3CVQA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to pts1 peptide (7-skl)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
315
structure length
289
Chain Sequence
NTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARALDPADIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Peroxisome targeting signal 1 receptor PEX5
publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 97
structure length 289
sequence length 315
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvqA00
4JHRA 4WNEA 3MV3B 1NA0A 2XCCA 5HI7A 3URZA 4I2ZA 2VGXB 4YNDA 5D0QD 5DIZA 3PE4A 3OXGA 3TGOA 4UI9K 3ZGQA 3PDNA 1OUVA 4KXKB 3LKUA 3JYSA 2VGXA 4I9CA 3TG5A 2Y4UA 3QWPA 3ZHEA 4WUYA 4AIFA 5EX3A 2C0MA 3AS8A 2LSVA 5G05C 2JLBA 4JA9A 4HORA 4N3CA 4U07A 1PC2A 4H7YA 3ASDA 2YHCA 4KBQA 3QWWA 2IFUA 4YVOA 2HO1A 3CVNA 5BNWA 2PZIA 4GA1A 4YVQC 4UI9C 3OXFA 3GZ2A 3Q49B 3QOUA 2PQRA 4G25A 4B94A 2VYIA 5EX0A 2XGMA 3VTXA 1ELWA 2IF4A 4ME2A 3OXLA 1IYGA 4N39A 2FF4A 4XI0A 2FI7A 5A6CA 2OOEA 5ARFA 4WNFA 2UY1B 4U0UA 3N71A 4UQYA 1A17A 3S7JA 3S7DA 5FZRA 3RJVA 1W3BA 3S7FA 3AS5A 5DBKA 2UY1A 3HYMB 2XGOA 3BEEA 4G24A 4Y6WA 4APOA 3QWVA 3FWVA 1WAO1 3SF4A 4I2WA 2UWJG 3RU0A 1WM5A 5ARGA 4W9RA 4U0ZA 4N5CA 2C0LA 2KCLA 3ZHEB 4JA7A 3UQ3A 2VQ2A 4ABNA 4GYOA 1NA3A 3GW4A 3EDTB 5FZSA 4GYYA 3IEGA 4GPKA 3QKYA 4GA0A 1HXIA 1HH8A 1TJCA 2PL2A 5JJTA 4HOQA 4WNGA 3GYZA 5FT9A 2KCKA 3TAXA 2I6HA 4N2QA 3LPZA 2J9QA 5KJNA 3WXXA 3PE3A 2ONDA 1NZNA 4GCNA 5FJYA 2WQHA 1B89A 2PQNA 4AY6A 2FBNA 5C1DA 2LSUA 5LCWJ 4I17A 1KT1A 1FCHA 5FTPA 3KS2A 1IHGA 4LEUA 4BT8A 3KAEA 4J8DA 3MKRA 2FO7A 1E96B 4CDRA 4GZ5A 3K9IA 4UQXA 3MV2B 3FFLA 2KC7A 3CK9A 4XIFA 3VTYA 5G04J 3RO3A 1Y8MA 2R5SA 4N3BA 5EKQD 4G2VA 1ZBPA 3LYAA 3CKBA 5A7DB 2Q7FA 3GZ1A 4I9EA 3Q47B 3TG4A 2NC9A 4BTAA 2DBAA 4XI9A 2V5FA 3MA5A 5CCMA 5KJMA 4I1AA 1P5QA 3ZFWA 2KATA 4J0UA 3RIBA 3KD7A 4A1SA 1ELRA 5AYWD 3ESKA 3LCAA 3RKVA 3ASHA 4EQFA 2WPVA 4RG9A 3FP3A 3O48A 4Y6CA 4GCOA 4CGVA 3MEKA 4G26A 5JJ6A 4F3VA 3CKCA 3ZN3A 3CVQA 3SZ7A 2XPIA 4U04A 4UI9J 2MHKA 4U0SA 1ZU2A 5KJKA 4CGWA 2Y4TA 3ASGA 1HZ4A 4UQZA 2KCVA 3UUXA 2HYZA 3NF1A 4IN3B 3CK7A 1QZ2A 5BT1A 4AY5A 4G1TA 5FZQA 4NQ0A 2GW1A 4BWRA 2C2LA 3CVLA 3U3WA 4GZ6A 3E4BA 2XGSA 4H7XA 3Q15A 3ULQA 3LY7A 4WNDA 4JL0A 4O6FA 1XNFA 4J8FA 4GYWA 2BUGA 4HOTA 5M72A 3LY9A 2HR2A 2XEVA 4HOUA 5HQ8A 4BT9A 2P58C 3Q4AB 2AVPA 4NRHB 5BW8C 3Q5MA 3S7BA 3AS4A 5KJLA 3U4TA 3ZPJA 4J8EA 2L6JA 3UPVA 3CVPA 4KYOB 5CCLA 4G23A 1KLXA 5CHEE 3QDNA 1KT0A 2VSYA 5LCWC 4N3AA 2VGYA 5D0OD 3RO2A 3CK8A 2YQ8A 1YA0A 4GZ3A 4HOSA 4AM9A 3ASFA 2E2EA 4GA2A 2VSNA 5JJ7A 3LY8A 2FEZA 4RG6A 3CEQA 2LNIA 2XCBA 5G05J 2QFCA 3CV0A 3R9AB 5G04C 1QQEA 4N2SA 4BTBA
chains in the Genus database with same CATH superfamily
1TNYA 3PZ1A 2JABA 2XCCA 4B8CB 4D10C 2R05A 4I2ZA 4E6HA 4DI3A 1OUVA 1NI1A 3SFYA 1OT8A 1S0PA 2WMNA 2CFZA 4TXPA 2YINA 3ML9A 4JA9A 2H6FA 4HORA 4BFRA 3EIQC 5EYPF 3ASDA 4CYMD 3KEZA 4YVOA 5KWDA 5LFAA 5BNWA 4MRUA 2MOWA 3L54A 1N94A 3CHPA 3FEYA 4FLBA 3ZRHA 3HXCA 1DCQA 2RFMA 2WXHA 3CSTA 3GZ2A 1MJ0A 3NBNB 3SGHA 5CBNA 4PS7A 3ASNE 5CRUA 2XGMA 3VTXA 1ELWA 3JCKC 3W9GA 2OEVA 3FU5A 4K0RA 2IJGX 2IOLA 4L2YA 2LXLA 3G2VA 2MYOA 5A6CA 2NSZA 4B89A 3FUJA 4V3IA 4EHMA 3LEWA 4WNFA 3APDA 2UY1B 1HG2A 3N71A 3I4RB 3PNLB 3S7DA 3UM0A 1X81A 3NOCD 1EDUA 3S7FA 3TXNA 2ILRA 1H6PA 3NZUA 3MJWA 1LTXA 3L9TA 2UY1A 2V5QC 2WB2A 1IQUA 2MRIA 3NB2A 3JUIA 5BXUA 4Z68A 2LXMA 2OEWA 5ARGA 3C98A 4W9RA 4N5CA 2NXPA 3PVLA 1H2VC 1E8XA 4GYYA 1HH8A 4I6GA 1IKND 3TWQA 1QBQA 4HQDA 3BG0B 3PUKA 2I6HA 2IEJA 4L23A 1OWMA 2LUHA 4RSYA 3VLFA 4I6EA 3ZU7B 4JB8P 2ETAA 3PE3A 2ONDA 3JUEA 2WQHA 3SBSA 2ZISA 3TWUA 2XPYA 2WXIA 2LSUA 1OCRE 1A5EA 1FCHA 4DPRA 1IHGA 3KAEA 4J8DA 2KZTB 2FO7A 2IONA 4CDRA 2XRYA 4MKTA 2H6GA 4FADA 3HIZA 4Q94A 3V31A 4RLYA 3P2BA 1N52A 3CHMA 3FFLA 2KC7A 3T5VA 2KZTA 4KVOA 4GTMA 3MX3A 4AOFA 3ZXSA 4N3BA 1N4QA 4JPSA 3PZ3A 2X6IA 3C5RA 3L16A 4FP7A 2YNQA 2FULA 2IO3C 1SA5A 2NC9A 4C0EA 5EN5D 5CRVA 2LAHA 4GB9A 2DBAA 3UXGA 2V5FA 3NQPA 3MA5A 3ABME 2F8YA 5KJMA 2L0IA 3TWSA 3PH0C 2E0IA 4U95D 2DZOA 2R59A 3ONLA 3KD7A 1FT1A 5AQ7A 2KM4A 4A1SA 4XX5A 2X38A 5T8IA 4TRQA 1ELRA 4G8KA 1BU9A 1WG0A 4MS6A 3L13A 2WPVA 4TXQA 4Y6CA 3ZKJA 4CGVA 4EECA 2EIJE 2XS1A 4G26A 5T4YA 4F3VA 4NIKA 4CT0A 2L6BA 4DLQA 4U0SA 3LDZA 1ZU2A 4APFA 4CGWA 2Y4TA 1NL4A 3ASGA 1HZ4A 1G3NB 3Q75A 3FUIA 3L08A 4IN3B 3PEVB 3LVRE 3HDXA 4AY5A 2GW1A 3EU9A 1LF8A 2C2LA 5AQAA 3CVLA 3B7UX 3QAQA 4GZ6A 4WAFA 3BU8A 3ZVVA 2KBXA 1XNFA 3DXKG 1OCCE 2I9CA 2WXRA 2V0PA 5D2MC 3CVYA 4ATGA 4L7TA 3LY9A 2XEVA 2EIKE 1N4PA 4L1BA 4NRHB 5BW8C 3Q5MA 3ZEFA 3EJNA 3S7BA 3B95A 5CBOA 4DX7D 4J8EA 4AXHA 3FUDA 3HXEA 4KYOB 1Z5SC 5KBAA 3QK0A 3IV0A 1V55E 1KLXA 2VSYA 3D9JA 5D0OD 4YDWA 3ASOE 4GMJA 3UT8A 3CHRA 1E7UA 1U2VG 1E90A 4IYPA 4WWOA 4HS2A 3J5PA 2QYJA 3GZSA 4RG6A 4DX5D 5AJLA 2WXGA 2R02A 3CGHA 5AIJA 4JEHA 4HFGA 4F6RD 1NA0A 5HI7A 4DX1A 3PZ2A 4K03A 1BPOA 2H6HA 3OXGA 3TGOA 3ZGQA 4J7WA 4J8SA 4TUUA 1HU3A 2BEDA 4GU5A 2DWZA 5BXOA 4ANWA 1WY6A 4HI8A 2DVWA 5CEAA 3ZHEA 4WUYA 2WXJA 1JCQA 2C0MA 3AS8A 5ENRD 4B93B 1FVHA 5G05C 3OAWA 5BUZA 2Y3AA 3APFA 4U07A 3FTWA 1Y6IA 3SBTB 3FEXA 4H7YA 1QYMA 1OCZE 2A5UA 3TWWA 2XHEA 1O5MA 1IQRA 4ZFHA 2Y0BG 1HS6A 2GRMA 2X6HA 4YVQC 3LJNA 1INZA 3OXFA 4B0ZA 3Q7AA 4BX8A 3HXDA 3Q49B 3QOUA 2WM9A 2VYIA 5EX0A 3DBSA 4ME2A 4GPMA 3OXLA 5ENTD 4N39A 4GMLA 3CVUA 3FUNA 1OWOA 4XI0A 3B7RL 4A63B 1HO8A 3ZYLA 1N4RA 2WXFA 4Q69A 4R7LA 4I6JA 3R7RA 4U0UA 5EYLA 1TR4A 3O4ZA 3S7JA 3C3QA 3JXIA 2CHXA 4U8HA 4P29A 3CHSA 1MX4A 5CERB 1HG5A 2GGFA 1FPPA 2XGOA 3BEEA 4G24A 4APOA 2VGEA 3QWVA 4OAVB 1WAO1 4I2WA 2GRQB 2OVFA 3LVQE 2VTBA 3Q7FA 4U0ZA 3TWTA 2KCLA 4I1MA 5C2YA 5IY5E 3UQ3A 4HLLA 1UJKA 2VQ2A 5ANLA 4FC8A 3EDTB 5FZSA 3FTSA 5ANRA 3QB2A 5A23A 1HXIA 1TJCA 4XE0A 4KZ0A 3ZYMA 2RG8A 3ML8A 3UM1A 5B1BE 3TXMA 2Y69E 4KMOA 3LPZA 2J9QA 4OVUA 5E75A 1HE8A 3RSEG 2XZDG 1Z3YA 2R17C 5FWQA 2PQNA 4EZLA 3DPYA 3D9PA 3PNTB 4PS8A 1ELKA 3P1UA 4GTVA 3SNXA 4I17A 5JMND 1KT1A 3KS2A 1YCSB 4GZ5A 3TWXA 1N9AA 2DYRE 1Z3XA 1H19A 5LX8A 3X2QE 4A55A 3V79K 3CK9A 4XIFA 3FU3A 3U64A 1H6KA 3AG4E 5EKQD 1JWFA 2R5SA 2V8SE 2WMOA 4ILGA 1MQSA 1UG3A 1ZBPA 3MYVA 2IO2C 3KSLA 3TG4A 4DI4A 5ITZF 4BETA 1K8KG 3BUAA 1RW2A 4U7EB 3OTNA 1E8WA 4BTAA 4ACKA 4XI9A 3ZYQA 1K1AA 4GTQA 3DSWA 4I1AA 2QZAA 3JQ0A 2KATA 2P9IG 3B7BA 3FUEA 1SA4A 2XZTG 4G11A 3ISMC 4MBGA 3ESKA 2IY0C 2AJAA 3PREA 3VLEA 3UIPC 4EQFA 2RD0A 4KVMA 3FP3A 3O48A 2F37A 4GCOA 4YDEA 3NOGD 5AAOA 3CQGB 3CKCA 3CVQA 3PUJA 3UM2A 2XPIA 3G2SA 2WQ7A 2RKKA 1U3DA 2IOSA 4QQIA 5D66A 1KZOA 3Q9UC 2OCCE 3EIJA 1D8EA 4GTPA 2DIWA 2GRLA 4ANXA 1EYHA 4FU3A 4GTTA 4AJWA 3CK7A 2PNNA 3D9LA 3DEPA 1BLXB 3L6AA 4UWGA 5AJDA 3UI2A 2BTDA 4NURA 3U3WA 3E37A 4H7XA 3LS8A 3Q15A 4HRNA 4HVBA 3FTVA 2X6FA 2CG3A 3FY4A 4JL0A 4O6FA 5T3RA 4HLEA 2X6KA 4JHJA 2ETCA 1YMPA 5HQ8A 3WG7E 3B7TA 4JEUA 3ENEA 2AVPA 3FULA 4CEMA 4HXIA 3L82A 4GTOA 3KSQA 5KJLA 4GZCA 3CVVA 3UM3A 3DSUA 3SFZA 2CHWA 3LXUX 4DX6D 4EBAA 1JCRA 5CHEE 3QDNA 5LCWC 3FUHA 1IXVA 3CK8A 1YA0A 2R03A 4ANVA 3D9KA 4J6IA 3V30A 3AG2E 3B13A 2E2EA 4GA2A 4I43A 3RRMB 4FA6A 4X8QA 2A4ZA 4PUCA 3UINC 3AU4A 4IULA 1UJJA 4FHJA 4EBAG 2FO1E 2RFAA 3MGBA 5G04C 1QQEA 2OV8A 4BTBA 1E7VA 4JHRA 1HF8A 3MV3B 4WWNA 2F0YA 2GROB 3AG1E 2DZNA 5D0QD 1PAQA 2EINE 3CQCB 4TUMA 4UI9K 3NAWA 3PDNA 5LOZA 2EILE 4KXKB 4TXRA 1FVFA 3JYSA 4FULA 4EZJA 3TG5A 1K3ZD 1DC2A 2Y4UA 3UT7A 3QWPA 2WXQA 1D8DA 4HB5A 2M63A 4N3CA 2L0TB 1H2UA 5ENOD 2H6IA 2YHCA 2IFUA 2PM6A 3CVNA 2J8SD 3T5XA 4FLHA 3HG0D 5CMYA 2WXPA 3FHEA 3RK6A 4L2LA 1Q2ZA 2Y1LE 3IHYA 3E33A 1OWNA 2P9NG 4O60A 3CHOA 4GAAA 4G25A 4B94A 4G8LA 1KZPA 3FTUA 2IF4A 4LG6A 2HM8A 1IYGA 2NYJA 2FF4A 3T8MA 3Q79A 3G2UA 2LAIA 3MCXA 4XEIG 5AENA 3DEOA 4UQYA 1A17A 4C48B 2EIME 3DSTA 4RVBA 1N4SA 3L22A 3APCA 5ENSD 5HRYA 1EF1C 4Y6WA 3SF4A 2AWIA 2IQCA 2UWJG 4UWLA 1WM5A 1L5JA 5FQ8A 5KNHD 2ZU6B 2C0LA 5J08A 3ZHEB 2J09A 4ILHB 4ABNA 3GW4A 1QNFA 3F6QA 4K5BA 2ZIRA 2WQ6A 1N0RA 4GPKA 4DRXE 3DWLG 3C72A 2WVIA 2V4LA 4WNGA 1O1SA 2P9KG 3GYZA 4O1OA 5FT9A 4A1GA 3TAXA 4AEZC 4C0MA 5EIDA 5KJNA 4ILIA 1PY1A 3U66A 3DSVA 3FUFA 5CMWA 1O1RA 1NZNA 1S63A 5FIOA 2I1KA 2FBNA 4F53A 4C9BB 3EHMA 5LCWJ 3DSSA 3JQ1A 3AJIA 4JZYA 4LRZA 4UWKA 4CZ2D 5JHAA 3HXBA 3CVWA 4BT8A 5AARA 3B7SA 1AP7A 3RAUA 5G55A 1N54A 4UQXA 2XS8A 1N0QA 4LUNU 2WXOA 3D9HA 1UN9A 4UUCA 5JHBA 3UKUG 4U63A 5G04J 1Z6TA 1DVPA 1KPSB 1Y8MA 3FUKA 3LYAA 1H0AA 3CKBA 4I9EA 3Q47B 4IRUA 4AP2A 1SQMA 3ZIMA 2VTBB 4LCTA 4HRLA 2A5EA 3IKOB 2GRNB 5ENNA 4HI9A 4CRWA 3ZFWA 4EZKA 3RIBA 3V2OA 3ULYA 1OY3D 3ABLE 4U8YD 3FUMA 4LNGA 2XPZA 1BD8A 3ULEG 4RG9A 3LJ3A 2X6JA 5KNGA 3DXMG 2XQ0A 4XKBA 1UW4B 4BEPA 3MEKA 5JJ6A 3QNKA 4JXTA 3ZW3A 3QARA 4GTRA 3SZ7A 4BESA 3S2AA 4FJZA 3DPDA 1TN7A 1TEZA 3SI5A 1N11A 5KJKA 2GRRB 4RQIA 2DYSE 3ABKE 4UQZA 5LP0A 3UUXA 2HYZA 1FT2A 4PS3A 3TL5A 1H2TC 4F7AA 3UT4A 2AXUA 3Q73A 4UWFA 5BT1A 3UX4A 4G1TA 5FZQA 3RRUA 3AAAC 4BX9A 3E4BA 4L9PA 3IBEA 5B1AE 4AVXA 3LY7A 4JD2G 4J8FA 4GYWA 1XGWA 4HOTA 5M72A 1TNZA 2AXVA 2AXZA 4HOUA 4AV7A 2L9BA 2DCPA 1EPUA 1JCSA 2J49A 1OWPA 3T8KA 3I3NA 5J90A 3QC1A 1DCEA 3U4TA 3ZPJA 1TNOA 2L6JA 4E85A 1NP7A 5E76A 4G23A 3UMVA 2QYUA 2WXNA 3CLJA 4N3AA 4K5CA 3RO2A 4HRMB 2IU1A 4JW1A 4GZ3A 2YQ8A 2XENA 3L17A 3ASFA 4DJAA 3HVEB 2VSNA 5JJ7A 3LY8A 4YDYA 2BKGA 2WXLA 3ESLA 4DUIA 2LNIA 4N5QA 2XCBA 5G05J 2QFCA 4M3OA 5FQ7A 4UWHA 3HVEA 3D9NA 4WNEA 3URZA 4KT6B 2VGXB 4YNDA 5DIZA 3U9WA 1MYOA 3PE4A 1SZ9A 3G2WA 2R2LA 1TN6A 3DRAA 2P9LG 4LERA 1AWCB 3LKUA 2VJ8A 2VGXA 4O1PA 4CT4A 4I9CA 5JA4D 4DK5A 3ZYKA 4QFVA 1UOHA 2V4HC 1MX6A 4AIFA 5EX3A 1TNUA 2LSVA 2JLBA 5AN8A 3SFXA 3ZNGA 4TV3A 1TJFA 3MKQB 3TJPA 4OYSA 1PC2A 4DLOA 4KBQA 3QWWA 5CEDB 1HFAA 2PM7A 2HO1A 2WXMA 3UIOC 3I4GA 3QJZA 4XZ4A 2PZIA 3MKQA 4WWPA 3HHMA 4GA1A 2X3MA 4UI9C 4MLPA 2AW6A 3AG3E 3UKRG 2PQRA 4HBDA 1N95A 3IHVA 5ENPD 5BV0A 1LD7A 3BG1B 2J07A 3FDHA 4YDOA 2HE0A 3I5PA 2FI7A 2OOEA 5ARFA 3R7QA 3FTYA 4OAUC 5FZRA 3RJVA 1SZAA 1W3BA 5EIBE 4ANUA 3J5QB 5FQ4A 3AS5A 5DBKA 3PRZA 3FH5A 3HYMB 5KCMA 2BF0X 1JUQA 3FWVA 1WDYA 3RU0A 4DX2A 1TYQG 4KZCA 4BY6A 2B0OE 1DNPA 4PDXA 4JA7A 3UTMA 4GYOA 1NA3A 1BI8B 3IEGA 3HRAA 3QKYA 4GA0A 1BI7B 4URKA 2PL2A 5JJTA 4CCAA 4HOQA 3PEUB 5AQBA 4BSZB 2JEKA 2KCKA 5G2NA 2I1JA 3EHRA 2ZXWE 1D9SA 4N2QA 3SO8A 1JPLA 4EPZA 3WXXA 3VLDA 4GCNA 2XEHA 3EU5A 5FJYA 1U3CA 1B89A 4AY6A 1YYHA 3PS6A 5C1DA 2BKKB 3EUVA 2P9SG 2OVBA 4OVVA 5H7PA 2P2CP 5FTPA 3D9OA 4LEUA 4F1SA 3MKRA 1E96B 3K9IA 5EILA 3EHQA 1O1TA 4NACA 2WXKA 3T9KA 3MV2B 3C3RA 1ZB1A 5BPPA 1S70B 2XEEA 1NFIE 4JC8A 1HX8A 4LNUD 3VTYA 3RO3A 4XKCA 3HXFA 4G2VA 1OCOE 5A7DB 2Q7FA 3TWVA 3GZ1A 4U96D 4FHKA 3KEAA 1RZ4A 5EDSA 1E8ZA 4B8AA 2J4BA 3PZDA 2QY7A 5CCMA 1MHQA 2XRZA 1GW6A 2B6CA 1P5QA 5HS0A 2QC9A 2P9PG 3IXEA 1IHBA 4U8VD 3SD5A 3SQVA 4J0UA 4GZDA 4F1PA 5B3SE 2YHEA 3FH8A 2ZGDA 5AYWD 3ONKA 3LCAA 2VSOE 3RKVA 3ASHA 3E30A 2GRPB 4BERA 1OWLA 1SVXA 4ATZD 5BV1A 2P9UG 1JWGA 3TWRA 1SW6A 2LO6A 1LD8A 3E34A 3ZN3A 2F8XK 3FTXA 4U04A 4UI9J 5AQ9A 2MHKA 4FJYA 1K1BA 1VDYA 1S64A 3D9MA 2KCVA 3W9FA 3JXJA 4PH4B 4LSZE 3V2XA 1OXJA 3NF1A 4I1OB 1QZ2A 3FU0A 1V54E 1UN8A 4A3TA 2CG2A 3CR3A 4NQ0A 2ETBA 4A3VA 4BWRA 2XGSA 3DSXA 3NZSA 3Q9NC 4JHKA 3ZUVB 3EHNA 3ULQA 4WNDA 3MZLB 4K5AB 3CIAA 2BUGA 1H6OA 2I2OA 2KXPC 3CSFA 2HR2A 3FTZA 4HNAD 2ZGGA 3ZXPA 1X5BA 4GTSA 3AU5A 4BT9A 2EQXA 2P58C 3Q4AB 3G2TA 4M7CA 4GMRA 3C3OA 3AS4A 3BQOA 3PZ4A 2CFUA 4LNBA 1MX2A 3UPVA 3CVPA 3SHFA 5CECB 3D9IA 2VSXE 3RRNB 5CCLA 3D3MA 3FH7A 1TNBA 1KT0A 4CDMA 2VGYA 4J8YA 1TN8A 5FQ6A 5HKPA 4JVSA 3R9MA 4Q96A 4HOSA 4ZHBA 4AM9A 2J4DA 5FINA 2CHZA 4CDNA 3SY2A 2J08A 3FU6A 4BSXA 2FEZA 3E32A 3CEQA 1E8YA 3CHQA 5ENQD 3CV0A 3R9AB 4ACLA 1MZCA 3CVXA 4N2SA 3Q78A
chains in the Genus database with same CATH topology
3HVEA 4JHRA 1HF8A 3D9NA 4WNEA 3MV3B 1NA0A 4WWNA 2XCCA 5HI7A 4B8CB 4D10C 3URZA 4I2ZA 4KT6B 2VGXB 4YNDA 4K03A 5D0QD 1BPOA 4E6HA 5DIZA 3U9WA 3PE4A 1SZ9A 3OXGA 1PAQA 3CQCB 3TGOA 3G2WA 4UI9K 3ZGQA 4DI3A 3PDNA 1OUVA 4J8SA 5LOZA 4LERA 4KXKB 4TUUA 1HU3A 3LKUA 1FVFA 2VJ8A 3JYSA 1S0PA 2VGXA 4FULA 4GU5A 2WMNA 4I9CA 4CT4A 4EZJA 2CFZA 3TG5A 2Y4UA 4DK5A 3ZYKA 4QFVA 3UT7A 3QWPA 4ANWA 2WXQA 1WY6A 3ZHEA 4WUYA 2WXJA 2YINA 4AIFA 5EX3A 2C0MA 3AS8A 1FVHA 2LSVA 3ML9A 3OAWA 2JLBA 5G05C 5BUZA 4JA9A 2Y3AA 2M63A 4TV3A 4HORA 1TJFA 4N3CA 2L0TB 3MKQB 3APFA 4U07A 4BFRA 1H2UA 3TJPA 4OYSA 1PC2A 3EIQC 3FTWA 1Y6IA 3SBTB 3FEXA 4H7YA 3ASDA 4DLOA 2YHCA 4KBQA 3QWWA 3KEZA 2IFUA 4YVOA 2A5UA 1HFAA 2PM7A 2HO1A 2PM6A 2WXMA 2XHEA 3CVNA 3T5XA 3I4GA 3QJZA 5LFAA 4XZ4A 2PZIA 4FLHA 1IQRA 4MRUA 5BNWA 2MOWA 3L54A 5CMYA 3CHPA 3FEYA 4FLBA 3MKQA 2WXPA 3FHEA 1HS6A 2GRMA 3HHMA 4WWPA 4GA1A 2X6HA 3ZRHA 3RK6A 4L2LA 4YVQC 2X3MA 4UI9C 1INZA 4MLPA 2WXHA 3OXFA 4B0ZA 3CSTA 3IHYA 3GZ2A 2AW6A 4BX8A 1OWNA 3Q49B 3SGHA 3QOUA 2PQRA 3CHOA 4PS7A 4GAAA 3IHVA 2WM9A 4G25A 4B94A 2VYIA 5EX0A 2XGMA 3FTUA 3VTXA 1ELWA 3DBSA 2IF4A 3JCKC 5BV0A 4ME2A 3BG1B 3FU5A 3OXLA 4K0RA 2IJGX 2HM8A 2IOLA 1IYGA 2J07A 3FDHA 4L2YA 4N39A 4GMLA 3CVUA 2FF4A 3FUNA 1OWOA 3T8MA 4XI0A 3G2VA 3B7RL 3G2UA 3I5PA 2FI7A 5A6CA 1HO8A 3ZYLA 2NSZA 2WXFA 4B89A 2LAIA 3FUJA 4R7LA 4V3IA 4Q69A 3LEWA 2OOEA 5ARFA 4WNFA 3MCXA 3APDA 4I6JA 3R7QA 3FTYA 3R7RA 2UY1B 4U0UA 1HG2A 3N71A 5AENA 3I4RB 1A17A 3O4ZA 3PNLB 4UQYA 3S7JA 3S7DA 5FZRA 3RJVA 1SZAA 2CHXA 4U8HA 1W3BA 4ANUA 4P29A 1EDUA 3CHSA 5FQ4A 3S7FA 3AS5A 3TXNA 2ILRA 4RVBA 3NZUA 3MJWA 5DBKA 1HG5A 2GGFA 3PRZA 3L22A 2UY1A 3APCA 2WB2A 1IQUA 3FH5A 2MRIA 3HYMB 3JUIA 5KCMA 2XGOA 2BF0X 3BEEA 1EF1C 4G24A 4Y6WA 4APOA 1JUQA 3QWVA 3FWVA 1WAO1 3SF4A 2AWIA 4I2WA 2IQCA 2UWJG 4UWLA 3RU0A 2OVFA 1WM5A 3LVQE 2VTBA 1L5JA 5FQ8A 4KZCA 2ZU6B 5ARGA 3C98A 4BY6A 4W9RA 4U0ZA 1DNPA 4N5CA 2C0LA 2KCLA 4I1MA 5C2YA 3ZHEB 2J09A 2NXPA 5J08A 4ILHB 3PVLA 4JA7A 1UJKA 1H2VC 2VQ2A 4PDXA 4GYOA 3UQ3A 1NA3A 3GW4A 4FC8A 5ANLA 4ABNA 3EDTB 1QNFA 5FZSA 1E8XA 3FTSA 5ANRA 2WQ6A 4GYYA 3QB2A 3IEGA 4GPKA 3QKYA 4GA0A 5A23A 1HXIA 1HH8A 2WVIA 4URKA 1TJCA 2PL2A 4XE0A 4KZ0A 3ZYMA 5JJTA 4CCAA 4HOQA 4I6GA 2V4LA 4WNGA 3PEUB 2RG8A 3ML8A 5EKQD 3GYZA 5FT9A 4A1GA 2JEKA 2KCKA 3TAXA 3BG0B 3TXMA 5G2NA 2I1JA 4KMOA 3PUKA 4AEZC 2I6HA 4L23A 4C0MA 4N2QA 1OWMA 3LPZA 2J9QA 5KJNA 4ILIA 4RSYA 3VLFA 4I6EA 4OVUA 1PY1A 1JPLA 3U66A 5E75A 3WXXA 4EPZA 1HE8A 3PE3A 2ONDA 3FUFA 3VLDA 5CMWA 1NZNA 4GCNA 1Z3YA 5FJYA 2WQHA 2R17C 3SBSA 1U3CA 1B89A 5FWQA 2PQNA 4AY6A 2I1KA 4EZLA 2XPYA 3D9PA 2FBNA 3PNTB 4PS8A 4F53A 3PS6A 4C9BB 5C1DA 2WXIA 1ELKA 3P1UA 3SNXA 2LSUA 3EHMA 5LCWJ 4I17A 2OVBA 3JQ1A 4OVVA 4JZYA 4LRZA 4UWKA 5JHAA 1KT1A 1FCHA 5FTPA 4DPRA 3KS2A 3D9OA 1IHGA 4LEUA 3CVWA 4BT8A 4F1SA 3KAEA 4J8DA 3B7SA 3MKRA 2KZTB 2FO7A 2IONA 1E96B 4CDRA 2XRYA 4GZ5A 4MKTA 5G55A 3K9IA 1N54A 4FADA 3HIZA 4UQXA 4Q94A 1Z3XA 4LUNU 2WXOA 4NACA 2WXKA 1H19A 3P2BA 1N52A 3MV2B 5LX8A 3CHMA 3FFLA 4A55A 2KC7A 5BPPA 3T5VA 3CK9A 1UN9A 2KZTA 3FU3A 4JC8A 4XIFA 1HX8A 3U64A 1H6KA 3VTYA 5JHBA 4U63A 4KVOA 5G04J 1Z6TA 3MX3A 4AOFA 1DVPA 3ZXSA 3RO3A 1Y8MA 3FUKA 1JWFA 2R5SA 2V8SE 2WMOA 4ILGA 4N3BA 1MQSA 1UG3A 1ZBPA 4G2VA 4XKCA 3LYAA 3MYVA 1H0AA 4JPSA 2X6IA 3CKBA 2Q7FA 5A7DB 3GZ1A 4I9EA 3L16A 3Q47B 4FP7A 3TG4A 4DI4A 4IRUA 2YNQA 2FULA 2NC9A 4FHKA 4C0EA 4AP2A 1SQMA 3OTNA 3ZIMA 5EDSA 1E8WA 2LAHA 1E8ZA 4GB9A 4BTAA 2DBAA 2VTBB 4LCTA 4B8AA 4ACKA 4XI9A 3ZYQA 2V5FA 3IKOB 3NQPA 3MA5A 2J4BA 3PZDA 5ENNA 2QY7A 5CCMA 1MHQA 5KJMA 2XRZA 1GW6A 4I1AA 2L0IA 4CRWA 1P5QA 3JQ0A 3PH0C 3ZFWA 2E0IA 2KATA 4EZKA 3SD5A 3FUEA 4J0UA 2R59A 3ONLA 4GZDA 3KD7A 3RIBA 2KM4A 4A1SA 4XX5A 2X38A 2YHEA 3FH8A 5T8IA 4TRQA 1ELRA 4G11A 5AYWD 3FUMA 3ONKA 3ESKA 3LCAA 3PREA 2VSOE 3RKVA 3VLEA 3ASHA 2XPZA 4MS6A 4EQFA 3L13A 2RD0A 2WPVA 1OWLA 4RG9A 3LJ3A 2X6JA 5BV1A 4KVMA 3FP3A 1JWGA 3O48A 2XQ0A 4Y6CA 4GCOA 4CGVA 4EECA 4XKBA 1UW4B 2LO6A 3MEKA 4G26A 5JJ6A 5T4YA 3QNKA 4JXTA 3ZW3A 3CQGB 3CKCA 4F3VA 3ZN3A 3CVQA 3PUJA 3QARA 4CT0A 3SZ7A 3S2AA 2XPIA 3G2SA 3FTXA 4U04A 4FJZA 4DLQA 3DPDA 4UI9J 2MHKA 2WQ7A 4FJYA 4U0SA 3LDZA 3SI5A 1ZU2A 4APFA 5KJKA 1TEZA 4CGWA 2Y4TA 1VDYA 1U3DA 2IOSA 3D9MA 3ASGA 1HZ4A 4UQZA 5LP0A 2KCVA 3UUXA 3EIJA 2HYZA 4PH4B 2DIWA 3FUIA 4PS3A 3TL5A 2GRLA 4ANXA 1H2TC 3L08A 4F7AA 3UT4A 1EYHA 3NF1A 4FU3A 3PEVB 4IN3B 2AXUA 3LVRE 4AJWA 3CK7A 1QZ2A 3FU0A 4I1OB 4A3TA 1UN8A 3D9LA 3HDXA 2CG2A 4UWFA 4AY5A 5BT1A 3L6AA 3CR3A 4G1TA 5FZQA 3UX4A 4NQ0A 4UWGA 2GW1A 5AJDA 3RRUA 4A3VA 4BWRA 1LF8A 2BTDA 2C2LA 3CVLA 4NURA 3B7UX 3QAQA 4GZ6A 4BX9A 3E4BA 3U3WA 2XGSA 4H7XA 3NZSA 3IBEA 4JHKA 3LS8A 3Q15A 3EHNA 4WAFA 3ULQA 4AVXA 3LY7A 4WNDA 4HVBA 3MZLB 3FTVA 2X6FA 2CG3A 3FY4A 4JL0A 4O6FA 5T3RA 3ZVVA 1XNFA 4HLEA 3CIAA 4J8FA 2I9CA 4GYWA 2WXRA 2V0PA 2BUGA 1XGWA 3CVYA 2X6KA 4HOTA 4ATGA 4L7TA 5M72A 2I2OA 3CSFA 3LY9A 2HR2A 3FTZA 2XEVA 2AXVA 4JHJA 2AXZA 4HOUA 4AV7A 2L9BA 1X5BA 2DCPA 5HQ8A 1EPUA 3B7TA 3AU5A 4JEUA 2EQXA 4BT9A 4L1BA 2P58C 3ENEA 3Q4AB 3G2TA 2AVPA 1OWPA 2J49A 4NRHB 5BW8C 3FULA 3I3NA 3Q5MA 3EJNA 3ZEFA 3S7BA 4CEMA 5J90A 3QC1A 4HXIA 3AS4A 5KJLA 4GZCA 3U4TA 3ZPJA 3CVVA 4J8EA 4AXHA 2CFUA 3SFZA 2L6JA 4E85A 3FUDA 3UPVA 2CHWA 3CVPA 3LXUX 1NP7A 3SHFA 3D9IA 4KYOB 5E76A 2VSXE 3QK0A 3IV0A 3RRNB 4EBAA 5CCLA 4G23A 3UMVA 1KLXA 2WXNA 3D3MA 3FH7A 5CHEE 3QDNA 1KT0A 2VSYA 4CDMA 5LCWC 3CLJA 4N3AA 2VGYA 3D9JA 3FUHA 5D0OD 5FQ6A 3RO2A 4JVSA 2IU1A 4JW1A 3CK8A 2YQ8A 1YA0A 4GZ3A 4Q96A 4HOSA 4ANVA 3D9KA 4AM9A 3L17A 4GMJA 2J4DA 4J6IA 3UT8A 3ASFA 2CHZA 3CHRA 1E7UA 4CDNA 3B13A 2J08A 2E2EA 4GA2A 4DJAA 3HVEB 2VSNA 4I43A 3FU6A 3RRMB 4FA6A 3LY8A 4BSXA 5JJ7A 1E90A 4IYPA 4WWOA 2A4ZA 4PUCA 2FEZA 2WXLA 3ESLA 3AU4A 4IULA 4HS2A 1UJJA 3GZSA 4FHJA 4RG6A 3CEQA 2LNIA 1E8YA 5AJLA 4EBAG 2XCBA 2WXGA 5G05J 3CGHA 3CHQA 2QFCA 3MGBA 3CV0A 3R9AB 4ACLA 5AIJA 5G04C 4M3OA 3CVXA 1QQEA 2OV8A 4N2SA 5FQ7A 4BTBA 4UWHA 4JEHA 4HFGA 1E7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHR A;  4WNE A;  3MV3 B;  1NA0 A;  2XCC A;  5HI7 A;  3URZ A;  4I2Z A;  2VGX B;  4YND A;  5D0Q D;  5DIZ A;  3PE4 A;  3OXG A;  3TGO A;  4UI9 K;  3ZGQ A;  3PDN A;  1OUV A;  4KXK B;  3LKU A;  3JYS A;  2VGX A;  4I9C A;  3TG5 A;  2Y4U A;  3QWP A;  3ZHE A;  4WUY A;  4AIF A;  5EX3 A;  2C0M A;  3AS8 A;  2LSV A;  5G05 C;  2JLB A;  4JA9 A;  4HOR A;  4N3C A;  4U07 A;  1PC2 A;  4H7Y A;  3ASD A;  2YHC A;  4KBQ A;  3QWW A;  2IFU A;  4YVO A;  2HO1 A;  3CVN A;  5BNW A;  2PZI A;  4GA1 A;  4YVQ C;  4UI9 C;  3OXF A;  3GZ2 A;  3Q49 B;  3QOU A;  2PQR A;  4G25 A;  4B94 A;  2VYI A;  5EX0 A;  2XGM A;  3VTX A;  1ELW A;  2IF4 A;  4ME2 A;  3OXL A;  1IYG A;  4N39 A;  2FF4 A;  4XI0 A;  2FI7 A;  5A6C A;  2OOE A;  5ARF A;  4WNF A;  2UY1 B;  4U0U A;  3N71 A;  4UQY A;  1A17 A;  3S7J A;  3S7D A;  5FZR A;  3RJV A;  1W3B A;  3S7F A;  3AS5 A;  5DBK A;  2UY1 A;  3HYM B;  2XGO A;  3BEE A;  4G24 A;  4Y6W A;  4APO A;  3QWV A;  3FWV A;  1WAO 1;  3SF4 A;  4I2W A;  2UWJ G;  3RU0 A;  1WM5 A;  5ARG A;  4W9R A;  4U0Z A;  4N5C A;  2C0L A;  2KCL A;  3ZHE B;  4JA7 A;  3UQ3 A;  2VQ2 A;  4ABN A;  4GYO A;  1NA3 A;  3GW4 A;  3EDT B;  5FZS A;  4GYY A;  3IEG A;  4GPK A;  3QKY A;  4GA0 A;  1HXI A;  1HH8 A;  1TJC A;  2PL2 A;  5JJT A;  4HOQ A;  4WNG A;  3GYZ A;  5FT9 A;  2KCK A;  3TAX A;  2I6H A;  4N2Q A;  3LPZ A;  2J9Q A;  5KJN A;  3WXX A;  3PE3 A;  2OND A;  1NZN A;  4GCN A;  5FJY A;  2WQH A;  1B89 A;  2PQN A;  4AY6 A;  2FBN A;  5C1D A;  2LSU A;  5LCW J;  4I17 A;  1KT1 A;  1FCH A;  5FTP A;  3KS2 A;  1IHG A;  4LEU A;  4BT8 A;  3KAE A;  4J8D A;  3MKR A;  2FO7 A;  1E96 B;  4CDR A;  4GZ5 A;  3K9I A;  4UQX A;  3MV2 B;  3FFL A;  2KC7 A;  3CK9 A;  4XIF A;  3VTY A;  5G04 J;  3RO3 A;  1Y8M A;  2R5S A;  4N3B A;  5EKQ D;  4G2V A;  1ZBP A;  3LYA A;  3CKB A;  5A7D B;  2Q7F A;  3GZ1 A;  4I9E A;  3Q47 B;  3TG4 A;  2NC9 A;  4BTA A;  2DBA A;  4XI9 A;  2V5F A;  3MA5 A;  5CCM A;  5KJM A;  4I1A A;  1P5Q A;  3ZFW A;  2KAT A;  4J0U A;  3RIB A;  3KD7 A;  4A1S A;  1ELR A;  5AYW D;  3ESK A;  3LCA A;  3RKV A;  3ASH A;  4EQF A;  2WPV A;  4RG9 A;  3FP3 A;  3O48 A;  4Y6C A;  4GCO A;  4CGV A;  3MEK A;  4G26 A;  5JJ6 A;  4F3V A;  3CKC A;  3ZN3 A;  3CVQ A;  3SZ7 A;  2XPI A;  4U04 A;  4UI9 J;  2MHK A;  4U0S A;  1ZU2 A;  5KJK A;  4CGW A;  2Y4T A;  3ASG A;  1HZ4 A;  4UQZ A;  2KCV A;  3UUX A;  2HYZ A;  3NF1 A;  4IN3 B;  3CK7 A;  1QZ2 A;  5BT1 A;  4AY5 A;  4G1T A;  5FZQ A;  4NQ0 A;  2GW1 A;  4BWR A;  2C2L A;  3CVL A;  3U3W A;  4GZ6 A;  3E4B A;  2XGS A;  4H7X A;  3Q15 A;  3ULQ A;  3LY7 A;  4WND A;  4JL0 A;  4O6F A;  1XNF A;  4J8F A;  4GYW A;  2BUG A;  4HOT A;  5M72 A;  3LY9 A;  2HR2 A;  2XEV A;  4HOU A;  5HQ8 A;  4BT9 A;  2P58 C;  3Q4A B;  2AVP A;  4NRH B;  5BW8 C;  3Q5M A;  3S7B A;  3AS4 A;  5KJL A;  3U4T A;  3ZPJ A;  4J8E A;  2L6J A;  3UPV A;  3CVP A;  4KYO B;  5CCL A;  4G23 A;  1KLX A;  5CHE E;  3QDN A;  1KT0 A;  2VSY A;  5LCW C;  4N3A A;  2VGY A;  5D0O D;  3RO2 A;  3CK8 A;  2YQ8 A;  1YA0 A;  4GZ3 A;  4HOS A;  4AM9 A;  3ASF A;  2E2E A;  4GA2 A;  2VSN A;  5JJ7 A;  3LY8 A;  2FEZ A;  4RG6 A;  3CEQ A;  2LNI A;  2XCB A;  5G05 J;  2QFC A;  3CV0 A;  3R9A B;  5G04 C;  1QQE A;  4N2S A;  4BTB A; 
#chains in the Genus database with same CATH topology
 1TNY A;  3PZ1 A;  2JAB A;  2XCC A;  4B8C B;  4D10 C;  2R05 A;  4I2Z A;  4E6H A;  4DI3 A;  1OUV A;  1NI1 A;  3SFY A;  1OT8 A;  1S0P A;  2WMN A;  2CFZ A;  4TXP A;  2YIN A;  3ML9 A;  4JA9 A;  2H6F A;  4HOR A;  4BFR A;  3EIQ C;  5EYP F;  3ASD A;  4CYM D;  3KEZ A;  4YVO A;  5KWD A;  5LFA A;  5BNW A;  4MRU A;  2MOW A;  3L54 A;  1N94 A;  3CHP A;  3FEY A;  4FLB A;  3ZRH A;  3HXC A;  1DCQ A;  2RFM A;  2WXH A;  3CST A;  3GZ2 A;  1MJ0 A;  3NBN B;  3SGH A;  5CBN A;  4PS7 A;  3ASN E;  5CRU A;  2XGM A;  3VTX A;  1ELW A;  3JCK C;  3W9G A;  2OEV A;  3FU5 A;  4K0R A;  2IJG X;  2IOL A;  4L2Y A;  2LXL A;  3G2V A;  2MYO A;  5A6C A;  2NSZ A;  4B89 A;  3FUJ A;  4V3I A;  4EHM A;  3LEW A;  4WNF A;  3APD A;  2UY1 B;  1HG2 A;  3N71 A;  3I4R B;  3PNL B;  3S7D A;  3UM0 A;  1X81 A;  3NOC D;  1EDU A;  3S7F A;  3TXN A;  2ILR A;  1H6P A;  3NZU A;  3MJW A;  1LTX A;  3L9T A;  2UY1 A;  2V5Q C;  2WB2 A;  1IQU A;  2MRI A;  3NB2 A;  3JUI A;  5BXU A;  4Z68 A;  2LXM A;  2OEW A;  5ARG A;  3C98 A;  4W9R A;  4N5C A;  2NXP A;  3PVL A;  1H2V C;  1E8X A;  4GYY A;  1HH8 A;  4I6G A;  1IKN D;  3TWQ A;  1QBQ A;  4HQD A;  3BG0 B;  3PUK A;  2I6H A;  2IEJ A;  4L23 A;  1OWM A;  2LUH A;  4RSY A;  3VLF A;  4I6E A;  3ZU7 B;  4JB8 P;  2ETA A;  3PE3 A;  2OND A;  3JUE A;  2WQH A;  3SBS A;  2ZIS A;  3TWU A;  2XPY A;  2WXI A;  2LSU A;  1OCR E;  1A5E A;  1FCH A;  4DPR A;  1IHG A;  3KAE A;  4J8D A;  2KZT B;  2FO7 A;  2ION A;  4CDR A;  2XRY A;  4MKT A;  2H6G A;  4FAD A;  3HIZ A;  4Q94 A;  3V31 A;  4RLY A;  3P2B A;  1N52 A;  3CHM A;  3FFL A;  2KC7 A;  3T5V A;  2KZT A;  4KVO A;  4GTM A;  3MX3 A;  4AOF A;  3ZXS A;  4N3B A;  1N4Q A;  4JPS A;  3PZ3 A;  2X6I A;  3C5R A;  3L16 A;  4FP7 A;  2YNQ A;  2FUL A;  2IO3 C;  1SA5 A;  2NC9 A;  4C0E A;  5EN5 D;  5CRV A;  2LAH A;  4GB9 A;  2DBA A;  3UXG A;  2V5F A;  3NQP A;  3MA5 A;  3ABM E;  2F8Y A;  5KJM A;  2L0I A;  3TWS A;  3PH0 C;  2E0I A;  4U95 D;  2DZO A;  2R59 A;  3ONL A;  3KD7 A;  1FT1 A;  5AQ7 A;  2KM4 A;  4A1S A;  4XX5 A;  2X38 A;  5T8I A;  4TRQ A;  1ELR A;  4G8K A;  1BU9 A;  1WG0 A;  4MS6 A;  3L13 A;  2WPV A;  4TXQ A;  4Y6C A;  3ZKJ A;  4CGV A;  4EEC A;  2EIJ E;  2XS1 A;  4G26 A;  5T4Y A;  4F3V A;  4NIK A;  4CT0 A;  2L6B A;  4DLQ A;  4U0S A;  3LDZ A;  1ZU2 A;  4APF A;  4CGW A;  2Y4T A;  1NL4 A;  3ASG A;  1HZ4 A;  1G3N B;  3Q75 A;  3FUI A;  3L08 A;  4IN3 B;  3PEV B;  3LVR E;  3HDX A;  4AY5 A;  2GW1 A;  3EU9 A;  1LF8 A;  2C2L A;  5AQA A;  3CVL A;  3B7U X;  3QAQ A;  4GZ6 A;  4WAF A;  3BU8 A;  3ZVV A;  2KBX A;  1XNF A;  3DXK G;  1OCC E;  2I9C A;  2WXR A;  2V0P A;  5D2M C;  3CVY A;  4ATG A;  4L7T A;  3LY9 A;  2XEV A;  2EIK E;  1N4P A;  4L1B A;  4NRH B;  5BW8 C;  3Q5M A;  3ZEF A;  3EJN A;  3S7B A;  3B95 A;  5CBO A;  4DX7 D;  4J8E A;  4AXH A;  3FUD A;  3HXE A;  4KYO B;  1Z5S C;  5KBA A;  3QK0 A;  3IV0 A;  1V55 E;  1KLX A;  2VSY A;  3D9J A;  5D0O D;  4YDW A;  3ASO E;  4GMJ A;  3UT8 A;  3CHR A;  1E7U A;  1U2V G;  1E90 A;  4IYP A;  4WWO A;  4HS2 A;  3J5P A;  2QYJ A;  3GZS A;  4RG6 A;  4DX5 D;  5AJL A;  2WXG A;  2R02 A;  3CGH A;  5AIJ A;  4JEH A;  4HFG A;  4F6R D;  1NA0 A;  5HI7 A;  4DX1 A;  3PZ2 A;  4K03 A;  1BPO A;  2H6H A;  3OXG A;  3TGO A;  3ZGQ A;  4J7W A;  4J8S A;  4TUU A;  1HU3 A;  2BED A;  4GU5 A;  2DWZ A;  5BXO A;  4ANW A;  1WY6 A;  4HI8 A;  2DVW A;  5CEA A;  3ZHE A;  4WUY A;  2WXJ A;  1JCQ A;  2C0M A;  3AS8 A;  5ENR D;  4B93 B;  1FVH A;  5G05 C;  3OAW A;  5BUZ A;  2Y3A A;  3APF A;  4U07 A;  3FTW A;  1Y6I A;  3SBT B;  3FEX A;  4H7Y A;  1QYM A;  1OCZ E;  2A5U A;  3TWW A;  2XHE A;  1O5M A;  1IQR A;  4ZFH A;  2Y0B G;  1HS6 A;  2GRM A;  2X6H A;  4YVQ C;  3LJN A;  1INZ A;  3OXF A;  4B0Z A;  3Q7A A;  4BX8 A;  3HXD A;  3Q49 B;  3QOU A;  2WM9 A;  2VYI A;  5EX0 A;  3DBS A;  4ME2 A;  4GPM A;  3OXL A;  5ENT D;  4N39 A;  4GML A;  3CVU A;  3FUN A;  1OWO A;  4XI0 A;  3B7R L;  4A63 B;  1HO8 A;  3ZYL A;  1N4R A;  2WXF A;  4Q69 A;  4R7L A;  4I6J A;  3R7R A;  4U0U A;  5EYL A;  1TR4 A;  3O4Z A;  3S7J A;  3C3Q A;  3JXI A;  2CHX A;  4U8H A;  4P29 A;  3CHS A;  1MX4 A;  5CER B;  1HG5 A;  2GGF A;  1FPP A;  2XGO A;  3BEE A;  4G24 A;  4APO A;  2VGE A;  3QWV A;  4OAV B;  1WAO 1;  4I2W A;  2GRQ B;  2OVF A;  3LVQ E;  2VTB A;  3Q7F A;  4U0Z A;  3TWT A;  2KCL A;  4I1M A;  5C2Y A;  5IY5 E;  3UQ3 A;  4HLL A;  1UJK A;  2VQ2 A;  5ANL A;  4FC8 A;  3EDT B;  5FZS A;  3FTS A;  5ANR A;  3QB2 A;  5A23 A;  1HXI A;  1TJC A;  4XE0 A;  4KZ0 A;  3ZYM A;  2RG8 A;  3ML8 A;  3UM1 A;  5B1B E;  3TXM A;  2Y69 E;  4KMO A;  3LPZ A;  2J9Q A;  4OVU A;  5E75 A;  1HE8 A;  3RSE G;  2XZD G;  1Z3Y A;  2R17 C;  5FWQ A;  2PQN A;  4EZL A;  3DPY A;  3D9P A;  3PNT B;  4PS8 A;  1ELK A;  3P1U A;  4GTV A;  3SNX A;  4I17 A;  5JMN D;  1KT1 A;  3KS2 A;  1YCS B;  4GZ5 A;  3TWX A;  1N9A A;  2DYR E;  1Z3X A;  1H19 A;  5LX8 A;  3X2Q E;  4A55 A;  3V79 K;  3CK9 A;  4XIF A;  3FU3 A;  3U64 A;  1H6K A;  3AG4 E;  5EKQ D;  1JWF A;  2R5S A;  2V8S E;  2WMO A;  4ILG A;  1MQS A;  1UG3 A;  1ZBP A;  3MYV A;  2IO2 C;  3KSL A;  3TG4 A;  4DI4 A;  5ITZ F;  4BET A;  1K8K G;  3BUA A;  1RW2 A;  4U7E B;  3OTN A;  1E8W A;  4BTA A;  4ACK A;  4XI9 A;  3ZYQ A;  1K1A A;  4GTQ A;  3DSW A;  4I1A A;  2QZA A;  3JQ0 A;  2KAT A;  2P9I G;  3B7B A;  3FUE A;  1SA4 A;  2XZT G;  4G11 A;  3ISM C;  4MBG A;  3ESK A;  2IY0 C;  2AJA A;  3PRE A;  3VLE A;  3UIP C;  4EQF A;  2RD0 A;  4KVM A;  3FP3 A;  3O48 A;  2F37 A;  4GCO A;  4YDE A;  3NOG D;  5AAO A;  3CQG B;  3CKC A;  3CVQ A;  3PUJ A;  3UM2 A;  2XPI A;  3G2S A;  2WQ7 A;  2RKK A;  1U3D A;  2IOS A;  4QQI A;  5D66 A;  1KZO A;  3Q9U C;  2OCC E;  3EIJ A;  1D8E A;  4GTP A;  2DIW A;  2GRL A;  4ANX A;  1EYH A;  4FU3 A;  4GTT A;  4AJW A;  3CK7 A;  2PNN A;  3D9L A;  3DEP A;  1BLX B;  3L6A A;  4UWG A;  5AJD A;  3UI2 A;  2BTD A;  4NUR A;  3U3W A;  3E37 A;  4H7X A;  3LS8 A;  3Q15 A;  4HRN A;  4HVB A;  3FTV A;  2X6F A;  2CG3 A;  3FY4 A;  4JL0 A;  4O6F A;  5T3R A;  4HLE A;  2X6K A;  4JHJ A;  2ETC A;  1YMP A;  5HQ8 A;  3WG7 E;  3B7T A;  4JEU A;  3ENE A;  2AVP A;  3FUL A;  4CEM A;  4HXI A;  3L82 A;  4GTO A;  3KSQ A;  5KJL A;  4GZC A;  3CVV A;  3UM3 A;  3DSU A;  3SFZ A;  2CHW A;  3LXU X;  4DX6 D;  4EBA A;  1JCR A;  5CHE E;  3QDN A;  5LCW C;  3FUH A;  1IXV A;  3CK8 A;  1YA0 A;  2R03 A;  4ANV A;  3D9K A;  4J6I A;  3V30 A;  3AG2 E;  3B13 A;  2E2E A;  4GA2 A;  4I43 A;  3RRM B;  4FA6 A;  4X8Q A;  2A4Z A;  4PUC A;  3UIN C;  3AU4 A;  4IUL A;  1UJJ A;  4FHJ A;  4EBA G;  2FO1 E;  2RFA A;  3MGB A;  5G04 C;  1QQE A;  2OV8 A;  4BTB A;  1E7V A;  4JHR A;  1HF8 A;  3MV3 B;  4WWN A;  2F0Y A;  2GRO B;  3AG1 E;  2DZN A;  5D0Q D;  1PAQ A;  2EIN E;  3CQC B;  4TUM A;  4UI9 K;  3NAW A;  3PDN A;  5LOZ A;  2EIL E;  4KXK B;  4TXR A;  1FVF A;  3JYS A;  4FUL A;  4EZJ A;  3TG5 A;  1K3Z D;  1DC2 A;  2Y4U A;  3UT7 A;  3QWP A;  2WXQ A;  1D8D A;  4HB5 A;  2M63 A;  4N3C A;  2L0T B;  1H2U A;  5ENO D;  2H6I A;  2YHC A;  2IFU A;  2PM6 A;  3CVN A;  2J8S D;  3T5X A;  4FLH A;  3HG0 D;  5CMY A;  2WXP A;  3FHE A;  3RK6 A;  4L2L A;  1Q2Z A;  2Y1L E;  3IHY A;  3E33 A;  1OWN A;  2P9N G;  4O60 A;  3CHO A;  4GAA A;  4G25 A;  4B94 A;  4G8L A;  1KZP A;  3FTU A;  2IF4 A;  4LG6 A;  2HM8 A;  1IYG A;  2NYJ A;  2FF4 A;  3T8M A;  3Q79 A;  3G2U A;  2LAI A;  3MCX A;  4XEI G;  5AEN A;  3DEO A;  4UQY A;  1A17 A;  4C48 B;  2EIM E;  3DST A;  4RVB A;  1N4S A;  3L22 A;  3APC A;  5ENS D;  5HRY A;  1EF1 C;  4Y6W A;  3SF4 A;  2AWI A;  2IQC A;  2UWJ G;  4UWL A;  1WM5 A;  1L5J A;  5FQ8 A;  5KNH D;  2ZU6 B;  2C0L A;  5J08 A;  3ZHE B;  2J09 A;  4ILH B;  4ABN A;  3GW4 A;  1QNF A;  3F6Q A;  4K5B A;  2ZIR A;  2WQ6 A;  1N0R A;  4GPK A;  4DRX E;  3DWL G;  3C72 A;  2WVI A;  2V4L A;  4WNG A;  1O1S A;  2P9K G;  3GYZ A;  4O1O A;  5FT9 A;  4A1G A;  3TAX A;  4AEZ C;  4C0M A;  5EID A;  5KJN A;  4ILI A;  1PY1 A;  3U66 A;  3DSV A;  3FUF A;  5CMW A;  1O1R A;  1NZN A;  1S63 A;  5FIO A;  2I1K A;  2FBN A;  4F53 A;  4C9B B;  3EHM A;  5LCW J;  3DSS A;  3JQ1 A;  3AJI A;  4JZY A;  4LRZ A;  4UWK A;  4CZ2 D;  5JHA A;  3HXB A;  3CVW A;  4BT8 A;  5AAR A;  3B7S A;  1AP7 A;  3RAU A;  5G55 A;  1N54 A;  4UQX A;  2XS8 A;  1N0Q A;  4LUN U;  2WXO A;  3D9H A;  1UN9 A;  4UUC A;  5JHB A;  3UKU G;  4U63 A;  5G04 J;  1Z6T A;  1DVP A;  1KPS B;  1Y8M A;  3FUK A;  3LYA A;  1H0A A;  3CKB A;  4I9E A;  3Q47 B;  4IRU A;  4AP2 A;  1SQM A;  3ZIM A;  2VTB B;  4LCT A;  4HRL A;  2A5E A;  3IKO B;  2GRN B;  5ENN A;  4HI9 A;  4CRW A;  3ZFW A;  4EZK A;  3RIB A;  3V2O A;  3ULY A;  1OY3 D;  3ABL E;  4U8Y D;  3FUM A;  4LNG A;  2XPZ A;  1BD8 A;  3ULE G;  4RG9 A;  3LJ3 A;  2X6J A;  5KNG A;  3DXM G;  2XQ0 A;  4XKB A;  1UW4 B;  4BEP A;  3MEK A;  5JJ6 A;  3QNK A;  4JXT A;  3ZW3 A;  3QAR A;  4GTR A;  3SZ7 A;  4BES A;  3S2A A;  4FJZ A;  3DPD A;  1TN7 A;  1TEZ A;  3SI5 A;  1N11 A;  5KJK A;  2GRR B;  4RQI A;  2DYS E;  3ABK E;  4UQZ A;  5LP0 A;  3UUX A;  2HYZ A;  1FT2 A;  4PS3 A;  3TL5 A;  1H2T C;  4F7A A;  3UT4 A;  2AXU A;  3Q73 A;  4UWF A;  5BT1 A;  3UX4 A;  4G1T A;  5FZQ A;  3RRU A;  3AAA C;  4BX9 A;  3E4B A;  4L9P A;  3IBE A;  5B1A E;  4AVX A;  3LY7 A;  4JD2 G;  4J8F A;  4GYW A;  1XGW A;  4HOT A;  5M72 A;  1TNZ A;  2AXV A;  2AXZ A;  4HOU A;  4AV7 A;  2L9B A;  2DCP A;  1EPU A;  1JCS A;  2J49 A;  1OWP A;  3T8K A;  3I3N A;  5J90 A;  3QC1 A;  1DCE A;  3U4T A;  3ZPJ A;  1TNO A;  2L6J A;  4E85 A;  1NP7 A;  5E76 A;  4G23 A;  3UMV A;  2QYU A;  2WXN A;  3CLJ A;  4N3A A;  4K5C A;  3RO2 A;  4HRM B;  2IU1 A;  4JW1 A;  4GZ3 A;  2YQ8 A;  2XEN A;  3L17 A;  3ASF A;  4DJA A;  3HVE B;  2VSN A;  5JJ7 A;  3LY8 A;  4YDY A;  2BKG A;  2WXL A;  3ESL A;  4DUI A;  2LNI A;  4N5Q A;  2XCB A;  5G05 J;  2QFC A;  4M3O A;  5FQ7 A;  4UWH A;  3HVE A;  3D9N A;  4WNE A;  3URZ A;  4KT6 B;  2VGX B;  4YND A;  5DIZ A;  3U9W A;  1MYO A;  3PE4 A;  1SZ9 A;  3G2W A;  2R2L A;  1TN6 A;  3DRA A;  2P9L G;  4LER A;  1AWC B;  3LKU A;  2VJ8 A;  2VGX A;  4O1P A;  4CT4 A;  4I9C A;  5JA4 D;  4DK5 A;  3ZYK A;  4QFV A;  1UOH A;  2V4H C;  1MX6 A;  4AIF A;  5EX3 A;  1TNU A;  2LSV A;  2JLB A;  5AN8 A;  3SFX A;  3ZNG A;  4TV3 A;  1TJF A;  3MKQ B;  3TJP A;  4OYS A;  1PC2 A;  4DLO A;  4KBQ A;  3QWW A;  5CED B;  1HFA A;  2PM7 A;  2HO1 A;  2WXM A;  3UIO C;  3I4G A;  3QJZ A;  4XZ4 A;  2PZI A;  3MKQ A;  4WWP A;  3HHM A;  4GA1 A;  2X3M A;  4UI9 C;  4MLP A;  2AW6 A;  3AG3 E;  3UKR G;  2PQR A;  4HBD A;  1N95 A;  3IHV A;  5ENP D;  5BV0 A;  1LD7 A;  3BG1 B;  2J07 A;  3FDH A;  4YDO A;  2HE0 A;  3I5P A;  2FI7 A;  2OOE A;  5ARF A;  3R7Q A;  3FTY A;  4OAU C;  5FZR A;  3RJV A;  1SZA A;  1W3B A;  5EIB E;  4ANU A;  3J5Q B;  5FQ4 A;  3AS5 A;  5DBK A;  3PRZ A;  3FH5 A;  3HYM B;  5KCM A;  2BF0 X;  1JUQ A;  3FWV A;  1WDY A;  3RU0 A;  4DX2 A;  1TYQ G;  4KZC A;  4BY6 A;  2B0O E;  1DNP A;  4PDX A;  4JA7 A;  3UTM A;  4GYO A;  1NA3 A;  1BI8 B;  3IEG A;  3HRA A;  3QKY A;  4GA0 A;  1BI7 B;  4URK A;  2PL2 A;  5JJT A;  4CCA A;  4HOQ A;  3PEU B;  5AQB A;  4BSZ B;  2JEK A;  2KCK A;  5G2N A;  2I1J A;  3EHR A;  2ZXW E;  1D9S A;  4N2Q A;  3SO8 A;  1JPL A;  4EPZ A;  3WXX A;  3VLD A;  4GCN A;  2XEH A;  3EU5 A;  5FJY A;  1U3C A;  1B89 A;  4AY6 A;  1YYH A;  3PS6 A;  5C1D A;  2BKK B;  3EUV A;  2P9S G;  2OVB A;  4OVV A;  5H7P A;  2P2C P;  5FTP A;  3D9O A;  4LEU A;  4F1S A;  3MKR A;  1E96 B;  3K9I A;  5EIL A;  3EHQ A;  1O1T A;  4NAC A;  2WXK A;  3T9K A;  3MV2 B;  3C3R A;  1ZB1 A;  5BPP A;  1S70 B;  2XEE A;  1NFI E;  4JC8 A;  1HX8 A;  4LNU D;  3VTY A;  3RO3 A;  4XKC A;  3HXF A;  4G2V A;  1OCO E;  5A7D B;  2Q7F A;  3TWV A;  3GZ1 A;  4U96 D;  4FHK A;  3KEA A;  1RZ4 A;  5EDS A;  1E8Z A;  4B8A A;  2J4B A;  3PZD A;  2QY7 A;  5CCM A;  1MHQ A;  2XRZ A;  1GW6 A;  2B6C A;  1P5Q A;  5HS0 A;  2QC9 A;  2P9P G;  3IXE A;  1IHB A;  4U8V D;  3SD5 A;  3SQV A;  4J0U A;  4GZD A;  4F1P A;  5B3S E;  2YHE A;  3FH8 A;  2ZGD A;  5AYW D;  3ONK A;  3LCA A;  2VSO E;  3RKV A;  3ASH A;  3E30 A;  2GRP B;  4BER A;  1OWL A;  1SVX A;  4ATZ D;  5BV1 A;  2P9U G;  1JWG A;  3TWR A;  1SW6 A;  2LO6 A;  1LD8 A;  3E34 A;  3ZN3 A;  2F8X K;  3FTX A;  4U04 A;  4UI9 J;  5AQ9 A;  2MHK A;  4FJY A;  1K1B A;  1VDY A;  1S64 A;  3D9M A;  2KCV A;  3W9F A;  3JXJ A;  4PH4 B;  4LSZ E;  3V2X A;  1OXJ A;  3NF1 A;  4I1O B;  1QZ2 A;  3FU0 A;  1V54 E;  1UN8 A;  4A3T A;  2CG2 A;  3CR3 A;  4NQ0 A;  2ETB A;  4A3V A;  4BWR A;  2XGS A;  3DSX A;  3NZS A;  3Q9N C;  4JHK A;  3ZUV B;  3EHN A;  3ULQ A;  4WND A;  3MZL B;  4K5A B;  3CIA A;  2BUG A;  1H6O A;  2I2O A;  2KXP C;  3CSF A;  2HR2 A;  3FTZ A;  4HNA D;  2ZGG A;  3ZXP A;  1X5B A;  4GTS A;  3AU5 A;  4BT9 A;  2EQX A;  2P58 C;  3Q4A B;  3G2T A;  4M7C A;  4GMR A;  3C3O A;  3AS4 A;  3BQO A;  3PZ4 A;  2CFU A;  4LNB A;  1MX2 A;  3UPV A;  3CVP A;  3SHF A;  5CEC B;  3D9I A;  2VSX E;  3RRN B;  5CCL A;  3D3M A;  3FH7 A;  1TNB A;  1KT0 A;  4CDM A;  2VGY A;  4J8Y A;  1TN8 A;  5FQ6 A;  5HKP A;  4JVS A;  3R9M A;  4Q96 A;  4HOS A;  4ZHB A;  4AM9 A;  2J4D A;  5FIN A;  2CHZ A;  4CDN A;  3SY2 A;  2J08 A;  3FU6 A;  4BSX A;  2FEZ A;  3E32 A;  3CEQ A;  1E8Y A;  3CHQ A;  5ENQ D;  3CV0 A;  3R9A B;  4ACL A;  1MZC A;  3CVX A;  4N2S A;  3Q78 A; 
#chains in the Genus database with same CATH homology
 3HVE A;  4JHR A;  1HF8 A;  3D9N A;  4WNE A;  3MV3 B;  1NA0 A;  4WWN A;  2XCC A;  5HI7 A;  4B8C B;  4D10 C;  3URZ A;  4I2Z A;  4KT6 B;  2VGX B;  4YND A;  4K03 A;  5D0Q D;  1BPO A;  4E6H A;  5DIZ A;  3U9W A;  3PE4 A;  1SZ9 A;  3OXG A;  1PAQ A;  3CQC B;  3TGO A;  3G2W A;  4UI9 K;  3ZGQ A;  4DI3 A;  3PDN A;  1OUV A;  4J8S A;  5LOZ A;  4LER A;  4KXK B;  4TUU A;  1HU3 A;  3LKU A;  1FVF A;  2VJ8 A;  3JYS A;  1S0P A;  2VGX A;  4FUL A;  4GU5 A;  2WMN A;  4I9C A;  4CT4 A;  4EZJ A;  2CFZ A;  3TG5 A;  2Y4U A;  4DK5 A;  3ZYK A;  4QFV A;  3UT7 A;  3QWP A;  4ANW A;  2WXQ A;  1WY6 A;  3ZHE A;  4WUY A;  2WXJ A;  2YIN A;  4AIF A;  5EX3 A;  2C0M A;  3AS8 A;  1FVH A;  2LSV A;  3ML9 A;  3OAW A;  2JLB A;  5G05 C;  5BUZ A;  4JA9 A;  2Y3A A;  2M63 A;  4TV3 A;  4HOR A;  1TJF A;  4N3C A;  2L0T B;  3MKQ B;  3APF A;  4U07 A;  4BFR A;  1H2U A;  3TJP A;  4OYS A;  1PC2 A;  3EIQ C;  3FTW A;  1Y6I A;  3SBT B;  3FEX A;  4H7Y A;  3ASD A;  4DLO A;  2YHC A;  4KBQ A;  3QWW A;  3KEZ A;  2IFU A;  4YVO A;  2A5U A;  1HFA A;  2PM7 A;  2HO1 A;  2PM6 A;  2WXM A;  2XHE A;  3CVN A;  3T5X A;  3I4G A;  3QJZ A;  5LFA A;  4XZ4 A;  2PZI A;  4FLH A;  1IQR A;  4MRU A;  5BNW A;  2MOW A;  3L54 A;  5CMY A;  3CHP A;  3FEY A;  4FLB A;  3MKQ A;  2WXP A;  3FHE A;  1HS6 A;  2GRM A;  3HHM A;  4WWP A;  4GA1 A;  2X6H A;  3ZRH A;  3RK6 A;  4L2L A;  4YVQ C;  2X3M A;  4UI9 C;  1INZ A;  4MLP A;  2WXH A;  3OXF A;  4B0Z A;  3CST A;  3IHY A;  3GZ2 A;  2AW6 A;  4BX8 A;  1OWN A;  3Q49 B;  3SGH A;  3QOU A;  2PQR A;  3CHO A;  4PS7 A;  4GAA A;  3IHV A;  2WM9 A;  4G25 A;  4B94 A;  2VYI A;  5EX0 A;  2XGM A;  3FTU A;  3VTX A;  1ELW A;  3DBS A;  2IF4 A;  3JCK C;  5BV0 A;  4ME2 A;  3BG1 B;  3FU5 A;  3OXL A;  4K0R A;  2IJG X;  2HM8 A;  2IOL A;  1IYG A;  2J07 A;  3FDH A;  4L2Y A;  4N39 A;  4GML A;  3CVU A;  2FF4 A;  3FUN A;  1OWO A;  3T8M A;  4XI0 A;  3G2V A;  3B7R L;  3G2U A;  3I5P A;  2FI7 A;  5A6C A;  1HO8 A;  3ZYL A;  2NSZ A;  2WXF A;  4B89 A;  2LAI A;  3FUJ A;  4R7L A;  4V3I A;  4Q69 A;  3LEW A;  2OOE A;  5ARF A;  4WNF A;  3MCX A;  3APD A;  4I6J A;  3R7Q A;  3FTY A;  3R7R A;  2UY1 B;  4U0U A;  1HG2 A;  3N71 A;  5AEN A;  3I4R B;  1A17 A;  3O4Z A;  3PNL B;  4UQY A;  3S7J A;  3S7D A;  5FZR A;  3RJV A;  1SZA A;  2CHX A;  4U8H A;  1W3B A;  4ANU A;  4P29 A;  1EDU A;  3CHS A;  5FQ4 A;  3S7F A;  3AS5 A;  3TXN A;  2ILR A;  4RVB A;  3NZU A;  3MJW A;  5DBK A;  1HG5 A;  2GGF A;  3PRZ A;  3L22 A;  2UY1 A;  3APC A;  2WB2 A;  1IQU A;  3FH5 A;  2MRI A;  3HYM B;  3JUI A;  5KCM A;  2XGO A;  2BF0 X;  3BEE A;  1EF1 C;  4G24 A;  4Y6W A;  4APO A;  1JUQ A;  3QWV A;  3FWV A;  1WAO 1;  3SF4 A;  2AWI A;  4I2W A;  2IQC A;  2UWJ G;  4UWL A;  3RU0 A;  2OVF A;  1WM5 A;  3LVQ E;  2VTB A;  1L5J A;  5FQ8 A;  4KZC A;  2ZU6 B;  5ARG A;  3C98 A;  4BY6 A;  4W9R A;  4U0Z A;  1DNP A;  4N5C A;  2C0L A;  2KCL A;  4I1M A;  5C2Y A;  3ZHE B;  2J09 A;  2NXP A;  5J08 A;  4ILH B;  3PVL A;  4JA7 A;  1UJK A;  1H2V C;  2VQ2 A;  4PDX A;  4GYO A;  3UQ3 A;  1NA3 A;  3GW4 A;  4FC8 A;  5ANL A;  4ABN A;  3EDT B;  1QNF A;  5FZS A;  1E8X A;  3FTS A;  5ANR A;  2WQ6 A;  4GYY A;  3QB2 A;  3IEG A;  4GPK A;  3QKY A;  4GA0 A;  5A23 A;  1HXI A;  1HH8 A;  2WVI A;  4URK A;  1TJC A;  2PL2 A;  4XE0 A;  4KZ0 A;  3ZYM A;  5JJT A;  4CCA A;  4HOQ A;  4I6G A;  2V4L A;  4WNG A;  3PEU B;  2RG8 A;  3ML8 A;  5EKQ D;  3GYZ A;  5FT9 A;  4A1G A;  2JEK A;  2KCK A;  3TAX A;  3BG0 B;  3TXM A;  5G2N A;  2I1J A;  4KMO A;  3PUK A;  4AEZ C;  2I6H A;  4L23 A;  4C0M A;  4N2Q A;  1OWM A;  3LPZ A;  2J9Q A;  5KJN A;  4ILI A;  4RSY A;  3VLF A;  4I6E A;  4OVU A;  1PY1 A;  1JPL A;  3U66 A;  5E75 A;  3WXX A;  4EPZ A;  1HE8 A;  3PE3 A;  2OND A;  3FUF A;  3VLD A;  5CMW A;  1NZN A;  4GCN A;  1Z3Y A;  5FJY A;  2WQH A;  2R17 C;  3SBS A;  1U3C A;  1B89 A;  5FWQ A;  2PQN A;  4AY6 A;  2I1K A;  4EZL A;  2XPY A;  3D9P A;  2FBN A;  3PNT B;  4PS8 A;  4F53 A;  3PS6 A;  4C9B B;  5C1D A;  2WXI A;  1ELK A;  3P1U A;  3SNX A;  2LSU A;  3EHM A;  5LCW J;  4I17 A;  2OVB A;  3JQ1 A;  4OVV A;  4JZY A;  4LRZ A;  4UWK A;  5JHA A;  1KT1 A;  1FCH A;  5FTP A;  4DPR A;  3KS2 A;  3D9O A;  1IHG A;  4LEU A;  3CVW A;  4BT8 A;  4F1S A;  3KAE A;  4J8D A;  3B7S A;  3MKR A;  2KZT B;  2FO7 A;  2ION A;  1E96 B;  4CDR A;  2XRY A;  4GZ5 A;  4MKT A;  5G55 A;  3K9I A;  1N54 A;  4FAD A;  3HIZ A;  4UQX A;  4Q94 A;  1Z3X A;  4LUN U;  2WXO A;  4NAC A;  2WXK A;  1H19 A;  3P2B A;  1N52 A;  3MV2 B;  5LX8 A;  3CHM A;  3FFL A;  4A55 A;  2KC7 A;  5BPP A;  3T5V A;  3CK9 A;  1UN9 A;  2KZT A;  3FU3 A;  4JC8 A;  4XIF A;  1HX8 A;  3U64 A;  1H6K A;  3VTY A;  5JHB A;  4U63 A;  4KVO A;  5G04 J;  1Z6T A;  3MX3 A;  4AOF A;  1DVP A;  3ZXS A;  3RO3 A;  1Y8M A;  3FUK A;  1JWF A;  2R5S A;  2V8S E;  2WMO A;  4ILG A;  4N3B A;  1MQS A;  1UG3 A;  1ZBP A;  4G2V A;  4XKC A;  3LYA A;  3MYV A;  1H0A A;  4JPS A;  2X6I A;  3CKB A;  2Q7F A;  5A7D B;  3GZ1 A;  4I9E A;  3L16 A;  3Q47 B;  4FP7 A;  3TG4 A;  4DI4 A;  4IRU A;  2YNQ A;  2FUL A;  2NC9 A;  4FHK A;  4C0E A;  4AP2 A;  1SQM A;  3OTN A;  3ZIM A;  5EDS A;  1E8W A;  2LAH A;  1E8Z A;  4GB9 A;  4BTA A;  2DBA A;  2VTB B;  4LCT A;  4B8A A;  4ACK A;  4XI9 A;  3ZYQ A;  2V5F A;  3IKO B;  3NQP A;  3MA5 A;  2J4B A;  3PZD A;  5ENN A;  2QY7 A;  5CCM A;  1MHQ A;  5KJM A;  2XRZ A;  1GW6 A;  4I1A A;  2L0I A;  4CRW A;  1P5Q A;  3JQ0 A;  3PH0 C;  3ZFW A;  2E0I A;  2KAT A;  4EZK A;  3SD5 A;  3FUE A;  4J0U A;  2R59 A;  3ONL A;  4GZD A;  3KD7 A;  3RIB A;  2KM4 A;  4A1S A;  4XX5 A;  2X38 A;  2YHE A;  3FH8 A;  5T8I A;  4TRQ A;  1ELR A;  4G11 A;  5AYW D;  3FUM A;  3ONK A;  3ESK A;  3LCA A;  3PRE A;  2VSO E;  3RKV A;  3VLE A;  3ASH A;  2XPZ A;  4MS6 A;  4EQF A;  3L13 A;  2RD0 A;  2WPV A;  1OWL A;  4RG9 A;  3LJ3 A;  2X6J A;  5BV1 A;  4KVM A;  3FP3 A;  1JWG A;  3O48 A;  2XQ0 A;  4Y6C A;  4GCO A;  4CGV A;  4EEC A;  4XKB A;  1UW4 B;  2LO6 A;  3MEK A;  4G26 A;  5JJ6 A;  5T4Y A;  3QNK A;  4JXT A;  3ZW3 A;  3CQG B;  3CKC A;  4F3V A;  3ZN3 A;  3CVQ A;  3PUJ A;  3QAR A;  4CT0 A;  3SZ7 A;  3S2A A;  2XPI A;  3G2S A;  3FTX A;  4U04 A;  4FJZ A;  4DLQ A;  3DPD A;  4UI9 J;  2MHK A;  2WQ7 A;  4FJY A;  4U0S A;  3LDZ A;  3SI5 A;  1ZU2 A;  4APF A;  5KJK A;  1TEZ A;  4CGW A;  2Y4T A;  1VDY A;  1U3D A;  2IOS A;  3D9M A;  3ASG A;  1HZ4 A;  4UQZ A;  5LP0 A;  2KCV A;  3UUX A;  3EIJ A;  2HYZ A;  4PH4 B;  2DIW A;  3FUI A;  4PS3 A;  3TL5 A;  2GRL A;  4ANX A;  1H2T C;  3L08 A;  4F7A A;  3UT4 A;  1EYH A;  3NF1 A;  4FU3 A;  3PEV B;  4IN3 B;  2AXU A;  3LVR E;  4AJW A;  3CK7 A;  1QZ2 A;  3FU0 A;  4I1O B;  4A3T A;  1UN8 A;  3D9L A;  3HDX A;  2CG2 A;  4UWF A;  4AY5 A;  5BT1 A;  3L6A A;  3CR3 A;  4G1T A;  5FZQ A;  3UX4 A;  4NQ0 A;  4UWG A;  2GW1 A;  5AJD A;  3RRU A;  4A3V A;  4BWR A;  1LF8 A;  2BTD A;  2C2L A;  3CVL A;  4NUR A;  3B7U X;  3QAQ A;  4GZ6 A;  4BX9 A;  3E4B A;  3U3W A;  2XGS A;  4H7X A;  3NZS A;  3IBE A;  4JHK A;  3LS8 A;  3Q15 A;  3EHN A;  4WAF A;  3ULQ A;  4AVX A;  3LY7 A;  4WND A;  4HVB A;  3MZL B;  3FTV A;  2X6F A;  2CG3 A;  3FY4 A;  4JL0 A;  4O6F A;  5T3R A;  3ZVV A;  1XNF A;  4HLE A;  3CIA A;  4J8F A;  2I9C A;  4GYW A;  2WXR A;  2V0P A;  2BUG A;  1XGW A;  3CVY A;  2X6K A;  4HOT A;  4ATG A;  4L7T A;  5M72 A;  2I2O A;  3CSF A;  3LY9 A;  2HR2 A;  3FTZ A;  2XEV A;  2AXV A;  4JHJ A;  2AXZ A;  4HOU A;  4AV7 A;  2L9B A;  1X5B A;  2DCP A;  5HQ8 A;  1EPU A;  3B7T A;  3AU5 A;  4JEU A;  2EQX A;  4BT9 A;  4L1B A;  2P58 C;  3ENE A;  3Q4A B;  3G2T A;  2AVP A;  1OWP A;  2J49 A;  4NRH B;  5BW8 C;  3FUL A;  3I3N A;  3Q5M A;  3EJN A;  3ZEF A;  3S7B A;  4CEM A;  5J90 A;  3QC1 A;  4HXI A;  3AS4 A;  5KJL A;  4GZC A;  3U4T A;  3ZPJ A;  3CVV A;  4J8E A;  4AXH A;  2CFU A;  3SFZ A;  2L6J A;  4E85 A;  3FUD A;  3UPV A;  2CHW A;  3CVP A;  3LXU X;  1NP7 A;  3SHF A;  3D9I A;  4KYO B;  5E76 A;  2VSX E;  3QK0 A;  3IV0 A;  3RRN B;  4EBA A;  5CCL A;  4G23 A;  3UMV A;  1KLX A;  2WXN A;  3D3M A;  3FH7 A;  5CHE E;  3QDN A;  1KT0 A;  2VSY A;  4CDM A;  5LCW C;  3CLJ A;  4N3A A;  2VGY A;  3D9J A;  3FUH A;  5D0O D;  5FQ6 A;  3RO2 A;  4JVS A;  2IU1 A;  4JW1 A;  3CK8 A;  2YQ8 A;  1YA0 A;  4GZ3 A;  4Q96 A;  4HOS A;  4ANV A;  3D9K A;  4AM9 A;  3L17 A;  4GMJ A;  2J4D A;  4J6I A;  3UT8 A;  3ASF A;  2CHZ A;  3CHR A;  1E7U A;  4CDN A;  3B13 A;  2J08 A;  2E2E A;  4GA2 A;  4DJA A;  3HVE B;  2VSN A;  4I43 A;  3FU6 A;  3RRM B;  4FA6 A;  3LY8 A;  4BSX A;  5JJ7 A;  1E90 A;  4IYP A;  4WWO A;  2A4Z A;  4PUC A;  2FEZ A;  2WXL A;  3ESL A;  3AU4 A;  4IUL A;  4HS2 A;  1UJJ A;  3GZS A;  4FHJ A;  4RG6 A;  3CEQ A;  2LNI A;  1E8Y A;  5AJL A;  4EBA G;  2XCB A;  2WXG A;  5G05 J;  3CGH A;  3CHQ A;  2QFC A;  3MGB A;  3CV0 A;  3R9A B;  4ACL A;  5AIJ A;  5G04 C;  4M3O A;  3CVX A;  1QQE A;  2OV8 A;  4N2S A;  5FQ7 A;  4BTB A;  4UWH A;  4JEH A;  4HFG A;  1E7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...