2EIME

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eimE00
3AG2E 5B1AE 1OCCE 2EIJE 3ASNE 3AG3E 2OCCE 2EINE 3AG1E 5IY5E 2EIKE 2Y69E 3AG4E 1OCRE 1V54E 2DYRE 3WG7E 3ASOE 5B3SE 2EILE 3X2QE 2EIME 1V55E 2DYSE 5B1BE 2ZXWE 3ABLE 3ABME 1OCZE 3ABKE 1OCOE
chains in the Genus database with same CATH superfamily
3FTVA 1NL4A 5DIZA 3CVVA 1LF8A 3D3MA 4J8YA 3TGOA 4HOQA 2P58C 2XCBA 4JZYA 2WXGA 1BD8A 2L6BA 3SBSA 4GTPA 4JHKA 2CHZA 1H6OA 2FF4A 4C48B 2F0YA 1HG5A 3ONLA 4RG9A 4RG6A 2ETAA 3RU0A 2P9SG 1TNZA 5T3RA 2OCCE 4FU3A 4A55A 3FUKA 4LSZE 2PM6A 1N95A 3CK9A 5EDSA 5G05J 2DZOA 3Q79A 1N11A 4OAVB 3KAEA 3TAXA 3U9WA 3FTYA 2P9NG 2CFZA 1H0AA 3GW4A 2QYJA 4OYSA 3TG4A 4B93B 3UM0A 2DYRE 3FH5A 2VYIA 2AXUA 3L9TA 1N4QA 2KCKA 3QK0A 2QFCA 5AQAA 2FO1E 3V2XA 4DPRA 4BTAA 4GA1A 2RKKA 1NA3A 5CEAA 5ENSD 4BX9A 4D10C 5ENTD 5D0QD 2V8SE 1K1BA 2H6HA 3ZUVB 1RW2A 4ACKA 4L2YA 3SO8A 1BPOA 3B7RL 1SVXA 3ZXSA 4XKCA 4YDWA 3KEAA 4Q94A 5CCLA 4UQYA 1OCRE 2I9CA 3TXMA 1H6PA 1AWCB 1INZA 3EHMA 3VLDA 1IYGA 4Z68A 3R9AB 3ZHEB 3SFXA 3LDZA 3FY4A 4PS8A 3OXFA 4FHKA 3DXMG 3K9IA 4KVMA 4BFRA 3UM3A 3UT8A 4F6RD 1ZB1A 3N71A 3V2OA 2WXMA 1N0RA 1N54A 4IN3B 3VLEA 4BT9A 4H7XA 2LSVA 2P9KG 4J6IA 4I2WA 1H2UA 5CHEE 3SF4A 2BEDA 3FULA 4JA9A 3MKRA 4NRHB 2PL2A 4G8LA 4CDMA 2ZISA 3AG3E 3EUVA 5JJTA 5IY5E 5FT9A 3E30A 4LCTA 3KS2A 3UPVA 1TN7A 3ZN3A 2V5FA 4N3CA 3CVXA 3TWWA 4HB5A 1K3ZD 4FP7A 4F1SA 2XZDG 2XS1A 4MS6A 2J07A 4GMLA 4GZ6A 3ZKJA 4UWKA 3HXCA 4G24A 2HYZA 3MJWA 3HXFA 4N39A 1UN9A 2BKKB 4APOA 4B0ZA 4LNBA 5T4YA 4HS2A 4DI4A 4WWPA 1MX2A 2A4ZA 4JHRA 3AG1E 5AAOA 4KT6B 2XZTG 3ASHA 2WXRA 3FP3A 4HRNA 5AJLA 2VSOE 1YA0A 3JUEA 5G05C 4URKA 3FUIA 3KSQA 4AIFA 5EX0A 4EQFA 3D9PA 4EPZA 2AVPA 2Q7FA 3LKUA 4N3BA 4RVBA 1Z3XA 2QC9A 3J5QB 3P2BA 2KXPC 2VGXA 3D9OA 4ME2A 2LSUA 5BV0A 5B1AE 2P9IG 4XI9A 4ANUA 3J5PA 4CT0A 3U66A 5FINA 4QFVA 3L17A 1E8ZA 3CVLA 3X2QE 3MZLB 1U3DA 5ARGA 5ENNA 3ULEG 2I1KA 3DPDA 2V4HC 2WVIA 1TEZA 3LCAA 2FEZA 1U3CA 3MV2B 4HBDA 2Y4TA 3T5XA 3Q7FA 4AV7A 2YHCA 3OTNA 4U7EB 1E7VA 4L2LA 2DCPA 3HRAA 4DLOA 3JQ0A 1PC2A 2WXIA 1OWPA 5J90A 3APFA 4HXIA 3ABLE 3FEYA 4A3TA 4AM9A 5JJ7A 3CHMA 3BQOA 4GCNA 4AJWA 4U8HA 3PE3A 1WAO1 4I1AA 1S70B 4CGVA 3Q7AA 4PS7A 5ANLA 4A1GA 3NAWA 1BI7B 4TRQA 1MJ0A 4HOTA 1K8KG 1HE8A 3FEXA 2GGFA 5CMWA 5FZRA 2HO1A 4AVXA 5FQ6A 2OVBA 1IQUA 4DRXE 4DUIA 2OOEA 3O48A 4N3AA 5D66A 1E8YA 3Q49B 4NIKA 4U0SA 3PREA 1BLXB 1P5QA 3L13A 1LD7A 2GRQB 2OV8A 4FC8A 3UMVA 3L54A 3DEPA 3LY8A 4EBAG 3PZ2A 1B89A 2XRYA 3JXIA 5A23A 1UN8A 1SZAA 2Y69E 5CCMA 1KZPA 5EIDA 4C0EA 2H6FA 3QWVA 4U8YD 3ZRHA 3IHVA 2XEEA 3W9FA 1Q2ZA 2UY1A 1TJFA 4JPSA 1JPLA 2NSZA 2JLBA 3CV0A 1SQMA 4DI3A 1IXVA 3SFZA 3PVLA 4ILGA 3CVYA 2MOWA 4FLHA 4LNGA 1E7UA 3UXGA 3G2SA 2ETCA 5EYLA 5KJNA 5FZSA 2XPZA 1S0PA 3B7UX 2J08A 4P29A 4J8SA 4G1TA 3JYSA 1LD8A 4AOFA 3MKQB 1H2VC 5A7DB 3CSTA 4H7YA 2C2LA 1ZBPA 2X6HA 5LP0A 1Z3YA 1MHQA 3Q9NC 4GYOA 3HVEB 3OXGA 1E96B 4K03A 2PNNA 3CLJA 4GTMA 4HRLA 1DC2A 2R02A 5AQBA 4MLPA 3PRZA 4U0UA 2WXQA 2YNQA 4KYOB 4O1PA 4J8EA 2J09A 3NF1A 3FDHA 4CZ2D 2HR2A 3MCXA 3G2WA 3S2AA 4N5QA 2XEVA 4UUCA 4GYWA 1YMPA 1O1SA 5KCMA 2EILE 1MYOA 4TXPA 1HO8A 2KC7A 3FUHA 2PZIA 4U8VD 4B89A 1OWOA 2XCCA 5ENPD 1HG2A 2AXZA 2X6IA 2EINE 2WM9A 3CVWA 3UT4A 3ZYLA 1TNOA 2LNIA 3IHYA 4UI9K 5CERB 4I17A 3SQVA 2NC9A 1H19A 3UQ3A 2DYSE 2ZIRA 4PS3A 5T8IA 2IQCA 3MGBA 3EHNA 3IV0A 3LPZA 4XI0A 5C1DA 2GRRB 4JVSA 3PEVB 4DX7D 3LEWA 3VTXA 3W9GA 2WXNA 5KNHD 2DVWA 4DX5D 5CECB 3FUNA 4KZCA 5B1BE 3FUEA 2MHKA 3C72A 3SNXA 3OXLA 2VTBA 3URZA 3HDXA 5BNWA 5CEDB 4U07A 4GPKA 1N4PA 1QZ2A 2RFMA 3UT7A 2VGXB 5FQ8A 2ZGDA 1EYHA 1TNUA 2RG8A 4NURA 5AQ7A 4CRWA 2OVFA 4UI9C 3NOCD 1LTXA 3D9JA 5KBAA 5M72A 2KM4A 2R59A 4I1OB 5CBOA 2X6KA 3D9KA 5J08A 1WG0A 5A6CA 3JCKC 3WXXA 3D9IA 3QAQA 3EDTB 1FCHA 2RFAA 2R03A 4G8KA 4F3VA 3L16A 1X5BA 4ACLA 1G3NB 5BT1A 2WB2A 5HQ8A 4UWHA 5CRVA 1E90A 2X6JA 4FA6A 3LY7A 3FU6A 4N2SA 4ATGA 3ZNGA 2P9PG 4A1SA 5E75A 4EZKA 2J4DA 3AU4A 3AS8A 3AS5A 3C3OA 4HI9A 3ASOE 4KBQA 5FJYA 3EIQC 4I2ZA 5CRUA 2AJAA 3CIAA 4FJYA 3SY2A 1OXJA 4ILHB 3ASDA 2IU1A 4LERA 1H2TC 1SW6A 4KXKB 2L6JA 4ANVA 1DNPA 2ZGGA 2GW1A 2F37A 3R9MA 1ELKA 3G2UA 2GRPB 2VTBB 3LVRE 3JUIA 2FI7A 3EIJA 3ZYQA 4BEPA 1VDYA 1O5MA 4JA7A 5LFAA 1TN6A 3GYZA 2XS8A 4ANXA 2L9BA 3CR3A 3NB2A 3SI5A 2WQ7A 5G04C 4XEIG 2EIJE 3L6AA 4HLEA 3SZ7A 1HFAA 1PY1A 4U63A 1EPUA 4CCAA 1EF1C 4U0ZA 4F53A 2M63A 4JW1A 4TUUA 4I9EA 3RAUA 3V31A 4V3IA 4GZ3A 1OUVA 3IXEA 3CKCA 5HRYA 3ABKE 5AN8A 4DX2A 5ENQD 1OWNA 3B13A 4M3OA 3Q5MA 2GROB 4G25A 4GTTA 4GZDA 2R5SA 4HLLA 4NQ0A 4HI8A 1D9SA 2CHXA 1Z5SC 5JMND 3RJVA 4WNDA 3I4RB 1JCQA 4XE0A 2WQ6A 1TR4A 4AXHA 3B7SA 4APFA 3CVNA 3S7FA 3E4BA 5B3SE 3EHQA 3KD7A 4W9RA 3BUAA 1JCRA 3UINC 2CHWA 3RK6A 4HOSA 2UWJG 2X38A 3UKRG 5JHBA 2QZAA 5EIBE 4WWNA 4FJZA 3R7QA 5AARA 4ILIA 4Y6WA 2C0LA 1EDUA 3ESKA 3QOUA 3AJIA 5G04J 4O60A 1DVPA 5EX3A 2DZNA 5D2MC 3FFLA 3Q47B 4N5CA 3T9KA 2WXKA 3TWUA 4BTBA 1S64A 5FQ4A 4AY5A 4YNDA 4JEUA 4B8AA 1BU9A 4XKBA 4MRUA 4BX8A 1OCZE 3UM1A 3CVQA 3HHMA 5AJDA 3ULYA 5ARFA 3MV3B 1WY6A 4GZ5A 5ENRD 3UI2A 4K5BA 1ZU2A 4A63B 4BETA 5FQ7A 4LG6A 5D0OD 3DSSA 1IQRA 4PDXA 4DX6D 2IONA 2KBXA 5BXOA 2WXOA 1HU3A 1NP7A 4X8QA 2B0OE 5H7PA 3JQ1A 3G2VA 5HS0A 2IJGX 2Y1LE 4U04A 3CHOA 3CHPA 3IKOB 4JL0A 2B6CA 4XX5A 4FADA 3HXDA 5HI7A 3FUJA 2H6GA 4GYYA 5KNGA 4GZCA 2LXLA 2V5QC 3UIOC 2LAHA 4CEMA 4BWRA 2VSYA 1IHGA 3PNTB 2FO7A 1FVHA 2GRLA 2NYJA 4YDOA 1D8DA 1O1TA 1PAQA 3QB2A 4G11A 2IY0C 2JABA 4QQIA 3ZVVA 4K5AB 3TWSA 2HM8A 3BU8A 3CHSA 5JHAA 4E6HA 4RLYA 1N9AA 4EBAA 4LEUA 3CSFA 4GU5A 5KJMA 3MYVA 2V0PA 3C5RA 2WXLA 1JCSA 2ZXWE 1TNBA 1W3BA 3UUXA 3QNKA 2GRMA 1RZ4A 4J8FA 4I6GA 3APCA 3FU0A 2IEJA 3ZU7B 3PDNA 3MEKA 5G2NA 3DWLG 3ASGA 3FUDA 4CDRA 1XGWA 1V55E 1N4RA 1AP7A 2CG2A 4JC8A 4FULA 4GPMA 3PE4A 3E37A 1D8EA 3S7JA 4YVOA 5ENOD 3FTXA 4IULA 2KZTB 3AS4A 4I1MA 4EHMA 3Q4AB 2IOLA 5G55A 3V79K 3CHRA 3ZW3A 3JXJA 3EJNA 3I5PA 5BXUA 4CGWA 4J0UA 3HXBA 5CMYA 5ITZF 2DIWA 2YINA 4L9PA 1HZ4A 3Q78A 2EQXA 4I6JA 5DBKA 1A5EA 4AEZC 2WXFA 3ONKA 3C3RA 2R17C 4R7LA 4RQIA 1BI8B 4TXQA 3GZ2A 2LO6A 3TWXA 1MQSA 2VJ8A 5AYWD 4UQXA 4AP2A 5ANRA 3U4TA 5LOZA 3EU5A 2VSXE 4G2VA 2WXJA 4AY6A 2IO3C 4HFGA 1HH8A 1O1RA 3DSUA 3KEZA 2KCVA 3FTZA 4O6FA 5E76A 3OAWA 3DSVA 4GTOA 4L7TA 1N52A 2QYUA 3PZ1A 2Y4UA 4Y6CA 3NZUA 3QWWA 3RSEG 3LJNA 3E32A 3FUFA 1Y8MA 3ZGQA 4LUNU 3NBNB 3B7TA 2V4LA 2XEHA 3L82A 3IBEA 2BTDA 3LJ3A 1MX4A 1OT8A 4GTRA 3V30A 1NFIE 3QWPA 3QDNA 3ISMC 3ZHEA 3QKYA 1L5JA 1KT1A 3Q9UC 2J49A 3D9NA 4XIFA 3FTSA 4I6EA 2XENA 3E33A 1SZ9A 3C3QA 2OEWA 3TXNA 3HG0D 3MA5A 3Q73A 4OVUA 2FULA 3TWQA 4UI9J 4GAAA 4HNAD 3ZYMA 4GA2A 4TV3A 3U64A 3ZXPA 2DBAA 4UWGA 4U96D 5KJKA 2J8SD 2WXPA 4ATZD 3MX3A 3ENEA 3PS6A 2AWIA 2VGEA 2PM7A 2ONDA 2E0IA 2HE0A 3ZPJA 4LNUD 2UY1B 3CQCB 1NZNA 2LUHA 2ILRA 3QC1A 3FHEA 4K0RA 4HVBA 2IO2C 1E8WA 2VSNA 3FWVA 4WNFA 3LVQE 3TWRA 3IEGA 2WXHA 5JJ6A 3DRAA 4TUMA 4G26A 1HF8A 3B7BA 3L08A 1IHBA 2A5EA 3ABME 4MBGA 4KVOA 2XHEA 1MX6A 3EU9A 1WM5A 4DLQA 3ASFA 2Y3AA 2OEVA 2BUGA 1JUQA 4DK5A 2XPIA 4CDNA 2KCLA 3PZ4A 4GB9A 1SA5A 4EZLA 2NXPA 3RRMB 4NACA 3Q15A 3SHFA 3CK8A 4DX1A 3WG7E 4BESA 3UTMA 4C9BB 4JHJA 1A17A 1NI1A 3DEOA 3DPYA 3TWVA 3S7BA 3L22A 4Q96A 3BEEA 4ZFHA 3PZDA 4GMRA 3CHQA 3ZFWA 3RKVA 1YCSB 4YDYA 3ZYKA 3SGHA 3SBTB 3LS8A 2PQRA 2JEKA 5FIOA 4HRMB 3T8MA 1KLXA 3FTWA 2RD0A 1FT2A 2LXMA 4YVQC 3SD5A 4HQDA 5C2YA 2Y0BG 3FTUA 4HORA 3ULQA 1OCOE 4PUCA 1ELWA 5KWDA 3R7RA 1HS6A 1OWLA 2L0TB 4G23A 5HKPA 3I4GA 2XRZA 2AW6A 3ZEFA 2A5UA 3NQPA 1GW6A 4MKTA 2DWZA 3CVPA 2WQHA 3C98A 1KT0A 1HX8A 3B95A 3DSTA 3AG2E 2PQNA 4ANWA 5LCWJ 1TNYA 3PUJA 1QYMA 2MRIA 4KMOA 3HYMB 1OWMA 4TXRA 3NOGD 2WMOA 3FU3A 3QARA 5FTPA 1UJKA 1S63A 3UX4A 3DXKG 3Q75A 4ZHBA 1QQEA 2IF4A 1UG3A 4IRUA 3T8KA 2R2LA 4M7CA 2BF0X 4GA0A 3RO2A 2VGYA 3ML8A 1N4SA 5JA4D 1IKND 2CFUA 1HXIA 3QJZA 3MKQA 3CGHA 3O4ZA 3FH8A 3PNLB 4XZ4A 4F1PA 1TYQG 1YYHA 4FHJA 1KPSB 3HVEA 5EYPF 5EN5D 2I2OA 4OAUC 1V54E 2H6IA 1WDYA 3DSXA 3RIBA 3CQGB 3TJPA 3ESLA 4BY6A 4BERA 3EHRA 4KZ0A 3UM2A 3DBSA 2WPVA 3P1UA 1Y6IA 4K5CA 3PUKA 1UJJA 3HIZA 2KATA 1H6KA 3AG4E 4EECA 1X81A 2BKGA 4WUYA 1N0QA 2YQ8A 1FVFA 4WNEA 3F6QA 2QY7A 1UW4B 3KSLA 4FLBA 4UQZA 5LX8A 4J8DA 5FZQA 3PZ3A 5BV1A 2WMNA 2I6HA 4B8CB 1XNFA 4YDEA 3DSWA 3FU5A 4GCOA 4HOUA 4WNGA 2YHEA 3PH0C 4GTVA 3ML9A 4BT8A 4I43A 3AU5A 1K1AA 3TWTA 3E34A 3CVUA 4L23A 1KZOA 3SFYA 5EKQD 3G2TA 2XQ0A 3D9HA 5BW8C 1U2VG 4RSYA 1NA0A 4GTSA 1JWGA 5KJLA 3VTYA 4PH4B 4C0MA 3UKUG 3RO3A 3VLFA 2ETBA 3T5VA 4JXTA 4U95D 1OY3D 4I9CA 1Z6TA 1E8XA 2E2EA 1JWFA 4UWLA 4J7WA 4JB8P 4DJAA 1SA4A 3NZSA 4IYPA 3RRNB 2P9UG 2J4BA 1DCQA 1N94A 4JEHA 3BG0B 3TG5A 5AENA 3LY9A 2XGSA 2J9QA 5AIJA 4F7AA 3GZSA 4L1BA 4ABNA 1TN8A 4BSXA 2I1JA 3D9MA 4LRZA 2EIKE 2F8XK 3CKBA 4E85A 3UIPC 2KZTA 3TL5A 3LXUX 3S7DA 3HXEA 3APDA 3D9LA 2L0IA 4O1OA 1MZCA 2GRNB 4EZJA 2CG3A 1UOHA 1OCCE 1QNFA 5AQ9A 3ASNE 4CYMD 4JD2G 4OVVA 5LCWC 3U3WA 1QBQA 4N2QA 5EILA 4UWFA 3I3NA 2ZU6B 4Q69A 5FWQA 5BPPA 4WAFA 2X6FA 2XGMA 2P2CP 2VQ2A 2IOSA 3CEQA 4B94A 2LAIA 2R05A 4GTQA 3GZ1A 2XPYA 1TJCA 4WWOA 2AXVA 5BUZA 4GMJA 2EIME 1FT1A 3RRUA 3LYAA 3AAAC 2FBNA 2IFUA 2X3MA 2XGOA 4BSZB 2F8YA 2P9LG 3FH7A 1FPPA 3PEUB 2MYOA 3CK7A 2C0MA 4A3VA 4CT4A 3BG1B 3ZIMA 5CBNA 3FUMA 1DCEA 1ELRA
chains in the Genus database with same CATH topology
3AG2E 5B1AE 1OCCE 2EIJE 3ASNE 3AG3E 2OCCE 2EINE 3AG1E 5IY5E 2EIKE 2Y69E 3AG4E 1OCRE 1V54E 2DYRE 3WG7E 3ASOE 5B3SE 2EILE 3X2QE 2EIME 1V55E 2DYSE 5B1BE 2ZXWE 3ABLE 3ABME 1OCZE 3ABKE 1OCOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AG2 E;  5B1A E;  1OCC E;  2EIJ E;  3ASN E;  3AG3 E;  2OCC E;  2EIN E;  3AG1 E;  5IY5 E;  2EIK E;  2Y69 E;  3AG4 E;  1OCR E;  1V54 E;  2DYR E;  3WG7 E;  3ASO E;  5B3S E;  2EIL E;  3X2Q E;  2EIM E;  1V55 E;  2DYS E;  5B1B E;  2ZXW E;  3ABL E;  3ABM E;  1OCZ E;  3ABK E;  1OCO E; 
#chains in the Genus database with same CATH topology
 3FTV A;  1NL4 A;  5DIZ A;  3CVV A;  1LF8 A;  3D3M A;  4J8Y A;  3TGO A;  4HOQ A;  2P58 C;  2XCB A;  4JZY A;  2WXG A;  1BD8 A;  2L6B A;  3SBS A;  4GTP A;  4JHK A;  2CHZ A;  1H6O A;  2FF4 A;  4C48 B;  2F0Y A;  1HG5 A;  3ONL A;  4RG9 A;  4RG6 A;  2ETA A;  3RU0 A;  2P9S G;  1TNZ A;  5T3R A;  2OCC E;  4FU3 A;  4A55 A;  3FUK A;  4LSZ E;  2PM6 A;  1N95 A;  3CK9 A;  5EDS A;  5G05 J;  2DZO A;  3Q79 A;  1N11 A;  4OAV B;  3KAE A;  3TAX A;  3U9W A;  3FTY A;  2P9N G;  2CFZ A;  1H0A A;  3GW4 A;  2QYJ A;  4OYS A;  3TG4 A;  4B93 B;  3UM0 A;  2DYR E;  3FH5 A;  2VYI A;  2AXU A;  3L9T A;  1N4Q A;  2KCK A;  3QK0 A;  2QFC A;  5AQA A;  2FO1 E;  3V2X A;  4DPR A;  4BTA A;  4GA1 A;  2RKK A;  1NA3 A;  5CEA A;  5ENS D;  4BX9 A;  4D10 C;  5ENT D;  5D0Q D;  2V8S E;  1K1B A;  2H6H A;  3ZUV B;  1RW2 A;  4ACK A;  4L2Y A;  3SO8 A;  1BPO A;  3B7R L;  1SVX A;  3ZXS A;  4XKC A;  4YDW A;  3KEA A;  4Q94 A;  5CCL A;  4UQY A;  1OCR E;  2I9C A;  3TXM A;  1H6P A;  1AWC B;  1INZ A;  3EHM A;  3VLD A;  1IYG A;  4Z68 A;  3R9A B;  3ZHE B;  3SFX A;  3LDZ A;  3FY4 A;  4PS8 A;  3OXF A;  4FHK A;  3DXM G;  3K9I A;  4KVM A;  4BFR A;  3UM3 A;  3UT8 A;  4F6R D;  1ZB1 A;  3N71 A;  3V2O A;  2WXM A;  1N0R A;  1N54 A;  4IN3 B;  3VLE A;  4BT9 A;  4H7X A;  2LSV A;  2P9K G;  4J6I A;  4I2W A;  1H2U A;  5CHE E;  3SF4 A;  2BED A;  3FUL A;  4JA9 A;  3MKR A;  4NRH B;  2PL2 A;  4G8L A;  4CDM A;  2ZIS A;  3AG3 E;  3EUV A;  5JJT A;  5IY5 E;  5FT9 A;  3E30 A;  4LCT A;  3KS2 A;  3UPV A;  1TN7 A;  3ZN3 A;  2V5F A;  4N3C A;  3CVX A;  3TWW A;  4HB5 A;  1K3Z D;  4FP7 A;  4F1S A;  2XZD G;  2XS1 A;  4MS6 A;  2J07 A;  4GML A;  4GZ6 A;  3ZKJ A;  4UWK A;  3HXC A;  4G24 A;  2HYZ A;  3MJW A;  3HXF A;  4N39 A;  1UN9 A;  2BKK B;  4APO A;  4B0Z A;  4LNB A;  5T4Y A;  4HS2 A;  4DI4 A;  4WWP A;  1MX2 A;  2A4Z A;  4JHR A;  3AG1 E;  5AAO A;  4KT6 B;  2XZT G;  3ASH A;  2WXR A;  3FP3 A;  4HRN A;  5AJL A;  2VSO E;  1YA0 A;  3JUE A;  5G05 C;  4URK A;  3FUI A;  3KSQ A;  4AIF A;  5EX0 A;  4EQF A;  3D9P A;  4EPZ A;  2AVP A;  2Q7F A;  3LKU A;  4N3B A;  4RVB A;  1Z3X A;  2QC9 A;  3J5Q B;  3P2B A;  2KXP C;  2VGX A;  3D9O A;  4ME2 A;  2LSU A;  5BV0 A;  5B1A E;  2P9I G;  4XI9 A;  4ANU A;  3J5P A;  4CT0 A;  3U66 A;  5FIN A;  4QFV A;  3L17 A;  1E8Z A;  3CVL A;  3X2Q E;  3MZL B;  1U3D A;  5ARG A;  5ENN A;  3ULE G;  2I1K A;  3DPD A;  2V4H C;  2WVI A;  1TEZ A;  3LCA A;  2FEZ A;  1U3C A;  3MV2 B;  4HBD A;  2Y4T A;  3T5X A;  3Q7F A;  4AV7 A;  2YHC A;  3OTN A;  4U7E B;  1E7V A;  4L2L A;  2DCP A;  3HRA A;  4DLO A;  3JQ0 A;  1PC2 A;  2WXI A;  1OWP A;  5J90 A;  3APF A;  4HXI A;  3ABL E;  3FEY A;  4A3T A;  4AM9 A;  5JJ7 A;  3CHM A;  3BQO A;  4GCN A;  4AJW A;  4U8H A;  3PE3 A;  1WAO 1;  4I1A A;  1S70 B;  4CGV A;  3Q7A A;  4PS7 A;  5ANL A;  4A1G A;  3NAW A;  1BI7 B;  4TRQ A;  1MJ0 A;  4HOT A;  1K8K G;  1HE8 A;  3FEX A;  2GGF A;  5CMW A;  5FZR A;  2HO1 A;  4AVX A;  5FQ6 A;  2OVB A;  1IQU A;  4DRX E;  4DUI A;  2OOE A;  3O48 A;  4N3A A;  5D66 A;  1E8Y A;  3Q49 B;  4NIK A;  4U0S A;  3PRE A;  1BLX B;  1P5Q A;  3L13 A;  1LD7 A;  2GRQ B;  2OV8 A;  4FC8 A;  3UMV A;  3L54 A;  3DEP A;  3LY8 A;  4EBA G;  3PZ2 A;  1B89 A;  2XRY A;  3JXI A;  5A23 A;  1UN8 A;  1SZA A;  2Y69 E;  5CCM A;  1KZP A;  5EID A;  4C0E A;  2H6F A;  3QWV A;  4U8Y D;  3ZRH A;  3IHV A;  2XEE A;  3W9F A;  1Q2Z A;  2UY1 A;  1TJF A;  4JPS A;  1JPL A;  2NSZ A;  2JLB A;  3CV0 A;  1SQM A;  4DI3 A;  1IXV A;  3SFZ A;  3PVL A;  4ILG A;  3CVY A;  2MOW A;  4FLH A;  4LNG A;  1E7U A;  3UXG A;  3G2S A;  2ETC A;  5EYL A;  5KJN A;  5FZS A;  2XPZ A;  1S0P A;  3B7U X;  2J08 A;  4P29 A;  4J8S A;  4G1T A;  3JYS A;  1LD8 A;  4AOF A;  3MKQ B;  1H2V C;  5A7D B;  3CST A;  4H7Y A;  2C2L A;  1ZBP A;  2X6H A;  5LP0 A;  1Z3Y A;  1MHQ A;  3Q9N C;  4GYO A;  3HVE B;  3OXG A;  1E96 B;  4K03 A;  2PNN A;  3CLJ A;  4GTM A;  4HRL A;  1DC2 A;  2R02 A;  5AQB A;  4MLP A;  3PRZ A;  4U0U A;  2WXQ A;  2YNQ A;  4KYO B;  4O1P A;  4J8E A;  2J09 A;  3NF1 A;  3FDH A;  4CZ2 D;  2HR2 A;  3MCX A;  3G2W A;  3S2A A;  4N5Q A;  2XEV A;  4UUC A;  4GYW A;  1YMP A;  1O1S A;  5KCM A;  2EIL E;  1MYO A;  4TXP A;  1HO8 A;  2KC7 A;  3FUH A;  2PZI A;  4U8V D;  4B89 A;  1OWO A;  2XCC A;  5ENP D;  1HG2 A;  2AXZ A;  2X6I A;  2EIN E;  2WM9 A;  3CVW A;  3UT4 A;  3ZYL A;  1TNO A;  2LNI A;  3IHY A;  4UI9 K;  5CER B;  4I17 A;  3SQV A;  2NC9 A;  1H19 A;  3UQ3 A;  2DYS E;  2ZIR A;  4PS3 A;  5T8I A;  2IQC A;  3MGB A;  3EHN A;  3IV0 A;  3LPZ A;  4XI0 A;  5C1D A;  2GRR B;  4JVS A;  3PEV B;  4DX7 D;  3LEW A;  3VTX A;  3W9G A;  2WXN A;  5KNH D;  2DVW A;  4DX5 D;  5CEC B;  3FUN A;  4KZC A;  5B1B E;  3FUE A;  2MHK A;  3C72 A;  3SNX A;  3OXL A;  2VTB A;  3URZ A;  3HDX A;  5BNW A;  5CED B;  4U07 A;  4GPK A;  1N4P A;  1QZ2 A;  2RFM A;  3UT7 A;  2VGX B;  5FQ8 A;  2ZGD A;  1EYH A;  1TNU A;  2RG8 A;  4NUR A;  5AQ7 A;  4CRW A;  2OVF A;  4UI9 C;  3NOC D;  1LTX A;  3D9J A;  5KBA A;  5M72 A;  2KM4 A;  2R59 A;  4I1O B;  5CBO A;  2X6K A;  3D9K A;  5J08 A;  1WG0 A;  5A6C A;  3JCK C;  3WXX A;  3D9I A;  3QAQ A;  3EDT B;  1FCH A;  2RFA A;  2R03 A;  4G8K A;  4F3V A;  3L16 A;  1X5B A;  4ACL A;  1G3N B;  5BT1 A;  2WB2 A;  5HQ8 A;  4UWH A;  5CRV A;  1E90 A;  2X6J A;  4FA6 A;  3LY7 A;  3FU6 A;  4N2S A;  4ATG A;  3ZNG A;  2P9P G;  4A1S A;  5E75 A;  4EZK A;  2J4D A;  3AU4 A;  3AS8 A;  3AS5 A;  3C3O A;  4HI9 A;  3ASO E;  4KBQ A;  5FJY A;  3EIQ C;  4I2Z A;  5CRU A;  2AJA A;  3CIA A;  4FJY A;  3SY2 A;  1OXJ A;  4ILH B;  3ASD A;  2IU1 A;  4LER A;  1H2T C;  1SW6 A;  4KXK B;  2L6J A;  4ANV A;  1DNP A;  2ZGG A;  2GW1 A;  2F37 A;  3R9M A;  1ELK A;  3G2U A;  2GRP B;  2VTB B;  3LVR E;  3JUI A;  2FI7 A;  3EIJ A;  3ZYQ A;  4BEP A;  1VDY A;  1O5M A;  4JA7 A;  5LFA A;  1TN6 A;  3GYZ A;  2XS8 A;  4ANX A;  2L9B A;  3CR3 A;  3NB2 A;  3SI5 A;  2WQ7 A;  5G04 C;  4XEI G;  2EIJ E;  3L6A A;  4HLE A;  3SZ7 A;  1HFA A;  1PY1 A;  4U63 A;  1EPU A;  4CCA A;  1EF1 C;  4U0Z A;  4F53 A;  2M63 A;  4JW1 A;  4TUU A;  4I9E A;  3RAU A;  3V31 A;  4V3I A;  4GZ3 A;  1OUV A;  3IXE A;  3CKC A;  5HRY A;  3ABK E;  5AN8 A;  4DX2 A;  5ENQ D;  1OWN A;  3B13 A;  4M3O A;  3Q5M A;  2GRO B;  4G25 A;  4GTT A;  4GZD A;  2R5S A;  4HLL A;  4NQ0 A;  4HI8 A;  1D9S A;  2CHX A;  1Z5S C;  5JMN D;  3RJV A;  4WND A;  3I4R B;  1JCQ A;  4XE0 A;  2WQ6 A;  1TR4 A;  4AXH A;  3B7S A;  4APF A;  3CVN A;  3S7F A;  3E4B A;  5B3S E;  3EHQ A;  3KD7 A;  4W9R A;  3BUA A;  1JCR A;  3UIN C;  2CHW A;  3RK6 A;  4HOS A;  2UWJ G;  2X38 A;  3UKR G;  5JHB A;  2QZA A;  5EIB E;  4WWN A;  4FJZ A;  3R7Q A;  5AAR A;  4ILI A;  4Y6W A;  2C0L A;  1EDU A;  3ESK A;  3QOU A;  3AJI A;  5G04 J;  4O60 A;  1DVP A;  5EX3 A;  2DZN A;  5D2M C;  3FFL A;  3Q47 B;  4N5C A;  3T9K A;  2WXK A;  3TWU A;  4BTB A;  1S64 A;  5FQ4 A;  4AY5 A;  4YND A;  4JEU A;  4B8A A;  1BU9 A;  4XKB A;  4MRU A;  4BX8 A;  1OCZ E;  3UM1 A;  3CVQ A;  3HHM A;  5AJD A;  3ULY A;  5ARF A;  3MV3 B;  1WY6 A;  4GZ5 A;  5ENR D;  3UI2 A;  4K5B A;  1ZU2 A;  4A63 B;  4BET A;  5FQ7 A;  4LG6 A;  5D0O D;  3DSS A;  1IQR A;  4PDX A;  4DX6 D;  2ION A;  2KBX A;  5BXO A;  2WXO A;  1HU3 A;  1NP7 A;  4X8Q A;  2B0O E;  5H7P A;  3JQ1 A;  3G2V A;  5HS0 A;  2IJG X;  2Y1L E;  4U04 A;  3CHO A;  3CHP A;  3IKO B;  4JL0 A;  2B6C A;  4XX5 A;  4FAD A;  3HXD A;  5HI7 A;  3FUJ A;  2H6G A;  4GYY A;  5KNG A;  4GZC A;  2LXL A;  2V5Q C;  3UIO C;  2LAH A;  4CEM A;  4BWR A;  2VSY A;  1IHG A;  3PNT B;  2FO7 A;  1FVH A;  2GRL A;  2NYJ A;  4YDO A;  1D8D A;  1O1T A;  1PAQ A;  3QB2 A;  4G11 A;  2IY0 C;  2JAB A;  4QQI A;  3ZVV A;  4K5A B;  3TWS A;  2HM8 A;  3BU8 A;  3CHS A;  5JHA A;  4E6H A;  4RLY A;  1N9A A;  4EBA A;  4LEU A;  3CSF A;  4GU5 A;  5KJM A;  3MYV A;  2V0P A;  3C5R A;  2WXL A;  1JCS A;  2ZXW E;  1TNB A;  1W3B A;  3UUX A;  3QNK A;  2GRM A;  1RZ4 A;  4J8F A;  4I6G A;  3APC A;  3FU0 A;  2IEJ A;  3ZU7 B;  3PDN A;  3MEK A;  5G2N A;  3DWL G;  3ASG A;  3FUD A;  4CDR A;  1XGW A;  1V55 E;  1N4R A;  1AP7 A;  2CG2 A;  4JC8 A;  4FUL A;  4GPM A;  3PE4 A;  3E37 A;  1D8E A;  3S7J A;  4YVO A;  5ENO D;  3FTX A;  4IUL A;  2KZT B;  3AS4 A;  4I1M A;  4EHM A;  3Q4A B;  2IOL A;  5G55 A;  3V79 K;  3CHR A;  3ZW3 A;  3JXJ A;  3EJN A;  3I5P A;  5BXU A;  4CGW A;  4J0U A;  3HXB A;  5CMY A;  5ITZ F;  2DIW A;  2YIN A;  4L9P A;  1HZ4 A;  3Q78 A;  2EQX A;  4I6J A;  5DBK A;  1A5E A;  4AEZ C;  2WXF A;  3ONK A;  3C3R A;  2R17 C;  4R7L A;  4RQI A;  1BI8 B;  4TXQ A;  3GZ2 A;  2LO6 A;  3TWX A;  1MQS A;  2VJ8 A;  5AYW D;  4UQX A;  4AP2 A;  5ANR A;  3U4T A;  5LOZ A;  3EU5 A;  2VSX E;  4G2V A;  2WXJ A;  4AY6 A;  2IO3 C;  4HFG A;  1HH8 A;  1O1R A;  3DSU A;  3KEZ A;  2KCV A;  3FTZ A;  4O6F A;  5E76 A;  3OAW A;  3DSV A;  4GTO A;  4L7T A;  1N52 A;  2QYU A;  3PZ1 A;  2Y4U A;  4Y6C A;  3NZU A;  3QWW A;  3RSE G;  3LJN A;  3E32 A;  3FUF A;  1Y8M A;  3ZGQ A;  4LUN U;  3NBN B;  3B7T A;  2V4L A;  2XEH A;  3L82 A;  3IBE A;  2BTD A;  3LJ3 A;  1MX4 A;  1OT8 A;  4GTR A;  3V30 A;  1NFI E;  3QWP A;  3QDN A;  3ISM C;  3ZHE A;  3QKY A;  1L5J A;  1KT1 A;  3Q9U C;  2J49 A;  3D9N A;  4XIF A;  3FTS A;  4I6E A;  2XEN A;  3E33 A;  1SZ9 A;  3C3Q A;  2OEW A;  3TXN A;  3HG0 D;  3MA5 A;  3Q73 A;  4OVU A;  2FUL A;  3TWQ A;  4UI9 J;  4GAA A;  4HNA D;  3ZYM A;  4GA2 A;  4TV3 A;  3U64 A;  3ZXP A;  2DBA A;  4UWG A;  4U96 D;  5KJK A;  2J8S D;  2WXP A;  4ATZ D;  3MX3 A;  3ENE A;  3PS6 A;  2AWI A;  2VGE A;  2PM7 A;  2OND A;  2E0I A;  2HE0 A;  3ZPJ A;  4LNU D;  2UY1 B;  3CQC B;  1NZN A;  2LUH A;  2ILR A;  3QC1 A;  3FHE A;  4K0R A;  4HVB A;  2IO2 C;  1E8W A;  2VSN A;  3FWV A;  4WNF A;  3LVQ E;  3TWR A;  3IEG A;  2WXH A;  5JJ6 A;  3DRA A;  4TUM A;  4G26 A;  1HF8 A;  3B7B A;  3L08 A;  1IHB A;  2A5E A;  3ABM E;  4MBG A;  4KVO A;  2XHE A;  1MX6 A;  3EU9 A;  1WM5 A;  4DLQ A;  3ASF A;  2Y3A A;  2OEV A;  2BUG A;  1JUQ A;  4DK5 A;  2XPI A;  4CDN A;  2KCL A;  3PZ4 A;  4GB9 A;  1SA5 A;  4EZL A;  2NXP A;  3RRM B;  4NAC A;  3Q15 A;  3SHF A;  3CK8 A;  4DX1 A;  3WG7 E;  4BES A;  3UTM A;  4C9B B;  4JHJ A;  1A17 A;  1NI1 A;  3DEO A;  3DPY A;  3TWV A;  3S7B A;  3L22 A;  4Q96 A;  3BEE A;  4ZFH A;  3PZD A;  4GMR A;  3CHQ A;  3ZFW A;  3RKV A;  1YCS B;  4YDY A;  3ZYK A;  3SGH A;  3SBT B;  3LS8 A;  2PQR A;  2JEK A;  5FIO A;  4HRM B;  3T8M A;  1KLX A;  3FTW A;  2RD0 A;  1FT2 A;  2LXM A;  4YVQ C;  3SD5 A;  4HQD A;  5C2Y A;  2Y0B G;  3FTU A;  4HOR A;  3ULQ A;  1OCO E;  4PUC A;  1ELW A;  5KWD A;  3R7R A;  1HS6 A;  1OWL A;  2L0T B;  4G23 A;  5HKP A;  3I4G A;  2XRZ A;  2AW6 A;  3ZEF A;  2A5U A;  3NQP A;  1GW6 A;  4MKT A;  2DWZ A;  3CVP A;  2WQH A;  3C98 A;  1KT0 A;  1HX8 A;  3B95 A;  3DST A;  3AG2 E;  2PQN A;  4ANW A;  5LCW J;  1TNY A;  3PUJ A;  1QYM A;  2MRI A;  4KMO A;  3HYM B;  1OWM A;  4TXR A;  3NOG D;  2WMO A;  3FU3 A;  3QAR A;  5FTP A;  1UJK A;  1S63 A;  3UX4 A;  3DXK G;  3Q75 A;  4ZHB A;  1QQE A;  2IF4 A;  1UG3 A;  4IRU A;  3T8K A;  2R2L A;  4M7C A;  2BF0 X;  4GA0 A;  3RO2 A;  2VGY A;  3ML8 A;  1N4S A;  5JA4 D;  1IKN D;  2CFU A;  1HXI A;  3QJZ A;  3MKQ A;  3CGH A;  3O4Z A;  3FH8 A;  3PNL B;  4XZ4 A;  4F1P A;  1TYQ G;  1YYH A;  4FHJ A;  1KPS B;  3HVE A;  5EYP F;  5EN5 D;  2I2O A;  4OAU C;  1V54 E;  2H6I A;  1WDY A;  3DSX A;  3RIB A;  3CQG B;  3TJP A;  3ESL A;  4BY6 A;  4BER A;  3EHR A;  4KZ0 A;  3UM2 A;  3DBS A;  2WPV A;  3P1U A;  1Y6I A;  4K5C A;  3PUK A;  1UJJ A;  3HIZ A;  2KAT A;  1H6K A;  3AG4 E;  4EEC A;  1X81 A;  2BKG A;  4WUY A;  1N0Q A;  2YQ8 A;  1FVF A;  4WNE A;  3F6Q A;  2QY7 A;  1UW4 B;  3KSL A;  4FLB A;  4UQZ A;  5LX8 A;  4J8D A;  5FZQ A;  3PZ3 A;  5BV1 A;  2WMN A;  2I6H A;  4B8C B;  1XNF A;  4YDE A;  3DSW A;  3FU5 A;  4GCO A;  4HOU A;  4WNG A;  2YHE A;  3PH0 C;  4GTV A;  3ML9 A;  4BT8 A;  4I43 A;  3AU5 A;  1K1A A;  3TWT A;  3E34 A;  3CVU A;  4L23 A;  1KZO A;  3SFY A;  5EKQ D;  3G2T A;  2XQ0 A;  3D9H A;  5BW8 C;  1U2V G;  4RSY A;  1NA0 A;  4GTS A;  1JWG A;  5KJL A;  3VTY A;  4PH4 B;  4C0M A;  3UKU G;  3RO3 A;  3VLF A;  2ETB A;  3T5V A;  4JXT A;  4U95 D;  1OY3 D;  4I9C A;  1Z6T A;  1E8X A;  2E2E A;  1JWF A;  4UWL A;  4J7W A;  4JB8 P;  4DJA A;  1SA4 A;  3NZS A;  4IYP A;  3RRN B;  2P9U G;  2J4B A;  1DCQ A;  1N94 A;  4JEH A;  3BG0 B;  3TG5 A;  5AEN A;  3LY9 A;  2XGS A;  2J9Q A;  5AIJ A;  4F7A A;  3GZS A;  4L1B A;  4ABN A;  1TN8 A;  4BSX A;  2I1J A;  3D9M A;  4LRZ A;  2EIK E;  2F8X K;  3CKB A;  4E85 A;  3UIP C;  2KZT A;  3TL5 A;  3LXU X;  3S7D A;  3HXE A;  3APD A;  3D9L A;  2L0I A;  4O1O A;  1MZC A;  2GRN B;  4EZJ A;  2CG3 A;  1UOH A;  1OCC E;  1QNF A;  5AQ9 A;  3ASN E;  4CYM D;  4JD2 G;  4OVV A;  5LCW C;  3U3W A;  1QBQ A;  4N2Q A;  5EIL A;  4UWF A;  3I3N A;  2ZU6 B;  4Q69 A;  5FWQ A;  5BPP A;  4WAF A;  2X6F A;  2XGM A;  2P2C P;  2VQ2 A;  2IOS A;  3CEQ A;  4B94 A;  2LAI A;  2R05 A;  4GTQ A;  3GZ1 A;  2XPY A;  1TJC A;  4WWO A;  2AXV A;  5BUZ A;  4GMJ A;  2EIM E;  1FT1 A;  3RRU A;  3LYA A;  3AAA C;  2FBN A;  2IFU A;  2X3M A;  2XGO A;  4BSZ B;  2F8Y A;  2P9L G;  3FH7 A;  1FPP A;  3PEU B;  2MYO A;  3CK7 A;  2C0M A;  4A3V A;  4CT4 A;  3BG1 B;  3ZIM A;  5CBN A;  3FUM A;  1DCE A;  1ELR A; 
#chains in the Genus database with same CATH homology
 3AG2 E;  5B1A E;  1OCC E;  2EIJ E;  3ASN E;  3AG3 E;  2OCC E;  2EIN E;  3AG1 E;  5IY5 E;  2EIK E;  2Y69 E;  3AG4 E;  1OCR E;  1V54 E;  2DYR E;  3WG7 E;  3ASO E;  5B3S E;  2EIL E;  3X2Q E;  2EIM E;  1V55 E;  2DYS E;  5B1B E;  2ZXW E;  3ABL E;  3ABM E;  1OCZ E;  3ABK E;  1OCO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...