3CVQA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to pts1 peptide (7-skl)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
315
structure length
289
Chain Sequence
NTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARALDPADIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
molecule keywords Peroxisome targeting signal 1 receptor PEX5
total genus 97
structure length 289
sequence length 315
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvqA00
3GZ1A 5M72A 5EX0A 3U4TA 3RIBA 3MKRA 3LY7A 1TJCA 4JL0A 2Y4UA 4JHRA 2PZIA 1Y8MA 2XGSA 3AS5A 4YNDA 2AVPA 3Q4AB 2WPVA 4GA1A 2GW1A 3AS4A 4G24A 4N3BA 5G05C 3ZHEB 4U0ZA 4Y6CA 3SF4A 5BNWA 3CK8A 4G25A 4GCNA 2HYZA 1B89A 3KD7A 3LY9A 1ELWA 2IFUA 1QQEA 2XEVA 1YA0A 3OXFA 3PE3A 4I2ZA 2KCVA 4UQZA 5FZSA 2DBAA 2PQRA 3RU0A 5G04J 4AY5A 3E4BA 4RG9A 3QWPA 4N2SA 3CVLA 5CHEE 2LSUA 3QOUA 2UWJG 3O48A 3CKBA 3GYZA 4I2WA 2PL2A 4YVOA 3ASDA 5A7DB 3FFLA 4JA9A 4GA0A 3VTXA 3ASFA 2ONDA 4UQXA 4J0UA 2VGXB 4O6FA 4N3AA 5ARGA 4UI9J 2IF4A 5DIZA 1WAO1 2C0LA 3RJVA 3ZHEA 4CGWA 4GCOA 3ASGA 2FI7A 5G04C 4U07A 2I6HA 5EX3A 3QDNA 4N2QA 1ELRA 5BW8C 5FT9A 2VYIA 4IN3B 4WNGA 5LCWJ 5LCWC 4GZ3A 3PDNA 5FZRA 3S7JA 3VTYA 3CVNA 2C0MA 5G05J 3IEGA 1P5QA 5C1DA 4HOSA 4HOQA 4NRHB 1WM5A 4NQ0A 3Q47B 4N39A 1XNFA 1ZBPA 3S7DA 4HOTA 3KS2A 1ZU2A 1E96B 4WUYA 4YVQC 3TAXA 1HXIA 3HYMB 3KAEA 3JYSA 4UI9K 4UI9C 3ESKA 4WNDA 2VGXA 2Y4TA 3OXLA 4UQYA 3CK9A 3ZFWA 4F3VA 2KATA 3AS8A 2XGMA 3Q49B 4H7YA 4RG6A 4AIFA 4APOA 1KT1A 2FBNA 2UY1A 3CKCA 2FEZA 4GZ5A 4W9RA 2HR2A 4H7XA 4XIFA 4BTBA 2XCCA 4GPKA 5JJ7A 4BTAA 3FWVA 1FCHA 1NZNA 2OOEA 2R5SA 4I9EA 4N3CA 5KJNA 5D0QD 5CCMA 3CEQA 3LCAA 3U3WA 4G26A 4I1AA 3TG5A 5HI7A 3TG4A 3ULQA 1KT0A 1IYGA 3FP3A 4G1TA 4KYOB 5AYWD 3GZ2A 2NC9A 3MV3B 3OXGA 3K9IA 2BUGA 4J8FA 3QWVA 4GYOA 4A1SA 4GYWA 5KJMA 3Q15A 3N71A 2YQ8A 4CGVA 3CV0A 2MHKA 3UQ3A 3S7BA 1HH8A 4JA7A 2KCKA 3Q5MA 2VGYA 3LPZA 2HO1A 1OUVA 2UY1B 2FF4A 1W3BA 3BEEA 2KC7A 4GYYA 2JLBA 3QWWA 4ABNA 4CDRA 5KJKA 2XCBA 3ASHA 4BT9A 4HORA 2KCLA 3CK7A 4GA2A 5FJYA 2PQNA 2LNIA 3CVQA 3MV2B 3RO3A 4AM9A 4GZ6A 4J8DA 1NA0A 3MA5A 4N5CA 4Y6WA 3LY8A 5EKQD 5KJLA 5CCLA 3ZPJA 1PC2A 2XPIA 2YHCA 1A17A 3UPVA 4B94A 4AY6A 3PE4A 4I17A 5ARFA 2VSYA 3NF1A 4G2VA 3UUXA 2V5FA 4LEUA 5D0OD 5DBKA 3S7FA 3EDTB 5BT1A 4EQFA 2J9QA 2VQ2A 3TGOA 2E2EA 1KLXA 2WQHA 2C2LA 5HQ8A 4I9CA 4XI0A 5JJTA 3RKVA 2Q7FA 4BT8A 4J8EA 2VSNA 3LYAA 5JJ6A 3R9AB 2L6JA 3GW4A 3LKUA 2QFCA 1HZ4A 4G23A 5FZQA 3CVPA 3ZGQA 4WNEA 3SZ7A 1QZ2A 1NA3A 3QKYA 4XI9A 4U04A 4HOUA 4ME2A 4BWRA 5FTPA 2FO7A 4KXKB 3ZN3A 3MEKA 4U0SA 3URZA 4U0UA 2P58C 3WXXA 5A6CA 1IHGA 3RO2A 4WNFA 2LSVA 4KBQA 2XGOA
chains in the Genus database with same CATH superfamily
1OWPA 2HE0A 4A55A 3ZHEB 1N0RA 3ASNE 2X38A 2NSZA 3LS8A 2LSUA 4I2WA 4O60A 2EILE 2ONDA 3FTXA 2ETCA 3FTUA 4HS2A 1BD8A 3PH0C 4PUCA 1U3DA 3IEGA 2AXVA 3TXMA 3ONLA 3P1UA 4GTMA 3UT8A 4G8KA 4CRWA 4WNDA 2EIKE 4WWNA 4CT0A 5ENTD 1BI8B 2AW6A 1Z3YA 2BKKB 3G2TA 1D9SA 3E34A 3HG0D 3HXFA 2WB2A 2UY1B 5JHAA 4GA2A 2EINE 4OAUC 3DRAA 2R02A 4I17A 2H6HA 5EN5D 2VQ2A 3APDA 1IQRA 2WQHA 4J8EA 3QJZA 3QARA 3HXDA 4KXKB 3F6QA 3EU9A 4H7YA 4E85A 3FY4A 4BFRA 3SF4A 2XPZA 5LX8A 2YINA 3PE3A 2DYSE 3NAWA 4YDEA 2YHEA 2RG8A 3PZ4A 4B8CB 2F8YA 1FVHA 3NZSA 3PUJA 5LCWJ 3PDNA 5FZRA 4IYPA 3CVUA 5AN8A 2MOWA 3MCXA 1H2TC 3S7DA 3FTYA 5ENRD 1FVFA 2KATA 3FDHA 1KT1A 2DIWA 2FBNA 5FQ4A 4GMJA 1G3NB 2ZISA 3CHOA 4HBDA 3OXGA 3LEWA 3TWQA 4TUUA 4JA7A 3UKRG 1BI7B 3MKQA 1KZOA 4U8VD 3B7BA 2YHCA 1Z5SC 2V5FA 2WXHA 1OWLA 3B7TA 2VSXE 1FPPA 5LOZA 4WNEA 2QY7A 2XHEA 3FTSA 5BV1A 5EDSA 4GMLA 1X81A 4KBQA 1HS6A 5M72A 5EX0A 4DX5D 4I6JA 2NYJA 3E33A 4A63B 2XS1A 3NQPA 1HE8A 3AU4A 3JQ0A 3UX4A 4HLEA 4HI8A 3ISMC 4N3AA 1IHBA 1ELRA 2ZXWE 3HVEA 3CSFA 4APOA 2F0YA 2P9KG 1UW4B 3SHFA 1N52A 3ULQA 5KNGA 5KNHD 3CVWA 3DPYA 4FP7A 3IV0A 4J8FA 3QWVA 4GYOA 4L7TA 4CGVA 1HU3A 4ABNA 2WXNA 4FHJA 2ZGGA 1OWMA 3E30A 4QQIA 2J8SD 4WAFA 5CBNA 1KLXA 3ESLA 5JJ6A 3R9AB 4LNGA 2H6IA 4EPZA 3B7UX 4LUNU 3D9HA 3Q79A 2BEDA 5BV0A 4I43A 3SNXA 1IHGA 4L9PA 4HNAD 2LXLA 3E32A 2B0OE 1O1TA 3DBSA 2VGEA 1N4QA 4KT6B 1K3ZD 1U2VG 3C3OA 3PEVB 2BKGA 4B0ZA 3E4BA 4LSZE 3QK0A 5CHEE 3QB2A 2IQCA 4BESA 3C98A 3FFLA 3DSTA 4GA0A 3ASFA 3ZRHA 4RSYA 2GRNB 3CQCB 2RFMA 3FUHA 3V79K 4O1PA 4NIKA 4DI3A 1XNFA 2V8SE 3CK9A 4N5QA 4OAVB 4BTAA 4K5CA 1OCCE 1AP7A 4XX5A 4HRLA 3CEQA 1DCQA 2R2LA 4UWKA 2WXMA 2P9UG 2LAIA 5D66A 3ASOE 1U3CA 2J07A 5B3SE 4AJWA 3UTMA 1ZB1A 1UOHA 3MA5A 3C72A 5KJLA 2RFAA 4TUMA 3ZPJA 3W9GA 3PE4A 3FUJA 2KBXA 5ARFA 3QAQA 3L6AA 4XI0A 4C48B 3RKVA 3UMVA 4JHKA 1HZ4A 3CIAA 3SZ7A 1E7UA 4KVMA 3FUIA 4NURA 4XI9A 3UKUG 5ENOD 2PNNA 1D8DA 3ZKJA 5E76A 5BPPA 1TJCA 4ANVA 3ZIMA 2WMNA 4YNDA 3CQGB 4K0RA 3KD7A 1OY3D 1QQEA 4UQZA 2XQ0A 3C3QA 3QOUA 1HF8A 1DVPA 5ENQD 5ANRA 4GU5A 4BX8A 1SZ9A 2FI7A 4JW1A 1MX4A 2AJAA 2BTDA 4LNUD 5FT9A 3L82A 3AG4E 2C0MA 2RD0A 3AAAC 4KZ0A 2L0IA 4WUYA 3TAXA 3PUKA 4K03A 3T5VA 1S0PA 4AV7A 2R59A 4PS8A 2J4DA 3MKQB 2F37A 1BLXB 5KCMA 2XEHA 4N3CA 5B1AE 4DX2A 4TXPA 1TN7A 3ENEA 1JWFA 4MBGA 3CV0A 4GZCA 1TN8A 2GGFA 1OUVA 4CDRA 4ZFHA 4RLYA 4FLBA 4MRUA 4TRQA 2XEEA 2OEVA 4AXHA 3SD5A 3LJ3A 3EJNA 3FUKA 4AVXA 4LEUA 4A3VA 4TXQA 4URKA 3FUFA 3CVPA 3L54A 4BWRA 4HOUA 4CDMA 4JHJA 3QNKA 2WQ6A 3DEPA 1BU9A 4G24A 2XEVA 4R7LA 4C0EA 4BSXA 2UWJG 2PL2A 3UT7A 4PH4B 4JA9A 2CHWA 4FHKA 3VTXA 2VGXB 3EUVA 1BPOA 3T8MA 3I5PA 5CECB 1VDYA 3VTYA 3S2AA 2VSOE 4NRHB 2ZU6B 1E96B 2EIJE 2JEKA 4OVVA 3KEZA 4G11A 3Q7AA 2XCCA 4GMRA 5JJ7A 2IJGX 4FJZA 3UINC 4E6HA 3R7RA 3LCAA 3FP3A 2P9NG 5LP0A 2YQ8A 4MKTA 3IKOB 2VGYA 1SW6A 2KCLA 3DEOA 3MV2B 4AM9A 5AQBA 4J8DA 5EKQD 1MHQA 4B94A 5A23A 4ILGA 5CRUA 1KPSB 3W9FA 5CERB 3PREA 2XRYA 2WXFA 4GTVA 2CG2A 1NA3A 2X6JA 1YMPA 5BXUA 3WXXA 4K5BA 4UWFA 3Q73A 4J6IA 3TWVA 4BY6A 2Y4UA 3CVYA 3U66A 1DCEA 3FH5A 4GAAA 3CK8A 4GCNA 3ZXSA 1OXJA 1UJJA 4JB8P 3CKBA 2RKKA 5D2MC 3SFYA 2R17C 2A4ZA 4CGWA 4GCOA 5G04C 2X6HA 4U07A 2FULA 5JA4D 2WXQA 4BETA 2VYIA 4DX7D 5FQ7A 5C1DA 3RRNB 4YVQC 5HS0A 3C3RA 1RZ4A 1NP7A 4GZ5A 1QNFA 4W9RA 1FCHA 4JC8A 4I1AA 4L2YA 4Z68A 1TR4A 4BSZB 1TNYA 1TYQG 4EBAA 2DWZA 3BQOA 3I3NA 3DXMG 2GROB 4ANUA 3UM2A 3ASHA 3CVQA 1OWNA 2ZIRA 3NOCD 2LO6A 2XZTG 1EF1C 2VSYA 4QFVA 4TXRA 3V30A 1DNPA 3DWLG 4M3OA 4UUCA 5CRVA 5E75A 5FIOA 3T5XA 2X6IA 4Q69A 2GRLA 1TN6A 4U0SA 2WXIA 4HI9A 5A6CA 3RU0A 5AJDA 1YCSB 1N95A 2CHXA 4RQIA 2WXKA 3I4RB 1E8YA 4Y6CA 3B95A 4O6FA 2IFUA 1YA0A 2KCVA 3QWPA 3O4ZA 4GTRA 5CMYA 3GYZA 3FH7A 5KBAA 2X3MA 4UI9J 3I4GA 3VLFA 2IEJA 3ASGA 4I6GA 4EZJA 1SA4A 5LCWC 2M63A 4ATZD 5G05J 4ACLA 1P5QA 1H6PA 3RRUA 3Q47B 1JCSA 3KS2A 3HYMB 3OXLA 4RG6A 3D9IA 3Q49B 4BTBA 4UWGA 2CFUA 5ENSD 1LD7A 1EDUA 5HI7A 2I9CA 3LDZA 2FO1E 4A1SA 3K9IA 4I1MA 5T8IA 2MHKA 2OVFA 4YDWA 3UQ3A 1HH8A 2AXZA 2QZAA 1W3BA 1UJKA 4HORA 2DYRE 3FULA 2PM6A 1K8KG 4MLPA 4CCAA 5AQ9A 2ILRA 3HHMA 2ETBA 4TV3A 3D9LA 3ZN3A 3ZYQA 4GTQA 3FUMA 4WNFA 3D9JA 2VTBA 2DZOA 3UI2A 3RK6A 5FQ6A 2E0IA 5G05C 3U9WA 4NACA 2AWIA 3CVLA 2X6FA 4V3IA 4UQXA 3C5RA 1WAO1 4B93B 4ILHB 5AIJA 1IKND 4WWPA 5KWDA 3UXGA 3EHRA 3KSQA 1ZBPA 3QC1A 3ESKA 1N94A 1OCOE 2MYOA 4UQYA 5ITZF 3EU5A 2QYJA 4HQDA 3ABKE 1QBQA 5J90A 4U96D 1UN8A 3PEUB 3Q9UC 2JABA 2NC9A 2BUGA 4KMOA 2V5QC 2ETAA 3TJPA 1H6KA 4PS7A 3S7BA 3LPZA 2HO1A 2H6GA 1SQMA 2DVWA 3CK7A 2PQNA 4GZ6A 5BXOA 1Q2ZA 5AAOA 3T9KA 1SA5A 3HIZA 1O5MA 4JPSA 4AEZC 4I9CA 2Q7FA 3G2VA 4JEHA 2I1JA 3ZYLA 1H6OA 4ANXA 5JHBA 5FTPA 2YNQA 4UWLA 3URZA 4WWOA 4D10C 3RO2A 2P9LG 2V4HC 3D9OA 1S70B 4ZHBA 3Q4AB 4KZCA 3LY9A 3OXFA 5FZSA 3SFZA 2L0TB 4DRXE 3X2QE 3KSLA 2GRPB 3ASDA 4CT4A 4EZLA 3CGHA 4PDXA 1S64A 3AG1E 1INZA 2QC9A 5T3RA 4KVOA 1H2UA 3LVRE 4HXIA 2GRRB 3ABLE 1EPUA 1ZU2A 1HXIA 5AJLA 3ZFWA 3PZ3A 2Y4TA 3OTNA 2ZGDA 4XIFA 3FUDA 1NZNA 4U8YD 4P29A 1KT0A 4DI4A 2KM4A 1XGWA 2KZTB 3N71A 4I1OB 4CYMD 4JEUA 3CVXA 3J5PA 3G2UA 2XCBA 4BT9A 4A1GA 4Y6WA 3UPVA 1WY6A 3PZ1A 3FTVA 3EDTB 4EQFA 4JVSA 1PAQA 4CZ2D 4XKCA 4GTOA 2IU1A 5CEDB 5FWQA 3ZGQA 5EIBE 4L1BA 2LSVA 3FU6A 3TWXA 1TJFA 3FU5A 4M7CA 1O1RA 3PZ2A 4JHRA 1JCRA 3AS5A 1H2VC 4N3BA 4HLLA 4N2SA 3T8KA 2VTBB 4O1OA 4XE0A 4J0UA 2CG3A 2Y69E 5AQAA 3ZHEA 3J5QB 3EHNA 4HVBA 3SO8A 4GTSA 5BW8C 4IN3B 2J09A 3CVNA 1H0AA 4NQ0A 1YYHA 1SVXA 2WXPA 3JYSA 5EYLA 4FU3A 1RW2A 5CMWA 4GPKA 3NB2A 5D0QD 2A5EA 3TL5A 3TG5A 5G55A 3L08A 2NXPA 3EIQC 5KJMA 1FT2A 1E8ZA 3Q5MA 3CHMA 3UM3A 5KJKA 2JLBA 2XPYA 3SY2A 3TXNA 1NA0A 5CEAA 4UWHA 1LTXA 4JXTA 3EHMA 3UIOC 2P2CP 3D3MA 3JUEA 3R7QA 3TGOA 5HQ8A 5JJTA 4PS3A 2IY0C 3DSUA 3HXCA 4MS6A 3APCA 3IBEA 1QZ2A 3B7SA 3MX3A 3MZLB 4U04A 3E37A 3MEKA 4FLHA 2PZIA 1Y8MA 2LAHA 4U8HA 2VJ8A 4A3TA 1MJ0A 4G25A 2AXUA 1B89A 4GTPA 4JD2G 4G8LA 1NI1A 3ULYA 2IOSA 4EBAG 4OYSA 2GRQB 3ML9A 1N11A 3LVQE 3UT4A 4HOQA 1WM5A 4B8AA 3Q9NC 3HRAA 3G2SA 3KAEA 1OCZE 3NOGD 3TWUA 3ZUVB 1D8EA 1UN9A 1OCRE 3ZYMA 4AIFA 4GB9A 4DLOA 2KXPC 4DK5A 2R5SA 4I9EA 5KJNA 3PRZA 3VLDA 4KYOB 2L9BA 3HVEB 1MX2A 1MX6A 3MV3B 3L9TA 4DX1A 3SQVA 4B89A 3TWSA 5JMND 1TNOA 3CSTA 2OV8A 3HDXA 2CFZA 2R05A 4AOFA 3RO3A 2LNIA 3DSSA 3RSEG 3ZW3A 4J8SA 1LD8A 3UUXA 1N4SA 2H6FA 3S7FA 5J08A 4DX6D 1MYOA 2E2EA 3GW4A 2QFCA 5BUZA 3FEYA 3L17A 4ME2A 2FO7A 3U64A 4EZKA 3DSWA 3Q7FA 2P9IG 3U4TA 2WVIA 3MKRA 5AQ7A 4IULA 2DZNA 3UM1A 2WXGA 2OEWA 2V0PA 2GW1A 5BNWA 2HYZA 4LRZA 2PQRA 1TNBA 3FEXA 1N4PA 3DPDA 3AU5A 3ONKA 1H19A 3GZSA 3KEAA 1HG2A 3MYVA 5ARGA 2V4LA 1TNUA 2X6KA 3AG3E 4WNGA 4GZ3A 4U7EB 2LXMA 1N54A 3PNTB 2OCCE 4HOTA 3FUNA 3MJWA 2XGMA 5EYPF 1MZCA 3G2WA 4ACKA 5HRYA 3SGHA 3EHQA 1NFIE 5FQ8A 2IO2C 3ZNGA 1IYGA 3SBSA 3RAUA 2EQXA 1O1SA 1S63A 2PM7A 4GYYA 2R03A 4K5AB 3B13A 3FTZA 4HRNA 3CLJA 4FJYA 4N5CA 1K1AA 5D0OD 2J49A 3CHQA 4GPMA 4YDYA 3B7RL 2Y1LE 3EIJA 3TWWA 4U0UA 2P58C 1E7VA 3D9KA 4JZYA 4Q94A 4CDNA 3JUIA 2XENA 4JL0A 5AENA 3CR3A 2WPVA 4GA1A 4I2ZA 4Q96A 3NZUA 4FULA 3HXEA 1IQUA 2CHZA 3FHEA 4DUIA 2I6HA 4CEMA 3R9MA 3ULEG 4EECA 4J8YA 1HFAA 2WXRA 3S7JA 1HX8A 1ELKA 4HOSA 4LERA 1X5BA 4FC8A 4UI9K 1QYMA 2XRZA 4F3VA 2XS8A 3AS8A 3CKCA 4DLQA 3FWVA 2OOEA 1L5JA 3MGBA 5CCMA 4OVUA 4G1TA 3RRMB 3JCKC 5AYWD 3GZ2A 1Z6TA 3ABME 1OT8A 3UIPC 1N4RA 4L23A 2QYUA 3Q15A 3UM0A 5DIZA 2FF4A 3BEEA 3QWWA 5T4YA 2J4BA 1IXVA 4U95D 5FJYA 1E90A 1AWCB 2Y0BG 4AY6A 2WQ7A 4J7WA 5B1BE 3NF1A 2OVBA 4F1PA 5BT1A 4BERA 3ML8A 2J9QA 1UG3A 2L6JA 3LKUA 5FZQA 2Y3AA 4X8QA 1N9AA 1JUQA 3L13A 3D9MA 5ANLA 3VLEA 4HRMB 3FTWA 4BT8A 4LG6A 2XZDG 3LY7A 3CHRA 1JCQA 3DSVA 2XGSA 3ZEFA 3JQ1A 3TWRA 4FADA 1ELWA 4AY5A 4RG9A 1N0QA 3BG0B 3O48A 5C2YA 4XKBA 4YVOA 3ZXPA 3DXKG 3FU0A 3BG1B 2IF4A 1MQSA 2C0LA 5EX3A 3QDNA 3PVLA 1KZPA 4GTTA 3FUEA 4ILIA 3CVVA 4F1SA 4XZ4A 3LJNA 4N39A 3AG2E 3PNLB 3PS6A 5H7PA 3IHVA 2UY1A 2HR2A 4H7XA 2WXJA 3CHSA 5EILA 3TG4A 2I2OA 5AARA 2WMOA 2IONA 4BEPA 4DJAA 2GRMA 3L16A 3IXEA 2KCKA 1PY1A 2IO3C 1LF8A 4L2LA 5LFAA 3FU3A 3BUAA 3ZVVA 3LY8A 5CCLA 1PC2A 2I1KA 5FINA 3V2OA 5EIDA 1Z3XA 4ATGA 4HB5A 2DCPA 2WXOA 1A5EA 2C2LA 3PZDA 2J08A 2F8XK 2MRIA 3APFA 4BX9A 3GZ1A 3RIBA 3AJIA 1E8WA 2P9PG 2L6BA 2BF0X 3CHPA 3SFXA 1EYHA 1DC2A 5ENNA 1V54E 2AVPA 1HG5A 3AS4A 1JPLA 4U0ZA 3ZU7B 4LCTA 2DBAA 3SBTB 3LXUX 5G04J 1WDYA 2A5UA 4DPRA 5G2NA 3NBNB 5HKPA 5A7DB 2WM9A 1V55E 3V31A 4C9BB 3D9PA 4I6EA 1FT1A 3D9NA 4LNBA 3RJVA 2HM8A 3SI5A 4AP2A 4N2QA 4C0MA 3ZYKA 1Y6IA 3HXBA 2KZTA 3V2XA 5ENPD 4UI9C 2VGXA 2EIME 3Q75A 2FEZA 1SZAA 3IHYA 4IRUA 3U3WA 2WXLA 4G26A 4ANWA 3P2BA 4EHMA 1GW6A 3TWTA 4XEIG 4APFA 1HO8A 4GYWA 3JXJA 3Q78A 1E8XA 1TNZA 4GZDA 2IOLA 3OAWA 3JXIA 1TEZA 4RVBA 2KC7A 5CBOA 1WG0A 4F7AA 2LUHA 1K1BA 4F53A 2XPIA 1A17A 4HFGA 4G2VA 3DSXA 2B6CA 5DBKA 3WG7E 1JWGA 4F6RD 5IY5E 1NL4A 3BU8A 2VSNA 3LYAA 4G23A 4U63A 4YDOA 3QKYA 3FH8A 3L22A 1OWOA 2P9SG 2XGOA 4FA6A
chains in the Genus database with same CATH topology
2VTBA 3U4TA 5E76A 2WVIA 3MKRA 1OWPA 4IULA 5BPPA 1TJCA 4ANVA 3RK6A 3ZIMA 5FQ6A 2WMNA 4A55A 2WXGA 4YNDA 2E0IA 2V0PA 2GW1A 3CQGB 4K0RA 5G05C 3ZHEB 5BNWA 3U9WA 4NACA 2HYZA 3KD7A 4LRZA 1QQEA 2X38A 4UQZA 2PQRA 2AWIA 2XQ0A 3CVLA 2NSZA 3LS8A 2X6FA 2LSUA 3QOUA 4V3IA 3FEXA 4I2WA 1HF8A 1DVPA 3DPDA 3AU5A 2ONDA 3ONKA 1H19A 4UQXA 3GZSA 3MYVA 1HG2A 3FTXA 5ARGA 5ANRA 3FTUA 4GU5A 2V4LA 4HS2A 1WAO1 4BX8A 1SZ9A 2FI7A 2X6KA 4JW1A 4ILHB 2BTDA 5AIJA 3PH0C 4WNGA 5FT9A 4PUCA 1U3DA 4GZ3A 4WWPA 2C0MA 3IEGA 2RD0A 2AXVA 1N54A 3TXMA 3ONLA 3P1UA 3PNTB 4KZ0A 1ZBPA 2L0IA 3QC1A 4HOTA 4WUYA 3TAXA 3UT8A 4CRWA 3PUKA 3FUNA 4WNDA 3ESKA 4UQYA 4K03A 3MJWA 3T5VA 1S0PA 2XGMA 4AV7A 2R59A 4PS8A 3G2WA 4WWNA 4ACKA 4CT0A 3SGHA 2J4DA 3MKQB 5J90A 5KCMA 5FQ8A 2AW6A 4N3CA 1Z3YA 3G2TA 1UN8A 3PEUB 1IYGA 3SBSA 2NC9A 2BUGA 3ENEA 4KMOA 1JWFA 4PS7A 1H6KA 2EQXA 3CV0A 4GZCA 3TJPA 3S7BA 2GGFA 2PM7A 5LX8A 2WB2A 3LPZA 2HO1A 1OUVA 2UY1B 4GYYA 4CDRA 5JHAA 3B13A 3FTZA 1SQMA 3CK7A 4GA2A 2PQNA 4FLBA 3CLJA 4FJYA 4GZ6A 4MRUA 4N5CA 4TRQA 4AXHA 3SD5A 3LJ3A 3EJNA 3FUKA 4I17A 4AVXA 4LEUA 3HIZA 5D0OD 4JPSA 2J49A 4AEZC 2VQ2A 3APDA 3CHQA 1IQRA 4A3VA 2WQHA 4I9CA 4URKA 3FUFA 2Q7FA 4J8EA 3QJZA 3G2VA 3B7RL 4JEHA 2I1JA 3CVPA 3L54A 3QARA 3ZYLA 4ANXA 5JHBA 4BWRA 4HOUA 5FTPA 3EIJA 4KXKB 2YNQA 4UWLA 3URZA 4CDMA 4U0UA 4JHJA 2P58C 4WWOA 4D10C 1E7VA 3RO2A 3D9KA 3QNKA 4H7YA 4JZYA 4Q94A 2WQ6A 4CDNA 3JUIA 4E85A 3D9OA 4JL0A 5AENA 3FY4A 4BFRA 3CR3A 3Q4AB 2WPVA 4GA1A 4G24A 4KZCA 3SF4A 3LY9A 2XPZA 2XEVA 3OXFA 2YINA 3PE3A 4I2ZA 4R7LA 5FZSA 4Q96A 3SFZA 4C0EA 2L0TB 3NZUA 4BSXA 2UWJG 4FULA 2PL2A 3UT7A 3ASDA 4CT4A 4PH4B 4EZLA 4JA9A 1IQUA 2CHWA 3CGHA 4FHKA 3VTXA 2YHEA 4PDXA 2RG8A 4B8CB 2VGXB 1INZA 2CHZA 3FHEA 1FVHA 5T3RA 1BPOA 4KVOA 3T8MA 3I5PA 2I6HA 3NZSA 4CEMA 1VDYA 3PUJA 4EECA 1HFAA 1H2UA 5LCWJ 2WXRA 3PDNA 5FZRA 3S7JA 3VTYA 3LVRE 1HX8A 4HXIA 4IYPA 1ELKA 2VSOE 3S2AA 3CVUA 4HOSA 4NRHB 4LERA 2MOWA 3MCXA 1H2TC 2ZU6B 1EPUA 3S7DA 1X5BA 3FTYA 1ZU2A 4FC8A 1E96B 1FVFA 1HXIA 5AJLA 3ZFWA 4UI9K 2Y4TA 2XRZA 2JEKA 4F3VA 2KATA 3AS8A 3FDHA 3OTNA 3KEZA 4OVVA 1KT1A 4G11A 2DIWA 2FBNA 3CKCA 4DLQA 4XIFA 5FQ4A 2XCCA 3FUDA 4GMJA 5JJ7A 3FWVA 2IJGX 1NZNA 2OOEA 4FJZA 1L5JA 3MGBA 4E6HA 5CCMA 4OVUA 3CHOA 3R7RA 3LCAA 4P29A 1KT0A 4DI4A 3FP3A 4G1TA 3RRMB 2KM4A 3JCKC 3GZ2A 1Z6TA 1XGWA 5AYWD 2KZTB 3OXGA 3LEWA 5LP0A 4L23A 3Q15A 3N71A 2YQ8A 4I1OB 4MKTA 4TUUA 4JEUA 4JA7A 3IKOB 5DIZA 2VGYA 3CVXA 2FF4A 3BEEA 3MKQA 3QWWA 3G2UA 2XCBA 2J4BA 5T4YA 4BT9A 2KCLA 5FJYA 3MV2B 4AM9A 1E90A 4J8DA 4A1GA 4Y6WA 5EKQD 1MHQA 3UPVA 2YHCA 2WQ7A 4AY6A 4B94A 5A23A 1WY6A 4ILGA 3NF1A 2OVBA 2V5FA 2WXHA 3FTVA 5BT1A 3EDTB 1OWLA 3ML8A 2J9QA 4EQFA 4JVSA 1UG3A 3B7TA 1PAQA 4XKCA 3PREA 2XRYA 2WXFA 2IU1A 5FWQA 2CG2A 2L6JA 2VSXE 3LKUA 5FZQA 3ZGQA 5LOZA 4WNEA 2QY7A 2Y3AA 2XHEA 3FTSA 1NA3A 5BV1A 5EDSA 2X6JA 1JUQA 4GMLA 3L13A 4L1BA 3D9MA 3WXXA 5ANLA 3VLEA 4UWFA 2LSVA 3FTWA 4KBQA 4BT8A 4J6IA 3FU6A 1HS6A 5M72A 5EX0A 1TJFA 3FU5A 3LY7A 3CHRA 4BY6A 2Y4UA 4I6JA 3CVYA 4JHRA 3U66A 2XGSA 3FH5A 3ZEFA 3AS5A 3JQ1A 4GAAA 1H2VC 4N3BA 3CK8A 3NQPA 4GCNA 4FADA 3ZXSA 1ELWA 1HE8A 4AY5A 1UJJA 4RG9A 4N2SA 3AU4A 3BG0B 3O48A 3CKBA 3JQ0A 5C2YA 3UX4A 2VTBB 4XKBA 4YVOA 3FU0A 4HLEA 4XE0A 3BG1B 4J0UA 2R17C 4N3AA 2CG3A 2IF4A 2A4ZA 1MQSA 2C0LA 3ZHEA 4CGWA 4GCOA 5G04C 3EHNA 2X6HA 4U07A 2FULA 4HVBA 5EX3A 3QDNA 1ELRA 2WXQA 3PVLA 5BW8C 2VYIA 3FUEA 4IN3B 2J09A 4ILIA 3CVNA 3CVVA 4F1SA 5FQ7A 5C1DA 4XZ4A 1H0AA 4NQ0A 4N39A 3HVEA 3PNLB 2WXPA 3RRNB 4YVQC 3PS6A 3JYSA 3CSFA 4FU3A 4APOA 1NP7A 3IHVA 2UY1A 1QNFA 4GZ5A 4W9RA 2HR2A 4H7XA 1UW4B 5CMWA 4GPKA 2WXJA 3SHFA 1FCHA 3CHSA 5D0QD 1N52A 4JC8A 3TL5A 4I1AA 3TG5A 4L2YA 5G55A 3TG4A 3ULQA 2I2OA 3L08A 3CVWA 4FP7A 2NXPA 2WMOA 3IV0A 3EIQC 4J8FA 3QWVA 4GYOA 4EBAA 5KJMA 2IONA 3I3NA 4L7TA 4CGVA 4DJAA 2GRMA 3L16A 1HU3A 4ANUA 2KCKA 1E8ZA 3Q5MA 1PY1A 3CHMA 5KJKA 4ABNA 2JLBA 1LF8A 4L2LA 3ASHA 2WXNA 4FHJA 5LFAA 3CVQA 2XPYA 3FU3A 3TXNA 1NA0A 1OWNA 3ZVVA 3LY8A 4UWHA 1OWMA 5CCLA 4JXTA 1PC2A 3EHMA 2I1KA 2LO6A 1EF1C 2VSYA 1Z3XA 4WAFA 3D3MA 4QFVA 1DNPA 4ATGA 3R7QA 4M3OA 2DCPA 2WXOA 1KLXA 3TGOA 2C2LA 5HQ8A 5JJTA 4PS3A 3ESLA 5E75A 3T5XA 5JJ6A 3R9AB 3PZDA 2J08A 4MS6A 3APCA 3B7UX 3IBEA 1QZ2A 3B7SA 4EPZA 2X6IA 3MX3A 3MZLB 2GRLA 4U04A 4Q69A 4LUNU 3MEKA 4U0SA 2MRIA 2WXIA 5BV0A 4I43A 3APFA 3SNXA 1IHGA 5A6CA 3RU0A 4FLHA 5AJDA 4BX9A 3GZ1A 3RIBA 1E8WA 2BF0X 2CHXA 3CHPA 3DBSA 1EYHA 2PZIA 1Y8MA 5ENNA 2LAHA 2WXKA 2AVPA 3I4RB 1HG5A 1E8YA 3AS4A 4U8HA 1JPLA 2VJ8A 4U0ZA 4KT6B 4Y6CA 4A3TA 4G25A 2AXUA 4O6FA 1B89A 4LCTA 3PEVB 2IFUA 1YA0A 2KCVA 2DBAA 3SBTB 4B0ZA 3LXUX 5G04J 3E4BA 3QWPA 3O4ZA 3QK0A 5CMYA 2A5UA 5CHEE 4DPRA 2IOSA 3QB2A 5G2NA 3GYZA 3FH7A 2IQCA 3C98A 5A7DB 2WM9A 3FFLA 4EBAG 4GA0A 2X3MA 3ASFA 4C9BB 3ZRHA 4RSYA 4UI9J 3D9PA 4OYSA 4I6EA 3D9NA 3CQCB 3I4GA 3RJVA 2HM8A 3VLFA 3ML9A 3ASGA 4I6GA 3FUHA 3SI5A 4EZJA 4AP2A 4N2QA 3LVQE 4C0MA 5LCWC 2M63A 3UT4A 4DI3A 5G05J 4ACLA 1P5QA 3RRUA 3ZYKA 4HOQA 1WM5A 1Y6IA 3Q47B 1XNFA 4B8AA 3KS2A 2KZTA 3G2SA 3HYMB 3KAEA 4UI9C 2V8SE 2VGXA 3OXLA 1UN9A 3CK9A 4RG6A 3D9IA 3Q49B 3ZYMA 4AIFA 4GB9A 4BTBA 4DLOA 2FEZA 4UWGA 4BTAA 1SZAA 2CFUA 4DK5A 2R5SA 4I9EA 5KJNA 3PRZA 4XX5A 3IHYA 3CEQA 4IRUA 3VLDA 2WXLA 4G26A 1EDUA 5HI7A 3U3WA 2I9CA 4UWKA 4KYOB 4ANWA 2WXMA 2L9BA 3P2BA 3LDZA 2LAIA 3HVEB 1GW6A 3MV3B 4A1SA 3K9IA 4I1MA 4APFA 1HO8A 4GYWA 5T8IA 2MHKA 2OVFA 1E8XA 4GZDA 3UQ3A 2IOLA 1HH8A 4B89A 1U3CA 2AXZA 3CSTA 2J07A 3OAWA 1W3BA 2OV8A 2KC7A 4RVBA 4AJWA 3HDXA 1UJKA 2CFZA 1TEZA 4HORA 4AOFA 4F7AA 3RO3A 2LNIA 3ZW3A 3MA5A 3FULA 4F53A 5KJLA 2PM6A 4J8SA 3ZPJA 2XPIA 1A17A 4HFGA 3PE4A 3FUJA 5ARFA 4G2VA 3UUXA 5DBKA 3S7FA 4MLPA 1JWGA 5J08A 2E2EA 3QAQA 4CCAA 3L6AA 4XI0A 3RKVA 3UMVA 2VSNA 2ILRA 3LYAA 3GW4A 4G23A 4JHKA 2QFCA 1HZ4A 4U63A 3CIAA 3SZ7A 1E7UA 3QKYA 5BUZA 3FEYA 3HHMA 3FH8A 3FUIA 3L17A 4KVMA 4ME2A 4NURA 4TV3A 4XI9A 3D9LA 2FO7A 3ZN3A 3U64A 3ZYQA 3L22A 4EZKA 1OWOA 3FUMA 4WNFA 2XGOA 4FA6A 3D9JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GZ1 A;  5M72 A;  5EX0 A;  3U4T A;  3RIB A;  3MKR A;  3LY7 A;  1TJC A;  4JL0 A;  2Y4U A;  4JHR A;  2PZI A;  1Y8M A;  2XGS A;  3AS5 A;  4YND A;  2AVP A;  3Q4A B;  2WPV A;  4GA1 A;  2GW1 A;  3AS4 A;  4G24 A;  4N3B A;  5G05 C;  3ZHE B;  4U0Z A;  4Y6C A;  3SF4 A;  5BNW A;  3CK8 A;  4G25 A;  4GCN A;  2HYZ A;  1B89 A;  3KD7 A;  3LY9 A;  1ELW A;  2IFU A;  1QQE A;  2XEV A;  1YA0 A;  3OXF A;  3PE3 A;  4I2Z A;  2KCV A;  4UQZ A;  5FZS A;  2DBA A;  2PQR A;  3RU0 A;  5G04 J;  4AY5 A;  3E4B A;  4RG9 A;  3QWP A;  4N2S A;  3CVL A;  5CHE E;  2LSU A;  3QOU A;  2UWJ G;  3O48 A;  3CKB A;  3GYZ A;  4I2W A;  2PL2 A;  4YVO A;  3ASD A;  5A7D B;  3FFL A;  4JA9 A;  4GA0 A;  3VTX A;  3ASF A;  2OND A;  4UQX A;  4J0U A;  2VGX B;  4O6F A;  4N3A A;  5ARG A;  4UI9 J;  2IF4 A;  5DIZ A;  1WAO 1;  2C0L A;  3RJV A;  3ZHE A;  4CGW A;  4GCO A;  3ASG A;  2FI7 A;  5G04 C;  4U07 A;  2I6H A;  5EX3 A;  3QDN A;  4N2Q A;  1ELR A;  5BW8 C;  5FT9 A;  2VYI A;  4IN3 B;  4WNG A;  5LCW J;  5LCW C;  4GZ3 A;  3PDN A;  5FZR A;  3S7J A;  3VTY A;  3CVN A;  2C0M A;  5G05 J;  3IEG A;  1P5Q A;  5C1D A;  4HOS A;  4HOQ A;  4NRH B;  1WM5 A;  4NQ0 A;  3Q47 B;  4N39 A;  1XNF A;  1ZBP A;  3S7D A;  4HOT A;  3KS2 A;  1ZU2 A;  1E96 B;  4WUY A;  4YVQ C;  3TAX A;  1HXI A;  3HYM B;  3KAE A;  3JYS A;  4UI9 K;  4UI9 C;  3ESK A;  4WND A;  2VGX A;  2Y4T A;  3OXL A;  4UQY A;  3CK9 A;  3ZFW A;  4F3V A;  2KAT A;  3AS8 A;  2XGM A;  3Q49 B;  4H7Y A;  4RG6 A;  4AIF A;  4APO A;  1KT1 A;  2FBN A;  2UY1 A;  3CKC A;  2FEZ A;  4GZ5 A;  4W9R A;  2HR2 A;  4H7X A;  4XIF A;  4BTB A;  2XCC A;  4GPK A;  5JJ7 A;  4BTA A;  3FWV A;  1FCH A;  1NZN A;  2OOE A;  2R5S A;  4I9E A;  4N3C A;  5KJN A;  5D0Q D;  5CCM A;  3CEQ A;  3LCA A;  3U3W A;  4G26 A;  4I1A A;  3TG5 A;  5HI7 A;  3TG4 A;  3ULQ A;  1KT0 A;  1IYG A;  3FP3 A;  4G1T A;  4KYO B;  5AYW D;  3GZ2 A;  2NC9 A;  3MV3 B;  3OXG A;  3K9I A;  2BUG A;  4J8F A;  3QWV A;  4GYO A;  4A1S A;  4GYW A;  5KJM A;  3Q15 A;  3N71 A;  2YQ8 A;  4CGV A;  3CV0 A;  2MHK A;  3UQ3 A;  3S7B A;  1HH8 A;  4JA7 A;  2KCK A;  3Q5M A;  2VGY A;  3LPZ A;  2HO1 A;  1OUV A;  2UY1 B;  2FF4 A;  1W3B A;  3BEE A;  2KC7 A;  4GYY A;  2JLB A;  3QWW A;  4ABN A;  4CDR A;  5KJK A;  2XCB A;  3ASH A;  4BT9 A;  4HOR A;  2KCL A;  3CK7 A;  4GA2 A;  5FJY A;  2PQN A;  2LNI A;  3CVQ A;  3MV2 B;  3RO3 A;  4AM9 A;  4GZ6 A;  4J8D A;  1NA0 A;  3MA5 A;  4N5C A;  4Y6W A;  3LY8 A;  5EKQ D;  5KJL A;  5CCL A;  3ZPJ A;  1PC2 A;  2XPI A;  2YHC A;  1A17 A;  3UPV A;  4B94 A;  4AY6 A;  3PE4 A;  4I17 A;  5ARF A;  2VSY A;  3NF1 A;  4G2V A;  3UUX A;  2V5F A;  4LEU A;  5D0O D;  5DBK A;  3S7F A;  3EDT B;  5BT1 A;  4EQF A;  2J9Q A;  2VQ2 A;  3TGO A;  2E2E A;  1KLX A;  2WQH A;  2C2L A;  5HQ8 A;  4I9C A;  4XI0 A;  5JJT A;  3RKV A;  2Q7F A;  4BT8 A;  4J8E A;  2VSN A;  3LYA A;  5JJ6 A;  3R9A B;  2L6J A;  3GW4 A;  3LKU A;  2QFC A;  1HZ4 A;  4G23 A;  5FZQ A;  3CVP A;  3ZGQ A;  4WNE A;  3SZ7 A;  1QZ2 A;  1NA3 A;  3QKY A;  4XI9 A;  4U04 A;  4HOU A;  4ME2 A;  4BWR A;  5FTP A;  2FO7 A;  4KXK B;  3ZN3 A;  3MEK A;  4U0S A;  3URZ A;  4U0U A;  2P58 C;  3WXX A;  5A6C A;  1IHG A;  3RO2 A;  4WNF A;  2LSV A;  4KBQ A;  2XGO A; 
#chains in the Genus database with same CATH topology
 1OWP A;  2HE0 A;  4A55 A;  3ZHE B;  1N0R A;  3ASN E;  2X38 A;  2NSZ A;  3LS8 A;  2LSU A;  4I2W A;  4O60 A;  2EIL E;  2OND A;  3FTX A;  2ETC A;  3FTU A;  4HS2 A;  1BD8 A;  3PH0 C;  4PUC A;  1U3D A;  3IEG A;  2AXV A;  3TXM A;  3ONL A;  3P1U A;  4GTM A;  3UT8 A;  4G8K A;  4CRW A;  4WND A;  2EIK E;  4WWN A;  4CT0 A;  5ENT D;  1BI8 B;  2AW6 A;  1Z3Y A;  2BKK B;  3G2T A;  1D9S A;  3E34 A;  3HG0 D;  3HXF A;  2WB2 A;  2UY1 B;  5JHA A;  4GA2 A;  2EIN E;  4OAU C;  3DRA A;  2R02 A;  4I17 A;  2H6H A;  5EN5 D;  2VQ2 A;  3APD A;  1IQR A;  2WQH A;  4J8E A;  3QJZ A;  3QAR A;  3HXD A;  4KXK B;  3F6Q A;  3EU9 A;  4H7Y A;  4E85 A;  3FY4 A;  4BFR A;  3SF4 A;  2XPZ A;  5LX8 A;  2YIN A;  3PE3 A;  2DYS E;  3NAW A;  4YDE A;  2YHE A;  2RG8 A;  3PZ4 A;  4B8C B;  2F8Y A;  1FVH A;  3NZS A;  3PUJ A;  5LCW J;  3PDN A;  5FZR A;  4IYP A;  3CVU A;  5AN8 A;  2MOW A;  3MCX A;  1H2T C;  3S7D A;  3FTY A;  5ENR D;  1FVF A;  2KAT A;  3FDH A;  1KT1 A;  2DIW A;  2FBN A;  5FQ4 A;  4GMJ A;  1G3N B;  2ZIS A;  3CHO A;  4HBD A;  3OXG A;  3LEW A;  3TWQ A;  4TUU A;  4JA7 A;  3UKR G;  1BI7 B;  3MKQ A;  1KZO A;  4U8V D;  3B7B A;  2YHC A;  1Z5S C;  2V5F A;  2WXH A;  1OWL A;  3B7T A;  2VSX E;  1FPP A;  5LOZ A;  4WNE A;  2QY7 A;  2XHE A;  3FTS A;  5BV1 A;  5EDS A;  4GML A;  1X81 A;  4KBQ A;  1HS6 A;  5M72 A;  5EX0 A;  4DX5 D;  4I6J A;  2NYJ A;  3E33 A;  4A63 B;  2XS1 A;  3NQP A;  1HE8 A;  3AU4 A;  3JQ0 A;  3UX4 A;  4HLE A;  4HI8 A;  3ISM C;  4N3A A;  1IHB A;  1ELR A;  2ZXW E;  3HVE A;  3CSF A;  4APO A;  2F0Y A;  2P9K G;  1UW4 B;  3SHF A;  1N52 A;  3ULQ A;  5KNG A;  5KNH D;  3CVW A;  3DPY A;  4FP7 A;  3IV0 A;  4J8F A;  3QWV A;  4GYO A;  4L7T A;  4CGV A;  1HU3 A;  4ABN A;  2WXN A;  4FHJ A;  2ZGG A;  1OWM A;  3E30 A;  4QQI A;  2J8S D;  4WAF A;  5CBN A;  1KLX A;  3ESL A;  5JJ6 A;  3R9A B;  4LNG A;  2H6I A;  4EPZ A;  3B7U X;  4LUN U;  3D9H A;  3Q79 A;  2BED A;  5BV0 A;  4I43 A;  3SNX A;  1IHG A;  4L9P A;  4HNA D;  2LXL A;  3E32 A;  2B0O E;  1O1T A;  3DBS A;  2VGE A;  1N4Q A;  4KT6 B;  1K3Z D;  1U2V G;  3C3O A;  3PEV B;  2BKG A;  4B0Z A;  3E4B A;  4LSZ E;  3QK0 A;  5CHE E;  3QB2 A;  2IQC A;  4BES A;  3C98 A;  3FFL A;  3DST A;  4GA0 A;  3ASF A;  3ZRH A;  4RSY A;  2GRN B;  3CQC B;  2RFM A;  3FUH A;  3V79 K;  4O1P A;  4NIK A;  4DI3 A;  1XNF A;  2V8S E;  3CK9 A;  4N5Q A;  4OAV B;  4BTA A;  4K5C A;  1OCC E;  1AP7 A;  4XX5 A;  4HRL A;  3CEQ A;  1DCQ A;  2R2L A;  4UWK A;  2WXM A;  2P9U G;  2LAI A;  5D66 A;  3ASO E;  1U3C A;  2J07 A;  5B3S E;  4AJW A;  3UTM A;  1ZB1 A;  1UOH A;  3MA5 A;  3C72 A;  5KJL A;  2RFA A;  4TUM A;  3ZPJ A;  3W9G A;  3PE4 A;  3FUJ A;  2KBX A;  5ARF A;  3QAQ A;  3L6A A;  4XI0 A;  4C48 B;  3RKV A;  3UMV A;  4JHK A;  1HZ4 A;  3CIA A;  3SZ7 A;  1E7U A;  4KVM A;  3FUI A;  4NUR A;  4XI9 A;  3UKU G;  5ENO D;  2PNN A;  1D8D A;  3ZKJ A;  5E76 A;  5BPP A;  1TJC A;  4ANV A;  3ZIM A;  2WMN A;  4YND A;  3CQG B;  4K0R A;  3KD7 A;  1OY3 D;  1QQE A;  4UQZ A;  2XQ0 A;  3C3Q A;  3QOU A;  1HF8 A;  1DVP A;  5ENQ D;  5ANR A;  4GU5 A;  4BX8 A;  1SZ9 A;  2FI7 A;  4JW1 A;  1MX4 A;  2AJA A;  2BTD A;  4LNU D;  5FT9 A;  3L82 A;  3AG4 E;  2C0M A;  2RD0 A;  3AAA C;  4KZ0 A;  2L0I A;  4WUY A;  3TAX A;  3PUK A;  4K03 A;  3T5V A;  1S0P A;  4AV7 A;  2R59 A;  4PS8 A;  2J4D A;  3MKQ B;  2F37 A;  1BLX B;  5KCM A;  2XEH A;  4N3C A;  5B1A E;  4DX2 A;  4TXP A;  1TN7 A;  3ENE A;  1JWF A;  4MBG A;  3CV0 A;  4GZC A;  1TN8 A;  2GGF A;  1OUV A;  4CDR A;  4ZFH A;  4RLY A;  4FLB A;  4MRU A;  4TRQ A;  2XEE A;  2OEV A;  4AXH A;  3SD5 A;  3LJ3 A;  3EJN A;  3FUK A;  4AVX A;  4LEU A;  4A3V A;  4TXQ A;  4URK A;  3FUF A;  3CVP A;  3L54 A;  4BWR A;  4HOU A;  4CDM A;  4JHJ A;  3QNK A;  2WQ6 A;  3DEP A;  1BU9 A;  4G24 A;  2XEV A;  4R7L A;  4C0E A;  4BSX A;  2UWJ G;  2PL2 A;  3UT7 A;  4PH4 B;  4JA9 A;  2CHW A;  4FHK A;  3VTX A;  2VGX B;  3EUV A;  1BPO A;  3T8M A;  3I5P A;  5CEC B;  1VDY A;  3VTY A;  3S2A A;  2VSO E;  4NRH B;  2ZU6 B;  1E96 B;  2EIJ E;  2JEK A;  4OVV A;  3KEZ A;  4G11 A;  3Q7A A;  2XCC A;  4GMR A;  5JJ7 A;  2IJG X;  4FJZ A;  3UIN C;  4E6H A;  3R7R A;  3LCA A;  3FP3 A;  2P9N G;  5LP0 A;  2YQ8 A;  4MKT A;  3IKO B;  2VGY A;  1SW6 A;  2KCL A;  3DEO A;  3MV2 B;  4AM9 A;  5AQB A;  4J8D A;  5EKQ D;  1MHQ A;  4B94 A;  5A23 A;  4ILG A;  5CRU A;  1KPS B;  3W9F A;  5CER B;  3PRE A;  2XRY A;  2WXF A;  4GTV A;  2CG2 A;  1NA3 A;  2X6J A;  1YMP A;  5BXU A;  3WXX A;  4K5B A;  4UWF A;  3Q73 A;  4J6I A;  3TWV A;  4BY6 A;  2Y4U A;  3CVY A;  3U66 A;  1DCE A;  3FH5 A;  4GAA A;  3CK8 A;  4GCN A;  3ZXS A;  1OXJ A;  1UJJ A;  4JB8 P;  3CKB A;  2RKK A;  5D2M C;  3SFY A;  2R17 C;  2A4Z A;  4CGW A;  4GCO A;  5G04 C;  2X6H A;  4U07 A;  2FUL A;  5JA4 D;  2WXQ A;  4BET A;  2VYI A;  4DX7 D;  5FQ7 A;  5C1D A;  3RRN B;  4YVQ C;  5HS0 A;  3C3R A;  1RZ4 A;  1NP7 A;  4GZ5 A;  1QNF A;  4W9R A;  1FCH A;  4JC8 A;  4I1A A;  4L2Y A;  4Z68 A;  1TR4 A;  4BSZ B;  1TNY A;  1TYQ G;  4EBA A;  2DWZ A;  3BQO A;  3I3N A;  3DXM G;  2GRO B;  4ANU A;  3UM2 A;  3ASH A;  3CVQ A;  1OWN A;  2ZIR A;  3NOC D;  2LO6 A;  2XZT G;  1EF1 C;  2VSY A;  4QFV A;  4TXR A;  3V30 A;  1DNP A;  3DWL G;  4M3O A;  4UUC A;  5CRV A;  5E75 A;  5FIO A;  3T5X A;  2X6I A;  4Q69 A;  2GRL A;  1TN6 A;  4U0S A;  2WXI A;  4HI9 A;  5A6C A;  3RU0 A;  5AJD A;  1YCS B;  1N95 A;  2CHX A;  4RQI A;  2WXK A;  3I4R B;  1E8Y A;  4Y6C A;  3B95 A;  4O6F A;  2IFU A;  1YA0 A;  2KCV A;  3QWP A;  3O4Z A;  4GTR A;  5CMY A;  3GYZ A;  3FH7 A;  5KBA A;  2X3M A;  4UI9 J;  3I4G A;  3VLF A;  2IEJ A;  3ASG A;  4I6G A;  4EZJ A;  1SA4 A;  5LCW C;  2M63 A;  4ATZ D;  5G05 J;  4ACL A;  1P5Q A;  1H6P A;  3RRU A;  3Q47 B;  1JCS A;  3KS2 A;  3HYM B;  3OXL A;  4RG6 A;  3D9I A;  3Q49 B;  4BTB A;  4UWG A;  2CFU A;  5ENS D;  1LD7 A;  1EDU A;  5HI7 A;  2I9C A;  3LDZ A;  2FO1 E;  4A1S A;  3K9I A;  4I1M A;  5T8I A;  2MHK A;  2OVF A;  4YDW A;  3UQ3 A;  1HH8 A;  2AXZ A;  2QZA A;  1W3B A;  1UJK A;  4HOR A;  2DYR E;  3FUL A;  2PM6 A;  1K8K G;  4MLP A;  4CCA A;  5AQ9 A;  2ILR A;  3HHM A;  2ETB A;  4TV3 A;  3D9L A;  3ZN3 A;  3ZYQ A;  4GTQ A;  3FUM A;  4WNF A;  3D9J A;  2VTB A;  2DZO A;  3UI2 A;  3RK6 A;  5FQ6 A;  2E0I A;  5G05 C;  3U9W A;  4NAC A;  2AWI A;  3CVL A;  2X6F A;  4V3I A;  4UQX A;  3C5R A;  1WAO 1;  4B93 B;  4ILH B;  5AIJ A;  1IKN D;  4WWP A;  5KWD A;  3UXG A;  3EHR A;  3KSQ A;  1ZBP A;  3QC1 A;  3ESK A;  1N94 A;  1OCO E;  2MYO A;  4UQY A;  5ITZ F;  3EU5 A;  2QYJ A;  4HQD A;  3ABK E;  1QBQ A;  5J90 A;  4U96 D;  1UN8 A;  3PEU B;  3Q9U C;  2JAB A;  2NC9 A;  2BUG A;  4KMO A;  2V5Q C;  2ETA A;  3TJP A;  1H6K A;  4PS7 A;  3S7B A;  3LPZ A;  2HO1 A;  2H6G A;  1SQM A;  2DVW A;  3CK7 A;  2PQN A;  4GZ6 A;  5BXO A;  1Q2Z A;  5AAO A;  3T9K A;  1SA5 A;  3HIZ A;  1O5M A;  4JPS A;  4AEZ C;  4I9C A;  2Q7F A;  3G2V A;  4JEH A;  2I1J A;  3ZYL A;  1H6O A;  4ANX A;  5JHB A;  5FTP A;  2YNQ A;  4UWL A;  3URZ A;  4WWO A;  4D10 C;  3RO2 A;  2P9L G;  2V4H C;  3D9O A;  1S70 B;  4ZHB A;  3Q4A B;  4KZC A;  3LY9 A;  3OXF A;  5FZS A;  3SFZ A;  2L0T B;  4DRX E;  3X2Q E;  3KSL A;  2GRP B;  3ASD A;  4CT4 A;  4EZL A;  3CGH A;  4PDX A;  1S64 A;  3AG1 E;  1INZ A;  2QC9 A;  5T3R A;  4KVO A;  1H2U A;  3LVR E;  4HXI A;  2GRR B;  3ABL E;  1EPU A;  1ZU2 A;  1HXI A;  5AJL A;  3ZFW A;  3PZ3 A;  2Y4T A;  3OTN A;  2ZGD A;  4XIF A;  3FUD A;  1NZN A;  4U8Y D;  4P29 A;  1KT0 A;  4DI4 A;  2KM4 A;  1XGW A;  2KZT B;  3N71 A;  4I1O B;  4CYM D;  4JEU A;  3CVX A;  3J5P A;  3G2U A;  2XCB A;  4BT9 A;  4A1G A;  4Y6W A;  3UPV A;  1WY6 A;  3PZ1 A;  3FTV A;  3EDT B;  4EQF A;  4JVS A;  1PAQ A;  4CZ2 D;  4XKC A;  4GTO A;  2IU1 A;  5CED B;  5FWQ A;  3ZGQ A;  5EIB E;  4L1B A;  2LSV A;  3FU6 A;  3TWX A;  1TJF A;  3FU5 A;  4M7C A;  1O1R A;  3PZ2 A;  4JHR A;  1JCR A;  3AS5 A;  1H2V C;  4N3B A;  4HLL A;  4N2S A;  3T8K A;  2VTB B;  4O1O A;  4XE0 A;  4J0U A;  2CG3 A;  2Y69 E;  5AQA A;  3ZHE A;  3J5Q B;  3EHN A;  4HVB A;  3SO8 A;  4GTS A;  5BW8 C;  4IN3 B;  2J09 A;  3CVN A;  1H0A A;  4NQ0 A;  1YYH A;  1SVX A;  2WXP A;  3JYS A;  5EYL A;  4FU3 A;  1RW2 A;  5CMW A;  4GPK A;  3NB2 A;  5D0Q D;  2A5E A;  3TL5 A;  3TG5 A;  5G55 A;  3L08 A;  2NXP A;  3EIQ C;  5KJM A;  1FT2 A;  1E8Z A;  3Q5M A;  3CHM A;  3UM3 A;  5KJK A;  2JLB A;  2XPY A;  3SY2 A;  3TXN A;  1NA0 A;  5CEA A;  4UWH A;  1LTX A;  4JXT A;  3EHM A;  3UIO C;  2P2C P;  3D3M A;  3JUE A;  3R7Q A;  3TGO A;  5HQ8 A;  5JJT A;  4PS3 A;  2IY0 C;  3DSU A;  3HXC A;  4MS6 A;  3APC A;  3IBE A;  1QZ2 A;  3B7S A;  3MX3 A;  3MZL B;  4U04 A;  3E37 A;  3MEK A;  4FLH A;  2PZI A;  1Y8M A;  2LAH A;  4U8H A;  2VJ8 A;  4A3T A;  1MJ0 A;  4G25 A;  2AXU A;  1B89 A;  4GTP A;  4JD2 G;  4G8L A;  1NI1 A;  3ULY A;  2IOS A;  4EBA G;  4OYS A;  2GRQ B;  3ML9 A;  1N11 A;  3LVQ E;  3UT4 A;  4HOQ A;  1WM5 A;  4B8A A;  3Q9N C;  3HRA A;  3G2S A;  3KAE A;  1OCZ E;  3NOG D;  3TWU A;  3ZUV B;  1D8E A;  1UN9 A;  1OCR E;  3ZYM A;  4AIF A;  4GB9 A;  4DLO A;  2KXP C;  4DK5 A;  2R5S A;  4I9E A;  5KJN A;  3PRZ A;  3VLD A;  4KYO B;  2L9B A;  3HVE B;  1MX2 A;  1MX6 A;  3MV3 B;  3L9T A;  4DX1 A;  3SQV A;  4B89 A;  3TWS A;  5JMN D;  1TNO A;  3CST A;  2OV8 A;  3HDX A;  2CFZ A;  2R05 A;  4AOF A;  3RO3 A;  2LNI A;  3DSS A;  3RSE G;  3ZW3 A;  4J8S A;  1LD8 A;  3UUX A;  1N4S A;  2H6F A;  3S7F A;  5J08 A;  4DX6 D;  1MYO A;  2E2E A;  3GW4 A;  2QFC A;  5BUZ A;  3FEY A;  3L17 A;  4ME2 A;  2FO7 A;  3U64 A;  4EZK A;  3DSW A;  3Q7F A;  2P9I G;  3U4T A;  2WVI A;  3MKR A;  5AQ7 A;  4IUL A;  2DZN A;  3UM1 A;  2WXG A;  2OEW A;  2V0P A;  2GW1 A;  5BNW A;  2HYZ A;  4LRZ A;  2PQR A;  1TNB A;  3FEX A;  1N4P A;  3DPD A;  3AU5 A;  3ONK A;  1H19 A;  3GZS A;  3KEA A;  1HG2 A;  3MYV A;  5ARG A;  2V4L A;  1TNU A;  2X6K A;  3AG3 E;  4WNG A;  4GZ3 A;  4U7E B;  2LXM A;  1N54 A;  3PNT B;  2OCC E;  4HOT A;  3FUN A;  3MJW A;  2XGM A;  5EYP F;  1MZC A;  3G2W A;  4ACK A;  5HRY A;  3SGH A;  3EHQ A;  1NFI E;  5FQ8 A;  2IO2 C;  3ZNG A;  1IYG A;  3SBS A;  3RAU A;  2EQX A;  1O1S A;  1S63 A;  2PM7 A;  4GYY A;  2R03 A;  4K5A B;  3B13 A;  3FTZ A;  4HRN A;  3CLJ A;  4FJY A;  4N5C A;  1K1A A;  5D0O D;  2J49 A;  3CHQ A;  4GPM A;  4YDY A;  3B7R L;  2Y1L E;  3EIJ A;  3TWW A;  4U0U A;  2P58 C;  1E7V A;  3D9K A;  4JZY A;  4Q94 A;  4CDN A;  3JUI A;  2XEN A;  4JL0 A;  5AEN A;  3CR3 A;  2WPV A;  4GA1 A;  4I2Z A;  4Q96 A;  3NZU A;  4FUL A;  3HXE A;  1IQU A;  2CHZ A;  3FHE A;  4DUI A;  2I6H A;  4CEM A;  3R9M A;  3ULE G;  4EEC A;  4J8Y A;  1HFA A;  2WXR A;  3S7J A;  1HX8 A;  1ELK A;  4HOS A;  4LER A;  1X5B A;  4FC8 A;  4UI9 K;  1QYM A;  2XRZ A;  4F3V A;  2XS8 A;  3AS8 A;  3CKC A;  4DLQ A;  3FWV A;  2OOE A;  1L5J A;  3MGB A;  5CCM A;  4OVU A;  4G1T A;  3RRM B;  3JCK C;  5AYW D;  3GZ2 A;  1Z6T A;  3ABM E;  1OT8 A;  3UIP C;  1N4R A;  4L23 A;  2QYU A;  3Q15 A;  3UM0 A;  5DIZ A;  2FF4 A;  3BEE A;  3QWW A;  5T4Y A;  2J4B A;  1IXV A;  4U95 D;  5FJY A;  1E90 A;  1AWC B;  2Y0B G;  4AY6 A;  2WQ7 A;  4J7W A;  5B1B E;  3NF1 A;  2OVB A;  4F1P A;  5BT1 A;  4BER A;  3ML8 A;  2J9Q A;  1UG3 A;  2L6J A;  3LKU A;  5FZQ A;  2Y3A A;  4X8Q A;  1N9A A;  1JUQ A;  3L13 A;  3D9M A;  5ANL A;  3VLE A;  4HRM B;  3FTW A;  4BT8 A;  4LG6 A;  2XZD G;  3LY7 A;  3CHR A;  1JCQ A;  3DSV A;  2XGS A;  3ZEF A;  3JQ1 A;  3TWR A;  4FAD A;  1ELW A;  4AY5 A;  4RG9 A;  1N0Q A;  3BG0 B;  3O48 A;  5C2Y A;  4XKB A;  4YVO A;  3ZXP A;  3DXK G;  3FU0 A;  3BG1 B;  2IF4 A;  1MQS A;  2C0L A;  5EX3 A;  3QDN A;  3PVL A;  1KZP A;  4GTT A;  3FUE A;  4ILI A;  3CVV A;  4F1S A;  4XZ4 A;  3LJN A;  4N39 A;  3AG2 E;  3PNL B;  3PS6 A;  5H7P A;  3IHV A;  2UY1 A;  2HR2 A;  4H7X A;  2WXJ A;  3CHS A;  5EIL A;  3TG4 A;  2I2O A;  5AAR A;  2WMO A;  2ION A;  4BEP A;  4DJA A;  2GRM A;  3L16 A;  3IXE A;  2KCK A;  1PY1 A;  2IO3 C;  1LF8 A;  4L2L A;  5LFA A;  3FU3 A;  3BUA A;  3ZVV A;  3LY8 A;  5CCL A;  1PC2 A;  2I1K A;  5FIN A;  3V2O A;  5EID A;  1Z3X A;  4ATG A;  4HB5 A;  2DCP A;  2WXO A;  1A5E A;  2C2L A;  3PZD A;  2J08 A;  2F8X K;  2MRI A;  3APF A;  4BX9 A;  3GZ1 A;  3RIB A;  3AJI A;  1E8W A;  2P9P G;  2L6B A;  2BF0 X;  3CHP A;  3SFX A;  1EYH A;  1DC2 A;  5ENN A;  1V54 E;  2AVP A;  1HG5 A;  3AS4 A;  1JPL A;  4U0Z A;  3ZU7 B;  4LCT A;  2DBA A;  3SBT B;  3LXU X;  5G04 J;  1WDY A;  2A5U A;  4DPR A;  5G2N A;  3NBN B;  5HKP A;  5A7D B;  2WM9 A;  1V55 E;  3V31 A;  4C9B B;  3D9P A;  4I6E A;  1FT1 A;  3D9N A;  4LNB A;  3RJV A;  2HM8 A;  3SI5 A;  4AP2 A;  4N2Q A;  4C0M A;  3ZYK A;  1Y6I A;  3HXB A;  2KZT A;  3V2X A;  5ENP D;  4UI9 C;  2VGX A;  2EIM E;  3Q75 A;  2FEZ A;  1SZA A;  3IHY A;  4IRU A;  3U3W A;  2WXL A;  4G26 A;  4ANW A;  3P2B A;  4EHM A;  1GW6 A;  3TWT A;  4XEI G;  4APF A;  1HO8 A;  4GYW A;  3JXJ A;  3Q78 A;  1E8X A;  1TNZ A;  4GZD A;  2IOL A;  3OAW A;  3JXI A;  1TEZ A;  4RVB A;  2KC7 A;  5CBO A;  1WG0 A;  4F7A A;  2LUH A;  1K1B A;  4F53 A;  2XPI A;  1A17 A;  4HFG A;  4G2V A;  3DSX A;  2B6C A;  5DBK A;  3WG7 E;  1JWG A;  4F6R D;  5IY5 E;  1NL4 A;  3BU8 A;  2VSN A;  3LYA A;  4G23 A;  4U63 A;  4YDO A;  3QKY A;  3FH8 A;  3L22 A;  1OWO A;  2P9S G;  2XGO A;  4FA6 A; 
#chains in the Genus database with same CATH homology
 2VTB A;  3U4T A;  5E76 A;  2WVI A;  3MKR A;  1OWP A;  4IUL A;  5BPP A;  1TJC A;  4ANV A;  3RK6 A;  3ZIM A;  5FQ6 A;  2WMN A;  4A55 A;  2WXG A;  4YND A;  2E0I A;  2V0P A;  2GW1 A;  3CQG B;  4K0R A;  5G05 C;  3ZHE B;  5BNW A;  3U9W A;  4NAC A;  2HYZ A;  3KD7 A;  4LRZ A;  1QQE A;  2X38 A;  4UQZ A;  2PQR A;  2AWI A;  2XQ0 A;  3CVL A;  2NSZ A;  3LS8 A;  2X6F A;  2LSU A;  3QOU A;  4V3I A;  3FEX A;  4I2W A;  1HF8 A;  1DVP A;  3DPD A;  3AU5 A;  2OND A;  3ONK A;  1H19 A;  4UQX A;  3GZS A;  3MYV A;  1HG2 A;  3FTX A;  5ARG A;  5ANR A;  3FTU A;  4GU5 A;  2V4L A;  4HS2 A;  1WAO 1;  4BX8 A;  1SZ9 A;  2FI7 A;  2X6K A;  4JW1 A;  4ILH B;  2BTD A;  5AIJ A;  3PH0 C;  4WNG A;  5FT9 A;  4PUC A;  1U3D A;  4GZ3 A;  4WWP A;  2C0M A;  3IEG A;  2RD0 A;  2AXV A;  1N54 A;  3TXM A;  3ONL A;  3P1U A;  3PNT B;  4KZ0 A;  1ZBP A;  2L0I A;  3QC1 A;  4HOT A;  4WUY A;  3TAX A;  3UT8 A;  4CRW A;  3PUK A;  3FUN A;  4WND A;  3ESK A;  4UQY A;  4K03 A;  3MJW A;  3T5V A;  1S0P A;  2XGM A;  4AV7 A;  2R59 A;  4PS8 A;  3G2W A;  4WWN A;  4ACK A;  4CT0 A;  3SGH A;  2J4D A;  3MKQ B;  5J90 A;  5KCM A;  5FQ8 A;  2AW6 A;  4N3C A;  1Z3Y A;  3G2T A;  1UN8 A;  3PEU B;  1IYG A;  3SBS A;  2NC9 A;  2BUG A;  3ENE A;  4KMO A;  1JWF A;  4PS7 A;  1H6K A;  2EQX A;  3CV0 A;  4GZC A;  3TJP A;  3S7B A;  2GGF A;  2PM7 A;  5LX8 A;  2WB2 A;  3LPZ A;  2HO1 A;  1OUV A;  2UY1 B;  4GYY A;  4CDR A;  5JHA A;  3B13 A;  3FTZ A;  1SQM A;  3CK7 A;  4GA2 A;  2PQN A;  4FLB A;  3CLJ A;  4FJY A;  4GZ6 A;  4MRU A;  4N5C A;  4TRQ A;  4AXH A;  3SD5 A;  3LJ3 A;  3EJN A;  3FUK A;  4I17 A;  4AVX A;  4LEU A;  3HIZ A;  5D0O D;  4JPS A;  2J49 A;  4AEZ C;  2VQ2 A;  3APD A;  3CHQ A;  1IQR A;  4A3V A;  2WQH A;  4I9C A;  4URK A;  3FUF A;  2Q7F A;  4J8E A;  3QJZ A;  3G2V A;  3B7R L;  4JEH A;  2I1J A;  3CVP A;  3L54 A;  3QAR A;  3ZYL A;  4ANX A;  5JHB A;  4BWR A;  4HOU A;  5FTP A;  3EIJ A;  4KXK B;  2YNQ A;  4UWL A;  3URZ A;  4CDM A;  4U0U A;  4JHJ A;  2P58 C;  4WWO A;  4D10 C;  1E7V A;  3RO2 A;  3D9K A;  3QNK A;  4H7Y A;  4JZY A;  4Q94 A;  2WQ6 A;  4CDN A;  3JUI A;  4E85 A;  3D9O A;  4JL0 A;  5AEN A;  3FY4 A;  4BFR A;  3CR3 A;  3Q4A B;  2WPV A;  4GA1 A;  4G24 A;  4KZC A;  3SF4 A;  3LY9 A;  2XPZ A;  2XEV A;  3OXF A;  2YIN A;  3PE3 A;  4I2Z A;  4R7L A;  5FZS A;  4Q96 A;  3SFZ A;  4C0E A;  2L0T B;  3NZU A;  4BSX A;  2UWJ G;  4FUL A;  2PL2 A;  3UT7 A;  3ASD A;  4CT4 A;  4PH4 B;  4EZL A;  4JA9 A;  1IQU A;  2CHW A;  3CGH A;  4FHK A;  3VTX A;  2YHE A;  4PDX A;  2RG8 A;  4B8C B;  2VGX B;  1INZ A;  2CHZ A;  3FHE A;  1FVH A;  5T3R A;  1BPO A;  4KVO A;  3T8M A;  3I5P A;  2I6H A;  3NZS A;  4CEM A;  1VDY A;  3PUJ A;  4EEC A;  1HFA A;  1H2U A;  5LCW J;  2WXR A;  3PDN A;  5FZR A;  3S7J A;  3VTY A;  3LVR E;  1HX8 A;  4HXI A;  4IYP A;  1ELK A;  2VSO E;  3S2A A;  3CVU A;  4HOS A;  4NRH B;  4LER A;  2MOW A;  3MCX A;  1H2T C;  2ZU6 B;  1EPU A;  3S7D A;  1X5B A;  3FTY A;  1ZU2 A;  4FC8 A;  1E96 B;  1FVF A;  1HXI A;  5AJL A;  3ZFW A;  4UI9 K;  2Y4T A;  2XRZ A;  2JEK A;  4F3V A;  2KAT A;  3AS8 A;  3FDH A;  3OTN A;  3KEZ A;  4OVV A;  1KT1 A;  4G11 A;  2DIW A;  2FBN A;  3CKC A;  4DLQ A;  4XIF A;  5FQ4 A;  2XCC A;  3FUD A;  4GMJ A;  5JJ7 A;  3FWV A;  2IJG X;  1NZN A;  2OOE A;  4FJZ A;  1L5J A;  3MGB A;  4E6H A;  5CCM A;  4OVU A;  3CHO A;  3R7R A;  3LCA A;  4P29 A;  1KT0 A;  4DI4 A;  3FP3 A;  4G1T A;  3RRM B;  2KM4 A;  3JCK C;  3GZ2 A;  1Z6T A;  1XGW A;  5AYW D;  2KZT B;  3OXG A;  3LEW A;  5LP0 A;  4L23 A;  3Q15 A;  3N71 A;  2YQ8 A;  4I1O B;  4MKT A;  4TUU A;  4JEU A;  4JA7 A;  3IKO B;  5DIZ A;  2VGY A;  3CVX A;  2FF4 A;  3BEE A;  3MKQ A;  3QWW A;  3G2U A;  2XCB A;  2J4B A;  5T4Y A;  4BT9 A;  2KCL A;  5FJY A;  3MV2 B;  4AM9 A;  1E90 A;  4J8D A;  4A1G A;  4Y6W A;  5EKQ D;  1MHQ A;  3UPV A;  2YHC A;  2WQ7 A;  4AY6 A;  4B94 A;  5A23 A;  1WY6 A;  4ILG A;  3NF1 A;  2OVB A;  2V5F A;  2WXH A;  3FTV A;  5BT1 A;  3EDT B;  1OWL A;  3ML8 A;  2J9Q A;  4EQF A;  4JVS A;  1UG3 A;  3B7T A;  1PAQ A;  4XKC A;  3PRE A;  2XRY A;  2WXF A;  2IU1 A;  5FWQ A;  2CG2 A;  2L6J A;  2VSX E;  3LKU A;  5FZQ A;  3ZGQ A;  5LOZ A;  4WNE A;  2QY7 A;  2Y3A A;  2XHE A;  3FTS A;  1NA3 A;  5BV1 A;  5EDS A;  2X6J A;  1JUQ A;  4GML A;  3L13 A;  4L1B A;  3D9M A;  3WXX A;  5ANL A;  3VLE A;  4UWF A;  2LSV A;  3FTW A;  4KBQ A;  4BT8 A;  4J6I A;  3FU6 A;  1HS6 A;  5M72 A;  5EX0 A;  1TJF A;  3FU5 A;  3LY7 A;  3CHR A;  4BY6 A;  2Y4U A;  4I6J A;  3CVY A;  4JHR A;  3U66 A;  2XGS A;  3FH5 A;  3ZEF A;  3AS5 A;  3JQ1 A;  4GAA A;  1H2V C;  4N3B A;  3CK8 A;  3NQP A;  4GCN A;  4FAD A;  3ZXS A;  1ELW A;  1HE8 A;  4AY5 A;  1UJJ A;  4RG9 A;  4N2S A;  3AU4 A;  3BG0 B;  3O48 A;  3CKB A;  3JQ0 A;  5C2Y A;  3UX4 A;  2VTB B;  4XKB A;  4YVO A;  3FU0 A;  4HLE A;  4XE0 A;  3BG1 B;  4J0U A;  2R17 C;  4N3A A;  2CG3 A;  2IF4 A;  2A4Z A;  1MQS A;  2C0L A;  3ZHE A;  4CGW A;  4GCO A;  5G04 C;  3EHN A;  2X6H A;  4U07 A;  2FUL A;  4HVB A;  5EX3 A;  3QDN A;  1ELR A;  2WXQ A;  3PVL A;  5BW8 C;  2VYI A;  3FUE A;  4IN3 B;  2J09 A;  4ILI A;  3CVN A;  3CVV A;  4F1S A;  5FQ7 A;  5C1D A;  4XZ4 A;  1H0A A;  4NQ0 A;  4N39 A;  3HVE A;  3PNL B;  2WXP A;  3RRN B;  4YVQ C;  3PS6 A;  3JYS A;  3CSF A;  4FU3 A;  4APO A;  1NP7 A;  3IHV A;  2UY1 A;  1QNF A;  4GZ5 A;  4W9R A;  2HR2 A;  4H7X A;  1UW4 B;  5CMW A;  4GPK A;  2WXJ A;  3SHF A;  1FCH A;  3CHS A;  5D0Q D;  1N52 A;  4JC8 A;  3TL5 A;  4I1A A;  3TG5 A;  4L2Y A;  5G55 A;  3TG4 A;  3ULQ A;  2I2O A;  3L08 A;  3CVW A;  4FP7 A;  2NXP A;  2WMO A;  3IV0 A;  3EIQ C;  4J8F A;  3QWV A;  4GYO A;  4EBA A;  5KJM A;  2ION A;  3I3N A;  4L7T A;  4CGV A;  4DJA A;  2GRM A;  3L16 A;  1HU3 A;  4ANU A;  2KCK A;  1E8Z A;  3Q5M A;  1PY1 A;  3CHM A;  5KJK A;  4ABN A;  2JLB A;  1LF8 A;  4L2L A;  3ASH A;  2WXN A;  4FHJ A;  5LFA A;  3CVQ A;  2XPY A;  3FU3 A;  3TXN A;  1NA0 A;  1OWN A;  3ZVV A;  3LY8 A;  4UWH A;  1OWM A;  5CCL A;  4JXT A;  1PC2 A;  3EHM A;  2I1K A;  2LO6 A;  1EF1 C;  2VSY A;  1Z3X A;  4WAF A;  3D3M A;  4QFV A;  1DNP A;  4ATG A;  3R7Q A;  4M3O A;  2DCP A;  2WXO A;  1KLX A;  3TGO A;  2C2L A;  5HQ8 A;  5JJT A;  4PS3 A;  3ESL A;  5E75 A;  3T5X A;  5JJ6 A;  3R9A B;  3PZD A;  2J08 A;  4MS6 A;  3APC A;  3B7U X;  3IBE A;  1QZ2 A;  3B7S A;  4EPZ A;  2X6I A;  3MX3 A;  3MZL B;  2GRL A;  4U04 A;  4Q69 A;  4LUN U;  3MEK A;  4U0S A;  2MRI A;  2WXI A;  5BV0 A;  4I43 A;  3APF A;  3SNX A;  1IHG A;  5A6C A;  3RU0 A;  4FLH A;  5AJD A;  4BX9 A;  3GZ1 A;  3RIB A;  1E8W A;  2BF0 X;  2CHX A;  3CHP A;  3DBS A;  1EYH A;  2PZI A;  1Y8M A;  5ENN A;  2LAH A;  2WXK A;  2AVP A;  3I4R B;  1HG5 A;  1E8Y A;  3AS4 A;  4U8H A;  1JPL A;  2VJ8 A;  4U0Z A;  4KT6 B;  4Y6C A;  4A3T A;  4G25 A;  2AXU A;  4O6F A;  1B89 A;  4LCT A;  3PEV B;  2IFU A;  1YA0 A;  2KCV A;  2DBA A;  3SBT B;  4B0Z A;  3LXU X;  5G04 J;  3E4B A;  3QWP A;  3O4Z A;  3QK0 A;  5CMY A;  2A5U A;  5CHE E;  4DPR A;  2IOS A;  3QB2 A;  5G2N A;  3GYZ A;  3FH7 A;  2IQC A;  3C98 A;  5A7D B;  2WM9 A;  3FFL A;  4EBA G;  4GA0 A;  2X3M A;  3ASF A;  4C9B B;  3ZRH A;  4RSY A;  4UI9 J;  3D9P A;  4OYS A;  4I6E A;  3D9N A;  3CQC B;  3I4G A;  3RJV A;  2HM8 A;  3VLF A;  3ML9 A;  3ASG A;  4I6G A;  3FUH A;  3SI5 A;  4EZJ A;  4AP2 A;  4N2Q A;  3LVQ E;  4C0M A;  5LCW C;  2M63 A;  3UT4 A;  4DI3 A;  5G05 J;  4ACL A;  1P5Q A;  3RRU A;  3ZYK A;  4HOQ A;  1WM5 A;  1Y6I A;  3Q47 B;  1XNF A;  4B8A A;  3KS2 A;  2KZT A;  3G2S A;  3HYM B;  3KAE A;  4UI9 C;  2V8S E;  2VGX A;  3OXL A;  1UN9 A;  3CK9 A;  4RG6 A;  3D9I A;  3Q49 B;  3ZYM A;  4AIF A;  4GB9 A;  4BTB A;  4DLO A;  2FEZ A;  4UWG A;  4BTA A;  1SZA A;  2CFU A;  4DK5 A;  2R5S A;  4I9E A;  5KJN A;  3PRZ A;  4XX5 A;  3IHY A;  3CEQ A;  4IRU A;  3VLD A;  2WXL A;  4G26 A;  1EDU A;  5HI7 A;  3U3W A;  2I9C A;  4UWK A;  4KYO B;  4ANW A;  2WXM A;  2L9B A;  3P2B A;  3LDZ A;  2LAI A;  3HVE B;  1GW6 A;  3MV3 B;  4A1S A;  3K9I A;  4I1M A;  4APF A;  1HO8 A;  4GYW A;  5T8I A;  2MHK A;  2OVF A;  1E8X A;  4GZD A;  3UQ3 A;  2IOL A;  1HH8 A;  4B89 A;  1U3C A;  2AXZ A;  3CST A;  2J07 A;  3OAW A;  1W3B A;  2OV8 A;  2KC7 A;  4RVB A;  4AJW A;  3HDX A;  1UJK A;  2CFZ A;  1TEZ A;  4HOR A;  4AOF A;  4F7A A;  3RO3 A;  2LNI A;  3ZW3 A;  3MA5 A;  3FUL A;  4F53 A;  5KJL A;  2PM6 A;  4J8S A;  3ZPJ A;  2XPI A;  1A17 A;  4HFG A;  3PE4 A;  3FUJ A;  5ARF A;  4G2V A;  3UUX A;  5DBK A;  3S7F A;  4MLP A;  1JWG A;  5J08 A;  2E2E A;  3QAQ A;  4CCA A;  3L6A A;  4XI0 A;  3RKV A;  3UMV A;  2VSN A;  2ILR A;  3LYA A;  3GW4 A;  4G23 A;  4JHK A;  2QFC A;  1HZ4 A;  4U63 A;  3CIA A;  3SZ7 A;  1E7U A;  3QKY A;  5BUZ A;  3FEY A;  3HHM A;  3FH8 A;  3FUI A;  3L17 A;  4KVM A;  4ME2 A;  4NUR A;  4TV3 A;  4XI9 A;  3D9L A;  2FO7 A;  3ZN3 A;  3U64 A;  3ZYQ A;  3L22 A;  4EZK A;  1OWO A;  3FUM A;  4WNF A;  2XGO A;  4FA6 A;  3D9J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...