2EIME

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eimE00
1OCCE 3WG7E 3X2QE 3AG3E 2ZXWE 3ABKE 1V55E 3AG4E 2DYSE 2EIME 2DYRE 2EINE 5B1AE 2EIKE 2OCCE 1V54E 3ABME 3ASNE 3ASOE 5B1BE 3AG1E 3AG2E 2Y69E 5B3SE 1OCRE 5IY5E 1OCZE 2EIJE 2EILE 3ABLE 1OCOE
chains in the Genus database with same CATH superfamily
5AQ7A 4HORA 4N2QA 5J08A 1OXJA 2F8XK 1HF8A 2BF0X 3APFA 4KMOA 3OTNA 4H7YA 4D10C 3ASHA 3MA5A 5EDSA 2XGMA 3FTYA 1HXIA 3W9FA 1JWFA 1HG2A 2R5SA 1TN7A 4CCAA 2WMNA 3L82A 3E34A 1UJKA 3PS6A 3R7RA 3D9LA 2FF4A 1S0PA 1XNFA 3E33A 2AXVA 1HX8A 5JJ7A 2L6JA 4TXRA 2OVFA 1KLXA 3SQVA 4PH4B 3NOGD 1NI1A 1SA5A 2ETCA 1UN9A 5LP0A 3LJ3A 1OWNA 3EU5A 3FH5A 4TXQA 2FEZA 5ENPD 3ZYLA 3LJNA 3LYAA 4I9CA 3I4GA 3B7BA 4TRQA 3Q7AA 3TWWA 4L1BA 1DNPA 3HVEB 3FH8A 4MRUA 1NP7A 4JHJA 2DBAA 1TNYA 2C2LA 3L13A 3P1UA 5CERB 3UT8A 4GZ6A 1H2TC 3UMVA 3FUFA 4IN3B 2PL2A 3S7DA 4GTVA 1P5QA 4Q96A 3LKUA 2PM7A 1LTXA 4HB5A 4LRZA 4CDNA 3NF1A 4URKA 1KZOA 3HDXA 2CHWA 5HQ8A 2UY1A 3EHMA 3Q9UC 2XEEA 4JC8A 4OAVB 2IOLA 5C1DA 1Q2ZA 3PEUB 2VYIA 4A3VA 2WXFA 1BD8A 2R05A 3FULA 3E4BA 3T5VA 3ZYQA 2RFAA 3Q15A 3UT4A 3G2TA 4FULA 3Q7FA 3L6AA 4G2VA 4AY6A 2XS8A 4HOQA 4QFVA 4GPKA 1NA3A 2P9PG 5FZRA 3UIOC 1E8ZA 3ZN3A 5FT9A 4N39A 5AQBA 4A3TA 5EYLA 2GRQB 4UWKA 3CVNA 3TGOA 1IYGA 1H0AA 2XEVA 4FADA 2WXLA 2VGXB 4WNEA 5CMWA 4U8YD 4APOA 2R17C 3RIBA 1HH8A 2ILRA 4F1SA 3ULEG 1NA0A 2XPIA 3NB2A 4Q69A 3ABKE 1V55E 4E6HA 3WXXA 3ZNGA 4AVXA 5EIDA 1N52A 2NYJA 4EBAA 4KXKB 3LDZA 3RRUA 3QK0A 2L0IA 2FULA 5G05J 4JHKA 2CG2A 5ENQD 2B6CA 3PRZA 4GA2A 4DX2A 1XGWA 1A17A 3ZEFA 3PZ2A 5D66A 3R9AB 1U2VG 5CMYA 4L2YA 4C0EA 3AS5A 1JCRA 3KS2A 2WQ6A 3RK6A 4YDWA 4AJWA 3FEYA 3EU9A 2BTDA 4KT6B 4M3OA 1QQEA 2XPYA 4XZ4A 3PE3A 3G2SA 3UM0A 3U4TA 5ENNA 1N4RA 4ACLA 5CRUA 3ASNE 1N95A 4UQXA 2WXKA 3VLDA 2QYJA 1N0QA 4ILGA 5ENOD 5A7DB 1QYMA 3V31A 2GRMA 5EX0A 5AARA 2LSVA 2VGXA 2ETBA 2C0MA 1FVFA 2QY7A 3SF4A 3QAQA 1E90A 3ASFA 3QB2A 1SW6A 4H7XA 3ZYKA 4AY5A 4L9PA 3RU0A 3C3OA 2AVPA 3FH7A 3CV0A 1JCQA 4N2SA 2X6KA 4C0MA 1MZCA 3PUKA 3UKRG 4AV7A 2J09A 3N71A 3B7RL 3QWWA 2MOWA 3IXEA 5HS0A 4GZ3A 2GRRB 3S7JA 4UWFA 3V2XA 1Y6IA 3JXIA 4FJZA 4A55A 4BX9A 5FQ8A 4I43A 4U63A 3B7TA 5T4YA 1YA0A 5KNHD 1OCZE 4K03A 1TN8A 2R59A 3HXBA 5JHBA 4DI4A 4YDOA 1S64A 2WXMA 4I1MA 2L6BA 3L54A 1AP7A 3CVWA 1W3BA 2LNIA 1TJCA 4HOSA 4TXPA 3CK7A 2J07A 5G04C 3AS4A 3DXMG 4E85A 3QOUA 3DBSA 2X6HA 4APFA 5ENTD 2H6IA 3KEZA 3AG4E 1A5EA 3AU5A 4RG6A 5BXUA 2XGOA 3PH0C 2WXQA 2IJGX 4GAAA 4MLPA 2GRLA 4XX5A 1UW4B 3ZVVA 3Q75A 4JD2G 4XKBA 4J6IA 3MEKA 3CSTA 1QBQA 2VGYA 3PZ1A 3BG0B 4GA0A 4N3AA 1E7UA 4N3CA 3V30A 4FHJA 4LNBA 5D0OD 4G8LA 3L9TA 3SBTB 4B93B 5FZQA 4JEUA 5B1AE 3FTVA 2KATA 3CSFA 3RKVA 3TXNA 4K5AB 1U3CA 2KBXA 5T8IA 2VSNA 4LSZE 3HXFA 5AJLA 2PQNA 3LEWA 3UPVA 1ZU2A 2P9SG 4BTBA 2I9CA 3RRMB 5FZSA 4QQIA 3PZ4A 5BT1A 2F0YA 3R9MA 1MX2A 4XKCA 2MHKA 4AIFA 1UJJA 3DSSA 3NBNB 4U8VD 5KJKA 4HVBA 2IOSA 5ARGA 1N54A 3ONKA 5CEAA 4G8KA 2Y0BG 4EQFA 2X6IA 3UKUG 4FP7A 3ASOE 1DCQA 2YNQA 3QWPA 3IBEA 2UWJG 2XENA 4GCNA 2KZTB 4G25A 4J0UA 3HXEA 3CHMA 3VTXA 2QC9A 2WXRA 3CK8A 2ZIRA 1GW6A 3FTSA 3UM1A 3GZ1A 1HZ4A 5AAOA 2WXJA 4UUCA 1ZBPA 4EHMA 3B7SA 3ONLA 1E96B 5EYPF 3ZIMA 4L23A 1YYHA 3B7UX 3OAWA 5FWQA 1WDYA 3Q4AB 5HI7A 1TNUA 1O1TA 3TWSA 1FT2A 2WVIA 1O5MA 5CEDB 3HXCA 3LY7A 1H6PA 2NXPA 1MJ0A 4FJYA 4JB8P 4PS7A 3DRAA 3TL5A 4KZ0A 4R7LA 2X3MA 3BQOA 3TXMA 4U07A 3Q47B 4PS8A 4K5CA 3ASGA 2WXGA 4CGWA 1TNBA 3LS8A 3SD5A 3FUIA 4ATGA 3CKBA 2A5UA 4AM9A 1D9SA 4JA9A 5BV0A 3GW4A 3S2AA 2DYRE 2WXOA 4P29A 1NFIE 2IO3C 1Z3XA 3EHNA 2BKKB 4U7EB 3CVVA 4PDXA 2VQ2A 3U64A 2X6JA 1E8WA 4Y6WA 1KT0A 2PZIA 3WG7E 2VGEA 1JWGA 5FQ7A 4ATZD 2I1JA 2P9NG 2WMOA 3CVLA 2GRPB 2OOEA 1IQRA 2IQCA 3MKRA 1IKND 3FUEA 1D8EA 3HVEA 4AP2A 1OUVA 3JUEA 3IHVA 1DVPA 2AJAA 4OVVA 4DUIA 3CHRA 4LUNU 5AYWD 3LXUX 4O1PA 2V8SE 4K5BA 5LCWJ 4JVSA 1QZ2A 2YHCA 2KM4A 5IY5E 4I9EA 3G2UA 4HI8A 3HG0D 1WY6A 3AS8A 2KCLA 3C98A 4GTSA 4U04A 4BT9A 4WNDA 1TEZA 2LO6A 1SZ9A 3FUHA 3NQPA 4A1GA 4UWGA 3UINC 3DEPA 4L2LA 1Z3YA 3LVQE 3FUKA 2R2LA 3IHYA 2XS1A 4I1AA 3IV0A 5KJLA 4KVMA 3CGHA 3UX4A 2V5QC 2WM9A 3FEXA 1OT8A 5LOZA 3FTZA 2LAHA 2RG8A 2J8SD 2DYSE 5BXOA 5KWDA 3GZSA 4UI9J 2WQHA 4J8SA 1TR4A 1YMPA 2NC9A 3QNKA 4BFRA 3DSVA 4EZKA 3UT7A 1N4QA 3DWLG 4A63B 3ZU7B 3HRAA 4N3BA 1ELWA 4U0SA 1BLXB 1N94A 3SBSA 3TWQA 5HRYA 3CIAA 2QZAA 1N4PA 2C0LA 2DZNA 4BWRA 4EPZA 1OCCE 3FP3A 4HLEA 3LPZA 4DJAA 1X81A 2XZDG 4NQ0A 4WAFA 3Q49B 1AWCB 2I1KA 4KYOB 4G26A 3T9KA 2BEDA 4JXTA 2V4HC 3EUVA 3FWVA 2IEJA 3CR3A 2EILE 3UM2A 3RO3A 3S7FA 3SFYA 3SI5A 3FU5A 2QFCA 5BW8C 5FQ4A 2E2EA 2JEKA 2ZGDA 1EDUA 5KBAA 4HRLA 4ABNA 4LG6A 2IF4A 1E8YA 4RSYA 4GMRA 4BX8A 4G1TA 4K0RA 3D9HA 4L7TA 5JJTA 2HO1A 4GZCA 3F6QA 2XHEA 1N11A 4HOUA 2DWZA 2P9KG 2VSYA 5B3SE 1NZNA 1ELKA 3MCXA 3L22A 4XI9A 5BUZA 1WM5A 4KVOA 3JQ0A 3Q78A 4NURA 4GA1A 4BTAA 4TUMA 4EZLA 3CK9A 4GTQA 4EECA 3Q79A 4LNUD 1UG3A 3D3MA 2WXPA 2L0TB 4GYWA 3V79K 1TNZA 2LSUA 2A5EA 3ML8A 1JUQA 3MKQB 4G23A 3C3QA 3MX3A 3OXGA 3UUXA 4ILIA 3C72A 3PUJA 5EIBE 4KBQA 1HS6A 3T8MA 4UWHA 2OVBA 4HLLA 1WAO1 2KCVA 3CVYA 1H6KA 1N0RA 5HKPA 2DCPA 4GCOA 5G05C 3LY8A 3GZ2A 3W9GA 4CDMA 1WG0A 4ANWA 2OCCE 2KCKA 3ABME 3NZUA 5CBNA 2P9IG 1BU9A 4LNGA 2IO2C 2WQ7A 5ARFA 2V0PA 2CHZA 5EX3A 2CHXA 4CRWA 2WXIA 3NAWA 3DSUA 1K3ZD 2J9QA 5CCLA 1H2UA 1HG5A 4HS2A 3NOCD 3FTUA 4LCTA 3MZLB 2NSZA 2BUGA 2QYUA 2YQ8A 4AOFA 3UQ3A 3UM3A 3D9IA 4GTMA 5A23A 3D9KA 4GMLA 3NZSA 5ITZF 3CHQA 2KXPC 4Q94A 4CEMA 3JXJA 3TWTA 2F37A 1VDYA 3UTMA 3D9NA 4GMJA 3JQ1A 1JPLA 5AIJA 3X2QE 3DXKG 3CEQA 5BV1A 1OY3D 4BERA 4GTPA 1SZAA 4J7WA 4N5CA 4JW1A 4U96D 3SFZA 3ULYA 3FHEA 1G3NB 5FTPA 4DX7D 1H2VC 3DSXA 3SY2A 3UIPC 2P9LG 4UQZA 1LD7A 2J49A 4GYYA 5CHEE 1N9AA 5D0QD 4BY6A 4U8HA 1EPUA 3LY9A 2CG3A 4U0UA 3URZA 2XEHA 2DIWA 4GU5A 3APCA 2OEWA 4B94A 5KCMA 3E37A 5AJDA 1MX6A 3QJZA 3TG5A 1EF1C 4HFGA 3MV3B 4DI3A 3QC1A 2VTBB 4CGVA 5J90A 4HRMB 5JJ6A 4ILHB 4MS6A 1X5BA 2IU1A 3PDNA 3QARA 3I5PA 1QNFA 3HHMA 4OVUA 4B8CB 3DPYA 4WNGA 2AWIA 2X38A 3LCAA 3HXDA 3QDNA 2Q7FA 2Y69E 1KT1A 3EHRA 2RKKA 4HOTA 3ZW3A 2ETAA 3ASDA 4F3VA 2RFMA 4JEHA 2UY1B 2R03A 4FHKA 4CZ2D 3PNTB 3ISMC 3EHQA 1TYQG 3FU6A 4UQYA 4HRNA 4HI9A 5E75A 3AG2E 4F7AA 3VLFA 3TWUA 4YVQC 3KSQA 4GZDA 4FLBA 2WB2A 3FUMA 4GTOA 4XIFA 1PAQA 4KZCA 1L5JA 3QWVA 4DPRA 1SA4A 2WPVA 1OWMA 3P2BA 3DSWA 3U3WA 2AW6A 4W9RA 4YNDA 3FDHA 3ABLE 4HNAD 4BESA 1MX4A 5CBOA 1K8KG 2Y4UA 1MHQA 4NRHB 3SNXA 2HYZA 4ANUA 2EIKE 4ZFHA 1K1BA 1UN8A 4DLQA 3U66A 4UI9C 1KPSB 1IHGA 5EILA 4F53A 4TV3A 3IKOB 4EBAG 3KD7A 2AXZA 2XZTG 3ZXSA 1O1SA 4ZHBA 4MKTA 4B89A 4JHRA 1HU3A 3CHOA 5E76A 4LEUA 5G04J 3C3RA 2P2CP 3PEVB 4I17A 3CKCA 3RSEG 4B0ZA 3FU3A 2KC7A 4RVBA 1FT1A 3HIZA 1ELRA 3S7BA 4O6FA 3J5PA 4JPSA 3ML9A 4Z68A 2ZXWE 4CYMD 2X6FA 1IXVA 3FUJA 3AJIA 5T3RA 3TWVA 4IYPA 3CQGB 2J4BA 1FPPA 1Y8MA 2XRZA 4XEIG 5H7PA 4OAUC 2I6HA 3ZFWA 2PNNA 4EZJA 3T5XA 3ZXPA 2RD0A 4A1SA 5CCMA 1DCEA 2VSXE 4PS3A 2HE0A 1NL4A 1SVXA 3TG4A 3CVQA 3GYZA 2EQXA 5G2NA 2LUHA 1INZA 1KZPA 3EJNA 4CT0A 3J5QB 3JYSA 3RRNB 3B13A 3U9WA 1MYOA 3K9IA 3G2WA 3FUNA 3FTWA 1RZ4A 1MQSA 3AG3E 5CRVA 4BEPA 2GW1A 1Z6TA 1UOHA 3TAXA 3MGBA 5JMND 2L9BA 4FA6A 1K1AA 2WXNA 5AQAA 1IQUA 2J4DA 4BT8A 2B0OE 3G2VA 3PE4A 3Q9NC 1BPOA 5A6CA 2ONDA 3RAUA 2IONA 2P9UG 1HO8A 4JA7A 4IRUA 4WWPA 1LD8A 4I2ZA 2JLBA 3I3NA 3MYVA 2PQRA 4I6EA 5FINA 1ZB1A 1HFAA 2CFZA 2H6FA 1H6OA 4O1OA 4DK5A 4WNFA 3TJPA 2XGSA 3FFLA 5G55A 4J8YA 4UWLA 3LVRE 1RW2A 5ANLA 1HE8A 2HR2A 3I4RB 4HQDA 4OYSA 3V2OA 2LXLA 2LAIA 2VTBA 4J8DA 4BSXA 4J8FA 3O48A 1IHBA 1PC2A 1FVHA 1TJFA 3D9OA 3VTYA 3T8KA 5BNWA 4WWOA 1N4SA 1OWOA 4CDRA 4GTTA 4YDEA 2GROB 5AN8A 5CECB 4LERA 4U0ZA 4AEZC 1OWLA 4XI0A 1EYHA 3BUAA 4G24A 2YHEA 2DZOA 2MYOA 3BEEA 2M63A 3SHFA 3L08A 5LFAA 2AXUA 4DX1A 3SGHA 1OCOE 3L17A 2FBNA 5LCWC 5D2MC 1Z5SC 1DC2A 4FLHA 4N5QA 3E32A 4WUYA 3PVLA 3BG1B 2HM8A 4TUUA 4RLYA 3RJVA 1H19A 4B8AA 2R02A 4NIKA 4XE0A 4F6RD 4C9BB 3ESLA 3JCKC 3DSTA 3FTXA 3TWXA 2J08A 4GYOA 3CLJA 4NACA 3E30A 2GRNB 2IFUA 2EIJE 2FI7A 4ACKA 4GB9A 5FIOA 3CHPA 3C5RA 3KSLA 4FC8A 5JA4D 2XCCA 3MKQA 4G11A 5AQ9A 3ZUVB 2OEVA 3AU4A 5DIZA 1E7VA 3L16A 3EIQC 3ZRHA 2P58C 4RG9A 5ENRD 2A4ZA 4Y6CA 4I6JA 2JABA 2MRIA 4WWNA 2EINE 3ESKA 3FU0A 1B89A 4JL0A 3OXLA 3CVXA 4PUCA 3OXFA 2FO7A 3FY4A 4DLOA 1LF8A 5B1BE 3PZDA 1OCRE 3ZYMA 4AXHA 3EDTB 3ZPJA 3DPDA 3PZ3A 4GTRA 4I6GA 3O4ZA 2XPZA 3APDA 2ZGGA 4I1OB 2XQ0A 2EIME 1BI8B 3HYMB 4MBGA 3ENEA 3IEGA 1V54E 3MV2B 4DX5D 1OWPA 2DVWA 1BI7B 4I2WA 2FO1E 5KJMA 4JZYA 3DEOA 1O1RA 1S63A 2H6HA 3UXGA 3FUDA 4GPMA 5EKQD 3ZHEB 5C2YA 4X8QA 5ENSD 5JHAA 2YINA 2Y4TA 1TN6A 3CQCB 3PNLB 4BSZB 1E8XA 4HBDA 3QKYA 2CFUA 2ZU6B 4RQIA 4M7CA 4ME2A 3AG1E 5DBKA 3SZ7A 3B95A 5ANRA 3VLEA 4IULA 3Q5MA 5BPPA 2XRYA 4F1PA 4FU3A 2V4LA 3JUIA 4GZ5A 4CT4A 2ZISA 4C48B 2E0IA 2V5FA 2VSOE 4BETA 3D9MA 3TWRA 2IY0C 2Y3AA 2VJ8A 2Y1LE 3R7QA 4U95D 3ZHEA 4ANVA 2H6GA 1YCSB 3KAEA 5FQ6A 3D9JA 3ULQA 4YDYA 1PY1A 3ZGQA 3EIJA 2BKGA 3Q73A 3MJWA 4J8EA 3AAAC 1JCSA 3SO8A 2PM6A 4UI9K 3D9PA 3SFXA 3BU8A 4HXIA 3KEAA 4YVOA 2F8YA 3CVUA 3CHSA 1U3DA 4DX6D 3RO2A 5KJNA 3CVPA 2KZTA 5LX8A 5EN5D 2OV8A 2XCBA 4V3IA 5FJYA 3UI2A 2LXMA 2GGFA 5AENA 1S70B 4DRXE 3ZKJA 5M72A 3PREA 2WXHA 1SQMA 1TNOA 1FCHA 4ANXA 4O60A 5KNGA 1D8DA 2I2OA
chains in the Genus database with same CATH topology
1OCCE 3WG7E 3X2QE 3AG3E 2ZXWE 3ABKE 1V55E 3AG4E 2DYSE 2EIME 2DYRE 2EINE 5B1AE 2EIKE 2OCCE 1V54E 3ABME 3ASNE 3ASOE 5B1BE 3AG1E 3AG2E 2Y69E 5B3SE 1OCRE 5IY5E 1OCZE 2EIJE 2EILE 3ABLE 1OCOE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCC E;  3WG7 E;  3X2Q E;  3AG3 E;  2ZXW E;  3ABK E;  1V55 E;  3AG4 E;  2DYS E;  2EIM E;  2DYR E;  2EIN E;  5B1A E;  2EIK E;  2OCC E;  1V54 E;  3ABM E;  3ASN E;  3ASO E;  5B1B E;  3AG1 E;  3AG2 E;  2Y69 E;  5B3S E;  1OCR E;  5IY5 E;  1OCZ E;  2EIJ E;  2EIL E;  3ABL E;  1OCO E; 
#chains in the Genus database with same CATH topology
 5AQ7 A;  4HOR A;  4N2Q A;  5J08 A;  1OXJ A;  2F8X K;  1HF8 A;  2BF0 X;  3APF A;  4KMO A;  3OTN A;  4H7Y A;  4D10 C;  3ASH A;  3MA5 A;  5EDS A;  2XGM A;  3FTY A;  1HXI A;  3W9F A;  1JWF A;  1HG2 A;  2R5S A;  1TN7 A;  4CCA A;  2WMN A;  3L82 A;  3E34 A;  1UJK A;  3PS6 A;  3R7R A;  3D9L A;  2FF4 A;  1S0P A;  1XNF A;  3E33 A;  2AXV A;  1HX8 A;  5JJ7 A;  2L6J A;  4TXR A;  2OVF A;  1KLX A;  3SQV A;  4PH4 B;  3NOG D;  1NI1 A;  1SA5 A;  2ETC A;  1UN9 A;  5LP0 A;  3LJ3 A;  1OWN A;  3EU5 A;  3FH5 A;  4TXQ A;  2FEZ A;  5ENP D;  3ZYL A;  3LJN A;  3LYA A;  4I9C A;  3I4G A;  3B7B A;  4TRQ A;  3Q7A A;  3TWW A;  4L1B A;  1DNP A;  3HVE B;  3FH8 A;  4MRU A;  1NP7 A;  4JHJ A;  2DBA A;  1TNY A;  2C2L A;  3L13 A;  3P1U A;  5CER B;  3UT8 A;  4GZ6 A;  1H2T C;  3UMV A;  3FUF A;  4IN3 B;  2PL2 A;  3S7D A;  4GTV A;  1P5Q A;  4Q96 A;  3LKU A;  2PM7 A;  1LTX A;  4HB5 A;  4LRZ A;  4CDN A;  3NF1 A;  4URK A;  1KZO A;  3HDX A;  2CHW A;  5HQ8 A;  2UY1 A;  3EHM A;  3Q9U C;  2XEE A;  4JC8 A;  4OAV B;  2IOL A;  5C1D A;  1Q2Z A;  3PEU B;  2VYI A;  4A3V A;  2WXF A;  1BD8 A;  2R05 A;  3FUL A;  3E4B A;  3T5V A;  3ZYQ A;  2RFA A;  3Q15 A;  3UT4 A;  3G2T A;  4FUL A;  3Q7F A;  3L6A A;  4G2V A;  4AY6 A;  2XS8 A;  4HOQ A;  4QFV A;  4GPK A;  1NA3 A;  2P9P G;  5FZR A;  3UIO C;  1E8Z A;  3ZN3 A;  5FT9 A;  4N39 A;  5AQB A;  4A3T A;  5EYL A;  2GRQ B;  4UWK A;  3CVN A;  3TGO A;  1IYG A;  1H0A A;  2XEV A;  4FAD A;  2WXL A;  2VGX B;  4WNE A;  5CMW A;  4U8Y D;  4APO A;  2R17 C;  3RIB A;  1HH8 A;  2ILR A;  4F1S A;  3ULE G;  1NA0 A;  2XPI A;  3NB2 A;  4Q69 A;  3ABK E;  1V55 E;  4E6H A;  3WXX A;  3ZNG A;  4AVX A;  5EID A;  1N52 A;  2NYJ A;  4EBA A;  4KXK B;  3LDZ A;  3RRU A;  3QK0 A;  2L0I A;  2FUL A;  5G05 J;  4JHK A;  2CG2 A;  5ENQ D;  2B6C A;  3PRZ A;  4GA2 A;  4DX2 A;  1XGW A;  1A17 A;  3ZEF A;  3PZ2 A;  5D66 A;  3R9A B;  1U2V G;  5CMY A;  4L2Y A;  4C0E A;  3AS5 A;  1JCR A;  3KS2 A;  2WQ6 A;  3RK6 A;  4YDW A;  4AJW A;  3FEY A;  3EU9 A;  2BTD A;  4KT6 B;  4M3O A;  1QQE A;  2XPY A;  4XZ4 A;  3PE3 A;  3G2S A;  3UM0 A;  3U4T A;  5ENN A;  1N4R A;  4ACL A;  5CRU A;  3ASN E;  1N95 A;  4UQX A;  2WXK A;  3VLD A;  2QYJ A;  1N0Q A;  4ILG A;  5ENO D;  5A7D B;  1QYM A;  3V31 A;  2GRM A;  5EX0 A;  5AAR A;  2LSV A;  2VGX A;  2ETB A;  2C0M A;  1FVF A;  2QY7 A;  3SF4 A;  3QAQ A;  1E90 A;  3ASF A;  3QB2 A;  1SW6 A;  4H7X A;  3ZYK A;  4AY5 A;  4L9P A;  3RU0 A;  3C3O A;  2AVP A;  3FH7 A;  3CV0 A;  1JCQ A;  4N2S A;  2X6K A;  4C0M A;  1MZC A;  3PUK A;  3UKR G;  4AV7 A;  2J09 A;  3N71 A;  3B7R L;  3QWW A;  2MOW A;  3IXE A;  5HS0 A;  4GZ3 A;  2GRR B;  3S7J A;  4UWF A;  3V2X A;  1Y6I A;  3JXI A;  4FJZ A;  4A55 A;  4BX9 A;  5FQ8 A;  4I43 A;  4U63 A;  3B7T A;  5T4Y A;  1YA0 A;  5KNH D;  1OCZ E;  4K03 A;  1TN8 A;  2R59 A;  3HXB A;  5JHB A;  4DI4 A;  4YDO A;  1S64 A;  2WXM A;  4I1M A;  2L6B A;  3L54 A;  1AP7 A;  3CVW A;  1W3B A;  2LNI A;  1TJC A;  4HOS A;  4TXP A;  3CK7 A;  2J07 A;  5G04 C;  3AS4 A;  3DXM G;  4E85 A;  3QOU A;  3DBS A;  2X6H A;  4APF A;  5ENT D;  2H6I A;  3KEZ A;  3AG4 E;  1A5E A;  3AU5 A;  4RG6 A;  5BXU A;  2XGO A;  3PH0 C;  2WXQ A;  2IJG X;  4GAA A;  4MLP A;  2GRL A;  4XX5 A;  1UW4 B;  3ZVV A;  3Q75 A;  4JD2 G;  4XKB A;  4J6I A;  3MEK A;  3CST A;  1QBQ A;  2VGY A;  3PZ1 A;  3BG0 B;  4GA0 A;  4N3A A;  1E7U A;  4N3C A;  3V30 A;  4FHJ A;  4LNB A;  5D0O D;  4G8L A;  3L9T A;  3SBT B;  4B93 B;  5FZQ A;  4JEU A;  5B1A E;  3FTV A;  2KAT A;  3CSF A;  3RKV A;  3TXN A;  4K5A B;  1U3C A;  2KBX A;  5T8I A;  2VSN A;  4LSZ E;  3HXF A;  5AJL A;  2PQN A;  3LEW A;  3UPV A;  1ZU2 A;  2P9S G;  4BTB A;  2I9C A;  3RRM B;  5FZS A;  4QQI A;  3PZ4 A;  5BT1 A;  2F0Y A;  3R9M A;  1MX2 A;  4XKC A;  2MHK A;  4AIF A;  1UJJ A;  3DSS A;  3NBN B;  4U8V D;  5KJK A;  4HVB A;  2IOS A;  5ARG A;  1N54 A;  3ONK A;  5CEA A;  4G8K A;  2Y0B G;  4EQF A;  2X6I A;  3UKU G;  4FP7 A;  3ASO E;  1DCQ A;  2YNQ A;  3QWP A;  3IBE A;  2UWJ G;  2XEN A;  4GCN A;  2KZT B;  4G25 A;  4J0U A;  3HXE A;  3CHM A;  3VTX A;  2QC9 A;  2WXR A;  3CK8 A;  2ZIR A;  1GW6 A;  3FTS A;  3UM1 A;  3GZ1 A;  1HZ4 A;  5AAO A;  2WXJ A;  4UUC A;  1ZBP A;  4EHM A;  3B7S A;  3ONL A;  1E96 B;  5EYP F;  3ZIM A;  4L23 A;  1YYH A;  3B7U X;  3OAW A;  5FWQ A;  1WDY A;  3Q4A B;  5HI7 A;  1TNU A;  1O1T A;  3TWS A;  1FT2 A;  2WVI A;  1O5M A;  5CED B;  3HXC A;  3LY7 A;  1H6P A;  2NXP A;  1MJ0 A;  4FJY A;  4JB8 P;  4PS7 A;  3DRA A;  3TL5 A;  4KZ0 A;  4R7L A;  2X3M A;  3BQO A;  3TXM A;  4U07 A;  3Q47 B;  4PS8 A;  4K5C A;  3ASG A;  2WXG A;  4CGW A;  1TNB A;  3LS8 A;  3SD5 A;  3FUI A;  4ATG A;  3CKB A;  2A5U A;  4AM9 A;  1D9S A;  4JA9 A;  5BV0 A;  3GW4 A;  3S2A A;  2DYR E;  2WXO A;  4P29 A;  1NFI E;  2IO3 C;  1Z3X A;  3EHN A;  2BKK B;  4U7E B;  3CVV A;  4PDX A;  2VQ2 A;  3U64 A;  2X6J A;  1E8W A;  4Y6W A;  1KT0 A;  2PZI A;  3WG7 E;  2VGE A;  1JWG A;  5FQ7 A;  4ATZ D;  2I1J A;  2P9N G;  2WMO A;  3CVL A;  2GRP B;  2OOE A;  1IQR A;  2IQC A;  3MKR A;  1IKN D;  3FUE A;  1D8E A;  3HVE A;  4AP2 A;  1OUV A;  3JUE A;  3IHV A;  1DVP A;  2AJA A;  4OVV A;  4DUI A;  3CHR A;  4LUN U;  5AYW D;  3LXU X;  4O1P A;  2V8S E;  4K5B A;  5LCW J;  4JVS A;  1QZ2 A;  2YHC A;  2KM4 A;  5IY5 E;  4I9E A;  3G2U A;  4HI8 A;  3HG0 D;  1WY6 A;  3AS8 A;  2KCL A;  3C98 A;  4GTS A;  4U04 A;  4BT9 A;  4WND A;  1TEZ A;  2LO6 A;  1SZ9 A;  3FUH A;  3NQP A;  4A1G A;  4UWG A;  3UIN C;  3DEP A;  4L2L A;  1Z3Y A;  3LVQ E;  3FUK A;  2R2L A;  3IHY A;  2XS1 A;  4I1A A;  3IV0 A;  5KJL A;  4KVM A;  3CGH A;  3UX4 A;  2V5Q C;  2WM9 A;  3FEX A;  1OT8 A;  5LOZ A;  3FTZ A;  2LAH A;  2RG8 A;  2J8S D;  2DYS E;  5BXO A;  5KWD A;  3GZS A;  4UI9 J;  2WQH A;  4J8S A;  1TR4 A;  1YMP A;  2NC9 A;  3QNK A;  4BFR A;  3DSV A;  4EZK A;  3UT7 A;  1N4Q A;  3DWL G;  4A63 B;  3ZU7 B;  3HRA A;  4N3B A;  1ELW A;  4U0S A;  1BLX B;  1N94 A;  3SBS A;  3TWQ A;  5HRY A;  3CIA A;  2QZA A;  1N4P A;  2C0L A;  2DZN A;  4BWR A;  4EPZ A;  1OCC E;  3FP3 A;  4HLE A;  3LPZ A;  4DJA A;  1X81 A;  2XZD G;  4NQ0 A;  4WAF A;  3Q49 B;  1AWC B;  2I1K A;  4KYO B;  4G26 A;  3T9K A;  2BED A;  4JXT A;  2V4H C;  3EUV A;  3FWV A;  2IEJ A;  3CR3 A;  2EIL E;  3UM2 A;  3RO3 A;  3S7F A;  3SFY A;  3SI5 A;  3FU5 A;  2QFC A;  5BW8 C;  5FQ4 A;  2E2E A;  2JEK A;  2ZGD A;  1EDU A;  5KBA A;  4HRL A;  4ABN A;  4LG6 A;  2IF4 A;  1E8Y A;  4RSY A;  4GMR A;  4BX8 A;  4G1T A;  4K0R A;  3D9H A;  4L7T A;  5JJT A;  2HO1 A;  4GZC A;  3F6Q A;  2XHE A;  1N11 A;  4HOU A;  2DWZ A;  2P9K G;  2VSY A;  5B3S E;  1NZN A;  1ELK A;  3MCX A;  3L22 A;  4XI9 A;  5BUZ A;  1WM5 A;  4KVO A;  3JQ0 A;  3Q78 A;  4NUR A;  4GA1 A;  4BTA A;  4TUM A;  4EZL A;  3CK9 A;  4GTQ A;  4EEC A;  3Q79 A;  4LNU D;  1UG3 A;  3D3M A;  2WXP A;  2L0T B;  4GYW A;  3V79 K;  1TNZ A;  2LSU A;  2A5E A;  3ML8 A;  1JUQ A;  3MKQ B;  4G23 A;  3C3Q A;  3MX3 A;  3OXG A;  3UUX A;  4ILI A;  3C72 A;  3PUJ A;  5EIB E;  4KBQ A;  1HS6 A;  3T8M A;  4UWH A;  2OVB A;  4HLL A;  1WAO 1;  2KCV A;  3CVY A;  1H6K A;  1N0R A;  5HKP A;  2DCP A;  4GCO A;  5G05 C;  3LY8 A;  3GZ2 A;  3W9G A;  4CDM A;  1WG0 A;  4ANW A;  2OCC E;  2KCK A;  3ABM E;  3NZU A;  5CBN A;  2P9I G;  1BU9 A;  4LNG A;  2IO2 C;  2WQ7 A;  5ARF A;  2V0P A;  2CHZ A;  5EX3 A;  2CHX A;  4CRW A;  2WXI A;  3NAW A;  3DSU A;  1K3Z D;  2J9Q A;  5CCL A;  1H2U A;  1HG5 A;  4HS2 A;  3NOC D;  3FTU A;  4LCT A;  3MZL B;  2NSZ A;  2BUG A;  2QYU A;  2YQ8 A;  4AOF A;  3UQ3 A;  3UM3 A;  3D9I A;  4GTM A;  5A23 A;  3D9K A;  4GML A;  3NZS A;  5ITZ F;  3CHQ A;  2KXP C;  4Q94 A;  4CEM A;  3JXJ A;  3TWT A;  2F37 A;  1VDY A;  3UTM A;  3D9N A;  4GMJ A;  3JQ1 A;  1JPL A;  5AIJ A;  3X2Q E;  3DXK G;  3CEQ A;  5BV1 A;  1OY3 D;  4BER A;  4GTP A;  1SZA A;  4J7W A;  4N5C A;  4JW1 A;  4U96 D;  3SFZ A;  3ULY A;  3FHE A;  1G3N B;  5FTP A;  4DX7 D;  1H2V C;  3DSX A;  3SY2 A;  3UIP C;  2P9L G;  4UQZ A;  1LD7 A;  2J49 A;  4GYY A;  5CHE E;  1N9A A;  5D0Q D;  4BY6 A;  4U8H A;  1EPU A;  3LY9 A;  2CG3 A;  4U0U A;  3URZ A;  2XEH A;  2DIW A;  4GU5 A;  3APC A;  2OEW A;  4B94 A;  5KCM A;  3E37 A;  5AJD A;  1MX6 A;  3QJZ A;  3TG5 A;  1EF1 C;  4HFG A;  3MV3 B;  4DI3 A;  3QC1 A;  2VTB B;  4CGV A;  5J90 A;  4HRM B;  5JJ6 A;  4ILH B;  4MS6 A;  1X5B A;  2IU1 A;  3PDN A;  3QAR A;  3I5P A;  1QNF A;  3HHM A;  4OVU A;  4B8C B;  3DPY A;  4WNG A;  2AWI A;  2X38 A;  3LCA A;  3HXD A;  3QDN A;  2Q7F A;  2Y69 E;  1KT1 A;  3EHR A;  2RKK A;  4HOT A;  3ZW3 A;  2ETA A;  3ASD A;  4F3V A;  2RFM A;  4JEH A;  2UY1 B;  2R03 A;  4FHK A;  4CZ2 D;  3PNT B;  3ISM C;  3EHQ A;  1TYQ G;  3FU6 A;  4UQY A;  4HRN A;  4HI9 A;  5E75 A;  3AG2 E;  4F7A A;  3VLF A;  3TWU A;  4YVQ C;  3KSQ A;  4GZD A;  4FLB A;  2WB2 A;  3FUM A;  4GTO A;  4XIF A;  1PAQ A;  4KZC A;  1L5J A;  3QWV A;  4DPR A;  1SA4 A;  2WPV A;  1OWM A;  3P2B A;  3DSW A;  3U3W A;  2AW6 A;  4W9R A;  4YND A;  3FDH A;  3ABL E;  4HNA D;  4BES A;  1MX4 A;  5CBO A;  1K8K G;  2Y4U A;  1MHQ A;  4NRH B;  3SNX A;  2HYZ A;  4ANU A;  2EIK E;  4ZFH A;  1K1B A;  1UN8 A;  4DLQ A;  3U66 A;  4UI9 C;  1KPS B;  1IHG A;  5EIL A;  4F53 A;  4TV3 A;  3IKO B;  4EBA G;  3KD7 A;  2AXZ A;  2XZT G;  3ZXS A;  1O1S A;  4ZHB A;  4MKT A;  4B89 A;  4JHR A;  1HU3 A;  3CHO A;  5E76 A;  4LEU A;  5G04 J;  3C3R A;  2P2C P;  3PEV B;  4I17 A;  3CKC A;  3RSE G;  4B0Z A;  3FU3 A;  2KC7 A;  4RVB A;  1FT1 A;  3HIZ A;  1ELR A;  3S7B A;  4O6F A;  3J5P A;  4JPS A;  3ML9 A;  4Z68 A;  2ZXW E;  4CYM D;  2X6F A;  1IXV A;  3FUJ A;  3AJI A;  5T3R A;  3TWV A;  4IYP A;  3CQG B;  2J4B A;  1FPP A;  1Y8M A;  2XRZ A;  4XEI G;  5H7P A;  4OAU C;  2I6H A;  3ZFW A;  2PNN A;  4EZJ A;  3T5X A;  3ZXP A;  2RD0 A;  4A1S A;  5CCM A;  1DCE A;  2VSX E;  4PS3 A;  2HE0 A;  1NL4 A;  1SVX A;  3TG4 A;  3CVQ A;  3GYZ A;  2EQX A;  5G2N A;  2LUH A;  1INZ A;  1KZP A;  3EJN A;  4CT0 A;  3J5Q B;  3JYS A;  3RRN B;  3B13 A;  3U9W A;  1MYO A;  3K9I A;  3G2W A;  3FUN A;  3FTW A;  1RZ4 A;  1MQS A;  3AG3 E;  5CRV A;  4BEP A;  2GW1 A;  1Z6T A;  1UOH A;  3TAX A;  3MGB A;  5JMN D;  2L9B A;  4FA6 A;  1K1A A;  2WXN A;  5AQA A;  1IQU A;  2J4D A;  4BT8 A;  2B0O E;  3G2V A;  3PE4 A;  3Q9N C;  1BPO A;  5A6C A;  2OND A;  3RAU A;  2ION A;  2P9U G;  1HO8 A;  4JA7 A;  4IRU A;  4WWP A;  1LD8 A;  4I2Z A;  2JLB A;  3I3N A;  3MYV A;  2PQR A;  4I6E A;  5FIN A;  1ZB1 A;  1HFA A;  2CFZ A;  2H6F A;  1H6O A;  4O1O A;  4DK5 A;  4WNF A;  3TJP A;  2XGS A;  3FFL A;  5G55 A;  4J8Y A;  4UWL A;  3LVR E;  1RW2 A;  5ANL A;  1HE8 A;  2HR2 A;  3I4R B;  4HQD A;  4OYS A;  3V2O A;  2LXL A;  2LAI A;  2VTB A;  4J8D A;  4BSX A;  4J8F A;  3O48 A;  1IHB A;  1PC2 A;  1FVH A;  1TJF A;  3D9O A;  3VTY A;  3T8K A;  5BNW A;  4WWO A;  1N4S A;  1OWO A;  4CDR A;  4GTT A;  4YDE A;  2GRO B;  5AN8 A;  5CEC B;  4LER A;  4U0Z A;  4AEZ C;  1OWL A;  4XI0 A;  1EYH A;  3BUA A;  4G24 A;  2YHE A;  2DZO A;  2MYO A;  3BEE A;  2M63 A;  3SHF A;  3L08 A;  5LFA A;  2AXU A;  4DX1 A;  3SGH A;  1OCO E;  3L17 A;  2FBN A;  5LCW C;  5D2M C;  1Z5S C;  1DC2 A;  4FLH A;  4N5Q A;  3E32 A;  4WUY A;  3PVL A;  3BG1 B;  2HM8 A;  4TUU A;  4RLY A;  3RJV A;  1H19 A;  4B8A A;  2R02 A;  4NIK A;  4XE0 A;  4F6R D;  4C9B B;  3ESL A;  3JCK C;  3DST A;  3FTX A;  3TWX A;  2J08 A;  4GYO A;  3CLJ A;  4NAC A;  3E30 A;  2GRN B;  2IFU A;  2EIJ E;  2FI7 A;  4ACK A;  4GB9 A;  5FIO A;  3CHP A;  3C5R A;  3KSL A;  4FC8 A;  5JA4 D;  2XCC A;  3MKQ A;  4G11 A;  5AQ9 A;  3ZUV B;  2OEV A;  3AU4 A;  5DIZ A;  1E7V A;  3L16 A;  3EIQ C;  3ZRH A;  2P58 C;  4RG9 A;  5ENR D;  2A4Z A;  4Y6C A;  4I6J A;  2JAB A;  2MRI A;  4WWN A;  2EIN E;  3ESK A;  3FU0 A;  1B89 A;  4JL0 A;  3OXL A;  3CVX A;  4PUC A;  3OXF A;  2FO7 A;  3FY4 A;  4DLO A;  1LF8 A;  5B1B E;  3PZD A;  1OCR E;  3ZYM A;  4AXH A;  3EDT B;  3ZPJ A;  3DPD A;  3PZ3 A;  4GTR A;  4I6G A;  3O4Z A;  2XPZ A;  3APD A;  2ZGG A;  4I1O B;  2XQ0 A;  2EIM E;  1BI8 B;  3HYM B;  4MBG A;  3ENE A;  3IEG A;  1V54 E;  3MV2 B;  4DX5 D;  1OWP A;  2DVW A;  1BI7 B;  4I2W A;  2FO1 E;  5KJM A;  4JZY A;  3DEO A;  1O1R A;  1S63 A;  2H6H A;  3UXG A;  3FUD A;  4GPM A;  5EKQ D;  3ZHE B;  5C2Y A;  4X8Q A;  5ENS D;  5JHA A;  2YIN A;  2Y4T A;  1TN6 A;  3CQC B;  3PNL B;  4BSZ B;  1E8X A;  4HBD A;  3QKY A;  2CFU A;  2ZU6 B;  4RQI A;  4M7C A;  4ME2 A;  3AG1 E;  5DBK A;  3SZ7 A;  3B95 A;  5ANR A;  3VLE A;  4IUL A;  3Q5M A;  5BPP A;  2XRY A;  4F1P A;  4FU3 A;  2V4L A;  3JUI A;  4GZ5 A;  4CT4 A;  2ZIS A;  4C48 B;  2E0I A;  2V5F A;  2VSO E;  4BET A;  3D9M A;  3TWR A;  2IY0 C;  2Y3A A;  2VJ8 A;  2Y1L E;  3R7Q A;  4U95 D;  3ZHE A;  4ANV A;  2H6G A;  1YCS B;  3KAE A;  5FQ6 A;  3D9J A;  3ULQ A;  4YDY A;  1PY1 A;  3ZGQ A;  3EIJ A;  2BKG A;  3Q73 A;  3MJW A;  4J8E A;  3AAA C;  1JCS A;  3SO8 A;  2PM6 A;  4UI9 K;  3D9P A;  3SFX A;  3BU8 A;  4HXI A;  3KEA A;  4YVO A;  2F8Y A;  3CVU A;  3CHS A;  1U3D A;  4DX6 D;  3RO2 A;  5KJN A;  3CVP A;  2KZT A;  5LX8 A;  5EN5 D;  2OV8 A;  2XCB A;  4V3I A;  5FJY A;  3UI2 A;  2LXM A;  2GGF A;  5AEN A;  1S70 B;  4DRX E;  3ZKJ A;  5M72 A;  3PRE A;  2WXH A;  1SQM A;  1TNO A;  1FCH A;  4ANX A;  4O60 A;  5KNG A;  1D8D A;  2I2O A; 
#chains in the Genus database with same CATH homology
 1OCC E;  3WG7 E;  3X2Q E;  3AG3 E;  2ZXW E;  3ABK E;  1V55 E;  3AG4 E;  2DYS E;  2EIM E;  2DYR E;  2EIN E;  5B1A E;  2EIK E;  2OCC E;  1V54 E;  3ABM E;  3ASN E;  3ASO E;  5B1B E;  3AG1 E;  3AG2 E;  2Y69 E;  5B3S E;  1OCR E;  5IY5 E;  1OCZ E;  2EIJ E;  2EIL E;  3ABL E;  1OCO E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...