2EIME

Zinc ion binding structure of bovine heart cytochrome c oxidase in the fully reduced state
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
105
structure length
105
Chain Sequence
HETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A histidine residue acting as a controlling site for dioxygen reduction and proton pumping by cytochrome c oxidase
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
total genus 42
structure length 105
sequence length 105
chains with identical sequence R
ec nomenclature
pdb deposition date 2007-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 2eimE00
3ABLE 2OCCE 1OCZE 2EIME 3ASOE 5B1BE 2DYRE 2Y69E 3ABME 3ASNE 3X2QE 1V54E 1OCOE 3AG4E 3WG7E 2EIKE 5B3SE 3AG3E 1V55E 2DYSE 2EILE 3AG1E 3ABKE 2EIJE 5IY5E 3AG2E 5B1AE 1OCCE 1OCRE 2EINE 2ZXWE
chains in the Genus database with same CATH superfamily
3FTZA 3MJWA 4UWKA 5FZRA 4DI4A 5AQBA 3ASNE 3Q73A 4RSYA 4FJYA 4HOQA 4I1AA 2FI7A 4M3OA 3TWSA 3AG1E 2XZDG 4YDYA 5EYPF 4U63A 2C2LA 5LCWC 1OWOA 1AWCB 4GYOA 1LF8A 5EIBE 4GTSA 4UQZA 4FA6A 3PE4A 3FP3A 1IXVA 4DJAA 3Q7AA 2H6GA 2XCBA 4O1PA 2DCPA 2MOWA 3VTYA 5KNGA 4YDEA 3ASDA 2XEVA 2MHKA 3PZDA 5B1AE 2R03A 3V2OA 4I6JA 3FH8A 3FEYA 1S63A 2WXQA 3VTXA 3SF4A 4CGVA 1N0RA 3KD7A 2LAHA 3L17A 4IULA 4ATGA 4I1OB 4LNBA 3LY9A 2YHEA 5KNHD 2KZTB 3PUJA 2V5FA 2H6IA 5CECB 1S64A 2ETCA 2PL2A 2LUHA 2XQ0A 1WM5A 3C3QA 4GU5A 2KATA 4CT4A 3I4GA 3L22A 4I2WA 3W9GA 3VLDA 3ZYMA 3UKRG 3BG0B 1QNFA 3ONLA 2CHZA 3DEPA 5AJDA 3ZRHA 1TN8A 3Q15A 4J8SA 4GCNA 4U0ZA 4XIFA 4YVQC 4K03A 4QQIA 4Q94A 2HYZA 3CSTA 3MKRA 4TXRA 4N5CA 5EIDA 4U07A 5G05C 1UOHA 5EDSA 1YMPA 3FUJA 1DC2A 3VLFA 4AJWA 3ZFWA 5BT1A 2RFMA 3AG4E 2Y1LE 3Q78A 4CDNA 4HRLA 2OOEA 2EILE 4OVVA 4MLPA 3Q79A 3Q4AB 3SHFA 1MX4A 4U04A 5EILA 3B7SA 4GZ6A 3D3MA 4B93B 3QKYA 4DRXE 4I6EA 5FT9A 2JEKA 4PH4B 1Z5SC 2KC7A 2WXLA 2AXUA 4B89A 5T4YA 4UUCA 1OWNA 4WWOA 1UN9A 2JLBA 4NRHB 2I9CA 1PY1A 5T3RA 4U7EB 3FTVA 2XENA 3PDNA 3S2AA 4U95D 3TXMA 3JYSA 3PRZA 4PS8A 4BEPA 2I1KA 1K1AA 3ISMC 5CEDB 3DSSA 2NSZA 4UWHA 4E6HA 4UI9C 4Y6CA 4L7TA 2L6BA 2LNIA 2XPIA 4LNGA 2VJ8A 3E32A 2C0LA 3FUMA 3UT4A 4B0ZA 4L2LA 5JMND 4DX5D 5KCMA 3RU0A 1BPOA 5CMYA 1H0AA 2HR2A 2I2OA 2KM4A 4EZLA 1WG0A 3SFXA 5BXUA 2HE0A 4JZYA 2DWZA 3ULYA 5KJMA 3URZA 5D0QD 5G55A 3CQCB 1UJKA 3G2SA 5ARGA 3V2XA 4HORA 4HVBA 2VGYA 2ZGDA 1LTXA 1Z3XA 5ENPD 3GW4A 3EUVA 3DSUA 3HVEA 4WNEA 3SBTB 3SZ7A 3CVQA 1E7VA 5EN5D 2AWIA 4J8FA 3L08A 5D2MC 2P2CP 1H2UA 1QZ2A 1ZU2A 3IV0A 1KLXA 3LEWA 1TNYA 3NQPA 2OEVA 2PM6A 4CDMA 3ZXPA 3CIAA 3ZUVB 4OAUC 4JEUA 3RJVA 5KWDA 2XCCA 2HO1A 1TR4A 4ANWA 3JUIA 3UQ3A 5D66A 3ASGA 3MV2B 1NFIE 1TN7A 4V3IA 4XI0A 1QYMA 2VTBA 4AY5A 3D9MA 1OWMA 4ACLA 2DYRE 5T8IA 3FULA 2IO2C 4P29A 3I4RB 3LVRE 4GTMA 3CVYA 5FTPA 2ETBA 4FHJA 2IY0C 2YQ8A 2LSUA 4F6RD 4JEHA 3FTUA 5FQ7A 3Q9UC 3B7TA 3ML9A 4UI9J 3FFLA 4WNFA 2J4DA 3DPDA 5A6CA 2PQNA 1KZOA 3DSTA 3WXXA 2IOSA 1OCRE 4KZ0A 1O1TA 3IKOB 5KJNA 4TXQA 2B6CA 1PAQA 3EHQA 3EHNA 3PE3A 1UJJA 4BESA 4GMRA 3C3RA 2CFZA 3ML8A 4BT8A 1HF8A 5LFAA 2E2EA 4AVXA 5JJ7A 1JWGA 5KBAA 3ZYKA 4GPKA 3CSFA 3VLEA 1BD8A 2WXJA 1IHGA 3LY7A 3OXLA 4ILHB 4N2SA 2X6JA 3Q9NC 4IYPA 2UWJG 3SFYA 1HFAA 3S7FA 1S70B 4BT9A 4F1PA 3E30A 2AVPA 2C0MA 4AV7A 4LCTA 1BLXB 2P9SG 1OCOE 2XPYA 3MYVA 3I5PA 1KT0A 5AIJA 2FO7A 1E7UA 2VQ2A 3HDXA 2EIJE 4L23A 2P9KG 2X38A 4JA7A 4YDOA 3LCAA 5EKQD 4CT0A 3ULEG 1FVFA 5C1DA 4URKA 1Z3YA 3RIBA 4Z68A 3MA5A 2HM8A 1UW4B 2JABA 3BQOA 2M63A 4GPMA 3TWXA 2EIKE 2CG2A 4UQYA 4WAFA 3JXJA 3PEVB 2LXMA 1QQEA 3FUEA 5HQ8A 3AS4A 4CEMA 1XNFA 1IKND 5C2YA 4AIFA 5CCLA 3ONKA 4GZDA 3CVWA 5G2NA 1OXJA 3ZU7B 1Y8MA 2X6IA 3TGOA 3D9KA 1XGWA 3NB2A 3CGHA 3FUKA 4B8CB 3DRAA 5J08A 2XRZA 2RD0A 1HH8A 1PC2A 3O48A 1TJCA 3FH7A 3ZNGA 3CHMA 1TNBA 3UT7A 3GZ2A 3P1UA 1K1BA 1HG2A 3G2VA 3V30A 2PM7A 2IONA 1HG5A 4FP7A 4HQDA 3RAUA 2QYUA 1AP7A 3CEQA 2CG3A 3QWPA 1SZ9A 3ZPJA 3T5XA 2BTDA 1NA0A 3NZUA 4H7XA 3D9JA 4MRUA 2R5SA 2IO3C 2XZTG 2OV8A 3L13A 2L0TB 1D8DA 1ZBPA 3ZXSA 1IHBA 3SNXA 4GTOA 5D0OD 1E8WA 4AP2A 3CHQA 3CVUA 4HRMB 1S0PA 4PS3A 4XI9A 4ZFHA 4N3CA 4LG6A 5AARA 1N94A 1RW2A 3FUDA 3UUXA 3QWVA 3AG2E 4MKTA 2GRPB 2RFAA 3PZ1A 2R05A 3LKUA 3TWQA 3TAXA 5BPPA 3CK9A 5CEAA 1U3CA 3OAWA 3KSQA 3JXIA 4JC8A 1U2VG 3BUAA 3UM2A 3JCKC 4BETA 1O5MA 4FC8A 3MV3B 5CBNA 3ASOE 4AEZC 2WXRA 3CHPA 3ZYQA 2Y69E 4EECA 2GRLA 2IFUA 3UM3A 4BX9A 3D9PA 2X6FA 3EDTB 3IHYA 4HOTA 5FWQA 4UWGA 4GA0A 4HS2A 5AENA 1JWFA 4KYOB 4OYSA 4JHRA 3ASFA 1EDUA 3CVVA 1H6KA 4GA1A 3LDZA 4RQIA 1D9SA 2AXZA 3B95A 4GTQA 3CVPA 5KJKA 3V79K 3NF1A 5IY5E 4JL0A 2L6JA 5CRUA 4APFA 2F0YA 3CK7A 4G24A 4J8YA 5A7DB 4B8AA 4GYWA 1OWPA 3U4TA 3CV0A 2XHEA 5EYLA 3S7BA 2P9UG 3AU4A 3FTYA 4XX5A 4U8VD 2QYJA 1NL4A 2WXGA 1DCEA 3ENEA 1OWLA 3IXEA 4KVMA 3TL5A 3KEZA 5AQAA 4RG9A 3CVXA 3MKQB 2OEWA 2Y3AA 5FZQA 4BFRA 2KCVA 4ILGA 4WWNA 3UM0A 3KEAA 1OUVA 1OCCE 3DSWA 4I2ZA 1X5BA 3EJNA 4CYMD 3CQGB 4EBAG 4KZCA 5FZSA 3SFZA 2WQ7A 4FULA 3TJPA 3EIJA 3J5PA 2V4LA 2DZNA 3AG3E 1E8XA 3OTNA 5ENRD 2DVWA 2MRIA 1SW6A 2EINE 4AXHA 3FTXA 5FQ6A 3TXNA 3L16A 3GZ1A 5AAOA 2IOLA 4I17A 1NI1A 3R7QA 3HXCA 1QBQA 4DX6D 4LRZA 5ENTD 1TJFA 4MS6A 5AN8A 2R02A 4GTTA 5HRYA 1LD8A 3SY2A 2VSOE 3ZHEA 3LYAA 3RO3A 4XZ4A 1EF1C 1WDYA 1YCSB 1O1RA 2RG8A 3PZ2A 3ZVVA 4LSZE 1HZ4A 3CR3A 4HRNA 4OAVB 2VGXA 4F7AA 2QFCA 5CMWA 2GRNB 2V5QC 5ENOD 4XEIG 4J6IA 2V4HC 2XS8A 3L54A 1FVHA 3D9HA 1MJ0A 1MX6A 3LS8A 1P5QA 5AYWD 1V55E 1JPLA 3MX3A 1K8KG 4EQFA 2OCCE 3IBEA 2B0OE 2KCLA 5G04J 3ABME 4NURA 2GW1A 3TWRA 5FIOA 3D9LA 4YDWA 4E85A 4FHKA 2WXHA 3E33A 4U8HA 4KVOA 4JPSA 4RG6A 3LXUX 2WQ6A 4EZJA 1ELWA 3HXFA 4TRQA 4NQ0A 4N2QA 1LD7A 1JCSA 4C0EA 2GRRB 1Z6TA 2UY1B 4BTBA 2DYSE 3CVLA 4CGWA 4A63B 1SVXA 5CRVA 2NYJA 1FT1A 3JQ1A 1UN8A 5AQ9A 4HBDA 3DWLG 1DNPA 3PZ3A 3W9FA 1DCQA 4GMJA 5LX8A 2XPZA 3DXKG 1BI8B 3DXMG 4GTPA 2BUGA 3BU8A 4UI9K 5E76A 4ILIA 3ESKA 4EZKA 3ESLA 2WMOA 4DUIA 2IF4A 4A1SA 1H2VC 1HU3A 4A1GA 3FTWA 4GA2A 3APDA 2Y4UA 2F8XK 3FU3A 2WQHA 4HLLA 1FCHA 4PUCA 3UM1A 3SQVA 3FU6A 2WB2A 2WXNA 3U66A 3NZSA 2ETAA 3CK8A 4H7YA 4K5BA 3TWUA 4X8QA 5G05J 3V31A 1OT8A 3KS2A 4FJZA 2CHXA 4R7LA 3OXFA 2WXMA 3GZSA 4JHKA 2F37A 3QWWA 5CCMA 5EX0A 2Y4TA 2AJAA 2QY7A 4LNUD 1IYGA 4DLQA 1ELRA 3CHOA 3TG5A 2XEHA 5JJ6A 3CHSA 3ZHEB 4F1SA 5G04C 3UTMA 4QFVA 3DSVA 4GTVA 5M72A 2VTBB 4GAAA 5CERB 1NZNA 5FJYA 2X3MA 3R9MA 2H6FA 2FO1E 3LJNA 2BKGA 3PS6A 1N0QA 1IQUA 4ANVA 5FINA 2XGMA 1BU9A 2IJGX 3LPZA 1Y6IA 3G2TA 5ITZF 2BF0X 2YNQA 3FUIA 3SD5A 3NOGD 5BV1A 4IRUA 2P9IG 2XGOA 1H6OA 3L82A 2E0IA 4KT6B 3UINC 3MCXA 4U96D 2QC9A 3FEXA 4O6FA 2KBXA 2VSYA 5ARFA 2EQXA 3F6QA 2J08A 3FWVA 5JJTA 1JCRA 2DIWA 4N5QA 2J4BA 2WXFA 2V8SE 5BXOA 4RVBA 1N4PA 1H19A 1WAO1 4A3VA 4GZ5A 2WXIA 4O60A 1OY3D 1TN6A 2MYOA 3HRAA 5JA4D 2CFUA 3C98A 3FY4A 1E8ZA 4K0RA 3FUNA 4WNGA 3T9KA 4HLEA 4OVUA 2BEDA 2XS1A 5B1BE 1KPSB 4I43A 4AY6A 5HS0A 2OVFA 3CVNA 4JXTA 4DK5A 4DI3A 2L9BA 2P9NG 4AOFA 1HS6A 4ZHBA 2VSXE 4Q69A 3Q49B 4BERA 1N54A 3L6AA 1W3BA 1NA3A 3Q47B 1X81A 4MBGA 4ANUA 1NP7A 3FU0A 3TWVA 2LSVA 5HI7A 1INZA 4K5CA 4JD2G 2VGXB 1N9AA 1DVPA 3MKQA 3MZLB 2XEEA 2Q7FA 3HYMB 1MX2A 2UY1A 3J5QB 4I9EA 4L9PA 5JHBA 3LY8A 1V54E 1TEZA 1FPPA 4ABNA 2KXPC 2WVIA 3QK0A 1ZB1A 3D9NA 1HX8A 3S7JA 2J9QA 2LO6A 3TWWA 2A4ZA 4XKCA 4U0SA 5DIZA 3SI5A 1BI7B 2WXOA 1UG3A 4G26A 1KT1A 3PREA 4FLBA 3QOUA 3QC1A 2J07A 3UI2A 2J49A 4G23A 5BNWA 3CHRA 2WPVA 3UIPC 1B89A 3RSEG 3KSLA 2DBAA 4GZCA 1E96B 4BWRA 3FHEA 3QAQA 2X6KA 5LP0A 1TYQG 4EHMA 2P9LG 4N3BA 4W9RA 4DPRA 3RRMB 4ANXA 2LAIA 5CBOA 1SA4A 4FU3A 4JVSA 2YHCA 4CZ2D 2YINA 3FH5A 2ZXWE 3E4BA 1SA5A 3K9IA 3Q5MA 1YYHA 4I9CA 4IN3B 4TUUA 4GB9A 3RKVA 3UX4A 3ZEFA 5AQ7A 2L0IA 3RO2A 4GCOA 4DX7D 3I3NA 3B7UX 4UWFA 4WUYA 3QNKA 4NIKA 1FT2A 5BV0A 2H6HA 4HFGA 5DBKA 4K5AB 2WMNA 3PEUB 3ZN3A 2WM9A 3PVLA 1Q2ZA 4YNDA 2ZU6B 2ONDA 3AU5A 4U0UA 4DLOA 5J90A 3C5RA 4TXPA 2I1JA 4EBAA 1HO8A 4O1OA 4F53A 3HG0D 4JA9A 2EIME 4BX8A 3UT8A 4PDXA 2J8SD 4GTRA 3L9TA 2NC9A 4KBQA 5ENSD 5ENNA 3ABKE 3KAEA 4GMLA 1MYOA 2A5EA 3GYZA 2XGSA 3CKCA 4HOSA 5CHEE 1SZAA 3PUKA 4I1MA 2CHWA 4RLYA 4BSZB 5BUZA 4B94A 3PNLB 3APCA 1KZPA 2FBNA 3DBSA 4ATZD 2IU1A 4APOA 5ANRA 4UQXA 2J09A 1WY6A 1N4SA 4JW1A 2FULA 2R17C 4Y6WA 3HXBA 1HXIA 5KJLA 3D9IA 3FU5A 3UPVA 2PNNA 3SBSA 3HIZA 4TUMA 4XE0A 3T8KA 1N4QA 3HHMA 4N3AA 5FQ4A 4UWLA 1A5EA 4TV3A 4HB5A 4A55A 2VGEA 2ZGGA 3EU5A 3P2BA 3QARA 4CRWA 3SO8A 1MHQA 3T8MA 4ACKA 3BG1B 4AM9A 3IHVA 4I6GA 4DX1A 4D10C 3U64A 2GGFA 2VSNA 3G2WA 3FDHA 2GRQB 2ZIRA 2WXPA 3ZYLA 3AAAC 4J7WA 3ZW3A 4LEUA 3FUFA 1E90A 2AXVA 3Q75A 5FQ8A 3RRNB 3N71A 4LUNU 3AS8A 2F8YA 2Y0BG 2I6HA 4BSXA 3C72A 3O4ZA 1G3NB 4PS7A 5ANLA 3B7RL 3EU9A 3Q7FA 1O1SA 3TWTA 4GZ3A 1H2TC 2X6HA 1IQRA 3RRUA 1D8EA 3MEKA 4HI9A 3U9WA 2NXPA 3QB2A 3ZIMA 3G2UA 3NBNB 2ZISA 4C9BB 3B7BA 2PQRA 3AJIA 3FTSA 1GW6A 2QZAA 4WNDA 2GROB 1YA0A 1OCZE 3DEOA 3QDNA 4U8YD 4L2YA 1TNUA 3UMVA 4JHJA 1SQMA 3LJ3A 3ULQA 4C0MA 4DX2A 3EHRA 2P9PG 3DSXA 4FLHA 3R9AB 3OXGA 4JB8P 1TNZA 3FUHA 3JQ0A 3B13A 1A17A 4G8LA 5EX3A 4HNAD 5B3SE 2ILRA 2PZIA 2VYIA 4GYYA 2GRMA 3CLJA 4HI8A 1N95A 3HXDA 4G8KA 4KXKB 2DZOA 2FF4A 3LVQE 3PH0C 3CKBA 3PNTB 3HVEB 4EPZA 3SGHA 3NAWA 3EIQC 5JHAA 4F3VA 1MQSA 3DPYA 4A3TA 1JUQA 5LOZA 3R7RA 1N4RA 3QJZA 2RKKA 4J8DA 2OVBA 4HOUA 4N39A 2XRYA 4CCAA 5ENQD 1N52A 5AJLA 3BEEA 4WWPA 1HE8A 3WG7E 1TNOA 5E75A 2R2LA 1RZ4A 2A5UA 3HXEA 4J0UA 2WXKA 2V0PA 4G1TA 5LCWJ 4L1BA 4J8EA 5A23A 3ZKJA 4M7CA 3UKUG 1L5JA 4BTAA 3S7DA 2KZTA 3X2QE 1U3DA 3UIOC 3E37A 1ELKA 3UXGA 2R59A 4LERA 3PZ4A 3MGBA 1H6PA 1E8YA 5H7PA 4NACA 2IQCA 3RK6A 3U3WA 2KCKA 3JUEA 4FADA 4G25A 3ZGQA 2FEZA 2IEJA 4BY6A 1EPUA 4CDRA 1JCQA 4KMOA 5BW8C 3E34A 5HKPA 2P58C 1K3ZD 2AW6A 4Q96A 3NOCD 1N11A 1MZCA 3ABLE 4G11A 4G2VA 4HXIA 3IEGA 2LXLA 3ASHA 3AS5A 3TG4A 3T5VA 1EYHA 3C3OA 3EHMA 4ME2A 4C48B 2BKKB 3APFA 4XKBA 3D9OA 1VDYA 4YVOA
chains in the Genus database with same CATH topology
3ABLE 2OCCE 1OCZE 2EIME 3ASOE 5B1BE 2DYRE 2Y69E 3ABME 3ASNE 3X2QE 1V54E 1OCOE 3AG4E 3WG7E 2EIKE 5B3SE 3AG3E 1V55E 2DYSE 2EILE 3AG1E 3ABKE 2EIJE 5IY5E 3AG2E 5B1AE 1OCCE 1OCRE 2EINE 2ZXWE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABL E;  2OCC E;  1OCZ E;  2EIM E;  3ASO E;  5B1B E;  2DYR E;  2Y69 E;  3ABM E;  3ASN E;  3X2Q E;  1V54 E;  1OCO E;  3AG4 E;  3WG7 E;  2EIK E;  5B3S E;  3AG3 E;  1V55 E;  2DYS E;  2EIL E;  3AG1 E;  3ABK E;  2EIJ E;  5IY5 E;  3AG2 E;  5B1A E;  1OCC E;  1OCR E;  2EIN E;  2ZXW E; 
#chains in the Genus database with same CATH topology
 3FTZ A;  3MJW A;  4UWK A;  5FZR A;  4DI4 A;  5AQB A;  3ASN E;  3Q73 A;  4RSY A;  4FJY A;  4HOQ A;  4I1A A;  2FI7 A;  4M3O A;  3TWS A;  3AG1 E;  2XZD G;  4YDY A;  5EYP F;  4U63 A;  2C2L A;  5LCW C;  1OWO A;  1AWC B;  4GYO A;  1LF8 A;  5EIB E;  4GTS A;  4UQZ A;  4FA6 A;  3PE4 A;  3FP3 A;  1IXV A;  4DJA A;  3Q7A A;  2H6G A;  2XCB A;  4O1P A;  2DCP A;  2MOW A;  3VTY A;  5KNG A;  4YDE A;  3ASD A;  2XEV A;  2MHK A;  3PZD A;  5B1A E;  2R03 A;  3V2O A;  4I6J A;  3FH8 A;  3FEY A;  1S63 A;  2WXQ A;  3VTX A;  3SF4 A;  4CGV A;  1N0R A;  3KD7 A;  2LAH A;  3L17 A;  4IUL A;  4ATG A;  4I1O B;  4LNB A;  3LY9 A;  2YHE A;  5KNH D;  2KZT B;  3PUJ A;  2V5F A;  2H6I A;  5CEC B;  1S64 A;  2ETC A;  2PL2 A;  2LUH A;  2XQ0 A;  1WM5 A;  3C3Q A;  4GU5 A;  2KAT A;  4CT4 A;  3I4G A;  3L22 A;  4I2W A;  3W9G A;  3VLD A;  3ZYM A;  3UKR G;  3BG0 B;  1QNF A;  3ONL A;  2CHZ A;  3DEP A;  5AJD A;  3ZRH A;  1TN8 A;  3Q15 A;  4J8S A;  4GCN A;  4U0Z A;  4XIF A;  4YVQ C;  4K03 A;  4QQI A;  4Q94 A;  2HYZ A;  3CST A;  3MKR A;  4TXR A;  4N5C A;  5EID A;  4U07 A;  5G05 C;  1UOH A;  5EDS A;  1YMP A;  3FUJ A;  1DC2 A;  3VLF A;  4AJW A;  3ZFW A;  5BT1 A;  2RFM A;  3AG4 E;  2Y1L E;  3Q78 A;  4CDN A;  4HRL A;  2OOE A;  2EIL E;  4OVV A;  4MLP A;  3Q79 A;  3Q4A B;  3SHF A;  1MX4 A;  4U04 A;  5EIL A;  3B7S A;  4GZ6 A;  3D3M A;  4B93 B;  3QKY A;  4DRX E;  4I6E A;  5FT9 A;  2JEK A;  4PH4 B;  1Z5S C;  2KC7 A;  2WXL A;  2AXU A;  4B89 A;  5T4Y A;  4UUC A;  1OWN A;  4WWO A;  1UN9 A;  2JLB A;  4NRH B;  2I9C A;  1PY1 A;  5T3R A;  4U7E B;  3FTV A;  2XEN A;  3PDN A;  3S2A A;  4U95 D;  3TXM A;  3JYS A;  3PRZ A;  4PS8 A;  4BEP A;  2I1K A;  1K1A A;  3ISM C;  5CED B;  3DSS A;  2NSZ A;  4UWH A;  4E6H A;  4UI9 C;  4Y6C A;  4L7T A;  2L6B A;  2LNI A;  2XPI A;  4LNG A;  2VJ8 A;  3E32 A;  2C0L A;  3FUM A;  3UT4 A;  4B0Z A;  4L2L A;  5JMN D;  4DX5 D;  5KCM A;  3RU0 A;  1BPO A;  5CMY A;  1H0A A;  2HR2 A;  2I2O A;  2KM4 A;  4EZL A;  1WG0 A;  3SFX A;  5BXU A;  2HE0 A;  4JZY A;  2DWZ A;  3ULY A;  5KJM A;  3URZ A;  5D0Q D;  5G55 A;  3CQC B;  1UJK A;  3G2S A;  5ARG A;  3V2X A;  4HOR A;  4HVB A;  2VGY A;  2ZGD A;  1LTX A;  1Z3X A;  5ENP D;  3GW4 A;  3EUV A;  3DSU A;  3HVE A;  4WNE A;  3SBT B;  3SZ7 A;  3CVQ A;  1E7V A;  5EN5 D;  2AWI A;  4J8F A;  3L08 A;  5D2M C;  2P2C P;  1H2U A;  1QZ2 A;  1ZU2 A;  3IV0 A;  1KLX A;  3LEW A;  1TNY A;  3NQP A;  2OEV A;  2PM6 A;  4CDM A;  3ZXP A;  3CIA A;  3ZUV B;  4OAU C;  4JEU A;  3RJV A;  5KWD A;  2XCC A;  2HO1 A;  1TR4 A;  4ANW A;  3JUI A;  3UQ3 A;  5D66 A;  3ASG A;  3MV2 B;  1NFI E;  1TN7 A;  4V3I A;  4XI0 A;  1QYM A;  2VTB A;  4AY5 A;  3D9M A;  1OWM A;  4ACL A;  2DYR E;  5T8I A;  3FUL A;  2IO2 C;  4P29 A;  3I4R B;  3LVR E;  4GTM A;  3CVY A;  5FTP A;  2ETB A;  4FHJ A;  2IY0 C;  2YQ8 A;  2LSU A;  4F6R D;  4JEH A;  3FTU A;  5FQ7 A;  3Q9U C;  3B7T A;  3ML9 A;  4UI9 J;  3FFL A;  4WNF A;  2J4D A;  3DPD A;  5A6C A;  2PQN A;  1KZO A;  3DST A;  3WXX A;  2IOS A;  1OCR E;  4KZ0 A;  1O1T A;  3IKO B;  5KJN A;  4TXQ A;  2B6C A;  1PAQ A;  3EHQ A;  3EHN A;  3PE3 A;  1UJJ A;  4BES A;  4GMR A;  3C3R A;  2CFZ A;  3ML8 A;  4BT8 A;  1HF8 A;  5LFA A;  2E2E A;  4AVX A;  5JJ7 A;  1JWG A;  5KBA A;  3ZYK A;  4GPK A;  3CSF A;  3VLE A;  1BD8 A;  2WXJ A;  1IHG A;  3LY7 A;  3OXL A;  4ILH B;  4N2S A;  2X6J A;  3Q9N C;  4IYP A;  2UWJ G;  3SFY A;  1HFA A;  3S7F A;  1S70 B;  4BT9 A;  4F1P A;  3E30 A;  2AVP A;  2C0M A;  4AV7 A;  4LCT A;  1BLX B;  2P9S G;  1OCO E;  2XPY A;  3MYV A;  3I5P A;  1KT0 A;  5AIJ A;  2FO7 A;  1E7U A;  2VQ2 A;  3HDX A;  2EIJ E;  4L23 A;  2P9K G;  2X38 A;  4JA7 A;  4YDO A;  3LCA A;  5EKQ D;  4CT0 A;  3ULE G;  1FVF A;  5C1D A;  4URK A;  1Z3Y A;  3RIB A;  4Z68 A;  3MA5 A;  2HM8 A;  1UW4 B;  2JAB A;  3BQO A;  2M63 A;  4GPM A;  3TWX A;  2EIK E;  2CG2 A;  4UQY A;  4WAF A;  3JXJ A;  3PEV B;  2LXM A;  1QQE A;  3FUE A;  5HQ8 A;  3AS4 A;  4CEM A;  1XNF A;  1IKN D;  5C2Y A;  4AIF A;  5CCL A;  3ONK A;  4GZD A;  3CVW A;  5G2N A;  1OXJ A;  3ZU7 B;  1Y8M A;  2X6I A;  3TGO A;  3D9K A;  1XGW A;  3NB2 A;  3CGH A;  3FUK A;  4B8C B;  3DRA A;  5J08 A;  2XRZ A;  2RD0 A;  1HH8 A;  1PC2 A;  3O48 A;  1TJC A;  3FH7 A;  3ZNG A;  3CHM A;  1TNB A;  3UT7 A;  3GZ2 A;  3P1U A;  1K1B A;  1HG2 A;  3G2V A;  3V30 A;  2PM7 A;  2ION A;  1HG5 A;  4FP7 A;  4HQD A;  3RAU A;  2QYU A;  1AP7 A;  3CEQ A;  2CG3 A;  3QWP A;  1SZ9 A;  3ZPJ A;  3T5X A;  2BTD A;  1NA0 A;  3NZU A;  4H7X A;  3D9J A;  4MRU A;  2R5S A;  2IO3 C;  2XZT G;  2OV8 A;  3L13 A;  2L0T B;  1D8D A;  1ZBP A;  3ZXS A;  1IHB A;  3SNX A;  4GTO A;  5D0O D;  1E8W A;  4AP2 A;  3CHQ A;  3CVU A;  4HRM B;  1S0P A;  4PS3 A;  4XI9 A;  4ZFH A;  4N3C A;  4LG6 A;  5AAR A;  1N94 A;  1RW2 A;  3FUD A;  3UUX A;  3QWV A;  3AG2 E;  4MKT A;  2GRP B;  2RFA A;  3PZ1 A;  2R05 A;  3LKU A;  3TWQ A;  3TAX A;  5BPP A;  3CK9 A;  5CEA A;  1U3C A;  3OAW A;  3KSQ A;  3JXI A;  4JC8 A;  1U2V G;  3BUA A;  3UM2 A;  3JCK C;  4BET A;  1O5M A;  4FC8 A;  3MV3 B;  5CBN A;  3ASO E;  4AEZ C;  2WXR A;  3CHP A;  3ZYQ A;  2Y69 E;  4EEC A;  2GRL A;  2IFU A;  3UM3 A;  4BX9 A;  3D9P A;  2X6F A;  3EDT B;  3IHY A;  4HOT A;  5FWQ A;  4UWG A;  4GA0 A;  4HS2 A;  5AEN A;  1JWF A;  4KYO B;  4OYS A;  4JHR A;  3ASF A;  1EDU A;  3CVV A;  1H6K A;  4GA1 A;  3LDZ A;  4RQI A;  1D9S A;  2AXZ A;  3B95 A;  4GTQ A;  3CVP A;  5KJK A;  3V79 K;  3NF1 A;  5IY5 E;  4JL0 A;  2L6J A;  5CRU A;  4APF A;  2F0Y A;  3CK7 A;  4G24 A;  4J8Y A;  5A7D B;  4B8A A;  4GYW A;  1OWP A;  3U4T A;  3CV0 A;  2XHE A;  5EYL A;  3S7B A;  2P9U G;  3AU4 A;  3FTY A;  4XX5 A;  4U8V D;  2QYJ A;  1NL4 A;  2WXG A;  1DCE A;  3ENE A;  1OWL A;  3IXE A;  4KVM A;  3TL5 A;  3KEZ A;  5AQA A;  4RG9 A;  3CVX A;  3MKQ B;  2OEW A;  2Y3A A;  5FZQ A;  4BFR A;  2KCV A;  4ILG A;  4WWN A;  3UM0 A;  3KEA A;  1OUV A;  1OCC E;  3DSW A;  4I2Z A;  1X5B A;  3EJN A;  4CYM D;  3CQG B;  4EBA G;  4KZC A;  5FZS A;  3SFZ A;  2WQ7 A;  4FUL A;  3TJP A;  3EIJ A;  3J5P A;  2V4L A;  2DZN A;  3AG3 E;  1E8X A;  3OTN A;  5ENR D;  2DVW A;  2MRI A;  1SW6 A;  2EIN E;  4AXH A;  3FTX A;  5FQ6 A;  3TXN A;  3L16 A;  3GZ1 A;  5AAO A;  2IOL A;  4I17 A;  1NI1 A;  3R7Q A;  3HXC A;  1QBQ A;  4DX6 D;  4LRZ A;  5ENT D;  1TJF A;  4MS6 A;  5AN8 A;  2R02 A;  4GTT A;  5HRY A;  1LD8 A;  3SY2 A;  2VSO E;  3ZHE A;  3LYA A;  3RO3 A;  4XZ4 A;  1EF1 C;  1WDY A;  1YCS B;  1O1R A;  2RG8 A;  3PZ2 A;  3ZVV A;  4LSZ E;  1HZ4 A;  3CR3 A;  4HRN A;  4OAV B;  2VGX A;  4F7A A;  2QFC A;  5CMW A;  2GRN B;  2V5Q C;  5ENO D;  4XEI G;  4J6I A;  2V4H C;  2XS8 A;  3L54 A;  1FVH A;  3D9H A;  1MJ0 A;  1MX6 A;  3LS8 A;  1P5Q A;  5AYW D;  1V55 E;  1JPL A;  3MX3 A;  1K8K G;  4EQF A;  2OCC E;  3IBE A;  2B0O E;  2KCL A;  5G04 J;  3ABM E;  4NUR A;  2GW1 A;  3TWR A;  5FIO A;  3D9L A;  4YDW A;  4E85 A;  4FHK A;  2WXH A;  3E33 A;  4U8H A;  4KVO A;  4JPS A;  4RG6 A;  3LXU X;  2WQ6 A;  4EZJ A;  1ELW A;  3HXF A;  4TRQ A;  4NQ0 A;  4N2Q A;  1LD7 A;  1JCS A;  4C0E A;  2GRR B;  1Z6T A;  2UY1 B;  4BTB A;  2DYS E;  3CVL A;  4CGW A;  4A63 B;  1SVX A;  5CRV A;  2NYJ A;  1FT1 A;  3JQ1 A;  1UN8 A;  5AQ9 A;  4HBD A;  3DWL G;  1DNP A;  3PZ3 A;  3W9F A;  1DCQ A;  4GMJ A;  5LX8 A;  2XPZ A;  3DXK G;  1BI8 B;  3DXM G;  4GTP A;  2BUG A;  3BU8 A;  4UI9 K;  5E76 A;  4ILI A;  3ESK A;  4EZK A;  3ESL A;  2WMO A;  4DUI A;  2IF4 A;  4A1S A;  1H2V C;  1HU3 A;  4A1G A;  3FTW A;  4GA2 A;  3APD A;  2Y4U A;  2F8X K;  3FU3 A;  2WQH A;  4HLL A;  1FCH A;  4PUC A;  3UM1 A;  3SQV A;  3FU6 A;  2WB2 A;  2WXN A;  3U66 A;  3NZS A;  2ETA A;  3CK8 A;  4H7Y A;  4K5B A;  3TWU A;  4X8Q A;  5G05 J;  3V31 A;  1OT8 A;  3KS2 A;  4FJZ A;  2CHX A;  4R7L A;  3OXF A;  2WXM A;  3GZS A;  4JHK A;  2F37 A;  3QWW A;  5CCM A;  5EX0 A;  2Y4T A;  2AJA A;  2QY7 A;  4LNU D;  1IYG A;  4DLQ A;  1ELR A;  3CHO A;  3TG5 A;  2XEH A;  5JJ6 A;  3CHS A;  3ZHE B;  4F1S A;  5G04 C;  3UTM A;  4QFV A;  3DSV A;  4GTV A;  5M72 A;  2VTB B;  4GAA A;  5CER B;  1NZN A;  5FJY A;  2X3M A;  3R9M A;  2H6F A;  2FO1 E;  3LJN A;  2BKG A;  3PS6 A;  1N0Q A;  1IQU A;  4ANV A;  5FIN A;  2XGM A;  1BU9 A;  2IJG X;  3LPZ A;  1Y6I A;  3G2T A;  5ITZ F;  2BF0 X;  2YNQ A;  3FUI A;  3SD5 A;  3NOG D;  5BV1 A;  4IRU A;  2P9I G;  2XGO A;  1H6O A;  3L82 A;  2E0I A;  4KT6 B;  3UIN C;  3MCX A;  4U96 D;  2QC9 A;  3FEX A;  4O6F A;  2KBX A;  2VSY A;  5ARF A;  2EQX A;  3F6Q A;  2J08 A;  3FWV A;  5JJT A;  1JCR A;  2DIW A;  4N5Q A;  2J4B A;  2WXF A;  2V8S E;  5BXO A;  4RVB A;  1N4P A;  1H19 A;  1WAO 1;  4A3V A;  4GZ5 A;  2WXI A;  4O60 A;  1OY3 D;  1TN6 A;  2MYO A;  3HRA A;  5JA4 D;  2CFU A;  3C98 A;  3FY4 A;  1E8Z A;  4K0R A;  3FUN A;  4WNG A;  3T9K A;  4HLE A;  4OVU A;  2BED A;  2XS1 A;  5B1B E;  1KPS B;  4I43 A;  4AY6 A;  5HS0 A;  2OVF A;  3CVN A;  4JXT A;  4DK5 A;  4DI3 A;  2L9B A;  2P9N G;  4AOF A;  1HS6 A;  4ZHB A;  2VSX E;  4Q69 A;  3Q49 B;  4BER A;  1N54 A;  3L6A A;  1W3B A;  1NA3 A;  3Q47 B;  1X81 A;  4MBG A;  4ANU A;  1NP7 A;  3FU0 A;  3TWV A;  2LSV A;  5HI7 A;  1INZ A;  4K5C A;  4JD2 G;  2VGX B;  1N9A A;  1DVP A;  3MKQ A;  3MZL B;  2XEE A;  2Q7F A;  3HYM B;  1MX2 A;  2UY1 A;  3J5Q B;  4I9E A;  4L9P A;  5JHB A;  3LY8 A;  1V54 E;  1TEZ A;  1FPP A;  4ABN A;  2KXP C;  2WVI A;  3QK0 A;  1ZB1 A;  3D9N A;  1HX8 A;  3S7J A;  2J9Q A;  2LO6 A;  3TWW A;  2A4Z A;  4XKC A;  4U0S A;  5DIZ A;  3SI5 A;  1BI7 B;  2WXO A;  1UG3 A;  4G26 A;  1KT1 A;  3PRE A;  4FLB A;  3QOU A;  3QC1 A;  2J07 A;  3UI2 A;  2J49 A;  4G23 A;  5BNW A;  3CHR A;  2WPV A;  3UIP C;  1B89 A;  3RSE G;  3KSL A;  2DBA A;  4GZC A;  1E96 B;  4BWR A;  3FHE A;  3QAQ A;  2X6K A;  5LP0 A;  1TYQ G;  4EHM A;  2P9L G;  4N3B A;  4W9R A;  4DPR A;  3RRM B;  4ANX A;  2LAI A;  5CBO A;  1SA4 A;  4FU3 A;  4JVS A;  2YHC A;  4CZ2 D;  2YIN A;  3FH5 A;  2ZXW E;  3E4B A;  1SA5 A;  3K9I A;  3Q5M A;  1YYH A;  4I9C A;  4IN3 B;  4TUU A;  4GB9 A;  3RKV A;  3UX4 A;  3ZEF A;  5AQ7 A;  2L0I A;  3RO2 A;  4GCO A;  4DX7 D;  3I3N A;  3B7U X;  4UWF A;  4WUY A;  3QNK A;  4NIK A;  1FT2 A;  5BV0 A;  2H6H A;  4HFG A;  5DBK A;  4K5A B;  2WMN A;  3PEU B;  3ZN3 A;  2WM9 A;  3PVL A;  1Q2Z A;  4YND A;  2ZU6 B;  2OND A;  3AU5 A;  4U0U A;  4DLO A;  5J90 A;  3C5R A;  4TXP A;  2I1J A;  4EBA A;  1HO8 A;  4O1O A;  4F53 A;  3HG0 D;  4JA9 A;  2EIM E;  4BX8 A;  3UT8 A;  4PDX A;  2J8S D;  4GTR A;  3L9T A;  2NC9 A;  4KBQ A;  5ENS D;  5ENN A;  3ABK E;  3KAE A;  4GML A;  1MYO A;  2A5E A;  3GYZ A;  2XGS A;  3CKC A;  4HOS A;  5CHE E;  1SZA A;  3PUK A;  4I1M A;  2CHW A;  4RLY A;  4BSZ B;  5BUZ A;  4B94 A;  3PNL B;  3APC A;  1KZP A;  2FBN A;  3DBS A;  4ATZ D;  2IU1 A;  4APO A;  5ANR A;  4UQX A;  2J09 A;  1WY6 A;  1N4S A;  4JW1 A;  2FUL A;  2R17 C;  4Y6W A;  3HXB A;  1HXI A;  5KJL A;  3D9I A;  3FU5 A;  3UPV A;  2PNN A;  3SBS A;  3HIZ A;  4TUM A;  4XE0 A;  3T8K A;  1N4Q A;  3HHM A;  4N3A A;  5FQ4 A;  4UWL A;  1A5E A;  4TV3 A;  4HB5 A;  4A55 A;  2VGE A;  2ZGG A;  3EU5 A;  3P2B A;  3QAR A;  4CRW A;  3SO8 A;  1MHQ A;  3T8M A;  4ACK A;  3BG1 B;  4AM9 A;  3IHV A;  4I6G A;  4DX1 A;  4D10 C;  3U64 A;  2GGF A;  2VSN A;  3G2W A;  3FDH A;  2GRQ B;  2ZIR A;  2WXP A;  3ZYL A;  3AAA C;  4J7W A;  3ZW3 A;  4LEU A;  3FUF A;  1E90 A;  2AXV A;  3Q75 A;  5FQ8 A;  3RRN B;  3N71 A;  4LUN U;  3AS8 A;  2F8Y A;  2Y0B G;  2I6H A;  4BSX A;  3C72 A;  3O4Z A;  1G3N B;  4PS7 A;  5ANL A;  3B7R L;  3EU9 A;  3Q7F A;  1O1S A;  3TWT A;  4GZ3 A;  1H2T C;  2X6H A;  1IQR A;  3RRU A;  1D8E A;  3MEK A;  4HI9 A;  3U9W A;  2NXP A;  3QB2 A;  3ZIM A;  3G2U A;  3NBN B;  2ZIS A;  4C9B B;  3B7B A;  2PQR A;  3AJI A;  3FTS A;  1GW6 A;  2QZA A;  4WND A;  2GRO B;  1YA0 A;  1OCZ E;  3DEO A;  3QDN A;  4U8Y D;  4L2Y A;  1TNU A;  3UMV A;  4JHJ A;  1SQM A;  3LJ3 A;  3ULQ A;  4C0M A;  4DX2 A;  3EHR A;  2P9P G;  3DSX A;  4FLH A;  3R9A B;  3OXG A;  4JB8 P;  1TNZ A;  3FUH A;  3JQ0 A;  3B13 A;  1A17 A;  4G8L A;  5EX3 A;  4HNA D;  5B3S E;  2ILR A;  2PZI A;  2VYI A;  4GYY A;  2GRM A;  3CLJ A;  4HI8 A;  1N95 A;  3HXD A;  4G8K A;  4KXK B;  2DZO A;  2FF4 A;  3LVQ E;  3PH0 C;  3CKB A;  3PNT B;  3HVE B;  4EPZ A;  3SGH A;  3NAW A;  3EIQ C;  5JHA A;  4F3V A;  1MQS A;  3DPY A;  4A3T A;  1JUQ A;  5LOZ A;  3R7R A;  1N4R A;  3QJZ A;  2RKK A;  4J8D A;  2OVB A;  4HOU A;  4N39 A;  2XRY A;  4CCA A;  5ENQ D;  1N52 A;  5AJL A;  3BEE A;  4WWP A;  1HE8 A;  3WG7 E;  1TNO A;  5E75 A;  2R2L A;  1RZ4 A;  2A5U A;  3HXE A;  4J0U A;  2WXK A;  2V0P A;  4G1T A;  5LCW J;  4L1B A;  4J8E A;  5A23 A;  3ZKJ A;  4M7C A;  3UKU G;  1L5J A;  4BTA A;  3S7D A;  2KZT A;  3X2Q E;  1U3D A;  3UIO C;  3E37 A;  1ELK A;  3UXG A;  2R59 A;  4LER A;  3PZ4 A;  3MGB A;  1H6P A;  1E8Y A;  5H7P A;  4NAC A;  2IQC A;  3RK6 A;  3U3W A;  2KCK A;  3JUE A;  4FAD A;  4G25 A;  3ZGQ A;  2FEZ A;  2IEJ A;  4BY6 A;  1EPU A;  4CDR A;  1JCQ A;  4KMO A;  5BW8 C;  3E34 A;  5HKP A;  2P58 C;  1K3Z D;  2AW6 A;  4Q96 A;  3NOC D;  1N11 A;  1MZC A;  3ABL E;  4G11 A;  4G2V A;  4HXI A;  3IEG A;  2LXL A;  3ASH A;  3AS5 A;  3TG4 A;  3T5V A;  1EYH A;  3C3O A;  3EHM A;  4ME2 A;  4C48 B;  2BKK B;  3APF A;  4XKB A;  3D9O A;  1VDY A;  4YVO A; 
#chains in the Genus database with same CATH homology
 3ABL E;  2OCC E;  1OCZ E;  2EIM E;  3ASO E;  5B1B E;  2DYR E;  2Y69 E;  3ABM E;  3ASN E;  3X2Q E;  1V54 E;  1OCO E;  3AG4 E;  3WG7 E;  2EIK E;  5B3S E;  3AG3 E;  1V55 E;  2DYS E;  2EIL E;  3AG1 E;  3ABK E;  2EIJ E;  5IY5 E;  3AG2 E;  5B1A E;  1OCC E;  1OCR E;  2EIN E;  2ZXW E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...