2EIME

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eimE00
2Y69E 1V54E 2EIKE 2EILE 3ABME 3AG1E 1V55E 1OCOE 3AG2E 5B3SE 2EINE 2EIJE 3ASOE 1OCRE 2DYSE 5B1AE 3WG7E 2OCCE 5IY5E 5B1BE 3ABLE 2DYRE 2ZXWE 3ABKE 2EIME 3AG4E 1OCZE 3X2QE 3ASNE 1OCCE 3AG3E
chains in the Genus database with same CATH superfamily
3APDA 1GW6A 2F8XK 1HS6A 4JW1A 1K1AA 4DLQA 3N71A 3PS6A 1FVFA 4GA0A 3AS8A 2ETAA 4LSZE 5AJLA 3G2TA 3UUXA 2LO6A 4DJAA 4LCTA 3AG2E 4B93B 1P5QA 4WWNA 3WG7E 3E30A 4EECA 1H2UA 4K5AB 1HX8A 2V4HC 1N11A 4KVOA 3AU4A 4M7CA 3DEOA 1S63A 2YHEA 5FWQA 3PH0C 2BEDA 3GZ2A 4GTVA 4ABNA 2ONDA 4GAAA 2I1JA 4RQIA 1E90A 4XKBA 4NQ0A 1A17A 3ASOE 5FZSA 4PDXA 4WWOA 4ANXA 3RRNB 5BPPA 3ZVVA 1VDYA 3Q73A 4GTPA 3QWWA 3VLDA 2AXUA 4JA9A 3CKCA 2ILRA 3D9NA 3OAWA 1WM5A 4U7EB 4XZ4A 2IONA 2OVBA 2XCBA 2ETBA 3C3OA 3U9WA 3L9TA 1S64A 4HOSA 4N5CA 1K3ZD 3S7DA 2EIJE 3FUHA 4TUMA 4GZCA 3LVRE 4A3VA 2B6CA 2ZISA 3EHMA 3HXCA 1IHBA 4APFA 4JXTA 2EILE 2VGEA 3MZLB 3SBTB 1MZCA 2L0IA 3QARA 5AYWD 5FJYA 3LDZA 2FO1E 3ZUVB 1EYHA 4ILHB 3I4RB 2OEWA 4N5QA 4UWFA 5D0OD 3E37A 3ABLE 1IYGA 2VGYA 1YCSB 1QQEA 1D8EA 2WXMA 3V2XA 2PM7A 5BUZA 4CZ2D 5ANLA 3SNXA 1S70B 3HG0D 5BV0A 3QAQA 3FUKA 3S2AA 2GRMA 2IQCA 3LVQE 3NB2A 3L54A 1JCQA 2KBXA 4YDEA 3V2OA 4BTBA 4FP7A 2P58C 2J8SD 2V5FA 1OWMA 3LJNA 3R9AB 3SGHA 5J08A 1BLXB 3DSSA 3FU3A 1MYOA 3TJPA 3KEAA 4HI8A 5CRVA 3BEEA 3DSUA 3EU5A 4LNGA 5EIDA 3DSVA 4B89A 3HXFA 3PE4A 4Y6WA 2AWIA 2Y3AA 4H7XA 3G2UA 2ZXWE 3ZFWA 3FTUA 4LRZA 3CLJA 3NOGD 3ISMC 2ZGDA 2LSVA 2XENA 3ZU7B 3Q15A 5C1DA 4WNDA 2VSYA 3PZ2A 4J8FA 3JQ0A 4DRXE 3TL5A 5KJLA 1H2VC 5T3RA 4B94A 4PUCA 3ENEA 4Q69A 1HU3A 3I5PA 3C3RA 2YINA 4K0RA 4J8YA 2I9CA 3T8KA 2JABA 2VSNA 2YNQA 2PNNA 2X6KA 5B3SE 4CRWA 4PS3A 1WDYA 3ONKA 4JHJA 4KVMA 3KSLA 3SZ7A 3E33A 5EYLA 3LY9A 3TG5A 3CVXA 2QC9A 3FEYA 4OAVB 2DIWA 4XEIG 1N0RA 1UJJA 4XE0A 1RW2A 1H0AA 2ETCA 2AJAA 4KT6B 3QNKA 4FLBA 5D66A 5BT1A 1UG3A 3QDNA 4BEPA 1NI1A 2JEKA 4UWHA 5AQBA 1N4SA 5KJKA 1DC2A 4ZHBA 1MHQA 4JA7A 5CBNA 4B8AA 2XS8A 4L23A 2FBNA 4ILGA 4BT8A 4W9RA 2DWZA 2CHWA 3DPDA 1OUVA 2V4LA 5D0QD 2GRQB 2XS1A 3CHRA 3UKUG 4GCOA 1TNBA 5CCLA 4O1PA 3ZKJA 2E2EA 1DNPA 1E7VA 3EHNA 3RK6A 3APCA 2LNIA 5ENQD 5A6CA 5FT9A 4R7LA 3FUJA 3CHSA 3CVYA 4N3AA 3VLFA 4L2LA 4CGWA 3FTVA 4GTQA 2X6HA 3CEQA 4XKCA 1NA0A 4GZ5A 1E7UA 3VTXA 1BI7B 3BQOA 3F6QA 2XEEA 2KCKA 5ENSD 4WAFA 3Q9UC 3AS4A 3ZYQA 2L0TB 2MRIA 5DBKA 4WNGA 4O6FA 3CVPA 1WAO1 5CECB 5FZQA 4WNEA 4F1PA 2PM6A 1AWCB 2C0MA 2WM9A 2LXLA 3SFXA 2V5QC 4A1GA 4EZLA 3IKOB 2DVWA 2GRRB 5FQ4A 1HH8A 3UKRG 4G2VA 3MA5A 3TWTA 1UOHA 2CG3A 5CMWA 3ASFA 4AXHA 3IEGA 3JXIA 3TGOA 3B13A 2H6IA 2YQ8A 1HF8A 3LJ3A 4U96D 1FVHA 3MX3A 3L22A 4BSXA 1OCCE 3EUVA 4YDWA 1H6PA 4C0EA 3Q79A 3PRZA 3P2BA 4HVBA 2GGFA 4EPZA 3CVWA 2AXZA 1IXVA 4AVXA 1FPPA 3E32A 3QJZA 3PZ3A 3IHYA 3AG4E 3QWVA 3ASNE 1N4RA 3UI2A 3DXKG 2FF4A 4RG6A 1IQUA 4BERA 1K1BA 1Z6TA 3PEVB 2A5EA 1WY6A 3ZHEA 4HFGA 4UQZA 1KT0A 4N39A 1MJ0A 1NZNA 3R7RA 1N0QA 3FUNA 5LOZA 4BWRA 2R59A 4TUUA 1UW4B 2P9SG 1Z5SC 3FTWA 3L16A 1MX2A 1HO8A 1NP7A 3G2SA 1A5EA 3D9MA 2GW1A 1OWLA 3ULYA 1N94A 1O1SA 3MKQA 3KAEA 3CHMA 4LG6A 3P1UA 2GRNB 1N9AA 1JWGA 1SW6A 1OWNA 3V30A 4BESA 4HBDA 1TNUA 5E76A 3ASHA 3IBEA 3C3QA 4MLPA 4KZ0A 3UT4A 3EHRA 1TN7A 3ESLA 3CQCB 4RVBA 4CDRA 3BU8A 4GTOA 3B7UX 3RO2A 3CVVA 5AQAA 3FH7A 3JXJA 4GYOA 3R9MA 1N52A 2LAIA 5ENPD 1QYMA 1S0PA 2X38A 3TWVA 4FA6A 1TR4A 4DUIA 1V55E 2MHKA 5G04J 2HM8A 3ONLA 4PS7A 2XGOA 1TJCA 4MKTA 2YHCA 3ZW3A 3NAWA 4KBQA 1KLXA 3AG3E 4U63A 1TN8A 3V31A 5KJMA 2PZIA 5CMYA 4OVUA 1K8KG 4G23A 5HS0A 4O1OA 1EDUA 5CERB 3ASGA 5AAOA 2WXIA 3D9KA 4G8KA 4K03A 1TNYA 3KSQA 3PUKA 3Q7FA 1JUQA 2VSXE 2Y4TA 2PL2A 2ZIRA 4GTSA 3OXGA 4A1SA 5ENTD 4N2SA 4CGVA 5DIZA 4JEUA 2DYRE 4KZCA 3HXEA 2IEJA 1H6KA 4XX5A 4BT9A 3PEUB 5EYPF 1TNOA 3HHMA 3UPVA 4U95D 2RD0A 1UN8A 2WXPA 1UJKA 1HG2A 3URZA 4GMLA 4ACKA 3JYSA 3D9PA 5A7DB 1N95A 3PZ4A 4OVVA 4JD2G 4JC8A 4JB8P 1KT1A 1O1TA 2VTBA 2P9IG 4QFVA 4DI3A 3G2VA 3FFLA 2R03A 4I1AA 4URKA 2RG8A 3T5XA 1WG0A 3DEPA 3FUEA 4XI0A 3UM0A 4B0ZA 2JLBA 3MV3B 1ELKA 3K9IA 4HNAD 3VLEA 4FC8A 3CVQA 3SHFA 3FUDA 3RRMB 1H2TC 3TWXA 4HOUA 2DYSE 5EIBE 1FT2A 3L6AA 5FIOA 5JJ7A 1LF8A 2J08A 5CBOA 4EZJA 4DX5D 3EHQA 2LXMA 2KZTA 3ZIMA 4IYPA 4HB5A 3T9KA 4JVSA 4EZKA 3Q4AB 3MYVA 5CRUA 3UT8A 3DSWA 3L82A 4FJZA 4FJYA 4GTMA 3BG1B 2Y1LE 3L13A 3FTSA 3ULEG 2C2LA 5BXOA 2XPYA 2F8YA 3CIAA 5FINA 2X6JA 2WXLA 3QOUA 5EN5D 2DBAA 2OV8A 1OCOE 1U2VG 2AW6A 4Z68A 3OXFA 4AEZC 5FZRA 3LEWA 4NIKA 2WXHA 2DZOA 4GA1A 4I2ZA 5JMND 2LSUA 3ESKA 1N54A 2BKGA 1EF1C 2ZGGA 4ILIA 4KXKB 1INZA 4N3CA 5G2NA 3DSXA 4Y6CA 4HRNA 3ZGQA 4ZFHA 3IHVA 4GYWA 2QYJA 2I2OA 4GZ6A 3FULA 1ELRA 2NYJA 5HKPA 2OVFA 3S7JA 3NQPA 3MEKA 3EDTB 5JA4D 3L17A 1DVPA 5AQ9A 5B1AE 4CDMA 3JCKC 2Q7FA 4G26A 4G11A 3PNTB 4HOTA 3CHPA 3SI5A 3KEZA 2XZDG 3FUMA 5HQ8A 4GTRA 4JL0A 4G8LA 1RZ4A 4IULA 4OYSA 2EIKE 4GU5A 4JPSA 4XIFA 2H6FA 4U8HA 5LX8A 4K5CA 3LCAA 2DCPA 2WXFA 3I4GA 3CGHA 3ZPJA 4L9PA 4UI9J 2H6GA 1QNFA 3T8MA 3E34A 4J8DA 3KD7A 1Y8MA 3OTNA 3AS5A 5CEAA 2KATA 1Y6IA 3U64A 3ZYMA 1OWOA 1PC2A 1D9SA 4AJWA 1PY1A 3HXDA 2EIME 3MGBA 1OXJA 4C0MA 1XNFA 5LP0A 2BKKB 1TJFA 2XRYA 2L9BA 2HO1A 3R7QA 3S7BA 1KZPA 3OXLA 2A4ZA 4Q94A 1E8XA 4AM9A 4UQYA 3W9GA 4I17A 4U8YD 1NL4A 5LFAA 2J49A 4J0UA 5HI7A 1U3CA 5G05J 2CG2A 4RLYA 5T8IA 3CVLA 4KMOA 3SY2A 5FQ7A 4FADA 2HE0A 1ELWA 1X5BA 3DSTA 3CK8A 4YNDA 2WXNA 2QZAA 3TWRA 2WXRA 3VTYA 4U0UA 2IF4A 3ZHEB 2J09A 2UY1A 4JHRA 5LCWJ 2FI7A 1YMPA 5B1BE 2XGMA 3RIBA 1SA4A 4GCNA 2ZU6B 4HXIA 1YYHA 4PS8A 1N4QA 2CHZA 4F53A 3HRAA 5CEDB 4H7YA 3B7TA 3TAXA 3RRUA 3CHOA 4Q96A 3Q9NC 5CCMA 2VJ8A 5BXUA 2R02A 4GA2A 4HRLA 2VGXB 4HRMB 3MKQB 2IO3C 3TG4A 3RKVA 3SO8A 2WQHA 2LAHA 3HDXA 5KBAA 3UM2A 4IN3B 3TWWA 1N4PA 4F7AA 4GPKA 1ZBPA 2IU1A 3BUAA 4CCAA 4BSZB 5ENNA 4TRQA 3SFZA 2NC9A 4I6GA 4AIFA 4U8VD 3UM1A 5ENOD 5JHBA 2BTDA 3FTYA 3PUJA 3GZ1A 3HVEA 3APFA 4DI4A 4F3VA 2AXVA 2XRZA 3X2QE 3JUEA 3EU9A 3UQ3A 1U3DA 3ZNGA 4UQXA 5LCWC 5ARGA 4UWKA 1HE8A 4MS6A 2HYZA 2EINE 3MJWA 1JWFA 4RSYA 3ZYKA 4U04A 1D8DA 1UN9A 4DX1A 4V3IA 2XQ0A 5C2YA 2FULA 2XEHA 3CQGB 3D9LA 4TXQA 2J9QA 4BX8A 4QQIA 3FH8A 1DCQA 1TEZA 4EQFA 3ZYLA 2XCCA 3NZUA 3S7FA 2KCLA 4HI9A 5M72A 3D9JA 4FLHA 3Q78A 4U0ZA 2WXQA 4LUNU 5J90A 1LTXA 2R2LA 1V54E 2I1KA 3NBNB 2WMOA 3CK9A 3FU0A 4FHKA 4CDNA 4WUYA 2DZNA 4FU3A 1BPOA 1SA5A 1LD8A 3FU5A 1B89A 3CHQA 4I1OB 3GZSA 2GRPB 3NF1A 2BF0X 3PDNA 3B7BA 3AAAC 3V79K 1OY3D 2P9KG 3CKBA 3IXEA 2L6BA 3CK7A 1W3BA 3Q49B 1TYQG 1Q2ZA 2H6HA 2OCCE 1SZ9A 5ITZF 4TXRA 3Q7AA 3Q5MA 3B7SA 3NOCD 2WXOA 4J8EA 2VTBB 4C48B 1E8YA 2R5SA 3DPYA 2L6JA 1OCRE 2F37A 2NXPA 5JHAA 3QKYA 4GTTA 3FU6A 2VSOE 1MQSA 3FY4A 2KM4A 3MKRA 2MOWA 4CYMD 3WXXA 4LERA 5G04C 2M63A 4CT0A 1L5JA 4GZ3A 2XPIA 1JPLA 2P9LG 2IOLA 2HR2A 5ANRA 3FP3A 3SBSA 1ZB1A 2CFZA 5IY5E 3D9OA 3IV0A 4YVQC 5EX0A 4J6IA 3FWVA 3O4ZA 1FCHA 3CVUA 5KNHD 2P9UG 4A63B 1JCRA 4YVOA 1XGWA 2QYUA 2KZTB 3KS2A 2IJGX 3CSFA 3FHEA 2RFAA 2P2CP 1KZOA 3HYMB 2FO7A 1O1RA 2IOSA 4HS2A 4LNUD 4I2WA 3QK0A 4DX2A 2XHEA 1BU9A 4HQDA 3DBSA 3JUIA 2VYIA 4XI9A 4GZDA 3SQVA 4GMRA 2X6FA 4E6HA 4A55A 1NA3A 4MRUA 3PZDA 4AY6A 2MYOA 1MX4A 2XEVA 4BFRA 2XPZA 2OEVA 1IHGA 5EDSA 3LYAA 4NURA 1LD7A 3NZSA 2QY7A 3QWPA 4FULA 3EIJA 4ANVA 2XGSA 4JHKA 5HRYA 5D2MC 5CHEE 4BY6A 2P9PG 1NFIE 3B95A 3Q47B 4OAUC 3GW4A 3O48A 3HXBA 3QB2A 4U0SA 4DX6D 3UT7A 3SFYA 5G55A 1OT8A 1HZ4A 3DXMG 3E4BA 4EBAG 1KPSB 2B0OE 4I9EA 3HIZA 3LKUA 2E0IA 4C9BB 4ME2A 3UIOC 4HORA 3B7RL 5AJDA 1HFAA 2BUGA 4F6RD 2J4DA 2WXGA 3G2WA 1OWPA 1Z3YA 4M3OA 3C5RA 4YDOA 3FH5A 2V8SE 1EPUA 3TXMA 1H19A 4L1BA 4FHJA 2PQNA 1AP7A 2WQ7A 3TXNA 4F1SA 1E8ZA 2GROB 4HLEA 5EILA 3UIPC 2KXPC 3ASDA 2J07A 2WQ6A 5EKQD 5T4YA 2F0YA 4ATGA 3C72A 4L7TA 5BW8C 4G1TA 2NSZA 1HG5A 2R05A 4GPMA 5EX3A 5KWDA 4CEMA 3FUIA 3AG1E 2LUHA 3D9HA 3J5QB 4UI9K 5FQ8A 1MX6A 5ENRD 2X6IA 4N2QA 2C0LA 4U07A 4EBAA 5AN8A 5A23A 3DWLG 3W9FA 3LY7A 2GRLA 5JJTA 2I6HA 1IKND 4ANUA 3D3MA 4UUCA 3SF4A 1TN6A 1ZU2A 4RG9A 3FTZA 3ULQA 3EJNA 3L08A 4J8SA 4JEHA 3U4TA 3ML9A 4PH4B 3UM3A 4BETA 2RKKA 4WWPA 1O5MA 4GB9A 4I1MA 3UMVA 4AP2A 4IRUA 5AARA 3MV2B 2WB2A 3ZXPA 2X3MA 3ABME 2QFCA 3CV0A 4DPRA 5KCMA 4J7WA 1E96B 3TWQA 3LY8A 4G24A 5E75A 5KJNA 2Y0BG 4DLOA 5AQ7A 3FTXA 1DCEA 1QBQA 3EIQC 3PVLA 3D9IA 2IY0C 5AIJA 1HXIA 2WXKA 2IO2C 2J4BA 3AU5A 4I6JA 4P29A 1Z3XA 4AV7A 4BX9A 1YA0A 3ML8A 2WMNA 4EHMA 2UY1B 2Y4UA 3RO3A 3UX4A 4AY5A 4B8CB 1SZAA 3FDHA 4LEUA 4ATZD 3CVNA 3MCXA 4G25A 3FEXA 4L2YA 4ACLA 2CFUA 4NACA 4UI9C 5JJ6A 2WVIA 1E8WA 3U66A 4GMJA 4I43A 3FUFA 3U3WA 3DRAA 4LNBA 4HOQA 3JQ1A 2Y69E 3SD5A 1BI8B 1H6OA 3LPZA 4O60A 2IFUA 1IQRA 4AOFA 4UWLA 3T5VA 3ZXSA 3GYZA 3Q75A 3CR3A 4GYYA 4WNFA 2V0PA 2WPVA 3ZEFA 4BTAA 2R17C 1SVXA 4TXPA 1X81A 1PAQA 4APOA 4I9CA 3PE3A 5ARFA 1JCSA 2A5UA 4D10C 1G3NB 3PREA 3UTMA 3RAUA 5BNWA 2XZTG 1FT1A 4JZYA 3J5PA 2P9NG 5AENA 3PZ1A 5G05C 3ZN3A 4N3BA 3HVEB 1OCZE 3ZRHA 2KC7A 3PNLB 3LXUX 4KYOB 3C98A 3BG0B 5FQ6A 4I6EA 4A3TA 4YDYA 1SQMA 4NRHB 5KNGA 4K5BA 4MBGA 4X8QA 3LS8A 1TNZA 2OOEA 3AJIA 4CT4A 2PQRA 3UXGA 3ABKE 2KCVA 3UINC 2VGXA 2CHXA 2RFMA 2AVPA 3I3NA 2UWJG 4DX7D 4DK5A 4UWGA 1BD8A 2VQ2A 2FEZA 2EQXA 4TV3A 5H7PA 3TWSA 5FTPA 3RSEG 3RJVA 3RU0A 3QC1A 3CSTA 5BV1A 4ANWA 4E85A 4HLLA 1QZ2A 2WXJA 3TWUA
chains in the Genus database with same CATH topology
2Y69E 1V54E 2EIKE 2EILE 3ABME 3AG1E 1V55E 1OCOE 3AG2E 5B3SE 2EINE 2EIJE 3ASOE 1OCRE 2DYSE 5B1AE 3WG7E 2OCCE 5IY5E 5B1BE 3ABLE 2DYRE 2ZXWE 3ABKE 2EIME 3AG4E 1OCZE 3X2QE 3ASNE 1OCCE 3AG3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y69 E;  1V54 E;  2EIK E;  2EIL E;  3ABM E;  3AG1 E;  1V55 E;  1OCO E;  3AG2 E;  5B3S E;  2EIN E;  2EIJ E;  3ASO E;  1OCR E;  2DYS E;  5B1A E;  3WG7 E;  2OCC E;  5IY5 E;  5B1B E;  3ABL E;  2DYR E;  2ZXW E;  3ABK E;  2EIM E;  3AG4 E;  1OCZ E;  3X2Q E;  3ASN E;  1OCC E;  3AG3 E; 
#chains in the Genus database with same CATH topology
 3APD A;  1GW6 A;  2F8X K;  1HS6 A;  4JW1 A;  1K1A A;  4DLQ A;  3N71 A;  3PS6 A;  1FVF A;  4GA0 A;  3AS8 A;  2ETA A;  4LSZ E;  5AJL A;  3G2T A;  3UUX A;  2LO6 A;  4DJA A;  4LCT A;  3AG2 E;  4B93 B;  1P5Q A;  4WWN A;  3WG7 E;  3E30 A;  4EEC A;  1H2U A;  4K5A B;  1HX8 A;  2V4H C;  1N11 A;  4KVO A;  3AU4 A;  4M7C A;  3DEO A;  1S63 A;  2YHE A;  5FWQ A;  3PH0 C;  2BED A;  3GZ2 A;  4GTV A;  4ABN A;  2OND A;  4GAA A;  2I1J A;  4RQI A;  1E90 A;  4XKB A;  4NQ0 A;  1A17 A;  3ASO E;  5FZS A;  4PDX A;  4WWO A;  4ANX A;  3RRN B;  5BPP A;  3ZVV A;  1VDY A;  3Q73 A;  4GTP A;  3QWW A;  3VLD A;  2AXU A;  4JA9 A;  3CKC A;  2ILR A;  3D9N A;  3OAW A;  1WM5 A;  4U7E B;  4XZ4 A;  2ION A;  2OVB A;  2XCB A;  2ETB A;  3C3O A;  3U9W A;  3L9T A;  1S64 A;  4HOS A;  4N5C A;  1K3Z D;  3S7D A;  2EIJ E;  3FUH A;  4TUM A;  4GZC A;  3LVR E;  4A3V A;  2B6C A;  2ZIS A;  3EHM A;  3HXC A;  1IHB A;  4APF A;  4JXT A;  2EIL E;  2VGE A;  3MZL B;  3SBT B;  1MZC A;  2L0I A;  3QAR A;  5AYW D;  5FJY A;  3LDZ A;  2FO1 E;  3ZUV B;  1EYH A;  4ILH B;  3I4R B;  2OEW A;  4N5Q A;  4UWF A;  5D0O D;  3E37 A;  3ABL E;  1IYG A;  2VGY A;  1YCS B;  1QQE A;  1D8E A;  2WXM A;  3V2X A;  2PM7 A;  5BUZ A;  4CZ2 D;  5ANL A;  3SNX A;  1S70 B;  3HG0 D;  5BV0 A;  3QAQ A;  3FUK A;  3S2A A;  2GRM A;  2IQC A;  3LVQ E;  3NB2 A;  3L54 A;  1JCQ A;  2KBX A;  4YDE A;  3V2O A;  4BTB A;  4FP7 A;  2P58 C;  2J8S D;  2V5F A;  1OWM A;  3LJN A;  3R9A B;  3SGH A;  5J08 A;  1BLX B;  3DSS A;  3FU3 A;  1MYO A;  3TJP A;  3KEA A;  4HI8 A;  5CRV A;  3BEE A;  3DSU A;  3EU5 A;  4LNG A;  5EID A;  3DSV A;  4B89 A;  3HXF A;  3PE4 A;  4Y6W A;  2AWI A;  2Y3A A;  4H7X A;  3G2U A;  2ZXW E;  3ZFW A;  3FTU A;  4LRZ A;  3CLJ A;  3NOG D;  3ISM C;  2ZGD A;  2LSV A;  2XEN A;  3ZU7 B;  3Q15 A;  5C1D A;  4WND A;  2VSY A;  3PZ2 A;  4J8F A;  3JQ0 A;  4DRX E;  3TL5 A;  5KJL A;  1H2V C;  5T3R A;  4B94 A;  4PUC A;  3ENE A;  4Q69 A;  1HU3 A;  3I5P A;  3C3R A;  2YIN A;  4K0R A;  4J8Y A;  2I9C A;  3T8K A;  2JAB A;  2VSN A;  2YNQ A;  2PNN A;  2X6K A;  5B3S E;  4CRW A;  4PS3 A;  1WDY A;  3ONK A;  4JHJ A;  4KVM A;  3KSL A;  3SZ7 A;  3E33 A;  5EYL A;  3LY9 A;  3TG5 A;  3CVX A;  2QC9 A;  3FEY A;  4OAV B;  2DIW A;  4XEI G;  1N0R A;  1UJJ A;  4XE0 A;  1RW2 A;  1H0A A;  2ETC A;  2AJA A;  4KT6 B;  3QNK A;  4FLB A;  5D66 A;  5BT1 A;  1UG3 A;  3QDN A;  4BEP A;  1NI1 A;  2JEK A;  4UWH A;  5AQB A;  1N4S A;  5KJK A;  1DC2 A;  4ZHB A;  1MHQ A;  4JA7 A;  5CBN A;  4B8A A;  2XS8 A;  4L23 A;  2FBN A;  4ILG A;  4BT8 A;  4W9R A;  2DWZ A;  2CHW A;  3DPD A;  1OUV A;  2V4L A;  5D0Q D;  2GRQ B;  2XS1 A;  3CHR A;  3UKU G;  4GCO A;  1TNB A;  5CCL A;  4O1P A;  3ZKJ A;  2E2E A;  1DNP A;  1E7V A;  3EHN A;  3RK6 A;  3APC A;  2LNI A;  5ENQ D;  5A6C A;  5FT9 A;  4R7L A;  3FUJ A;  3CHS A;  3CVY A;  4N3A A;  3VLF A;  4L2L A;  4CGW A;  3FTV A;  4GTQ A;  2X6H A;  3CEQ A;  4XKC A;  1NA0 A;  4GZ5 A;  1E7U A;  3VTX A;  1BI7 B;  3BQO A;  3F6Q A;  2XEE A;  2KCK A;  5ENS D;  4WAF A;  3Q9U C;  3AS4 A;  3ZYQ A;  2L0T B;  2MRI A;  5DBK A;  4WNG A;  4O6F A;  3CVP A;  1WAO 1;  5CEC B;  5FZQ A;  4WNE A;  4F1P A;  2PM6 A;  1AWC B;  2C0M A;  2WM9 A;  2LXL A;  3SFX A;  2V5Q C;  4A1G A;  4EZL A;  3IKO B;  2DVW A;  2GRR B;  5FQ4 A;  1HH8 A;  3UKR G;  4G2V A;  3MA5 A;  3TWT A;  1UOH A;  2CG3 A;  5CMW A;  3ASF A;  4AXH A;  3IEG A;  3JXI A;  3TGO A;  3B13 A;  2H6I A;  2YQ8 A;  1HF8 A;  3LJ3 A;  4U96 D;  1FVH A;  3MX3 A;  3L22 A;  4BSX A;  1OCC E;  3EUV A;  4YDW A;  1H6P A;  4C0E A;  3Q79 A;  3PRZ A;  3P2B A;  4HVB A;  2GGF A;  4EPZ A;  3CVW A;  2AXZ A;  1IXV A;  4AVX A;  1FPP A;  3E32 A;  3QJZ A;  3PZ3 A;  3IHY A;  3AG4 E;  3QWV A;  3ASN E;  1N4R A;  3UI2 A;  3DXK G;  2FF4 A;  4RG6 A;  1IQU A;  4BER A;  1K1B A;  1Z6T A;  3PEV B;  2A5E A;  1WY6 A;  3ZHE A;  4HFG A;  4UQZ A;  1KT0 A;  4N39 A;  1MJ0 A;  1NZN A;  3R7R A;  1N0Q A;  3FUN A;  5LOZ A;  4BWR A;  2R59 A;  4TUU A;  1UW4 B;  2P9S G;  1Z5S C;  3FTW A;  3L16 A;  1MX2 A;  1HO8 A;  1NP7 A;  3G2S A;  1A5E A;  3D9M A;  2GW1 A;  1OWL A;  3ULY A;  1N94 A;  1O1S A;  3MKQ A;  3KAE A;  3CHM A;  4LG6 A;  3P1U A;  2GRN B;  1N9A A;  1JWG A;  1SW6 A;  1OWN A;  3V30 A;  4BES A;  4HBD A;  1TNU A;  5E76 A;  3ASH A;  3IBE A;  3C3Q A;  4MLP A;  4KZ0 A;  3UT4 A;  3EHR A;  1TN7 A;  3ESL A;  3CQC B;  4RVB A;  4CDR A;  3BU8 A;  4GTO A;  3B7U X;  3RO2 A;  3CVV A;  5AQA A;  3FH7 A;  3JXJ A;  4GYO A;  3R9M A;  1N52 A;  2LAI A;  5ENP D;  1QYM A;  1S0P A;  2X38 A;  3TWV A;  4FA6 A;  1TR4 A;  4DUI A;  1V55 E;  2MHK A;  5G04 J;  2HM8 A;  3ONL A;  4PS7 A;  2XGO A;  1TJC A;  4MKT A;  2YHC A;  3ZW3 A;  3NAW A;  4KBQ A;  1KLX A;  3AG3 E;  4U63 A;  1TN8 A;  3V31 A;  5KJM A;  2PZI A;  5CMY A;  4OVU A;  1K8K G;  4G23 A;  5HS0 A;  4O1O A;  1EDU A;  5CER B;  3ASG A;  5AAO A;  2WXI A;  3D9K A;  4G8K A;  4K03 A;  1TNY A;  3KSQ A;  3PUK A;  3Q7F A;  1JUQ A;  2VSX E;  2Y4T A;  2PL2 A;  2ZIR A;  4GTS A;  3OXG A;  4A1S A;  5ENT D;  4N2S A;  4CGV A;  5DIZ A;  4JEU A;  2DYR E;  4KZC A;  3HXE A;  2IEJ A;  1H6K A;  4XX5 A;  4BT9 A;  3PEU B;  5EYP F;  1TNO A;  3HHM A;  3UPV A;  4U95 D;  2RD0 A;  1UN8 A;  2WXP A;  1UJK A;  1HG2 A;  3URZ A;  4GML A;  4ACK A;  3JYS A;  3D9P A;  5A7D B;  1N95 A;  3PZ4 A;  4OVV A;  4JD2 G;  4JC8 A;  4JB8 P;  1KT1 A;  1O1T A;  2VTB A;  2P9I G;  4QFV A;  4DI3 A;  3G2V A;  3FFL A;  2R03 A;  4I1A A;  4URK A;  2RG8 A;  3T5X A;  1WG0 A;  3DEP A;  3FUE A;  4XI0 A;  3UM0 A;  4B0Z A;  2JLB A;  3MV3 B;  1ELK A;  3K9I A;  4HNA D;  3VLE A;  4FC8 A;  3CVQ A;  3SHF A;  3FUD A;  3RRM B;  1H2T C;  3TWX A;  4HOU A;  2DYS E;  5EIB E;  1FT2 A;  3L6A A;  5FIO A;  5JJ7 A;  1LF8 A;  2J08 A;  5CBO A;  4EZJ A;  4DX5 D;  3EHQ A;  2LXM A;  2KZT A;  3ZIM A;  4IYP A;  4HB5 A;  3T9K A;  4JVS A;  4EZK A;  3Q4A B;  3MYV A;  5CRU A;  3UT8 A;  3DSW A;  3L82 A;  4FJZ A;  4FJY A;  4GTM A;  3BG1 B;  2Y1L E;  3L13 A;  3FTS A;  3ULE G;  2C2L A;  5BXO A;  2XPY A;  2F8Y A;  3CIA A;  5FIN A;  2X6J A;  2WXL A;  3QOU A;  5EN5 D;  2DBA A;  2OV8 A;  1OCO E;  1U2V G;  2AW6 A;  4Z68 A;  3OXF A;  4AEZ C;  5FZR A;  3LEW A;  4NIK A;  2WXH A;  2DZO A;  4GA1 A;  4I2Z A;  5JMN D;  2LSU A;  3ESK A;  1N54 A;  2BKG A;  1EF1 C;  2ZGG A;  4ILI A;  4KXK B;  1INZ A;  4N3C A;  5G2N A;  3DSX A;  4Y6C A;  4HRN A;  3ZGQ A;  4ZFH A;  3IHV A;  4GYW A;  2QYJ A;  2I2O A;  4GZ6 A;  3FUL A;  1ELR A;  2NYJ A;  5HKP A;  2OVF A;  3S7J A;  3NQP A;  3MEK A;  3EDT B;  5JA4 D;  3L17 A;  1DVP A;  5AQ9 A;  5B1A E;  4CDM A;  3JCK C;  2Q7F A;  4G26 A;  4G11 A;  3PNT B;  4HOT A;  3CHP A;  3SI5 A;  3KEZ A;  2XZD G;  3FUM A;  5HQ8 A;  4GTR A;  4JL0 A;  4G8L A;  1RZ4 A;  4IUL A;  4OYS A;  2EIK E;  4GU5 A;  4JPS A;  4XIF A;  2H6F A;  4U8H A;  5LX8 A;  4K5C A;  3LCA A;  2DCP A;  2WXF A;  3I4G A;  3CGH A;  3ZPJ A;  4L9P A;  4UI9 J;  2H6G A;  1QNF A;  3T8M A;  3E34 A;  4J8D A;  3KD7 A;  1Y8M A;  3OTN A;  3AS5 A;  5CEA A;  2KAT A;  1Y6I A;  3U64 A;  3ZYM A;  1OWO A;  1PC2 A;  1D9S A;  4AJW A;  1PY1 A;  3HXD A;  2EIM E;  3MGB A;  1OXJ A;  4C0M A;  1XNF A;  5LP0 A;  2BKK B;  1TJF A;  2XRY A;  2L9B A;  2HO1 A;  3R7Q A;  3S7B A;  1KZP A;  3OXL A;  2A4Z A;  4Q94 A;  1E8X A;  4AM9 A;  4UQY A;  3W9G A;  4I17 A;  4U8Y D;  1NL4 A;  5LFA A;  2J49 A;  4J0U A;  5HI7 A;  1U3C A;  5G05 J;  2CG2 A;  4RLY A;  5T8I A;  3CVL A;  4KMO A;  3SY2 A;  5FQ7 A;  4FAD A;  2HE0 A;  1ELW A;  1X5B A;  3DST A;  3CK8 A;  4YND A;  2WXN A;  2QZA A;  3TWR A;  2WXR A;  3VTY A;  4U0U A;  2IF4 A;  3ZHE B;  2J09 A;  2UY1 A;  4JHR A;  5LCW J;  2FI7 A;  1YMP A;  5B1B E;  2XGM A;  3RIB A;  1SA4 A;  4GCN A;  2ZU6 B;  4HXI A;  1YYH A;  4PS8 A;  1N4Q A;  2CHZ A;  4F53 A;  3HRA A;  5CED B;  4H7Y A;  3B7T A;  3TAX A;  3RRU A;  3CHO A;  4Q96 A;  3Q9N C;  5CCM A;  2VJ8 A;  5BXU A;  2R02 A;  4GA2 A;  4HRL A;  2VGX B;  4HRM B;  3MKQ B;  2IO3 C;  3TG4 A;  3RKV A;  3SO8 A;  2WQH A;  2LAH A;  3HDX A;  5KBA A;  3UM2 A;  4IN3 B;  3TWW A;  1N4P A;  4F7A A;  4GPK A;  1ZBP A;  2IU1 A;  3BUA A;  4CCA A;  4BSZ B;  5ENN A;  4TRQ A;  3SFZ A;  2NC9 A;  4I6G A;  4AIF A;  4U8V D;  3UM1 A;  5ENO D;  5JHB A;  2BTD A;  3FTY A;  3PUJ A;  3GZ1 A;  3HVE A;  3APF A;  4DI4 A;  4F3V A;  2AXV A;  2XRZ A;  3X2Q E;  3JUE A;  3EU9 A;  3UQ3 A;  1U3D A;  3ZNG A;  4UQX A;  5LCW C;  5ARG A;  4UWK A;  1HE8 A;  4MS6 A;  2HYZ A;  2EIN E;  3MJW A;  1JWF A;  4RSY A;  3ZYK A;  4U04 A;  1D8D A;  1UN9 A;  4DX1 A;  4V3I A;  2XQ0 A;  5C2Y A;  2FUL A;  2XEH A;  3CQG B;  3D9L A;  4TXQ A;  2J9Q A;  4BX8 A;  4QQI A;  3FH8 A;  1DCQ A;  1TEZ A;  4EQF A;  3ZYL A;  2XCC A;  3NZU A;  3S7F A;  2KCL A;  4HI9 A;  5M72 A;  3D9J A;  4FLH A;  3Q78 A;  4U0Z A;  2WXQ A;  4LUN U;  5J90 A;  1LTX A;  2R2L A;  1V54 E;  2I1K A;  3NBN B;  2WMO A;  3CK9 A;  3FU0 A;  4FHK A;  4CDN A;  4WUY A;  2DZN A;  4FU3 A;  1BPO A;  1SA5 A;  1LD8 A;  3FU5 A;  1B89 A;  3CHQ A;  4I1O B;  3GZS A;  2GRP B;  3NF1 A;  2BF0 X;  3PDN A;  3B7B A;  3AAA C;  3V79 K;  1OY3 D;  2P9K G;  3CKB A;  3IXE A;  2L6B A;  3CK7 A;  1W3B A;  3Q49 B;  1TYQ G;  1Q2Z A;  2H6H A;  2OCC E;  1SZ9 A;  5ITZ F;  4TXR A;  3Q7A A;  3Q5M A;  3B7S A;  3NOC D;  2WXO A;  4J8E A;  2VTB B;  4C48 B;  1E8Y A;  2R5S A;  3DPY A;  2L6J A;  1OCR E;  2F37 A;  2NXP A;  5JHA A;  3QKY A;  4GTT A;  3FU6 A;  2VSO E;  1MQS A;  3FY4 A;  2KM4 A;  3MKR A;  2MOW A;  4CYM D;  3WXX A;  4LER A;  5G04 C;  2M63 A;  4CT0 A;  1L5J A;  4GZ3 A;  2XPI A;  1JPL A;  2P9L G;  2IOL A;  2HR2 A;  5ANR A;  3FP3 A;  3SBS A;  1ZB1 A;  2CFZ A;  5IY5 E;  3D9O A;  3IV0 A;  4YVQ C;  5EX0 A;  4J6I A;  3FWV A;  3O4Z A;  1FCH A;  3CVU A;  5KNH D;  2P9U G;  4A63 B;  1JCR A;  4YVO A;  1XGW A;  2QYU A;  2KZT B;  3KS2 A;  2IJG X;  3CSF A;  3FHE A;  2RFA A;  2P2C P;  1KZO A;  3HYM B;  2FO7 A;  1O1R A;  2IOS A;  4HS2 A;  4LNU D;  4I2W A;  3QK0 A;  4DX2 A;  2XHE A;  1BU9 A;  4HQD A;  3DBS A;  3JUI A;  2VYI A;  4XI9 A;  4GZD A;  3SQV A;  4GMR A;  2X6F A;  4E6H A;  4A55 A;  1NA3 A;  4MRU A;  3PZD A;  4AY6 A;  2MYO A;  1MX4 A;  2XEV A;  4BFR A;  2XPZ A;  2OEV A;  1IHG A;  5EDS A;  3LYA A;  4NUR A;  1LD7 A;  3NZS A;  2QY7 A;  3QWP A;  4FUL A;  3EIJ A;  4ANV A;  2XGS A;  4JHK A;  5HRY A;  5D2M C;  5CHE E;  4BY6 A;  2P9P G;  1NFI E;  3B95 A;  3Q47 B;  4OAU C;  3GW4 A;  3O48 A;  3HXB A;  3QB2 A;  4U0S A;  4DX6 D;  3UT7 A;  3SFY A;  5G55 A;  1OT8 A;  1HZ4 A;  3DXM G;  3E4B A;  4EBA G;  1KPS B;  2B0O E;  4I9E A;  3HIZ A;  3LKU A;  2E0I A;  4C9B B;  4ME2 A;  3UIO C;  4HOR A;  3B7R L;  5AJD A;  1HFA A;  2BUG A;  4F6R D;  2J4D A;  2WXG A;  3G2W A;  1OWP A;  1Z3Y A;  4M3O A;  3C5R A;  4YDO A;  3FH5 A;  2V8S E;  1EPU A;  3TXM A;  1H19 A;  4L1B A;  4FHJ A;  2PQN A;  1AP7 A;  2WQ7 A;  3TXN A;  4F1S A;  1E8Z A;  2GRO B;  4HLE A;  5EIL A;  3UIP C;  2KXP C;  3ASD A;  2J07 A;  2WQ6 A;  5EKQ D;  5T4Y A;  2F0Y A;  4ATG A;  3C72 A;  4L7T A;  5BW8 C;  4G1T A;  2NSZ A;  1HG5 A;  2R05 A;  4GPM A;  5EX3 A;  5KWD A;  4CEM A;  3FUI A;  3AG1 E;  2LUH A;  3D9H A;  3J5Q B;  4UI9 K;  5FQ8 A;  1MX6 A;  5ENR D;  2X6I A;  4N2Q A;  2C0L A;  4U07 A;  4EBA A;  5AN8 A;  5A23 A;  3DWL G;  3W9F A;  3LY7 A;  2GRL A;  5JJT A;  2I6H A;  1IKN D;  4ANU A;  3D3M A;  4UUC A;  3SF4 A;  1TN6 A;  1ZU2 A;  4RG9 A;  3FTZ A;  3ULQ A;  3EJN A;  3L08 A;  4J8S A;  4JEH A;  3U4T A;  3ML9 A;  4PH4 B;  3UM3 A;  4BET A;  2RKK A;  4WWP A;  1O5M A;  4GB9 A;  4I1M A;  3UMV A;  4AP2 A;  4IRU A;  5AAR A;  3MV2 B;  2WB2 A;  3ZXP A;  2X3M A;  3ABM E;  2QFC A;  3CV0 A;  4DPR A;  5KCM A;  4J7W A;  1E96 B;  3TWQ A;  3LY8 A;  4G24 A;  5E75 A;  5KJN A;  2Y0B G;  4DLO A;  5AQ7 A;  3FTX A;  1DCE A;  1QBQ A;  3EIQ C;  3PVL A;  3D9I A;  2IY0 C;  5AIJ A;  1HXI A;  2WXK A;  2IO2 C;  2J4B A;  3AU5 A;  4I6J A;  4P29 A;  1Z3X A;  4AV7 A;  4BX9 A;  1YA0 A;  3ML8 A;  2WMN A;  4EHM A;  2UY1 B;  2Y4U A;  3RO3 A;  3UX4 A;  4AY5 A;  4B8C B;  1SZA A;  3FDH A;  4LEU A;  4ATZ D;  3CVN A;  3MCX A;  4G25 A;  3FEX A;  4L2Y A;  4ACL A;  2CFU A;  4NAC A;  4UI9 C;  5JJ6 A;  2WVI A;  1E8W A;  3U66 A;  4GMJ A;  4I43 A;  3FUF A;  3U3W A;  3DRA A;  4LNB A;  4HOQ A;  3JQ1 A;  2Y69 E;  3SD5 A;  1BI8 B;  1H6O A;  3LPZ A;  4O60 A;  2IFU A;  1IQR A;  4AOF A;  4UWL A;  3T5V A;  3ZXS A;  3GYZ A;  3Q75 A;  3CR3 A;  4GYY A;  4WNF A;  2V0P A;  2WPV A;  3ZEF A;  4BTA A;  2R17 C;  1SVX A;  4TXP A;  1X81 A;  1PAQ A;  4APO A;  4I9C A;  3PE3 A;  5ARF A;  1JCS A;  2A5U A;  4D10 C;  1G3N B;  3PRE A;  3UTM A;  3RAU A;  5BNW A;  2XZT G;  1FT1 A;  4JZY A;  3J5P A;  2P9N G;  5AEN A;  3PZ1 A;  5G05 C;  3ZN3 A;  4N3B A;  3HVE B;  1OCZ E;  3ZRH A;  2KC7 A;  3PNL B;  3LXU X;  4KYO B;  3C98 A;  3BG0 B;  5FQ6 A;  4I6E A;  4A3T A;  4YDY A;  1SQM A;  4NRH B;  5KNG A;  4K5B A;  4MBG A;  4X8Q A;  3LS8 A;  1TNZ A;  2OOE A;  3AJI A;  4CT4 A;  2PQR A;  3UXG A;  3ABK E;  2KCV A;  3UIN C;  2VGX A;  2CHX A;  2RFM A;  2AVP A;  3I3N A;  2UWJ G;  4DX7 D;  4DK5 A;  4UWG A;  1BD8 A;  2VQ2 A;  2FEZ A;  2EQX A;  4TV3 A;  5H7P A;  3TWS A;  5FTP A;  3RSE G;  3RJV A;  3RU0 A;  3QC1 A;  3CST A;  5BV1 A;  4ANW A;  4E85 A;  4HLL A;  1QZ2 A;  2WXJ A;  3TWU A; 
#chains in the Genus database with same CATH homology
 2Y69 E;  1V54 E;  2EIK E;  2EIL E;  3ABM E;  3AG1 E;  1V55 E;  1OCO E;  3AG2 E;  5B3S E;  2EIN E;  2EIJ E;  3ASO E;  1OCR E;  2DYS E;  5B1A E;  3WG7 E;  2OCC E;  5IY5 E;  5B1B E;  3ABL E;  2DYR E;  2ZXW E;  3ABK E;  2EIM E;  3AG4 E;  1OCZ E;  3X2Q E;  3ASN E;  1OCC E;  3AG3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...