4U8HA

Crystal structure of mammalian period-cryptochrome complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
490
structure length
490
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
publication title Molecular assembly of the period-cryptochrome circadian transcriptional repressor complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein/transcription
total genus 146
structure length 490
sequence length 490
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4u8hA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u8hA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4u8hA01
2YY5A 3IVXA 4L2IA 3DPIA 2QJOA 4MVXA 4PBRA 1N2HA 2C5SA 3AKZA 3ZJTA 1QU2A 2QJFA 3ISJA 1DNPA 1XNJA 4XFDA 1OD6A 2X0KA 1J20A 1PFWA 4GRIA 2EJCA 3SEZA 3IDFA 1O96B 2V0GA 1TFUA 4GU5A 4ZT3A 1JHDA 1K92A 3IOEA 1YULA 2B7LA 2J4DA 3KT3A 2A86A 4AS1A 2A7XA 1NI5A 4ZCTA 1N77A 3FNRA 4ZT2A 3BL5A 4DDKA 1F7UA 3RHSA 4A91A 3OP1A 5DB4A 2H29A 1JEDA 1H3NA 1YUNA 4X0EA 3KT8A 3S3TA 2A84A 4XFJA 3P0HA 2DETA 1X6VA 3FY4A 2OV4A 1FFYA 1YI8A 2A1UA 3H9BA 3INNA 3ZJVA 3ZGZA 3UMVA 2A4MA 1O5TA 4NDAA 5JBNA 4BWVA 1U0BB 3Q12A 1M8KA 4CDMA 1O94C 1NYLA 1IH8A 3FIUA 3KFLA 4PBTA 3H99A 1KAQA 5KHAA 3QTBA 4MUIA 1N1DA 4MVCA 4I6JA 2PZ8A 1T6XA 1MB9A 2CYBA 4Q16A 2BYTA 1QRTA 3FDXA 1IRXA 2RD2A 4XSVA 4OUDB 4DDMA 3CLUC 1OWOA 4HPWA 1S4MA 2DXIA 4MW5A 1JIIA 1MOPA 3VU8A 1NUUA 1N2JA 3LOQA 1XNGA 1MB2A 1WXIA 1U3CA 3F3MA 4MW2A 5FO1A 1N2GA 3RK1A 1YIDA 3MUEA 4EF6A 1G8HA 1XJQA 3FH0A 2J07A 4CDNA 1QQTA 4ZT5A 1EFVB 4ARCA 3SZGA 3CLSC 1FYDA 3IMEA 2ZUEA 2CSXA 3COWA 3IVGA 3HZRA 2DERA 4PY2A 1O94D 4ZT7A 3RJZA 1GPMA 1H3EA 3A05A 1J1UA 1IVSA 1TEZA 3NBKA 4KKVA 4JZYA 1N75A 1O0BA 3FI0A 4CT0A 1NUPA 3X1JA 2E21A 1NUSA 3ND7A 4ZCRA 4I6EA 4R2LA 1G59A 3VGJA 3CLUD 1H3FA 4H3SA 2NSYA 2J09A 1PG2A 2EL7A 4J75A 1KQPA 4MUJA 3AIIA 2XRYA 1NSYA 4EG1A 4YBRA 3PNBA 4MW7A 1F7VA 5LM3A 3GLVA 5K0TA 2E89A 1MAUA 4MUEA 1ZH0A 3HGMA 1COZA 2AG6A 1O95D 3CLTC 4MQ6A 3GMIA 1WOYA 3IMCA 5FO0A 4FZJA 3A04A 1PFYA 2IELA 3NV7A 3K32A 1OWLA 1XNHA 1LW7A 1NURA 4UZEA 1V8FA 1VBMA 5DK4A 3MXTA 2WSIA 3MMXA 3RFFA 3H9CA 2VTBB 2GKSA 3P0IA 3N2YA 4YMIA 4NZPA 3P0JA 4MUFA 2Z09A 3HL4A 1KH2A 3ZXSA 3ELBA 1QRUA 2D54A 1HYBA 1M8GA 1O0CA 3SEQA 3COYA 3IMGA 3N05A 1M83A 3IOBA 4P2BA 5DEOA 4MLPA 1N2EA 3L92A 1NP7A 1IQ0A 1U7XA 3COZA 2CV1A 3CLTD 4WSOA 2PZBA 5J59A 4MUNA 1M1ZA 4DDHA 3KT0A 1O6BA 2RE8A 1NUQA 4HK4A 4JFAA 1QU3A 2CV0A 1R6TA 3ZIUA 1MJHA 3IUEA 1I6KA 3LCJA 4MUKA 1N2OA 1R6UA 5IHXA 3A2KA 1T6YA 3X1MA 2BTEA 4MWDA 2E0IA 3IOCA 4MW9A 4EG6A 3GUZA 3AL0C 3TQIA 1OWPA 2QUKA 5TGTA 2Z08A 1Q77A 2VTBA 3UC5A 3TZEA 5HUHA 2X3FA 1O97C 2A1TS 4Q93A 1N78A 4EFKA 1EUYA 1R6XA 1K4KA 2DR2A 3IVCA 2IP1A 1V47A 4EGAA 1NZJA 1PFVA 3A4IA 3CVXA 2YWBA 1J1ZA 3ZJUA 1CT9A 1O96A 1I6LA 2ZUFA 1U7DA 2DPLA 3SDBA 2PXHA 4KPUB 2JANA 1EFPB 3MLAA 1X8XA 4J76A 1GAXA 3FWKA 3UY4A 1GTSA 1OBHA 4G6ZA 4JYZA 5K0SA 1U3DA 2JAXA 1Q11A 2E18A 1GN8A 1GZUA 4S1OA 1I6MA 3L93A 5BNZA 1ZUNA 4AQ7A 2AZXA 4KR7A 5FNZA 1IQUA 4DLPA 1UFVA 1VBKA 2X1LA 1M8PA 3D6VA 3PXUA 1IHOA 1KKUA 4UZFA 1TYBE 1N2IA 3TQOA 1ZH6A 3ILVA 1WKBA 4JXZA 4MWCA 2CFOA 1TYDE 4DJAA 2QTNA 3P52A 2NZ2A 1WY5A 1ULHA 3CA8A 4U7JA 1LI5A 1TQ8A 1KQOA 4R0NA 4EG5A 3AFHA 3CVVA 2GOYA 1WQ4A 5EKDA 3IH5A 4OUDA 4NAHA 4U63A 1VLHA 4EG4A 2QTRA 3RBAA 3LE8A 2QUHA 1YIAA 5TS2A 3HMQA 4MW6A 2CT8A 1G8FA 4ZT6A 1EFPA 5J58A 2PZAA 3HV0A 3CLSD 3H97A 1QTQA 4RPIA 2D5BA 3E27A 1JIJA 1PFUA 3H05A 2PG3A 3ZUGA 2R5WA 1H1TA 1KP2A 4ZCQA 1KR2A 4MUGA 4F3RA 5H7XA 2DEUA 1EFVA 4MWEA 2DUMA 3HFJA 4RUKA 4QBTA 4R2MA 2CV2A 1KQNA 3PRHA 3C8ZA 1WZ2A 2O8VA 4QRDA 2A1UB 4F4HA 1RQGA 1JEEA 5H16A 4U8HA 5KCMA 1NUTA 1P7PA 1J21A 1JZSA 5F23A 1JECA 1T9GR 3QE4A 3CVYA 1Q15A 2QJTA 2ZP1A 3UK2A 2XRZA 2WQ6A 1KP3A 5IJXA 3CVUA 4E1AA 4YP6A 2J5BA 1OWMA 1KORA 2G36A 2H2AA 1T9GS 1Q19A 1EE1A 1IFXA 1MRZA 1B6TA 3VRHA 1EXDA 4MVWA 1K4MA 1K97A 1N2BA 2CUZA 4ZCSA 5KWVA 4EG7A 3DO8A 1IQRA 4TS1A 2A1TR 3FOCA 2QUIA 2J08A 1WXEA 2X1MA 1PG0A 5J5AA 4HJXA 1KAMA 1MAWA 2JA2A 4ARIA 2D13A 1QNFA 3IODA 1WJGA 2QUJA 3G6KA 1G8GA 1J70A 3Q10A 1N3LA 4NX2A 1TYCA 1F9AA 3N8HA 1ILEA 1SURA 1GTRA 1JILA 3TZLA 4WNYA 2WB2A 4DNXA 3JXEA 5AHWA 3CLRC 1M8JA 4ND7A 2HZ7A 3AG5A 2YXNA 4EG3A 4I6GA 1KH1A 2CYCA 1M8FA 1MC1A 4HJRA 1JGTA 2VXOA 4MULA 3CR8A 3ND6A 2AKEA 1WXHA 1EUQA 2YWCA 1QJCA 1Y42X 2V0CA 5LFAA 1WXGA 5HUJA 4CQNA 4MUHA 5HG0A 1JZQA 3UOWA 3K9WA 3KT6A 4DE5A 3COVA 1O97D 3PNYA 3PNVA 4QREA 3NBAA 3SP1A 4MWBA 3FETA 4MAFA 1TYAE 1JIKA 1J09A 1GLNA 4K03A 3DV2A 3Q4GA 4JXXA 4L2IB 1D2RA 3U1VA 1QRSA 1O95C 2WQ7A 3SZ3A 2HGZA 2OQ2A 3ND5A 2A88A 4ZCPA 3CLRD 3ZXIA 4K0RA 3QTTA 3TS1A 1OWNA 1OBCA 2CYAA 2PFSA 4KR9A 1A8HA 4EG8A 4OJMX 3TNJA 4MVYA 3G59A 3D6UA 3I05A 2IJGX 4NATA 3G5AA 4PBSA 3FG9A 4KR6A 3OTWA 4KPUA 4MW1A 2HMAA 2GM3A 4G5FA 4YP5A 4YP7A 1VBNA 5TEVA 1KH3A 3FHJA 2DLCX 1ZJWA 5LLTA 1EJ2A 1VL2A 1YUMA 3M5WA 3N9IA 2TS1A 3SYTA 5DASA 3X1KA 3DLAA 3AG6A 4ND6A 1JMVA 1LI7A 4NAUA 3MLBA 1WXFA 1BS2A 1T6ZA 1F4LA 5TEWA 2PIDA 2QTMA 1WQ3A 4G5YA 4ZT4A 1MBZA 1I2DA 2O5RA 3IUBA 2Z3VA 3CVWA 2I1LA 3RK0A 4MW0A 4MW4A
chains in the Genus database with same CATH superfamily
5AXDA 3JQDA 3G2UA 2PKQO 2IIVA 3JD4A 5KJEA 4DLNA 5KHLB 3CIAA 3ZEFA 1TJNA 3LDGA 5L95A 3P5SA 5IAOA 1XGKA 2XNCA 2HFKA 1EGQA 5E6SA 4DDKA 4KIFA 3HR4A 4U9HS 5CEJA 4V0NA 3GNQA 5AW6A 1JXOA 3ZIDA 3ONDA 3F1LA 3C16C 3EF0A 2W7TA 4QG7A 4CIWA 3DZGA 4GGMX 1LNSA 3RIGA 4E88A 4MV0A 3WLMA 4O4HA 3LP8A 3PFKA 3V80A 1CXZA 4AXHA 5CA1F 2RGDA 1UKCA 1KA9H 4H60A 2I76A 4IOKA 4LDPA 2CSXA 3PQ8A 2LUOA 1TEZA 3LUGA 4OUKX 4BHTA 1YNSA 4Q19A 1JPUA 4Q1DA 3I8OA 2FW7A 5IT4A 4RZUA 4D0RA 5JQGB 2BEVB 4CDRA 2CMDA 2YRFA 3CUUA 1UOQA 3KZNA 4Y2RA 4LNUB 3NVDA 4UZEA 4O6VA 4TRRA 5K01A 1GDDA 5CT8A 3NM5A 3WMRA 1AX9A 4J49A 1ZO8A 3JYOA 1QBKC 3KD7A 2O8CB 1W19A 4HQOA 4DB2A 1NP7A 4US2R 5LQNA 4UUPA 2FWJA 5C8YF 3KK0A 5AIJA 4PQEA 3WXBA 2XPIA 3TL3A 4BLPA 1EK5A 3NTUA 5JQGA 2BEVA 1MJHA 4GPTA 4MUKA 4JJKA 1M3SA 4AO6A 4LNUA 1AXRA 4EKEA 3GP3A 1P4RA 1XJCA 4PYOA 3IJEB 2EG5A 1JKMA 4JENA 1RMTA 3PFIA 1HF8A 3S81A 3TJPA 4ZMRA 4RK6A 2H48A 2ZUFA 4BVLA 3RBVA 4UMDA 1M6VA 5CYFA 4RFLA 1QZ3A 4FUTA 4DANA 1BU5A 4R54A 3EGEA 1N0HA 1LS1A 1YZUA 1I7QB 1V6SA 4DLOA 3OCZA 5CIWA 2PX5A 5CXQA 2VTDA 5E75A 1QHYA 3EGCA 3M1LA 1ZD8A 4D74A 1YR9A 3QI2A 2OHHA 4UXHA 3HDQA 3CVVA 3DB1A 3OXGA 1DBQA 4QGAA 1CG6A 1KZYC 2VT6A 3FHTA 3SFXA 4GRDA 4FGLA 2B9EA 3S2SA 3T4XA 4PR0A 4DT1B 2P9EA 4WA8A 1KP2A 4BLQA 4FE4A 3CPJB 2H7XA 3OUTA 2R6JA 4MWEA 1K8ZB 1MQAA 3QVLA 4IKOA 4M8LA 3PRHA 2J5QA 1RWKA 5LD2B 5I7FA 3NVMB 1HRKA 4NCKA 1NUTA 4EHBA 4N0PA 3NYQA 1SBQA 5IULC 4JYCA 4BYGA 5TQJA 4YCAA 2GK6A 2BZ0A 4MVWA 1Y4UA 3PC8C 4J8SA 3UJCA 2CJWA 4DT1A 4DCPA 2I29A 3NYWA 2B25A 3MUOA 3GYBA 3M6MD 3OESA 3D9PA 5IF9A 3RJMA 4AS2A 3LT4A 3G7SA 3P9NA 3RROA 1QF7A 1CEEA 4O4LA 2O2EA 3HEBA 2G7ZA 2WU8A 2FPPB 3S7DA 1IHPA 5G04C 5AUNB 4ZOBA 2I7CA 4E2XA 4J91A 2GLUA 5EXPA 1Z68A 2EQBA 1B14A 5EMHA 2EKBA 3A2NA 4CQMD 2H4FA 3KSZO 4HSEA 4S1VA 5FULA 2AE2A 3E3MA 2CW5A 4RH0A 4ZU1X 2AFHB 5A7FA 3NBMA 3QUQA 3D5EA 3EMDA 4I55F 5ECWA 5E4TA 2IU6A 4PC6A 3WQHA 3CE9A 1R00A 1XXHE 3KQMA 1T24A 3TGWA 4DV0B 2NVBA 4MVJM 1BXRB 4NQRA 2ZRPA 3CNLA 2GRPB 3T3IA 1H4SA 2FPPA 3I76A 4HDCA 3QWFA 4B3GA 3SPXA 1QZTA 2CL7X 3S6JA 1XTUA 3T5CA 2CCGA 4E5SA 3FMOB 1HOTA 2VQ3A 1MX5A 4BO1A 3DZHA 4X61A 4TYWA 1QCZA 3BEOA 3RVJA 1OD6A 2W6QA 4TL9A 3B12A 5FJIA 2B21A 3COPA 4B79A 2XBUA 5AKIA 5JCJD 1UJCA 1CULC 4UUMA 1DXQA 3M6UA 2EATA 3KUCA 1UOHA 4OXYA 4DMHA 1Y6JA 4GPMA 5K9ZA 2EJUA 4D81A 1MT3A 1ISHA 5DFAA 5JO9A 3FIUA 1VPTA 3GLRA 2ZIGA 3F6PA 4QTZA 2PUHA 1YHYA 1KZPA 4FDVA 4JVLA 1JIIA 3FDIA 3TCXB 4L16A 3KUDA 1N2JA 4LX8A 2HHLA 3TPZA 3BDAA 3ZY5A 1A17A 1G8HA 1D4FA 3GVPA 2WIGA 2ODBA 1FYDA 1JDSA 1P5ZB 5DNVA 1E8XA 3K0CA 2HC9A 2XYQA 3U3RA 4HH4A 3TEFA 2HIMA 1G59A 4JOSA 3GFTA 1BFDA 1JSLA 4K9SA 4KXYA 1N9KA 3QW2A 2JEOA 1U0JA 2BVNA 5KSOA 3L82B 4GNKA 5JSYA 2ISQA 3LW8A 4MH0R 5MN4A 3ZVVA 1TTPB 5F1KA 3R3UA 2Q3BA 3MXTA 2WSIA 5K2OA 5FTLA 4PM4A 1S6YA 5BPFA 1TM4E 5BN5A 4YLGA 1OFGA 2Y93A 2JLBA 1XMOB 5HIMA 4ZYXA 4TROA 2A67A 3Q5EA 3KB6A 5DTQA 4WAFA 2VSXA 4FLBA 3O95A 4W1QA 2C3OA 3K0FA 1DKUA 4MS4B 4UM8B 3GF4A 1HNNA 3L82A 4ANVA 2GAAA 1Y9ZA 5DTRA 3HCEA 4YECA 1YQ9A 1B15A 4TMWA 5L8VA 2A1TS 1OZGA 2B6HA 2ENWA 2XIQA 3KCQA 2G76A 2RHMA 1YB2A 1H5NA 1JHAA 1A8UA 5A02A 5B7PA 1TEHA 4IHJB 4PYIA 2JANA 5ED4A 1T8TA 1X8XA 2C77A 3DULA 4BLVA 5BSRA 2RDMA 2PNNA 3OZDA 4JR0A 3BKXA 2FMUA 4RULA 2I1JA 3B5EA 4CM9D 1IQUA 1M8PA 3KS2A 3Q0IA 2FHPA 1E7UA 2IDKA 2AJ8A 1BE0A 3L6UA 4V0MA 1X7YA 1DRUA 3P9XA 2CFSA 1OV4A 3WSWA 4UARA 4GC9A 4IL5A 1FVHA 3DKIA 1DWUA 5ENPD 5BV7A 5TXGA 5BMVB 3B1KA 2MJLA 3U39A 4U2GA 1XKXA 1EJ0A 1V9CA 3LDZA 5EJMA 4WK4B 4JUDX 1PYGA 4ABYA 3VPHA 1IBCA 1SNYA 2W6ZA 1KQNA 4HX2A 1JDJA 2B98A 3FMPB 5IBRA 2AEJA 2J5RA 3A3OA 1GZVA 2HYZA 3BN3A 3KELA 1EE1A 2JF0A 2PCJA 1N2XA 2O3TA 4DM3A 3DE0X 3ZDRA 3K2QA 4QQFA 4XGNA 4REQB 4JNKA 4HJXA 1AM4D 2D13A 1TU4A 2PMFA 3BVPA 2ZUVA 5C1OA 3PSAA 4KQHA 4TMKA 1EM8A 4PZAA 4HX9A 2UYHA 3OZVA 1I3CA 1N54A 2CJXA 4G97A 1EUQA 1TC1A 5FBRB 1E2NA 1Y42X 3PDHA 1TI7A 3UWPA 1HQYE 1Z4JA 3RAJA 5FINA 4KXVA 4O1OA 2VK2A 2H92A 1OF1A 1LNZA 2EOAA 3SYMA 5JAIA 4REQA 4WXPA 2UXCB 4UI9C 5KNCD 2HO4A 2IVZA 3HHMA 3EAFA 3R5TA 4KR9A 2AXPA 3G59A 1PFGA 3JYLA 3I05A 3D6JA 1FYXA 4DPMA 1Y5LA 2O8EB 2J6HA 1LJLA 3UB4A 2WHQA 1JR4A 4WWHA 4D2IA 3KKLA 1SVIA 4OHFA 4ND6A 4F1KA 3Q3JB 6GPBA 4I3FA 1W2HA 4O6FA 4QJIA 2JLSA 3ENEA 2P9SG 2FPLA 1VQ1A 4ZVOA 4F5WA 4M7OA 4J90A 4M8IA 1UANA 1YDGA 2IHKA 2X6TA 1W9MA 2X9VA 4HFGA 2XUFA 2XGJA 3CVOA 1AH2A 1SCBA 2R0QC 3U64A 5DRTA 4L8GA 4XGKA 1CF2O 1XKLA 3TWSA 2C7GA 3S3TA 2A84A 3LVBA 3VYSB 4YRDA 2WG2A 3H1AA 1CUEA 1W5BA 3F2IA 3UK1A 3JX9A 4PSDA 2I03A 4NDAA 4DXHA 2WR8A 3WGJA 3MMNA 1HC7A 1W73A 2R17C 2GUWA 2C95A 1ZSVA 3I09A 4UFPA 2V5AA 4IJ5A 1TECE 2I3AA 3H8SA 3KJGA 5LYJB 4KQWA 4B8ZA 2P2YA 2ZCVA 4G5RA 2OFXA 1DC3A 1QH8B 3GJSA 3WLAA 5B3LA 1H3EA 3CU5A 4D8WA 1TU3A 1MC8A 1VIDA 1VC2A 3QEJA 1SGWA 4S1NA 1R0CA 5A04A 1B26A 5DGXA 5HOQA 3J81k 2YUTA 4B8AA 4YBRA 4I50A 4XEUA 1COZA 1PR9A 2FSUA 2QRQA 4FMCF 4HUTA 2FFQA 3B7WA 4EVIA 3H6KA 4HEQA 3DOOA 4WOJA 3WL3A 3I0MA 1QH8A 3TMKA 1SVNA 2V3WA 2I6QA 3MMPA 4H6PA 5FCDA 4D96A 2QJRA 3BFXA 2WXRA 3A1SA 3DTVB 3CPEA 4B3SB 3VVLA 4JLDA 3N76A 13PKA 1DOZA 1JR6A 1V7PC 1ZUNB 3NHLA 4MLDA 4B4KA 2IZ1A 1N5KA 2NPOA 1V25A 1P29A 3N3AC 3HYMB 2WKSA 1K5GA 3KSDO 1G16A 1Q77A 2V8OA 1UP6A 5EFZA 2PM8A 1EFHA 3AGPA 4V03A 4Z86A 2A14A 4BAZA 4MVJD 2M98A 3WGLA 1QVAA 3VVBA 3M6AA 1ZUNA 4EOGA 5FNZA 1QM5A 4XJVA 2YWXA 5A3RA 3OPYI 4H7HA 1SC6A 1J8MF 1NPTO 5LQUA 2BFDB 2COKA 4F2HA 1LQ2A 1G6KA 4WTOA 1SOAA 3ZWBA 4RDXA 1AJEA 3AWIA 1ZUHA 4DLTA 4JCOA 3LLVA 4BNWA 4LOJA 4EG0A 4UAUA 1NASA 4MZXA 3ZQ6A 2GVZC 1BTOA 1E7WA 2C2BA 2P5TB 3BGWA 5JS8A 4MCJA 5SY4A 4J6FA 4AWBA 3NT2A 2BFDA 1R5OA 2LGJA 3BF8A 3KBBA 4E5UA 1G42A 5DT2A 2QVLA 3L8EA 2I8CA 3RYFB 4D7AA 3ZE1B 1T6BY 1EGHA 5JJBA 2QAGC 4BX8A 2W2XA 4LTDA 4DA7A 4LRXA 1S9HA 3FRHA 4OFZA 5IYZB 3UAGA 4UUCA 1U8FO 3CW9A 2GJKA 3BGOS 4XA8A 4D9KA 9ATCA 2XNJA 1F0PA 2O2SA 4NX2A 2BTOA 1BD8A 3CHYA 4JLAA 4LRZA 4BWGA 4D4IA 3U7HB 1P6UA 2BHSA 3V4LA 1EDOA 2Y0PA 1HDXA 3FGOA 3RYFA 2KZTA 4B3XA 3JTMA 2CG2A 4FI3C 4N9QA 3DE1X 4QUAA 4EHMA 3WLIA 3K9WA 2RAVA 3NB0A 1YVUA 2YHAA 5IYZA 3KQPA 3EVEA 2WWYA 1QR2A 4C48B 1BIFA 2ACKA 3TTXA 3W2EA 4FJ1A 3L7BA 2FULA 1J2EA 1SMKA 2IZZA 5DGDA 2JEKA 3P2EA 3VR3A 3S1LA 4GTRA 2IJGX 3QFCA 1PLLA 2ADMA 5KAPA 4FFBB 2KX7A 4HOUA 1KEVA 2QZPA 2R1UA 1V7ZA 5IC5A 5EOVA 1OYOA 4ZTBA 5LVAA 2HCTA 4C4ZA 3IT1A 3F6QA 3IUJA 2V9ZA 4KOEC 2DKOA 4R98A 4WCFB 1Z2OX 5C35A 5JZBA 2QEQA 4EI2A 1IPFA 3BSWA 5KYWB 3EYWA 3BMNB 4LRUA 4F6LA 5JA4D 3IDSA 3H0CA 421PA 1MEEA 5CH8A 3P0EA 2WMNB 5FA6A 3MF4A 2DECA 1R0SA 3Q78A 1A4UA 5CUQA 4FFBA 1BDHA 1V4NA 2FUEA 4C22A 1THTA 4Q34A 5KJNA 4Z9FA 3EWAA 1DAMA 2Q3HA 3QX3A 5LOZA 4WCFA 1HKUA 4U6SA 5KYWA 2ZR8A 4KH1A 3DHVA 3VPXA 1KAQA 3RC3A 2V65A 1R8QA 2WMNA 1WZUA 5LMZA 1EZ1A 3TF5A 2O54A 5CYGA 3JZIA 1HNXB 3VU8A 4AF8A 4IIEA 4ZOLF 5LQJA 1ESMA 4FKMA 1XRQA 4KO1S 5IDQA 1M7HA 1X1AA 3E8MA 1UBFA 1PT7A 4GLJA 2CB9A 3PJEA 3HZRA 1KK3A 3SICE 2P9BA 2R5FA 3S70A 5JNUA 1DCKA 1N75A 2CL5A 1ZD9A 5AI5A 5A3QA 3E05A 3R6TA 4JYBA 2VHCA 1Z36A 2YOGA 5LZ9A 4WY2A 5ENDA 4RGBA 3CZAA 3AONB 3GW8A 2O57A 3O8QA 1YZYA 3W5UA 1ZN7A 4GM0A 4PLZA 1LSJA 4DR3B 3HL4A 2FPGB 2A30A 4B17A 3PYXA 3MLEA 3RWMB 1J0EA 3A6GA 1SC9A 3MQFA 1ESZA 3GIWA 5ALFA 3QMMA 1CW2B 1Y7IA 3Q79A 7MHTA 2BRUC 2PZBA 1QG2A 3L6EA 4JJFA 4DYDA 1G98A 2OCCE 1DEXA 1PSZA 4MWDA 3BF7A 4MW9A 1N52A 2RARA 4DA6A 5FWDA 4AL4A 4D98A 1O95A 1JI3A 1PGQA 4O4IF 3HUDA 2DR2A 3IVCA 1I8TA 1JEJA 3SIWA 2ZT7A 5DTMA 4FJYA 3IQHX 3D6HA 2FY8A 1UM8A 2O2IA 1GN8A 3FTSA 1MOZA 3L6OO 5KJCA 4BV9A 5JAMA 4J43A 2I1KA 1WKBA 1L5MA 3L8HA 3I5MA 2HZBA 1H6OA 5EJIA 4JI0B 2C4WA 4R7TA 4TKVA 4WXMA 2W8ZA 4V0QA 4GKJB 3G17A 2H1WA 3L1IA 4YFYA 1VPDA 1J7KA 1KDVA 5IVKA 2E87A 3A9WA 2Z2KA 4RTPA 4Q9IA 3V1LA 1CS0B 3M49A 3UTDA 4J0DA 4DQDA 3GFGA 2E1PA 4G1FA 1BROA 4QRDA 1RQGA 2R05A 1XAHA 1V1RB 2B5WA 2GCEA 3BX1A 2YYSA 4DY4A 3ZU7B 1US8B 5CB4B 5SICE 1YA4A 3MTBA 2Y1OA 5CR9A 2JFBA 2PGIA 3EIUA 3GLKA 3ULKA 4AF7A 4APFA 3KQSA 4J8EA 4PS1A 2J0SA 4JSYA 1Q1NA 3D3EA 2DGDA 1YS7A 2GZRA 3T3DA 3DEAA 2QYOA 5CLHA 3I01M 4BO6A 2NO4A 3C7CB 3CEHA 5JDCA 4IVPA 1RR6A 1US8A 5AK3A 4FU3A 4QFDA 3JPWA 1T1EA 1W0JA 4YP1A 2QE6A 3UICA 1Z18A 4ZVKA 1MX4A 5FFNA 5TQ0A 1IG0A 3AEZA 2OP0A 3AVWA 3LBFA 5EGSA 1U8YA 5AXBA 1IHBA 4EWLA 3ROQA 1C9YA 5HCUA 3OLZA 1L9XA 4JLMA 5DYNA 3LY8A 4H35A 4PTLA 4Y2PA 3MJ4A 1WW3A 4HUQB 2DPGA 4RESA 1RYEA 1PT9A 1C8KA 3CUWA 3ZH9B 4E30A 1AKRA 2XMGA 3OQJA 4CCYB 3CPSA 2J33A 5ABPA 5KWEA 5BOSB 3MZ0A 3DWLG 4XIFA 5CX1A 3IHLA 1ABFA 1FUKA 2JABA 1AURA 3FCSB 3C3WA 3F7MA 2H2GA 2D8AA 5HXAA 4A1FA 1NVUQ 1DQNA 1Z34A 3CRNA 3R0XA 4HUQA 1ORVA 4TXPA 5IKXA 1XZNA 4GCOA 2C5GA 3LIPA 3ZEIA 2D0IA 1SULA 3D4LA 3AP1A 3SIXA 2APJA 1UJ6A 2KS6A 2COUA 1MR3F 2PAFA 2AC7A 2NXPA 5GOTA 3TLGB 3ZIMA 3SXUB 4I19A 1WMDA 3U9LA 4H2DA 1YZ3A 5JYBA 2AJTA 1P9WA 2H9AA 3SJ7A 5J2TF 1E3MA 3H42B 3V9AA 3CUKA 1WMBA 5IAKA 1NLMA 2EGGA 3VR2D 4RF5A 2I4TA 5BR7A 4DQVA 1YQDA 4GPKA 2WYOA 3NIFB 3U7GA 3ZWQA 3NV9A 4OHRA 3SXUA 2WTNA 1J0BA 2HUPA 1XD8A 4KQKA 3CV0A 3R7BA 1WPXA 1ISMA 3COYA 3DDCA 1W581 3TD9A 2NVUB 2HDHA 3UH0A 4IY1A 5I9NA 2G88A 2GT1A 1NWCA 4DCUA 2E4ZA 3MVEA 3NCHA 1U5BB 2O9JA 4PLTA 1J0XO 1N2OA 2AJCA 3OEHA 2YHSA 5HJ7A 2W2LD 3BCHA 4IV8A 1SQ0A 2Y1DA 4H7KA 5DLDA 5ARFA 5JLJA 1TNOA 2BH2A 1SCJA 3FTVA 1OI3A 1IOVA 1JJAA 5KVVA 1HH8A 5JJ6A 3SNXA 3C3RA 1ZISA 1B0UA 2NVUA 4CMIA 2EWVA 3EGIA 1QFJA 2K87A 1GAXA 4MPDA 3CH7A 4EL5A 2P9PG 2E18A 1E2GA 4K6KA 2WSLA 4J16A 1U5BA 1VPLA 2H4ZA 4RO0A 3ILVA 2OD7A 2I9KA 2B83A 4RKRA 3GHHA 4GOXA 3MINB 3ZHEA 3ABRB 1L3IA 4EHIA 3WXMA 3ACCA 5ALKA 1NFIE 3UWOA 4RZIA 2G1AA 3K9LA 1SCUB 2WTEA 2JFFA 3PFHA 1JRLA 4O2BF 4DHEA 4WOCA 1IY9A 3OQVA 1D04A 3H16A 4RU1A 2BI8A 4XIJA 1P1RA 1L5YA 4G86A 2VYND 4QL3A 1C7EA 1NULA 3M6XA 2IGBA 4F3YA 4HNAA 1JECA 5DNDA 3ZDFA 4ERNA 4FQ8A 4OVVA 3LY9A 3IDOA 3MINA 3HZOA 3OT4A 1XG5A 2WM9B 2FKNA 3FTYA 1A82A 2G83A 1XAJA 1SCUA 3O84A 4I1SA 3OZ7A 4WNFA 5FL7D 4Q3OA 2WSBA 1E1QA 1KYWA 2XOKA 1FRZA 2R79A 4GI3A 3QA3E 2FPOA 3CXUA 3NDPA 4I2WA 3OO1A 4JYPA 2X4LA 4HZIA 1JA1A 4Y30A 5KKCA 4U7WA 1V11A 2JHPA 1QS0B 3X2EA 2QB5A 2ZYWX 4PWYA 5HUQA 2OBMA 3IP5A 4W9RA 3BXXA 3CEQA 1ENYA 3MILA 2PX4A 2AE1A 3G85A 5HCIA 2CK3D 2REXB 1JALA 2VCYA 2X42A 4BJHB 5CJJA 3D6UA 2VRNA 3H9JA 3RBZA 4TTIA 2VDVE 2NADA 1NBMD 3MJEA 3KPVA 1ZC4A 4JSTA 1QS0A 4ZMBA 5H3LA 3F7TA 5DP1A 3ICWA 4DZZA 3B7SA 1G5TA 4DUPA 4B85A 3CNOA 2ZBQA 1P39A 2CMKA 1PZGA 2WXGA 4QU8A 4W82A 5JBIA 1AQIA 1E5XA 2RC5A 4FLFA 3GVHA 1HG5A 3Q8WA 2J41A 5I01A 2O1XA 2C2WA 1RCTE 2UZAA 2QWXA 4JN6B 5D5PA 1GZ3A 2QZJA 4LY0A 4OTZA 2C4KA 4I4TB 3PICA 2Q6VA 2PZLA 4YHBA 3IR5A 3L0BA 2RC6A 5EL0A 2AEMA 5LNK6 3IQDB 2EWWA 2QMUA 3DYVA 4Q9LA 3SSOA 3HA5A 1VL8A 4LDQA 1JCSA 2WG1A 3H1GA 3PQFA 4UHFA 5EZQA 1VJ1A 4I4TA 3RK1A 4YCDA 3AX6A 3I5PA 4ZT7A 1GPMA 2NTEA 5C8DA 3GN2A 4OYYA 2YZGA 3IR7A 2EIME 3B6KA 1GGMA 1H6AA 3VO9A 2DWZA 3E22B 2KQUA 1MKYA 5H8WA 3D6FA 1V5GA 4U7HA 3SS7X 3KR1A 1T8RA 4AT1A 4DJ5X 3STTA 5FPPA 4YMLA 4U7TB 3KQTA 4DVJA 3UGTA 1E79D 2WXMA 2OLEA 2JJYA 1QK5A 1Y1KE 4MAMA 1O0CA 4RS4A 1KSHA 3MJTA 1RXUA 3HZZA 3SF8B 2AMYA 3APDA 3E22A 3Q1KA 1KYTA 4OP3A 4Q9JA 3H5IA 4TLMB 4MQ5A 1W3BA 5HF5A 3QBDA 3C74A 3MTQA 5ERGB 4EF5A 3VMMA 2PSJA 4U5XA 3C1OA 5BXUA 4I9EA 3KQNA 2VYVD 3GZNA 2DOKA 1C8VB 3NC1C 4EKIA 1NPYA 2VPWA 4FHCA 1TRHA 1UKAA 3GJXC 2HMSA 3LX4A 4AJ4A 1XLVA 3AI7A 3EVZA 2A4KA 4U02A 4P22A 4WI1A 1A5SB 4IS3A 4NFSA 2FFHA 3ELUA 1JJVA 4BZZA 3P19A 4RETA 3OTGA 3QSYA 2FSPA 4CKCA 1L5WA 3HY6A 4MR8B 3H1EA 4KR0A 3IR6A 1ZZEA 5HKPA 3WBKA 4BE7B 3E0QA 3DZJA 1VSUA 2BZGA 5JH7A 1FQWA 4NIMA 4Y2HA 2PG3A 2V98A 3G7NA 1A8PA 4BJ6A 1C41A 3HFJA 3PQDA 1CB0A 3MCUA 4IH1A 3GUCA 4OHXA 3SFZA 5AHKA 2ZLBA 2QQEA 5ESXA 5KCMA 3HBLA 1M0SA 4IVQA 1G3RA 3U3ZA 2XMZA 1RP7A 3JD1A 5DXFA 2WD8A 4MR8A 3T3EA 4TWAA 5DRYA 1OAAA 3DCIA 2OCDA 5EJ7A 2YJTD 2WK1A 5B1IA 3RWOA 4INJA 2CUNA 4D25A 3H0KA 3RQIA 1JSCA 1JMYA 2XOXA 2IXDA 4JHKA 3AEXA 4CKBA 4LYYA 2RGYA 2D3WA 3QUAA 2CGEA 4K87A 4M1OA 3K9CA 1ZA2A 5AFSA 3R9AB 4DLZA 5IK2D 1QBQA 5TMDA 1OBFO 3U7JA 1JZTA 3ANSA 2ZSFA 3KOXA 2RKBA 2GBIA 4LVNA 4Y0AA 5CD1A 4DE5A 4ZOAA 1D07A 3Q4GA 4C3OB 1VIYA 1J2TA 2V6GA 1E58A 1EINA 5E6RB 4PC7A 2AFVA 5LBTA 3N0XA 1WP9A 1RQXA 5AAOA 2WHEA 3OHPA 1J0CA 1WKCA 1RWQA 4RVUA 1RRFA 1TMKA 5B55A 2EXXA 1CQJB 2XEXA 3T7JA 4DTCA 3PZ4A 5GVSA 4BAUA 3FDJA 4UEJA 3AVXA 4IRXA 3EZ9A 1CUBA 4FXPA 2PQ0A 4DNQA 4G65A 5E6RA 3V8RA 1OI2A 1K6IA 3HYNA 2KI5A 1YE8A 3HBFA 4EK9A 3D9QX 3AEUB 4D9BA 1YR2A 4A91A 1NMYA 5KNBD 3BZUA 1X3SA 1QOPB 1UC9A 2QTAA 5G41A 4BEVA 3ETCA 1CQJA 4KWTA 1WLYA 3H4TA 3K0HA 4X41A 5DLEA 2D8MA 5F98A 4WKPA 2BCJQ 4CYMA 1Z08A 2GN0A 2HHHB 4MNTA 3TAHA 5KBAA 3UM3A 1Z4LA 5KYKA 2JRCA 1A50B 3NP7A 3BH6A 4FGUA 5BWMA 2WBLC 3C3EA 1SXJB 1I7NA 2IYTA 2DERA 2IYVA 4HD8A 3AHFA 5JC8A 5B7NA 2QZ9A 3ZWWA 4BLTA 3SC2A 1E5LA 2C2GA 4KTVE 1XRMA 2PSFA 2FQXA 1DAPA 1YJQA 3P45A 2XCTB 2CBZA 3TAUA 2IY7A 1AGNA 1PZFA 3NNDA 2H2DA 4FA6A 1XRJA 4PQFA 4JXTA 3VPCA 1OC4A 1SXJA 4CKWB 4WNEA 3IEXA 4Y1RB 3DWIA 5IS2A 3ESQA 4Y98A 3B6ZA 1NVTA 1E2IA 1CTQA 5JNLA 1NJ5A 4I66A 2FJPA 3KT0A 4HK4A 4HNHA 2CV0A 5E38A 1FLVA 4LRWA 3KR2A 2V74B 3EAQA 1OAOC 3MMSA 2PWBA 4WDRA 1IRIA 3G8BA 1YQXA 4Z54A 4CEIB 4RDCA 1B43A 3QKYA 4EY8A 2GN9A 1HGXA 4Y1RA 2IHNA 4E2ZA 1FFXB 4LOAA 3ZK7A 1ODSA 1PJZA 3LKDA 2GF0A 4LF5B 3ASUA 1MPTA 1PNQA 3SFVA 5DVZA 1MFPA 5DM1A 1TD1A 4EYKA 4C0KA 2X1LA 1RYZA 3H3XA 5JECA 4R2JA 4DJAA 1O1RA 3DAPA 2DZDA 3BGSA 3WP0A 3UT5B 3UUEA 4EG5A 4TYMA 3LXUX 3UTMA 4UMEA 2GK7A 1KJNA 2R6ZA 5I7EA 4OUDA 4M0PA 4ZRMA 1FFXA 5C2JB 3Q6IA 3VZPA 2FZCA 3E2IA 3ZH2A 3G23A 2J87A 1MQSA 1QIDA 2IUSA 2I87A 2PEZA 1NXTA 2JFHA 5E8RA 2Q6IA 4TXNA 4QGSA 4NBNA 1WDTA 4FX2A 2XS1A 4OJNA 4P7GA 4O4HB 3UT5A 4C5BA 3D81A 1YA6A 3HE3A 4U0JA 4MV1A 5FA5A 4FBLA 3OJEA 1PUJA 1WD5A 2BJVA 5DBHX 3VOBA 3AHEA 4Z2YA 3N7TA 4RK1A 2ZT6A 4UDXX 1H2FA 5CFPA 1X1TA 2XYRA 1XQWA 4DM7A 2HPHA 2PBRA 3FU6A 1N5OX 1XSEA 2JAHA 4TZTA 3TO5A 1GTL1 1SZDA 1H05A 4MPTA 1P8JA 4LC9A 1T29A 5HG0A 3HRHA 3AF5A 1RI4A 4OLAA 1YMQA 2OAGA 5B1SA 3B53X 1N1EA 3I52A 4MV3A 1CD5A 5FFFA 4TTSA 5AOVA 4EFDA 3KSQA 1XVAA 3BCRA 2Y92A 3O4GA 4L08A 1IEXA 4AQDA 3FG9A 3ZI7A 2B4YA 1DXOA 3O90A 2Q3EA 3UMRA 3TWUA 1EJ2A 2C61A 4DPLA 3B1WA 4OQ4A 2J4CA 3OKPA 5DHAA 2YASA 3TIXB 3FPCA 3GXBA 1AGYA 4FHKA 2J3DA 5A3JA 2I2OA 3GGCA 2GDJA 1NVXQ 2Z56A 1Z17A 1JJFA 1U5AA 4CMJA 4QQNA 3LVQE 4AV7A 2I3BA 4X6UA 5FOWA 5JROA 4OXQA 1LU9A 1PJCA 2JFPA 5CDTA 1M6VB 3VH3A 3CJQA 2WT4A 2BD0A 2R03A 5CPBA 3KTDA 1UXJA 4Y6QA 4HV4A 2EZTA 4G5OA 2E5WA 5CW1A 3PI7A 2IGTA 4E11A 4OB8A 1FFYA 1YI8A 5HMMA 3W2IA 3IV7A 1MVLA 2FG7C 2Q3DA 3W7BA 1M8KA 3C3DA 2P1ZA 3H99A 1HT0A 5TF4A 3QTBA 1OIVA 1RXSA 2H59A 4EY3A 4I6JA 1HXHA 1G21A 1LCIA 4IDNA 4TLCA 3E1SA 1KEEB 2WHXA 5KSWB 4LC1A 4O60A 3A1TA 1L5JA 3M2TA 1C3VA 3L6DA 5LWHA 3OZSA 2JHAA 3ODGA 1YT5A 2JI8A 1XTBA 2B92A 2PUWA 3G5UA 4KH0A 4MARA 3RS0A 3VGJA 4AM9A 1XJ0A 4YPOA 4UMFA 3NIGB 4ALLA 4NRHB 3OQPA 1JLMA 2A9JA 1KEEA 4G4SO 3V1MA 1USVA 2VRCD 3G5MA 2JAWA 2CJWB 4B6SA 2OK8A 1F6WA 5C1IA 1E9AA 3RFFA 2XTAA 2CNLA 5EHXA 1KI3A 2D2IA 2JC3A 4XWGA 3AXTA 4NBKA 5C5DA 4IDAA 2PQ2A 4XM0A 1DDIA 1ARZA 4E5YA 4O4LB 4QUJA 4WKOA 2HA4A 1FRQA 5E9WA 2QG9A 3EW7A 3OIDA 4QBHA 4RVBA 4S1WA 4HWRA 1NPDA 3VR0A 3T1YB 3S28A 5EAIA 2UVQA 2NO0A 3W04A 4J0IA 1L8XA 4ZTUB 1K0UA 4DDWA 3UC5A 2ZUCA 3O83A 4CLEA 4FMDB 2VRBA 5GV7A 1GPYA 1EUYA 4F38A 4AO7A 4R7LA 2Z1MA 4B6FA 1LDYA 3OA2A 4H31A 1P9RA 3EIOA 4FPXA 2PR2A 2YC4C 1MO4A 4X6YA 3DVQX 4DG9A 4JC5A 4BN4A 3EE6A 2VPZA 4J7XA 1JDZA 1VBKA 3T3PB 4HGRA 3UNXA 3I6IA 1U5CA 3OF3A 5IAJA 4Y9UA 1OH5A 1JG4A 1ODIA 1S2GA 1M6HA 4HZUB 2R44A 4A23A 4F7WA 4Q0MA 3M34A 4BMZA 3EOZA 4DNPA 4LQ4A 4DDVA 4Q69A 3Q9NC 4RKYA 5AKEA 2P6RA 4DLWA 4XUGB 5F23A 2VDRB 1KRXA 1SUAA 2ZP1A 1CKEA 4RNCA 3RREA 1Y7PA 1E4OA 5TVGA 4RLYA 4HZUA 4HRVA 4OQNA 1Z6QA 3DSSA 3UGJA 4ZICA 1W0KD 4IXTA 4R3UC 3BERA 3KEAA 2QZ4A 3BRQA 3ZJYA 2YYYA 4NJEA 3ZVNA 4DEXA 2VP5A 4IVNA 4WUTA 4EI8A 2YRXA 5DPMA 2O6HA 1KQGA 1U28C 4MYUA 1U2GA 4UVGA 3L0CA 2QP4A 4ACBA 4BTEA 4YASA 2HZ7A 3L6BA 3MCWA 1XCPA 2IIQA 2ZJ3A 3JZDA 3K6RA 1OA1A 2YZ2A 4FGWA 7ADHA 2XMRA 3UOGA 2CXSA 4G1TA 2B20A 5T64A 1H42A 5C5EA 2WJ4A 3PXXA 2FQ1A 5KYTA 1SQFA 1W88B 4YJDA 5JHGB 2W43A 3LCVB 5BN5B 2J9FB 3V4ZA 4M49A 3EA5A 3LAWA 3RODA 4D6XA 1GV0A 2B0CA 4FINA 2XMSA 2OORA 4BAGA 4ZTZB 2YV2A 3K0FB 1UFKA 3JYHA 4GW3A 3QEBZ 1MOSA 1WXWA 2BKVA 2QORA 3MBOA 3F46A 1AQYA 1D1PA 4LF9B 3ANYB 2Z6AA 3SQXA 1W88A 4LKRA 1TM7E 1N2HA 1YD7A 1DX6A 2JLXA 3T8YA 5DSTA 2HJ9A 3GVCA 3RSFA 2J9FA 2WVJA 3H8WA 1KWKA 4WNIA 2HV8A 3VYTB 1QQ6A 4J3FA 3SC6A 2Z2JA 2QV7A 2BFMA 2EC5A 1PG5A 4UNPA 4B81A 1GL6A 2WM8A 3K8ZA 3ZCSA 4WXYB 1BX0A 4B7ZA 3M1IA 2AJBA 1O9BA 1J8DA 4EY6A 5CNMA 4UM9B 4OYHA 3LA8A 4V38A 3F4LA 1X7YB 2PQRA 5DM2A 2Y0DA 3QWVA 1RKQA 3ZVLA 4O2LA 1C7ZA 2IQIA 1T6XA 3RJ9A 3NTVA 4MHOA 5B1EA 2E37A 2FCRA 4BJ1A 5EZYA 1ZHHA 2QZAA 4H1HA 3MJRA 3OMLA 4ASUD 4RSGA 2H00A 2YV4A 2XE7A 2XB6A 4TV9B 1TA0A 4R9UC 2YMLA 5J40A 4NQZA 5FTWA 4LMRA 2NT3A 2V6IA 4CN8A 1OLXB 3DLPX 5KO2A 1X2EA 4AYWA 1NSYA 3KYBA 1GLVA 4EJSC 3P9RA 4JC0A 3VNUA 2FMHA 1V37A 2EJBA 5HSGA 2XVAA 3FLEA 3DDUA 3H3FA 2O59A 2V9CA 4V3BA 3H5RA 2PZKA 1RAFA 3O21A 3WLFA 2X8WA 3PTLA 1BCSA 1XQVA 4TV9A 1BU9A 4DQXA 4KXNA 2BV3A 4G89A 2P7IA 1QIJA 2WXIA 4B94A 1EM8B 3SQWA 3AG4E 4DW8A 5HJ2A 1UP7A 3S8MA 3C5HA 3WLTA 4E0BA 1F48A 4HLUC 2AMJA 3IELA 1KIAA 1OLXA 1DMSA 3T4UA 4PZDA 1G8JA 3P1JA 1FDTA 4IJWA 3AZOA 1EXMA 5LUBA 1SHUX 1E89A 3ES9A 3WO1A 4OVUA 3N5KA 4MYDA 3MBKA 5F1OA 2XUQA 4MKFA 1PZXA 1ADYA 2VAMA 1E7QA 2JKYA 3VHXA 4NYJR 1S3SA 2YWBA 1J1ZA 3DOFA 3CNHA 1BO6A 3B7GA 1Y1PA 1UUFA 1SCIA 4LZNA 5KWDA 1O8BA 1JWBB 2E6UX 4RGVA 1ND5A 5BMVF 1SG9A 3C6KA 2A2ZA 1SC4A 2NZ2A 1VKZA 1QIMA 3BWMA 3WOHA 1T0PA 2GK3A 3LL7A 4IZ6A 4EG4A 2BGWA 4DJFC 4WW0A 5ENQD 1U11A 1LK5A 1LTHR 4PUCA 1SBIA 5EHGA 2GN2A 5KQGA 1U0LA 1VHWA 2WIDA 4N3CA 5EE1A 2P27A 1YS9A 4MLCA 2I62A 4IFEA 2AXVA 2D3TA 4JJGA 5ICGA 5LP6B 3P9SA 2Q6KA 4ATZD 1W4LA 4V02A 1TA9A 1BNCA 5E9AA 5EMNA 1TYZA 4YMWA 2C8LA 2XZTA 1N2BA 4BNHA 4A6PA 5K6AA 3HABA 5FAKA 4CL0A 3CE6A 1MQ8B 3EVDA 2BF0X 3W5SA 3J5PA 3QOXA 3ONFA 1ZG3A 2J48A 4I43A 3P2KA 1W93A 5K6TA 4KNYA 3MYRA 5FEMA 5LP6A 4PCUA 4MJLA 3LPLA 5K7SA 4BNNA 3K53A 4MULA 5CLIA 5F2KA 4KACA 4I50B 4JZKA 1WXGA 5G40A 1YZQA 3VVMA 1IHXA 4FJZA 5H80A 4G8LA 3NBYC 2Q99A 4Q5IA 1QLHA 4BETA 3KPYA 4YROA 4RD4A 1B1CA 3I9LA 4QXOA 4RFVA 3VNQA 5AW1A 3FGZA 5AHOA 2NMVA 3L7LA 3FUUA 2I80A 2FZVA 4IMJB 2XSZA 5AKLA 3S2UA 2PGNA 3KLPX 2Z9CA 2JGDA 2ZYIA 3FNHA 2QW8A 1E6LA 2ZPTX 5E2BA 2HV9A 2VQDA 2PS9A 2QLLA 2WF5A 4AKTA 4LGCA 5K3DA 4JGIA 1GPBA 3HXBA 2DCUA 5F73A 5LKAA 5JJLA 1G5QA 1RC0A 2DWCA 5JT1A 4X3PA 4IP0A 1PK9A 5NLLA 3K5HA 2VSOE 4DJEC 4ZT2A 1VCIA 2GILA 1OYVA 3E5HA 5SYNA 3HWWA 3AW8A 2B7CA 3THXB 5LYJF 1O5TA 5J4HA 2HA6A 3ZDBA 3A25A 5A5GA 2DAPA 1AY0A 2RD2A 3DFUA 3IJRA 4PLGA 1NI1A 2Z4SA 2P3SA 4PLWA 3DFZA 1DVPA 3Q3IA 3RO3A 3LBIA 2PRYA 2W42A 2DULA 5AM2A 4JI4B 3THXA 2FN7A 4GUDA 1C0EA 3QBVA 3PENA 3EY4A 4RKQA 3MWJA 4S35A 2XWQA 1L7QA 3BXPA 4J75A 3ZYKA 4UAJA 4NMXB 1RJGA 4MRPA 2IOLA 1U2VG 3WK4A 2B78A 1ZNYA 1JFLA 2ERYA 3H4VA 2ZJ0A 4RHEA 1OCCE 4CL3A 1EDUA 3LK6A 3G2QA 3ULQA 4OBBA 4Z4FA 2O14A 1XVLA 1PKXA 1U7TA 1IN1A 3V3KA 3ZHZA 5KTMA 2FPRA 3NASA 3S2GA 4WV3A 4C0JA 3RSCA 3SO8A 5I47A 3X1XA 2XCOA 3AOEC 2ZTHA 1D6SA 4P7BA 1DC5A 3I9FA 2KZTB 4DC1A 3GAFA 1XF1A 3IP3A 3HC7A 3AVPA 1UKYA 2G7MC 2J7KA 2X6KA 2ZRJA 3KS9A 1ZKMA 4OAUC 1GGFA 4NDZA 5EXDA 5H4HA 4GZ5A 1KYIA 5TGTA 2IPAB 4L22A 4HS4A 3ZGVA 1T1RA 2V7WA 5A4AA 1XDSA 3E03A 3U3DA 2V97A 4YLYA 4NONA 2FXIA 2OHFA 2QPAA 5LIPA 4Z8YA 4CT4B 4D9FA 5BQXA 1QVZA 1MV5A 3T1HB 4R71A 2IKQA 5HIJA 3G02A 1YGYA 4H6XA 4FE3A 5A4IS 3X3HA 1D2MA 3QWPA 1EHCA 4MJ7A 1GLGA 4LJ8A 1EE2A 1HR0B 2I6UA 4QQ8A 4RKFA 5FWXA 1ULHA 5JXJA 4P8RA 3GGJA 3VTKA 1K63A 1TMOA 2BFAA 3I2IA 3DVAB 4PCAA 2DY1A 2G0NA 4IFIA 3TXMA 5FH9A 1L1RA 3O3OB 2Y68A 3L5OA 4URUR 4CT4A 1L7AA 1QFMA 3R75A 4XYBA 1RZVA 1N8SA 3WRYA 2PGLA 8MHTA 4QPDA 3W7VA 3R0JA 3GNSA 3OE7A 3JUEA 2MYPA 4D4KA 1P7YA 4TXHA 1G9SA 1T9GR 2TSYB 4S24A 2MR6A 2GPNA 3QFRA 3CVUA 4J7WA 4LJ9A 4QOEA 3PNLB 5EKUA 3DVAA 4X66B 2ZRNA 2MOKA 2ZTVA 2Q1TA 4GOMD 5AUOB 2V7GA 1N5MA 2REOA 4XB6B 2O4CA 1DVRA 3L4JA 1UZUA 3OKFA 1IDOA 1MAWA 1E8YA 4EARA 4ARIA 1NHWA 3NBUA 1XF9A 2C04A 3MTGA 1TJ3A 2YXBA 3NGMA 1P2TA 1T0IA 1QHSA 3TOVA 2ZT8A 4NV0A 4BESA 1JV2B 1OUVA 2V9PA 3N58A 3GCXA 4HDRB 1OILA 3PNLA 2PIAA 4IPTA 1R8JA 1LS6A 4G67A 1ZD3A 4AY2A 4HI8A 3GGPA 4UDOA 3O8QB 3FPKA 5EINA 3PNTB 3R6LA 1W36C 1JKIA 2I2CA 1CNFA 1TAQA 3LBYA 4QC2A 1M7BA 2XPCA 3DV9A 2LZ0A 3I6YA 3OTWA 4TWJA 3N28A 3V4FA 3VPBA 3WK5A 1I4DD 3U3KA 1MABA 1Q44A 5C52B 4KC0A 1GGNA 1DIAA 2ZS9A 3CEAA 3M5WA 4HDRA 3O1HB 3N8GA 1ZR2A 5HKAA 4RGYA 4RMNA 3VO2A 3E3NA 1NMEA 1MBZA 3DMTC 4DSZA 3IS3A 3DCNA 3WIVA 3MK31 5EPUA 4QXPA 3OIWA 1X7XB 4JYMA 2MYUA 5K3SA 4E46A 4OG2A 2ZYAA 2NUPA 3AS4A 3NF1A 4KHPB 1A8IA 1OX5A 3IPYA 4LK3A 3DDWA 2VLBA 1LD7A 1XVIA 5T6MA 3L1VA 1SIWA 3O5AA 4MKRA 3LT2A 3P96A 1ZKDA 1T2FA 4YIHA 3HU3A 1KO8A 1L4BA 4YMUA 2BMAA 1EESA 4WCVA 2JW5A 2KM1A 3B13A 1PF7E 1U9JA 3FXAA 2GD6A 1X7XA 2SNIE 4TKVB 1L7DA 4W5RA 3AJEA 1VFPA 3G0IA 2WYWA 3B9PA 2ROQA 4QBIA 3IB3A 1E4YA 5BORA 1U2QA 1Z7EA 3RV4A 1VPEA 4Y8VA 2DFLA 1KZ6A 2PKWA 4JL6A 1JCQA 4HEJA 4QUHA 4B6QA 4DUGD 2P9GA 3RUPA 2VDKB 4JAVC 5EGNA 2WJJA 4G8CA 1P1JA 1ETUA 3TJMA 2LBPA 3KNZA 2FN8A 4BB6A 1MXHA 3FB1A 3D3JA 3LPAA 2R68A 2X8AA 1TNUA 3FOFC 2GYWA 4HAZA 2BISA 4G0UA 3H9CA 1DG3A 1UXHA 1U9YA 3RFVA 1M8GA 4C7MA 3U16A 3BXGA 1YS1X 2HA0A 2D0PB 3RSSA 1NLZA 1M6NA 2XT6A 1U7XA 2Q3JA 4WSOA 4QE3A 1VCNA 4GKVA 3DXKG 2E5FA 3A4LA 1Q6ZA 1MO2A 3AG1E 1GVHA 1FYFA 1L5ZA 1X8LA 3KSBC 2PKEA 4I17A 3RO2A 4GFDA 5JJ7A 5TQ0B 5DMXA 2LP4Y 3ZGQA 4WA7A 2H1FA 2EKDA 2LCIA 3DHWC 5ENOD 2RCNA 4QQKA 4I9CA 2KYRA 2X0RA 3HDJA 1XRPA 4J0EA 5CFLA 5D2MC 3KLBA 4DV7B 1JYFA 4KREA 1X39A 1W49A 4KRYA 4O63O 3H7IA 5DI3A 3WLEA 2X5JO 4II3A 2PMDA 2GJSA 5HQTA 4KHZA 3R7FA 3QEAZ 1FNCA 2GOYA 1WUTA 2YJ6A 2PWAA 1NLUA 5BSFA 3FOEC 4BLOA 1AS3A 2V7XA 1XZMA 3GGGA 5CB4F 4LGVA 5JANA 4HQNA 5CX1B 3HM9A 4Y0VA 4Q24A 3JRWA 3LQFA 3FDFA 4B3BA 3L1KA 3P7MA 3A6FA 4UNRA 4I5GA 3L06A 5C7IO 1RT9A 1Z7WA 2FGKA 3A0RB 3E7FA 5HRYA 2DR0A 1FDUA 1KJIA 5I9MA 1P2BA 1FZQA 1V9SA 3R76A 3PXAA 5I7OA 4L15A 5JCPA 2ZXFA 1WJGA 1CRLA 1TVMA 5LDHA 4QTXA 4KQXA 1ZNXA 2QLFA 4BRSA 4AS3A 4XQ9A 1MRNA 1K2WA 5AHWA 3L18A 3EK2A 5FQ4A 1SIUA 2ZEJA 2BGGA 1OX6A 1EFUA 4UTPA 5BSWA 3B1FA 3L7NA 3AVVA 1G9XA 3W5CA 4PZYA 3NAQA 2OZKA 4WXHA 3CF6R 5FPQA 3CEJA 3F96A 2WY2D 1YCSB 2ADFA 4XE5A 3V97A 5LDGA 1K27A 1Q20A 1VA5A 3VUFA 1N3IA 1SA4A 3LCMA 3LUPA 2WG0A 1E5TA 1XDUA 4DLLA 5LZ8A 2FW0A 1NE7A 3ONNA 1JLHA 1FSGA 2XB9A 4EHDA 2J0QA 2CDNA 5C2YA 3BUSA 4RYDA 5A06A 4WECA 1Y9DA 2PHZA 4ATNA 4D97A 1RNLA 2OOEA 1FL9A 2FMIA 4MGKR 2R9VA 3TTSA 2O52A 1KKLA 2Q5QA 4RH1A 1L6RA 4KGXA 5CM2Z 4RWEA 2NQ8A 4AKGA 2IHYA 1Z5VA 4KFUA 4D3XA 3CNBA 1NU8A 1PZEA 1J20A 5KCZA 3PDWA 1VGQA 4UXJA 3CZPA 3JD2A 4CMIB 3HLKA 4YAOA 2A0UA 2IOFA 2YXEA 2AOVA 5AJXA 1OCZE 2O19A 2FPSA 1WUYA 1HDRA 3I1FA 3BB3A 2YOFA 4WNDA 5GQSA 1LSSA 2VF7A 1SZAA 2QAIA 2OBYA 4M9QA 4UU0A 3KKQA 3D7SA 2XRMA 4CDMA 1V5IA 3N75A 1B8VA 4ZANA 2PAAA 3HUFA 2Y2UA 4RENA 1H2XA 3ZHEB 3OURA 3O48A 7MDHA 3KEFA 3NW9A 4H17A 3HRKA 1FY2A 3VISA 2AN9A 4AMGA 2TMDA 3SZUA 3A9UA 3LPZA 2V55B 1DX9A 4XWAA 1DO2A 3N2GB 3U56A 3NBKA 2VT2A 3KSMA 3U4GA 1HLFA 4HNAB 1GSOA 1TD9A 1CRQA 3ESZA 3F47A 1X81A 3OCCA 3N6RA 4ZHQF 5LBUA 1F2VA 3KQKA 4Q3NA 4BWFB 2GBLA 1Q2UA 1Z6AA 2GARA 2CNNA 2PLRA 1XWWA 2A78A 1Z56C 4IDHA 3T7IA 4OQYA 4Q4JB 4BQFA 2KC7A 1U3WA 3N2GA 4RK4A 5KVAA 1ZVKA 3RJTA 1NVWQ 1ZH8A 3FX2A 5IXYA 4F60A 1UAGA 3FZQA 1T91A 5D85A 4KZPA 1ZI9A 3I6MA 1FNBA 5TPZD 5KZMB 1KFCB 1X0VA 1V11B 5JAPA 3LC7O 4XD2A 4FP7A 2J9YB 1OKKD 1PEYA 3KP1A 4LNBA 3WMGA 2CFIA 4YRTA 1Y1LA 2C98A 3FSGA 2OCKA 1RYFA 3MTIA 1UBGA 2DSTA 5DWDA 4Q4JA 2FFJA 4POAA 2UZ4A 4I4NA 2HTEA 2HRRA 2IKSA 5CBPA 4E85A 4EGAA 3S2YA 4ZHSA 3WLNA 2HMYB 3TFOA 2H63A 4AIRA 3T99A 4QULA 1JHPA 3HLYA 1J5PA 2JFXA 3KJIA 2DBZA 3TE7A 5AMXA 4N7BA 3GP5A 3GY0A 4LV8B 1KZ9A 4QXQA 2QTLA 4EYSA 4F12A 3S8YA 3R5FA 2JCYA 3G0GA 4IUCS 2YJGA 3ZHRA 4RX1A 2JJ1A 3T5TA 3NHSA 2WUWE 4HAOA 1V2HE 3N71A 4E51A 2QT0A 4PRKA 3HYLA 1T4DA 5B7QA 2CSUA 1WBBA 2SICE 1OI7A 1TQHA 2FA9A 5JEEA 1I5RA 1OXUA 2WKPA 3ID6C 3Q85A 2R4UA 3FOZA 1QYMA 4W99A 1VSBA 5LSAA 2ZVQX 3AR7A 1HZ4A 3VDQA 2PUDA 2NAFA 3IEUA 2JH8A 5HFJA 2C5LA 1SKMA 1E9CA 2IXEA 2HNAA 1K9SA 4MSUA 1VSVA 2JFNA 4IW3B 3DEOA 1JIQA 4PPNA 3TR6A 4R9NA 1DL5A 2I4IA 4PRYA 2YJZA 5UKDA 6ADHA 3HMKA 4CIXA 5BW5A 4WBXC 2G1JA 2HCJB 5TB5A 4I1MA 2I6XA 3E7WA 3N8DA 3FHCB 1MJNA 4QYWA 4UHDA 2HM8A 3MXOA 3GRCA 2LIPA 4CLRA 5I4CA 3X1DA 2AW6A 1H5QA 2HX1A 3OU2A 3OU6A 3EIWA 2VWQA 1QWOA 2AYZA 1U4NA 1F8YA 1SWWA 2J7PA 3TNDA 1FFEA 3OI7A 4ENPA 3C3PA 3BZBA 1L4LA 3ISMC 4IXWA 2XECA 3ZZ0A 5KC9A 1L5KA 1LVUA 1UWVA 2FFRA 2WIKA 1LTXA 4TKLA 4NHOA 3LEWA 3HB1A 3INRA 1UCFA 1UFRA 2JA1A 3SSMA 4KO4S 2WNSA 3JQ9C 1KS2A 4M1QA 4MQ4A 2PLNA 3R5XA 3GZNB 4L3VA 4L76A 4R0VA 2IZOA 3OZBA 4BLWA 5CERB 2I3DA 4QU0A 2FW6A 2IQCA 4E32A 2MHKA 1NN0A 3UJBA 4P5PA 4Z51A 2ZZMA 4TUYB 2AXQA 6Q21A 3ZHXA 2F00A 4PO8A 3LCRA 4TS9A 1EEXB 2BKLA 1P5QA 4URYR 2J3HA 3U2QA 2B8WA 2DPXA 1E32A 1P31A 3EDQA 4CKCB 1DT5A 3LYAA 3BIOA 3G0BA 3RARA 4ANUA 2C9BA 1GY8A 3UIEA 2OZPA 1GTMA 1WXIA 4I0WB 5JH7B 4MUXA 2VJMB 2C5AA 4U0SA 3MUEA 1OZ0A 4TTVA 3UQ3A 4C0MA 2Z8YM 4TUYA 3GDGA 1TTTA 3KL4A 4GG1A 4BB5A 3RHTA 1YHNA 2C0PA 4AI6A 4BMYA 4DPRA 4WJKB 1RXVA 5L51A 3PQCA 3LHKA 2I6FA 2VYQA 1J97A 3ZWVA 1EPUA 3ESRA 1HURA 5ARCA 1Z0ZA 3K2IA 3WA6A 2HKIA 2H4JA 4D9MA 2VJMA 2HDOA 2YJNA 1W94A 1C9KA 3U0VA 4MQLA 3GLQA 3A7EA 4HVCA 4CKBB 4YRZA 3AVUA 2IITA 5LZ7A 4CEJA 1PR5A 4XWYA 3BFJA 4GYYA 3E33A 2QX7A 2F3PA 4UM5A 1LDNA 1KSJA 4LYHA 3A14A 3PPWA 2BKAA 3PT5A 2ZWMA 2XXJA 1OVMA 1PR2A 4HY3A 1PWYE 3VAAA 3Q8KA 4OCZA 3X1MA 3M4XA 1KGDA 2I8LA 1FF9A 1EK1A 2NTJA 1SK8A 4QARA 3DM5A 1HU3A 5K4HA 3JS5A 4R8KA 4CG2A 1W5TA 2N75A 2J5KA 3W8NA 1E9FA 4ZAXA 2PT7A 4FE7A 4IDPA 3OWOA 3I9V1 3ANMA 2VP4A 3NFYA 4ENWA 1K0FA 4NECA 2UYGA 2CVFA 4YCNA 5CG1A 3V55A 1EIZA 4IF6A 4D0SA 5FYDA 4FYWA 4PSKA 9LDTA 2PT9A 3DTYA 1DU4A 3NS7A 1F4PA 2L9BA 3GJQA 4AJ2A 2HGSA 1IE3A 3ENZA 2WTAA 4WUYA 2JGAA 3R44A 4PXYA 5K99A 1Y6GA 5DLPA 1QQBA 3FH8A 3ZGLA 2Z2YA 4BNJA 2XPYA 1IN6A 1IM2A 4E07A 1BE8A 1BOFA 3ORSA 2EP7A 3VHLB 1T3TA 1LTKA 2X22A 4G9EA 3ROPA 2WKWA 3DE3X 2JIZD 5ARGA 4PHHA 3FYDA 3GCZA 5TGDA 4AU1A 2B4QA 5ECYA 1UT6A 2IUYA 3ROMA 1Q7BA 1UDRA 5FBQB 5H9WA 1DCMA 3IAM6 4IDDA 5GTDA 1J25A 2FRDA 3D7MA 4KOAA 1PJLA 2FYTA 1M2KA 1YMPA 1OE0A 1H9AA 4I9HA 2DQSA 2PFKA 3AIKA 1KMNA 1B41A 2XVZA 2RHGB 3SC2B 1C4OA 2C7VA 3GNLA 4I6GA 4AAYA 2AHOA 3FWYA 3WIOA 2XNSA 2ODQA 3WYNA 2AZ4A 3GUUA 3TLMA 2PD3A 1G3NB 4TMXA 2AJLI 4PDXA 2P8SA 1K08A 2G09A 4RY8A 2ZANA 1ECLA 2P2NA 3FDZA 2CDAA 4M99A 3D7NA 4LXQA 3GLUA 5DH9A 4KQFA 5H7PA 1A7UA 1N8KA 1XRSB 3GLTA 1GFZA 1XEAA 1VI5A 2PS1A 1X8JA 3W5BA 1A7KA 1MD9A 4UUAA 3ZS9A 1EFLA 2OVFA 2GK4A 1YRQA 4Q3LA 5KVSA 4D1YA 2WM2A 3KG2A 1BX1A 1PNOA 5DNUA 2I4MA 6REQB 2ILVA 4LX0A 2L0IA 3F9CA 1MDBA 1SR8A 3TJZA 3MJDA 2RAUA 2ECKA 4RWZA 2J4DA 4XASA 1VMIA 2FDRA 1PWZA 1PTJA 4RTMA 1YBMA 2VR1A 1VE1A 4GI2A 4OF4A 3D4NA 2UYYA 4DLKA 4GKKB 4MR7A 1WBJB 4QYXA 3HN7A 2F43A 3RS5A 1KQFA 3TZBA 3STVA 3WQQA 1F14A 6REQA 2C9OA 4IIDA 2YZNA 3E5RA 5EIOA 1Z2PX 4R1NA 2OYSA 2HRDA 4OUDB 2KE5A 2K7ZA 4MB0A 3HU2A 4MHSA 4DV1B 5EE9A 4I2VA 4M6WB 3J81A 4PFJA 2QR2A 3WOVA 3C14C 1GUZA 5KNHD 4C4XA 4AC9A 1XVUA 2R6GA 2FVXA 1GPH1 1UBHS 5IG2A 3MWDB 2IYRA 4WRRA 2FHSA 1MAHA 1RRMA 1X5BA 1LWOA 2FUG1 4QYIA 5P21A 1YU6A 4YCBA 1EMDA 2H5JA 3RKRA 3DGEC 1JPNA 3NHRA 1MPXA 3FTQA 3PXGA 4M6WA 3EPKA 3SJUA 2HHAA 4DZTA 3QU2A 2PN1A 3HUEA 4QEZA 3JYQA 3MWDA 1SU6A 1X1BA 3A1FA 2VO1A 5AI4A 4BX2A 3I62A 3GGOA 4FILA 2P9LG 2NZXA 2FN4A 2EBUA 4YK7A 3EPHA 4U6NA 4BNLA 1T8YA 1AN9A 2YWDA 1EUCB 2VQEB 3KOUA 5KB3A 1SCAA 1E3DA 3K35A 2ORWA 2XWSA 4GO1A 3HI6A 5AK6A 1KVRA 1DC7A 4KBYA 2AG1A 1E59A 1M9NA 2LUHA 3O4VA 1OBHA 4AY5A 1PEDA 4DQLA 3JQAB 5L4SA 3TCKA 4POOA 2PMBA 1TLLA 1NI4B 4UZFA 4WZBA 1EUCA 1SHLA 4RPKA 3I2GA 3LC1O 3WLKX 1QF9A 5F9MA 3BPSA 4IRMA 3DE2X 1JU3A 3HJCA 1OT8A 3AJ8A 2EQAA 2DBQA 2ZUBA 2QMZA 3H97A 3Q3HA 2H52A 3GRVA 4Q9HA 4ZAFA 1JHZA 1G3IA 4PQRA 3F73A 4H1TA 3KTFA 2I7XA 3JQAA 1C8LA 1FYEA 4ZU3A 1NI4A 3G2OA 4Y6PA 2Q1WA 1BQ3A 2DRIA 2GESA 3JARA 1J21A 1DUIA 1P9OA 1N8NA 3OY7A 3DW1X 2C2HA 1SBYA 4AF6A 4TUUA 4WWOA 2QN3A 4DMGA 2ETBA 4BEPA 4XI9A 1IFXA 1GFWA 1G21B 4ZV9A 2DZNA 4WADA 4OHUA 2CUZA 1JAIA 2AG0A 1FUEA 2VTEA 4BL5A 3QB2A 4OSOA 3SHFA 1WXEA 3E2PA 4GPBA 2H5EA 2ZAMA 1R4NB 4LWQA 1JYEA 4QNMA 1DDGA 5ANRA 1GG8A 3EF3A 4LDRA 1E9DA 2BMJA 2P62A 4WFKA 3N7AA 3BB1A 3H2IA 3I5UA 2DF8A 1PR6A 3CRW1 3W6NA 3MTAA 4X90A 4K6HA 2RGUA 5LPNA 4IIJB 1MNQA 2FH5B 1D03A 5TPWA 1TZCA 4AYTA 1U9IA 4F86A 5JQGF 5SY9A 4PX3A 1R4NA 3TQFA 1ZH2A 4RF2A 1VSTA 2VJPA 4M53A 2QMQA 1RPZA 4TV3A 1BX3A 4KR6A 4G25A 2XZPA 5JATA 3OHMA 2IQ5A 1DXYA 4JLSA 4DN6A 1TK2A 1VL5A 2OYRA 2UWJG 3HG7A 2QX4A 3ICOA 3IERA 4FADA 1GQOA 4FQ5A 4IIJA 1F4LA 3NKVA 4G5YA 4KXXA 2JG3A 3UT0A 2V1UA 1BSVA 2QOEA 2OP1A 5IF3A 3NTOA 4P7FA 8GPBA 4UEWA 4CMBA 5K3AA 4TWBA 1UR5A 4EA8A 2ETCA 3QXHA 1PY1A 2YWJA 3R3WA 1K92A 1XXLA 3M1AA 4GTMA 3NBQA 1U65A 2O2HA 3EZYA 4J8YA 2I8AA 3R09A 2V4MA 3PNSA 3AM5A 3LO8A 1P60A 3P0HA 1FRNA 3C8UA 2CVHA 3FJ1A 2ZIEA 3ETHA 5C3MA 2QI9C 2VAVA 2BZ1A 5BWLA 2C57A 4MVCA 5G1NA 2PVSA 4XKJA 3R24A 4YY3B 2HBRA 2PKRA 5D3QA 1E1RD 3WAJA 1BD3A 2YR0A 5G0TA 3GG9A 3WIDA 1U8CB 1YONA 4G24A 2Z4TA 3FH0A 1H0AA 1WULS 1HPLA 2E4UA 3CQGB 3JR7A 2H3EA 3ZHYA 4BASA 1LDGA 1TT5A 3E2MA 1W1IA 3WC4A 2W2VA 4F56A 3RB8A 5EIEA 1X1EA 3H5NA 2UXDB 1YDMA 1NVMB 3FFBA 4LZJA 1AHPA 1CHNA 3QNUA 4UULA 3VZRA 1A8SA 4KBQA 2PMEA 3TECE 4E5KA 2XZLA 3EEIA 4NJEB 4KQMA 2X5KO 4KYOB 4HYYA 3KZ1E 3H5WA 4W8HA 2AA3A 3CNQS 3D8BA 1TPYA 5HK8A 2VHUA 3ZY3A 3EYAA 1BOOA 5AP9A 4QHYA 4FMDF 3BXZA 1YOBA 4OYLA 2ECFA 2YCBA 5C4GB 2I6HA 4G1EB 5D1HA 2JHCA 1OMOA 1TJCA 1HH4A 3UF0A 3EHMA 2IEZA 3PXBA 4XX0B 4PXSA 2O7RA 1RKVA 2JLWA 5BQPA 4HAVA 2BTEA 4F5DA 4NV3A 4ZYTA 1IM8A 2BSXA 3H5LA 4C0QC 2QN9A 1BRMA 4JUIA 4AECA 1ZIYA 1BVRA 4NYJQ 2FPKA 2CHFA 4DKJA 4OJTA 1V7CA 4FBGA 2JAUA 3VQTA 5FLXA 1GGVA 3ZHSA 3FBGA 1TX4B 3GH3A 4YNBA 1CIVA 2CHWA 2IZ7A 3DSRA 2WJVA 3L93A 4UBNA 2G80A 1UFVA 3DP9A 3H87A 4EGCB 1KPIA 2FEOA 3D6VA 4XX0A 5CVVA 4MYHA 1ABBA 1GA4A 3JASA 5I9IA 3MCXA 3VLEA 3ZCRA 3R8XA 3O8CA 4Q1AA 2AR9A 1UPXA 1YS6A 1Z4NA 4IQGA 3QAQA 1O6CA 4RHYA 4WD3A 2I9PA 4WDQA 1SRQA 2EVWX 2XUOA 5GGXA 2EP5A 3IBGA 1EQAA 4Y6LA 2ZJ7A 3WIBA 1J4AA 2CT8A 1WDMA 2II6A 2GRUA 3CX4A 4HLQB 2XWBF 3BDIA 3O9MA 4FKBA 4R2MA 3UXMA 4GX1A 4PH4B 3G0OA 5F2NA 4ZVSA 3LNTA 4J4HA 3M81A 1A72A 2OY0A 3NU1A 2ZAOA 1R3UA 4FNMA 1QQ5A 2VH5R 3LNCA 3FP3A 2ODPA 3HACA 2DWPA 4OQQA 2B4TO 2N0SA 5EZYB 2DTEA 1YNOA 1ISJA 2Z2IA 3CBQA 3HP1A 3B8HA 3F5FA 4B44A 3AM3A 1G8GA 1FNSA 4P82A 1HFEL 2E49A 4B6OA 4AY3A 1GYRA 3ZLVA 3NOCD 3PEFA 4PEVA 4OHZA 4HXGA 4L27A 2WWFA 3Q9LA 2WYIA 1U4OA 4H7EA 3FPBA 4GNRA 1WETA 3ZE0B 1BHO1 1B3RA 5ER6A 1ELWA 4JXXA 1Y80A 4XQ0A 5IBQA 1E8NA 2O2DA 3OAAD 4XYMA 1JFRA 1BCSB 5IWAB 1ZAKA 2ZISA 1KPGA 1M0WA 3X2SA 4OH7A 3VX3A 1IVNA 1P6QA 5FYQA 1K6MA 2NX2A 1DG1G 1KJZA 1PRYA 3AKDA 1P80A 1A5TA 3MX3A 1C7QA 1ZCJA 5LMNB 1A4IA 4DRXA 3G1TA 5BRNA 4CDGA 4MCIA 4O4JB 3S2IA 3K09C 3PYLA 3ONKA 2QA5A 3H4MA 4BGEA 4X3OA 2PX8A 1SVKA 1WD7A 3C3QA 5M34A 1E0DA 4H6WA 2FN3A 3VHXB 4XFDA 2FI1A 3CURA 4X8LA 1DO0A 4CFYA 3UX4A 1NI5A 4R05A 5JZVA 3LQ4A 1K6XA 3FUKA 5C37A 3JQ6A 4X1IB 3K20A 4IHJF 3ZZMA 1ZK3A 4EVSA 4O4JA 1JVNA 1JLRA 4NK4A 2UVDA 2HWUA 2J9XB 1KU0A 3G8CA 1HLDA 5AT1A 4TV8A 4Q16A 1KSFX 4ZDWA 1OWOA 3R6WA 1TN6A 2FDXA 1MIOB 2ZK7A 3A0UA 2W4IA 4X1IA 3DAFA 4BUCA 2LAHA 3R20A 1T9DA 4MRSA 1AK2A 2AI2A 2O3UA 1RC1A 4IZIA 1HZZA 3FI0A 4J8FA 1UQUA 3KVYA 2QYUA 1EVZA 1P33A 3D2BA 1PVDA 1JR3D 4CZ2D 2V6JA 1YC2A 2BBOA 1JJ7A 1Z13A 1MIOA 4C6RA 4OHBA 2YNMC 4GZMA 1AN0A 4OLJA 2BE9A 3QFHA 3UG6A 4YUVA 4ZVQA 2IHTA 4L8LA 2C99A 3V42A 2X19A 3FN4A 2CV1A 1H6CA 5A5DA 1FFWA 3TQCA 2VSFA 3QK7A 5IUKC 1JYSA 1DJOA 2YWHA 5COBA 4B6EA 1NNSA 4WCDA 5BN1A 4B3FX 1Q0ZA 2XUIA 1NSFA 2BM0A 4K9MA 2OPBA 3PA8A 1Y8ZA 5AJYA 3CLVA 4FFOA 2GERA 3O74A 1M72A 2WKQA 4FR0A 4P34A 1ZL2A 1O96A 2RJOA 1COWD 16PKA 3R3HA 3UY4A 3B70A 4UQXA 4P38A 1OROA 4KXFB 2JGDB 2J30A 4ZI3A 1BA3A 2J85A 5IKOA 2BGLA 4J7AA 2AD1A 1Y81A 1XO1A 2JASA 4R69A 3HBNA 3DBIA 4BEJA 3G9QA 3FPJA 2CF5A 3L7MA 8OHMA 5HCNA 1GRVA 3F90A 5A9SB 4R8VA 1JKXA 2JJMA 1J6UA 1N25A 5HTKA 1G8KA 1EGAA 5EYLA 3M1YA 4KEAA 1ZHFA 1AKQA 3BJMA 2VKTA 2VXBA 1XLTC 5H16A 3TTYA 2Q6LA 4KUHA 1PDVA 4UBJA 3QPAA 3DF7A 1H1DA 2ZBPA 1GAQA 2K6GA 5LA6B 4RF3A 4HWKA 1KI4A 3E9QA 5A9SA 2W6CX 4FHJA 1LTQA 3DMRA 4LFCB 2HR1A 4DGSA 1N7HA 2AFHE 2A1TR 4PSCA 3QF4A 5BN3B 4G26A 4I50F 4DWJA 2V6FA 3R0QA 2DQ4A 3KEQA 1V45E 1DFIA 4UNNA 1C7RA 1TYCA 4N5MA 1CYEA 2LTAA 1E64A 2ZYUX 4MCAA 2Q1XA 4Q3EA 4IIVA 1MG0A 5AI8A 3T5MA 5K0FA 5IRCD 4ONEA 5LA6A 2QSJA 1RZ4A 3H5AA 4B7XA 2MYNA 1XCJA 1TO2E 2VDMB 4EY7A 4B3TB 3BB4A 4WLEA 1IOWA 1TUGA 2SHKA 2PX6A 5EJ8A 3GQBA 4R51A 3ADCA 4QFMA 4P4UA 3WA7A 3HDVA 1T8PA 5BN3A 5IVHA 1E92A 2X2PA 2NSJA 1FSSA 5K0NA 4X1YB 3UB3A 4N76A 4O29A 5EVCA 3CHRA 3LYUA 4I5IA 2HMAA 2BEWA 1SVSA 3M7IA 2P3OA 4CBVA 3ZV5A 3D4IA 2NNWB 5JPDA 3PFBA 3S1SA 3IILA 5LLTA 5FUYA 2W6JA 2XAUA 2L6BA 4CLOA 1VE7A 4NV1A 3KJEA 1X1DA 2QTMA 2WYHA 1TK3A 4KN9S 2XUPA 3RAUA 4MW0A 2YY5A 3BIXA 4XM1A 3AR9A 4OQMA 2GSWA 4J1NA 5JIBA 3INYA 4X1YA 5IKPA 1BDJA 5H83A 5CXSA 3SEZA 2PY6A 4Q7KA 2QL9A 4KX5A 3S5UA 1T3LA 1VIMA 1ILWA 2V7BA 5KQPA 1T5HX 1ADGA 3FUXA 3GBSA 1UPAA 3AUAA 3SBEA 2HAEA 4JBYA 3C1UA 3ZE6A 3K5IA 3ROXA 5FWXB 1J0AA 4NOMA 3KEMA 1YAJA 3VR4A 2XXBA 1MENA 4C7JA 1V55E 4D3FA 1I5EA 2IPNA 4Q4AA 3T7EA 1RVDA 3B3GA 5AXCA 1ZNZA 5KI6A 3L5KA 1Z3XA 4AYXA 1SCNE 4DCTA 4IUBS 5KJ1A 3A05A 1ISIA 2O8NA 3SF4A 3X1JA 2XQVA 3B1YA 2HO1A 4GA2A 2OG1A 4KGZA 2HK6A 3TPCA 5AKJA 3KZXA 5FORA 1E94E 1H6BA 1NURA 4TKUB 3DT6A 3U5TA 2BBTA 1PW7A 3EZXA 3G3EA 4W4TA 4RE5A 4C0XA 5IYZF 4FYJA 1L4EA 4TMVA 4GM4A 3FLMA 1L2TA 5E95A 4DDHA 2RE8A 3SJAA 1AMUA 4JUFA 5AKKA 1XR3A 4UTNA 2IBTA 2PXXA 5B64A 1ES9A 4L9AA 1AF4A 1I7PA 4C7XA 4TKUA 1I51A 4U2FA 4KMOA 1AA6A 1FFBA 1R6XA 2GWHA 4JJ6A 1Y82A 5BVHB 1KFEB 1S3FA 1QDUA 1MABB 1K06A 4OGWA 1HTWA 1XZPA 4ARBA 3KQYA 2VBIA 4AQ7A 2ZRLA 3PXUA 2JDID 4PS0A 2FO1E 1H2TC 5F5NA 2ZBUA 4EQZA 4BE9A 3OFNA 3KAEA 2NUPB 3UANA 4JQCA 1DX4A 2XITA 3JATB 2EKPA 1U0SY 4B4WA 3JVVA 4G5GA 4N7RA 5BVHA 5J58A 4Y2JA 1PWHA 3UAOA 1R3DA 1F4VA 1PFUA 1P2SA 2BWJA 5JMTA 1U8ZA 1O0SA 2HMUA 1XLWA 3BE4A 2CV2A 2PLAA 2ZJYA 1XNQB 1J5XA 2P9JA 2GZDA 4JP5A 3TUJC 4GPEA 3RH0A 3B13B 3E8XA 4KDCA 3ELWA 1FTNA 2XRZA 5EJGA 3VKFA 2PH5A 3WLQA 3WQRA 5L3RA 3AR3A 3R7AA 1V9LA 3TK1A 3JATA 2KB0A 2IRWA 1V26A 4L50A 4DARA 1PBNA 1CRPA 8LDHA 4CF4A 5CM8B 4B82A 5SZIA 1DTWA 1KI6B 3T3OA 4NZNA 2G4LA 4M22A 3HXLA 2VJOA 3G88A 1FDSA 5FR1A 4KJZA 1TM1E 4JLPA 4URZR 1XDWA 1GUYA 3VX4A 1Z82A 3H1PA 4LYEA 4XYGA 1I2AA 4BQQA 3I9OA 2FWAA 4RV9A 2IY0C 3HRAA 2G40A 5KYYB 1YR7A 3CINA 2DT5A 4MX8A 4RZ2A 2OO3A 3WWEA 4HAYA 1KI6A 3TIGA 4XVRA 2ES4A 1OAKA 5AO9A 4K6FA 1EAYA 2Q2VA 3TIFA 3V7WA 2ZRBA 3D6AA 3AY0A 1RIFA 1MJGM 2DLCX 5BV8A 3KTOA 3CUVA 3SYTA 4TGLA 1L7PA 5KYYA 2OCGA 2CLSA 4IIBA 2PXCA 2Q07A 1NBAA 1GQQA 1QE5A 3EZLA 4B4VA 2FWBA 3OX2A 1A98A 3RK6A 1I36A 4MRRA 1LPAB 4EF4A 3USES 4GRIA 4MGZR 4FYVA 2R00A 1JHDA 2B7LA 1VPWA 4R40A 1RXIA 2KLBA 3DL7A 4FW9A 1J2UA 3M3HA 4RV5A 1PC2A 1H2RS 1YS2X 3WFZA 4JI3B 1VE3A 5DI3B 2A4MA 2JVKA 3PS6A 4JJEA 4LGMA 4A8JB 2LKDA 1RAEA 3IE2A 4JR2A 1U1DA 1XTQA 2Z2XA 1DQYA 1HO3A 4Q1FA 2BE7A 3PD7A 2RHCA 1C50A 4QIHA 3OJXA 2AS0A 5FI5A 3IHTA 3I4CA 3AUFA 2GEKA 3UUGA 3OUZA 5FPYA 4ARCA 2HA2A 2P9CA 3WHKA 3KZMA 1J1UA 4DA0A 4HNTA 5BXQC 4YJ2A 2ILRA 4DABA 4RH3A 4A8JA 2HJSA 2HTFA 2GQ0A 3PRYA 3ASZA 3PFGA 5REQB 4EG1A 2XVMA 4Q7LA 1FJHA 3RVPA 4LF6B 3ZD7A 2V7EA 2DM6A 5SZHB 1OWLA 4LG6A 2BSQA 1LUAA 1ULSA 3AS5A 1JQAA 1UJ2A 1TIPA 4B8WA 4RF4A 4H4EA 3LJNA 1E1LA 3ZXPA 2YDYA 4QOHA 3U4MA 3TWQA 2RBGA 3A6KA 3K0SA 3ZZNA 1OY3D 3K0EA 4U39A 5REQA 4YRJA 2L17A 1ZRMA 3W5AA 2C9YA 3EZFA 4PS3A 1RQ2A 2YMPA 3BWDD 5DNCA 4W7HA 4QRIA 3QEKA