05 J;  4H7X A;  4AV7 A;  3WXX A;  3ENE A;  4FLH A;  3G2S A;  4BX9 A;  2PM6 A;  4AJW A;  1HO8 A;  3G2T A;  4BFR A;  2KCL A;  2CFZ A;  2WXN A;  2L9B A;  3PDN A;  4BX8 A;  3D3M A;  5C1D A;  1HF8 A;  3EIQ C;  4BTA A;  3EIJ A;  3PZD A;  2WXK A;  4G26 A;  4LCT A;  1LF8 A;  4U0U A;  3L6A A;  3ESK A;  3FUF A;  4GYY A;  5T4Y A;  4KVO A;  3Q4A B;  5KCM A;  4HXI A;  4L7T A;  4I1M A;  2OVF A;  2R59 A;  3IHV A;  3ZRH A;  3FTX A;  3L22 A;  1N52 A;  4B94 A;  3LEW A;  4BT8 A;  4BSX A;  5JHB A;  5ENN A;  5G2N A;  3APD A;  2UY1 B;  4WNE A;  4ANV A;  2I1J A;  2V8S E;  3MCX A;  3CVY A;  1XGW A;  4ANW A;  3B7T A;  5FTP A;  2E0I A;  3Q15 A;  2E2E A;  3EHM A;  3LPZ A;  4TUU A;  4UQY A;  1UN8 A;  2C2L A;  2WXR A;  3AU4 A;  2A5U A;  3DBS A;  4BTB A;  2J07 A;  4JHR A;  2J09 A;  1PY1 A;  2WXQ A;  3I3N A;  5HI7 A;  1HFA A;  4XE0 A;  5BW8 C;  3FU0 A;  4K0R A;  3UX4 A;  4ILH B;  1E8Y A;  3D9O A;  5FZS A;  2IOL A;  5G05 C;  1GW6 A;  3PEV B;  4MLP A;  3U9W A;  1H19 A;  2VJ8 A;  3AS4 A;  4ME2 A;  3ZHE B;  3OTN A;  1TJC A;  4KMO A;  4R7L A;  2HR2 A;  2HYZ A;  3U4T A;  4F53 A;  5E75 A;  1PC2 A;  3CHM A;  4JHK A;  4WWO A;  4B89 A;  2V4L A;  1ELK A;  3S7J A;  3HYM B;  2R17 C;  2I2O A;  3Q49 B;  3RK6 A;  3MKR A;  2NXP A;  2J08 A;  2YQ8 A;  5KJN A;  3OXG A;  4WWN A;  3ZN3 A;  3FH5 A;  3D9K A;  3FY4 A;  4C0M A;  4F1S A;  4DK5 A;  2XRY A;  3L13 A;  1H2V C;  2AW6 A;  3L08 A;  4KZC A;  1ZBP A;  3FUD A;  4J8F A;  2QY7 A;  4I1A A;  4AXH A;  4FU3 A;  4HS2 A;  3CVQ A;  4JEU A;  3NF1 A;  5FQ7 A;  3SZ7 A;  2RD0 A;  4HOQ A;  4Y6C A;  3SHF A;  1VDY A;  5CCL A;  3K9I A;  3RRN B;  4AY6 A;  1OWP A;  4A3V A;  3CHR A;  2CG2 A;  2X6H A;  3QDN A;  4UWG A;  3LYA A;  1HXI A;  3CEQ A;  4XI9 A;  5CMY A;  3PE4 A;  4AOF A;  1TJF A;  1N54 A;  2RG8 A;  1E7U A;  1E96 B;  4GZ5 A;  4JHJ A;  2WMN A;  1OWN A;  3GZS A;  4CT0 A;  5KJL A;  3VLD A;  1IHG A;  4AIF A;  4B8C B;  3U66 A;  2M63 A;  4FC8 A;  1Z3Y A;  1UN9 A;  3PVL A;  5EX3 A;  5FQ8 A;  2ZU6 B;  3AU5 A;  3I4R B;  4OYS A;  1SQM A;  3LVQ E;  3VTX A;  4PH4 B;  1HS6 A;  2IU1 A;  3RO2 A;  4L2Y A;  3KS2 A;  4N5C A;  3ZPJ A;  3ZYQ A;  1JPL A;  3C98 A;  4J0U A;  3APF A;  1E7V A;  2WXO A;  4J8E A;  4CGW A;  3FUN A;  3QKY A;  4NUR A;  3CVV A;  4DJA A;  4JA9 A;  4I2W A;  4XKB A;  4UWL A;  5M72 A;  5ARF A;  4ATG A;  5D0Q D;  1NA0 A;  1H2U A;  4JL0 A;  1HE8 A;  2X38 A;  1HG5 A;  4JPS A;  2VSY A;  5AEN A;  2VGX A;  3MGB A;  4CEM A;  4U07 A;  4URK A;  4RG6 A;  5T3R A;  4YVO A;  4DLQ A;  2VSN A;  5BV1 A;  3QOU A;  2CHX A;  3B13 A;  4WNF A;  1OUV A;  4N2S A;  3AS5 A;  4KVM A;  3R9A B;  1PAQ A;  1QNF A;  3UT8 A;  5KJM A;  3CK9 A;  3QJZ A;  4Y6W A;  1NZN A;  4I2Z A;  2P58 C;  5BNW A;  2FUL A;  2FI7 A;  2YNQ A;  3ASG A;  4U0Z A;  4TV3 A;  4GA1 A;  3NZU A;  4N2Q A;  1ELR A;  1EDU A;  4NRH B;  2IOS A;  4A55 A;  3UPV A;  1FVF A;  3CKC A;  3CGH A;  3CQG B;  5AYW D;  4L1B A;  4ACL A;  4GAA A;  4HVB A;  4G24 A;  3CVU A;  4WWP A;  1WY6 A;  2WPV A;  3QC1 A;  4APF A;  1X5B A;  3E4B A;  2JLB A;  4GA0 A;  2I6H A;  2AXV A;  3U64 A;  3SGH A;  2WQH A;  2OVB A;  2XGM A;  2A4Z A;  4GCO A;  3ZYL A;  5A23 A;  2Y4U A;  1JWG A;  4UI9 J;  2WQ6 A;  3FFL A;  5AJL A;  3CHQ A;  5FQ6 A;  3LDZ A;  4I9E A;  1EPU A;  2J4D A;  3ONK A;  2WXP A;  2XPY A;  3AS8 A;  1JWF A;  3CVP A;  2FF4 A;  4DLO A;  1IQU A;  3TXN A;  4GZ3 A;  3RRM B;  3FU3 A;  4MKT A;  3URZ A;  4JVS A;  4B0Z A;  3PH0 C;  4PS8 A;  3FTU A;  2HM8 A;  2QFC A;  2YHE A;  4I43 A;  4LUN U;  5LCW J;  2I9C A;  4AEZ C;  4J8S A;  2GRL A;  1NP7 A;  4ANU A;  1EF1 C;  5HQ8 A;  2I1K A;  2FO7 A;  1FVH A;  3D9P A;  2VSO E;  1U3D A;  2MHK A;  2PQR A;  2YIN A;  3G2W A;  3P1U A;  5T8I A;  2WQ7 A;  1DVP A;  5JJT A;  1WAO 1;  4C9B B;  3HVE B;  4CCA A;  2LAI A;  3RIB A;  2CHZ A;  2WXL A;  3B7S A;  3HVE A;  4OVV A;  4EZL A;  3ZW3 A;  3UT4 A;  2UWJ G;  2WXI A;  3PRZ A;  3ZYK A;  4CDN A;  1UJK A;  3FU6 A;  4C0E A;  3EHN A;  2L0T B;  3D9N A;  4XZ4 A;  3LS8 A;  2HO1 A;  3APC A;  4N3C A;  4UWK A;  1JUQ A;  2X3M A;  3MEK A;  3MYV A;  2VYI A;  2C0L A;  4PDX A;  2PM7 A;  5C2Y A;  4GB9 A;  1Y8M A;  4G25 A;  3CVL A;  3FUJ A;  5FQ4 A;  3T5X A;  1E8X A;  5CHE E;  3LY8 A;  4FJZ A;  4UI9 C;  2CFU A;  2J49 A;  4U63 A;  4EEC A;  4YVQ C;  5JJ6 A;  3CQC B;  3BG0 B;  3FTW A;  3D9I A;  4I1O B;  4KXK B;  3TG5 A;  2OOE A;  3VLE A;  4EPZ A;  3QNK A;  4I6J A;  2DBA A;  3KAE A;  1UJJ A;  4TRQ A;  2WVI A;  5BT1 A;  4FLB A;  1BPO A;  1HZ4 A;  1E90 A;  2KCK A;  4A1S A;  3ZGQ A;  4UQZ A;  4K03 A;  4GYO A;  3B7R L;  5BPP A;  3IV0 A;  3FU5 A;  3PE3 A;  5LCW C;  5LP0 A;  4QFV A;  4DI4 A;  4JA7 A;  3NQP A;  2KZT B;  4N39 A;  4RG9 A;  4A3T A;  2KZT A;  2DCP A;  2YHC A;  3CLJ A;  3FUE A;  3HIZ A;  4A1G A;  3JCK C;  3P2B A;  2DIW A;  2CHW A;  2FBN A;  3CHO A;  2J9Q A;  4BT9 A;  4FHK A;  4L23 A;  3CK7 A;  3VTY A;  3ZYM A;  3FUL A;  2AVP A;  3MKQ B;  4UQX A;  1TEZ A;  1W3B A;  4PS7 A;  2OV8 A;  3MKQ A;  3RJV A;  4EZK A;  3D9M A;  4FJY A;  3Q47 B;  4JC8 A;  2XGS A;  1OWL A;  3PNL B;  1SZA A;  3BEE A;  5G55 A;  4IN3 B;  3TJP A;  4ANX A;  2NSZ A;  4G2V A;  3QWV A;  4HFG A;  5LX8 A;  4GZ6 A;  3G2V A;  4CDM A;  3CVX A;  2IF4 A;  3FH8 A;  3PUK A;  3HDX A;  5BUZ A;  1KT1 A;  4E6H A;  2VGX B;  4M3O A;  3FUK A;  3MZL B;  2GGF A;  4XKC A;  3SD5 A;  3KEZ A;  3MV3 B;  2GRM A;  5D0O D;  5FZQ A;  4B8A A;  2JEK A;  2WXH A;  1KLX A;  4I6E A;  1E8W A;  2WB2 A;  3CST A;  3RU0 A;  3PS6 A;  3ZFW A;  4Q96 A;  4U04 A;  4IUL A;  4HOS A;  1INZ A;  2FEZ A;  2AXZ A;  3EJN A;  3OAW A;  3FTZ A;  4HOU A;  5A7D B;  3SFZ A;  3CVW A;  1H6K A;  4HLE A;  4ABN A;  1KT0 A;  2IQC A;  3ZVV A;  3IKO B;  2NC9 A;  3JQ0 A;  3Q5M A;  3D9J A;  3GZ1 A;  4XX5 A;  5G04 J;  2XGO A;  3HHM A;  5FWQ A;  3UUX A;  4H7Y A;  2LNI A;  5DIZ A;  4ACK A;  2KAT A;  1E8Z A;  4KT6 B;  2IJG X;  4BY6 A;  2EQX A;  2V5F A;  4J6I A;  2LO6 A;  3L17 A;  4U8H A;  3S7F A;  3U3W A;  4RSY A;  3ESL A;  5FZR A;  3O48 A;  3PEU B;  4E85 A;  1UG3 A;  5E76 A;  3DPD A;  4DI3 A;  4LEU A;  4J8D A;  4Q69 A;  3LXU X;  4G23 A;  2KC7 A;  4XI0 A;  3PUJ A;  3MV2 B;  3LJ3 A;  3TXM A;  4FP7 A;  3G2U A;  2XCC A;  1NA3 A;  3R7Q A;  4U0S A;  2R5S A;  1H2T C;  4EBA G;  3TAX A;  3ASD A;  3S7D A;  3ULQ A;  3FTV A;  4F7A A;  3GW4 A;  2WM9 A;  3MA5 A;  4LER A;  3GYZ A;  5CMW A;  3CK8 A;  1H0A A;  3LY7 A;  1P5Q A;  3LKU A;  3CHS A;  4XIF A;  3FWV A;  4G11 A;  5CCM A;  4WUY A;  4WAF A;  4LRZ A;  3FP3 A;  3I4G A;  3LCA A;  5G04 C;  3UQ3 A;  2LSU A;  2BUG A;  4FHJ A;  3S7B A;  3SBS A;  2L6J A;  4PS3 A;  2AWI A;  2UY1 A;  5J08 A;  3IBE A;  4ILI A;  5ARG A;  3QK0 A;  4I9C A;  5EKQ D;  2OND A;  1OWM A;  2IFU A;  3ZXS A;  3FTS A;  2MOW A;  5DBK A;  3CIA A;  4HOR A;  3CSF A;  3FHE A;  4UWF A;  2KCV A;  2XRZ A;  3GZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...