4CGVA

First tpr of spaghetti (rpap3) bound to hsp90 peptide srmeevd
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
125
structure length
125
Chain Sequence
b'HVDSQKALVLKEKGNKYFKQGKYDEAIDCYTKGMDADPYNPVLPTNRASAYFRLKKFAVAESDCNLAVALNRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA POLYMERASE II-ASSOCIATED PROTEIN 3
publication title Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 50
structure length 125
sequence length 125
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4cgvA00
3AS4A 3LY9A 3ULQA 4BT9A 2XEVA 2PZIA 3CV0A 5BT1A 5KJKA 2IF4A 4GCOA 2AVPA 1YA0A 3IEGA 5LCWC 1NZNA 5DIZA 3Q4AB 4XI9A 4J8EA 5EKQD 3RO2A 4YVQC 2PQNA 1ELRA 3BEEA 4GZ3A 4UQZA 2QFCA 1TJCA 2R5SA 4G26A 5FJYA 1NA3A 4HOTA 3ESKA 3MA5A 2PQRA 5FZQA 5CHEE 4I17A 2UY1B 3QWVA 3MEKA 5BW8C 3CVQA 4AM9A 4HOUA 3LKUA 4WNGA 3ZHEB 3ZN3A 4HORA 3S7JA 4KXKB 2XGSA 4U0UA 2IFUA 4JL0A 4WNFA 4BTAA 3PDNA 3GZ1A 1ZU2A 5JJ7A 4RG9A 5D0QD 2PL2A 4XI0A 4I9CA 1PC2A 2UY1A 2FI7A 3Q15A 3QOUA 3S7FA 3CVNA 1P5QA 2Q7FA 4GPKA 3ZHEA 5FZSA 3CKBA 5JJ6A 1HXIA 2P58C 4G24A 1ELWA 3LCAA 3RU0A 5C1DA 5BNWA 4GA2A 2VQ2A 4N39A 3URZA 3LPZA 3CVLA 4WNDA 3VTYA 4GYWA 4NRHB 4YVOA 2JLBA 1OUVA 4Y6CA 5CCLA 3RIBA 5KJMA 4O6FA 5KJNA 3ASFA 3GW4A 3ASGA 1XNFA 4WNEA 4UQXA 2HO1A 3RJVA 1WM5A 2VYIA 3CKCA 4W9RA 3RKVA 2VGXA 2XGMA 4GYYA 4ME2A 2UWJG 4GA1A 4U07A 4EQFA 2BUGA 3VTXA 5LCWJ 3UPVA 4LEUA 5EX3A 3PE3A 3OXFA 4JHRA 3ZGQA 3KS2A 2XPIA 4JA7A 4WUYA 4YNDA 2HR2A 3SZ7A 4AY6A 2KATA 2WPVA 2KCLA 2WQHA 3FWVA 2XCBA 5EX0A 5A7DB 4BT8A 4UI9C 3O48A 5M72A 1W3BA 5G05C 1IYGA 1IHGA 3PE4A 3LY7A 3JYSA 3RO3A 2LSUA 5KJLA 3E4BA 2Y4TA 3SF4A 4CGWA 3R9AB 1FCHA 4RG6A 2YQ8A 5HQ8A 3QDNA 1HH8A 3CK7A 4I2WA 3MV2B 4KBQA 5FZRA 2V5FA 2C2LA 4GZ5A 4KYOB 4N3BA 3WXXA 5G04C 2C0MA 4AY5A 1ZBPA 3U3WA 3UUXA 5FTPA 4I9EA 3QWWA 2HYZA 2OOEA 1KT1A 3UQ3A 4APOA 4CDRA 2VSYA 4BWRA 1A17A 4G1TA 3ZFWA 3NF1A 2FO7A 2YHCA 4XIFA 4N3CA 1E96B 4J8FA 3TGOA 4GYOA 4Y6WA 3Q47B 5ARFA 5DBKA 2J9QA 3ASHA 3LY8A 2ONDA 2FF4A 4UI9K 2FBNA 4NQ0A 4U04A 5D0OD 2LNIA 1HZ4A 2NC9A 1QQEA 2XCCA 3FP3A 4G2VA 2LSVA 4U0ZA 4CGVA 4N3AA 4JA9A 4GZ6A 3FFLA 3MKRA 4N2SA 1NA0A 4I1AA 4AIFA 2MHKA 4G25A 2E2EA 3OXGA 2VSNA 4U0SA 3Q5MA 1Y8MA 3KD7A 3U4TA 4HOSA 2KCVA 3AS8A 2L6JA 2DBAA 4BTBA 3GYZA 3OXLA 4G23A 4J8DA 5JJTA 4UI9J 3TG5A 4N5CA 5G05J 3CVPA 3Q49B 4B94A 3ASDA 4F3VA 2FEZA 1KT0A 4H7XA 4UQYA 2KC7A 2VGYA 2XGOA 3HYMB 4N2QA 1QZ2A 5FT9A 4I2ZA 4HOQA 2Y4UA 2I6HA 3KAEA 1KLXA 4J0UA 4GA0A 3QKYA 3CK8A 3AS5A 3CEQA 3GZ2A 3TG4A 5G04J 3EDTB 2KCKA 5AYWD 3CK9A 4IN3B 3TAXA 2C0LA 4GCNA 5HI7A 3S7BA 5ARGA 4ABNA 3S7DA 3N71A 5CCMA 1B89A 3K9IA 2VGXB 4H7YA 3LYAA 3ZPJA 1WAO1 4A1SA 5A6CA 2GW1A 3QWPA 3MV3B
chains in the Genus database with same CATH superfamily
3ZKJA 2XEVA 2PZIA 4APFA 1TJFA 3EJNA 4OYSA 2J08A 3FTWA 2DCPA 2AVPA 1YA0A 3IEGA 4UWKA 4AXHA 5AENA 5ENOD 1NZNA 4CDNA 4JHKA 5B1AE 2QYJA 2BF0X 3PZ3A 1SW6A 4GPMA 4J8EA 3JCKC 2DWZA 3FH5A 3L08A 4UQZA 2QFCA 1NA3A 4HOTA 3HG0D 4J6IA 2IOSA 2CG3A 2EIKE 1E8XA 4AM9A 4HOUA 4LNGA 2EQXA 4HORA 4BY6A 1BLXB 2EILE 3IHYA 5FQ8A 4KXKB 1O1TA 3D9KA 4L2YA 4N5QA 4WNFA 4BTAA 5EYPF 1D8DA 5FINA 3DXKG 3HXDA 1TYQG 2A5EA 3CHOA 2UY1A 3QOUA 3C5RA 3CVNA 4ANXA 1OY3D 3BQOA 2OCCE 3LDZA 3MKQA 1EPUA 2V5QC 1BU9A 4G24A 1ELWA 3UIPC 1O1SA 1H19A 1BD8A 3LPZA 5CEDB 4BEPA 2X3MA 2YHEA 4YDEA 4I1MA 4NRHB 4PS8A 4YVOA 3D9IA 2F8XK 1OUVA 2DZNA 5AN8A 3FULA 5KJMA 2R03A 4O6FA 4EPZA 3APCA 3UIOC 3ZU7B 1N54A 1NI1A 3AJIA 3NAWA 3HXCA 4D10C 1Z5SC 4W9RA 3UT7A 5C2YA 3V2XA 3V2OA 4GYYA 5HRYA 4DLQA 5JMND 3E30A 5EYLA 2BUGA 5LCWJ 3AG3E 3ZYLA 3UPVA 3TWXA 4BX8A 3PE3A 4GZCA 3T8KA 4U96D 5BPPA 2XS8A 3I4RB 3ZGQA 3KS2A 4YNDA 5HS0A 3MZLB 3TWRA 3ZRHA 3J5PA 4AY6A 4A3TA 4FADA 3Q7AA 1U3DA 1AWCB 2XCBA 2P9NG 3DSXA 2LAHA 4U7EB 3O48A 3FUNA 2I1KA 3G2SA 1KZOA 1TEZA 1INZA 3JUIA 1IHGA 4IYPA 4QQIA 5JHBA 1U2VG 1NP7A 3AU4A 3JYSA 3NB2A 3RO3A 4JD2G 1OCOE 3D9MA 3R9AB 1OCCE 4XE0A 3U66A 3QAQA 1Y6IA 3B7SA 4YDOA 1RZ4A 3CK7A 2PM7A 5FZRA 2C2LA 2R17C 4GZ5A 2DIWA 1SA4A 3DPYA 4BESA 4BERA 4Q69A 2ETAA 2CG2A 4BX9A 3DSTA 1BI8B 1N4PA 4FP7A 3U3WA 3T5VA 3PS6A 3HHMA 4WAFA 1OWNA 2HYZA 4URKA 4CT0A 1TN6A 1N0QA 2M63A 2RFAA 5CERB 2F37A 4GU5A 4APOA 4CDRA 2VSYA 4BWRA 1A17A 4G1TA 3FU5A 4HVBA 5J90A 3MX3A 4XIFA 2RG8A 3EHNA 3PH0C 3PNTB 4J8FA 4GYOA 3TGOA 1XGWA 3LJ3A 2X38A 1HFAA 2XQ0A 4C9BB 1SQMA 4FLHA 3ESLA 2FF4A 3IV0A 4UI9K 1G3NB 3FTYA 5CBNA 4WWNA 1HZ4A 2NC9A 1DC2A 1Z3YA 4Q94A 1KZPA 3TJPA 1MJ0A 4CT4A 1L5JA 4CDMA 4U0ZA 1LD8A 3ASOE 4GZ6A 3HVEA 3NOCD 1LF8A 3MKRA 4JXTA 1S63A 3ZIMA 2XPYA 1JWGA 1N11A 2MHKA 4M3OA 1WY6A 3Q5MA 1Y8MA 4GB9A 3ZYMA 2IU1A 4LERA 2I1JA 4GAAA 3GYZA 3PRZA 3AG1E 2R59A 2HE0A 4EZLA 1FT2A 3Q49B 3ASDA 2FEZA 1KT0A 2QYUA 2PM6A 2H6GA 5ENPD 3HYMB 5AQBA 4GMLA 2P9PG 3R7RA 5BXOA 3UM1A 3ZXSA 4KVOA 3FTSA 5AJDA 3QB2A 4HOQA 2VTBA 2I6HA 2ETCA 4ATGA 4GA0A 3PZDA 2ZGGA 3QKYA 5AQ7A 3Q7FA 3CEQA 3DEOA 5T3RA 3P2BA 1DCQA 4AVXA 2KCKA 3ISMC 3QNKA 3CK9A 3TWUA 4PH4B 4GCNA 5HI7A 5CCMA 3S7DA 3N71A 3L17A 2F0YA 2MRIA 3EIJA 1DNPA 3ZPJA 5A6CA 2GW1A 3QWPA 3ULQA 4BT9A 1E90A 2IF4A 2CHZA 4GCOA 4DUIA 3SGHA 3Q73A 5ENRD 4TXRA 3RK6A 1O1RA 2ETBA 3DRAA 4HLEA 2QC9A 4XI9A 4A63B 2WXPA 5EKQD 5A23A 3B7TA 2Y1LE 3PZ4A 2MOWA 4L7TA 5B3SE 4JEHA 3D3MA 4HRNA 5FJYA 1UN8A 2WXRA 2PQRA 5FZQA 4AV7A 4UWLA 3VLDA 4IULA 3EHQA 3Q79A 1BI7B 2GRNB 5BW8C 3LKUA 3C72A 4WNGA 2NXPA 2H6FA 1AP7A 4DJAA 3ZHEB 3ZN3A 4LRZA 1EYHA 1JUQA 2WQ6A 1JCRA 4AP2A 5FIOA 2CHWA 4ZHBA 3EIQC 2J4DA 2IFUA 2WXFA 2P9UG 3PDNA 2XZDG 4ILHB 4KVMA 1MX6A 4RG9A 5D0QD 2PL2A 4I9CA 4YDYA 3D9OA 2J8SD 2LO6A 1PC2A 4ANVA 2FI7A 4CRWA 1IQRA 4XKCA 2Q7FA 1HS6A 5FZSA 3LVQE 2KM4A 3CKBA 3HRAA 5JJ6A 1HXIA 4MLPA 3CHSA 5AARA 1E8ZA 3CVVA 2L0TB 2WVIA 4GA2A 1RW2A 2VQ2A 3E32A 3SNXA 1OT8A 2AJAA 4N39A 3GZSA 5AQAA 3SBSA 3B7BA 4PS3A 3IKOB 3FEYA 1KPSB 1S64A 3V31A 2KBXA 3L16A 2E0IA 5CCLA 4WWPA 3RIBA 4TXPA 1D8EA 3KSQA 5J08A 4PUCA 5KJNA 5EIDA 3GW4A 3ASGA 1XNFA 4QFVA 2CFZA 1H2UA 4WWOA 4TV3A 4U63A 2VYIA 5G55A 3CKCA 4DPRA 4O60A 2XGMA 4A1GA 2P9KG 2QY7A 2X6HA 3IXEA 4B8AA 4EBAG 3VLEA 3OXFA 1HU3A 1HG5A 4HXIA 4WUYA 4C0MA 2KATA 3FDHA 5ENQD 2WQHA 3CVUA 3CHMA 2J4BA 1MX2A 3LS8A 5M72A 3ONLA 1W3BA 4HB5A 1E7VA 3PE4A 4HLLA 3UMVA 3JUEA 4I6GA 2LSUA 3CQGB 5KJLA 3TWQA 2Y4TA 3SF4A 3F6QA 4MRUA 2AW6A 2FO1E 3FUJA 3MV2B 1FPPA 2V5FA 4J8SA 4N3BA 4GTSA 2XS1A 1SVXA 3MJWA 4AY5A 3G2WA 3UUXA 5FTPA 3I3NA 4I9EA 4IRUA 4BSZB 2QZAA 2WXMA 3NBNB 4NURA 3QWWA 2OOEA 5KWDA 3JXJA 1YMPA 1H0AA 3CHPA 3D9NA 2JABA 3UQ3A 4HRMB 2BTDA 5B1BE 4ILGA 1TNUA 1WG0A 3EUVA 3NF1A 4ZFHA 2GRRB 4V3IA 2FO7A 4Y6WA 2NSZA 3B7UX 3ASHA 3LY8A 1OWMA 2V4LA 4K5BA 4GTPA 1QQEA 3CVXA 2KXPC 3I5PA 5ENTD 2LSVA 3UKUG 5CEAA 1V54E 2R02A 4CGVA 3FH7A 4Q96A 5IY5E 1K1AA 3RRMB 1MQSA 2ZIRA 1UOHA 1MYOA 3OTNA 4AIFA 4HI9A 2XRZA 4OAVB 2P9IG 4KT6B 3HDXA 4GTOA 3U64A 3SI5A 1TNYA 2DBAA 1JCSA 5JHAA 2XPZA 3OXLA 4J8DA 5JJTA 4UI9J 3TG5A 1H6OA 2X6IA 4JHJA 1EDUA 3MKQB 5G05J 2WXJA 2IO3C 2WB2A 5D66A 3NOGD 4F3VA 3P1UA 2KC7A 4RSYA 1FVFA 2GRLA 3CVYA 2IOLA 5BXUA 2R2LA 3Q78A 4F53A 4DI3A 5ENNA 2KZTA 1UN9A 3CK8A 3AS5A 4GMRA 2EINE 4FHJA 4G8LA 3FUFA 1N9AA 4J8YA 5G04J 3FH8A 1PY1A 1TN7A 4DRXE 3FUKA 3TAXA 2C0LA 1JWFA 3AU5A 1B89A 2WXOA 2XHEA 4JEUA 4LNUD 5BV0A 3AG4E 3V79K 1N4RA 5ANRA 3ZNGA 2WMNA 2ZXWE 3KEZA 3AS4A 3LY9A 3UINC 3C3OA 3CV0A 5ITZF 1Z6TA 2BKGA 5KJKA 1UG3A 4DX2A 1H6KA 1UJJA 3L9TA 3UM3A 3ZYQA 5LCWC 2GROB 2IEJA 5DIZA 3ZW3A 1TNZA 4RLYA 2OVFA 3RO2A 3DSSA 4LNBA 1N94A 4YVQC 2PQNA 3B95A 4GZ3A 2GRQB 2GRPB 4L1BA 4FJYA 3RRNB 4G26A 5EIBE 3RAUA 3FTXA 1WDYA 5CHEE 5LOZA 4I17A 4DX5D 3QWVA 3UKRG 3MEKA 3TXMA 3KEAA 2X6KA 2B0OE 3CVQA 1IKND 3RSEG 3C3QA 3UT8A 2WXLA 4U8VD 3S7JA 5ENSD 2XGSA 3CSTA 4U0UA 3FHEA 4JL0A 3GZ1A 4JW1A 5CMWA 2YINA 3LVRE 3SD5A 5LX8A 4RQIA 4I6JA 2J49A 3S7FA 1P5QA 3FEXA 3C3RA 3PEVB 5HKPA 4HRLA 3D9HA 4GPKA 1ELKA 3ZHEA 4ILIA 4DI4A 4HFGA 4FJZA 3C98A 2P58C 5KNHD 3LCAA 3RU0A 3FUEA 5C1DA 1UJKA 3QARA 1JPLA 5BNWA 4ATZD 4MS6A 2R05A 4O1PA 3QK0A 4FC8A 4LG6A 3VTYA 3DSWA 4GYWA 4KMOA 1E8WA 2P9LG 1D9SA 4LCTA 2JLBA 3SBTB 3SO8A 1HF8A 1SZ9A 4Y6CA 3Q9NC 1TR4A 2DYRE 3SQVA 1NL4A 5KCMA 3HVEB 1NFIE 2VJ8A 2HO1A 4O1OA 3UM0A 3RJVA 4EHMA 2NYJA 1WM5A 4PS7A 2CHXA 3E33A 3RKVA 2VGXA 4JPSA 4JVSA 4ME2A 3I4GA 4EQFA 2VSOE 3T9KA 3QC1A 3VTXA 1ZB1A 4LEUA 4A3VA 5EX3A 4E6HA 4JHRA 1H6PA 4K0RA 2XPIA 3KSLA 4C0EA 1VDYA 2HR2A 3ABKE 1TNOA 2WPVA 4DK5A 3FWVA 3DSUA 5EX0A 1OWLA 4BT8A 3JQ0A 2GRMA 1Q2ZA 3B7RL 3J5QB 3VLFA 1IYGA 1IXVA 3W9GA 1TN8A 3PVLA 3LY7A 4F7AA 2VTBB 4EZKA 3EHRA 4CGWA 1FCHA 2WXIA 3FU6A 1HH8A 4I2WA 4L23A 1QNFA 4KBQA 2DZOA 5D2MC 1A5EA 3G2TA 4KYOB 4GTQA 2Y0BG 1O5MA 3WXXA 3PZ1A 2F8YA 5AQ9A 1HX8A 3RRUA 3PZ2A 1MHQA 4L2LA 2WMOA 5AAOA 3TL5A 1KT1A 2XRYA 2CFUA 1OCZE 2ZU6B 3EHMA 3PEUB 2IQCA 4AOFA 3FTUA 3ZFWA 5AJLA 2WXQA 3L6AA 3EU9A 1N95A 1E96B 2DVWA 2J9QA 3FUMA 4M7CA 4F1PA 2FBNA 2WM9A 4U04A 3DXMG 2LNIA 1SZAA 2Y3AA 2XCCA 4GTMA 4A55A 4C48B 4XKBA 3CLJA 1OWPA 1H2TC 2BEDA 4N3AA 3FFLA 3FTZA 4AEZC 2DYSE 1X81A 4RVBA 2RKKA 2L6BA 2HM8A 4K5CA 4N2SA 2ZISA 3MCXA 4I1AA 1GW6A 4HNAD 3UXGA 3OXGA 4F6RD 4U0SA 4DX7D 4JC8A 1S0PA 3ENEA 2AXUA 3Q9UC 4HOSA 3NZSA 3FUDA 4G23A 4OVUA 1QYMA 3AG2E 4N5CA 3ZYKA 2OEWA 4B94A 4GMJA 2P9SG 3T8MA 4UUCA 4UQYA 5FQ7A 3S2AA 2VGYA 1YCSB 2OVBA 2H6IA 4N2QA 1QZ2A 1UW4B 3SY2A 2L0IA 4J7WA 2Y4UA 3KAEA 1KLXA 5LFAA 1OWOA 2H6HA 3MYVA 3FTVA 3GZ2A 2B6CA 4U95D 2V4HC 1MX4A 2V0PA 4UWGA 3ULEG 5JA4D 3CVWA 4IN3B 2J09A 2ZGDA 4ABNA 3S7BA 5ARGA 5E76A 3TWSA 1K8KG 5T4YA 1S70B 3K9IA 2OEVA 3U9WA 4KZCA 1IHBA 3D9PA 1WAO1 4A1SA 3FU3A 5FWQA 3Q75A 3BUAA 4B8CB 5BT1A 1DCEA 4UWFA 2ILRA 3BG1B 3G2UA 3R7QA 3G2VA 3SHFA 3BU8A 4U8YD 3DWLG 5CBOA 2RD0A 1U3CA 5FQ4A 3CR3A 3Q4AB 5AIJA 1N0RA 4I1OB 4GZDA 4MBGA 3APFA 3IBEA 1YYHA 2P2CP 5G2NA 3UM2A 5EN5D 3L22A 1ELRA 2GGFA 3BEEA 4Z68A 2XZTG 1DVPA 3ZVVA 1TJCA 2R5SA 3ESKA 3MA5A 2UY1B 1TNBA 3HXEA 1V55E 3DEPA 3HXFA 4TRQA 4FU3A 4YDWA 1E8YA 5KNGA 1ZU2A 3DPDA 3V30A 5JJ7A 3UT4A 1SA5A 1K1BA 4XI0A 2FULA 1BPOA 4XX5A 3CIAA 3WG7E 4HS2A 3Q15A 1HO8A 2AWIA 4ACLA 2V8SE 4B0ZA 4E85A 2LUHA 1N4SA 2IY0C 2EIME 5LP0A 1FVHA 3CGHA 2WXNA 4GTVA 3W9FA 3URZA 3CVLA 3O4ZA 4WNDA 3MGBA 1JCQA 3B13A 3EU5A 3L82A 4I43A 3DSVA 4OVVA 3CHQA 2X6JA 2VSXE 3AAAC 4R7LA 4DX6D 3ASFA 2XEEA 4WNEA 4LUNU 3LJNA 4UQXA 5BUZA 4B93B 1X5BA 4X8QA 4NACA 5H7PA 2LAIA 1PAQA 3HXBA 2UWJG 4GA1A 4U07A 2IO2C 4I6EA 3DBSA 4TXQA 2L9BA 1QBQA 4XEIG 1Z3XA 2JEKA 4JA7A 3SZ7A 4CEMA 1MZCA 2KCLA 2BKKB 3TXNA 4G11A 5A7DB 3LEWA 3L54A 4XZ4A 4UI9C 1HE8A 5G05C 4FLBA 2YNQA 4ANUA 2EIJE 4MKTA 3FY4A 4B89A 3SFXA 3TWTA 3E37A 4FULA 3E4BA 4PDXA 2A4ZA 2KZTB 4DLOA 3ULYA 3ABLE 4RG6A 4EZJA 2YQ8A 5HQ8A 4K5AB 3QJZA 3QDNA 5EDSA 3D9JA 2WXKA 3TWWA 3IHVA 2I9CA 4NIKA 3ABME 3R9MA 2A5UA 2Y69E 3CQCB 5G04C 2C0MA 3ASNE 5CRVA 1ZBPA 2XEHA 1IQUA 3PNLB 2XENA 3APDA 4BFRA 5BV1A 3D9LA 5CRUA 4CYMD 3HIZA 1OXJA 1E7UA 3TWVA 2MYOA 3PUKA 2RFMA 4ACKA 2YHCA 3ML9A 4N3CA 3NZUA 4K03A 2PNNA 2VGEA 3Q47B 5KBAA 5ARFA 5DBKA 4G8KA 2ONDA 2AXZA 3FU0A 3OAWA 4NQ0A 3E34A 3UI2A 5D0OD 3X2QE 4CCAA 3FP3A 4P29A 4G2VA 5E75A 3L13A 5FQ6A 4DX1A 4TUMA 4JA9A 4FA6A 3T5XA 4TUUA 3BG0B 3FUHA 4JZYA 2WQ7A 1NA0A 2OV8A 3FUIA 3ZEFA 4LSZE 4G25A 4EBAA 1LD7A 2E2EA 4KZ0A 2VSNA 2IONA 2X6FA 5CECB 3KD7A 2LXMA 3U4TA 1HG2A 4HQDA 2KCVA 3AS8A 2L6JA 4BTBA 4U8HA 3JXIA 1H2VC 2LXLA 4GTRA 3LXUX 3PREA 3ML8A 3CVPA 4HI8A 1EF1C 4AJWA 4H7XA 3SFZA 1FT1A 5ANLA 2XGOA 1N4QA 2WXGA 2J07A 4UWHA 4ANWA 1OCRE 3UTMA 5FT9A 3PUJA 5T8IA 4I2ZA 5CMYA 3JQ1A 4BETA 4CZ2D 3CHRA 4J0UA 4BSXA 4HBDA 2AXVA 3SFYA 3UX4A 3TG4A 4OAUC 5EILA 3ONKA 4L9PA 3NQPA 3EDTB 5AYWD 3CSFA 4FHKA 4JB8P 1K3ZD 2WXHA 2I2OA 1N52A 2VGXB 4H7YA 3LYAA 2IJGX 3ZXPA 4F1SA 4GTTA 3MV3B 4EECA 3ZUVB 1LTXA
chains in the Genus database with same CATH topology
3KEZA 3AS4A 3LY9A 3ULQA 4BT9A 2XEVA 2PZIA 3CV0A 4APFA 4B8CB 1TJFA 3EJNA 1Z6TA 5BT1A 1E90A 4UWFA 5KJKA 2CHZA 2IF4A 2ILRA 1UG3A 2J08A 3BG1B 4GCOA 3FTWA 4OYSA 2DCPA 3G2UA 1H6KA 3SGHA 3R7QA 1UJJA 3G2VA 2AVPA 3SHFA 1YA0A 3ZYQA 3RK6A 3IEGA 4UWKA 5LCWC 4AXHA 5AENA 2RD0A 1U3CA 1NZNA 4HLEA 5FQ4A 5DIZA 4CDNA 3CR3A 3ZW3A 4JHKA 2BF0X 3Q4AB 5AIJA 4I1OB 4XI9A 4GZDA 2WXPA 4J8EA 2OVFA 5EKQD 3APFA 3IBEA 3RO2A 5A23A 5G2NA 3JCKC 4YVQC 2PQNA 3L22A 3B7TA 3FH5A 1ELRA 2GGFA 3BEEA 4GZ3A 1DVPA 3L08A 4UQZA 2MOWA 4L1BA 4FJYA 4L7TA 4JEHA 2QFCA 3RRNB 3D3MA 3ZVVA 1TJCA 2R5SA 4G26A 5FJYA 1NA3A 4HOTA 1UN8A 2WXRA 3ESKA 3MA5A 2PQRA 5FZQA 3FTXA 4AV7A 5CHEE 5LOZA 4I17A 2UY1B 2IOSA 4J6IA 4UWLA 3VLDA 4IULA 3QWVA 2CG3A 3MEKA 1E8XA 5BW8C 3TXMA 2X6KA 3CVQA 4AM9A 4HOUA 3UT8A 3LKUA 4WNGA 2NXPA 4TRQA 2WXLA 3ZHEB 4DJAA 4FU3A 3ZN3A 4LRZA 2EQXA 1EYHA 1JUQA 4HORA 2WQ6A 3S7JA 4AP2A 4BY6A 2CHWA 3IHYA 5FQ8A 3EIQC 4KXKB 3D9KA 2XGSA 2J4DA 3CSTA 4U0UA 2IFUA 1E8YA 2WXFA 3FHEA 4JL0A 4L2YA 4WNFA 4BTAA 3PDNA 3GZ1A 4ILHB 1ZU2A 3DPDA 4KVMA 5JJ7A 4JW1A 4RG9A 3UT4A 5CMWA 5D0QD 2PL2A 4XI0A 2YINA 4I9CA 2FULA 3LVRE 1BPOA 3D9OA 2LO6A 3CHOA 3SD5A 1PC2A 4XX5A 4ANVA 3CIAA 2UY1A 2FI7A 4HS2A 3Q15A 2J49A 4I6JA 5LX8A 3QOUA 1HO8A 2AWIA 4CRWA 3S7FA 3CVNA 1IQRA 4XKCA 1P5QA 3FEXA 4ANXA 3PEVB 2Q7FA 1HS6A 4GPKA 4ACLA 2V8SE 1ELKA 4B0ZA 3ZHEA 4E85A 3LDZA 3MKQA 5FZSA 3LVQE 1EPUA 2KM4A 4ILIA 4DI4A 3CKBA 5JJ6A 1HXIA 4MLPA 4HFGA 4FJZA 3C98A 2P58C 3CHSA 1E8ZA 4G24A 3CVVA 1ELWA 3LCAA 3RU0A 3FUEA 2L0TB 5C1DA 5LP0A 1UJKA 2WVIA 3QARA 1JPLA 5BNWA 4GA2A 1FVHA 2VQ2A 3CGHA 3SNXA 4MS6A 2WXNA 1H19A 4N39A 3GZSA 3URZA 3QK0A 3SBSA 4PS3A 3LPZA 3CVLA 4FC8A 3O4ZA 4WNDA 3IKOB 3VTYA 3FEYA 3MGBA 2X3MA 2YHEA 4GYWA 4KMOA 1E8WA 3B13A 4LCTA 4I43A 4I1MA 4NRHB 4PS8A 4YVOA 2JLBA 3L16A 2E0IA 3D9IA 3SBTB 1OUVA 1HF8A 1SZ9A 3FULA 4Y6CA 5CCLA 4OVVA 3CHQA 4WWPA 3RIBA 5KJMA 2X6JA 2VSXE 4R7LA 4O6FA 4EPZA 5J08A 3APCA 4PUCA 3ASFA 5KJNA 3GW4A 3ASGA 5KCMA 3HVEB 1XNFA 4QFVA 4WNEA 4LUNU 2CFZA 4UQXA 1H2UA 1N54A 5BUZA 2VJ8A 2HO1A 1X5BA 4WWOA 4TV3A 3RJVA 4U63A 1WM5A 4PS7A 2CHXA 4D10C 2VYIA 5G55A 4NACA 3CKCA 2LAIA 4W9RA 4DPRA 1PAQA 3RKVA 3UT7A 2VGXA 5C2YA 2XGMA 4JPSA 4JVSA 4A1GA 4GYYA 4ME2A 2UWJG 4GA1A 3I4GA 4U07A 4DLQA 4I6EA 4EQFA 2QY7A 2VSOE 3DBSA 3QC1A 2BUGA 3VTXA 2L9BA 3ZYLA 5LCWJ 2X6HA 3UPVA 4B8AA 4LEUA 4A3VA 5EX3A 3VLEA 4BX8A 4EBAG 4E6HA 3PE3A 3OXFA 4GZCA 5BPPA 4JHRA 3I4RB 3ZGQA 3KS2A 4K0RA 1Z3XA 1HU3A 2XPIA 2JEKA 4JA7A 4C0EA 1HG5A 1VDYA 4HXIA 4WUYA 3MZLB 2HR2A 4YNDA 3ZRHA 3SZ7A 4CEMA 4C0MA 4AY6A 2KATA 2WPVA 4A3TA 2KCLA 3FDHA 3TXNA 4FADA 2WQHA 4DK5A 1U3DA 3FWVA 3CVUA 2XCBA 4G11A 3CHMA 5EX0A 5A7DB 1OWLA 3LEWA 3L54A 4BT8A 3JQ0A 4XZ4A 2GRMA 2J4BA 2LAHA 1HE8A 4UI9C 3O48A 3FUNA 5M72A 3LS8A 3B7RL 2I1KA 3ONLA 1W3BA 3VLFA 5G05C 3G2SA 1IYGA 4FLBA 1TEZA 1INZA 3JUIA 1IHGA 4IYPA 2YNQA 4ANUA 5JHBA 1E7VA 4MKTA 3FY4A 3PE4A 3PVLA 3LY7A 1NP7A 4B89A 3UMVA 4I6GA 3AU4A 3JYSA 4F7AA 3RO3A 2LSUA 4EZKA 2VTBB 3CQGB 4FULA 5KJLA 3E4BA 4PDXA 2A4ZA 2Y4TA 3D9MA 2KZTB 3SF4A 4CGWA 3R9AB 1FCHA 2WXIA 3FU6A 4DLOA 4RG6A 4MRUA 4XE0A 4EZJA 3U66A 2YQ8A 2AW6A 3QAQA 5HQ8A 1Y6IA 3QJZA 3QDNA 3B7SA 5EDSA 1HH8A 3CK7A 3FUJA 4I2WA 4L23A 3MV2B 1QNFA 4KBQA 3D9JA 2PM7A 5FZRA 2V5FA 2WXKA 2C2LA 2R17C 4GZ5A 3IHVA 2I9CA 3G2TA 2DIWA 4J8SA 4KYOB 2A5UA 4N3BA 4Q69A 3CQCB 3WXXA 2CG2A 4BX9A 5G04C 2C0MA 3MJWA 4AY5A 1ZBPA 4FP7A 3U3WA 3T5VA 1IQUA 3PS6A 3G2WA 3UUXA 5FTPA 1HX8A 3RRUA 3HHMA 3PNLB 4WAFA 3I3NA 4I9EA 1MHQA 4IRUA 1OWNA 2WXMA 4NURA 3APDA 3QWWA 4L2LA 2HYZA 2OOEA 4URKA 4BFRA 4CT0A 2WMOA 3TL5A 1KT1A 2XRYA 2CFUA 5BV1A 1H0AA 2M63A 3D9LA 3CHPA 3D9NA 2ZU6B 3EHMA 3PEUB 2IQCA 3UQ3A 4GU5A 3HIZA 4APOA 4AOFA 2VSYA 4BWRA 4CDRA 1E7UA 2BTDA 1A17A 4G1TA 3FTUA 3ZFWA 5AJLA 3PUKA 3FU5A 2WXQA 4ILGA 4HVBA 3L6AA 3NF1A 4ACKA 4V3IA 5J90A 3MX3A 2FO7A 2YHCA 4XIFA 3ML9A 4N3CA 2RG8A 3EHNA 1E96B 3NZUA 4K03A 3PH0C 3PNTB 4J8FA 4GYOA 3TGOA 1XGWA 3LJ3A 4Y6WA 2NSZA 2X38A 3Q47B 1HFAA 5ARFA 2J9QA 3ASHA 2XQ0A 3B7UX 5DBKA 4C9BB 3LY8A 1SQMA 1OWMA 3ESLA 4FLHA 2FF4A 2ONDA 2AXZA 3FU0A 3FUMA 3IV0A 4UI9K 3OAWA 3FTYA 2FBNA 4NQ0A 2WM9A 4U04A 2V4LA 5D0OD 4WWNA 2LNIA 4CCAA 1HZ4A 2NC9A 1SZAA 1QQEA 1Z3YA 2Y3AA 2XCCA 4Q94A 3FP3A 3CVXA 3TJPA 4P29A 3I5PA 4G2VA 5E75A 2LSVA 3L13A 4A55A 4XKBA 3CLJA 4CT4A 1L5JA 5FQ6A 4CDMA 1OWPA 1H2TC 4U0ZA 4CGVA 3FH7A 4JA9A 4N3AA 4GZ6A 3FFLA 4FA6A 3FTZA 4AEZC 3HVEA 3T5XA 4RVBA 1LF8A 3MKRA 4Q96A 2HM8A 4JXTA 4TUUA 3BG0B 3RRMB 3FUHA 4N2SA 1MQSA 4JZYA 2WQ7A 1NA0A 3MCXA 4I1AA 3ZIMA 2XPYA 1JWGA 2OV8A 3OTNA 3FUIA 4AIFA 3ZEFA 1GW6A 2MHKA 4M3OA 4G25A 2XRZA 4EBAA 2E2EA 3OXGA 2VSNA 4KZ0A 2IONA 1WY6A 3Q5MA 2X6FA 1Y8MA 4KT6B 4U0SA 4GB9A 3KD7A 3HDXA 4JC8A 3ZYMA 1S0PA 3U64A 3ENEA 2AXUA 3SI5A 2IU1A 3U4TA 4HOSA 1HG2A 4LERA 2I1JA 2KCVA 3AS8A 3FUDA 2L6JA 3NZSA 2DBAA 4BTBA 4GAAA 4U8HA 3GYZA 5JHAA 2XPZA 3OXLA 4G23A 4J8DA 5JJTA 1H2VC 4OVUA 4UI9J 3PRZA 3TG5A 2X6IA 4JHJA 2R59A 1EDUA 4N5CA 3MKQB 5G05J 3LXUX 3PREA 3ML8A 3ZYKA 3CVPA 4EZLA 3Q49B 4B94A 2WXJA 4GMJA 3ASDA 2WB2A 3T8MA 4F3VA 2FEZA 1EF1C 4AJWA 1KT0A 3P1UA 4H7XA 4UQYA 2KC7A 5ANLA 2VGYA 5FQ7A 2XGOA 3S2AA 2PM6A 3SFZA 2OVBA 3HYMB 2WXGA 4GMLA 4N2QA 4RSYA 3R7RA 3ZXSA 1FVFA 4KVOA 2GRLA 3FTSA 2J07A 3CVYA 4UWHA 2IOLA 1QZ2A 4ANWA 5AJDA 1UW4B 3PUJA 5FT9A 5T8IA 4I2ZA 3QB2A 4HOQA 3JQ1A 5CMYA 4F53A 2L0IA 2VTBA 4DI3A 2Y4UA 2I6HA 3KAEA 5ENNA 1KLXA 5LFAA 3CHRA 4J0UA 4BSXA 4ATGA 4GA0A 1OWOA 2AXVA 3MYVA 2KZTA 3PZDA 3FTVA 3QKYA 1UN9A 3CK8A 3AS5A 4FHJA 3CEQA 3GZ2A 5T3RA 3UX4A 3TG4A 3FUFA 2V0PA 4UWGA 5G04J 3P2BA 3FH8A 3ONKA 3NQPA 4AVXA 1PY1A 3EDTB 2KCKA 5AYWD 3CSFA 3QNKA 3CK9A 3FUKA 2J09A 4IN3B 3TAXA 3CVWA 4PH4B 2C0LA 4FHKA 4GCNA 5HI7A 1JWFA 3AU5A 5ARGA 3S7DA 3N71A 3S7BA 4ABNA 5CCMA 1B89A 2WXOA 2XHEA 4JEUA 5E76A 3L17A 5T4YA 2MRIA 2WXHA 3EIJA 2I2OA 3K9IA 1N52A 5BV0A 2VGXB 3U9WA 1DNPA 3LYAA 3D9PA 4H7YA 1WAO1 2IJGX 3FU3A 4KZCA 5ANRA 5FWQA 3ZPJA 4A1SA 4F1SA 2GW1A 5A6CA 3QWPA 3MV3B 4EECA 2WMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AS4 A;  3LY9 A;  3ULQ A;  4BT9 A;  2XEV A;  2PZI A;  3CV0 A;  5BT1 A;  5KJK A;  2IF4 A;  4GCO A;  2AVP A;  1YA0 A;  3IEG A;  5LCW C;  1NZN A;  5DIZ A;  3Q4A B;  4XI9 A;  4J8E A;  5EKQ D;  3RO2 A;  4YVQ C;  2PQN A;  1ELR A;  3BEE A;  4GZ3 A;  4UQZ A;  2QFC A;  1TJC A;  2R5S A;  4G26 A;  5FJY A;  1NA3 A;  4HOT A;  3ESK A;  3MA5 A;  2PQR A;  5FZQ A;  5CHE E;  4I17 A;  2UY1 B;  3QWV A;  3MEK A;  5BW8 C;  3CVQ A;  4AM9 A;  4HOU A;  3LKU A;  4WNG A;  3ZHE B;  3ZN3 A;  4HOR A;  3S7J A;  4KXK B;  2XGS A;  4U0U A;  2IFU A;  4JL0 A;  4WNF A;  4BTA A;  3PDN A;  3GZ1 A;  1ZU2 A;  5JJ7 A;  4RG9 A;  5D0Q D;  2PL2 A;  4XI0 A;  4I9C A;  1PC2 A;  2UY1 A;  2FI7 A;  3Q15 A;  3QOU A;  3S7F A;  3CVN A;  1P5Q A;  2Q7F A;  4GPK A;  3ZHE A;  5FZS A;  3CKB A;  5JJ6 A;  1HXI A;  2P58 C;  4G24 A;  1ELW A;  3LCA A;  3RU0 A;  5C1D A;  5BNW A;  4GA2 A;  2VQ2 A;  4N39 A;  3URZ A;  3LPZ A;  3CVL A;  4WND A;  3VTY A;  4GYW A;  4NRH B;  4YVO A;  2JLB A;  1OUV A;  4Y6C A;  5CCL A;  3RIB A;  5KJM A;  4O6F A;  5KJN A;  3ASF A;  3GW4 A;  3ASG A;  1XNF A;  4WNE A;  4UQX A;  2HO1 A;  3RJV A;  1WM5 A;  2VYI A;  3CKC A;  4W9R A;  3RKV A;  2VGX A;  2XGM A;  4GYY A;  4ME2 A;  2UWJ G;  4GA1 A;  4U07 A;  4EQF A;  2BUG A;  3VTX A;  5LCW J;  3UPV A;  4LEU A;  5EX3 A;  3PE3 A;  3OXF A;  4JHR A;  3ZGQ A;  3KS2 A;  2XPI A;  4JA7 A;  4WUY A;  4YND A;  2HR2 A;  3SZ7 A;  4AY6 A;  2KAT A;  2WPV A;  2KCL A;  2WQH A;  3FWV A;  2XCB A;  5EX0 A;  5A7D B;  4BT8 A;  4UI9 C;  3O48 A;  5M72 A;  1W3B A;  5G05 C;  1IYG A;  1IHG A;  3PE4 A;  3LY7 A;  3JYS A;  3RO3 A;  2LSU A;  5KJL A;  3E4B A;  2Y4T A;  3SF4 A;  4CGW A;  3R9A B;  1FCH A;  4RG6 A;  2YQ8 A;  5HQ8 A;  3QDN A;  1HH8 A;  3CK7 A;  4I2W A;  3MV2 B;  4KBQ A;  5FZR A;  2V5F A;  2C2L A;  4GZ5 A;  4KYO B;  4N3B A;  3WXX A;  5G04 C;  2C0M A;  4AY5 A;  1ZBP A;  3U3W A;  3UUX A;  5FTP A;  4I9E A;  3QWW A;  2HYZ A;  2OOE A;  1KT1 A;  3UQ3 A;  4APO A;  4CDR A;  2VSY A;  4BWR A;  1A17 A;  4G1T A;  3ZFW A;  3NF1 A;  2FO7 A;  2YHC A;  4XIF A;  4N3C A;  1E96 B;  4J8F A;  3TGO A;  4GYO A;  4Y6W A;  3Q47 B;  5ARF A;  5DBK A;  2J9Q A;  3ASH A;  3LY8 A;  2OND A;  2FF4 A;  4UI9 K;  2FBN A;  4NQ0 A;  4U04 A;  5D0O D;  2LNI A;  1HZ4 A;  2NC9 A;  1QQE A;  2XCC A;  3FP3 A;  4G2V A;  2LSV A;  4U0Z A;  4CGV A;  4N3A A;  4JA9 A;  4GZ6 A;  3FFL A;  3MKR A;  4N2S A;  1NA0 A;  4I1A A;  4AIF A;  2MHK A;  4G25 A;  2E2E A;  3OXG A;  2VSN A;  4U0S A;  3Q5M A;  1Y8M A;  3KD7 A;  3U4T A;  4HOS A;  2KCV A;  3AS8 A;  2L6J A;  2DBA A;  4BTB A;  3GYZ A;  3OXL A;  4G23 A;  4J8D A;  5JJT A;  4UI9 J;  3TG5 A;  4N5C A;  5G05 J;  3CVP A;  3Q49 B;  4B94 A;  3ASD A;  4F3V A;  2FEZ A;  1KT0 A;  4H7X A;  4UQY A;  2KC7 A;  2VGY A;  2XGO A;  3HYM B;  4N2Q A;  1QZ2 A;  5FT9 A;  4I2Z A;  4HOQ A;  2Y4U A;  2I6H A;  3KAE A;  1KLX A;  4J0U A;  4GA0 A;  3QKY A;  3CK8 A;  3AS5 A;  3CEQ A;  3GZ2 A;  3TG4 A;  5G04 J;  3EDT B;  2KCK A;  5AYW D;  3CK9 A;  4IN3 B;  3TAX A;  2C0L A;  4GCN A;  5HI7 A;  3S7B A;  5ARG A;  4ABN A;  3S7D A;  3N71 A;  5CCM A;  1B89 A;  3K9I A;  2VGX B;  4H7Y A;  3LYA A;  3ZPJ A;  1WAO 1;  4A1S A;  5A6C A;  2GW1 A;  3QWP A;  3MV3 B; 
#chains in the Genus database with same CATH topology
 3ZKJ A;  2XEV A;  2PZI A;  4APF A;  1TJF A;  3EJN A;  4OYS A;  2J08 A;  3FTW A;  2DCP A;  2AVP A;  1YA0 A;  3IEG A;  4UWK A;  4AXH A;  5AEN A;  5ENO D;  1NZN A;  4CDN A;  4JHK A;  5B1A E;  2QYJ A;  2BF0 X;  3PZ3 A;  1SW6 A;  4GPM A;  4J8E A;  3JCK C;  2DWZ A;  3FH5 A;  3L08 A;  4UQZ A;  2QFC A;  1NA3 A;  4HOT A;  3HG0 D;  4J6I A;  2IOS A;  2CG3 A;  2EIK E;  1E8X A;  4AM9 A;  4HOU A;  4LNG A;  2EQX A;  4HOR A;  4BY6 A;  1BLX B;  2EIL E;  3IHY A;  5FQ8 A;  4KXK B;  1O1T A;  3D9K A;  4L2Y A;  4N5Q A;  4WNF A;  4BTA A;  5EYP F;  1D8D A;  5FIN A;  3DXK G;  3HXD A;  1TYQ G;  2A5E A;  3CHO A;  2UY1 A;  3QOU A;  3C5R A;  3CVN A;  4ANX A;  1OY3 D;  3BQO A;  2OCC E;  3LDZ A;  3MKQ A;  1EPU A;  2V5Q C;  1BU9 A;  4G24 A;  1ELW A;  3UIP C;  1O1S A;  1H19 A;  1BD8 A;  3LPZ A;  5CED B;  4BEP A;  2X3M A;  2YHE A;  4YDE A;  4I1M A;  4NRH B;  4PS8 A;  4YVO A;  3D9I A;  2F8X K;  1OUV A;  2DZN A;  5AN8 A;  3FUL A;  5KJM A;  2R03 A;  4O6F A;  4EPZ A;  3APC A;  3UIO C;  3ZU7 B;  1N54 A;  1NI1 A;  3AJI A;  3NAW A;  3HXC A;  4D10 C;  1Z5S C;  4W9R A;  3UT7 A;  5C2Y A;  3V2X A;  3V2O A;  4GYY A;  5HRY A;  4DLQ A;  5JMN D;  3E30 A;  5EYL A;  2BUG A;  5LCW J;  3AG3 E;  3ZYL A;  3UPV A;  3TWX A;  4BX8 A;  3PE3 A;  4GZC A;  3T8K A;  4U96 D;  5BPP A;  2XS8 A;  3I4R B;  3ZGQ A;  3KS2 A;  4YND A;  5HS0 A;  3MZL B;  3TWR A;  3ZRH A;  3J5P A;  4AY6 A;  4A3T A;  4FAD A;  3Q7A A;  1U3D A;  1AWC B;  2XCB A;  2P9N G;  3DSX A;  2LAH A;  4U7E B;  3O48 A;  3FUN A;  2I1K A;  3G2S A;  1KZO A;  1TEZ A;  1INZ A;  3JUI A;  1IHG A;  4IYP A;  4QQI A;  5JHB A;  1U2V G;  1NP7 A;  3AU4 A;  3JYS A;  3NB2 A;  3RO3 A;  4JD2 G;  1OCO E;  3D9M A;  3R9A B;  1OCC E;  4XE0 A;  3U66 A;  3QAQ A;  1Y6I A;  3B7S A;  4YDO A;  1RZ4 A;  3CK7 A;  2PM7 A;  5FZR A;  2C2L A;  2R17 C;  4GZ5 A;  2DIW A;  1SA4 A;  3DPY A;  4BES A;  4BER A;  4Q69 A;  2ETA A;  2CG2 A;  4BX9 A;  3DST A;  1BI8 B;  1N4P A;  4FP7 A;  3U3W A;  3T5V A;  3PS6 A;  3HHM A;  4WAF A;  1OWN A;  2HYZ A;  4URK A;  4CT0 A;  1TN6 A;  1N0Q A;  2M63 A;  2RFA A;  5CER B;  2F37 A;  4GU5 A;  4APO A;  4CDR A;  2VSY A;  4BWR A;  1A17 A;  4G1T A;  3FU5 A;  4HVB A;  5J90 A;  3MX3 A;  4XIF A;  2RG8 A;  3EHN A;  3PH0 C;  3PNT B;  4J8F A;  4GYO A;  3TGO A;  1XGW A;  3LJ3 A;  2X38 A;  1HFA A;  2XQ0 A;  4C9B B;  1SQM A;  4FLH A;  3ESL A;  2FF4 A;  3IV0 A;  4UI9 K;  1G3N B;  3FTY A;  5CBN A;  4WWN A;  1HZ4 A;  2NC9 A;  1DC2 A;  1Z3Y A;  4Q94 A;  1KZP A;  3TJP A;  1MJ0 A;  4CT4 A;  1L5J A;  4CDM A;  4U0Z A;  1LD8 A;  3ASO E;  4GZ6 A;  3HVE A;  3NOC D;  1LF8 A;  3MKR A;  4JXT A;  1S63 A;  3ZIM A;  2XPY A;  1JWG A;  1N11 A;  2MHK A;  4M3O A;  1WY6 A;  3Q5M A;  1Y8M A;  4GB9 A;  3ZYM A;  2IU1 A;  4LER A;  2I1J A;  4GAA A;  3GYZ A;  3PRZ A;  3AG1 E;  2R59 A;  2HE0 A;  4EZL A;  1FT2 A;  3Q49 B;  3ASD A;  2FEZ A;  1KT0 A;  2QYU A;  2PM6 A;  2H6G A;  5ENP D;  3HYM B;  5AQB A;  4GML A;  2P9P G;  3R7R A;  5BXO A;  3UM1 A;  3ZXS A;  4KVO A;  3FTS A;  5AJD A;  3QB2 A;  4HOQ A;  2VTB A;  2I6H A;  2ETC A;  4ATG A;  4GA0 A;  3PZD A;  2ZGG A;  3QKY A;  5AQ7 A;  3Q7F A;  3CEQ A;  3DEO A;  5T3R A;  3P2B A;  1DCQ A;  4AVX A;  2KCK A;  3ISM C;  3QNK A;  3CK9 A;  3TWU A;  4PH4 B;  4GCN A;  5HI7 A;  5CCM A;  3S7D A;  3N71 A;  3L17 A;  2F0Y A;  2MRI A;  3EIJ A;  1DNP A;  3ZPJ A;  5A6C A;  2GW1 A;  3QWP A;  3ULQ A;  4BT9 A;  1E90 A;  2IF4 A;  2CHZ A;  4GCO A;  4DUI A;  3SGH A;  3Q73 A;  5ENR D;  4TXR A;  3RK6 A;  1O1R A;  2ETB A;  3DRA A;  4HLE A;  2QC9 A;  4XI9 A;  4A63 B;  2WXP A;  5EKQ D;  5A23 A;  3B7T A;  2Y1L E;  3PZ4 A;  2MOW A;  4L7T A;  5B3S E;  4JEH A;  3D3M A;  4HRN A;  5FJY A;  1UN8 A;  2WXR A;  2PQR A;  5FZQ A;  4AV7 A;  4UWL A;  3VLD A;  4IUL A;  3EHQ A;  3Q79 A;  1BI7 B;  2GRN B;  5BW8 C;  3LKU A;  3C72 A;  4WNG A;  2NXP A;  2H6F A;  1AP7 A;  4DJA A;  3ZHE B;  3ZN3 A;  4LRZ A;  1EYH A;  1JUQ A;  2WQ6 A;  1JCR A;  4AP2 A;  5FIO A;  2CHW A;  4ZHB A;  3EIQ C;  2J4D A;  2IFU A;  2WXF A;  2P9U G;  3PDN A;  2XZD G;  4ILH B;  4KVM A;  1MX6 A;  4RG9 A;  5D0Q D;  2PL2 A;  4I9C A;  4YDY A;  3D9O A;  2J8S D;  2LO6 A;  1PC2 A;  4ANV A;  2FI7 A;  4CRW A;  1IQR A;  4XKC A;  2Q7F A;  1HS6 A;  5FZS A;  3LVQ E;  2KM4 A;  3CKB A;  3HRA A;  5JJ6 A;  1HXI A;  4MLP A;  3CHS A;  5AAR A;  1E8Z A;  3CVV A;  2L0T B;  2WVI A;  4GA2 A;  1RW2 A;  2VQ2 A;  3E32 A;  3SNX A;  1OT8 A;  2AJA A;  4N39 A;  3GZS A;  5AQA A;  3SBS A;  3B7B A;  4PS3 A;  3IKO B;  3FEY A;  1KPS B;  1S64 A;  3V31 A;  2KBX A;  3L16 A;  2E0I A;  5CCL A;  4WWP A;  3RIB A;  4TXP A;  1D8E A;  3KSQ A;  5J08 A;  4PUC A;  5KJN A;  5EID A;  3GW4 A;  3ASG A;  1XNF A;  4QFV A;  2CFZ A;  1H2U A;  4WWO A;  4TV3 A;  4U63 A;  2VYI A;  5G55 A;  3CKC A;  4DPR A;  4O60 A;  2XGM A;  4A1G A;  2P9K G;  2QY7 A;  2X6H A;  3IXE A;  4B8A A;  4EBA G;  3VLE A;  3OXF A;  1HU3 A;  1HG5 A;  4HXI A;  4WUY A;  4C0M A;  2KAT A;  3FDH A;  5ENQ D;  2WQH A;  3CVU A;  3CHM A;  2J4B A;  1MX2 A;  3LS8 A;  5M72 A;  3ONL A;  1W3B A;  4HB5 A;  1E7V A;  3PE4 A;  4HLL A;  3UMV A;  3JUE A;  4I6G A;  2LSU A;  3CQG B;  5KJL A;  3TWQ A;  2Y4T A;  3SF4 A;  3F6Q A;  4MRU A;  2AW6 A;  2FO1 E;  3FUJ A;  3MV2 B;  1FPP A;  2V5F A;  4J8S A;  4N3B A;  4GTS A;  2XS1 A;  1SVX A;  3MJW A;  4AY5 A;  3G2W A;  3UUX A;  5FTP A;  3I3N A;  4I9E A;  4IRU A;  4BSZ B;  2QZA A;  2WXM A;  3NBN B;  4NUR A;  3QWW A;  2OOE A;  5KWD A;  3JXJ A;  1YMP A;  1H0A A;  3CHP A;  3D9N A;  2JAB A;  3UQ3 A;  4HRM B;  2BTD A;  5B1B E;  4ILG A;  1TNU A;  1WG0 A;  3EUV A;  3NF1 A;  4ZFH A;  2GRR B;  4V3I A;  2FO7 A;  4Y6W A;  2NSZ A;  3B7U X;  3ASH A;  3LY8 A;  1OWM A;  2V4L A;  4K5B A;  4GTP A;  1QQE A;  3CVX A;  2KXP C;  3I5P A;  5ENT D;  2LSV A;  3UKU G;  5CEA A;  1V54 E;  2R02 A;  4CGV A;  3FH7 A;  4Q96 A;  5IY5 E;  1K1A A;  3RRM B;  1MQS A;  2ZIR A;  1UOH A;  1MYO A;  3OTN A;  4AIF A;  4HI9 A;  2XRZ A;  4OAV B;  2P9I G;  4KT6 B;  3HDX A;  4GTO A;  3U64 A;  3SI5 A;  1TNY A;  2DBA A;  1JCS A;  5JHA A;  2XPZ A;  3OXL A;  4J8D A;  5JJT A;  4UI9 J;  3TG5 A;  1H6O A;  2X6I A;  4JHJ A;  1EDU A;  3MKQ B;  5G05 J;  2WXJ A;  2IO3 C;  2WB2 A;  5D66 A;  3NOG D;  4F3V A;  3P1U A;  2KC7 A;  4RSY A;  1FVF A;  2GRL A;  3CVY A;  2IOL A;  5BXU A;  2R2L A;  3Q78 A;  4F53 A;  4DI3 A;  5ENN A;  2KZT A;  1UN9 A;  3CK8 A;  3AS5 A;  4GMR A;  2EIN E;  4FHJ A;  4G8L A;  3FUF A;  1N9A A;  4J8Y A;  5G04 J;  3FH8 A;  1PY1 A;  1TN7 A;  4DRX E;  3FUK A;  3TAX A;  2C0L A;  1JWF A;  3AU5 A;  1B89 A;  2WXO A;  2XHE A;  4JEU A;  4LNU D;  5BV0 A;  3AG4 E;  3V79 K;  1N4R A;  5ANR A;  3ZNG A;  2WMN A;  2ZXW E;  3KEZ A;  3AS4 A;  3LY9 A;  3UIN C;  3C3O A;  3CV0 A;  5ITZ F;  1Z6T A;  2BKG A;  5KJK A;  1UG3 A;  4DX2 A;  1H6K A;  1UJJ A;  3L9T A;  3UM3 A;  3ZYQ A;  5LCW C;  2GRO B;  2IEJ A;  5DIZ A;  3ZW3 A;  1TNZ A;  4RLY A;  2OVF A;  3RO2 A;  3DSS A;  4LNB A;  1N94 A;  4YVQ C;  2PQN A;  3B95 A;  4GZ3 A;  2GRQ B;  2GRP B;  4L1B A;  4FJY A;  3RRN B;  4G26 A;  5EIB E;  3RAU A;  3FTX A;  1WDY A;  5CHE E;  5LOZ A;  4I17 A;  4DX5 D;  3QWV A;  3UKR G;  3MEK A;  3TXM A;  3KEA A;  2X6K A;  2B0O E;  3CVQ A;  1IKN D;  3RSE G;  3C3Q A;  3UT8 A;  2WXL A;  4U8V D;  3S7J A;  5ENS D;  2XGS A;  3CST A;  4U0U A;  3FHE A;  4JL0 A;  3GZ1 A;  4JW1 A;  5CMW A;  2YIN A;  3LVR E;  3SD5 A;  5LX8 A;  4RQI A;  4I6J A;  2J49 A;  3S7F A;  1P5Q A;  3FEX A;  3C3R A;  3PEV B;  5HKP A;  4HRL A;  3D9H A;  4GPK A;  1ELK A;  3ZHE A;  4ILI A;  4DI4 A;  4HFG A;  4FJZ A;  3C98 A;  2P58 C;  5KNH D;  3LCA A;  3RU0 A;  3FUE A;  5C1D A;  1UJK A;  3QAR A;  1JPL A;  5BNW A;  4ATZ D;  4MS6 A;  2R05 A;  4O1P A;  3QK0 A;  4FC8 A;  4LG6 A;  3VTY A;  3DSW A;  4GYW A;  4KMO A;  1E8W A;  2P9L G;  1D9S A;  4LCT A;  2JLB A;  3SBT B;  3SO8 A;  1HF8 A;  1SZ9 A;  4Y6C A;  3Q9N C;  1TR4 A;  2DYR E;  3SQV A;  1NL4 A;  5KCM A;  3HVE B;  1NFI E;  2VJ8 A;  2HO1 A;  4O1O A;  3UM0 A;  3RJV A;  4EHM A;  2NYJ A;  1WM5 A;  4PS7 A;  2CHX A;  3E33 A;  3RKV A;  2VGX A;  4JPS A;  4JVS A;  4ME2 A;  3I4G A;  4EQF A;  2VSO E;  3T9K A;  3QC1 A;  3VTX A;  1ZB1 A;  4LEU A;  4A3V A;  5EX3 A;  4E6H A;  4JHR A;  1H6P A;  4K0R A;  2XPI A;  3KSL A;  4C0E A;  1VDY A;  2HR2 A;  3ABK E;  1TNO A;  2WPV A;  4DK5 A;  3FWV A;  3DSU A;  5EX0 A;  1OWL A;  4BT8 A;  3JQ0 A;  2GRM A;  1Q2Z A;  3B7R L;  3J5Q B;  3VLF A;  1IYG A;  1IXV A;  3W9G A;  1TN8 A;  3PVL A;  3LY7 A;  4F7A A;  2VTB B;  4EZK A;  3EHR A;  4CGW A;  1FCH A;  2WXI A;  3FU6 A;  1HH8 A;  4I2W A;  4L23 A;  1QNF A;  4KBQ A;  2DZO A;  5D2M C;  1A5E A;  3G2T A;  4KYO B;  4GTQ A;  2Y0B G;  1O5M A;  3WXX A;  3PZ1 A;  2F8Y A;  5AQ9 A;  1HX8 A;  3RRU A;  3PZ2 A;  1MHQ A;  4L2L A;  2WMO A;  5AAO A;  3TL5 A;  1KT1 A;  2XRY A;  2CFU A;  1OCZ E;  2ZU6 B;  3EHM A;  3PEU B;  2IQC A;  4AOF A;  3FTU A;  3ZFW A;  5AJL A;  2WXQ A;  3L6A A;  3EU9 A;  1N95 A;  1E96 B;  2DVW A;  2J9Q A;  3FUM A;  4M7C A;  4F1P A;  2FBN A;  2WM9 A;  4U04 A;  3DXM G;  2LNI A;  1SZA A;  2Y3A A;  2XCC A;  4GTM A;  4A55 A;  4C48 B;  4XKB A;  3CLJ A;  1OWP A;  1H2T C;  2BED A;  4N3A A;  3FFL A;  3FTZ A;  4AEZ C;  2DYS E;  1X81 A;  4RVB A;  2RKK A;  2L6B A;  2HM8 A;  4K5C A;  4N2S A;  2ZIS A;  3MCX A;  4I1A A;  1GW6 A;  4HNA D;  3UXG A;  3OXG A;  4F6R D;  4U0S A;  4DX7 D;  4JC8 A;  1S0P A;  3ENE A;  2AXU A;  3Q9U C;  4HOS A;  3NZS A;  3FUD A;  4G23 A;  4OVU A;  1QYM A;  3AG2 E;  4N5C A;  3ZYK A;  2OEW A;  4B94 A;  4GMJ A;  2P9S G;  3T8M A;  4UUC A;  4UQY A;  5FQ7 A;  3S2A A;  2VGY A;  1YCS B;  2OVB A;  2H6I A;  4N2Q A;  1QZ2 A;  1UW4 B;  3SY2 A;  2L0I A;  4J7W A;  2Y4U A;  3KAE A;  1KLX A;  5LFA A;  1OWO A;  2H6H A;  3MYV A;  3FTV A;  3GZ2 A;  2B6C A;  4U95 D;  2V4H C;  1MX4 A;  2V0P A;  4UWG A;  3ULE G;  5JA4 D;  3CVW A;  4IN3 B;  2J09 A;  2ZGD A;  4ABN A;  3S7B A;  5ARG A;  5E76 A;  3TWS A;  1K8K G;  5T4Y A;  1S70 B;  3K9I A;  2OEV A;  3U9W A;  4KZC A;  1IHB A;  3D9P A;  1WAO 1;  4A1S A;  3FU3 A;  5FWQ A;  3Q75 A;  3BUA A;  4B8C B;  5BT1 A;  1DCE A;  4UWF A;  2ILR A;  3BG1 B;  3G2U A;  3R7Q A;  3G2V A;  3SHF A;  3BU8 A;  4U8Y D;  3DWL G;  5CBO A;  2RD0 A;  1U3C A;  5FQ4 A;  3CR3 A;  3Q4A B;  5AIJ A;  1N0R A;  4I1O B;  4GZD A;  4MBG A;  3APF A;  3IBE A;  1YYH A;  2P2C P;  5G2N A;  3UM2 A;  5EN5 D;  3L22 A;  1ELR A;  2GGF A;  3BEE A;  4Z68 A;  2XZT G;  1DVP A;  3ZVV A;  1TJC A;  2R5S A;  3ESK A;  3MA5 A;  2UY1 B;  1TNB A;  3HXE A;  1V55 E;  3DEP A;  3HXF A;  4TRQ A;  4FU3 A;  4YDW A;  1E8Y A;  5KNG A;  1ZU2 A;  3DPD A;  3V30 A;  5JJ7 A;  3UT4 A;  1SA5 A;  1K1B A;  4XI0 A;  2FUL A;  1BPO A;  4XX5 A;  3CIA A;  3WG7 E;  4HS2 A;  3Q15 A;  1HO8 A;  2AWI A;  4ACL A;  2V8S E;  4B0Z A;  4E85 A;  2LUH A;  1N4S A;  2IY0 C;  2EIM E;  5LP0 A;  1FVH A;  3CGH A;  2WXN A;  4GTV A;  3W9F A;  3URZ A;  3CVL A;  3O4Z A;  4WND A;  3MGB A;  1JCQ A;  3B13 A;  3EU5 A;  3L82 A;  4I43 A;  3DSV A;  4OVV A;  3CHQ A;  2X6J A;  2VSX E;  3AAA C;  4R7L A;  4DX6 D;  3ASF A;  2XEE A;  4WNE A;  4LUN U;  3LJN A;  4UQX A;  5BUZ A;  4B93 B;  1X5B A;  4X8Q A;  4NAC A;  5H7P A;  2LAI A;  1PAQ A;  3HXB A;  2UWJ G;  4GA1 A;  4U07 A;  2IO2 C;  4I6E A;  3DBS A;  4TXQ A;  2L9B A;  1QBQ A;  4XEI G;  1Z3X A;  2JEK A;  4JA7 A;  3SZ7 A;  4CEM A;  1MZC A;  2KCL A;  2BKK B;  3TXN A;  4G11 A;  5A7D B;  3LEW A;  3L54 A;  4XZ4 A;  4UI9 C;  1HE8 A;  5G05 C;  4FLB A;  2YNQ A;  4ANU A;  2EIJ E;  4MKT A;  3FY4 A;  4B89 A;  3SFX A;  3TWT A;  3E37 A;  4FUL A;  3E4B A;  4PDX A;  2A4Z A;  2KZT B;  4DLO A;  3ULY A;  3ABL E;  4RG6 A;  4EZJ A;  2YQ8 A;  5HQ8 A;  4K5A B;  3QJZ A;  3QDN A;  5EDS A;  3D9J A;  2WXK A;  3TWW A;  3IHV A;  2I9C A;  4NIK A;  3ABM E;  3R9M A;  2A5U A;  2Y69 E;  3CQC B;  5G04 C;  2C0M A;  3ASN E;  5CRV A;  1ZBP A;  2XEH A;  1IQU A;  3PNL B;  2XEN A;  3APD A;  4BFR A;  5BV1 A;  3D9L A;  5CRU A;  4CYM D;  3HIZ A;  1OXJ A;  1E7U A;  3TWV A;  2MYO A;  3PUK A;  2RFM A;  4ACK A;  2YHC A;  3ML9 A;  4N3C A;  3NZU A;  4K03 A;  2PNN A;  2VGE A;  3Q47 B;  5KBA A;  5ARF A;  5DBK A;  4G8K A;  2OND A;  2AXZ A;  3FU0 A;  3OAW A;  4NQ0 A;  3E34 A;  3UI2 A;  5D0O D;  3X2Q E;  4CCA A;  3FP3 A;  4P29 A;  4G2V A;  5E75 A;  3L13 A;  5FQ6 A;  4DX1 A;  4TUM A;  4JA9 A;  4FA6 A;  3T5X A;  4TUU A;  3BG0 B;  3FUH A;  4JZY A;  2WQ7 A;  1NA0 A;  2OV8 A;  3FUI A;  3ZEF A;  4LSZ E;  4G25 A;  4EBA A;  1LD7 A;  2E2E A;  4KZ0 A;  2VSN A;  2ION A;  2X6F A;  5CEC B;  3KD7 A;  2LXM A;  3U4T A;  1HG2 A;  4HQD A;  2KCV A;  3AS8 A;  2L6J A;  4BTB A;  4U8H A;  3JXI A;  1H2V C;  2LXL A;  4GTR A;  3LXU X;  3PRE A;  3ML8 A;  3CVP A;  4HI8 A;  1EF1 C;  4AJW A;  4H7X A;  3SFZ A;  1FT1 A;  5ANL A;  2XGO A;  1N4Q A;  2WXG A;  2J07 A;  4UWH A;  4ANW A;  1OCR E;  3UTM A;  5FT9 A;  3PUJ A;  5T8I A;  4I2Z A;  5CMY A;  3JQ1 A;  4BET A;  4CZ2 D;  3CHR A;  4J0U A;  4BSX A;  4HBD A;  2AXV A;  3SFY A;  3UX4 A;  3TG4 A;  4OAU C;  5EIL A;  3ONK A;  4L9P A;  3NQP A;  3EDT B;  5AYW D;  3CSF A;  4FHK A;  4JB8 P;  1K3Z D;  2WXH A;  2I2O A;  1N52 A;  2VGX B;  4H7Y A;  3LYA A;  2IJG X;  3ZXP A;  4F1S A;  4GTT A;  3MV3 B;  4EEC A;  3ZUV B;  1LTX A; 
#chains in the Genus database with same CATH homology
 3KEZ A;  3AS4 A;  3LY9 A;  3ULQ A;  4BT9 A;  2XEV A;  2PZI A;  3CV0 A;  4APF A;  4B8C B;  1TJF A;  3EJN A;  1Z6T A;  5BT1 A;  1E90 A;  4UWF A;  5KJK A;  2CHZ A;  2IF4 A;  2ILR A;  1UG3 A;  2J08 A;  3BG1 B;  4GCO A;  3FTW A;  4OYS A;  2DCP A;  3G2U A;  1H6K A;  3SGH A;  3R7Q A;  1UJJ A;  3G2V A;  2AVP A;  3SHF A;  1YA0 A;  3ZYQ A;  3RK6 A;  3IEG A;  4UWK A;  5LCW C;  4AXH A;  5AEN A;  2RD0 A;  1U3C A;  1NZN A;  4HLE A;  5FQ4 A;  5DIZ A;  4CDN A;  3CR3 A;  3ZW3 A;  4JHK A;  2BF0 X;  3Q4A B;  5AIJ A;  4I1O B;  4XI9 A;  4GZD A;  2WXP A;  4J8E A;  2OVF A;  5EKQ D;  3APF A;  3IBE A;  3RO2 A;  5A23 A;  5G2N A;  3JCK C;  4YVQ C;  2PQN A;  3L22 A;  3B7T A;  3FH5 A;  1ELR A;  2GGF A;  3BEE A;  4GZ3 A;  1DVP A;  3L08 A;  4UQZ A;  2MOW A;  4L1B A;  4FJY A;  4L7T A;  4JEH A;  2QFC A;  3RRN B;  3D3M A;  3ZVV A;  1TJC A;  2R5S A;  4G26 A;  5FJY A;  1NA3 A;  4HOT A;  1UN8 A;  2WXR A;  3ESK A;  3MA5 A;  2PQR A;  5FZQ A;  3FTX A;  4AV7 A;  5CHE E;  5LOZ A;  4I17 A;  2UY1 B;  2IOS A;  4J6I A;  4UWL A;  3VLD A;  4IUL A;  3QWV A;  2CG3 A;  3MEK A;  1E8X A;  5BW8 C;  3TXM A;  2X6K A;  3CVQ A;  4AM9 A;  4HOU A;  3UT8 A;  3LKU A;  4WNG A;  2NXP A;  4TRQ A;  2WXL A;  3ZHE B;  4DJA A;  4FU3 A;  3ZN3 A;  4LRZ A;  2EQX A;  1EYH A;  1JUQ A;  4HOR A;  2WQ6 A;  3S7J A;  4AP2 A;  4BY6 A;  2CHW A;  3IHY A;  5FQ8 A;  3EIQ C;  4KXK B;  3D9K A;  2XGS A;  2J4D A;  3CST A;  4U0U A;  2IFU A;  1E8Y A;  2WXF A;  3FHE A;  4JL0 A;  4L2Y A;  4WNF A;  4BTA A;  3PDN A;  3GZ1 A;  4ILH B;  1ZU2 A;  3DPD A;  4KVM A;  5JJ7 A;  4JW1 A;  4RG9 A;  3UT4 A;  5CMW A;  5D0Q D;  2PL2 A;  4XI0 A;  2YIN A;  4I9C A;  2FUL A;  3LVR E;  1BPO A;  3D9O A;  2LO6 A;  3CHO A;  3SD5 A;  1PC2 A;  4XX5 A;  4ANV A;  3CIA A;  2UY1 A;  2FI7 A;  4HS2 A;  3Q15 A;  2J49 A;  4I6J A;  5LX8 A;  3QOU A;  1HO8 A;  2AWI A;  4CRW A;  3S7F A;  3CVN A;  1IQR A;  4XKC A;  1P5Q A;  3FEX A;  4ANX A;  3PEV B;  2Q7F A;  1HS6 A;  4GPK A;  4ACL A;  2V8S E;  1ELK A;  4B0Z A;  3ZHE A;  4E85 A;  3LDZ A;  3MKQ A;  5FZS A;  3LVQ E;  1EPU A;  2KM4 A;  4ILI A;  4DI4 A;  3CKB A;  5JJ6 A;  1HXI A;  4MLP A;  4HFG A;  4FJZ A;  3C98 A;  2P58 C;  3CHS A;  1E8Z A;  4G24 A;  3CVV A;  1ELW A;  3LCA A;  3RU0 A;  3FUE A;  2L0T B;  5C1D A;  5LP0 A;  1UJK A;  2WVI A;  3QAR A;  1JPL A;  5BNW A;  4GA2 A;  1FVH A;  2VQ2 A;  3CGH A;  3SNX A;  4MS6 A;  2WXN A;  1H19 A;  4N39 A;  3GZS A;  3URZ A;  3QK0 A;  3SBS A;  4PS3 A;  3LPZ A;  3CVL A;  4FC8 A;  3O4Z A;  4WND A;  3IKO B;  3VTY A;  3FEY A;  3MGB A;  2X3M A;  2YHE A;  4GYW A;  4KMO A;  1E8W A;  3B13 A;  4LCT A;  4I43 A;  4I1M A;  4NRH B;  4PS8 A;  4YVO A;  2JLB A;  3L16 A;  2E0I A;  3D9I A;  3SBT B;  1OUV A;  1HF8 A;  1SZ9 A;  3FUL A;  4Y6C A;  5CCL A;  4OVV A;  3CHQ A;  4WWP A;  3RIB A;  5KJM A;  2X6J A;  2VSX E;  4R7L A;  4O6F A;  4EPZ A;  5J08 A;  3APC A;  4PUC A;  3ASF A;  5KJN A;  3GW4 A;  3ASG A;  5KCM A;  3HVE B;  1XNF A;  4QFV A;  4WNE A;  4LUN U;  2CFZ A;  4UQX A;  1H2U A;  1N54 A;  5BUZ A;  2VJ8 A;  2HO1 A;  1X5B A;  4WWO A;  4TV3 A;  3RJV A;  4U63 A;  1WM5 A;  4PS7 A;  2CHX A;  4D10 C;  2VYI A;  5G55 A;  4NAC A;  3CKC A;  2LAI A;  4W9R A;  4DPR A;  1PAQ A;  3RKV A;  3UT7 A;  2VGX A;  5C2Y A;  2XGM A;  4JPS A;  4JVS A;  4A1G A;  4GYY A;  4ME2 A;  2UWJ G;  4GA1 A;  3I4G A;  4U07 A;  4DLQ A;  4I6E A;  4EQF A;  2QY7 A;  2VSO E;  3DBS A;  3QC1 A;  2BUG A;  3VTX A;  2L9B A;  3ZYL A;  5LCW J;  2X6H A;  3UPV A;  4B8A A;  4LEU A;  4A3V A;  5EX3 A;  3VLE A;  4BX8 A;  4EBA G;  4E6H A;  3PE3 A;  3OXF A;  4GZC A;  5BPP A;  4JHR A;  3I4R B;  3ZGQ A;  3KS2 A;  4K0R A;  1Z3X A;  1HU3 A;  2XPI A;  2JEK A;  4JA7 A;  4C0E A;  1HG5 A;  1VDY A;  4HXI A;  4WUY A;  3MZL B;  2HR2 A;  4YND A;  3ZRH A;  3SZ7 A;  4CEM A;  4C0M A;  4AY6 A;  2KAT A;  2WPV A;  4A3T A;  2KCL A;  3FDH A;  3TXN A;  4FAD A;  2WQH A;  4DK5 A;  1U3D A;  3FWV A;  3CVU A;  2XCB A;  4G11 A;  3CHM A;  5EX0 A;  5A7D B;  1OWL A;  3LEW A;  3L54 A;  4BT8 A;  3JQ0 A;  4XZ4 A;  2GRM A;  2J4B A;  2LAH A;  1HE8 A;  4UI9 C;  3O48 A;  3FUN A;  5M72 A;  3LS8 A;  3B7R L;  2I1K A;  3ONL A;  1W3B A;  3VLF A;  5G05 C;  3G2S A;  1IYG A;  4FLB A;  1TEZ A;  1INZ A;  3JUI A;  1IHG A;  4IYP A;  2YNQ A;  4ANU A;  5JHB A;  1E7V A;  4MKT A;  3FY4 A;  3PE4 A;  3PVL A;  3LY7 A;  1NP7 A;  4B89 A;  3UMV A;  4I6G A;  3AU4 A;  3JYS A;  4F7A A;  3RO3 A;  2LSU A;  4EZK A;  2VTB B;  3CQG B;  4FUL A;  5KJL A;  3E4B A;  4PDX A;  2A4Z A;  2Y4T A;  3D9M A;  2KZT B;  3SF4 A;  4CGW A;  3R9A B;  1FCH A;  2WXI A;  3FU6 A;  4DLO A;  4RG6 A;  4MRU A;  4XE0 A;  4EZJ A;  3U66 A;  2YQ8 A;  2AW6 A;  3QAQ A;  5HQ8 A;  1Y6I A;  3QJZ A;  3QDN A;  3B7S A;  5EDS A;  1HH8 A;  3CK7 A;  3FUJ A;  4I2W A;  4L23 A;  3MV2 B;  1QNF A;  4KBQ A;  3D9J A;  2PM7 A;  5FZR A;  2V5F A;  2WXK A;  2C2L A;  2R17 C;  4GZ5 A;  3IHV A;  2I9C A;  3G2T A;  2DIW A;  4J8S A;  4KYO B;  2A5U A;  4N3B A;  4Q69 A;  3CQC B;  3WXX A;  2CG2 A;  4BX9 A;  5G04 C;  2C0M A;  3MJW A;  4AY5 A;  1ZBP A;  4FP7 A;  3U3W A;  3T5V A;  1IQU A;  3PS6 A;  3G2W A;  3UUX A;  5FTP A;  1HX8 A;  3RRU A;  3HHM A;  3PNL B;  4WAF A;  3I3N A;  4I9E A;  1MHQ A;  4IRU A;  1OWN A;  2WXM A;  4NUR A;  3APD A;  3QWW A;  4L2L A;  2HYZ A;  2OOE A;  4URK A;  4BFR A;  4CT0 A;  2WMO A;  3TL5 A;  1KT1 A;  2XRY A;  2CFU A;  5BV1 A;  1H0A A;  2M63 A;  3D9L A;  3CHP A;  3D9N A;  2ZU6 B;  3EHM A;  3PEU B;  2IQC A;  3UQ3 A;  4GU5 A;  3HIZ A;  4APO A;  4AOF A;  2VSY A;  4BWR A;  4CDR A;  1E7U A;  2BTD A;  1A17 A;  4G1T A;  3FTU A;  3ZFW A;  5AJL A;  3PUK A;  3FU5 A;  2WXQ A;  4ILG A;  4HVB A;  3L6A A;  3NF1 A;  4ACK A;  4V3I A;  5J90 A;  3MX3 A;  2FO7 A;  2YHC A;  4XIF A;  3ML9 A;  4N3C A;  2RG8 A;  3EHN A;  1E96 B;  3NZU A;  4K03 A;  3PH0 C;  3PNT B;  4J8F A;  4GYO A;  3TGO A;  1XGW A;  3LJ3 A;  4Y6W A;  2NSZ A;  2X38 A;  3Q47 B;  1HFA A;  5ARF A;  2J9Q A;  3ASH A;  2XQ0 A;  3B7U X;  5DBK A;  4C9B B;  3LY8 A;  1SQM A;  1OWM A;  3ESL A;  4FLH A;  2FF4 A;  2OND A;  2AXZ A;  3FU0 A;  3FUM A;  3IV0 A;  4UI9 K;  3OAW A;  3FTY A;  2FBN A;  4NQ0 A;  2WM9 A;  4U04 A;  2V4L A;  5D0O D;  4WWN A;  2LNI A;  4CCA A;  1HZ4 A;  2NC9 A;  1SZA A;  1QQE A;  1Z3Y A;  2Y3A A;  2XCC A;  4Q94 A;  3FP3 A;  3CVX A;  3TJP A;  4P29 A;  3I5P A;  4G2V A;  5E75 A;  2LSV A;  3L13 A;  4A55 A;  4XKB A;  3CLJ A;  4CT4 A;  1L5J A;  5FQ6 A;  4CDM A;  1OWP A;  1H2T C;  4U0Z A;  4CGV A;  3FH7 A;  4JA9 A;  4N3A A;  4GZ6 A;  3FFL A;  4FA6 A;  3FTZ A;  4AEZ C;  3HVE A;  3T5X A;  4RVB A;  1LF8 A;  3MKR A;  4Q96 A;  2HM8 A;  4JXT A;  4TUU A;  3BG0 B;  3RRM B;  3FUH A;  4N2S A;  1MQS A;  4JZY A;  2WQ7 A;  1NA0 A;  3MCX A;  4I1A A;  3ZIM A;  2XPY A;  1JWG A;  2OV8 A;  3OTN A;  3FUI A;  4AIF A;  3ZEF A;  1GW6 A;  2MHK A;  4M3O A;  4G25 A;  2XRZ A;  4EBA A;  2E2E A;  3OXG A;  2VSN A;  4KZ0 A;  2ION A;  1WY6 A;  3Q5M A;  2X6F A;  1Y8M A;  4KT6 B;  4U0S A;  4GB9 A;  3KD7 A;  3HDX A;  4JC8 A;  3ZYM A;  1S0P A;  3U64 A;  3ENE A;  2AXU A;  3SI5 A;  2IU1 A;  3U4T A;  4HOS A;  1HG2 A;  4LER A;  2I1J A;  2KCV A;  3AS8 A;  3FUD A;  2L6J A;  3NZS A;  2DBA A;  4BTB A;  4GAA A;  4U8H A;  3GYZ A;  5JHA A;  2XPZ A;  3OXL A;  4G23 A;  4J8D A;  5JJT A;  1H2V C;  4OVU A;  4UI9 J;  3PRZ A;  3TG5 A;  2X6I A;  4JHJ A;  2R59 A;  1EDU A;  4N5C A;  3MKQ B;  5G05 J;  3LXU X;  3PRE A;  3ML8 A;  3ZYK A;  3CVP A;  4EZL A;  3Q49 B;  4B94 A;  2WXJ A;  4GMJ A;  3ASD A;  2WB2 A;  3T8M A;  4F3V A;  2FEZ A;  1EF1 C;  4AJW A;  1KT0 A;  3P1U A;  4H7X A;  4UQY A;  2KC7 A;  5ANL A;  2VGY A;  5FQ7 A;  2XGO A;  3S2A A;  2PM6 A;  3SFZ A;  2OVB A;  3HYM B;  2WXG A;  4GML A;  4N2Q A;  4RSY A;  3R7R A;  3ZXS A;  1FVF A;  4KVO A;  2GRL A;  3FTS A;  2J07 A;  3CVY A;  4UWH A;  2IOL A;  1QZ2 A;  4ANW A;  5AJD A;  1UW4 B;  3PUJ A;  5FT9 A;  5T8I A;  4I2Z A;  3QB2 A;  4HOQ A;  3JQ1 A;  5CMY A;  4F53 A;  2L0I A;  2VTB A;  4DI3 A;  2Y4U A;  2I6H A;  3KAE A;  5ENN A;  1KLX A;  5LFA A;  3CHR A;  4J0U A;  4BSX A;  4ATG A;  4GA0 A;  1OWO A;  2AXV A;  3MYV A;  2KZT A;  3PZD A;  3FTV A;  3QKY A;  1UN9 A;  3CK8 A;  3AS5 A;  4FHJ A;  3CEQ A;  3GZ2 A;  5T3R A;  3UX4 A;  3TG4 A;  3FUF A;  2V0P A;  4UWG A;  5G04 J;  3P2B A;  3FH8 A;  3ONK A;  3NQP A;  4AVX A;  1PY1 A;  3EDT B;  2KCK A;  5AYW D;  3CSF A;  3QNK A;  3CK9 A;  3FUK A;  2J09 A;  4IN3 B;  3TAX A;  3CVW A;  4PH4 B;  2C0L A;  4FHK A;  4GCN A;  5HI7 A;  1JWF A;  3AU5 A;  5ARG A;  3S7D A;  3N71 A;  3S7B A;  4ABN A;  5CCM A;  1B89 A;  2WXO A;  2XHE A;  4JEU A;  5E76 A;  3L17 A;  5T4Y A;  2MRI A;  2WXH A;  3EIJ A;  2I2O A;  3K9I A;  1N52 A;  5BV0 A;  2VGX B;  3U9W A;  1DNP A;  3LYA A;  3D9P A;  4H7Y A;  1WAO 1;  2IJG X;  3FU3 A;  4KZC A;  5ANR A;  5FWQ A;  3ZPJ A;  4A1S A;  4F1S A;  2GW1 A;  5A6C A;  3QWP A;  3MV3 B;  4EEC A;  2WMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...