4CGVA

First tpr of spaghetti (rpap3) bound to hsp90 peptide srmeevd
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
125
structure length
125
Chain Sequence
HVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords RNA POLYMERASE II-ASSOCIATED PROTEIN 3
total genus 50
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cgvA00
2IF4A 2UY1B 4G24A 1QQEA 4N2QA 3QWVA 5A6CA 4G1TA 3ZPJA 5M72A 5A7DB 1E96B 2YHCA 4XI9A 1HXIA 1OUVA 5G04J 3QWWA 4J8EA 4JA7A 3RKVA 3S7FA 4WNGA 5EX3A 4GA0A 5FZRA 5HI7A 3TGOA 4A1SA 2HO1A 3CVLA 4UQYA 3O48A 5JJTA 4U0SA 3CK7A 3RO2A 2MHKA 2YQ8A 3PE4A 1QZ2A 4H7XA 1FCHA 4GCOA 4G2VA 5DIZA 2Q7FA 1ZU2A 3ASFA 3CVQA 1TJCA 3KAEA 2Y4UA 3KS2A 1W3BA 3LY8A 3Q49B 4N3BA 4XIFA 3R9AB 1KT1A 4RG6A 4WNFA 4ABNA 3RJVA 5KJKA 3OXLA 2IFUA 2KC7A 4EQFA 5LCWC 3EDTB 3MV2B 3FWVA 4GCNA 3S7BA 2FF4A 3HYMB 4NQ0A 4APOA 4F3VA 5JJ7A 2WQHA 4I9CA 4U0ZA 4BWRA 4AY6A 2JLBA 5ARFA 1IHGA 2J9QA 2KCVA 3CK8A 2VQ2A 3ASGA 3OXFA 4UI9J 4YVQC 4I2ZA 1ELWA 3GYZA 3LY9A 4G26A 3GW4A 4XI0A 3URZA 3VTYA 5LCWJ 2XCCA 2KATA 2UY1A 3QDNA 4ME2A 3QWPA 4U07A 5BT1A 3AS8A 4KXKB 4WNEA 1XNFA 2PL2A 2V5FA 4I2WA 5DBKA 5EX0A 5KJLA 2PZIA 4GPKA 2XCBA 3BEEA 3MV3B 2OOEA 3Q15A 4GZ5A 3S7DA 3TG5A 3Q4AB 3OXGA 5BW8C 2PQNA 2UWJG 4HOUA 4WUYA 3MA5A 1WM5A 2KCKA 1WAO1 2ONDA 3AS5A 2LSVA 4I1AA 4O6FA 4GZ3A 3FFLA 2HYZA 3ASHA 3K9IA 3RO3A 3GZ1A 3PE3A 5KJNA 4UQXA 3CEQA 4AM9A 4AY5A 4UI9K 5G04C 3CKCA 2FO7A 3CK9A 3CVPA 3LYAA 3FP3A 4GA1A 4H7YA 3JYSA 4N3AA 4YNDA 4NRHB 4HOTA 4IN3B 1NA3A 3CKBA 4G25A 4KYOB 3CV0A 1NZNA 5FZQA 1IYGA 3NF1A 5FZSA 3UQ3A 5D0QD 5HQ8A 5FT9A 3MEKA 2Y4TA 1HZ4A 2HR2A 3ZHEA 4GYWA 1HH8A 1KT0A 1NA0A 2VSYA 3PDNA 1KLXA 1Y8MA 3AS4A 3ULQA 2XEVA 2P58C 2LSUA 3N71A 4BT8A 3GZ2A 3IEGA 3UPVA 2E2EA 2DBAA 2VSNA 2XGSA 3CVNA 3QKYA 4J0UA 3ESKA 2VGYA 4U04A 3SZ7A 5JJ6A 1ZBPA 4WNDA 4BT9A 4I17A 2VYIA 4U0UA 4HOQA 4UI9C 2C0MA 5KJMA 3ZHEB 3E4BA 4HOSA 2L6JA 4N2SA 4JL0A 4BTBA 4I9EA 4Y6WA 3WXXA 3UUXA 1ELRA 4GA2A 2LNIA 4J8DA 3U4TA 3RU0A 2AVPA 2BUGA 2NC9A 2XPIA 1PC2A 5G05J 4KBQA 3LCAA 2XGMA 2VGXA 1YA0A 3Q47B 3S7JA 3ASDA 4RG9A 4W9RA 4Y6CA 4YVOA 2FI7A 3MKRA 4CGWA 4HORA 3LY7A 3LPZA 2FEZA 4JA9A 4UQZA 3ZN3A 2PQRA 3Q5MA 4G23A 5CHEE 5AYWD 5EKQD 4CGVA 4N3CA 4BTAA 4J8FA 3TAXA 5BNWA 4JHRA 5C1DA 3KD7A 2FBNA 5CCMA 2R5SA 3VTXA 3ZFWA 3U3WA 4GZ6A 4B94A 2GW1A 5D0OD 2VGXB 2QFCA 2WPVA 4GYOA 5FTPA 3ZGQA 2KCLA 4N5CA 2XGOA 5ARGA 5FJYA 3RIBA 3TG4A 4CDRA 1A17A 3QOUA 5CCLA 4LEUA 3LKUA 4N39A 1B89A 4AIFA 5G05C 4GYYA 1P5QA 3SF4A 2I6HA 2C0LA 2C2LA
chains in the Genus database with same CATH superfamily
3FTYA 2X6KA 1KZPA 4HRNA 3S7FA 2XENA 1FCHA 2J08A 3Q7AA 4Q94A 4ANWA 3ML8A 1W3BA 2IFUA 5B1AE 2XQ0A 4APOA 3S7BA 4F3VA 2FF4A 5ENOD 5AQ7A 3C72A 2WXGA 3FH5A 3PNTB 3R7RA 2VGEA 1LF8A 4XI0A 4L7TA 3TWQA 3X2QE 3MV3B 4GZ5A 2WXMA 3D3MA 1WAO1 2LSVA 3UM1A 4FC8A 4TXPA 3PE3A 1H6PA 2LUHA 4UWKA 1IQRA 3JQ1A 3UX4A 1O1TA 3EUVA 4GYWA 3PDNA 4U8HA 4OAVB 2VJ8A 4LSZE 4LRZA 2P58C 1E8WA 3UPVA 2E2EA 3KEZA 1ZBPA 2VYIA 5KJMA 4JL0A 1E7UA 3RU0A 4XKBA 3S7JA 4MRUA 3HRAA 3ZN3A 2PQRA 5CCMA 4A55A 4B94A 3UM2A 4N5CA 3TXNA 5CCLA 2LAHA 4JZYA 1SA5A 3SFZA 3SBTB 4I1MA 1HE8A 3HVEA 3AG4E 3QWWA 4JA7A 3TGOA 2WXNA 4CCAA 4U0SA 5CEDB 1TJCA 1N95A 3KSQA 3B7RL 4MLPA 5CERB 4UWLA 2WQHA 1EDUA 3URZA 2I1JA 1D9SA 1O1RA 1OCCE 1WDYA 2OV8A 3D9LA 3JXJA 2L0TB 3PEVB 3RRMB 2IY0C 5KJNA 5EIBE 3IHYA 3DSUA 4UI9K 3Q75A 5T4YA 4A3VA 3FH7A 1IXVA 3JYSA 4NRHB 4BX9A 3CV0A 5E75A 5AQAA 2DYSE 2VSYA 1KT0A 4U8YD 3BQOA 4EECA 4TXRA 3EHNA 2Y3AA 4BT8A 3GZ2A 2VSNA 2EIJE 1LD7A 1OXJA 3BU8A 3ABLE 4HOSA 4FHJA 3J5QB 3C3OA 3HXDA 3WXXA 2LNIA 2GGFA 2DIWA 3ZXSA 2P9NG 4W9RA 3AG2E 4HORA 4HLEA 4CT0A 5JHAA 2EINE 4BTAA 5HKPA 4Q69A 2VTBA 4GTOA 3DSVA 3EIQC 5EYPF 4PDXA 3LKUA 1B89A 3UKRG 1P5QA 2R2LA 4OVUA 3D9JA 4J8EA 3R9MA 4I6JA 5FZRA 4Q96A 3VLFA 2ZGDA 4D10C 2XS1A 4AP2A 3E37A 1H2VC 1D8DA 4DX2A 4RQIA 4GCOA 4NACA 5CBOA 3KAEA 4DI3A 3DWLG 4WNFA 4GZDA 2A5EA 3CGHA 5KBAA 1IHGA 2KCVA 4YDEA 4I2ZA 4G8LA 4HNAD 3QB2A 2V4HC 4ME2A 1H2UA 1XNFA 2XCBA 1E8XA 4ILGA 2KCKA 3HDXA 1TN6A 3UM3A 4DK5A 2P9LG 3EU5A 4CDNA 3KEAA 2VTBB 2CHWA 3W9GA 1JWGA 2KBXA 2XS8A 4ANUA 3SZ7A 1IKND 3UUXA 4FA6A 2BUGA 2VSXE 5BPPA 3SGHA 3V31A 2P9IG 4PS3A 3CQGB 3RRUA 3UMVA 3AG1E 4KZCA 5LFAA 1LTXA 3SBSA 3ZYKA 3TAXA 5FQ6A 4DX5D 3FUMA 2R02A 3ZHEA 4N2QA 1QQEA 4C0MA 3QWVA 4RVBA 1E96B 4OVVA 3EJNA 2F0YA 1NI1A 4GMLA 2I1KA 3E33A 3RO2A 3L54A 1JPLA 4L9PA 3TJPA 4EPZA 4XIFA 4E85A 1EYHA 2V5QC 3ONLA 1S64A 4NQ0A 3JUEA 4BFRA 1OWMA 4ATZD 2GRNB 5ARFA 2J9QA 1HFAA 3GYZA 3FEYA 4U96D 3OAWA 5LP0A 5DBKA 2IEJA 3FUFA 2WXPA 3TG5A 2PQNA 3TWRA 3C3QA 3K9IA 3NOGD 2WMOA 1HF8A 2GROB 3RK6A 4HOTA 1HO8A 4JD2G 2WXKA 4J7WA 1E7VA 4B8AA 1K8KG 1HX8A 3AS4A 2YINA 3TWVA 4U7EB 3CVNA 4OAUC 3ESKA 2IOLA 4ANXA 5ENNA 4I9EA 5FWQA 3RSEG 4KBQA 4ACLA 3AG3E 3MJWA 3FHEA 4JA9A 2H6FA 1ELKA 4J6IA 4F7AA 5D66A 3T5VA 2QFCA 2OEVA 4HQDA 1DVPA 5ENTD 1BPOA 3DPYA 4LEUA 2CG2A 3L82A 3G2WA 2I6HA 2C2LA 1DNPA 5BV1A 1H0AA 4E6HA 5EX3A 4A1SA 2DVWA 2MHKA 4WWNA 5DIZA 4EHMA 2Q7FA 3LY8A 4L23A 4B0ZA 1NL4A 2AXUA 1HU3A 4GZCA 4DRXE 5FQ8A 3LY9A 3GW4A 5JMND 3AS8A 3SFYA 1H19A 2QC9A 5AQBA 1VDYA 3QAQA 4K5AB 2GRQB 5G04C 4LERA 4UWGA 1BU9A 5FZQA 3UQ3A 3MEKA 2HR2A 1HH8A 3L9TA 4TUUA 3MZLB 2J4BA 2VGYA 3MKQB 2OCCE 4YDYA 2L6JA 3QK0A 4XX5A 4OYSA 1Y6IA 2XPIA 4J8YA 2XGMA 3ASDA 4CGWA 5ENPD 5CMYA 1WG0A 2XHEA 3ISMC 5AYWD 3EIJA 3U3WA 3U64A 4GB9A 3CHQA 4MBGA 4AIFA 4I6EA 4WNGA 5HI7A 3O48A 5JJTA 3MX3A 2LXMA 2R17C 1N9AA 4HBDA 2Y4UA 3CVYA 4HFGA 3OXLA 4ATGA 5LCWC 3MGBA 4U0ZA 2VQ2A 4UI9J 2IO2C 4I43A 2ZISA 3C98A 1FPPA 1HS6A 4KXKB 2V5FA 1XGWA 4GPKA 3OXGA 1OCRE 4HOUA 3MA5A 1WM5A 4I1AA 2ZXWE 3J5PA 5ENRD 2HYZA 3RO3A 2CHZA 2DZNA 4GA1A 4GTVA 3FTXA 4LG6A 3E34A 2P9KG 2QZAA 2GRMA 2ZU6B 1N4SA 1H2TC 2LSUA 3N71A 3PS6A 2R59A 3NQPA 3UT8A 3NZUA 3ASNE 3Q7FA 4EZJA 4DX6D 3BG1B 1X5BA 4BESA 1MZCA 4FULA 2XPZA 4A63B 4RG9A 2WQ7A 1JCRA 3LJNA 3Q5MA 2XZTG 4CGVA 3IBEA 2R5SA 3VTXA 3RAUA 5D0OD 2BKGA 4V3IA 3FTZA 5ARGA 4XZ4A 5G2NA 2AW6A 3UT4A 2X38A 4G2VA 3IKOB 4G1TA 3ZPJA 4HI8A 3CSTA 4O1PA 3FY4A 1UOHA 3CQCB 4QFVA 3PE4A 4ILHB 1QYMA 1K3ZD 4N3BA 2RFAA 4CEMA 3UKUG 4AY6A 4HRMB 3DXMG 1SA4A 2WM9A 3FH8A 1UN8A 1TR4A 4CT4A 4N5QA 4I1OB 3ZU7B 4X8QA 5BW8C 1RZ4A 3CVWA 3SHFA 1SQMA 4AXHA 3CK9A 2FO7A 3LJ3A 3HXFA 1SW6A 1IYGA 3NF1A 1NA0A 4JC8A 2CFUA 4FLHA 3FUEA 3SD5A 2MRIA 3V79K 4A3TA 4B8CB 4HOQA 1UJJA 1E8ZA 4BTBA 3T5XA 3FUJA 1V54E 3B7UX 5G05J 1DC2A 3ASOE 3SI5A 1AP7A 1TNUA 5EKQD 2LAIA 4GZ6A 5BV0A 4XE0A 5EN5D 2KCLA 2L0IA 3TG4A 3AU4A 1O5MA 4F6RD 5A23A 3FUHA 2J49A 3SFXA 5G04J 5C2YA 5AIJA 3L6AA 4UQYA 3HG0D 2QYJA 3UINC 3B7TA 3W9FA 3FU6A 3EHQA 5J08A 4GTSA 2WXLA 1UN9A 2JLBA 2IONA 2MYOA 2F8XK 1ELWA 3FTWA 3CIAA 4LNUD 2ETAA 5KJLA 1IQUA 3D9MA 5FIOA 1V55E 3FU3A 2I9CA 4M7CA 4KMOA 2Y1LE 5BXUA 5AAOA 4N3AA 4JHKA 3L22A 4IRUA 3PRZA 3VLDA 1HG5A 1TNOA 1N52A 1MYOA 5HRYA 3HXBA 3HHMA 2XEVA 1DCEA 4FHKA 3IEGA 2L9BA 5ENQD 1YMPA 1N54A 1E90A 2WXFA 3JXIA 2A5UA 3AJIA 3NZSA 3LCAA 3MKQA 2MOWA 3FUKA 4K03A 3MKRA 5CHEE 1TNZA 2X3MA 4PUCA 4J8SA 4DLQA 4CDRA 4N39A 5EDSA 4FJYA 3U66A 3Q73A 2IF4A 5A7DB 1SZAA 3RKVA 3P1UA 2HO1A 4GU5A 3FU0A 4O60A 3CK7A 4K5CA 3MCXA 2YQ8A 4H7XA 1ZU2A 5CMWA 2XPYA 4A1GA 3U9WA 1OY3D 3ASGA 3FUNA 5LCWJ 4L1BA 1N94A 2PL2A 2AXZA 3I5PA 3D9KA 3UT7A 2YHEA 3AS5A 1MX4A 3APDA 3GZ1A 5KNHD 2F8YA 5KWDA 2F37A 3CHRA 3FUDA 2X6FA 5HQ8A 1HZ4A 5EYLA 1A5EA 3P2BA 1KLXA 2QYUA 3CR3A 4WWOA 4DJAA 1UJKA 4HLLA 1JWFA 3QKYA 3JCKC 3DXKG 2AWIA 4GMRA 4UI9C 4GTPA 3LVQE 2XZDG 4G11A 3CVVA 1PC2A 1Z3YA 4HB5A 2NYJA 3CLJA 5BNWA 5C1DA 3ZFWA 3DSXA 4LNBA 3ZGQA 3MYVA 3C3RA 3RIBA 4P29A 3QOUA 4GTRA 4CDMA 1GW6A 2ZGGA 2IU1A 2H6IA 3HVEB 4WWPA 4TXQA 3QC1A 3T9KA 3UI2A 4GPMA 2WXJA 3R9AB 2XEEA 3DSSA 3EDTB 3MV2B 5JJ7A 3HYMB 2OEWA 5AJLA 4I9CA 2EQXA 4TUMA 4YVQC 4G26A 4FLBA 2J09A 4EBAG 4ACKA 1JCQA 3UTMA 4AV7A 3E32A 2CG3A 4JXTA 4DPRA 3LVRE 2LXLA 2I2OA 3CKCA 1TYQG 1BI8B 4DI4A 4H7YA 3ZVVA 2AXVA 3T8MA 4FADA 5B3SE 4BERA 4JEHA 4TV3A 1S0PA 1S63A 4LUNU 4MS6A 3DSTA 2ILRA 5BUZA 2DWZA 2YNQA 5B1BE 3ML9A 4BT9A 4U0UA 3ZHEB 2KXPC 3TWXA 4Y6WA 1WY6A 4JHJA 4F1SA 1ELRA 1OT8A 2DYRE 3ZNGA 1YA0A 2FI7A 4JEUA 1D8EA 4PS7A 1TN8A 1QBQA 3HIZA 4WAFA 1Z5SC 4AVXA 1X81A 2XGOA 1OWNA 3G2TA 3UIPC 2B0OE 2FO1E 4JW1A 1EF1C 1OUVA 3QARA 3AAAC 3CVLA 3PH0C 4EZKA 4MKTA 3Q78A 4RSYA 1TN7A 3KS2A 2BTDA 5CECB 2ETBA 4BEPA 3CHPA 4AJWA 4NURA 3OXFA 2UY1A 4U07A 4WNEA 3FULA 4O1OA 2PZIA 3BEEA 1YYHA 5ENSD 2ONDA 2XEHA 4GZ3A 3CVUA 4HI9A 5E76A 4AY5A 4U8VD 2DCPA 1K1BA 2FULA 3JUIA 4KYOB 4JB8P 3TXMA 4FU3A 2WQ6A 4B93B 1KPSB 2RD0A 2GRLA 2DBAA 3L13A 1G3NB 5CRVA 3E4BA 1S70B 4GAAA 3L16A 1BI7B 3D9IA 5FQ7A 5JHBA 3CVXA 3APFA 2EILE 3LY7A 1BLXB 4J8FA 3ESLA 2ETCA 1FVHA 2X6HA 3Q9UC 4FJZA 2R03A 4KVMA 3SF4A 1UW4B 5A6CA 5AQ9A 2YHCA 2J07A 3DEOA 1FVFA 5LX8A 3QJZA 3KSLA 2KM4A 1NFIE 3ASFA 3WG7E 3RJVA 2KC7A 3ZYLA 4URKA 3PNLB 2DZOA 3PZ4A 2IJGX 3PUKA 3ENEA 2XCCA 2KATA 3SNXA 5FINA 2CHXA 3EHRA 3S7DA 3DSWA 2L6BA 3OTNA 4O6FA 2A4ZA 4L2LA 3V2XA 2WXHA 2WXIA 1E8YA 2GRRB 5AJDA 3PZ2A 1INZA 5AENA 3F6QA 1JCSA 4QQIA 3NAWA 3FUIA 2IO3C 5FT9A 3ZW3A 4RLYA 4GTTA 4HVBA 2H6HA 2J8SD 4BSZB 4XEIG 4U04A 1N4RA 3NOCD 4J0UA 3FTSA 4WNDA 4ANVA 2C0MA 3D9HA 3ZIMA 3FTVA 1LD8A 4KT6B 4C0EA 4G23A 2WXQA 4R7LA 1Q2ZA 3S2AA 4PS8A 3ZKJA 3V30A 2HE0A 5FTPA 1PY1A 3B13A 5T8IA 3TWWA 5LOZA 4EBAA 3ZXPA 5KCMA 4K5BA 3UIOC 3B7SA 3UXGA 3D9OA 3IHVA 2OVFA 4DLOA 4NIKA 3CVQA 4KVOA 1MX2A 4ABNA 2KZTA 2WXOA 3ONKA 5CEAA 2R05A 4BWRA 3EU9A 3UM0A 2WB2A 3CHMA 2M63A 2X6JA 3PVLA 3QDNA 1JUQA 4GTQA 3LXUX 3CHSA 2BKKB 1SVXA 3CHOA 5IY5E 4UQXA 4AM9A 2EIME 3I3NA 1H6OA 3LYAA 1TJFA 4YNDA 5G55A 2HM8A 2Y4TA 1Y8MA 3D9NA 3PZ1A 3QNKA 3I4GA 2JEKA 1BD8A 1IHBA 1DCQA 5FQ4A 4DX7D 4L2YA 3T8KA 3FU5A 4GA2A 4EZLA 2NC9A 5AARA 2VGXA 4XKCA 2IQCA 4UQZA 1PAQA 3R7QA 4N3CA 1N11A 3AU5A 2GW1A 4C48B 3ULYA 1N0QA 1MJ0A 5ITZF 2V8SE 1O1SA 2P9PG 2V0PA 2XRYA 3FTUA 4G24A 4C9BB 4Z68A 4CRWA 4DX1A 1HXIA 3G2UA 4GA0A 3FEXA 3ABME 2V4LA 3ZYQA 2ZIRA 3NB2A 3SO8A 1QZ2A 4CZ2D 4F1PA 3I4RB 2CFZA 3Q79A 1K1AA 1KT1A 4RG6A 4CYMD 3ABKE 4GCNA 2P9SG 2EIKE 5J90A 3PZ3A 3ZYMA 3TWUA 3NBNB 1OWLA 2OVBA 4FP7A 3Q15A 2OOEA 3Q4AB 2UWJG 2KZTB 2RFMA 3PREA 4B89A 3D9PA 2RKKA 3FFLA 3PUJA 3FDHA 1NZNA 5FZSA 4HXIA 3DBSA 5T3RA 1FT1A 1U3CA 1SZ9A 3ULQA 3B7BA 5H7PA 1U3DA 4UUCA 5CBNA 3HXEA 4I17A 3CSFA 5ANRA 4J8DA 2IOSA 2AVPA 1MQSA 3RRNB 2AJAA 1Z6TA 4YVOA 2J4DA 3VLEA 3PEUB 1N4PA 1RW2A 4GMJA 5FJYA 4LNGA 1N4QA 1A17A 4UWFA 3SY2A 5G05C 1EPUA 2UY1B 4IULA 5D2MC 1MHQA 5M72A 4XI9A 4GTMA 4BX8A 1FT2A 2GRPB 3C5RA 4KZ0A 5CRUA 4G8KA 3Q49B 4U63A 3GZSA 1MX6A 3BG0B 3TWTA 4TRQA 4BY6A 5KNGA 1OCOE 3ULEG 3IV0A 5AN8A 5BT1A 1YCSB 3ZRHA 2WMNA 3ASHA 2WVIA 3SQVA 1NP7A 3PZDA 3DPDA 3BUAA 2X6IA 3CVPA 4HRLA 3FP3A 3G2VA 4IN3B 2WXRA 4JVSA 3TWSA 5D0QD 5HS0A 2P2CP 4AEZC 2LO6A 4ZFHA 3LEWA 2XGSA 4LCTA 5JJ6A 2B6CA 4N2SA 2P9UG 4YDOA 4I6GA 3DEPA 2QY7A 4HS2A 3ZEFA 4Y6CA 2FEZA 3G2SA 3DRAA 3LS8A 3KD7A 4GYOA 1ZB1A 1OWOA 2BEDA 4DUIA 1U2VG 4GYYA 3EHMA 1N0RA 5JA4D 2PM7A 2NSZA 1H6KA 3HXCA 3E30A 2BF0X 1TNBA 4YDWA 3U4TA 4UWHA 2VSOE 4PH4B 5KJKA 4EQFA 2JABA 1HG2A 3FWVA 4APFA 1OCZE 3APCA 2XRZA 3CK8A 2Y69E 3VTYA 1QNFA 5BXOA 3O4ZA 3QWPA 4I2WA 5EX0A 2PM6A 3JQ0A 4WUYA 3L08A 3V2OA 3CEQA 4ILIA 4U95D 1KZOA 1L5JA 3B95A 1NA3A 3CKBA 4G25A 4K0RA 4M3OA 2E0IA 3TL5A 4BETA 2Y0BG 4BSXA 1Z3XA 4JPSA 3IXEA 2NXPA 1AWCB 1OWPA 3L17A 2H6GA 5EIDA 5EILA 4IYPA 3Q47B 3LPZA 3ZUVB 3LDZA 4AOFA 4JHRA 2FBNA 5ANLA 2RG8A 4ZHBA 2VGXB 2PNNA 2WPVA 1TEZA 3Q9NC 1UG3A 4F53A 1TNYA 2C0LA
chains in the Genus database with same CATH topology
2IF4A 3FTYA 5KCMA 1DNPA 2X6KA 5BV1A 5A7DB 1SZAA 1H0AA 3RKVA 3S7FA 4E6HA 3P1UA 3B7SA 5EX3A 4A1SA 2HO1A 4GU5A 3D9OA 3IHVA 2OVFA 3FU0A 4DLOA 3CK7A 2MHKA 3MCXA 2YQ8A 4H7XA 1FCHA 2J08A 4WWNA 5DIZA 2Q7FA 1ZU2A 3CVQA 4KVOA 4Q94A 3LY8A 3ML8A 4ANWA 1W3BA 2XPYA 4ABNA 5CMWA 4A1GA 2KZTA 4L23A 2WXOA 2IFUA 2XQ0A 4B0ZA 4APOA 3S7BA 4F3VA 2FF4A 2AXUA 3ONKA 1HU3A 2WXGA 4GZCA 3U9WA 3FH5A 4BWRA 2WB2A 3PNTB 3ASGA 3CHMA 3FUNA 3R7RA 2M63A 1LF8A 5FQ8A 3LY9A 4XI0A 3GW4A 5LCWJ 4L1BA 4L7TA 2X6JA 3PVLA 3QDNA 1JUQA 3AS8A 2PL2A 2AXZA 1H19A 3I5PA 3D9KA 3MV3B 3LXUX 4GZ5A 3UT7A 2WXMA 3D3MA 2YHEA 1VDYA 1WAO1 3AS5A 2LSVA 3QAQA 3CHSA 4FC8A 3CHOA 3APDA 3GZ1A 3PE3A 4UQXA 4AM9A 3I3NA 5G04C 3LYAA 4UWKA 1IQRA 3CHRA 1TJFA 4LERA 4UWGA 4YNDA 3FUDA 2X6FA 3JQ1A 5FZQA 5G55A 2HM8A 5HQ8A 3UQ3A 3UX4A 3MEKA 2Y4TA 2HR2A 1HZ4A 4GYWA 1HH8A 3PDNA 4U8HA 4TUUA 2VJ8A 3P2BA 1KLXA 1Y8MA 3D9NA 3MZLB 3CR3A 3QNKA 3I4GA 4LRZA 2P58C 4WWOA 1E8WA 4DJAA 2J4BA 1UJKA 3UPVA 1JWFA 2E2EA 2JEKA 3QKYA 3JCKC 2VGYA 3KEZA 3MKQB 1ZBPA 2AWIA 2VYIA 5KJMA 4UI9C 5FQ4A 2L6JA 4JL0A 3QK0A 4L2YA 4XX5A 3LVQE 3FU5A 4OYSA 4GA2A 1E7UA 3RU0A 4G11A 1Y6IA 2NC9A 4XKBA 4EZLA 3CVVA 2XPIA 1PC2A 1Z3YA 2XGMA 2VGXA 3S7JA 3ASDA 4CGWA 4MRUA 4XKCA 5CMYA 2IQCA 4UQZA 2XHEA 1PAQA 3ZN3A 2PQRA 5AYWD 3R7QA 4N3CA 3CLJA 5BNWA 5C1DA 5CCMA 3EIJA 3ZFWA 3U3WA 4A55A 4B94A 3AU5A 2GW1A 3ZGQA 3MYVA 3U64A 4N5CA 4GB9A 3TXNA 3RIBA 4P29A 3QOUA 5CCLA 2LAHA 3CHQA 4AIFA 4JZYA 4CDMA 2V8SE 1GW6A 2V0PA 2XRYA 3FTUA 4G24A 2IU1A 3SFZA 4C9BB 3HVEB 4WWPA 3SBTB 4I1MA 1HE8A 3HVEA 4CRWA 1HXIA 4I6EA 3QWWA 4JA7A 3G2UA 4WNGA 4GA0A 5HI7A 3TGOA 3FEXA 2WXNA 4CCAA 3O48A 5JJTA 2V4LA 3QC1A 3MX3A 4U0SA 3ZYQA 2R17C 1QZ2A 3I4RB 2CFZA 1TJCA 2WXJA 2Y4UA 3R9AB 1KT1A 4RG6A 3CVYA 4HFGA 3OXLA 4ATGA 5LCWC 3MGBA 3EDTB 3B7RL 3MV2B 5JJ7A 4GCNA 4MLPA 3HYMB 4UWLA 2WQHA 5AJLA 4I9CA 4U0ZA 5J90A 2EQXA 2VQ2A 1EDUA 4UI9J 4YVQC 3ZYMA 4I43A 4G26A 3URZA 2I1JA 3C98A 4FLBA 1HS6A 2J09A 4EBAG 1OWLA 4KXKB 2V5FA 1XGWA 2OVBA 4ACKA 4FP7A 4GPKA 3Q15A 2OOEA 4AV7A 2OV8A 3D9LA 3Q4AB 3OXGA 2UWJG 2KZTB 4HOUA 3MA5A 1WM5A 3D9PA 3PREA 4B89A 4I1AA 2CG3A 2L0TB 3PEVB 4JXTA 4DPRA 3RRMB 3FFLA 2HYZA 3RO3A 5KJNA 2CHZA 3LVRE 3IHYA 4UI9K 2I2OA 3CKCA 5T4YA 4A3VA 3FH7A 3PUJA 4GA1A 4H7YA 3JYSA 4DI4A 4NRHB 3ZVVA 4BX9A 2AXVA 3FTXA 3T8MA 3FDHA 3CV0A 1NZNA 4FADA 5FZSA 2GRMA 4HXIA 5E75A 4JEHA 2VSYA 1KT0A 2ZU6B 3DBSA 4TV3A 5T3RA 1S0PA 4EECA 1H2TC 1U3CA 1SZ9A 3ULQA 3EHNA 4LUNU 2LSUA 4MS6A 3N71A 1U3DA 2ILRA 3PS6A 5BUZA 2Y3AA 4BT8A 3GZ2A 2YNQA 2R59A 2VSNA 3NQPA 3UT8A 3ML9A 3NZUA 4BT9A 4I17A 4U0UA 4FHJA 4EZJA 4HOSA 3CSFA 3ZHEB 3BG1B 4Y6WA 1WY6A 4JHJA 1X5BA 4F1SA 3WXXA 1ELRA 5ANRA 2LNIA 4J8DA 2IOSA 2GGFA 4FULA 2AVPA 2DIWA 1MQSA 2XPZA 3RRNB 3ZXSA 1Z6TA 1YA0A 4W9RA 4RG9A 4YVOA 4HORA 2FI7A 4JEUA 4PS7A 4HLEA 2WQ7A 2J4DA 4CT0A 3Q5MA 3VLEA 3PEUB 4BTAA 3HIZA 3IBEA 4CGVA 5JHAA 2R5SA 4WAFA 3VTXA 4Q69A 5D0OD 4AVXA 2VTBA 4V3IA 3FTZA 4GMJA 5FJYA 2XGOA 1OWNA 5ARGA 3EIQC 1A17A 3G2TA 4PDXA 3LKUA 4UWFA 1B89A 4XZ4A 5G2NA 2AW6A 5G05C 3UT4A 1P5QA 2X38A 1EPUA 4JW1A 4G2VA 4OVUA 2UY1B 3IKOB 4IULA 1MHQA 4G1TA 3ZPJA 5M72A 4XI9A 1EF1C 1OUVA 3D9JA 3CSTA 3QARA 4J8EA 4I6JA 5FZRA 4Q96A 3VLFA 4D10C 4BX8A 4AP2A 3CVLA 3FY4A 3CQCB 3PH0C 1H2VC 4EZKA 4MKTA 4QFVA 3PE4A 4KZ0A 4ILHB 4GCOA 4NACA 3KAEA 4N3BA 4RSYA 3Q49B 3KS2A 4U63A 4DI3A 2BTDA 3GZSA 4WNFA 4GZDA 4CEMA 3BG0B 3CHPA 4TRQA 4AJWA 3CGHA 4NURA 4BY6A 4AY6A 1IHGA 2KCVA 3OXFA 4I2ZA 3QB2A 2WM9A 3FH8A 1UN8A 3IV0A 2UY1A 4ME2A 4U07A 1H2UA 5BT1A 4CT4A 4I1OB 1XNFA 3FULA 4WNEA 3ZRHA 2PZIA 2XCBA 3BEEA 1E8XA 5BW8C 4ILGA 2KCKA 2ONDA 4GZ3A 2WMNA 3HDXA 3CVUA 3ASHA 3CVWA 2WVIA 3SHFA 1NP7A 3PZDA 1SQMA 5E76A 3DPDA 4AY5A 4AXHA 2X6IA 3CK9A 3CVPA 2FO7A 2DCPA 2FULA 3FP3A 3LJ3A 3G2VA 4DK5A 3JUIA 4IN3B 4KYOB 2WXRA 4JVSA 1IYGA 3NF1A 3TXMA 5D0QD 4CDNA 4FU3A 4AEZC 2LO6A 2VTBB 2CHWA 1JWGA 1NA0A 4JC8A 2CFUA 2WQ6A 4FLHA 2RD0A 3FUEA 3SD5A 3LEWA 2GRLA 2MRIA 4ANUA 2XGSA 2DBAA 4LCTA 3SZ7A 4A3TA 5JJ6A 3L13A 4B8CB 4HOQA 4N2SA 3E4BA 1UJJA 1E8ZA 4BTBA 4GAAA 3L16A 3D9IA 5FQ7A 3UUXA 3T5XA 3FUJA 4FA6A 4I6GA 5JHBA 3B7UX 2BUGA 2QY7A 5G05J 2VSXE 5BPPA 3SGHA 4HS2A 3CVXA 3SI5A 3APFA 3ZEFA 4Y6CA 4PS3A 3CQGB 3RRUA 3LY7A 3UMVA 2FEZA 3G2SA 4KZCA 5LFAA 3SBSA 5EKQD 3ZYKA 3LS8A 4J8FA 2LAIA 5FQ6A 3TAXA 3KD7A 3ESLA 4GZ6A 5BV0A 4XE0A 1FVHA 4GYOA 2X6HA 2KCLA 2L0IA 3TG4A 1OWOA 3AU4A 3FUMA 4FJZA 4GYYA 4KVMA 3EHMA 3SF4A 5A23A 3ZHEA 4N2QA 1QQEA 3FUHA 1UW4B 3QWVA 4C0MA 2PM7A 5A6CA 2J49A 4RVBA 2NSZA 1E96B 2YHCA 5G04J 4OVVA 2J07A 5C2YA 1FVFA 3EJNA 3L6AA 1H6KA 3QJZA 5AIJA 5LX8A 4UQYA 4GMLA 2I1KA 3RO2A 2KM4A 3L54A 1JPLA 3TJPA 2BF0X 3B7TA 4EPZA 3ASFA 3U4TA 4XIFA 4E85A 4UWHA 2VSOE 4PH4B 1EYHA 5KJKA 3RJVA 4EQFA 2KC7A 3FU6A 3ZYLA 3ONLA 5J08A 1HG2A 3FWVA 4APFA 4NQ0A 4URKA 3PNLB 2WXLA 4BFRA 1OWMA 3APCA 2IJGX 1UN9A 2JLBA 5ARFA 2XRZA 2J9QA 3CK8A 2IONA 1ELWA 1HFAA 3GYZA 3ENEA 3PUKA 3VTYA 1QNFA 2XCCA 2KATA 3SNXA 3O4ZA 3FEYA 3QWPA 3FTWA 3OAWA 5LP0A 4I2WA 3CIAA 5DBKA 5EX0A 2CHXA 5KJLA 1IQUA 3FUFA 2PM6A 3D9MA 2WXPA 3TG5A 3JQ0A 3FU3A 3S7DA 2PQNA 4WUYA 2I9CA 3L08A 3OTNA 4O6FA 4KMOA 2A4ZA 4L2LA 2WXHA 3K9IA 2WXIA 2WMOA 1E8YA 1HF8A 3CEQA 3RK6A 4ILIA 5AJDA 1INZA 1L5JA 5AENA 4N3AA 4HOTA 4JHKA 3L22A 4IRUA 1NA3A 3CKBA 4G25A 1HO8A 3FUIA 4K0RA 3PRZA 4M3OA 3VLDA 5FT9A 2WXKA 1HG5A 2E0IA 1N52A 1E7VA 3TL5A 4B8AA 3ZW3A 4HVBA 1HX8A 3AS4A 3HHMA 2XEVA 2YINA 4FHKA 4BSXA 1Z3XA 2L9BA 3IEGA 3CVNA 1N54A 1E90A 2WXFA 4J0UA 4JPSA 4U04A 3ESKA 2IOLA 3FTSA 4WNDA 2NXPA 2A5UA 4ANVA 4ANXA 2C0MA 5ENNA 3NZSA 4I9EA 1OWPA 3L17A 5FWQA 3ZIMA 3FTVA 4KBQA 3LCAA 3MKQA 4IYPA 4ACLA 2MOWA 3Q47B 3FUKA 3MJWA 4K03A 3MKRA 3FHEA 3LPZA 4JA9A 4KT6B 1ELKA 4C0EA 4G23A 5CHEE 3LDZA 2WXQA 4J6IA 4R7LA 4AOFA 4JHRA 3S2AA 2FBNA 4F7AA 5ANLA 2RG8A 4PS8A 2X3MA 2VGXB 3T5VA 2QFCA 2WPVA 4PUCA 1PY1A 1DVPA 5FTPA 1TEZA 3B13A 4J8SA 1BPOA 5T8IA 5LOZA 4CDRA 4DLQA 1UG3A 4LEUA 4N39A 2CG2A 4F53A 3G2WA 5EDSA 4FJYA 4EBAA 3U66A 2I6HA 2C0LA 2C2LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IF4 A;  2UY1 B;  4G24 A;  1QQE A;  4N2Q A;  3QWV A;  5A6C A;  4G1T A;  3ZPJ A;  5M72 A;  5A7D B;  1E96 B;  2YHC A;  4XI9 A;  1HXI A;  1OUV A;  5G04 J;  3QWW A;  4J8E A;  4JA7 A;  3RKV A;  3S7F A;  4WNG A;  5EX3 A;  4GA0 A;  5FZR A;  5HI7 A;  3TGO A;  4A1S A;  2HO1 A;  3CVL A;  4UQY A;  3O48 A;  5JJT A;  4U0S A;  3CK7 A;  3RO2 A;  2MHK A;  2YQ8 A;  3PE4 A;  1QZ2 A;  4H7X A;  1FCH A;  4GCO A;  4G2V A;  5DIZ A;  2Q7F A;  1ZU2 A;  3ASF A;  3CVQ A;  1TJC A;  3KAE A;  2Y4U A;  3KS2 A;  1W3B A;  3LY8 A;  3Q49 B;  4N3B A;  4XIF A;  3R9A B;  1KT1 A;  4RG6 A;  4WNF A;  4ABN A;  3RJV A;  5KJK A;  3OXL A;  2IFU A;  2KC7 A;  4EQF A;  5LCW C;  3EDT B;  3MV2 B;  3FWV A;  4GCN A;  3S7B A;  2FF4 A;  3HYM B;  4NQ0 A;  4APO A;  4F3V A;  5JJ7 A;  2WQH A;  4I9C A;  4U0Z A;  4BWR A;  4AY6 A;  2JLB A;  5ARF A;  1IHG A;  2J9Q A;  2KCV A;  3CK8 A;  2VQ2 A;  3ASG A;  3OXF A;  4UI9 J;  4YVQ C;  4I2Z A;  1ELW A;  3GYZ A;  3LY9 A;  4G26 A;  3GW4 A;  4XI0 A;  3URZ A;  3VTY A;  5LCW J;  2XCC A;  2KAT A;  2UY1 A;  3QDN A;  4ME2 A;  3QWP A;  4U07 A;  5BT1 A;  3AS8 A;  4KXK B;  4WNE A;  1XNF A;  2PL2 A;  2V5F A;  4I2W A;  5DBK A;  5EX0 A;  5KJL A;  2PZI A;  4GPK A;  2XCB A;  3BEE A;  3MV3 B;  2OOE A;  3Q15 A;  4GZ5 A;  3S7D A;  3TG5 A;  3Q4A B;  3OXG A;  5BW8 C;  2PQN A;  2UWJ G;  4HOU A;  4WUY A;  3MA5 A;  1WM5 A;  2KCK A;  1WAO 1;  2OND A;  3AS5 A;  2LSV A;  4I1A A;  4O6F A;  4GZ3 A;  3FFL A;  2HYZ A;  3ASH A;  3K9I A;  3RO3 A;  3GZ1 A;  3PE3 A;  5KJN A;  4UQX A;  3CEQ A;  4AM9 A;  4AY5 A;  4UI9 K;  5G04 C;  3CKC A;  2FO7 A;  3CK9 A;  3CVP A;  3LYA A;  3FP3 A;  4GA1 A;  4H7Y A;  3JYS A;  4N3A A;  4YND A;  4NRH B;  4HOT A;  4IN3 B;  1NA3 A;  3CKB A;  4G25 A;  4KYO B;  3CV0 A;  1NZN A;  5FZQ A;  1IYG A;  3NF1 A;  5FZS A;  3UQ3 A;  5D0Q D;  5HQ8 A;  5FT9 A;  3MEK A;  2Y4T A;  1HZ4 A;  2HR2 A;  3ZHE A;  4GYW A;  1HH8 A;  1KT0 A;  1NA0 A;  2VSY A;  3PDN A;  1KLX A;  1Y8M A;  3AS4 A;  3ULQ A;  2XEV A;  2P58 C;  2LSU A;  3N71 A;  4BT8 A;  3GZ2 A;  3IEG A;  3UPV A;  2E2E A;  2DBA A;  2VSN A;  2XGS A;  3CVN A;  3QKY A;  4J0U A;  3ESK A;  2VGY A;  4U04 A;  3SZ7 A;  5JJ6 A;  1ZBP A;  4WND A;  4BT9 A;  4I17 A;  2VYI A;  4U0U A;  4HOQ A;  4UI9 C;  2C0M A;  5KJM A;  3ZHE B;  3E4B A;  4HOS A;  2L6J A;  4N2S A;  4JL0 A;  4BTB A;  4I9E A;  4Y6W A;  3WXX A;  3UUX A;  1ELR A;  4GA2 A;  2LNI A;  4J8D A;  3U4T A;  3RU0 A;  2AVP A;  2BUG A;  2NC9 A;  2XPI A;  1PC2 A;  5G05 J;  4KBQ A;  3LCA A;  2XGM A;  2VGX A;  1YA0 A;  3Q47 B;  3S7J A;  3ASD A;  4RG9 A;  4W9R A;  4Y6C A;  4YVO A;  2FI7 A;  3MKR A;  4CGW A;  4HOR A;  3LY7 A;  3LPZ A;  2FEZ A;  4JA9 A;  4UQZ A;  3ZN3 A;  2PQR A;  3Q5M A;  4G23 A;  5CHE E;  5AYW D;  5EKQ D;  4CGV A;  4N3C A;  4BTA A;  4J8F A;  3TAX A;  5BNW A;  4JHR A;  5C1D A;  3KD7 A;  2FBN A;  5CCM A;  2R5S A;  3VTX A;  3ZFW A;  3U3W A;  4GZ6 A;  4B94 A;  2GW1 A;  5D0O D;  2VGX B;  2QFC A;  2WPV A;  4GYO A;  5FTP A;  3ZGQ A;  2KCL A;  4N5C A;  2XGO A;  5ARG A;  5FJY A;  3RIB A;  3TG4 A;  4CDR A;  1A17 A;  3QOU A;  5CCL A;  4LEU A;  3LKU A;  4N39 A;  1B89 A;  4AIF A;  5G05 C;  4GYY A;  1P5Q A;  3SF4 A;  2I6H A;  2C0L A;  2C2L A; 
#chains in the Genus database with same CATH topology
 3FTY A;  2X6K A;  1KZP A;  4HRN A;  3S7F A;  2XEN A;  1FCH A;  2J08 A;  3Q7A A;  4Q94 A;  4ANW A;  3ML8 A;  1W3B A;  2IFU A;  5B1A E;  2XQ0 A;  4APO A;  3S7B A;  4F3V A;  2FF4 A;  5ENO D;  5AQ7 A;  3C72 A;  2WXG A;  3FH5 A;  3PNT B;  3R7R A;  2VGE A;  1LF8 A;  4XI0 A;  4L7T A;  3TWQ A;  3X2Q E;  3MV3 B;  4GZ5 A;  2WXM A;  3D3M A;  1WAO 1;  2LSV A;  3UM1 A;  4FC8 A;  4TXP A;  3PE3 A;  1H6P A;  2LUH A;  4UWK A;  1IQR A;  3JQ1 A;  3UX4 A;  1O1T A;  3EUV A;  4GYW A;  3PDN A;  4U8H A;  4OAV B;  2VJ8 A;  4LSZ E;  4LRZ A;  2P58 C;  1E8W A;  3UPV A;  2E2E A;  3KEZ A;  1ZBP A;  2VYI A;  5KJM A;  4JL0 A;  1E7U A;  3RU0 A;  4XKB A;  3S7J A;  4MRU A;  3HRA A;  3ZN3 A;  2PQR A;  5CCM A;  4A55 A;  4B94 A;  3UM2 A;  4N5C A;  3TXN A;  5CCL A;  2LAH A;  4JZY A;  1SA5 A;  3SFZ A;  3SBT B;  4I1M A;  1HE8 A;  3HVE A;  3AG4 E;  3QWW A;  4JA7 A;  3TGO A;  2WXN A;  4CCA A;  4U0S A;  5CED B;  1TJC A;  1N95 A;  3KSQ A;  3B7R L;  4MLP A;  5CER B;  4UWL A;  2WQH A;  1EDU A;  3URZ A;  2I1J A;  1D9S A;  1O1R A;  1OCC E;  1WDY A;  2OV8 A;  3D9L A;  3JXJ A;  2L0T B;  3PEV B;  3RRM B;  2IY0 C;  5KJN A;  5EIB E;  3IHY A;  3DSU A;  4UI9 K;  3Q75 A;  5T4Y A;  4A3V A;  3FH7 A;  1IXV A;  3JYS A;  4NRH B;  4BX9 A;  3CV0 A;  5E75 A;  5AQA A;  2DYS E;  2VSY A;  1KT0 A;  4U8Y D;  3BQO A;  4EEC A;  4TXR A;  3EHN A;  2Y3A A;  4BT8 A;  3GZ2 A;  2VSN A;  2EIJ E;  1LD7 A;  1OXJ A;  3BU8 A;  3ABL E;  4HOS A;  4FHJ A;  3J5Q B;  3C3O A;  3HXD A;  3WXX A;  2LNI A;  2GGF A;  2DIW A;  3ZXS A;  2P9N G;  4W9R A;  3AG2 E;  4HOR A;  4HLE A;  4CT0 A;  5JHA A;  2EIN E;  4BTA A;  5HKP A;  4Q69 A;  2VTB A;  4GTO A;  3DSV A;  3EIQ C;  5EYP F;  4PDX A;  3LKU A;  1B89 A;  3UKR G;  1P5Q A;  2R2L A;  4OVU A;  3D9J A;  4J8E A;  3R9M A;  4I6J A;  5FZR A;  4Q96 A;  3VLF A;  2ZGD A;  4D10 C;  2XS1 A;  4AP2 A;  3E37 A;  1H2V C;  1D8D A;  4DX2 A;  4RQI A;  4GCO A;  4NAC A;  5CBO A;  3KAE A;  4DI3 A;  3DWL G;  4WNF A;  4GZD A;  2A5E A;  3CGH A;  5KBA A;  1IHG A;  2KCV A;  4YDE A;  4I2Z A;  4G8L A;  4HNA D;  3QB2 A;  2V4H C;  4ME2 A;  1H2U A;  1XNF A;  2XCB A;  1E8X A;  4ILG A;  2KCK A;  3HDX A;  1TN6 A;  3UM3 A;  4DK5 A;  2P9L G;  3EU5 A;  4CDN A;  3KEA A;  2VTB B;  2CHW A;  3W9G A;  1JWG A;  2KBX A;  2XS8 A;  4ANU A;  3SZ7 A;  1IKN D;  3UUX A;  4FA6 A;  2BUG A;  2VSX E;  5BPP A;  3SGH A;  3V31 A;  2P9I G;  4PS3 A;  3CQG B;  3RRU A;  3UMV A;  3AG1 E;  4KZC A;  5LFA A;  1LTX A;  3SBS A;  3ZYK A;  3TAX A;  5FQ6 A;  4DX5 D;  3FUM A;  2R02 A;  3ZHE A;  4N2Q A;  1QQE A;  4C0M A;  3QWV A;  4RVB A;  1E96 B;  4OVV A;  3EJN A;  2F0Y A;  1NI1 A;  4GML A;  2I1K A;  3E33 A;  3RO2 A;  3L54 A;  1JPL A;  4L9P A;  3TJP A;  4EPZ A;  4XIF A;  4E85 A;  1EYH A;  2V5Q C;  3ONL A;  1S64 A;  4NQ0 A;  3JUE A;  4BFR A;  1OWM A;  4ATZ D;  2GRN B;  5ARF A;  2J9Q A;  1HFA A;  3GYZ A;  3FEY A;  4U96 D;  3OAW A;  5LP0 A;  5DBK A;  2IEJ A;  3FUF A;  2WXP A;  3TG5 A;  2PQN A;  3TWR A;  3C3Q A;  3K9I A;  3NOG D;  2WMO A;  1HF8 A;  2GRO B;  3RK6 A;  4HOT A;  1HO8 A;  4JD2 G;  2WXK A;  4J7W A;  1E7V A;  4B8A A;  1K8K G;  1HX8 A;  3AS4 A;  2YIN A;  3TWV A;  4U7E B;  3CVN A;  4OAU C;  3ESK A;  2IOL A;  4ANX A;  5ENN A;  4I9E A;  5FWQ A;  3RSE G;  4KBQ A;  4ACL A;  3AG3 E;  3MJW A;  3FHE A;  4JA9 A;  2H6F A;  1ELK A;  4J6I A;  4F7A A;  5D66 A;  3T5V A;  2QFC A;  2OEV A;  4HQD A;  1DVP A;  5ENT D;  1BPO A;  3DPY A;  4LEU A;  2CG2 A;  3L82 A;  3G2W A;  2I6H A;  2C2L A;  1DNP A;  5BV1 A;  1H0A A;  4E6H A;  5EX3 A;  4A1S A;  2DVW A;  2MHK A;  4WWN A;  5DIZ A;  4EHM A;  2Q7F A;  3LY8 A;  4L23 A;  4B0Z A;  1NL4 A;  2AXU A;  1HU3 A;  4GZC A;  4DRX E;  5FQ8 A;  3LY9 A;  3GW4 A;  5JMN D;  3AS8 A;  3SFY A;  1H19 A;  2QC9 A;  5AQB A;  1VDY A;  3QAQ A;  4K5A B;  2GRQ B;  5G04 C;  4LER A;  4UWG A;  1BU9 A;  5FZQ A;  3UQ3 A;  3MEK A;  2HR2 A;  1HH8 A;  3L9T A;  4TUU A;  3MZL B;  2J4B A;  2VGY A;  3MKQ B;  2OCC E;  4YDY A;  2L6J A;  3QK0 A;  4XX5 A;  4OYS A;  1Y6I A;  2XPI A;  4J8Y A;  2XGM A;  3ASD A;  4CGW A;  5ENP D;  5CMY A;  1WG0 A;  2XHE A;  3ISM C;  5AYW D;  3EIJ A;  3U3W A;  3U64 A;  4GB9 A;  3CHQ A;  4MBG A;  4AIF A;  4I6E A;  4WNG A;  5HI7 A;  3O48 A;  5JJT A;  3MX3 A;  2LXM A;  2R17 C;  1N9A A;  4HBD A;  2Y4U A;  3CVY A;  4HFG A;  3OXL A;  4ATG A;  5LCW C;  3MGB A;  4U0Z A;  2VQ2 A;  4UI9 J;  2IO2 C;  4I43 A;  2ZIS A;  3C98 A;  1FPP A;  1HS6 A;  4KXK B;  2V5F A;  1XGW A;  4GPK A;  3OXG A;  1OCR E;  4HOU A;  3MA5 A;  1WM5 A;  4I1A A;  2ZXW E;  3J5P A;  5ENR D;  2HYZ A;  3RO3 A;  2CHZ A;  2DZN A;  4GA1 A;  4GTV A;  3FTX A;  4LG6 A;  3E34 A;  2P9K G;  2QZA A;  2GRM A;  2ZU6 B;  1N4S A;  1H2T C;  2LSU A;  3N71 A;  3PS6 A;  2R59 A;  3NQP A;  3UT8 A;  3NZU A;  3ASN E;  3Q7F A;  4EZJ A;  4DX6 D;  3BG1 B;  1X5B A;  4BES A;  1MZC A;  4FUL A;  2XPZ A;  4A63 B;  4RG9 A;  2WQ7 A;  1JCR A;  3LJN A;  3Q5M A;  2XZT G;  4CGV A;  3IBE A;  2R5S A;  3VTX A;  3RAU A;  5D0O D;  2BKG A;  4V3I A;  3FTZ A;  5ARG A;  4XZ4 A;  5G2N A;  2AW6 A;  3UT4 A;  2X38 A;  4G2V A;  3IKO B;  4G1T A;  3ZPJ A;  4HI8 A;  3CST A;  4O1P A;  3FY4 A;  1UOH A;  3CQC B;  4QFV A;  3PE4 A;  4ILH B;  1QYM A;  1K3Z D;  4N3B A;  2RFA A;  4CEM A;  3UKU G;  4AY6 A;  4HRM B;  3DXM G;  1SA4 A;  2WM9 A;  3FH8 A;  1UN8 A;  1TR4 A;  4CT4 A;  4N5Q A;  4I1O B;  3ZU7 B;  4X8Q A;  5BW8 C;  1RZ4 A;  3CVW A;  3SHF A;  1SQM A;  4AXH A;  3CK9 A;  2FO7 A;  3LJ3 A;  3HXF A;  1SW6 A;  1IYG A;  3NF1 A;  1NA0 A;  4JC8 A;  2CFU A;  4FLH A;  3FUE A;  3SD5 A;  2MRI A;  3V79 K;  4A3T A;  4B8C B;  4HOQ A;  1UJJ A;  1E8Z A;  4BTB A;  3T5X A;  3FUJ A;  1V54 E;  3B7U X;  5G05 J;  1DC2 A;  3ASO E;  3SI5 A;  1AP7 A;  1TNU A;  5EKQ D;  2LAI A;  4GZ6 A;  5BV0 A;  4XE0 A;  5EN5 D;  2KCL A;  2L0I A;  3TG4 A;  3AU4 A;  1O5M A;  4F6R D;  5A23 A;  3FUH A;  2J49 A;  3SFX A;  5G04 J;  5C2Y A;  5AIJ A;  3L6A A;  4UQY A;  3HG0 D;  2QYJ A;  3UIN C;  3B7T A;  3W9F A;  3FU6 A;  3EHQ A;  5J08 A;  4GTS A;  2WXL A;  1UN9 A;  2JLB A;  2ION A;  2MYO A;  2F8X K;  1ELW A;  3FTW A;  3CIA A;  4LNU D;  2ETA A;  5KJL A;  1IQU A;  3D9M A;  5FIO A;  1V55 E;  3FU3 A;  2I9C A;  4M7C A;  4KMO A;  2Y1L E;  5BXU A;  5AAO A;  4N3A A;  4JHK A;  3L22 A;  4IRU A;  3PRZ A;  3VLD A;  1HG5 A;  1TNO A;  1N52 A;  1MYO A;  5HRY A;  3HXB A;  3HHM A;  2XEV A;  1DCE A;  4FHK A;  3IEG A;  2L9B A;  5ENQ D;  1YMP A;  1N54 A;  1E90 A;  2WXF A;  3JXI A;  2A5U A;  3AJI A;  3NZS A;  3LCA A;  3MKQ A;  2MOW A;  3FUK A;  4K03 A;  3MKR A;  5CHE E;  1TNZ A;  2X3M A;  4PUC A;  4J8S A;  4DLQ A;  4CDR A;  4N39 A;  5EDS A;  4FJY A;  3U66 A;  3Q73 A;  2IF4 A;  5A7D B;  1SZA A;  3RKV A;  3P1U A;  2HO1 A;  4GU5 A;  3FU0 A;  4O60 A;  3CK7 A;  4K5C A;  3MCX A;  2YQ8 A;  4H7X A;  1ZU2 A;  5CMW A;  2XPY A;  4A1G A;  3U9W A;  1OY3 D;  3ASG A;  3FUN A;  5LCW J;  4L1B A;  1N94 A;  2PL2 A;  2AXZ A;  3I5P A;  3D9K A;  3UT7 A;  2YHE A;  3AS5 A;  1MX4 A;  3APD A;  3GZ1 A;  5KNH D;  2F8Y A;  5KWD A;  2F37 A;  3CHR A;  3FUD A;  2X6F A;  5HQ8 A;  1HZ4 A;  5EYL A;  1A5E A;  3P2B A;  1KLX A;  2QYU A;  3CR3 A;  4WWO A;  4DJA A;  1UJK A;  4HLL A;  1JWF A;  3QKY A;  3JCK C;  3DXK G;  2AWI A;  4GMR A;  4UI9 C;  4GTP A;  3LVQ E;  2XZD G;  4G11 A;  3CVV A;  1PC2 A;  1Z3Y A;  4HB5 A;  2NYJ A;  3CLJ A;  5BNW A;  5C1D A;  3ZFW A;  3DSX A;  4LNB A;  3ZGQ A;  3MYV A;  3C3R A;  3RIB A;  4P29 A;  3QOU A;  4GTR A;  4CDM A;  1GW6 A;  2ZGG A;  2IU1 A;  2H6I A;  3HVE B;  4WWP A;  4TXQ A;  3QC1 A;  3T9K A;  3UI2 A;  4GPM A;  2WXJ A;  3R9A B;  2XEE A;  3DSS A;  3EDT B;  3MV2 B;  5JJ7 A;  3HYM B;  2OEW A;  5AJL A;  4I9C A;  2EQX A;  4TUM A;  4YVQ C;  4G26 A;  4FLB A;  2J09 A;  4EBA G;  4ACK A;  1JCQ A;  3UTM A;  4AV7 A;  3E32 A;  2CG3 A;  4JXT A;  4DPR A;  3LVR E;  2LXL A;  2I2O A;  3CKC A;  1TYQ G;  1BI8 B;  4DI4 A;  4H7Y A;  3ZVV A;  2AXV A;  3T8M A;  4FAD A;  5B3S E;  4BER A;  4JEH A;  4TV3 A;  1S0P A;  1S63 A;  4LUN U;  4MS6 A;  3DST A;  2ILR A;  5BUZ A;  2DWZ A;  2YNQ A;  5B1B E;  3ML9 A;  4BT9 A;  4U0U A;  3ZHE B;  2KXP C;  3TWX A;  4Y6W A;  1WY6 A;  4JHJ A;  4F1S A;  1ELR A;  1OT8 A;  2DYR E;  3ZNG A;  1YA0 A;  2FI7 A;  4JEU A;  1D8E A;  4PS7 A;  1TN8 A;  1QBQ A;  3HIZ A;  4WAF A;  1Z5S C;  4AVX A;  1X81 A;  2XGO A;  1OWN A;  3G2T A;  3UIP C;  2B0O E;  2FO1 E;  4JW1 A;  1EF1 C;  1OUV A;  3QAR A;  3AAA C;  3CVL A;  3PH0 C;  4EZK A;  4MKT A;  3Q78 A;  4RSY A;  1TN7 A;  3KS2 A;  2BTD A;  5CEC B;  2ETB A;  4BEP A;  3CHP A;  4AJW A;  4NUR A;  3OXF A;  2UY1 A;  4U07 A;  4WNE A;  3FUL A;  4O1O A;  2PZI A;  3BEE A;  1YYH A;  5ENS D;  2OND A;  2XEH A;  4GZ3 A;  3CVU A;  4HI9 A;  5E76 A;  4AY5 A;  4U8V D;  2DCP A;  1K1B A;  2FUL A;  3JUI A;  4KYO B;  4JB8 P;  3TXM A;  4FU3 A;  2WQ6 A;  4B93 B;  1KPS B;  2RD0 A;  2GRL A;  2DBA A;  3L13 A;  1G3N B;  5CRV A;  3E4B A;  1S70 B;  4GAA A;  3L16 A;  1BI7 B;  3D9I A;  5FQ7 A;  5JHB A;  3CVX A;  3APF A;  2EIL E;  3LY7 A;  1BLX B;  4J8F A;  3ESL A;  2ETC A;  1FVH A;  2X6H A;  3Q9U C;  4FJZ A;  2R03 A;  4KVM A;  3SF4 A;  1UW4 B;  5A6C A;  5AQ9 A;  2YHC A;  2J07 A;  3DEO A;  1FVF A;  5LX8 A;  3QJZ A;  3KSL A;  2KM4 A;  1NFI E;  3ASF A;  3WG7 E;  3RJV A;  2KC7 A;  3ZYL A;  4URK A;  3PNL B;  2DZO A;  3PZ4 A;  2IJG X;  3PUK A;  3ENE A;  2XCC A;  2KAT A;  3SNX A;  5FIN A;  2CHX A;  3EHR A;  3S7D A;  3DSW A;  2L6B A;  3OTN A;  4O6F A;  2A4Z A;  4L2L A;  3V2X A;  2WXH A;  2WXI A;  1E8Y A;  2GRR B;  5AJD A;  3PZ2 A;  1INZ A;  5AEN A;  3F6Q A;  1JCS A;  4QQI A;  3NAW A;  3FUI A;  2IO3 C;  5FT9 A;  3ZW3 A;  4RLY A;  4GTT A;  4HVB A;  2H6H A;  2J8S D;  4BSZ B;  4XEI G;  4U04 A;  1N4R A;  3NOC D;  4J0U A;  3FTS A;  4WND A;  4ANV A;  2C0M A;  3D9H A;  3ZIM A;  3FTV A;  1LD8 A;  4KT6 B;  4C0E A;  4G23 A;  2WXQ A;  4R7L A;  1Q2Z A;  3S2A A;  4PS8 A;  3ZKJ A;  3V30 A;  2HE0 A;  5FTP A;  1PY1 A;  3B13 A;  5T8I A;  3TWW A;  5LOZ A;  4EBA A;  3ZXP A;  5KCM A;  4K5B A;  3UIO C;  3B7S A;  3UXG A;  3D9O A;  3IHV A;  2OVF A;  4DLO A;  4NIK A;  3CVQ A;  4KVO A;  1MX2 A;  4ABN A;  2KZT A;  2WXO A;  3ONK A;  5CEA A;  2R05 A;  4BWR A;  3EU9 A;  3UM0 A;  2WB2 A;  3CHM A;  2M63 A;  2X6J A;  3PVL A;  3QDN A;  1JUQ A;  4GTQ A;  3LXU X;  3CHS A;  2BKK B;  1SVX A;  3CHO A;  5IY5 E;  4UQX A;  4AM9 A;  2EIM E;  3I3N A;  1H6O A;  3LYA A;  1TJF A;  4YND A;  5G55 A;  2HM8 A;  2Y4T A;  1Y8M A;  3D9N A;  3PZ1 A;  3QNK A;  3I4G A;  2JEK A;  1BD8 A;  1IHB A;  1DCQ A;  5FQ4 A;  4DX7 D;  4L2Y A;  3T8K A;  3FU5 A;  4GA2 A;  4EZL A;  2NC9 A;  5AAR A;  2VGX A;  4XKC A;  2IQC A;  4UQZ A;  1PAQ A;  3R7Q A;  4N3C A;  1N11 A;  3AU5 A;  2GW1 A;  4C48 B;  3ULY A;  1N0Q A;  1MJ0 A;  5ITZ F;  2V8S E;  1O1S A;  2P9P G;  2V0P A;  2XRY A;  3FTU A;  4G24 A;  4C9B B;  4Z68 A;  4CRW A;  4DX1 A;  1HXI A;  3G2U A;  4GA0 A;  3FEX A;  3ABM E;  2V4L A;  3ZYQ A;  2ZIR A;  3NB2 A;  3SO8 A;  1QZ2 A;  4CZ2 D;  4F1P A;  3I4R B;  2CFZ A;  3Q79 A;  1K1A A;  1KT1 A;  4RG6 A;  4CYM D;  3ABK E;  4GCN A;  2P9S G;  2EIK E;  5J90 A;  3PZ3 A;  3ZYM A;  3TWU A;  3NBN B;  1OWL A;  2OVB A;  4FP7 A;  3Q15 A;  2OOE A;  3Q4A B;  2UWJ G;  2KZT B;  2RFM A;  3PRE A;  4B89 A;  3D9P A;  2RKK A;  3FFL A;  3PUJ A;  3FDH A;  1NZN A;  5FZS A;  4HXI A;  3DBS A;  5T3R A;  1FT1 A;  1U3C A;  1SZ9 A;  3ULQ A;  3B7B A;  5H7P A;  1U3D A;  4UUC A;  5CBN A;  3HXE A;  4I17 A;  3CSF A;  5ANR A;  4J8D A;  2IOS A;  2AVP A;  1MQS A;  3RRN B;  2AJA A;  1Z6T A;  4YVO A;  2J4D A;  3VLE A;  3PEU B;  1N4P A;  1RW2 A;  4GMJ A;  5FJY A;  4LNG A;  1N4Q A;  1A17 A;  4UWF A;  3SY2 A;  5G05 C;  1EPU A;  2UY1 B;  4IUL A;  5D2M C;  1MHQ A;  5M72 A;  4XI9 A;  4GTM A;  4BX8 A;  1FT2 A;  2GRP B;  3C5R A;  4KZ0 A;  5CRU A;  4G8K A;  3Q49 B;  4U63 A;  3GZS A;  1MX6 A;  3BG0 B;  3TWT A;  4TRQ A;  4BY6 A;  5KNG A;  1OCO E;  3ULE G;  3IV0 A;  5AN8 A;  5BT1 A;  1YCS B;  3ZRH A;  2WMN A;  3ASH A;  2WVI A;  3SQV A;  1NP7 A;  3PZD A;  3DPD A;  3BUA A;  2X6I A;  3CVP A;  4HRL A;  3FP3 A;  3G2V A;  4IN3 B;  2WXR A;  4JVS A;  3TWS A;  5D0Q D;  5HS0 A;  2P2C P;  4AEZ C;  2LO6 A;  4ZFH A;  3LEW A;  2XGS A;  4LCT A;  5JJ6 A;  2B6C A;  4N2S A;  2P9U G;  4YDO A;  4I6G A;  3DEP A;  2QY7 A;  4HS2 A;  3ZEF A;  4Y6C A;  2FEZ A;  3G2S A;  3DRA A;  3LS8 A;  3KD7 A;  4GYO A;  1ZB1 A;  1OWO A;  2BED A;  4DUI A;  1U2V G;  4GYY A;  3EHM A;  1N0R A;  5JA4 D;  2PM7 A;  2NSZ A;  1H6K A;  3HXC A;  3E30 A;  2BF0 X;  1TNB A;  4YDW A;  3U4T A;  4UWH A;  2VSO E;  4PH4 B;  5KJK A;  4EQF A;  2JAB A;  1HG2 A;  3FWV A;  4APF A;  1OCZ E;  3APC A;  2XRZ A;  3CK8 A;  2Y69 E;  3VTY A;  1QNF A;  5BXO A;  3O4Z A;  3QWP A;  4I2W A;  5EX0 A;  2PM6 A;  3JQ0 A;  4WUY A;  3L08 A;  3V2O A;  3CEQ A;  4ILI A;  4U95 D;  1KZO A;  1L5J A;  3B95 A;  1NA3 A;  3CKB A;  4G25 A;  4K0R A;  4M3O A;  2E0I A;  3TL5 A;  4BET A;  2Y0B G;  4BSX A;  1Z3X A;  4JPS A;  3IXE A;  2NXP A;  1AWC B;  1OWP A;  3L17 A;  2H6G A;  5EID A;  5EIL A;  4IYP A;  3Q47 B;  3LPZ A;  3ZUV B;  3LDZ A;  4AOF A;  4JHR A;  2FBN A;  5ANL A;  2RG8 A;  4ZHB A;  2VGX B;  2PNN A;  2WPV A;  1TEZ A;  3Q9N C;  1UG3 A;  4F53 A;  1TNY A;  2C0L A; 
#chains in the Genus database with same CATH homology
 2IF4 A;  3FTY A;  5KCM A;  1DNP A;  2X6K A;  5BV1 A;  5A7D B;  1SZA A;  1H0A A;  3RKV A;  3S7F A;  4E6H A;  3P1U A;  3B7S A;  5EX3 A;  4A1S A;  2HO1 A;  4GU5 A;  3D9O A;  3IHV A;  2OVF A;  3FU0 A;  4DLO A;  3CK7 A;  2MHK A;  3MCX A;  2YQ8 A;  4H7X A;  1FCH A;  2J08 A;  4WWN A;  5DIZ A;  2Q7F A;  1ZU2 A;  3CVQ A;  4KVO A;  4Q94 A;  3LY8 A;  3ML8 A;  4ANW A;  1W3B A;  2XPY A;  4ABN A;  5CMW A;  4A1G A;  2KZT A;  4L23 A;  2WXO A;  2IFU A;  2XQ0 A;  4B0Z A;  4APO A;  3S7B A;  4F3V A;  2FF4 A;  2AXU A;  3ONK A;  1HU3 A;  2WXG A;  4GZC A;  3U9W A;  3FH5 A;  4BWR A;  2WB2 A;  3PNT B;  3ASG A;  3CHM A;  3FUN A;  3R7R A;  2M63 A;  1LF8 A;  5FQ8 A;  3LY9 A;  4XI0 A;  3GW4 A;  5LCW J;  4L1B A;  4L7T A;  2X6J A;  3PVL A;  3QDN A;  1JUQ A;  3AS8 A;  2PL2 A;  2AXZ A;  1H19 A;  3I5P A;  3D9K A;  3MV3 B;  3LXU X;  4GZ5 A;  3UT7 A;  2WXM A;  3D3M A;  2YHE A;  1VDY A;  1WAO 1;  3AS5 A;  2LSV A;  3QAQ A;  3CHS A;  4FC8 A;  3CHO A;  3APD A;  3GZ1 A;  3PE3 A;  4UQX A;  4AM9 A;  3I3N A;  5G04 C;  3LYA A;  4UWK A;  1IQR A;  3CHR A;  1TJF A;  4LER A;  4UWG A;  4YND A;  3FUD A;  2X6F A;  3JQ1 A;  5FZQ A;  5G55 A;  2HM8 A;  5HQ8 A;  3UQ3 A;  3UX4 A;  3MEK A;  2Y4T A;  2HR2 A;  1HZ4 A;  4GYW A;  1HH8 A;  3PDN A;  4U8H A;  4TUU A;  2VJ8 A;  3P2B A;  1KLX A;  1Y8M A;  3D9N A;  3MZL B;  3CR3 A;  3QNK A;  3I4G A;  4LRZ A;  2P58 C;  4WWO A;  1E8W A;  4DJA A;  2J4B A;  1UJK A;  3UPV A;  1JWF A;  2E2E A;  2JEK A;  3QKY A;  3JCK C;  2VGY A;  3KEZ A;  3MKQ B;  1ZBP A;  2AWI A;  2VYI A;  5KJM A;  4UI9 C;  5FQ4 A;  2L6J A;  4JL0 A;  3QK0 A;  4L2Y A;  4XX5 A;  3LVQ E;  3FU5 A;  4OYS A;  4GA2 A;  1E7U A;  3RU0 A;  4G11 A;  1Y6I A;  2NC9 A;  4XKB A;  4EZL A;  3CVV A;  2XPI A;  1PC2 A;  1Z3Y A;  2XGM A;  2VGX A;  3S7J A;  3ASD A;  4CGW A;  4MRU A;  4XKC A;  5CMY A;  2IQC A;  4UQZ A;  2XHE A;  1PAQ A;  3ZN3 A;  2PQR A;  5AYW D;  3R7Q A;  4N3C A;  3CLJ A;  5BNW A;  5C1D A;  5CCM A;  3EIJ A;  3ZFW A;  3U3W A;  4A55 A;  4B94 A;  3AU5 A;  2GW1 A;  3ZGQ A;  3MYV A;  3U64 A;  4N5C A;  4GB9 A;  3TXN A;  3RIB A;  4P29 A;  3QOU A;  5CCL A;  2LAH A;  3CHQ A;  4AIF A;  4JZY A;  4CDM A;  2V8S E;  1GW6 A;  2V0P A;  2XRY A;  3FTU A;  4G24 A;  2IU1 A;  3SFZ A;  4C9B B;  3HVE B;  4WWP A;  3SBT B;  4I1M A;  1HE8 A;  3HVE A;  4CRW A;  1HXI A;  4I6E A;  3QWW A;  4JA7 A;  3G2U A;  4WNG A;  4GA0 A;  5HI7 A;  3TGO A;  3FEX A;  2WXN A;  4CCA A;  3O48 A;  5JJT A;  2V4L A;  3QC1 A;  3MX3 A;  4U0S A;  3ZYQ A;  2R17 C;  1QZ2 A;  3I4R B;  2CFZ A;  1TJC A;  2WXJ A;  2Y4U A;  3R9A B;  1KT1 A;  4RG6 A;  3CVY A;  4HFG A;  3OXL A;  4ATG A;  5LCW C;  3MGB A;  3EDT B;  3B7R L;  3MV2 B;  5JJ7 A;  4GCN A;  4MLP A;  3HYM B;  4UWL A;  2WQH A;  5AJL A;  4I9C A;  4U0Z A;  5J90 A;  2EQX A;  2VQ2 A;  1EDU A;  4UI9 J;  4YVQ C;  3ZYM A;  4I43 A;  4G26 A;  3URZ A;  2I1J A;  3C98 A;  4FLB A;  1HS6 A;  2J09 A;  4EBA G;  1OWL A;  4KXK B;  2V5F A;  1XGW A;  2OVB A;  4ACK A;  4FP7 A;  4GPK A;  3Q15 A;  2OOE A;  4AV7 A;  2OV8 A;  3D9L A;  3Q4A B;  3OXG A;  2UWJ G;  2KZT B;  4HOU A;  3MA5 A;  1WM5 A;  3D9P A;  3PRE A;  4B89 A;  4I1A A;  2CG3 A;  2L0T B;  3PEV B;  4JXT A;  4DPR A;  3RRM B;  3FFL A;  2HYZ A;  3RO3 A;  5KJN A;  2CHZ A;  3LVR E;  3IHY A;  4UI9 K;  2I2O A;  3CKC A;  5T4Y A;  4A3V A;  3FH7 A;  3PUJ A;  4GA1 A;  4H7Y A;  3JYS A;  4DI4 A;  4NRH B;  3ZVV A;  4BX9 A;  2AXV A;  3FTX A;  3T8M A;  3FDH A;  3CV0 A;  1NZN A;  4FAD A;  5FZS A;  2GRM A;  4HXI A;  5E75 A;  4JEH A;  2VSY A;  1KT0 A;  2ZU6 B;  3DBS A;  4TV3 A;  5T3R A;  1S0P A;  4EEC A;  1H2T C;  1U3C A;  1SZ9 A;  3ULQ A;  3EHN A;  4LUN U;  2LSU A;  4MS6 A;  3N71 A;  1U3D A;  2ILR A;  3PS6 A;  5BUZ A;  2Y3A A;  4BT8 A;  3GZ2 A;  2YNQ A;  2R59 A;  2VSN A;  3NQP A;  3UT8 A;  3ML9 A;  3NZU A;  4BT9 A;  4I17 A;  4U0U A;  4FHJ A;  4EZJ A;  4HOS A;  3CSF A;  3ZHE B;  3BG1 B;  4Y6W A;  1WY6 A;  4JHJ A;  1X5B A;  4F1S A;  3WXX A;  1ELR A;  5ANR A;  2LNI A;  4J8D A;  2IOS A;  2GGF A;  4FUL A;  2AVP A;  2DIW A;  1MQS A;  2XPZ A;  3RRN B;  3ZXS A;  1Z6T A;  1YA0 A;  4W9R A;  4RG9 A;  4YVO A;  4HOR A;  2FI7 A;  4JEU A;  4PS7 A;  4HLE A;  2WQ7 A;  2J4D A;  4CT0 A;  3Q5M A;  3VLE A;  3PEU B;  4BTA A;  3HIZ A;  3IBE A;  4CGV A;  5JHA A;  2R5S A;  4WAF A;  3VTX A;  4Q69 A;  5D0O D;  4AVX A;  2VTB A;  4V3I A;  3FTZ A;  4GMJ A;  5FJY A;  2XGO A;  1OWN A;  5ARG A;  3EIQ C;  1A17 A;  3G2T A;  4PDX A;  3LKU A;  4UWF A;  1B89 A;  4XZ4 A;  5G2N A;  2AW6 A;  5G05 C;  3UT4 A;  1P5Q A;  2X38 A;  1EPU A;  4JW1 A;  4G2V A;  4OVU A;  2UY1 B;  3IKO B;  4IUL A;  1MHQ A;  4G1T A;  3ZPJ A;  5M72 A;  4XI9 A;  1EF1 C;  1OUV A;  3D9J A;  3CST A;  3QAR A;  4J8E A;  4I6J A;  5FZR A;  4Q96 A;  3VLF A;  4D10 C;  4BX8 A;  4AP2 A;  3CVL A;  3FY4 A;  3CQC B;  3PH0 C;  1H2V C;  4EZK A;  4MKT A;  4QFV A;  3PE4 A;  4KZ0 A;  4ILH B;  4GCO A;  4NAC A;  3KAE A;  4N3B A;  4RSY A;  3Q49 B;  3KS2 A;  4U63 A;  4DI3 A;  2BTD A;  3GZS A;  4WNF A;  4GZD A;  4CEM A;  3BG0 B;  3CHP A;  4TRQ A;  4AJW A;  3CGH A;  4NUR A;  4BY6 A;  4AY6 A;  1IHG A;  2KCV A;  3OXF A;  4I2Z A;  3QB2 A;  2WM9 A;  3FH8 A;  1UN8 A;  3IV0 A;  2UY1 A;  4ME2 A;  4U07 A;  1H2U A;  5BT1 A;  4CT4 A;  4I1O B;  1XNF A;  3FUL A;  4WNE A;  3ZRH A;  2PZI A;  2XCB A;  3BEE A;  1E8X A;  5BW8 C;  4ILG A;  2KCK A;  2OND A;  4GZ3 A;  2WMN A;  3HDX A;  3CVU A;  3ASH A;  3CVW A;  2WVI A;  3SHF A;  1NP7 A;  3PZD A;  1SQM A;  5E76 A;  3DPD A;  4AY5 A;  4AXH A;  2X6I A;  3CK9 A;  3CVP A;  2FO7 A;  2DCP A;  2FUL A;  3FP3 A;  3LJ3 A;  3G2V A;  4DK5 A;  3JUI A;  4IN3 B;  4KYO B;  2WXR A;  4JVS A;  1IYG A;  3NF1 A;  3TXM A;  5D0Q D;  4CDN A;  4FU3 A;  4AEZ C;  2LO6 A;  2VTB B;  2CHW A;  1JWG A;  1NA0 A;  4JC8 A;  2CFU A;  2WQ6 A;  4FLH A;  2RD0 A;  3FUE A;  3SD5 A;  3LEW A;  2GRL A;  2MRI A;  4ANU A;  2XGS A;  2DBA A;  4LCT A;  3SZ7 A;  4A3T A;  5JJ6 A;  3L13 A;  4B8C B;  4HOQ A;  4N2S A;  3E4B A;  1UJJ A;  1E8Z A;  4BTB A;  4GAA A;  3L16 A;  3D9I A;  5FQ7 A;  3UUX A;  3T5X A;  3FUJ A;  4FA6 A;  4I6G A;  5JHB A;  3B7U X;  2BUG A;  2QY7 A;  5G05 J;  2VSX E;  5BPP A;  3SGH A;  4HS2 A;  3CVX A;  3SI5 A;  3APF A;  3ZEF A;  4Y6C A;  4PS3 A;  3CQG B;  3RRU A;  3LY7 A;  3UMV A;  2FEZ A;  3G2S A;  4KZC A;  5LFA A;  3SBS A;  5EKQ D;  3ZYK A;  3LS8 A;  4J8F A;  2LAI A;  5FQ6 A;  3TAX A;  3KD7 A;  3ESL A;  4GZ6 A;  5BV0 A;  4XE0 A;  1FVH A;  4GYO A;  2X6H A;  2KCL A;  2L0I A;  3TG4 A;  1OWO A;  3AU4 A;  3FUM A;  4FJZ A;  4GYY A;  4KVM A;  3EHM A;  3SF4 A;  5A23 A;  3ZHE A;  4N2Q A;  1QQE A;  3FUH A;  1UW4 B;  3QWV A;  4C0M A;  2PM7 A;  5A6C A;  2J49 A;  4RVB A;  2NSZ A;  1E96 B;  2YHC A;  5G04 J;  4OVV A;  2J07 A;  5C2Y A;  1FVF A;  3EJN A;  3L6A A;  1H6K A;  3QJZ A;  5AIJ A;  5LX8 A;  4UQY A;  4GML A;  2I1K A;  3RO2 A;  2KM4 A;  3L54 A;  1JPL A;  3TJP A;  2BF0 X;  3B7T A;  4EPZ A;  3ASF A;  3U4T A;  4XIF A;  4E85 A;  4UWH A;  2VSO E;  4PH4 B;  1EYH A;  5KJK A;  3RJV A;  4EQF A;  2KC7 A;  3FU6 A;  3ZYL A;  3ONL A;  5J08 A;  1HG2 A;  3FWV A;  4APF A;  4NQ0 A;  4URK A;  3PNL B;  2WXL A;  4BFR A;  1OWM A;  3APC A;  2IJG X;  1UN9 A;  2JLB A;  5ARF A;  2XRZ A;  2J9Q A;  3CK8 A;  2ION A;  1ELW A;  1HFA A;  3GYZ A;  3ENE A;  3PUK A;  3VTY A;  1QNF A;  2XCC A;  2KAT A;  3SNX A;  3O4Z A;  3FEY A;  3QWP A;  3FTW A;  3OAW A;  5LP0 A;  4I2W A;  3CIA A;  5DBK A;  5EX0 A;  2CHX A;  5KJL A;  1IQU A;  3FUF A;  2PM6 A;  3D9M A;  2WXP A;  3TG5 A;  3JQ0 A;  3FU3 A;  3S7D A;  2PQN A;  4WUY A;  2I9C A;  3L08 A;  3OTN A;  4O6F A;  4KMO A;  2A4Z A;  4L2L A;  2WXH A;  3K9I A;  2WXI A;  2WMO A;  1E8Y A;  1HF8 A;  3CEQ A;  3RK6 A;  4ILI A;  5AJD A;  1INZ A;  1L5J A;  5AEN A;  4N3A A;  4HOT A;  4JHK A;  3L22 A;  4IRU A;  1NA3 A;  3CKB A;  4G25 A;  1HO8 A;  3FUI A;  4K0R A;  3PRZ A;  4M3O A;  3VLD A;  5FT9 A;  2WXK A;  1HG5 A;  2E0I A;  1N52 A;  1E7V A;  3TL5 A;  4B8A A;  3ZW3 A;  4HVB A;  1HX8 A;  3AS4 A;  3HHM A;  2XEV A;  2YIN A;  4FHK A;  4BSX A;  1Z3X A;  2L9B A;  3IEG A;  3CVN A;  1N54 A;  1E90 A;  2WXF A;  4J0U A;  4JPS A;  4U04 A;  3ESK A;  2IOL A;  3FTS A;  4WND A;  2NXP A;  2A5U A;  4ANV A;  4ANX A;  2C0M A;  5ENN A;  3NZS A;  4I9E A;  1OWP A;  3L17 A;  5FWQ A;  3ZIM A;  3FTV A;  4KBQ A;  3LCA A;  3MKQ A;  4IYP A;  4ACL A;  2MOW A;  3Q47 B;  3FUK A;  3MJW A;  4K03 A;  3MKR A;  3FHE A;  3LPZ A;  4JA9 A;  4KT6 B;  1ELK A;  4C0E A;  4G23 A;  5CHE E;  3LDZ A;  2WXQ A;  4J6I A;  4R7L A;  4AOF A;  4JHR A;  3S2A A;  2FBN A;  4F7A A;  5ANL A;  2RG8 A;  4PS8 A;  2X3M A;  2VGX B;  3T5V A;  2QFC A;  2WPV A;  4PUC A;  1PY1 A;  1DVP A;  5FTP A;  1TEZ A;  3B13 A;  4J8S A;  1BPO A;  5T8I A;  5LOZ A;  4CDR A;  4DLQ A;  1UG3 A;  4LEU A;  4N39 A;  2CG2 A;  4F53 A;  3G2W A;  5EDS A;  4FJY A;  4EBA A;  3U66 A;  2I6H A;  2C0L A;  2C2L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...