2EIME

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eimE00
2DYSE 1V55E 3ASOE 5B1BE 3ABME 2OCCE 3AG4E 2Y69E 3AG3E 3ABKE 2EIME 2EIJE 3WG7E 2EINE 3ASNE 2DYRE 5B3SE 3ABLE 3X2QE 2EIKE 3AG2E 2EILE 1OCZE 1OCRE 1OCCE 1V54E 2ZXWE 5IY5E 3AG1E 1OCOE 5B1AE
chains in the Genus database with same CATH superfamily
1A17A 2L6JA 3MV2B 1HG5A 2WQ6A 5KJKA 1SZ9A 4F1PA 2VSXE 5FZQA 2ZGGA 2P9NG 3B7TA 2WXOA 4ANXA 4ILHB 4GA1A 3DPDA 2CG3A 2FO7A 3NBNB 5AAOA 3CHOA 3CV0A 3Q4AB 3LJ3A 3R9AB 1D8EA 5CBNA 3CVNA 3QAQA 3KSQA 3S7BA 5ARFA 3IBEA 5AQ9A 4FHJA 1N4SA 2VQ2A 2XS8A 4I6GA 3Q7AA 3RSEG 4E6HA 4GB9A 3ASFA 2AJAA 1X5BA 1DCQA 2RFAA 4BWRA 3APDA 4TV3A 1H0AA 4GTRA 2YHEA 3LXUX 2E0IA 2F37A 5DIZA 4JHKA 4GCOA 4DLOA 1PAQA 4J0UA 2WMNA 4B89A 4CT4A 4DX1A 3FTXA 4F7AA 2VYIA 3IEGA 4N39A 2PL2A 3N71A 4ANWA 4FULA 2KZTB 4G1TA 3U64A 2RKKA 3EU5A 1NA0A 4WAFA 4PUCA 4L2LA 1HH8A 1N95A 3J5QB 3SZ7A 2P58C 2P9KG 3URZA 1FPPA 3QK0A 5E76A 5EYLA 2GRRB 3FTVA 1K8KG 4G23A 5FJYA 2X6IA 4TRQA 3DEOA 3LCAA 2WXGA 3CSFA 5FQ7A 1NP7A 4O60A 2Y0BG 5KNHD 3QJZA 3PZ4A 2EIKE 4AOFA 5BV1A 3PREA 5CECB 2CFUA 3IHYA 4WNFA 4GZ5A 2AXZA 2P2CP 3FUHA 1HZ4A 3UPVA 2LAHA 2WXIA 3FUMA 4A55A 4Z68A 2XPIA 2WXPA 4KZCA 4YDEA 1N54A 1QBQA 2YHCA 3FTZA 2R02A 3G2SA 1NI1A 2RFMA 3IHVA 4HOTA 4G8KA 5FZSA 3ZW3A 3X2QE 2UWJG 1HX8A 1JCRA 3PEVB 5H7PA 2MOWA 1EPUA 4TUUA 4APFA 4CCAA 1B89A 5HQ8A 3T8KA 2B6CA 1UG3A 3SHFA 4DJAA 4CRWA 1Z3YA 5EYPF 1HXIA 1OWNA 2J9QA 3LY7A 2A5EA 2MHKA 4GTSA 2PM6A 4EHMA 3TWUA 3KD7A 3LPZA 4O6FA 1EF1C 3K9IA 3SNXA 1ELKA 4EECA 2FI7A 1AWCB 2XRYA 5D2MC 2P9SG 3FEXA 1S70B 3ASNE 5AARA 3FFLA 3CKCA 3HYMB 1JUQA 1TNZA 3DSUA 3MX3A 1H19A 4KVOA 3MCXA 2LNIA 1QNFA 4AY5A 4DUIA 2QC9A 2VGEA 3S7JA 2LAIA 4H7XA 3PZ3A 5FQ6A 5JHAA 2GW1A 5JJTA 5AENA 3AS4A 3OXLA 4JB8P 3LDZA 2LXMA 1WAO1 3LY9A 4L1BA 4YDOA 2I2OA 3V2XA 1E7UA 2BF0X 3JQ0A 3DXMG 3S7FA 2XCBA 4ACLA 1NZNA 2QZAA 5M72A 2XENA 3L6AA 5DBKA 3FH7A 3QARA 1TNOA 2VGYA 2J09A 2VSOE 4CDMA 1SA4A 4QFVA 5A23A 3C72A 2L6BA 4QQIA 4CGWA 3JQ1A 4GTTA 1GW6A 4UQYA 1V54E 2BUGA 4RQIA 4J8FA 4M3OA 1TR4A 4UUCA 3TWXA 2JLBA 3D9NA 1HF8A 4KYOB 1Q2ZA 3B95A 2AWIA 4F6RD 4JVSA 1RZ4A 3AU4A 4FLBA 4FJYA 4FADA 4HLLA 4UI9K 4ACKA 1OCCE 5ANLA 2XGMA 3ULQA 3UM1A 3NQPA 5ENNA 4EPZA 2R03A 1OXJA 4K0RA 3DBSA 2Y69E 5EN5D 4OVUA 1SQMA 2VTBB 1N94A 2KCVA 3PS6A 4WWNA 4WWOA 1UN9A 3RRNB 3D9JA 4BERA 4EZKA 3CHMA 5CHEE 4ZHBA 4LCTA 3J5PA 1G3NB 3KSLA 4ME2A 3SY2A 1ELWA 4RG6A 2ETAA 3MKQB 3DPYA 3FU3A 1HFAA 1TJCA 3FUJA 5ENTD 3ISMC 1KT1A 1U2VG 3ZIMA 1TNBA 4RVBA 5BUZA 3ZEFA 4A1GA 1EYHA 3CQCB 2XPYA 4KT6B 3JXIA 3IKOB 3CVLA 2X6HA 4NACA 2XGSA 4W9RA 3LYAA 3VTXA 3NOGD 4TXQA 2GRQB 4HQDA 3LVQE 4HBDA 3TL5A 2ETCA 4RG9A 1Z5SC 4LNUD 5FQ8A 1E90A 3D3MA 2KATA 2OV8A 2H6FA 2DIWA 4O1PA 4A3TA 3RAUA 3DSWA 3LY8A 2AVPA 2NXPA 2C2LA 4HS2A 2GRMA 4K03A 5ITZF 4G24A 2IF4A 1DNPA 4CEMA 1H2UA 5KJNA 4U04A 4AJWA 2VJ8A 1DC2A 1MQSA 4XI9A 4K5AB 3L22A 1OWOA 4HRLA 2WVIA 5BT1A 4CDNA 4HRMB 4J8YA 3FU5A 1JWGA 2H6GA 4AXHA 1H2VC 2XQ0A 2MYOA 4GZ3A 1P5QA 3MGBA 3Q9NC 3EJNA 3ZHEB 2H6HA 3JCKC 3NB2A 3UM3A 1QZ2A 2RG8A 5LFAA 1HU3A 4PH4B 4G2VA 4L9PA 3CHPA 4U8VD 3FULA 3HXFA 3SBSA 2J07A 1ZBPA 5G04C 3EU9A 4K5CA 5BXOA 3C3OA 2WXKA 5CCMA 4JPSA 5T4YA 3G2UA 3HG0D 5FINA 5CMYA 1YCSB 3CIAA 3VLDA 2L0IA 3RRUA 2IOLA 2DCPA 1IKND 4BX9A 5AQAA 3B13A 5AQ7A 5BW8C 5AN8A 3JYSA 3TG5A 3D9IA 2OEVA 2CG2A 3FTWA 2HYZA 2LUHA 4KMOA 4N3AA 3UQ3A 3PUKA 4GZ6A 4L2YA 4U95D 3E34A 2VSNA 3D9KA 3TWVA 4U07A 1MZCA 3R9MA 3ASOE 1E7VA 4N5QA 1U3DA 2GRPB 5C2YA 2XS1A 4J8SA 3HIZA 3MJWA 1PY1A 5T8IA 4GMJA 3FY4A 5AJDA 1MYOA 1H6OA 2OVBA 3ASGA 4D10C 1UOHA 1E8ZA 5EX0A 1WM5A 1N0RA 2VGXB 1K3ZD 5FWQA 5B3SE 4I1OB 1OUVA 3EHNA 4GYYA 3L08A 3I3NA 3CHQA 3UT4A 4HI8A 3SFZA 2HO1A 2I1JA 3GZ1A 3PUJA 2XEVA 2FULA 3LS8A 2L0TB 3PE3A 4BT8A 1N0QA 3E32A 3AU5A 2XCCA 3RU0A 1H6KA 4U7EB 2BKGA 1FT1A 3F6QA 4C0MA 1MHQA 3AG1E 4G25A 3HXCA 3FTSA 4HOSA 4HORA 3FEYA 4AVXA 4WNEA 4FA6A 3G2VA 3CLJA 2E2EA 1NFIE 2WXLA 3FP3A 5G55A 3Q47B 3KEAA 3OTNA 4UQXA 4Y6WA 3DSXA 3AAAC 3HXEA 3UI2A 3CHRA 3DSSA 1N4RA 3EHMA 3L13A 5AJLA 3DXKG 4TUMA 4BY6A 3FWVA 4DI3A 3EHQA 3E33A 2IOSA 4JL0A 3CVUA 1JPLA 4GZCA 5ANRA 4TXRA 3SFXA 1TYQG 3ASDA 3R7RA 2GRNB 2DBAA 3D9OA 4F53A 1IHBA 2NYJA 1JCSA 2LXLA 3IV0A 4YDYA 4I9EA 3HVEA 4GTOA 1S0PA 1UJKA 3CVPA 4JA7A 2V5QC 4TXPA 4BETA 3NAWA 3MV3B 1OCRE 2IU1A 4PS7A 4UWHA 3S2AA 1E8WA 1YYHA 4OAVB 4YDWA 3MEKA 3APFA 4GA2A 4G11A 2BKKB 2DVWA 2YINA 3KAEA 3CSTA 3FUNA 4BESA 3TWRA 2IFUA 1H6PA 4EBAA 2Y4TA 5BV0A 3FUIA 3FH8A 3MYVA 5EIBE 3QDNA 3SF4A 5G04J 4GMLA 4CT0A 1YA0A 2I1KA 4LUNU 2WXQA 2UY1A 4UI9C 4GYOA 3AJIA 3ZVVA 3TWSA 5LX8A 1TNUA 4PS3A 1W3BA 2GROB 4G26A 2HM8A 4XX5A 3IXEA 3QOUA 2KC7A 3JXJA 4NIKA 3QC1A 1NA3A 2WPVA 3ZRHA 4JEHA 3E37A 3FTUA 4FJZA 3B7UX 3C3QA 4N2SA 1Z6TA 4U96D 2P9PG 2IQCA 2EIME 3FU0A 3JUEA 4BFRA 3EDTB 3DEPA 3FUEA 4F3VA 4I17A 5CCLA 3MKRA 4AM9A 5ENOD 4Q94A 4YVOA 4MBGA 4UWFA 4J8DA 3RJVA 4I1MA 4NQ0A 1QYMA 1JCQA 4AY6A 2OEWA 4HNAD 2R05A 3NZUA 1JWFA 4HLEA 5LCWC 3ESKA 3CGHA 3QKYA 2A4ZA 3PZDA 5CRVA 1E8YA 5FIOA 4IN3B 2KZTA 2ZISA 3Q5MA 1TN6A 3OXGA 3UKUG 1OCOE 3SD5A 2F8YA 4X8QA 4HXIA 1IYGA 1OY3D 4BSXA 4BTAA 1SZAA 3EUVA 3ULEG 1MJ0A 4KZ0A 1VDYA 1N9AA 4UWKA 2DZNA 3Q7FA 4ATGA 3PZ2A 2I9CA 1D8DA 3DWLG 2HR2A 3CK8A 5EKQD 1HO8A 2PQNA 2FF4A 4GTMA 3ZFWA 1LF8A 3JUIA 4A1SA 5D0QD 4JA9A 2CFZA 3D9MA 2EILE 4Q96A 3BG1B 3TWWA 4U8YD 3ESLA 4A3VA 3U66A 2JABA 3TJPA 4PS8A 4WWPA 4L7TA 4JHJA 5BPPA 4AP2A 1LD8A 4ABNA 5JHBA 4ILIA 3L9TA 2HE0A 3KS2A 4JXTA 2V4HC 3ZGQA 1Y6IA 2WXFA 4ATZD 4U63A 3CVXA 4B0ZA 4OYSA 3PRZA 1TNYA 3MZLB 2F0YA 5EDSA 3B7SA 4NURA 3GZ2A 4AIFA 1TN7A 4ZFHA 1XGWA 4APOA 4WNDA 5J90A 3QNKA 1INZA 3DSVA 2PZIA 3AG2E 4XKBA 5CMWA 4KVMA 4LG6A 3CEQA 4EZJA 1WY6A 2OCCE 4GA0A 3PVLA 3U3WA 3V2OA 5G05C 4B8AA 4Y6CA 2KCLA 1N11A 3I4RB 4J6IA 1BI7B 1U3CA 4ANVA 1L5JA 4WNGA 2Y4UA 3NZSA 4GPMA 3HVEB 1HE8A 5ENPD 4J8EA 2QY7A 3W9GA 1X81A 1K1AA 3ML9A 2ZXWE 3RIBA 3Q49B 4CZ2D 1E96B 1BLXB 1TJFA 3VLEA 5A6CA 3CK7A 5HRYA 4N5CA 3V79K 2IJGX 1IHGA 4DX2A 3UIPC 3SQVA 5KJLA 4I6JA 1WDYA 2XZDG 1HS6A 3I5PA 2J4BA 4LNBA 4FC8A 3PNTB 5FQ4A 4LSZE 2DWZA 3HXDA 4AEZC 3RO3A 3GW4A 4UI9J 3U9WA 3GZSA 2NSZA 1OWLA 3Q79A 4DI4A 3D9PA 4XIFA 5JMND 3TXMA 4MS6A 2XHEA 3HDXA 4LEUA 2WM9A 1YMPA 3NF1A 2X3MA 3ONKA 1DCEA 5CBOA 5FTPA 1OWMA 2Q7FA 2QFCA 3C98A 3D9LA 4BT9A 3LEWA 2EQXA 4ANUA 5D66A 3ZYKA 2KXPC 1O1TA 4EBAG 1UJJA 5HI7A 4BTBA 3BU8A 5JA4D 3PZ1A 4HFGA 2V0PA 2XGOA 2YQ8A 4GU5A 1Z3XA 4OVVA 2B0OE 3OAWA 5ENQD 3AS8A 2ZGDA 5LCWJ 2NC9A 3T9KA 4WUYA 5ENSD 2VTBA 5HKPA 2KM4A 3UINC 3PEUB 2AXVA 3V30A 1IXVA 3W9FA 5C1DA 1KZOA 3KEZA 4JHRA 5CERB 1ELRA 4DX6D 4P29A 3BQOA 4F1SA 1KT0A 3WG7E 4JD2G 1BD8A 2EINE 5KNGA 2L9BA 4FHKA 4KXKB 2V4LA 4B8CB 3MKQA 3R7QA 3FU6A 3RRMB 3TGOA 5FZRA 2DYSE 3UUXA 5ENRD 1OT8A 3T5VA 2WXRA 4PDXA 2CHZA 4CDRA 2WQ7A 2WXNA 2WXHA 3Q75A 2XEHA 3AS5A 3L54A 3ZU7B 2MRIA 3UIOC 2R2LA 5JJ7A 4I43A 1N4PA 4YVQC 3LKUA 3UKRG 5BXUA 3VLFA 2X6KA 2X6JA 4V3IA 3BUAA 2ONDA 3APCA 3UMVA 4EZLA 4DRXE 1A5EA 3WXXA 3PH0C 1EDUA 3TG4A 2R5SA 4HRNA 3UM0A 4ILGA 4BEPA 2WQHA 1O5MA 3BEEA 3TAXA 2H6IA 2FO1E 2I6HA 3ENEA 3AG4E 4I2ZA 4JEUA 3LVRE 4RLYA 4H7YA 5LP0A 2PNNA 1ZB1A 4GYWA 1WG0A 4B94A 4J7WA 2ZU6B 1Y8MA 2P9IG 2XZTG 3TWTA 3FDHA 2YNQA 2IY0C 3OXFA 5G05J 2VSYA 3ZXPA 2ILRA 1BPOA 3E4BA 4U0SA 2CHWA 2WXMA 2M63A 2IO2C 4M7CA 1QQEA 1KPSB 3UXGA 3SO8A 2AW6A 1TN8A 3HRAA 2QYUA 3L16A 1UW4B 3ZHEA 1ZU2A 4CYMD 3CVQA 3O48A 4G8LA 2LSUA 4I2WA 2A5UA 2OVFA 4LERA 3SGHA 4IRUA 5B1AE 3PDNA 1V55E 5B1BE 2Y3AA 3UTMA 4K5BA 2AXUA 2J08A 4B93B 3BG0B 3T8MA 1O1RA 2WMOA 2OOEA 3O4ZA 3CK9A 2WB2A 4GTPA 4XEIG 2KBXA 1N4QA 4NRHB 1MX2A 1LD7A 3ONLA 2PM7A 1SA5A 3LJNA 3ZXSA 3AG3E 5AYWD 3FHEA 2X38A 3D9HA 1S63A 4O1OA 4MRUA 1XNFA 3C3RA 4U8HA 5KWDA 4L23A 2BTDA 3G2TA 2BEDA 4GTQA 5BNWA 3VTYA 4GZDA 1FCHA 4C48B 3FTYA 2IONA 1O1SA 3I4GA 3CVYA 2IEJA 1DVPA 4N2QA 5T3RA 4Q69A 3Q9UC 3EIJA 4I9CA 1UN8A 5JJ6A 1D9SA 2ZIRA 4FU3A 1E8XA 3TXNA 4FP7A 1K1BA 4HVBA 1H2TC 3RO2A 3FH5A 2XEEA 3QWVA 3ABME 4JZYA 3L17A 3FUKA 4IULA 5KBAA 3FUDA 3RK6A 1IQUA 1NL4A 2R17C 1IQRA 5EIDA 2J4DA 1OCZE 3DSTA 4GPKA 2VGXA 2FBNA 2IO3C 3ABKE 4XI0A 3UX4A 2F8XK 3ZYLA 3DRAA 2QYJA 2XRZA 3U4TA 2GRLA 1N52A 3P2BA 5LOZA 4DK5A 4EQFA 4A63B 4JW1A 2V5FA 3L82A 4LRZA 3QWPA 2C0MA 2X6FA 3QWWA 2CHXA 3S7DA 3T5XA 3G2WA 5D0OD 2V8SE 2WXJA 4HB5A 2RD0A 3TWQA 3GYZA 5AIJA 1PC2A 4HOUA 3CR3A 5IY5E 4AV7A 4URKA 1BU9A 1KZPA 3QB2A 5KJMA 2EIJE 3ASHA 3B7BA 5FT9A 4GTVA 3P1UA 5CRUA 1KLXA 4KBQA 3SBTB 5ARGA 3Q73A 5G2NA 4I1AA 3CQGB 2LO6A 2GGFA 2FEZA 4R7LA 3CVWA 3ULYA 4YNDA 1SVXA 1SW6A 4MLPA 5CEAA 4HOQA 5EILA 1MX4A 4LNGA 4N3BA 3ZN3A 4DX5D 1AP7A 1BI8B 4HI9A 5KCMA 4UWGA 2Y1LE 2ETBA 3ZYMA 3CKBA 3ZPJA 4GMRA 2KCKA 1FVFA 3NOCD 1FT2A 4C0EA 3Q78A 3ZYQA 4I6EA 1OWPA 3UT8A 4FLHA 3HXBA 4XZ4A 3B7RL 3FUFA 4U0UA 3ZUVB 3Q15A 1S64A 2P9LG 4IYPA 4E85A 4DPRA 3ZKJA 5CEDB 2JEKA 4CGVA 4N3CA 5AQBA 3C5RA 4DLQA 3PE4A 3V31A 4XKCA 4BX8A 3ABLE 2J49A 3SFYA 3UM2A 2LSVA 2C0LA 1HG2A 4C9BB 5E75A 4RSYA 4BSZB 3MA5A 1RW2A 3EIQC 4MKTA 4XE0A 5A7DB 3ML8A 4DX7D 5EX3A 3CHSA 3PNLB 1MX6A 4U0ZA 3ZNGA 2R59A 2P9UG 4OAUC 2PQRA 2DZOA 4GCNA 2XPZA 3EHRA 4JC8A 2J8SD 1FVHA 2DYRE 3HHMA 3E30A 4UQZA 3RKVA 5HS0A 5J08A 1TEZA 3CVVA 1LTXA 4GAAA 3UT7A 2UY1B 3SI5A 4UWLA
chains in the Genus database with same CATH topology
2DYSE 1V55E 3ASOE 5B1BE 3ABME 2OCCE 3AG4E 2Y69E 3AG3E 3ABKE 2EIME 2EIJE 3WG7E 2EINE 3ASNE 2DYRE 5B3SE 3ABLE 3X2QE 2EIKE 3AG2E 2EILE 1OCZE 1OCRE 1OCCE 1V54E 2ZXWE 5IY5E 3AG1E 1OCOE 5B1AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYS E;  1V55 E;  3ASO E;  5B1B E;  3ABM E;  2OCC E;  3AG4 E;  2Y69 E;  3AG3 E;  3ABK E;  2EIM E;  2EIJ E;  3WG7 E;  2EIN E;  3ASN E;  2DYR E;  5B3S E;  3ABL E;  3X2Q E;  2EIK E;  3AG2 E;  2EIL E;  1OCZ E;  1OCR E;  1OCC E;  1V54 E;  2ZXW E;  5IY5 E;  3AG1 E;  1OCO E;  5B1A E; 
#chains in the Genus database with same CATH topology
 1A17 A;  2L6J A;  3MV2 B;  1HG5 A;  2WQ6 A;  5KJK A;  1SZ9 A;  4F1P A;  2VSX E;  5FZQ A;  2ZGG A;  2P9N G;  3B7T A;  2WXO A;  4ANX A;  4ILH B;  4GA1 A;  3DPD A;  2CG3 A;  2FO7 A;  3NBN B;  5AAO A;  3CHO A;  3CV0 A;  3Q4A B;  3LJ3 A;  3R9A B;  1D8E A;  5CBN A;  3CVN A;  3QAQ A;  3KSQ A;  3S7B A;  5ARF A;  3IBE A;  5AQ9 A;  4FHJ A;  1N4S A;  2VQ2 A;  2XS8 A;  4I6G A;  3Q7A A;  3RSE G;  4E6H A;  4GB9 A;  3ASF A;  2AJA A;  1X5B A;  1DCQ A;  2RFA A;  4BWR A;  3APD A;  4TV3 A;  1H0A A;  4GTR A;  2YHE A;  3LXU X;  2E0I A;  2F37 A;  5DIZ A;  4JHK A;  4GCO A;  4DLO A;  1PAQ A;  4J0U A;  2WMN A;  4B89 A;  4CT4 A;  4DX1 A;  3FTX A;  4F7A A;  2VYI A;  3IEG A;  4N39 A;  2PL2 A;  3N71 A;  4ANW A;  4FUL A;  2KZT B;  4G1T A;  3U64 A;  2RKK A;  3EU5 A;  1NA0 A;  4WAF A;  4PUC A;  4L2L A;  1HH8 A;  1N95 A;  3J5Q B;  3SZ7 A;  2P58 C;  2P9K G;  3URZ A;  1FPP A;  3QK0 A;  5E76 A;  5EYL A;  2GRR B;  3FTV A;  1K8K G;  4G23 A;  5FJY A;  2X6I A;  4TRQ A;  3DEO A;  3LCA A;  2WXG A;  3CSF A;  5FQ7 A;  1NP7 A;  4O60 A;  2Y0B G;  5KNH D;  3QJZ A;  3PZ4 A;  2EIK E;  4AOF A;  5BV1 A;  3PRE A;  5CEC B;  2CFU A;  3IHY A;  4WNF A;  4GZ5 A;  2AXZ A;  2P2C P;  3FUH A;  1HZ4 A;  3UPV A;  2LAH A;  2WXI A;  3FUM A;  4A55 A;  4Z68 A;  2XPI A;  2WXP A;  4KZC A;  4YDE A;  1N54 A;  1QBQ A;  2YHC A;  3FTZ A;  2R02 A;  3G2S A;  1NI1 A;  2RFM A;  3IHV A;  4HOT A;  4G8K A;  5FZS A;  3ZW3 A;  3X2Q E;  2UWJ G;  1HX8 A;  1JCR A;  3PEV B;  5H7P A;  2MOW A;  1EPU A;  4TUU A;  4APF A;  4CCA A;  1B89 A;  5HQ8 A;  3T8K A;  2B6C A;  1UG3 A;  3SHF A;  4DJA A;  4CRW A;  1Z3Y A;  5EYP F;  1HXI A;  1OWN A;  2J9Q A;  3LY7 A;  2A5E A;  2MHK A;  4GTS A;  2PM6 A;  4EHM A;  3TWU A;  3KD7 A;  3LPZ A;  4O6F A;  1EF1 C;  3K9I A;  3SNX A;  1ELK A;  4EEC A;  2FI7 A;  1AWC B;  2XRY A;  5D2M C;  2P9S G;  3FEX A;  1S70 B;  3ASN E;  5AAR A;  3FFL A;  3CKC A;  3HYM B;  1JUQ A;  1TNZ A;  3DSU A;  3MX3 A;  1H19 A;  4KVO A;  3MCX A;  2LNI A;  1QNF A;  4AY5 A;  4DUI A;  2QC9 A;  2VGE A;  3S7J A;  2LAI A;  4H7X A;  3PZ3 A;  5FQ6 A;  5JHA A;  2GW1 A;  5JJT A;  5AEN A;  3AS4 A;  3OXL A;  4JB8 P;  3LDZ A;  2LXM A;  1WAO 1;  3LY9 A;  4L1B A;  4YDO A;  2I2O A;  3V2X A;  1E7U A;  2BF0 X;  3JQ0 A;  3DXM G;  3S7F A;  2XCB A;  4ACL A;  1NZN A;  2QZA A;  5M72 A;  2XEN A;  3L6A A;  5DBK A;  3FH7 A;  3QAR A;  1TNO A;  2VGY A;  2J09 A;  2VSO E;  4CDM A;  1SA4 A;  4QFV A;  5A23 A;  3C72 A;  2L6B A;  4QQI A;  4CGW A;  3JQ1 A;  4GTT A;  1GW6 A;  4UQY A;  1V54 E;  2BUG A;  4RQI A;  4J8F A;  4M3O A;  1TR4 A;  4UUC A;  3TWX A;  2JLB A;  3D9N A;  1HF8 A;  4KYO B;  1Q2Z A;  3B95 A;  2AWI A;  4F6R D;  4JVS A;  1RZ4 A;  3AU4 A;  4FLB A;  4FJY A;  4FAD A;  4HLL A;  4UI9 K;  4ACK A;  1OCC E;  5ANL A;  2XGM A;  3ULQ A;  3UM1 A;  3NQP A;  5ENN A;  4EPZ A;  2R03 A;  1OXJ A;  4K0R A;  3DBS A;  2Y69 E;  5EN5 D;  4OVU A;  1SQM A;  2VTB B;  1N94 A;  2KCV A;  3PS6 A;  4WWN A;  4WWO A;  1UN9 A;  3RRN B;  3D9J A;  4BER A;  4EZK A;  3CHM A;  5CHE E;  4ZHB A;  4LCT A;  3J5P A;  1G3N B;  3KSL A;  4ME2 A;  3SY2 A;  1ELW A;  4RG6 A;  2ETA A;  3MKQ B;  3DPY A;  3FU3 A;  1HFA A;  1TJC A;  3FUJ A;  5ENT D;  3ISM C;  1KT1 A;  1U2V G;  3ZIM A;  1TNB A;  4RVB A;  5BUZ A;  3ZEF A;  4A1G A;  1EYH A;  3CQC B;  2XPY A;  4KT6 B;  3JXI A;  3IKO B;  3CVL A;  2X6H A;  4NAC A;  2XGS A;  4W9R A;  3LYA A;  3VTX A;  3NOG D;  4TXQ A;  2GRQ B;  4HQD A;  3LVQ E;  4HBD A;  3TL5 A;  2ETC A;  4RG9 A;  1Z5S C;  4LNU D;  5FQ8 A;  1E90 A;  3D3M A;  2KAT A;  2OV8 A;  2H6F A;  2DIW A;  4O1P A;  4A3T A;  3RAU A;  3DSW A;  3LY8 A;  2AVP A;  2NXP A;  2C2L A;  4HS2 A;  2GRM A;  4K03 A;  5ITZ F;  4G24 A;  2IF4 A;  1DNP A;  4CEM A;  1H2U A;  5KJN A;  4U04 A;  4AJW A;  2VJ8 A;  1DC2 A;  1MQS A;  4XI9 A;  4K5A B;  3L22 A;  1OWO A;  4HRL A;  2WVI A;  5BT1 A;  4CDN A;  4HRM B;  4J8Y A;  3FU5 A;  1JWG A;  2H6G A;  4AXH A;  1H2V C;  2XQ0 A;  2MYO A;  4GZ3 A;  1P5Q A;  3MGB A;  3Q9N C;  3EJN A;  3ZHE B;  2H6H A;  3JCK C;  3NB2 A;  3UM3 A;  1QZ2 A;  2RG8 A;  5LFA A;  1HU3 A;  4PH4 B;  4G2V A;  4L9P A;  3CHP A;  4U8V D;  3FUL A;  3HXF A;  3SBS A;  2J07 A;  1ZBP A;  5G04 C;  3EU9 A;  4K5C A;  5BXO A;  3C3O A;  2WXK A;  5CCM A;  4JPS A;  5T4Y A;  3G2U A;  3HG0 D;  5FIN A;  5CMY A;  1YCS B;  3CIA A;  3VLD A;  2L0I A;  3RRU A;  2IOL A;  2DCP A;  1IKN D;  4BX9 A;  5AQA A;  3B13 A;  5AQ7 A;  5BW8 C;  5AN8 A;  3JYS A;  3TG5 A;  3D9I A;  2OEV A;  2CG2 A;  3FTW A;  2HYZ A;  2LUH A;  4KMO A;  4N3A A;  3UQ3 A;  3PUK A;  4GZ6 A;  4L2Y A;  4U95 D;  3E34 A;  2VSN A;  3D9K A;  3TWV A;  4U07 A;  1MZC A;  3R9M A;  3ASO E;  1E7V A;  4N5Q A;  1U3D A;  2GRP B;  5C2Y A;  2XS1 A;  4J8S A;  3HIZ A;  3MJW A;  1PY1 A;  5T8I A;  4GMJ A;  3FY4 A;  5AJD A;  1MYO A;  1H6O A;  2OVB A;  3ASG A;  4D10 C;  1UOH A;  1E8Z A;  5EX0 A;  1WM5 A;  1N0R A;  2VGX B;  1K3Z D;  5FWQ A;  5B3S E;  4I1O B;  1OUV A;  3EHN A;  4GYY A;  3L08 A;  3I3N A;  3CHQ A;  3UT4 A;  4HI8 A;  3SFZ A;  2HO1 A;  2I1J A;  3GZ1 A;  3PUJ A;  2XEV A;  2FUL A;  3LS8 A;  2L0T B;  3PE3 A;  4BT8 A;  1N0Q A;  3E32 A;  3AU5 A;  2XCC A;  3RU0 A;  1H6K A;  4U7E B;  2BKG A;  1FT1 A;  3F6Q A;  4C0M A;  1MHQ A;  3AG1 E;  4G25 A;  3HXC A;  3FTS A;  4HOS A;  4HOR A;  3FEY A;  4AVX A;  4WNE A;  4FA6 A;  3G2V A;  3CLJ A;  2E2E A;  1NFI E;  2WXL A;  3FP3 A;  5G55 A;  3Q47 B;  3KEA A;  3OTN A;  4UQX A;  4Y6W A;  3DSX A;  3AAA C;  3HXE A;  3UI2 A;  3CHR A;  3DSS A;  1N4R A;  3EHM A;  3L13 A;  5AJL A;  3DXK G;  4TUM A;  4BY6 A;  3FWV A;  4DI3 A;  3EHQ A;  3E33 A;  2IOS A;  4JL0 A;  3CVU A;  1JPL A;  4GZC A;  5ANR A;  4TXR A;  3SFX A;  1TYQ G;  3ASD A;  3R7R A;  2GRN B;  2DBA A;  3D9O A;  4F53 A;  1IHB A;  2NYJ A;  1JCS A;  2LXL A;  3IV0 A;  4YDY A;  4I9E A;  3HVE A;  4GTO A;  1S0P A;  1UJK A;  3CVP A;  4JA7 A;  2V5Q C;  4TXP A;  4BET A;  3NAW A;  3MV3 B;  1OCR E;  2IU1 A;  4PS7 A;  4UWH A;  3S2A A;  1E8W A;  1YYH A;  4OAV B;  4YDW A;  3MEK A;  3APF A;  4GA2 A;  4G11 A;  2BKK B;  2DVW A;  2YIN A;  3KAE A;  3CST A;  3FUN A;  4BES A;  3TWR A;  2IFU A;  1H6P A;  4EBA A;  2Y4T A;  5BV0 A;  3FUI A;  3FH8 A;  3MYV A;  5EIB E;  3QDN A;  3SF4 A;  5G04 J;  4GML A;  4CT0 A;  1YA0 A;  2I1K A;  4LUN U;  2WXQ A;  2UY1 A;  4UI9 C;  4GYO A;  3AJI A;  3ZVV A;  3TWS A;  5LX8 A;  1TNU A;  4PS3 A;  1W3B A;  2GRO B;  4G26 A;  2HM8 A;  4XX5 A;  3IXE A;  3QOU A;  2KC7 A;  3JXJ A;  4NIK A;  3QC1 A;  1NA3 A;  2WPV A;  3ZRH A;  4JEH A;  3E37 A;  3FTU A;  4FJZ A;  3B7U X;  3C3Q A;  4N2S A;  1Z6T A;  4U96 D;  2P9P G;  2IQC A;  2EIM E;  3FU0 A;  3JUE A;  4BFR A;  3EDT B;  3DEP A;  3FUE A;  4F3V A;  4I17 A;  5CCL A;  3MKR A;  4AM9 A;  5ENO D;  4Q94 A;  4YVO A;  4MBG A;  4UWF A;  4J8D A;  3RJV A;  4I1M A;  4NQ0 A;  1QYM A;  1JCQ A;  4AY6 A;  2OEW A;  4HNA D;  2R05 A;  3NZU A;  1JWF A;  4HLE A;  5LCW C;  3ESK A;  3CGH A;  3QKY A;  2A4Z A;  3PZD A;  5CRV A;  1E8Y A;  5FIO A;  4IN3 B;  2KZT A;  2ZIS A;  3Q5M A;  1TN6 A;  3OXG A;  3UKU G;  1OCO E;  3SD5 A;  2F8Y A;  4X8Q A;  4HXI A;  1IYG A;  1OY3 D;  4BSX A;  4BTA A;  1SZA A;  3EUV A;  3ULE G;  1MJ0 A;  4KZ0 A;  1VDY A;  1N9A A;  4UWK A;  2DZN A;  3Q7F A;  4ATG A;  3PZ2 A;  2I9C A;  1D8D A;  3DWL G;  2HR2 A;  3CK8 A;  5EKQ D;  1HO8 A;  2PQN A;  2FF4 A;  4GTM A;  3ZFW A;  1LF8 A;  3JUI A;  4A1S A;  5D0Q D;  4JA9 A;  2CFZ A;  3D9M A;  2EIL E;  4Q96 A;  3BG1 B;  3TWW A;  4U8Y D;  3ESL A;  4A3V A;  3U66 A;  2JAB A;  3TJP A;  4PS8 A;  4WWP A;  4L7T A;  4JHJ A;  5BPP A;  4AP2 A;  1LD8 A;  4ABN A;  5JHB A;  4ILI A;  3L9T A;  2HE0 A;  3KS2 A;  4JXT A;  2V4H C;  3ZGQ A;  1Y6I A;  2WXF A;  4ATZ D;  4U63 A;  3CVX A;  4B0Z A;  4OYS A;  3PRZ A;  1TNY A;  3MZL B;  2F0Y A;  5EDS A;  3B7S A;  4NUR A;  3GZ2 A;  4AIF A;  1TN7 A;  4ZFH A;  1XGW A;  4APO A;  4WND A;  5J90 A;  3QNK A;  1INZ A;  3DSV A;  2PZI A;  3AG2 E;  4XKB A;  5CMW A;  4KVM A;  4LG6 A;  3CEQ A;  4EZJ A;  1WY6 A;  2OCC E;  4GA0 A;  3PVL A;  3U3W A;  3V2O A;  5G05 C;  4B8A A;  4Y6C A;  2KCL A;  1N11 A;  3I4R B;  4J6I A;  1BI7 B;  1U3C A;  4ANV A;  1L5J A;  4WNG A;  2Y4U A;  3NZS A;  4GPM A;  3HVE B;  1HE8 A;  5ENP D;  4J8E A;  2QY7 A;  3W9G A;  1X81 A;  1K1A A;  3ML9 A;  2ZXW E;  3RIB A;  3Q49 B;  4CZ2 D;  1E96 B;  1BLX B;  1TJF A;  3VLE A;  5A6C A;  3CK7 A;  5HRY A;  4N5C A;  3V79 K;  2IJG X;  1IHG A;  4DX2 A;  3UIP C;  3SQV A;  5KJL A;  4I6J A;  1WDY A;  2XZD G;  1HS6 A;  3I5P A;  2J4B A;  4LNB A;  4FC8 A;  3PNT B;  5FQ4 A;  4LSZ E;  2DWZ A;  3HXD A;  4AEZ C;  3RO3 A;  3GW4 A;  4UI9 J;  3U9W A;  3GZS A;  2NSZ A;  1OWL A;  3Q79 A;  4DI4 A;  3D9P A;  4XIF A;  5JMN D;  3TXM A;  4MS6 A;  2XHE A;  3HDX A;  4LEU A;  2WM9 A;  1YMP A;  3NF1 A;  2X3M A;  3ONK A;  1DCE A;  5CBO A;  5FTP A;  1OWM A;  2Q7F A;  2QFC A;  3C98 A;  3D9L A;  4BT9 A;  3LEW A;  2EQX A;  4ANU A;  5D66 A;  3ZYK A;  2KXP C;  1O1T A;  4EBA G;  1UJJ A;  5HI7 A;  4BTB A;  3BU8 A;  5JA4 D;  3PZ1 A;  4HFG A;  2V0P A;  2XGO A;  2YQ8 A;  4GU5 A;  1Z3X A;  4OVV A;  2B0O E;  3OAW A;  5ENQ D;  3AS8 A;  2ZGD A;  5LCW J;  2NC9 A;  3T9K A;  4WUY A;  5ENS D;  2VTB A;  5HKP A;  2KM4 A;  3UIN C;  3PEU B;  2AXV A;  3V30 A;  1IXV A;  3W9F A;  5C1D A;  1KZO A;  3KEZ A;  4JHR A;  5CER B;  1ELR A;  4DX6 D;  4P29 A;  3BQO A;  4F1S A;  1KT0 A;  3WG7 E;  4JD2 G;  1BD8 A;  2EIN E;  5KNG A;  2L9B A;  4FHK A;  4KXK B;  2V4L A;  4B8C B;  3MKQ A;  3R7Q A;  3FU6 A;  3RRM B;  3TGO A;  5FZR A;  2DYS E;  3UUX A;  5ENR D;  1OT8 A;  3T5V A;  2WXR A;  4PDX A;  2CHZ A;  4CDR A;  2WQ7 A;  2WXN A;  2WXH A;  3Q75 A;  2XEH A;  3AS5 A;  3L54 A;  3ZU7 B;  2MRI A;  3UIO C;  2R2L A;  5JJ7 A;  4I43 A;  1N4P A;  4YVQ C;  3LKU A;  3UKR G;  5BXU A;  3VLF A;  2X6K A;  2X6J A;  4V3I A;  3BUA A;  2OND A;  3APC A;  3UMV A;  4EZL A;  4DRX E;  1A5E A;  3WXX A;  3PH0 C;  1EDU A;  3TG4 A;  2R5S A;  4HRN A;  3UM0 A;  4ILG A;  4BEP A;  2WQH A;  1O5M A;  3BEE A;  3TAX A;  2H6I A;  2FO1 E;  2I6H A;  3ENE A;  3AG4 E;  4I2Z A;  4JEU A;  3LVR E;  4RLY A;  4H7Y A;  5LP0 A;  2PNN A;  1ZB1 A;  4GYW A;  1WG0 A;  4B94 A;  4J7W A;  2ZU6 B;  1Y8M A;  2P9I G;  2XZT G;  3TWT A;  3FDH A;  2YNQ A;  2IY0 C;  3OXF A;  5G05 J;  2VSY A;  3ZXP A;  2ILR A;  1BPO A;  3E4B A;  4U0S A;  2CHW A;  2WXM A;  2M63 A;  2IO2 C;  4M7C A;  1QQE A;  1KPS B;  3UXG A;  3SO8 A;  2AW6 A;  1TN8 A;  3HRA A;  2QYU A;  3L16 A;  1UW4 B;  3ZHE A;  1ZU2 A;  4CYM D;  3CVQ A;  3O48 A;  4G8L A;  2LSU A;  4I2W A;  2A5U A;  2OVF A;  4LER A;  3SGH A;  4IRU A;  5B1A E;  3PDN A;  1V55 E;  5B1B E;  2Y3A A;  3UTM A;  4K5B A;  2AXU A;  2J08 A;  4B93 B;  3BG0 B;  3T8M A;  1O1R A;  2WMO A;  2OOE A;  3O4Z A;  3CK9 A;  2WB2 A;  4GTP A;  4XEI G;  2KBX A;  1N4Q A;  4NRH B;  1MX2 A;  1LD7 A;  3ONL A;  2PM7 A;  1SA5 A;  3LJN A;  3ZXS A;  3AG3 E;  5AYW D;  3FHE A;  2X38 A;  3D9H A;  1S63 A;  4O1O A;  4MRU A;  1XNF A;  3C3R A;  4U8H A;  5KWD A;  4L23 A;  2BTD A;  3G2T A;  2BED A;  4GTQ A;  5BNW A;  3VTY A;  4GZD A;  1FCH A;  4C48 B;  3FTY A;  2ION A;  1O1S A;  3I4G A;  3CVY A;  2IEJ A;  1DVP A;  4N2Q A;  5T3R A;  4Q69 A;  3Q9U C;  3EIJ A;  4I9C A;  1UN8 A;  5JJ6 A;  1D9S A;  2ZIR A;  4FU3 A;  1E8X A;  3TXN A;  4FP7 A;  1K1B A;  4HVB A;  1H2T C;  3RO2 A;  3FH5 A;  2XEE A;  3QWV A;  3ABM E;  4JZY A;  3L17 A;  3FUK A;  4IUL A;  5KBA A;  3FUD A;  3RK6 A;  1IQU A;  1NL4 A;  2R17 C;  1IQR A;  5EID A;  2J4D A;  1OCZ E;  3DST A;  4GPK A;  2VGX A;  2FBN A;  2IO3 C;  3ABK E;  4XI0 A;  3UX4 A;  2F8X K;  3ZYL A;  3DRA A;  2QYJ A;  2XRZ A;  3U4T A;  2GRL A;  1N52 A;  3P2B A;  5LOZ A;  4DK5 A;  4EQF A;  4A63 B;  4JW1 A;  2V5F A;  3L82 A;  4LRZ A;  3QWP A;  2C0M A;  2X6F A;  3QWW A;  2CHX A;  3S7D A;  3T5X A;  3G2W A;  5D0O D;  2V8S E;  2WXJ A;  4HB5 A;  2RD0 A;  3TWQ A;  3GYZ A;  5AIJ A;  1PC2 A;  4HOU A;  3CR3 A;  5IY5 E;  4AV7 A;  4URK A;  1BU9 A;  1KZP A;  3QB2 A;  5KJM A;  2EIJ E;  3ASH A;  3B7B A;  5FT9 A;  4GTV A;  3P1U A;  5CRU A;  1KLX A;  4KBQ A;  3SBT B;  5ARG A;  3Q73 A;  5G2N A;  4I1A A;  3CQG B;  2LO6 A;  2GGF A;  2FEZ A;  4R7L A;  3CVW A;  3ULY A;  4YND A;  1SVX A;  1SW6 A;  4MLP A;  5CEA A;  4HOQ A;  5EIL A;  1MX4 A;  4LNG A;  4N3B A;  3ZN3 A;  4DX5 D;  1AP7 A;  1BI8 B;  4HI9 A;  5KCM A;  4UWG A;  2Y1L E;  2ETB A;  3ZYM A;  3CKB A;  3ZPJ A;  4GMR A;  2KCK A;  1FVF A;  3NOC D;  1FT2 A;  4C0E A;  3Q78 A;  3ZYQ A;  4I6E A;  1OWP A;  3UT8 A;  4FLH A;  3HXB A;  4XZ4 A;  3B7R L;  3FUF A;  4U0U A;  3ZUV B;  3Q15 A;  1S64 A;  2P9L G;  4IYP A;  4E85 A;  4DPR A;  3ZKJ A;  5CED B;  2JEK A;  4CGV A;  4N3C A;  5AQB A;  3C5R A;  4DLQ A;  3PE4 A;  3V31 A;  4XKC A;  4BX8 A;  3ABL E;  2J49 A;  3SFY A;  3UM2 A;  2LSV A;  2C0L A;  1HG2 A;  4C9B B;  5E75 A;  4RSY A;  4BSZ B;  3MA5 A;  1RW2 A;  3EIQ C;  4MKT A;  4XE0 A;  5A7D B;  3ML8 A;  4DX7 D;  5EX3 A;  3CHS A;  3PNL B;  1MX6 A;  4U0Z A;  3ZNG A;  2R59 A;  2P9U G;  4OAU C;  2PQR A;  2DZO A;  4GCN A;  2XPZ A;  3EHR A;  4JC8 A;  2J8S D;  1FVH A;  2DYR E;  3HHM A;  3E30 A;  4UQZ A;  3RKV A;  5HS0 A;  5J08 A;  1TEZ A;  3CVV A;  1LTX A;  4GAA A;  3UT7 A;  2UY1 B;  3SI5 A;  4UWL A; 
#chains in the Genus database with same CATH homology
 2DYS E;  1V55 E;  3ASO E;  5B1B E;  3ABM E;  2OCC E;  3AG4 E;  2Y69 E;  3AG3 E;  3ABK E;  2EIM E;  2EIJ E;  3WG7 E;  2EIN E;  3ASN E;  2DYR E;  5B3S E;  3ABL E;  3X2Q E;  2EIK E;  3AG2 E;  2EIL E;  1OCZ E;  1OCR E;  1OCC E;  1V54 E;  2ZXW E;  5IY5 E;  3AG1 E;  1OCO E;  5B1A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...