3CVQA

Structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to pts1 peptide (7-skl)
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
315
structure length
289
Chain Sequence
NTDYPFEANNPYMYHENPMEEGLSMLKLANLAEAALAFEAVCQKEPEREEAWRSLGLTQAENEKDGLAIIALNHARALDPADIAVHAALAVSHTNEHNANAALASLRAWLLSQPQYEQLGSVNEDFFFAAPNEYRECRTLLHAALEMNPNDAQLHASLGVLYNLSNNYDSAAANLRRAVELRPDDAQLWNKLGATLANGNRPQEALDAYNRALDINPGYVRVMYNMAVSYSNMSQYDLAAKQLVRAIYMQVATRSMWDFFRMLLNVMNRPDLVELTYAQNVEPFAKEFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisome targeting signal 1 receptor PEX5
publication title Structural Insights into the recognition of peroxisomal targeting signal 1 by Trypanosoma brucei peroxin 5.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transport protein
total genus 97
structure length 289
sequence length 315
ec nomenclature
pdb deposition date 2008-04-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 3cvqA00
3CK7A 2LSVA 4GZ3A 3LY7A 4CDRA 2VYIA 4JA7A 3U4TA 1ZBPA 3BEEA 2WQHA 3ASHA 5FZSA 3WXXA 4GZ6A 3GZ2A 5FZQA 4GA2A 3UQ3A 3TG5A 5HI7A 2Y4TA 3U3WA 4N2SA 1QZ2A 4GYYA 4YNDA 3KAEA 2UY1B 3CEQA 1Y8MA 2XPIA 5KJNA 3RJVA 3LY9A 4I2WA 3O48A 1QQEA 3CK8A 4J8FA 3SF4A 4WNEA 3R9AB 3CKBA 1WM5A 4A1SA 2XCCA 3MV3B 3GZ1A 5HQ8A 4XIFA 2FF4A 4GCNA 4WNDA 5CHEE 5JJ7A 3LY8A 3RKVA 2XEVA 3Q4AB 3ZFWA 2PQRA 2C0MA 2UWJG 2LNIA 4YVQC 4F3VA 3AS4A 3S7DA 5DBKA 2VGYA 1HXIA 3AS5A 4GYOA 4J8DA 3QDNA 4XI9A 4I9CA 3MV2B 3NF1A 4G1TA 5ARGA 4U0UA 4EQFA 4I1AA 4N2QA 3JYSA 3PE3A 1WAO1 3ASFA 3FWVA 4KXKB 3ULQA 5KJLA 4UI9J 4RG9A 3GW4A 4YVOA 4ABNA 2XCBA 2BUGA 3K9IA 3QKYA 5EKQD 3ZHEA 4HOSA 5EX3A 3LKUA 5BT1A 5LCWJ 5A7DB 1A17A 3OXGA 2FI7A 4AIFA 1KT0A 2J9QA 2MHKA 5BW8C 3KD7A 4IN3B 2QFCA 1NA3A 4N3BA 4HOTA 3VTXA 3CVNA 2HR2A 3ZHEB 2LSUA 2P58C 3N71A 3LYAA 2YHCA 4UI9C 1P5QA 4N39A 3RO2A 1ELWA 5G04J 2KCVA 1HH8A 3ASDA 1W3BA 4JL0A 3CKCA 3IEGA 3QWPA 3URZA 2NC9A 1XNFA 4WNGA 4H7XA 3S7JA 2YQ8A 4WUYA 4BTAA 5LCWC 2KC7A 5KJKA 2L6JA 2OOEA 3MKRA 4AY6A 3MA5A 2VGXA 3RO3A 2DBAA 4HOQA 4BTBA 5D0QD 3ESKA 3AS8A 5ARFA 2ONDA 3RU0A 1IHGA 3Q5MA 4GCOA 4GA1A 5G04C 2IF4A 2HYZA 4B94A 5JJTA 4BWRA 4G26A 4BT8A 2PQNA 4N3CA 2WPVA 3CK9A 5M72A 5C1DA 4HORA 2VGXB 4Y6WA 2I6HA 5BNWA 4I2ZA 4ME2A 2HO1A 5D0OD 1NA0A 3ZN3A 2AVPA 4BT9A 1FCHA 2XGOA 1KLXA 4I9EA 5CCLA 1B89A 5EX0A 4JA9A 2GW1A 2KATA 5G05J 4GYWA 1ZU2A 5FT9A 2FO7A 3OXFA 2FBNA 3ZGQA 4CGWA 5AYWD 2C2LA 3HYMB 4KBQA 2XGSA 3LPZA 4I17A 3TAXA 3FFLA 4GZ5A 3CVQA 2C0LA 3PDNA 3LCAA 4XI0A 4Y6CA 1OUVA 4J8EA 4JHRA 3OXLA 4J0UA 3E4BA 1NZNA 2VQ2A 3CVLA 5CCMA 3FP3A 3RIBA 4APOA 4GA0A 2XGMA 5FJYA 3GYZA 3Q49B 3QWWA 2KCLA 3TGOA 5G05C 5KJMA 2Q7FA 3EDTB 5JJ6A 4G25A 4LEUA 4UI9K 3QOUA 4WNFA 3TG4A 4W9RA 4UQZA 1KT1A 4NQ0A 4U0ZA 4U0SA 1HZ4A 3SZ7A 5DIZA 4AM9A 4NRHB 3Q15A 2V5FA 5FZRA 1ELRA 3QWVA 4G23A 2FEZA 4UQYA 4O6FA 3S7FA 2JLBA 1YA0A 2VSNA 3CV0A 3ZPJA 2Y4UA 2KCKA 3PE4A 3UUXA 1PC2A 4N5CA 4HOUA 4U07A 5FTPA 3CVPA 4KYOB 4U04A 2R5SA 3MEKA 1E96B 5A6CA 2PZIA 4CGVA 2IFUA 4AY5A 4H7YA 4UQXA 3S7BA 4RG6A 2E2EA 3Q47B 1TJCA 2PL2A 3VTYA 2VSYA 4N3AA 3KS2A 1IYGA 3ASGA 3UPVA 4G24A 4GPKA 4G2VA 2UY1A
chains in the Genus database with same CATH superfamily
4CRWA 2F37A 3E34A 5EYLA 4CDRA 2EINE 2WQHA 2DVWA 2DYSE 3AU4A 4GZ6A 3WXXA 5FZQA 5HI7A 2Y4TA 2CHZA 3U3WA 4N2SA 4FHJA 3SI5A 1BI8B 4JHJA 4P29A 2XPIA 4BETA 3ZKJA 3L6AA 3OTNA 3DPDA 5FQ8A 3DBSA 3PNLB 2XPYA 3DXKG 3IBEA 4A1SA 1PAQA 2XZDG 4JEUA 2A4ZA 3LY8A 3T9KA 3Q4AB 1N4PA 4L9PA 2C0MA 4ANVA 3C3RA 2EIME 4Z68A 4YVQC 5D2MC 4YDEA 4IRUA 4K5BA 3SD5A 3ABME 4J8DA 3QDNA 3AG4E 1IQRA 3TWWA 3U66A 3L13A 4U0UA 3KSLA 4WWPA 1DVPA 4ANXA 4I1AA 3HXBA 3JYSA 2GGFA 3AJIA 3BG0B 4OAVB 5ANLA 3FULA 2I9CA 4WAFA 5EDSA 3FEYA 4EZLA 3GW4A 2VJ8A 4YVOA 4ABNA 2BUGA 3ZHEA 2CHXA 1TR4A 1ELKA 2R17C 4I6JA 2A5UA 3NAWA 5ENSD 3ZXSA 3LKUA 5BT1A 5ANRA 5LCWJ 3NBNB 3FH7A 4DLOA 1Z5SC 4AIFA 4GB9A 3UM0A 3PZ2A 1V54E 2P2CP 2WXNA 4XKBA 2QFCA 3MJWA 5ENOD 3U9WA 5BXUA 4HOTA 3G2UA 3N71A 2Y1LE 5BPPA 1ELWA 4G11A 1SZ9A 2F8XK 3ASDA 4F6RD 3IEGA 3Q7FA 4AV7A 4BSXA 4DI4A 2HM8A 4B0ZA 3S7JA 4WUYA 3ML8A 2KC7A 4K5CA 3P2BA 3MKQB 4HRMB 2L6JA 2I1KA 4LRZA 2XEHA 3E30A 2OCCE 3RO3A 5G2NA 3SFZA 3LEWA 1E7VA 3HVEA 1JCQA 1HO8A 3TWTA 2IO2C 3AS8A 3FTYA 1K3ZD 2MOWA 3Q5MA 4L23A 4DK5A 5T4YA 1UW4B 2Y3AA 4ZHBA 5JJTA 1TN6A 4G26A 2IONA 5C1DA 2WXHA 4HORA 2VGXB 4PH4B 4I2ZA 3L08A 2H6FA 2WXMA 1FT2A 3FUFA 3ZN3A 1KLXA 3PRZA 2GW1A 3W9GA 5G05J 2BKGA 2P9PG 4GYWA 3BU8A 3ZXPA 2R2LA 3OXFA 5AQ9A 2FBNA 3UIOC 3ZGQA 4LNBA 3LPZA 3FTVA 3ZIMA 3CHMA 4XI0A 3LCAA 5B3SE 1DCEA 3ZUVB 3HXEA 3OXLA 5IY5E 2LAHA 2X6IA 3E4BA 3CVVA 3KSQA 5CCMA 4TUUA 4U8YD 3C3OA 4GA0A 4UUCA 5CRVA 5FIOA 2XGMA 3GYZA 3ZU7B 1UN8A 4EZKA 2QZAA 3ZYMA 5CEDB 1OWNA 5JA4D 2XPZA 4LEUA 2EILE 4JW1A 4WWNA 1Z3XA 5T8IA 4ILGA 1HZ4A 4XX5A 4GZDA 5AIJA 2V5FA 3UX4A 3CQCB 1U3CA 4GMRA 5HS0A 4O6FA 2JLBA 3CV0A 2Y4UA 3D9JA 2OEWA 4N5CA 1NFIE 2WXOA 3CVPA 4U04A 3TWVA 2R5SA 2BKKB 2F0YA 1YCSB 4BX9A 1A5EA 2PZIA 3FTUA 2DZOA 3LXUX 2IFUA 3QB2A 1TNYA 3S7BA 4RG6A 2B0OE 2E2EA 1AWCB 1X5BA 4U96D 3Q47B 3PH0C 4PUCA 4PS8A 2VSYA 5B1BE 3FH5A 1OY3D 3QARA 2WXRA 3UPVA 3D9MA 3DRAA 4AXHA 1FVFA 2ZGDA 3CK7A 5J90A 3DSXA 3LY7A 2NXPA 5ENRD 3ASHA 4DX7D 3FUDA 4GA2A 4F1PA 5ENPD 4FLBA 3D9IA 4FJZA 1QZ2A 4YNDA 1AP7A 3B7SA 3Q9UC 3RSEG 2UY1B 3CEQA 4GTPA 4U8VD 1Y8MA 5KJNA 1YYHA 3RJVA 2DYRE 2BTDA 4JD2G 3DSUA 4AP2A 4BSZB 4CEMA 1WM5A 2XCCA 3FTSA 5J08A 5EYPF 3MX3A 2CHWA 2NYJA 4DRXE 5AAOA 3VLEA 1JUQA 1UJJA 3C5RA 3ZFWA 4GTOA 3TXMA 3IXEA 1JWGA 2UWJG 1MZCA 3QK0A 2LNIA 3KEAA 3CR3A 4ATZD 4PDXA 2H6IA 1H19A 3S7DA 5DBKA 3GZSA 4FLHA 1MHQA 5AQ7A 4TXRA 4XI9A 4I9CA 4DLQA 4G8LA 3PZ3A 1HE8A 2OVFA 5ARGA 2J09A 4I6EA 4FA6A 4N2QA 3PE3A 1WAO1 4E85A 3VLFA 3APCA 3W9FA 4EZJA 1DNPA 1NL4A 1TNZA 1N94A 2L9BA 4KVOA 1XGWA 2XEEA 2X38A 3EHNA 4UWFA 3TXNA 3FY4A 3L54A 4APFA 5EKQD 1TJFA 4HLLA 5ENTD 3DPYA 1S0PA 4U8HA 1IXVA 1SA5A 2IJGX 2IEJA 4LSZE 1H6PA 2PM7A 4TUMA 1H6KA 2P9SG 4L2YA 2KZTB 2OVBA 2AXUA 3D9LA 2R02A 2IY0C 4CT0A 1SA4A 3MYVA 4EBAA 1NA3A 2P58C 3LYAA 2YHCA 4I1MA 4EPZA 1P5QA 3HXDA 1VDYA 3FUJA 3D9NA 1HH8A 3KEZA 4FHKA 1W3BA 3D9OA 3O4ZA 3BUAA 3T8KA 2NC9A 4BY6A 2VTBB 2V0PA 4XKCA 4WNGA 3E32A 2YQ8A 3HDXA 5LCWC 2H6HA 1E8WA 1UN9A 4HVBA 4AOFA 3HXFA 2OV8A 1UOHA 2IOSA 2RFAA 3MKRA 3DEPA 3MA5A 1PY1A 5BXOA 4I1OB 4I43A 1E8YA 1S63A 1S64A 4V3IA 1WG0A 4MBGA 4EBAG 2DBAA 4HOQA 3DSWA 3V79K 2J8SD 3P1UA 1IHGA 2DWZA 1SZAA 2QYJA 2J07A 3SBSA 4PS3A 2KBXA 4GCOA 3E37A 2IF4A 5LOZA 1N52A 4CCAA 3EHRA 2WXQA 4BWRA 3MCXA 2P9KG 4LNUD 3HXCA 4N3CA 2WPVA 3JUEA 2ZIRA 4J8YA 2QY7A 3D9HA 3ASOE 5E76A 5BNWA 4OVUA 2HO1A 4EHMA 3L16A 1NA0A 3JXIA 5AN8A 4BT9A 1B89A 5EIBE 3SHFA 1JWFA 2X6HA 5FT9A 5KNHD 1FT1A 2FO7A 3JQ0A 3I4RB 3ENEA 4IYPA 4CGWA 2XGSA 1E7UA 4I17A 1OWLA 3TAXA 1OWOA 4LG6A 2ILRA 1Y6IA 3FFLA 4GZ5A 4HI9A 3FUHA 3TJPA 4Y6CA 4RLYA 1KPSB 1MJ0A 4G8KA 2WVIA 5AQBA 3I4GA 2VQ2A 3JXJA 3RIBA 3ULEG 3QNKA 2LXMA 1OWMA 2IO3C 5FJYA 3PZDA 1EF1C 3EUVA 3F6QA 1MX6A 3CIAA 4HRNA 4XE0A 1WDYA 3TGOA 5G05C 2P9IG 3NQPA 3CVWA 1N4RA 2R05A 3ABLE 1KT1A 2RKKA 3UXGA 2XRZA 2J49A 3ZRHA 2X3MA 4DUIA 1NP7A 1EPUA 4AM9A 4NRHB 5FZRA 3RRMB 1IKND 4G23A 2MRIA 2R03A 5KBAA 4UWLA 3S7FA 1Z6TA 3TWRA 5AJDA 4F7AA 5A23A 3FTWA 3PE4A 2EIKE 4HOUA 1S70B 3PEVB 4FULA 1H2VC 3CVUA 2HE0A 2V8SE 3LJ3A 1DC2A 4CGVA 5BV1A 4AY5A 2IOLA 4UQXA 4FJYA 2RFMA 2P9UG 3ISMC 3VLDA 3VTYA 3APFA 2I1JA 1MYOA 1MX2A 4K5AB 3FHEA 3KS2A 3EJNA 5D66A 3ML9A 4DPRA 4GPKA 1LD8A 2WXGA 3CQGB 1H2TC 4XZ4A 4FADA 4ATGA 3FDHA 2LSVA 4B93B 3L9TA 3PUJA 2X6JA 2CFZA 2WXLA 4JA7A 4CZ2D 2QC9A 2DCPA 3U4TA 1ZBPA 3BEEA 5CERB 1TNOA 2LO6A 4ILHB 5FZSA 3GZ2A 3BG1B 4JXTA 2I2OA 4KZ0A 3ZYKA 3HRAA 3E33A 1SVXA 4RSYA 3DSVA 4KT6B 3RRUA 3PZ4A 3B13A 4LUNU 4I2WA 3O48A 1TN8A 1QQEA 4QFVA 3SF4A 3DEOA 3WG7E 3CKBA 3X2QE 2XS8A 4XIFA 1O1SA 2FF4A 3AU5A 3T8MA 3ZEFA 4WNDA 4GTTA 5CHEE 2VGEA 5JJ7A 3SY2A 2F8YA 2PNNA 1N4QA 1HX8A 2XEVA 4NIKA 2IU1A 2ZXWE 1OCOE 4ILIA 3UT4A 4J6IA 4ACLA 4CYMD 1OWPA 3QC1A 2EQXA 1TEZA 4B89A 3TL5A 1EYHA 1HXIA 3AS5A 1N95A 4XEIG 3R7QA 3CHPA 3LVRE 3NF1A 1MX4A 4M7CA 1OCRE 1E8ZA 1V55E 3G2VA 3UI2A 1IQUA 3ASFA 1X81A 3FWVA 3ULQA 4BERA 4L2LA 5KJLA 4N5QA 5HRYA 4UI9J 1U3DA 3G2WA 3CGHA 4RG9A 4HRLA 3UKRG 3QJZA 5EIDA 3EIQC 3AG3E 4O60A 3K9IA 3QKYA 4JC8A 5JHBA 3EHQA 4HOSA 2GRQB 2AXVA 4BESA 3Q9NC 5EX3A 1H2UA 4KMOA 1A17A 3OXGA 3R7RA 2AJAA 1KT0A 4E6HA 5BW8C 4C0EA 3KD7A 2GRMA 3HHMA 4J7WA 1WY6A 3AG2E 4N3BA 3CVNA 3MKQA 4HXIA 3ZHEB 2LSUA 3UM1A 2V4LA 4N39A 1FPPA 5FQ6A 3RO2A 5G04J 4BEPA 1LD7A 3D9PA 1K1BA 3BQOA 3V31A 4CT4A 3SO8A 3URZA 4PS7A 5G55A 5JHAA 2WM9A 2XS1A 5CMYA 3JCKC 4F1SA 2R59A 4GAAA 5FINA 1GW6A 4K03A 5KJKA 2WQ6A 2WMOA 5LFAA 3CSTA 2JABA 2OOEA 4AY6A 2WXPA 1HS6A 2VGXA 4DX2A 2LXLA 1O5MA 2X6KA 1TN7A 4HBDA 3UIPC 4HFGA 4BTBA 5D0QD 4TRQA 4M3OA 5ARFA 3RU0A 5CBOA 3CHRA 4K0RA 2YHEA 4MRUA 4FC8A 2HYZA 3ZW3A 4IULA 2P9NG 4AJWA 4OYSA 3CK9A 5M72A 3FU0A 3T5VA 3T5XA 2V4HC 3HVEB 2E0IA 5D0OD 3ZNGA 3ESLA 1FCHA 4I9EA 1G3NB 3PREA 5EX0A 3SFYA 2GRRB 3FUIA 3LDZA 2OEVA 4MKTA 2GROB 1QNFA 2WB2A 3EHMA 5AYWD 2C2LA 3FH8A 3IKOB 1KZOA 3D3MA 3PDNA 1OUVA 4JHRA 3EU5A 3Q7AA 3RK6A 3I3NA 4LNGA 3DSTA 1NZNA 3FP3A 4B8CB 2L0IA 3UMVA 2RD0A 3RAUA 2H6GA 3FUMA 1D8EA 4NURA 1HG5A 1O1RA 4J8SA 1MQSA 3QWWA 3CHOA 2KCLA 1JCRA 5KJMA 2Q7FA 3ONLA 5JJ6A 3FUNA 4G25A 1OT8A 4UI9K 3QOUA 3ZVVA 4WNFA 3TG4A 3D9KA 1SQMA 5CRUA 5FWQA 4W9RA 4GMJA 4NQ0A 3SZ7A 1U2VG 5DIZA 3Q15A 3Q79A 1ELRA 1L5JA 4OAUC 1JCSA 3QWVA 5LX8A 1OCZE 4DI3A 4YDWA 1K8KG 1PC2A 4A3TA 3DSSA 3MZLB 2CG2A 3CVXA 3PUKA 4JZYA 4KYOB 2CFUA 3JUIA 5CEAA 3U64A 1K1AA 2RG8A 3ZYLA 4B8AA 2VSXE 1IHBA 4YDOA 2IQCA 1TNBA 4GTMA 2BEDA 2PL2A 1OCCE 1FVHA 2X6FA 3C72A 3J5PA 5HKPA 3ASGA 4AEZC 4Q96A 3IHVA 4C48B 3R9MA 2WXKA 5CMWA 4G2VA 3QAQA 2UY1A 2XHEA 4GZ3A 1BLXB 2XZTG 2V5QC 2VYIA 2ZISA 2LUHA 1D8DA 3EU9A 3UQ3A 3HG0D 1TNUA 3TG5A 3NZUA 4O1PA 4Q94A 2PM6A 2QYUA 5E75A 4X8QA 4GYYA 4HQDA 3MGBA 3KAEA 3NOGD 3FTZA 3UTMA 3LY9A 3L17A 3CK8A 4J8FA 4GTSA 5FQ4A 3RRNB 4WNEA 3R9AB 3Q78A 3MV3B 1DCQA 2ETAA 3GZ1A 5HQ8A 4A55A 1HU3A 1RZ4A 4EECA 4GTRA 4GCNA 3UT8A 1SW6A 3TWXA 2YINA 1N0RA 2AWIA 3RKVA 2PQRA 4JEHA 2WXJA 3NOCD 5KWDA 4OVVA 2DZNA 1LF8A 4F3VA 5KCMA 2FULA 2ETBA 3AS4A 2KXPC 2VGYA 3ZYQA 4GPMA 2GRPB 3B7RL 4JB8P 4GYOA 2Y0BG 2DIWA 4C9BB 1BU9A 3MV2B 4G1TA 3CHSA 1N9AA 3I5PA 4EQFA 4BFRA 5AENA 2WMNA 2ZU6B 3SBTB 4HB5A 2JEKA 5ENNA 2J4DA 4KXKB 4QQIA 4BX8A 4GTQA 3TWUA 1N4SA 5JMND 2KZTA 4KZCA 5CBNA 1H0AA 4HS2A 4GTVA 2XCBA 1E90A 2M63A 5H7PA 5B1AE 3HIZA 3CVYA 2L6BA 4U95D 5AQAA 4A1GA 4HI8A 1E8XA 3ABKE 4ZFHA 3ULYA 5T3RA 4A63B 4U7EB 5A7DB 1QYMA 4U63A 2FI7A 2XENA 1LTXA 1BPOA 2J9QA 5ITZF 1EDUA 1Q2ZA 2MHKA 2VTBA 2WQ7A 2KM4A 3Q75A 4IN3B 3VTXA 2HR2A 1QBQA 3NZSA 4LCTA 1ZB1A 4UI9C 4L7TA 4L1BA 4LERA 2XRYA 4NACA 2KCVA 3LJNA 1D9SA 5FQ7A 4JL0A 3CKCA 3QWPA 1N11A 1HFAA 1XNFA 3APDA 3UT7A 4H7XA 2GRLA 2VSOE 4BTAA 4CDNA 5CECB 1BD8A 1UJKA 3DWLG 3UM3A 2AXZA 4D10C 3CHQA 3FU5A 4ANWA 4RVBA 3V2OA 4Q69A 3FTXA 3ESKA 3PNTB 2ONDA 3SGHA 2WXIA 3JQ1A 3LS8A 1N0QA 4GA1A 5G04C 3DXMG 5EILA 3EIJA 4B94A 1KZPA 3B7TA 3V2XA 4BT8A 2PQNA 3FU3A 2FO1E 2YNQA 2LAIA 3SNXA 1BI7B 3NB2A 4Y6WA 2I6HA 4R7LA 4ME2A 4JPSA 4MS6A 1H6OA 3TWQA 5LP0A 2AVPA 2L0TB 2XGOA 5CCLA 3AG1E 3B7BA 3UKUG 4RQIA 4DX6D 3L82A 4JA9A 3V30A 2KATA 1TYQG 3ONKA 4ANUA 3IV0A 1ZU2A 1O1TA 2J4BA 4AVXA 3FU6A 4GU5A 1UG3A 3HYMB 3FEXA 4KBQA 3FUEA 5AARA 4A3VA 1NI1A 2P9LG 4DJAA 3CVQA 2C0LA 2AW6A 3L22A 4J8EA 3C98A 3SQVA 4JHKA 4J0UA 3FUKA 2WXFA 4DX1A 3CVLA 1JPLA 3B7UX 1HF8A 4MLPA 4APOA 1OXJA 5BUZA 4UWGA 4JVSA 3PVLA 2CG3A 3C3QA 3Q49B 5AJLA 1HG2A 2J08A 4URKA 4GZCA 3EDTB 3PS6A 3Q73A 3B95A 3UINC 4HNAD 3TWSA 5C2YA 5EN5D 4UWKA 1RW2A 4DX5D 4TV3A 3G2TA 4UQZA 4HLEA 5ENQD 4U0ZA 4U0SA 2MYOA 1N54A 4FU3A 4WWOA 3J5QB 3G2SA 3PZ1A 3S2AA 2FEZA 4UQYA 4F53A 1YA0A 2VSNA 4GMLA 4ACKA 3ZPJA 2KCKA 3UUXA 4TXQA 1Z3YA 4U07A 4O1OA 1INZA 5FTPA 5KNGA 4CDMA 4C0MA 3AAAC 3CLJA 4YDYA 3CSFA 3MEKA 4FP7A 1E96B 2Y69E 5A6CA 2GRNB 3ASNE 4H7YA 3OAWA 3PEUB 4UWHA 2BF0X 1TJCA 5BV0A 2A5EA 2EIJE 2NSZA 3IHYA 2ZGGA 3LVQE 1YMPA 4N3AA 3SFXA 4I6GA 3UM2A 1IYGA 2ETCA 4KVMA 4G24A 4TXPA 2B6CA 2XQ0A
chains in the Genus database with same CATH topology
3CK7A 5J90A 2XHEA 2LSVA 4CRWA 4GZ3A 3LY7A 2NXPA 3PUJA 4CDRA 2X6JA 2VYIA 2CFZA 2WXLA 4JA7A 2DCPA 3U4TA 1ZBPA 3BEEA 2WQHA 3ASHA 2LO6A 3AU4A 4ILHB 5FZSA 4GZ6A 3GZ2A 3BG1B 3WXXA 5FZQA 3FUDA 4GA2A 3UQ3A 4FLBA 3D9IA 4JXTA 3TG5A 5HI7A 2Y4TA 2CHZA 2I2OA 3NZUA 4FJZA 2PM6A 4Q94A 5E75A 3U3WA 4N2SA 4FHJA 1QZ2A 3SI5A 4GYYA 4YNDA 3B7SA 4KZ0A 3MGBA 3ZYKA 3KAEA 2UY1B 3CEQA 4JHJA 4RSYA 4KT6B 4P29A 3FTZA 3RRUA 1Y8MA 4LUNU 3B13A 2XPIA 5KJNA 3RJVA 3LY9A 4I2WA 3L17A 3O48A 1QQEA 3CK8A 3L6AA 3OTNA 2BTDA 4J8FA 4QFVA 5FQ4A 3DPDA 3SF4A 5FQ8A 3RRNB 4AP2A 3DBSA 4CEMA 4WNEA 3R9AB 3PNLB 3CKBA 2XPYA 1WM5A 3IBEA 4A1SA 2XCCA 3FTSA 3MV3B 5J08A 3GZ1A 5HQ8A 4A55A 1PAQA 4XIFA 1HU3A 2FF4A 3AU5A 4JEUA 3T8MA 4EECA 2A4ZA 3MX3A 4GCNA 3UT8A 3ZEFA 4WNDA 2CHWA 5CHEE 5JJ7A 3LY8A 2YINA 3VLEA 2AWIA 3RKVA 1HX8A 2XEVA 1JUQA 1UJJA 3Q4AB 3ZFWA 2IU1A 3TXMA 2PQRA 4JEHA 2C0MA 2WXJA 4ANVA 1JWGA 4ILIA 3UT4A 2UWJG 3QK0A 2LNIA 4J6IA 4YVQC 3CR3A 4OVVA 4ACLA 1LF8A 4F3VA 5KCMA 4PDXA 1OWPA 2FULA 4IRUA 1H19A 3AS4A 3S7DA 5DBKA 3QC1A 2VGYA 3ZYQA 3SD5A 2EQXA 3GZSA 1TEZA 3B7RL 4B89A 4FLHA 1MHQA 3TL5A 1EYHA 1HXIA 3AS5A 4GYOA 4J8DA 3QDNA 2DIWA 4XI9A 3R7QA 4I9CA 3CHPA 4C9BB 3LVRE 4DLQA 1IQRA 3MV2B 3NF1A 3U66A 4G1TA 2OVFA 1E8ZA 1HE8A 3L13A 5ARGA 4U0UA 3CHSA 4WWPA 3I5PA 3G2VA 4EQFA 2J09A 4BFRA 1DVPA 4I6EA 5AENA 4ANXA 2WMNA 4I1AA 2ZU6B 1IQUA 3SBTB 4FA6A 4N2QA 3JYSA 2GGFA 2JEKA 3PE3A 5ENNA 1WAO1 3ASFA 3BG0B 3FWVA 2J4DA 4KXKB 5ANLA 4E85A 3VLFA 3APCA 3ULQA 4BX8A 3FULA 4EZJA 4L2LA 5KJLA 1DNPA 2I9CA 4UI9J 2KZTA 4KZCA 1U3DA 4WAFA 5EDSA 3G2WA 3FEYA 2L9BA 3CGHA 4RG9A 1H0AA 3QJZA 4EZLA 3GW4A 2VJ8A 3EIQC 4HS2A 4YVOA 4ABNA 4KVOA 1XGWA 2X38A 3EHNA 3TXNA 4UWFA 2XCBA 1E90A 2M63A 2BUGA 3FY4A 3L54A 3K9IA 3QKYA 4JC8A 5JHBA 4APFA 5EKQD 1TJFA 3ZHEA 1S0PA 2CHXA 4U8HA 4HOSA 1ELKA 2R17C 3HIZA 4I6JA 3CVYA 2IJGX 4A1GA 2AXVA 2A5UA 5EX3A 1E8XA 3ZXSA 3LKUA 5T3RA 5BT1A 5ANRA 5LCWJ 1H2UA 5A7DB 4KMOA 2PM7A 3FH7A 1A17A 3OXGA 4U63A 2FI7A 4DLOA 3R7RA 1H6KA 4AIFA 1BPOA 1KT0A 2J9QA 1EDUA 4L2YA 4E6HA 4GB9A 2MHKA 2KZTB 2OVBA 2VTBA 2AXUA 5BW8C 3D9LA 3KD7A 2KM4A 4C0EA 2WQ7A 4CT0A 2GRMA 2WXNA 3HHMA 4IN3B 3MYVA 4XKBA 4EBAA 2QFCA 3MJWA 3U9WA 1NA3A 1WY6A 4N3BA 4HOTA 3VTXA 3G2UA 3CVNA 3MKQA 2HR2A 4HXIA 3ZHEB 3NZSA 4LCTA 2LSUA 2P58C 3N71A 3LYAA 2YHCA 4I1MA 2V4LA 1P5QA 4L7TA 4LERA 4L1BA 4N39A 4UI9C 5FQ6A 3RO2A 5BPPA 1ELWA 2XRYA 1VDYA 3FUJA 5G04J 4NACA 4G11A 2KCVA 3D9PA 3D9NA 1HH8A 3KEZA 4FHKA 1SZ9A 5FQ7A 3ASDA 1W3BA 3D9OA 4JL0A 4CT4A 3CKCA 3IEGA 3QWPA 3URZA 4PS7A 3O4ZA 5G55A 2NC9A 5JHAA 4BY6A 2WM9A 1HFAA 5CMYA 1XNFA 2VTBB 4AV7A 3APDA 4BSXA 3JCKC 4DI4A 2V0PA 4XKCA 3UT7A 4WNGA 2HM8A 4F1SA 4H7XA 2R59A 2GRLA 2VSOE 4GAAA 2YQ8A 3S7JA 4B0ZA 4WUYA 1GW6A 4BTAA 3HDXA 4CDNA 5LCWC 4K03A 3ML8A 2KC7A 1UJKA 3P2BA 1E8WA 1UN9A 4HVBA 4AOFA 5KJKA 3MKQB 2WQ6A 2WMOA 2OV8A 5LFAA 3CSTA 2IOSA 2L6JA 2OOEA 3MKRA 4AY6A 2AXZA 2WXPA 1HS6A 3MA5A 1PY1A 2I1KA 4I1OB 4LRZA 2VGXA 4I43A 4D10C 1E8YA 3RO3A 3CHQA 5G2NA 3SFZA 2X6KA 4V3IA 3LEWA 1E7VA 3FU5A 3HVEA 4ANWA 4EBAG 2DBAA 4HOQA 4RVBA 4Q69A 4HFGA 4BTBA 3FTXA 1HO8A 5D0QD 4TRQA 3ESKA 3PNTB 4M3OA 3AS8A 5ARFA 2ONDA 3FTYA 3SGHA 3P1UA 3RU0A 3CHRA 4K0RA 2YHEA 2MOWA 1IHGA 4MRUA 4FC8A 2WXIA 1SZAA 3Q5MA 3JQ1A 3LS8A 2J07A 4L23A 4PS3A 3SBSA 4GCOA 4GA1A 4DK5A 5T4YA 5G04C 2IF4A 2HYZA 1UW4B 3EIJA 5LOZA 4B94A 1N52A 4IULA 3ZW3A 4CCAA 3B7TA 4AJWA 2Y3AA 2WXQA 4OYSA 4BWRA 5JJTA 4G26A 3MCXA 4BT8A 2PQNA 3FU3A 4N3CA 2WPVA 3CK9A 5M72A 2YNQA 2LAIA 2IONA 5C1DA 3SNXA 2QY7A 2WXHA 4HORA 5E76A 2VGXB 3FU0A 4Y6WA 2I6HA 4PH4B 4R7LA 4I2ZA 5BNWA 3T5VA 3L08A 3T5XA 4ME2A 3HVEB 2WXMA 4JPSA 4MS6A 2E0IA 4OVUA 2HO1A 3FUFA 3L16A 5D0OD 1NA0A 5LP0A 3ZN3A 3ESLA 2AVPA 4BT9A 1FCHA 2L0TB 2XGOA 1KLXA 4I9EA 3PREA 3PRZA 1B89A 5EX0A 5CCLA 4JA9A 3SHFA 2GW1A 2KATA 4ANUA 5G05J 3ONKA 4GYWA 3IV0A 1ZU2A 3FUIA 3LDZA 1JWFA 2J4BA 2X6HA 5FT9A 2FO7A 3OXFA 4MKTA 3FU6A 4GU5A 1QNFA 3JQ0A 1UG3A 4AVXA 3I4RB 2WB2A 3EHMA 3ENEA 2FBNA 4IYPA 3ZGQA 4CGWA 5AYWD 2C2LA 3FEXA 3HYMB 4KBQA 3FH8A 2XGSA 1E7UA 3LPZA 4I17A 3IKOB 1OWLA 3FTVA 3ZIMA 3TAXA 3FUEA 1OWOA 2ILRA 4A3VA 1Y6IA 3CHMA 3FFLA 4GZ5A 3FUHA 4DJAA 3D3MA 3CVQA 2C0LA 3PDNA 3LCAA 4XI0A 2AW6A 3TJPA 4Y6CA 1OUVA 3L22A 4J8EA 3C98A 4JHRA 3OXLA 4JHKA 4J0UA 3RK6A 3FUKA 2LAHA 2WXFA 2X6IA 3E4BA 3I3NA 2WVIA 1NZNA 3I4GA 3CVVA 2VQ2A 3CVLA 1JPLA 3B7UX 3FP3A 3RIBA 1HF8A 4MLPA 4B8CB 5CCMA 4TUUA 2L0IA 4APOA 5BUZA 3QNKA 4UWGA 1OWMA 4GA0A 4JVSA 3UMVA 2RD0A 3PVLA 2XGMA 2CG3A 5FJYA 3GYZA 3Q49B 1UN8A 3PZDA 3FUMA 5AJLA 1EF1C 4EZKA 4NURA 1HG5A 1HG2A 4J8SA 2J08A 4URKA 1MQSA 3ZYMA 3CIAA 3CHOA 2KCLA 3QWWA 4XE0A 3TGOA 5G05C 4GZCA 5KJMA 2Q7FA 3EDTB 3ONLA 3PS6A 1OWNA 2XPZA 4EPZA 5JJ6A 3FUNA 4G25A 4LEUA 3NQPA 4UI9K 3QOUA 3ZVVA 4WNFA 3CVWA 3TG4A 4JW1A 4WWNA 5C2YA 3D9KA 4UWKA 1SQMA 4TV3A 1Z3XA 3G2TA 4W9RA 4UQZA 5FWQA 1KT1A 4HLEA 2XRZA 2J49A 5T8IA 4GMJA 4NQ0A 4ILGA 4U0ZA 3ZRHA 2X3MA 4U0SA 1HZ4A 1NP7A 1EPUA 4GZDA 4XX5A 5DIZA 3SZ7A 4NRHB 4AM9A 3Q15A 5AIJA 2V5FA 5FZRA 1N54A 1ELRA 1L5JA 3UX4A 4FU3A 3CQCB 1U3CA 4WWOA 3QWVA 3RRMB 3G2SA 3S2AA 4G23A 2MRIA 5LX8A 2FEZA 4DI3A 4UQYA 4F53A 4O6FA 4UWLA 2JLBA 1YA0A 2VSNA 3CV0A 3S7FA 1Z6TA 4GMLA 4ACKA 4F7AA 5AJDA 2Y4UA 3D9JA 2KCKA 3FTWA 3PE4A 3UUXA 3ZPJA 5A23A 1PC2A 4N5CA 4A3TA 1Z3YA 2WXOA 4HOUA 4U07A 3MZLB 2CG2A 3CVXA 1INZA 3PUKA 4JZYA 5FTPA 3CVPA 4CDMA 3PEVB 4C0MA 4KYOB 4U04A 2R5SA 3CLJA 3MEKA 3CSFA 1H2VC 4FULA 3CVUA 4FP7A 1E96B 2CFUA 2V8SE 3JUIA 4BX9A 5A6CA 3LJ3A 2PZIA 3FTUA 3U64A 4CGVA 2RG8A 2IFUA 3LXUX 5BV1A 3QB2A 3ZYLA 4B8AA 4AY5A 4H7YA 2IOLA 4UQXA 4FJYA 3S7BA 4RG6A 2VSXE 2E2EA 3OAWA 3PEUB 4UWHA 1X5BA 2BF0X 3Q47B 2IQCA 3PH0C 1TJCA 3VLDA 5BV0A 4PUCA 2NSZA 3IHYA 2PL2A 3LVQE 3VTYA 3APFA 4PS8A 2I1JA 2VSYA 1FVHA 4N3AA 3FHEA 4I6GA 2X6FA 3FH5A 3KS2A 1IYGA 3QARA 3EJNA 2WXRA 3ASGA 4AEZC 4Q96A 3IHVA 3ML9A 4KVMA 3UPVA 4G24A 4DPRA 4GPKA 2WXKA 2WXGA 3CQGB 3D9MA 1H2TC 4AXHA 5CMWA 1FVFA 3QAQA 4G2VA 4XZ4A 2UY1A 4FADA 4ATGA 3FDHA 2XQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CK7 A;  2LSV A;  4GZ3 A;  3LY7 A;  4CDR A;  2VYI A;  4JA7 A;  3U4T A;  1ZBP A;  3BEE A;  2WQH A;  3ASH A;  5FZS A;  3WXX A;  4GZ6 A;  3GZ2 A;  5FZQ A;  4GA2 A;  3UQ3 A;  3TG5 A;  5HI7 A;  2Y4T A;  3U3W A;  4N2S A;  1QZ2 A;  4GYY A;  4YND A;  3KAE A;  2UY1 B;  3CEQ A;  1Y8M A;  2XPI A;  5KJN A;  3RJV A;  3LY9 A;  4I2W A;  3O48 A;  1QQE A;  3CK8 A;  4J8F A;  3SF4 A;  4WNE A;  3R9A B;  3CKB A;  1WM5 A;  4A1S A;  2XCC A;  3MV3 B;  3GZ1 A;  5HQ8 A;  4XIF A;  2FF4 A;  4GCN A;  4WND A;  5CHE E;  5JJ7 A;  3LY8 A;  3RKV A;  2XEV A;  3Q4A B;  3ZFW A;  2PQR A;  2C0M A;  2UWJ G;  2LNI A;  4YVQ C;  4F3V A;  3AS4 A;  3S7D A;  5DBK A;  2VGY A;  1HXI A;  3AS5 A;  4GYO A;  4J8D A;  3QDN A;  4XI9 A;  4I9C A;  3MV2 B;  3NF1 A;  4G1T A;  5ARG A;  4U0U A;  4EQF A;  4I1A A;  4N2Q A;  3JYS A;  3PE3 A;  1WAO 1;  3ASF A;  3FWV A;  4KXK B;  3ULQ A;  5KJL A;  4UI9 J;  4RG9 A;  3GW4 A;  4YVO A;  4ABN A;  2XCB A;  2BUG A;  3K9I A;  3QKY A;  5EKQ D;  3ZHE A;  4HOS A;  5EX3 A;  3LKU A;  5BT1 A;  5LCW J;  5A7D B;  1A17 A;  3OXG A;  2FI7 A;  4AIF A;  1KT0 A;  2J9Q A;  2MHK A;  5BW8 C;  3KD7 A;  4IN3 B;  2QFC A;  1NA3 A;  4N3B A;  4HOT A;  3VTX A;  3CVN A;  2HR2 A;  3ZHE B;  2LSU A;  2P58 C;  3N71 A;  3LYA A;  2YHC A;  4UI9 C;  1P5Q A;  4N39 A;  3RO2 A;  1ELW A;  5G04 J;  2KCV A;  1HH8 A;  3ASD A;  1W3B A;  4JL0 A;  3CKC A;  3IEG A;  3QWP A;  3URZ A;  2NC9 A;  1XNF A;  4WNG A;  4H7X A;  3S7J A;  2YQ8 A;  4WUY A;  4BTA A;  5LCW C;  2KC7 A;  5KJK A;  2L6J A;  2OOE A;  3MKR A;  4AY6 A;  3MA5 A;  2VGX A;  3RO3 A;  2DBA A;  4HOQ A;  4BTB A;  5D0Q D;  3ESK A;  3AS8 A;  5ARF A;  2OND A;  3RU0 A;  1IHG A;  3Q5M A;  4GCO A;  4GA1 A;  5G04 C;  2IF4 A;  2HYZ A;  4B94 A;  5JJT A;  4BWR A;  4G26 A;  4BT8 A;  2PQN A;  4N3C A;  2WPV A;  3CK9 A;  5M72 A;  5C1D A;  4HOR A;  2VGX B;  4Y6W A;  2I6H A;  5BNW A;  4I2Z A;  4ME2 A;  2HO1 A;  5D0O D;  1NA0 A;  3ZN3 A;  2AVP A;  4BT9 A;  1FCH A;  2XGO A;  1KLX A;  4I9E A;  5CCL A;  1B89 A;  5EX0 A;  4JA9 A;  2GW1 A;  2KAT A;  5G05 J;  4GYW A;  1ZU2 A;  5FT9 A;  2FO7 A;  3OXF A;  2FBN A;  3ZGQ A;  4CGW A;  5AYW D;  2C2L A;  3HYM B;  4KBQ A;  2XGS A;  3LPZ A;  4I17 A;  3TAX A;  3FFL A;  4GZ5 A;  3CVQ A;  2C0L A;  3PDN A;  3LCA A;  4XI0 A;  4Y6C A;  1OUV A;  4J8E A;  4JHR A;  3OXL A;  4J0U A;  3E4B A;  1NZN A;  2VQ2 A;  3CVL A;  5CCM A;  3FP3 A;  3RIB A;  4APO A;  4GA0 A;  2XGM A;  5FJY A;  3GYZ A;  3Q49 B;  3QWW A;  2KCL A;  3TGO A;  5G05 C;  5KJM A;  2Q7F A;  3EDT B;  5JJ6 A;  4G25 A;  4LEU A;  4UI9 K;  3QOU A;  4WNF A;  3TG4 A;  4W9R A;  4UQZ A;  1KT1 A;  4NQ0 A;  4U0Z A;  4U0S A;  1HZ4 A;  3SZ7 A;  5DIZ A;  4AM9 A;  4NRH B;  3Q15 A;  2V5F A;  5FZR A;  1ELR A;  3QWV A;  4G23 A;  2FEZ A;  4UQY A;  4O6F A;  3S7F A;  2JLB A;  1YA0 A;  2VSN A;  3CV0 A;  3ZPJ A;  2Y4U A;  2KCK A;  3PE4 A;  3UUX A;  1PC2 A;  4N5C A;  4HOU A;  4U07 A;  5FTP A;  3CVP A;  4KYO B;  4U04 A;  2R5S A;  3MEK A;  1E96 B;  5A6C A;  2PZI A;  4CGV A;  2IFU A;  4AY5 A;  4H7Y A;  4UQX A;  3S7B A;  4RG6 A;  2E2E A;  3Q47 B;  1TJC A;  2PL2 A;  3VTY A;  2VSY A;  4N3A A;  3KS2 A;  1IYG A;  3ASG A;  3UPV A;  4G24 A;  4GPK A;  4G2V A;  2UY1 A; 
#chains in the Genus database with same CATH topology
 4CRW A;  2F37 A;  3E34 A;  5EYL A;  4CDR A;  2EIN E;  2WQH A;  2DVW A;  2DYS E;  3AU4 A;  4GZ6 A;  3WXX A;  5FZQ A;  5HI7 A;  2Y4T A;  2CHZ A;  3U3W A;  4N2S A;  4FHJ A;  3SI5 A;  1BI8 B;  4JHJ A;  4P29 A;  2XPI A;  4BET A;  3ZKJ A;  3L6A A;  3OTN A;  3DPD A;  5FQ8 A;  3DBS A;  3PNL B;  2XPY A;  3DXK G;  3IBE A;  4A1S A;  1PAQ A;  2XZD G;  4JEU A;  2A4Z A;  3LY8 A;  3T9K A;  3Q4A B;  1N4P A;  4L9P A;  2C0M A;  4ANV A;  3C3R A;  2EIM E;  4Z68 A;  4YVQ C;  5D2M C;  4YDE A;  4IRU A;  4K5B A;  3SD5 A;  3ABM E;  4J8D A;  3QDN A;  3AG4 E;  1IQR A;  3TWW A;  3U66 A;  3L13 A;  4U0U A;  3KSL A;  4WWP A;  1DVP A;  4ANX A;  4I1A A;  3HXB A;  3JYS A;  2GGF A;  3AJI A;  3BG0 B;  4OAV B;  5ANL A;  3FUL A;  2I9C A;  4WAF A;  5EDS A;  3FEY A;  4EZL A;  3GW4 A;  2VJ8 A;  4YVO A;  4ABN A;  2BUG A;  3ZHE A;  2CHX A;  1TR4 A;  1ELK A;  2R17 C;  4I6J A;  2A5U A;  3NAW A;  5ENS D;  3ZXS A;  3LKU A;  5BT1 A;  5ANR A;  5LCW J;  3NBN B;  3FH7 A;  4DLO A;  1Z5S C;  4AIF A;  4GB9 A;  3UM0 A;  3PZ2 A;  1V54 E;  2P2C P;  2WXN A;  4XKB A;  2QFC A;  3MJW A;  5ENO D;  3U9W A;  5BXU A;  4HOT A;  3G2U A;  3N71 A;  2Y1L E;  5BPP A;  1ELW A;  4G11 A;  1SZ9 A;  2F8X K;  3ASD A;  4F6R D;  3IEG A;  3Q7F A;  4AV7 A;  4BSX A;  4DI4 A;  2HM8 A;  4B0Z A;  3S7J A;  4WUY A;  3ML8 A;  2KC7 A;  4K5C A;  3P2B A;  3MKQ B;  4HRM B;  2L6J A;  2I1K A;  4LRZ A;  2XEH A;  3E30 A;  2OCC E;  3RO3 A;  5G2N A;  3SFZ A;  3LEW A;  1E7V A;  3HVE A;  1JCQ A;  1HO8 A;  3TWT A;  2IO2 C;  3AS8 A;  3FTY A;  1K3Z D;  2MOW A;  3Q5M A;  4L23 A;  4DK5 A;  5T4Y A;  1UW4 B;  2Y3A A;  4ZHB A;  5JJT A;  1TN6 A;  4G26 A;  2ION A;  5C1D A;  2WXH A;  4HOR A;  2VGX B;  4PH4 B;  4I2Z A;  3L08 A;  2H6F A;  2WXM A;  1FT2 A;  3FUF A;  3ZN3 A;  1KLX A;  3PRZ A;  2GW1 A;  3W9G A;  5G05 J;  2BKG A;  2P9P G;  4GYW A;  3BU8 A;  3ZXP A;  2R2L A;  3OXF A;  5AQ9 A;  2FBN A;  3UIO C;  3ZGQ A;  4LNB A;  3LPZ A;  3FTV A;  3ZIM A;  3CHM A;  4XI0 A;  3LCA A;  5B3S E;  1DCE A;  3ZUV B;  3HXE A;  3OXL A;  5IY5 E;  2LAH A;  2X6I A;  3E4B A;  3CVV A;  3KSQ A;  5CCM A;  4TUU A;  4U8Y D;  3C3O A;  4GA0 A;  4UUC A;  5CRV A;  5FIO A;  2XGM A;  3GYZ A;  3ZU7 B;  1UN8 A;  4EZK A;  2QZA A;  3ZYM A;  5CED B;  1OWN A;  5JA4 D;  2XPZ A;  4LEU A;  2EIL E;  4JW1 A;  4WWN A;  1Z3X A;  5T8I A;  4ILG A;  1HZ4 A;  4XX5 A;  4GZD A;  5AIJ A;  2V5F A;  3UX4 A;  3CQC B;  1U3C A;  4GMR A;  5HS0 A;  4O6F A;  2JLB A;  3CV0 A;  2Y4U A;  3D9J A;  2OEW A;  4N5C A;  1NFI E;  2WXO A;  3CVP A;  4U04 A;  3TWV A;  2R5S A;  2BKK B;  2F0Y A;  1YCS B;  4BX9 A;  1A5E A;  2PZI A;  3FTU A;  2DZO A;  3LXU X;  2IFU A;  3QB2 A;  1TNY A;  3S7B A;  4RG6 A;  2B0O E;  2E2E A;  1AWC B;  1X5B A;  4U96 D;  3Q47 B;  3PH0 C;  4PUC A;  4PS8 A;  2VSY A;  5B1B E;  3FH5 A;  1OY3 D;  3QAR A;  2WXR A;  3UPV A;  3D9M A;  3DRA A;  4AXH A;  1FVF A;  2ZGD A;  3CK7 A;  5J90 A;  3DSX A;  3LY7 A;  2NXP A;  5ENR D;  3ASH A;  4DX7 D;  3FUD A;  4GA2 A;  4F1P A;  5ENP D;  4FLB A;  3D9I A;  4FJZ A;  1QZ2 A;  4YND A;  1AP7 A;  3B7S A;  3Q9U C;  3RSE G;  2UY1 B;  3CEQ A;  4GTP A;  4U8V D;  1Y8M A;  5KJN A;  1YYH A;  3RJV A;  2DYR E;  2BTD A;  4JD2 G;  3DSU A;  4AP2 A;  4BSZ B;  4CEM A;  1WM5 A;  2XCC A;  3FTS A;  5J08 A;  5EYP F;  3MX3 A;  2CHW A;  2NYJ A;  4DRX E;  5AAO A;  3VLE A;  1JUQ A;  1UJJ A;  3C5R A;  3ZFW A;  4GTO A;  3TXM A;  3IXE A;  1JWG A;  2UWJ G;  1MZC A;  3QK0 A;  2LNI A;  3KEA A;  3CR3 A;  4ATZ D;  4PDX A;  2H6I A;  1H19 A;  3S7D A;  5DBK A;  3GZS A;  4FLH A;  1MHQ A;  5AQ7 A;  4TXR A;  4XI9 A;  4I9C A;  4DLQ A;  4G8L A;  3PZ3 A;  1HE8 A;  2OVF A;  5ARG A;  2J09 A;  4I6E A;  4FA6 A;  4N2Q A;  3PE3 A;  1WAO 1;  4E85 A;  3VLF A;  3APC A;  3W9F A;  4EZJ A;  1DNP A;  1NL4 A;  1TNZ A;  1N94 A;  2L9B A;  4KVO A;  1XGW A;  2XEE A;  2X38 A;  3EHN A;  4UWF A;  3TXN A;  3FY4 A;  3L54 A;  4APF A;  5EKQ D;  1TJF A;  4HLL A;  5ENT D;  3DPY A;  1S0P A;  4U8H A;  1IXV A;  1SA5 A;  2IJG X;  2IEJ A;  4LSZ E;  1H6P A;  2PM7 A;  4TUM A;  1H6K A;  2P9S G;  4L2Y A;  2KZT B;  2OVB A;  2AXU A;  3D9L A;  2R02 A;  2IY0 C;  4CT0 A;  1SA4 A;  3MYV A;  4EBA A;  1NA3 A;  2P58 C;  3LYA A;  2YHC A;  4I1M A;  4EPZ A;  1P5Q A;  3HXD A;  1VDY A;  3FUJ A;  3D9N A;  1HH8 A;  3KEZ A;  4FHK A;  1W3B A;  3D9O A;  3O4Z A;  3BUA A;  3T8K A;  2NC9 A;  4BY6 A;  2VTB B;  2V0P A;  4XKC A;  4WNG A;  3E32 A;  2YQ8 A;  3HDX A;  5LCW C;  2H6H A;  1E8W A;  1UN9 A;  4HVB A;  4AOF A;  3HXF A;  2OV8 A;  1UOH A;  2IOS A;  2RFA A;  3MKR A;  3DEP A;  3MA5 A;  1PY1 A;  5BXO A;  4I1O B;  4I43 A;  1E8Y A;  1S63 A;  1S64 A;  4V3I A;  1WG0 A;  4MBG A;  4EBA G;  2DBA A;  4HOQ A;  3DSW A;  3V79 K;  2J8S D;  3P1U A;  1IHG A;  2DWZ A;  1SZA A;  2QYJ A;  2J07 A;  3SBS A;  4PS3 A;  2KBX A;  4GCO A;  3E37 A;  2IF4 A;  5LOZ A;  1N52 A;  4CCA A;  3EHR A;  2WXQ A;  4BWR A;  3MCX A;  2P9K G;  4LNU D;  3HXC A;  4N3C A;  2WPV A;  3JUE A;  2ZIR A;  4J8Y A;  2QY7 A;  3D9H A;  3ASO E;  5E76 A;  5BNW A;  4OVU A;  2HO1 A;  4EHM A;  3L16 A;  1NA0 A;  3JXI A;  5AN8 A;  4BT9 A;  1B89 A;  5EIB E;  3SHF A;  1JWF A;  2X6H A;  5FT9 A;  5KNH D;  1FT1 A;  2FO7 A;  3JQ0 A;  3I4R B;  3ENE A;  4IYP A;  4CGW A;  2XGS A;  1E7U A;  4I17 A;  1OWL A;  3TAX A;  1OWO A;  4LG6 A;  2ILR A;  1Y6I A;  3FFL A;  4GZ5 A;  4HI9 A;  3FUH A;  3TJP A;  4Y6C A;  4RLY A;  1KPS B;  1MJ0 A;  4G8K A;  2WVI A;  5AQB A;  3I4G A;  2VQ2 A;  3JXJ A;  3RIB A;  3ULE G;  3QNK A;  2LXM A;  1OWM A;  2IO3 C;  5FJY A;  3PZD A;  1EF1 C;  3EUV A;  3F6Q A;  1MX6 A;  3CIA A;  4HRN A;  4XE0 A;  1WDY A;  3TGO A;  5G05 C;  2P9I G;  3NQP A;  3CVW A;  1N4R A;  2R05 A;  3ABL E;  1KT1 A;  2RKK A;  3UXG A;  2XRZ A;  2J49 A;  3ZRH A;  2X3M A;  4DUI A;  1NP7 A;  1EPU A;  4AM9 A;  4NRH B;  5FZR A;  3RRM B;  1IKN D;  4G23 A;  2MRI A;  2R03 A;  5KBA A;  4UWL A;  3S7F A;  1Z6T A;  3TWR A;  5AJD A;  4F7A A;  5A23 A;  3FTW A;  3PE4 A;  2EIK E;  4HOU A;  1S70 B;  3PEV B;  4FUL A;  1H2V C;  3CVU A;  2HE0 A;  2V8S E;  3LJ3 A;  1DC2 A;  4CGV A;  5BV1 A;  4AY5 A;  2IOL A;  4UQX A;  4FJY A;  2RFM A;  2P9U G;  3ISM C;  3VLD A;  3VTY A;  3APF A;  2I1J A;  1MYO A;  1MX2 A;  4K5A B;  3FHE A;  3KS2 A;  3EJN A;  5D66 A;  3ML9 A;  4DPR A;  4GPK A;  1LD8 A;  2WXG A;  3CQG B;  1H2T C;  4XZ4 A;  4FAD A;  4ATG A;  3FDH A;  2LSV A;  4B93 B;  3L9T A;  3PUJ A;  2X6J A;  2CFZ A;  2WXL A;  4JA7 A;  4CZ2 D;  2QC9 A;  2DCP A;  3U4T A;  1ZBP A;  3BEE A;  5CER B;  1TNO A;  2LO6 A;  4ILH B;  5FZS A;  3GZ2 A;  3BG1 B;  4JXT A;  2I2O A;  4KZ0 A;  3ZYK A;  3HRA A;  3E33 A;  1SVX A;  4RSY A;  3DSV A;  4KT6 B;  3RRU A;  3PZ4 A;  3B13 A;  4LUN U;  4I2W A;  3O48 A;  1TN8 A;  1QQE A;  4QFV A;  3SF4 A;  3DEO A;  3WG7 E;  3CKB A;  3X2Q E;  2XS8 A;  4XIF A;  1O1S A;  2FF4 A;  3AU5 A;  3T8M A;  3ZEF A;  4WND A;  4GTT A;  5CHE E;  2VGE A;  5JJ7 A;  3SY2 A;  2F8Y A;  2PNN A;  1N4Q A;  1HX8 A;  2XEV A;  4NIK A;  2IU1 A;  2ZXW E;  1OCO E;  4ILI A;  3UT4 A;  4J6I A;  4ACL A;  4CYM D;  1OWP A;  3QC1 A;  2EQX A;  1TEZ A;  4B89 A;  3TL5 A;  1EYH A;  1HXI A;  3AS5 A;  1N95 A;  4XEI G;  3R7Q A;  3CHP A;  3LVR E;  3NF1 A;  1MX4 A;  4M7C A;  1OCR E;  1E8Z A;  1V55 E;  3G2V A;  3UI2 A;  1IQU A;  3ASF A;  1X81 A;  3FWV A;  3ULQ A;  4BER A;  4L2L A;  5KJL A;  4N5Q A;  5HRY A;  4UI9 J;  1U3D A;  3G2W A;  3CGH A;  4RG9 A;  4HRL A;  3UKR G;  3QJZ A;  5EID A;  3EIQ C;  3AG3 E;  4O60 A;  3K9I A;  3QKY A;  4JC8 A;  5JHB A;  3EHQ A;  4HOS A;  2GRQ B;  2AXV A;  4BES A;  3Q9N C;  5EX3 A;  1H2U A;  4KMO A;  1A17 A;  3OXG A;  3R7R A;  2AJA A;  1KT0 A;  4E6H A;  5BW8 C;  4C0E A;  3KD7 A;  2GRM A;  3HHM A;  4J7W A;  1WY6 A;  3AG2 E;  4N3B A;  3CVN A;  3MKQ A;  4HXI A;  3ZHE B;  2LSU A;  3UM1 A;  2V4L A;  4N39 A;  1FPP A;  5FQ6 A;  3RO2 A;  5G04 J;  4BEP A;  1LD7 A;  3D9P A;  1K1B A;  3BQO A;  3V31 A;  4CT4 A;  3SO8 A;  3URZ A;  4PS7 A;  5G55 A;  5JHA A;  2WM9 A;  2XS1 A;  5CMY A;  3JCK C;  4F1S A;  2R59 A;  4GAA A;  5FIN A;  1GW6 A;  4K03 A;  5KJK A;  2WQ6 A;  2WMO A;  5LFA A;  3CST A;  2JAB A;  2OOE A;  4AY6 A;  2WXP A;  1HS6 A;  2VGX A;  4DX2 A;  2LXL A;  1O5M A;  2X6K A;  1TN7 A;  4HBD A;  3UIP C;  4HFG A;  4BTB A;  5D0Q D;  4TRQ A;  4M3O A;  5ARF A;  3RU0 A;  5CBO A;  3CHR A;  4K0R A;  2YHE A;  4MRU A;  4FC8 A;  2HYZ A;  3ZW3 A;  4IUL A;  2P9N G;  4AJW A;  4OYS A;  3CK9 A;  5M72 A;  3FU0 A;  3T5V A;  3T5X A;  2V4H C;  3HVE B;  2E0I A;  5D0O D;  3ZNG A;  3ESL A;  1FCH A;  4I9E A;  1G3N B;  3PRE A;  5EX0 A;  3SFY A;  2GRR B;  3FUI A;  3LDZ A;  2OEV A;  4MKT A;  2GRO B;  1QNF A;  2WB2 A;  3EHM A;  5AYW D;  2C2L A;  3FH8 A;  3IKO B;  1KZO A;  3D3M A;  3PDN A;  1OUV A;  4JHR A;  3EU5 A;  3Q7A A;  3RK6 A;  3I3N A;  4LNG A;  3DST A;  1NZN A;  3FP3 A;  4B8C B;  2L0I A;  3UMV A;  2RD0 A;  3RAU A;  2H6G A;  3FUM A;  1D8E A;  4NUR A;  1HG5 A;  1O1R A;  4J8S A;  1MQS A;  3QWW A;  3CHO A;  2KCL A;  1JCR A;  5KJM A;  2Q7F A;  3ONL A;  5JJ6 A;  3FUN A;  4G25 A;  1OT8 A;  4UI9 K;  3QOU A;  3ZVV A;  4WNF A;  3TG4 A;  3D9K A;  1SQM A;  5CRU A;  5FWQ A;  4W9R A;  4GMJ A;  4NQ0 A;  3SZ7 A;  1U2V G;  5DIZ A;  3Q15 A;  3Q79 A;  1ELR A;  1L5J A;  4OAU C;  1JCS A;  3QWV A;  5LX8 A;  1OCZ E;  4DI3 A;  4YDW A;  1K8K G;  1PC2 A;  4A3T A;  3DSS A;  3MZL B;  2CG2 A;  3CVX A;  3PUK A;  4JZY A;  4KYO B;  2CFU A;  3JUI A;  5CEA A;  3U64 A;  1K1A A;  2RG8 A;  3ZYL A;  4B8A A;  2VSX E;  1IHB A;  4YDO A;  2IQC A;  1TNB A;  4GTM A;  2BED A;  2PL2 A;  1OCC E;  1FVH A;  2X6F A;  3C72 A;  3J5P A;  5HKP A;  3ASG A;  4AEZ C;  4Q96 A;  3IHV A;  4C48 B;  3R9M A;  2WXK A;  5CMW A;  4G2V A;  3QAQ A;  2UY1 A;  2XHE A;  4GZ3 A;  1BLX B;  2XZT G;  2V5Q C;  2VYI A;  2ZIS A;  2LUH A;  1D8D A;  3EU9 A;  3UQ3 A;  3HG0 D;  1TNU A;  3TG5 A;  3NZU A;  4O1P A;  4Q94 A;  2PM6 A;  2QYU A;  5E75 A;  4X8Q A;  4GYY A;  4HQD A;  3MGB A;  3KAE A;  3NOG D;  3FTZ A;  3UTM A;  3LY9 A;  3L17 A;  3CK8 A;  4J8F A;  4GTS A;  5FQ4 A;  3RRN B;  4WNE A;  3R9A B;  3Q78 A;  3MV3 B;  1DCQ A;  2ETA A;  3GZ1 A;  5HQ8 A;  4A55 A;  1HU3 A;  1RZ4 A;  4EEC A;  4GTR A;  4GCN A;  3UT8 A;  1SW6 A;  3TWX A;  2YIN A;  1N0R A;  2AWI A;  3RKV A;  2PQR A;  4JEH A;  2WXJ A;  3NOC D;  5KWD A;  4OVV A;  2DZN A;  1LF8 A;  4F3V A;  5KCM A;  2FUL A;  2ETB A;  3AS4 A;  2KXP C;  2VGY A;  3ZYQ A;  4GPM A;  2GRP B;  3B7R L;  4JB8 P;  4GYO A;  2Y0B G;  2DIW A;  4C9B B;  1BU9 A;  3MV2 B;  4G1T A;  3CHS A;  1N9A A;  3I5P A;  4EQF A;  4BFR A;  5AEN A;  2WMN A;  2ZU6 B;  3SBT B;  4HB5 A;  2JEK A;  5ENN A;  2J4D A;  4KXK B;  4QQI A;  4BX8 A;  4GTQ A;  3TWU A;  1N4S A;  5JMN D;  2KZT A;  4KZC A;  5CBN A;  1H0A A;  4HS2 A;  4GTV A;  2XCB A;  1E90 A;  2M63 A;  5H7P A;  5B1A E;  3HIZ A;  3CVY A;  2L6B A;  4U95 D;  5AQA A;  4A1G A;  4HI8 A;  1E8X A;  3ABK E;  4ZFH A;  3ULY A;  5T3R A;  4A63 B;  4U7E B;  5A7D B;  1QYM A;  4U63 A;  2FI7 A;  2XEN A;  1LTX A;  1BPO A;  2J9Q A;  5ITZ F;  1EDU A;  1Q2Z A;  2MHK A;  2VTB A;  2WQ7 A;  2KM4 A;  3Q75 A;  4IN3 B;  3VTX A;  2HR2 A;  1QBQ A;  3NZS A;  4LCT A;  1ZB1 A;  4UI9 C;  4L7T A;  4L1B A;  4LER A;  2XRY A;  4NAC A;  2KCV A;  3LJN A;  1D9S A;  5FQ7 A;  4JL0 A;  3CKC A;  3QWP A;  1N11 A;  1HFA A;  1XNF A;  3APD A;  3UT7 A;  4H7X A;  2GRL A;  2VSO E;  4BTA A;  4CDN A;  5CEC B;  1BD8 A;  1UJK A;  3DWL G;  3UM3 A;  2AXZ A;  4D10 C;  3CHQ A;  3FU5 A;  4ANW A;  4RVB A;  3V2O A;  4Q69 A;  3FTX A;  3ESK A;  3PNT B;  2OND A;  3SGH A;  2WXI A;  3JQ1 A;  3LS8 A;  1N0Q A;  4GA1 A;  5G04 C;  3DXM G;  5EIL A;  3EIJ A;  4B94 A;  1KZP A;  3B7T A;  3V2X A;  4BT8 A;  2PQN A;  3FU3 A;  2FO1 E;  2YNQ A;  2LAI A;  3SNX A;  1BI7 B;  3NB2 A;  4Y6W A;  2I6H A;  4R7L A;  4ME2 A;  4JPS A;  4MS6 A;  1H6O A;  3TWQ A;  5LP0 A;  2AVP A;  2L0T B;  2XGO A;  5CCL A;  3AG1 E;  3B7B A;  3UKU G;  4RQI A;  4DX6 D;  3L82 A;  4JA9 A;  3V30 A;  2KAT A;  1TYQ G;  3ONK A;  4ANU A;  3IV0 A;  1ZU2 A;  1O1T A;  2J4B A;  4AVX A;  3FU6 A;  4GU5 A;  1UG3 A;  3HYM B;  3FEX A;  4KBQ A;  3FUE A;  5AAR A;  4A3V A;  1NI1 A;  2P9L G;  4DJA A;  3CVQ A;  2C0L A;  2AW6 A;  3L22 A;  4J8E A;  3C98 A;  3SQV A;  4JHK A;  4J0U A;  3FUK A;  2WXF A;  4DX1 A;  3CVL A;  1JPL A;  3B7U X;  1HF8 A;  4MLP A;  4APO A;  1OXJ A;  5BUZ A;  4UWG A;  4JVS A;  3PVL A;  2CG3 A;  3C3Q A;  3Q49 B;  5AJL A;  1HG2 A;  2J08 A;  4URK A;  4GZC A;  3EDT B;  3PS6 A;  3Q73 A;  3B95 A;  3UIN C;  4HNA D;  3TWS A;  5C2Y A;  5EN5 D;  4UWK A;  1RW2 A;  4DX5 D;  4TV3 A;  3G2T A;  4UQZ A;  4HLE A;  5ENQ D;  4U0Z A;  4U0S A;  2MYO A;  1N54 A;  4FU3 A;  4WWO A;  3J5Q B;  3G2S A;  3PZ1 A;  3S2A A;  2FEZ A;  4UQY A;  4F53 A;  1YA0 A;  2VSN A;  4GML A;  4ACK A;  3ZPJ A;  2KCK A;  3UUX A;  4TXQ A;  1Z3Y A;  4U07 A;  4O1O A;  1INZ A;  5FTP A;  5KNG A;  4CDM A;  4C0M A;  3AAA C;  3CLJ A;  4YDY A;  3CSF A;  3MEK A;  4FP7 A;  1E96 B;  2Y69 E;  5A6C A;  2GRN B;  3ASN E;  4H7Y A;  3OAW A;  3PEU B;  4UWH A;  2BF0 X;  1TJC A;  5BV0 A;  2A5E A;  2EIJ E;  2NSZ A;  3IHY A;  2ZGG A;  3LVQ E;  1YMP A;  4N3A A;  3SFX A;  4I6G A;  3UM2 A;  1IYG A;  2ETC A;  4KVM A;  4G24 A;  4TXP A;  2B6C A;  2XQ0 A; 
#chains in the Genus database with same CATH homology
 3CK7 A;  5J90 A;  2XHE A;  2LSV A;  4CRW A;  4GZ3 A;  3LY7 A;  2NXP A;  3PUJ A;  4CDR A;  2X6J A;  2VYI A;  2CFZ A;  2WXL A;  4JA7 A;  2DCP A;  3U4T A;  1ZBP A;  3BEE A;  2WQH A;  3ASH A;  2LO6 A;  3AU4 A;  4ILH B;  5FZS A;  4GZ6 A;  3GZ2 A;  3BG1 B;  3WXX A;  5FZQ A;  3FUD A;  4GA2 A;  3UQ3 A;  4FLB A;  3D9I A;  4JXT A;  3TG5 A;  5HI7 A;  2Y4T A;  2CHZ A;  2I2O A;  3NZU A;  4FJZ A;  2PM6 A;  4Q94 A;  5E75 A;  3U3W A;  4N2S A;  4FHJ A;  1QZ2 A;  3SI5 A;  4GYY A;  4YND A;  3B7S A;  4KZ0 A;  3MGB A;  3ZYK A;  3KAE A;  2UY1 B;  3CEQ A;  4JHJ A;  4RSY A;  4KT6 B;  4P29 A;  3FTZ A;  3RRU A;  1Y8M A;  4LUN U;  3B13 A;  2XPI A;  5KJN A;  3RJV A;  3LY9 A;  4I2W A;  3L17 A;  3O48 A;  1QQE A;  3CK8 A;  3L6A A;  3OTN A;  2BTD A;  4J8F A;  4QFV A;  5FQ4 A;  3DPD A;  3SF4 A;  5FQ8 A;  3RRN B;  4AP2 A;  3DBS A;  4CEM A;  4WNE A;  3R9A B;  3PNL B;  3CKB A;  2XPY A;  1WM5 A;  3IBE A;  4A1S A;  2XCC A;  3FTS A;  3MV3 B;  5J08 A;  3GZ1 A;  5HQ8 A;  4A55 A;  1PAQ A;  4XIF A;  1HU3 A;  2FF4 A;  3AU5 A;  4JEU A;  3T8M A;  4EEC A;  2A4Z A;  3MX3 A;  4GCN A;  3UT8 A;  3ZEF A;  4WND A;  2CHW A;  5CHE E;  5JJ7 A;  3LY8 A;  2YIN A;  3VLE A;  2AWI A;  3RKV A;  1HX8 A;  2XEV A;  1JUQ A;  1UJJ A;  3Q4A B;  3ZFW A;  2IU1 A;  3TXM A;  2PQR A;  4JEH A;  2C0M A;  2WXJ A;  4ANV A;  1JWG A;  4ILI A;  3UT4 A;  2UWJ G;  3QK0 A;  2LNI A;  4J6I A;  4YVQ C;  3CR3 A;  4OVV A;  4ACL A;  1LF8 A;  4F3V A;  5KCM A;  4PDX A;  1OWP A;  2FUL A;  4IRU A;  1H19 A;  3AS4 A;  3S7D A;  5DBK A;  3QC1 A;  2VGY A;  3ZYQ A;  3SD5 A;  2EQX A;  3GZS A;  1TEZ A;  3B7R L;  4B89 A;  4FLH A;  1MHQ A;  3TL5 A;  1EYH A;  1HXI A;  3AS5 A;  4GYO A;  4J8D A;  3QDN A;  2DIW A;  4XI9 A;  3R7Q A;  4I9C A;  3CHP A;  4C9B B;  3LVR E;  4DLQ A;  1IQR A;  3MV2 B;  3NF1 A;  3U66 A;  4G1T A;  2OVF A;  1E8Z A;  1HE8 A;  3L13 A;  5ARG A;  4U0U A;  3CHS A;  4WWP A;  3I5P A;  3G2V A;  4EQF A;  2J09 A;  4BFR A;  1DVP A;  4I6E A;  5AEN A;  4ANX A;  2WMN A;  4I1A A;  2ZU6 B;  1IQU A;  3SBT B;  4FA6 A;  4N2Q A;  3JYS A;  2GGF A;  2JEK A;  3PE3 A;  5ENN A;  1WAO 1;  3ASF A;  3BG0 B;  3FWV A;  2J4D A;  4KXK B;  5ANL A;  4E85 A;  3VLF A;  3APC A;  3ULQ A;  4BX8 A;  3FUL A;  4EZJ A;  4L2L A;  5KJL A;  1DNP A;  2I9C A;  4UI9 J;  2KZT A;  4KZC A;  1U3D A;  4WAF A;  5EDS A;  3G2W A;  3FEY A;  2L9B A;  3CGH A;  4RG9 A;  1H0A A;  3QJZ A;  4EZL A;  3GW4 A;  2VJ8 A;  3EIQ C;  4HS2 A;  4YVO A;  4ABN A;  4KVO A;  1XGW A;  2X38 A;  3EHN A;  3TXN A;  4UWF A;  2XCB A;  1E90 A;  2M63 A;  2BUG A;  3FY4 A;  3L54 A;  3K9I A;  3QKY A;  4JC8 A;  5JHB A;  4APF A;  5EKQ D;  1TJF A;  3ZHE A;  1S0P A;  2CHX A;  4U8H A;  4HOS A;  1ELK A;  2R17 C;  3HIZ A;  4I6J A;  3CVY A;  2IJG X;  4A1G A;  2AXV A;  2A5U A;  5EX3 A;  1E8X A;  3ZXS A;  3LKU A;  5T3R A;  5BT1 A;  5ANR A;  5LCW J;  1H2U A;  5A7D B;  4KMO A;  2PM7 A;  3FH7 A;  1A17 A;  3OXG A;  4U63 A;  2FI7 A;  4DLO A;  3R7R A;  1H6K A;  4AIF A;  1BPO A;  1KT0 A;  2J9Q A;  1EDU A;  4L2Y A;  4E6H A;  4GB9 A;  2MHK A;  2KZT B;  2OVB A;  2VTB A;  2AXU A;  5BW8 C;  3D9L A;  3KD7 A;  2KM4 A;  4C0E A;  2WQ7 A;  4CT0 A;  2GRM A;  2WXN A;  3HHM A;  4IN3 B;  3MYV A;  4XKB A;  4EBA A;  2QFC A;  3MJW A;  3U9W A;  1NA3 A;  1WY6 A;  4N3B A;  4HOT A;  3VTX A;  3G2U A;  3CVN A;  3MKQ A;  2HR2 A;  4HXI A;  3ZHE B;  3NZS A;  4LCT A;  2LSU A;  2P58 C;  3N71 A;  3LYA A;  2YHC A;  4I1M A;  2V4L A;  1P5Q A;  4L7T A;  4LER A;  4L1B A;  4N39 A;  4UI9 C;  5FQ6 A;  3RO2 A;  5BPP A;  1ELW A;  2XRY A;  1VDY A;  3FUJ A;  5G04 J;  4NAC A;  4G11 A;  2KCV A;  3D9P A;  3D9N A;  1HH8 A;  3KEZ A;  4FHK A;  1SZ9 A;  5FQ7 A;  3ASD A;  1W3B A;  3D9O A;  4JL0 A;  4CT4 A;  3CKC A;  3IEG A;  3QWP A;  3URZ A;  4PS7 A;  3O4Z A;  5G55 A;  2NC9 A;  5JHA A;  4BY6 A;  2WM9 A;  1HFA A;  5CMY A;  1XNF A;  2VTB B;  4AV7 A;  3APD A;  4BSX A;  3JCK C;  4DI4 A;  2V0P A;  4XKC A;  3UT7 A;  4WNG A;  2HM8 A;  4F1S A;  4H7X A;  2R59 A;  2GRL A;  2VSO E;  4GAA A;  2YQ8 A;  3S7J A;  4B0Z A;  4WUY A;  1GW6 A;  4BTA A;  3HDX A;  4CDN A;  5LCW C;  4K03 A;  3ML8 A;  2KC7 A;  1UJK A;  3P2B A;  1E8W A;  1UN9 A;  4HVB A;  4AOF A;  5KJK A;  3MKQ B;  2WQ6 A;  2WMO A;  2OV8 A;  5LFA A;  3CST A;  2IOS A;  2L6J A;  2OOE A;  3MKR A;  4AY6 A;  2AXZ A;  2WXP A;  1HS6 A;  3MA5 A;  1PY1 A;  2I1K A;  4I1O B;  4LRZ A;  2VGX A;  4I43 A;  4D10 C;  1E8Y A;  3RO3 A;  3CHQ A;  5G2N A;  3SFZ A;  2X6K A;  4V3I A;  3LEW A;  1E7V A;  3FU5 A;  3HVE A;  4ANW A;  4EBA G;  2DBA A;  4HOQ A;  4RVB A;  4Q69 A;  4HFG A;  4BTB A;  3FTX A;  1HO8 A;  5D0Q D;  4TRQ A;  3ESK A;  3PNT B;  4M3O A;  3AS8 A;  5ARF A;  2OND A;  3FTY A;  3SGH A;  3P1U A;  3RU0 A;  3CHR A;  4K0R A;  2YHE A;  2MOW A;  1IHG A;  4MRU A;  4FC8 A;  2WXI A;  1SZA A;  3Q5M A;  3JQ1 A;  3LS8 A;  2J07 A;  4L23 A;  4PS3 A;  3SBS A;  4GCO A;  4GA1 A;  4DK5 A;  5T4Y A;  5G04 C;  2IF4 A;  2HYZ A;  1UW4 B;  3EIJ A;  5LOZ A;  4B94 A;  1N52 A;  4IUL A;  3ZW3 A;  4CCA A;  3B7T A;  4AJW A;  2Y3A A;  2WXQ A;  4OYS A;  4BWR A;  5JJT A;  4G26 A;  3MCX A;  4BT8 A;  2PQN A;  3FU3 A;  4N3C A;  2WPV A;  3CK9 A;  5M72 A;  2YNQ A;  2LAI A;  2ION A;  5C1D A;  3SNX A;  2QY7 A;  2WXH A;  4HOR A;  5E76 A;  2VGX B;  3FU0 A;  4Y6W A;  2I6H A;  4PH4 B;  4R7L A;  4I2Z A;  5BNW A;  3T5V A;  3L08 A;  3T5X A;  4ME2 A;  3HVE B;  2WXM A;  4JPS A;  4MS6 A;  2E0I A;  4OVU A;  2HO1 A;  3FUF A;  3L16 A;  5D0O D;  1NA0 A;  5LP0 A;  3ZN3 A;  3ESL A;  2AVP A;  4BT9 A;  1FCH A;  2L0T B;  2XGO A;  1KLX A;  4I9E A;  3PRE A;  3PRZ A;  1B89 A;  5EX0 A;  5CCL A;  4JA9 A;  3SHF A;  2GW1 A;  2KAT A;  4ANU A;  5G05 J;  3ONK A;  4GYW A;  3IV0 A;  1ZU2 A;  3FUI A;  3LDZ A;  1JWF A;  2J4B A;  2X6H A;  5FT9 A;  2FO7 A;  3OXF A;  4MKT A;  3FU6 A;  4GU5 A;  1QNF A;  3JQ0 A;  1UG3 A;  4AVX A;  3I4R B;  2WB2 A;  3EHM A;  3ENE A;  2FBN A;  4IYP A;  3ZGQ A;  4CGW A;  5AYW D;  2C2L A;  3FEX A;  3HYM B;  4KBQ A;  3FH8 A;  2XGS A;  1E7U A;  3LPZ A;  4I17 A;  3IKO B;  1OWL A;  3FTV A;  3ZIM A;  3TAX A;  3FUE A;  1OWO A;  2ILR A;  4A3V A;  1Y6I A;  3CHM A;  3FFL A;  4GZ5 A;  3FUH A;  4DJA A;  3D3M A;  3CVQ A;  2C0L A;  3PDN A;  3LCA A;  4XI0 A;  2AW6 A;  3TJP A;  4Y6C A;  1OUV A;  3L22 A;  4J8E A;  3C98 A;  4JHR A;  3OXL A;  4JHK A;  4J0U A;  3RK6 A;  3FUK A;  2LAH A;  2WXF A;  2X6I A;  3E4B A;  3I3N A;  2WVI A;  1NZN A;  3I4G A;  3CVV A;  2VQ2 A;  3CVL A;  1JPL A;  3B7U X;  3FP3 A;  3RIB A;  1HF8 A;  4MLP A;  4B8C B;  5CCM A;  4TUU A;  2L0I A;  4APO A;  5BUZ A;  3QNK A;  4UWG A;  1OWM A;  4GA0 A;  4JVS A;  3UMV A;  2RD0 A;  3PVL A;  2XGM A;  2CG3 A;  5FJY A;  3GYZ A;  3Q49 B;  1UN8 A;  3PZD A;  3FUM A;  5AJL A;  1EF1 C;  4EZK A;  4NUR A;  1HG5 A;  1HG2 A;  4J8S A;  2J08 A;  4URK A;  1MQS A;  3ZYM A;  3CIA A;  3CHO A;  2KCL A;  3QWW A;  4XE0 A;  3TGO A;  5G05 C;  4GZC A;  5KJM A;  2Q7F A;  3EDT B;  3ONL A;  3PS6 A;  1OWN A;  2XPZ A;  4EPZ A;  5JJ6 A;  3FUN A;  4G25 A;  4LEU A;  3NQP A;  4UI9 K;  3QOU A;  3ZVV A;  4WNF A;  3CVW A;  3TG4 A;  4JW1 A;  4WWN A;  5C2Y A;  3D9K A;  4UWK A;  1SQM A;  4TV3 A;  1Z3X A;  3G2T A;  4W9R A;  4UQZ A;  5FWQ A;  1KT1 A;  4HLE A;  2XRZ A;  2J49 A;  5T8I A;  4GMJ A;  4NQ0 A;  4ILG A;  4U0Z A;  3ZRH A;  2X3M A;  4U0S A;  1HZ4 A;  1NP7 A;  1EPU A;  4GZD A;  4XX5 A;  5DIZ A;  3SZ7 A;  4NRH B;  4AM9 A;  3Q15 A;  5AIJ A;  2V5F A;  5FZR A;  1N54 A;  1ELR A;  1L5J A;  3UX4 A;  4FU3 A;  3CQC B;  1U3C A;  4WWO A;  3QWV A;  3RRM B;  3G2S A;  3S2A A;  4G23 A;  2MRI A;  5LX8 A;  2FEZ A;  4DI3 A;  4UQY A;  4F53 A;  4O6F A;  4UWL A;  2JLB A;  1YA0 A;  2VSN A;  3CV0 A;  3S7F A;  1Z6T A;  4GML A;  4ACK A;  4F7A A;  5AJD A;  2Y4U A;  3D9J A;  2KCK A;  3FTW A;  3PE4 A;  3UUX A;  3ZPJ A;  5A23 A;  1PC2 A;  4N5C A;  4A3T A;  1Z3Y A;  2WXO A;  4HOU A;  4U07 A;  3MZL B;  2CG2 A;  3CVX A;  1INZ A;  3PUK A;  4JZY A;  5FTP A;  3CVP A;  4CDM A;  3PEV B;  4C0M A;  4KYO B;  4U04 A;  2R5S A;  3CLJ A;  3MEK A;  3CSF A;  1H2V C;  4FUL A;  3CVU A;  4FP7 A;  1E96 B;  2CFU A;  2V8S E;  3JUI A;  4BX9 A;  5A6C A;  3LJ3 A;  2PZI A;  3FTU A;  3U64 A;  4CGV A;  2RG8 A;  2IFU A;  3LXU X;  5BV1 A;  3QB2 A;  3ZYL A;  4B8A A;  4AY5 A;  4H7Y A;  2IOL A;  4UQX A;  4FJY A;  3S7B A;  4RG6 A;  2VSX E;  2E2E A;  3OAW A;  3PEU B;  4UWH A;  1X5B A;  2BF0 X;  3Q47 B;  2IQC A;  3PH0 C;  1TJC A;  3VLD A;  5BV0 A;  4PUC A;  2NSZ A;  3IHY A;  2PL2 A;  3LVQ E;  3VTY A;  3APF A;  4PS8 A;  2I1J A;  2VSY A;  1FVH A;  4N3A A;  3FHE A;  4I6G A;  2X6F A;  3FH5 A;  3KS2 A;  1IYG A;  3QAR A;  3EJN A;  2WXR A;  3ASG A;  4AEZ C;  4Q96 A;  3IHV A;  3ML9 A;  4KVM A;  3UPV A;  4G24 A;  4DPR A;  4GPK A;  2WXK A;  2WXG A;  3CQG B;  3D9M A;  1H2T C;  4AXH A;  5CMW A;  1FVF A;  3QAQ A;  4G2V A;  4XZ4 A;  2UY1 A;  4FAD A;  4ATG A;  3FDH A;  2XQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...