4U8HA

Crystal structure of mammalian period-cryptochrome complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
490
structure length
490
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular assembly of the period-cryptochrome circadian transcriptional repressor complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein/transcription
molecule keywords Cryptochrome-2
total genus 146
structure length 490
sequence length 490
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4u8hA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u8hA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4u8hA01
3IMCA 4ZT4A 4UZEA 2C5SA 3CVUA 3COYA 3HGMA 5FNZA 1H1TA 1KAQA 4ARCA 3TNJA 3IVXA 3RK0A 4R2LA 4ZT2A 1JMVA 5J5AA 4EG3A 4EG1A 1O0BA 3RHSA 5BNZA 3OP1A 1EFPA 3MLBA 2OV4A 1OWMA 2QJOA 2RE8A 1H3EA 1N2GA 1TYBE 1ILEA 1J20A 5TEVA 3H99A 5LFAA 1O94D 4E1AA 1XNJA 1N2BA 1KORA 3HFJA 4AQ7A 4U8HA 3KFLA 1YI8A 3N05A 4CDMA 1J1ZA 1JHDA 3ZIUA 3A2KA 1M8GA 2EJCA 3FG9A 3GMIA 3Q10A 1N77A 4CDNA 3UK2A 3OTWA 2CV1A 5IHXA 3ISJA 3UMVA 2DUMA 2QJFA 1QU3A 3N8HA 1WXHA 1Q11A 3IMGA 4K0RA 4J76A 1EFVA 5J58A 3FOCA 1WJGA 3H97A 1F7UA 3G5AA 3RK1A 1G8HA 2A4MA 1QNFA 3CVWA 2EL7A 4KPUA 2PG3A 3ND5A 5KHAA 3CVVA 3CVXA 1M8PA 1U7XA 2PIDA 1N2EA 3P0JA 4FZJA 1N3LA 1OWPA 1VBKA 3FWKA 1ZH0A 3C8ZA 3IUEA 4XFDA 4PBSA 1T6XA 1S4MA 3Q4GA 5DEOA 4MUIA 4EG7A 3D6UA 3SDBA 2XRYA 3L93A 4QRDA 3BL5A 2ZP1A 3X1MA 3IOEA 3LE8A 3CA8A 3DLAA 4EG8A 1N2OA 4MW4A 5F23A 4BWVA 4MUJA 2QJTA 4MWBA 5FO1A 5IJXA 1NUSA 1X8XA 4NAHA 2CYAA 1TYCA 3FDXA 1GAXA 2PZAA 3IODA 1WZ2A 1N1DA 2WB2A 4YMIA 1OBHA 2NZ2A 1O0CA 1T9GR 3HL4A 1EE1A 4NATA 1EUYA 4U7JA 1KQPA 3G59A 1EUQA 4MW1A 3CLTC 1TQ8A 4MULA 1F4LA 1B6TA 5J59A 4AS1A 2JANA 3AG5A 1QRTA 1OWOA 3AFHA 1FFYA 1KR2A 3RJZA 2VTBA 3KT3A 1MAWA 2DPLA 4DJAA 3QTBA 1R6TA 2G36A 1M8JA 2CFOA 2ZUFA 3QTTA 1J1UA 4MVWA 1K97A 5EKDA 1I2DA 2B7LA 3NBAA 1OBCA 1J09A 3AKZA 4F3RA 2A84A 1JZSA 1NZJA 2R5WA 3DPIA 3IDFA 2PZBA 2V0CA 4R2MA 4Q93A 4KPUB 1NUUA 4MUNA 3QE4A 3ZJUA 4A91A 4XSVA 1GZUA 1VBMA 2CYCA 3NV7A 3AG6A 1JZQA 4MUKA 4ND7A 2IJGX 4S1OA 4EG6A 2A1TR 3CR8A 4OUDB 4GRIA 3CLUD 1O5TA 2XRZA 1O94C 3CVYA 3COVA 3P52A 4ZCTA 4HJXA 5HUHA 5H16A 5TS2A 4PBTA 4NZPA 3N2YA 4MWDA 1U3CA 2DXIA 4MWEA 1O97D 3CLTD 1GPMA 1MBZA 1R6XA 4MUGA 1O96A 2X1LA 4HK4A 2D13A 2J08A 1MJHA 4KR9A 3UY4A 3PNYA 1IQUA 4MVCA 3TS1A 3X1JA 3A4IA 2H29A 3UOWA 4KKVA 1OD6A 4R0NA 1M1ZA 3IVCA 5HUJA 4KR7A 5JBNA 3DV2A 4MW5A 3COZA 4CT0A 3GLVA 2O5RA 4HPWA 1Q19A 1K92A 3PNVA 1IQ0A 1O6BA 1JEEA 1FYDA 1BS2A 1XNHA 3D6VA 4ZT6A 3H05A 4ZT3A 3FIUA 4UZFA 3E27A 2TS1A 4OJMX 3P0IA 3ZGZA 1N78A 1N2JA 1G8GA 2I1LA 1IVSA 4DDHA 4L2IA 1U3DA 2QTNA 4PBRA 2BTEA 3ELBA 4MVYA 3IOCA 5DASA 4G5YA 2ZUEA 1VLHA 4JXXA 2WQ7A 1KAMA 1WXFA 3ZXSA 2X1MA 1RQGA 2D54A 4ZCPA 1GTRA 1GLNA 1PFWA 1U0BB 3MLAA 3JXEA 4QBTA 3DO8A 2QUIA 1WY5A 3M5WA 1O95D 1O97C 4DDKA 4Q16A 3GUZA 4JFAA 2J5BA 3A04A 4MWCA 4I6EA 3IOBA 1F7VA 2VTBB 5HG0A 1SURA 4EFKA 4DDMA 3VRHA 3IH5A 1XNGA 1YULA 2E18A 1KH1A 1MAUA 1U7DA 1R6UA 3A05A 1A8HA 2CUZA 4WNYA 3TQIA 4MW9A 3PXUA 5TGTA 3N9IA 1EXDA 1PFVA 4TS1A 3SYTA 4YBRA 2CV2A 1IQRA 2YXNA 3ILVA 2DERA 1Q15A 1KQOA 1JECA 1OWNA 3INNA 1T9GS 1NP7A 4PY2A 4YP5A 2QUJA 3X1KA 4ZCSA 1NUQA 3SP1A 1UFVA 2WQ6A 2J09A 2YWCA 5LM3A 1K4KA 3H9CA 3FI0A 1ZUNA 3FNRA 2GM3A 1JEDA 2X0KA 4DNXA 1GTSA 1QTQA 1EJ2A 2A1UA 2DR2A 2PFSA 2CV0A 4HJRA 3CLSD 3K32A 1CT9A 1MRZA 1V8FA 1XJQA 2IELA 3IVGA 2O8VA 1KKUA 5FO0A 2IP1A 5AHWA 3TZLA 4K03A 1PG0A 4RUKA 5KCMA 1JIIA 1IFXA 1ZH6A 5KWVA 1H3FA 1QJCA 1KQNA 2JA2A 1N2HA 1IHOA 1J70A 1YIAA 1I6KA 4ZCRA 1QRUA 4JXZA 2DETA 5K0SA 3SEQA 3NBKA 1NUPA 4ZT5A 1WQ3A 4H3SA 1T6ZA 1N75A 1V47A 3PNBA 2J4DA 1YIDA 4JYZA 2V0GA 3MMXA 1NYLA 2QTMA 3RFFA 3IUBA 1QQTA 2A7XA 4XFJA 2AZXA 1PFYA 3SEZA 3ZUGA 2X3FA 2A88A 3SZGA 1H3NA 3U1VA 4CQNA 4EG5A 2YWBA 3HZRA 1WKBA 1JILA 3ND7A 1PFUA 3RBAA 2YY5A 1MB9A 2VXOA 4I6GA 2HMAA 3Q12A 4EF6A 4MUHA 2H2AA 3VU8A 2CSXA 1M8KA 2A86A 3COWA 1G8FA 4KR6A 4WSOA 1D2RA 2A1TS 2WSIA 1M8FA 1YUNA 4U63A 1VBNA 4MLPA 3LCJA 1JGTA 1NI5A 3AIIA 1P7PA 3CLUC 3SZ3A 2Z09A 1MB2A 3MXTA 4EG4A 2HGZA 2CYBA 1KH3A 4NDAA 4QREA 2DLCX 1ZJWA 1Y42X 2A1UB 4F4HA 1NUTA 1Q77A 3L92A 1KP3A 2E0IA 4ARIA 5DB4A 4P2BA 1NSYA 2QTRA 4NAUA 3AL0C 1TEZA 3TZEA 1MOPA 1ULHA 1GN8A 3HMQA 4J75A 3K9WA 1JIKA 1IH8A 3IMEA 2JAXA 1QRSA 2QUKA 2E89A 1KP2A 1MC1A 1K4MA 1COZA 4ZT7A 5H7XA 1I6LA 3P0HA 1N2IA 3PRHA 4YP6A 3HV0A 3KT0A 2E21A 1F9AA 1LI5A 3LOQA 3CLRC 1WXIA 3F3MA 4ND6A 1WOYA 4MW0A 5LLTA 4DLPA 2GKSA 1TFUA 2Z08A 3ND6A 1WQ4A 1X6VA 4EGAA 3ZJVA 2PZ8A 4MUEA 3KT6A 4MW7A 4RPIA 1IRXA 2PXHA 3TQOA 4MW2A 1TYAE 2Z3VA 3KT8A 4X0EA 4JZYA 1NURA 3I05A 4MAFA 1O96B 1O95C 1EFPB 3CLSC 4L2IB 1VL2A 1JIJA 1EFVB 1PG2A 1LW7A 2BYTA 2RD2A 2QUHA 5K0TA 1M83A 2OQ2A 3FH0A 3G6KA 1DNPA 2D5BA 2HZ7A 4OUDA 1TYDE 3VGJA 3ZXIA 1LI7A 5TEWA 1T6YA 3MUEA 1KH2A 3CLRD 4MUFA 4MVXA 3FHJA 1WXGA 2CT8A 1WXEA 2J07A 3FETA 1QU2A 4MQ6A 4YP7A 1I6MA 2NSYA 4MW6A 4ZCQA 1YUMA 4I6JA 1G59A 3UC5A 3ZJTA 4NX2A 2DEUA 2AG6A 4GU5A 5DK4A 1HYBA 1J21A 3H9BA 4DE5A 3S3TA 4G6ZA 2AKEA 1OWLA 2GOYA 4G5FA 3FY4A
chains in the Genus database with same CATH superfamily
1AQUA 1NBAA 2RCNA 2YN0A 5D5HA 2J3DA 1E69A 2GMWA 2VWQA 3NHUA 4R01A 1V71A 4X95A 1K8KG 3RB8A 3FR8A 1T24A 2X9NA 2V7PA 1YMQA 1T36A 3VBEA 3G9QA 4OP2A 2E9SA 1ADYA 4AS1A 1T8RA 5D85A 2PUCA 3WQRA 2W2TA 1QH8A 1N2CE 1UOPA 3OKFA 4HX9A 3SQLA 3HPQA 3JQ6A 5HKBA 3PEYA 3S5JA 3PQ5A 2GK6A 3CRW1 4L5AA 3E7XA 1N6HA 3KQSA 5MGBA 5BN4A 4YDOA 3IP7A 1QZ2A 1NUHA 4NMWA 3DTVB 3NKVA 4WN9B 4BB0A 1P0QA 4FWIB 3WL8A 5ILOA 1EESA 1A5ZA 1KR5A 1QDLB 1G2PA 4MPPA 1PV1A 4XZ3A 3T5BA 3VR2A 3B1VA 3ZX4A 2RMKA 5E1MA 4DXHA 1CR6A 2LXMA 1Q7RA 1X7DA 4P7JA 5LD2B 3TL6A 4RVHA 5B64A 4Z4EA 1WXQA 4HUQB 3L08A 3EGOA 2A78A 4AP2A 2G7ZA 3JZDA 3UMVA 4FDVA 3TLZA 5LXTA 3R8FA 4K8OA 4C30A 2XRFA 4WE3A 3AFIA 5AI0A 3V8RA 3R0XA 1DV1A 1ZW6A 1QO0A 2I99A 2JFXA 4KV7A 4BNVA 4H18A 2A9RA 4HAIA 3DPDA 3IMGA 2PZJA 1ZGZA 1EVIA 3QXHA 1PJCA 1MX5A 1WMBA 1JHXA 1LS6A 1Z15A 1TR4A 3D02A 2Z30A 2FO1E 3LS2A 4YV1A 1GNSA 1F7UA 2C9OA 1AK1A 1EFHA 4ESEA 4XOUA 4G8LA 1WR8A 1NQTA 1DC3A 2XYGA 2GPJA 3WFZA 5IBPA 4KITB 4AMYA 3HXDA 3GAFA 3GAMA 2EG5A 3SIWA 1Y81A 1FW6A 2Y69E 3H9JA 1MXHA 3NT2A 4ZKEA 1T5TA 1JBKA 2OZEA 2Q99A 4FZJA 2PIDA 3OFJA 1N2EA 1OCRE 1HT3A 1QQAA 1VBKA 4OY3A 1L8QA 1FA9A 2C78A 4LWZA 3F6RA 1VSTA 4JBNA 1ADCA 1EIZA 4DX5D 2ZUWA 3BZWA 3T5XA 3HYSA 3OM1A 1WV0A 4RMHA 3LQKA 4LUNU 2F8XK 1SAYA 1GAEO 3QLVC 3RYFA 3O82A 2OXCA 3D6UA 4MWGA 1UXJA 1H22A 1D4ZA 4KQWA 4QRDA 3SQWA 2H17A 3D0QA 5DSZA 4WZBE 2C7OA 4MLCA 4LERA 4HTAA 3WMFA 4F1JA 1RJEA 3NJ8A 1XVIA 2ONYA 3G0CA 3TIGA 2FPPA 4NI5A 1LXCA 3GXOA 2NO4A 1K9SA 1DKPA 2R8BA 3EHDA 3I2KA 3KNZA 3E3NA 3ZU7B 2GN4A 3IODA 3P97A 4TKVB 3T7AA 1U2SA 3KALA 1E2BA 2NZ2A 4N5DA 5BNFA 1BE6A 1OCOE 1EE1A 5FPPA 3U3MA 1T0JB 4L9AA 5IYZF 3K6SA 5J4YA 3UT7A 1IWOA 2C0MA 2FN9A 4MULA 3S2YA 1E8MA 1XTQA 1K5DA 3C3BA 1N2SA 3QVWA 4ZIRA 2O4CA 4LK2A 3IC5A 4EAQA 3ASFA 3BT7A 2C9YA 1JTVA 2CZQA 2GBGA 4KX5A 2P5SA 4OHPA 4JI6B 3T9FA 5IAAA 1H2BA 2FI1A 2GYVA 1QHNA 2O4UX 3DQPA 2VS1A 4IDGA 5JI3E 2QBYA 4V0MA 1DKMA 4Q69A 2BUCA 5D3MB 5JJCA 1KTVA 5JSUA 1GVNB 3MJCA 4DQDA 1XJ0A 3NVMB 3HZOA 2K7FA 4N0DA 4OTZA 1Z28A 2C3PA 5IU6A 3HACA 1Y48E 4Y2YA 3F1LA 2A2ZA 2AG1A 3E18A 5BT1A 3AFGA 3ODGA 3P8ZA 4PZLA 3IAS6 3TRHA 3ZNOA 2IQIA 4ALKA 1SQFA 4N1AA 4RF2A 1H8ED 4AG5A 2B0JA 4N03A 3SHQA 3ZNQA 3ZDQA 3OWXA 5D8DA 3HVEA 1NFRA 4OREX 2VZ9A 1C7IA 1NVWQ 3CEQA 4QJ4A 1XA4A 2IX3A 1XE3A 1YZTA 1W59A 4Y9DA 1DEAA 4RFVA 1N52A 5GIOE 2WTEA 2XEHA 1R4MA 5C37A 4UWHA 1BFDA 2RH8A 2VSYA 1N2CB 2AG5A 2ODWA 3CPJB 3V7NA 4OAPA 3IB6A 3UXMA 3W8NA 5KQRA 1TQDA 1Y98A 4OIFA 3SI5A 1ZPDA 4J90A 3U3JA 1KO5A 4YRFA 1X7XB 1DC7A 3PHIA 4W4TA 2A1TR 3CR8A 3FMPB 1FDOA 1CIPA 1O5TA 4ANUA 2C97A 3COVA 3M5DA 1JWBB 1SKYB 4HDRB 4DM7A 3D54D 5K2MA 4RK1A 4FIZA 5KNBD 5KINB 1CYDA 2AXEA 1L5LA 4EY4A 2FFBA 4L8VA 3EIQC 2IY7A 3L3BA 1O9BA 1IATA 4QTTB 4RJJA 1JWAB 2YV5A 4G11A 4BBAA 1X1DA 1IEQA 4J91A 4KTTE 5DHTA 2UYGA 1I3NA 2BEKA 3CSTA 3E5NA 3NZUA 3CHMA 1UBNA 1NJ1A 2QJRA 3CSDA 5AIBA 2FFAA 3TNLA 5IRCD 3Q0TA 4MS1A 3T6KA 2WK1A 3NYIA 3K15A 2G9RA 1JR4A 3UOWA 1KQGA 4RTLA 1N0WA 2PX2A 3HO6A 3S2IA 2J45A 3G13A 4K6KA 4WOJA 2VK8A 1LBHA 4TUUA 4B35A 1JG3A 1NHGA 5BN3B 1Z88A 4KR7A 3SQVA 2FFHA 4FSDA 3FWYA 3WLNA 4HAVA 4PZYA 3BTSA 4JBYA 1FXSA 2PVCA 3QV2A 3KB8A 2P11A 1SG9A 4RTSA 4DV5B 5TV2A 3M33A 4OP3A 1KIMA 2AOTB 1KGSA 3ICCA 2D0DA 3LBIA 1U8TA 4TXHA 3D3MA 1Y9JA 4L7VA 1FQWA 1I5RA 2XQFA 4U00A 4U0JA 4ENRA 4Z4IA 1DX9A 3ZGZA 1E8WA 3BK2A 5EGSA 2P41A 1JQBA 2RGXA 1H6OA 3GUYA 4WKBA 2E4YA 4EUFA 1IVSA 1IN8A 2H06A 1J8MF 4Q15A 4ZAFA 3TCKA 3FOBA 4LF8B 3EMKA 1ZM4A 3FR7A 1NOJA 1S8AA 4PCVA 10MHA 1Y1LA 1H1DA 5AOVA 5FIOA 4NHEA 5DYIA 3GVCA 3K94A 4Z9XA 2WG0A 3RQSA 5LQJA 1G21A 3M6XA 1X7YA 5FIUA 2AJLI 1PFWA 1U0BB 1TTPB 5MN4A 5FLYA 3PS6A 3TXNA 4IYRA 3BG1B 3Q49B 5LCWC 1ULSA 2QUIA 3EPRA 2NO7A 1U9ZA 1C81A 1COWD 1VLJA 3U5ZB 4GPTA 5TQVA 2HHHB 1ZSYA 4UXIA 3EARA 4I1RA 3RS7A 4BEBA 2AHOA 2Q4DA 4IHJF 1J06A 2PMBA 3GUZA 3T8MA 2QIOA 4P83A 1PJTA 4UEKA 4Z86A 3U2QA 4EVIA 5I9TA 3DWLG 5A71A 2CFTA 1OB5A 3AZPA 4ZEWA 2PRSA 1G5FA 1HOXA 2OAEA 1W5TA 1JTFA 1KDPA 5LQDA 4YR9A 4PXSA 4G8DA 5LQMA 5JECA 1MAUA 1U7DA 5M5BA 3A05A 2OGZA 1T0IA 2HJSA 1Z6AA 4Q4JB 2C20A 2L69A 2YMPA 4PYOA 4AIIA 1VGVA 4UMEA 5LB2A 1LZKA 2VH2A 3GB9A 1V4NA 2ONKA 1IQRA 3EDRA 5DLDA 2HX1A 1PLLA 4JJEA 1JHQA 1F6WA 1YQXA 2X23A 3FPHA 4B0OA 4BJ6A 4IF6A 5AOBA 2O0JA 1NP7A 4HQFA 3FOAA 2JGNA 1E58A 4AKTA 1A5TA 1PU2A 1D7AA 3RRUA 4ZOQI 1WCXA 3PPYA 4PNPA 4TVOA 2IP4A 1V0JA 1A2OA 2EERA 2OFWA 4Z0TA 4UNRA 5JAMA 5EERA 2GNOA 5EJ6A 2G3YA 5D3MA 1Y0BA 5DX0A 1KO1A 1KYYA 4B6OA 1B6RA 1WUJS 4PRKA 2GAOA 5HRYA 5FOSA 4C4SA 3OTIA 2QQGA 4HNRA 2Y0DA 4K6CA 4KH0A 2PUTA 4PTYA 3CONA 4RF4A 2CFCA 4H08A 3TQTA 2HRDA 4YO8A 2O59A 1TI7A 1DAKA 1F38A 2P30A 2EC5A 3QP9A 4NECA 4ZO6A 4UFPA 4AY5A 1M75A 1N9AA 3DFZA 4C2UA 1QH1A 4QDTA 4ZVNA 1A71A 5BW6B 2H2WA 4I1VA 2PRKA 2Q1WA 4ZGBA 3KKOA 3P9ZA 4HGYA 5EEGA 5H3HA 1HRKA 4DR5B 4IDAA 2HJWA 3BFKA 2WU4A 1WULS 2BFWA 3F8TA 4MAAA 1C80A 4LMPA 5EHIA 1J6UA 1PG0A 1XZQA 1YVRA 3BIOA 3KSRA 3CX3A 3NW9A 3QQ5A 3KUXA 4R68A 5DN6A 1Q7GA 3Q41A 4ZAZA 5F9HA 1DEKA 4H60A 3PDIA 3OX2A 3CF6R 3JU3A 1YAHA 5TVKA 3U3WA 1O3YA 2FFQA 3U48A 3PJRA 2ZJ8A 3Q3GE 4X92A 5TE9A 1TKAA 2J33A 4EZEA 4E1VA 3LTNC 4NK4A 3DSXA 3KOWA 5HKOA 4JVMA 4YXFA 4F53A 3CJRA 3WGGA 2F8SA 4US0R 1QTIA 1PIWA 2D7JA 4FCCA 1E94E 4JJIA 4ZI2A 4ACKA 1EGQA 1UR5A 3JWPA 5T4EA 3C1OA 2AOUB 4REQB 5TRTA 4AZWA 4DIUA 4V1CA 5ENTD 2VYIA 1V8BA 3PGMA 3BOSA 3EVZA 4HXGA 5ALUA 5GOZA 4ANXA 1Z25A 3J81k 2FHSA 4JT9A 1XXLA 3PFIA 1W48A 4XFJA 3R7SA 4UE2A 5AENA 4MWSA 2FF7A 4PVCA 2QTHA 5DTIA 3TZBA 3OQOA 3E23A 2P9BA 2X3FA 2V96A 4K6FA 4YN3A 3WTCA 1GO2A 1ZD1A 1P9NA 4RZSA 1D1SA 3K8YA 5CNKA 1NBMA 3FTWA 3HXKA 5FUBA 5HBGA 3IL2A 2B9EA 4BO8A 1E1YA 1M5RA 3NVDA 4MLDA 1Z3YA 4O4HF 1RJGA 3M7IA 3D4BA 2JGFA 2AMLA 2Z4RA 5FWYB 1UXIA 3BK7A 3ONNA 4MJLA 3AF0A 3T4PA 3B7WA 1JYEA 3CVLA 1UH5A 3N0RA 1AZLA 1PL6A 1G98A 3HDXA 1X7XA 5ERGB 2JFOA 5BUCA 3VKGA 1R4NB 1GV0A 3STVA 4G5XA 2NU9A 3G9XA 5TARA 3RASA 3KJQA 3S8EA 3FTZA 2VDWB 4OF4A 5BSEA 3TX2A 5G0TA 3WYAA 5JCJD 4HQDA 5CU7A 1OGJA 1UP6A 4OYLA 2Y0BA 1NI5A 4YVFA 5G04J 3MJVA 3PHJA 4O2AB 2IFUA 2IYEA 3VPHA 1GNVA 1Q7CA 1H6KA 1S9HA 4GT1A 3ZOZA 4QLAA 1E2FA 1P1CA 3MTIA 1TM2A 2E6KA 2YQ5A 3GD5A 2H4FA 4QT0A 3DBRB 5F3RA 1VRVA 3LQRA 5JWOA 2ZSAA 3Q7PA 5E2BA 3PWSA 2C7PA 4HNUA 4FHCA 1Q77A 3A11A 3ZLVA 5EA2A 1E6KA 3BAFA 3CV3A 1CULC 3H9QA 1XHEA 1OYWA 4Q4LA 4XX1A 4AURA 1KAOA 5AW3A 1R0ZA 2DUNA 4RZQA 3DE2X 1YAJA 3W7VA 4GPAA 1OBFO 5FINA 3OTOB 3SHVA 5C1PA 1U7HA 3ZHEA 1YRQA 1WHTB 1E2EA 3OT4A 3P9IA 4O02B 3GZNA 3AOEC 4G67A 3HU2A 3EZFA 3ZHXA 1MOPA 1Q6ZA 1ULHA 1VDZA 2QAGA 3ECAA 5UKDA 4HUQA 4OOEA 4FR2A 2JFPA 2XX3A 1RM3A 4E15A 1FQOA 3LECA 3NCHA 1MXFA 3TQCA 4FMCF 1SKYE 3C8DA 3D3WB 2AXVA 1IUNA 4A2WA 5EJGA 5K0ZA 3AG3E 1NVBA 3LH5A 3T7CA 3TXAA 2V5AA 2O1XA 1U2DC 3MW8A 1F1JA 3V6LA 3I2YX 4M0MA 3ANXA 3CC8A 4HSGA 4PANA 1NMEA 2NAFA 1KEKA 4KFCA 5CA0A 2DYRE 1X15A 2A92A 2AOUA 4REQA 2J3HA 4PYKA 4B74A 4E6EA 2EHDA 3O2NA 2HU2A 3QPCA 1NRWA 1WU8A 4YV0A 3HB7A 4HQRA 1Z6TA 5KHLB 4NL4H 1CDEA 3EHEA 1DE0A 3IPXA 2Q29A 4HDRA 4MKHA 3TRDA 1O5OA 3A6FA 3IE0A 1UBOS 4G3XA 4QWMA 3HKEA 4RHEA 5AKZA 1ZNWA 3ZDEA 3AF2A 1ADGA 4EL5A 3G6WA 3FX2A 1BWPA 1NOKA 3VDRA 2VWPA 2O7QA 2LRHA 1QF7A 2GKSA 4QDOA 5AARA 3GFVA 1PX0A 3RAFC 1NBHA 2C2WA 1U9IA 4UNPA 3DBRA 4YRDA 1XZDA 3OECA 1T9ZA 4RVGA 2ZI4A 4B32A 3BDAA 3AO0B 4IIBA 4MW7A 2ZVJA 3CWZA 1PF7E 4HQOA 2W2XA 3PA6A 1FC0A 2Q5QA 4IH9A 5DLQC 3IV6A 4Y1FA 2HJVA 3HBJA 4HRVA 4ZK2A 2KHZA 3Q11A 3D9LA 2C5AA 1H65A 1NQAO 1LS1A 1E6CA 3PDNA 2DWUA 2EFEB 3ICVA 3NTQA 4RL6A 1G7CA 1NSTA 1ZX1A 2IEYA 2YVLA 2Q5HA 3OD5A 3QLJA 4MB0A 4RIFA 5IN4A 3B6EA 3RS0A 4LC9A 4JH0A 1OXJA 1Y3DE 4OCZA 4UARA 2PMWB 2BEVA 4CW7A 3TWOA 5LNK1 1UZNA 2HU7A 2RD2A 2ZI9A 4TV9B 2ODTX 1M83A 4HGPA 4LNBA 2H9AA 3OOWA 5CG2A 1HL3A 3HB1A 1LI7A 2RH4A 2P7HA 5EVCA 4LNUD 3KR0A 4BNWA 1W88A 1J9GA 2HK8A 4P4LA 4BATA 3AVXA 1QRAA 1BMFD 1QGUA 2EJUA 4YQYA 3TLMA 1CZNA 2ORYA 4AROA 1M0WA 3EZXA 3JR7A 3KE9A 2JFVA 1U9CA 3MOIA 2VUIB 1NATA 3NCTA 1UJ4A 4IJQA 4HGOA 4IRUA 1QO0D 2XOEA 3JS5A 2JDID 3WB0A 7REQA 5DV9A 1BDBA 6GPBA 3TW8A 4IICA 1J8QA 4P7GA 3U19A 1K0UA 1FFXA 4I4TF 1ZI9A 3ET4A 3QE2A 4MW6A 4DT1A 3INGA 1M6WA 3BEDA 5TXGA 2IO2C 3L4BA 2NUAB 1QS0A 1O87A 1RDFA 2HJ9A 4FJ1A 4HP8A 3W9BA 5B12A 1J1IA 1SVWA 3NHPA 3UX4A 3ZDRA 5CK5A 3FF1A 1TFRA 1MOQA 5KYXA 1MP0A 3QWBA 8GPBA 4XKBA 4HLQB 4Q18A 3S1LA 3WDKA 1OWLA 3DR5A 5JZBA 4O3FA 5D1HA 1CV2A 1ZQ9A 3FUCA 3BWCA 1AKTA 2RBKA 4UZEA 1FFDA 4BEPA 1QLWA 1O0SA 1DXYA 3GUVA 3PTLA 4ARCA 4FK8A 5H80A 1PEAA 2PR7A 2M2IA 1K63A 4ME6A 3FTYA 3AMVA 3KXKA 3N2EA 2GVDC 2R6FA 1P5QA 4G0OA 4OM7A 3HJGA 3W34A 3U4IA 1OLOA 2FR1A 5SYAA 1OWMA 3HR8A 4RELA 1HZZA 1Z6GA 1S1MA 4QUBA 1KHTA 4WJZA 3KTAA 3LRXA 1WOMA 3R3HA 3UHOA 4JL8A 5FUYA 5FT9A 5HIIA 1M1YA 1H8EA 3C3AA 3SSMA 3WLRA 4B89A 5MFPA 5KPDA 1O8BA 1BW9A 1PBNA 4EJSA 1OY3D 5CEJA 5CEFA 1IEXA 5C8DA 5HF8A 3UUXA 1E5TA 5B7GA 2A3RA 1N1MA 3MWLA 3Q10A 4K28A 4NCIA 1HYGA 1XTJA 4WK4B 4BNDA 4RZ3A 2NPIA 5BW8A 1N32B 3R5TA 4EK9A 1NR7A 3K0KA 1E96B 3FEXA 4DJ5X 2PL2A 1AKEA 4KO8A 1SUEA 2E4XA 3H0KA 4FB5A 3QOYA 4L5CA 4ZANA 5T8KC 5IH3A 1JPUA 4TYPA 5A1TA 2VJQA 1GKYA 2QR5A 2AIRA 1ZD8A 5K8IA 2C0CA 2YYSA 4LOLA 4X64B 3ZPJA 3DMDA 3H97A 1WHSB 4P32A 3H83A 5GV7A 4BDTA 3L46A 2IHNA 3BSFA 3FAZA 4XVHA 1G20E 5AI8A 4L4ZA 1YZQA 1NVVR 5A4MS 1E7QA 4XLZA 1SXQA 4N5HX 1ESDA 5BSVA 1C7FA 1OVMA 3L1UA 4N0QA 3NBQA 4I2VA 2GRRB 1C9EA 2UXDB 3EG9B 2L82A 2VP0A 3GGPA 4WLFA 5CR9A 1GYPA 2C2KA 4A63B 1XCPA 2PHZA 3KLPX 1BDJA 2VNSA 3HSKA 3MRTA 4QTXA 3QWWA 1ZGCA 2BI8A 2ZJOA 1JP7A 3G2MA 4IQFA 4JSTA 3ML1A 4N3CA 4GBJA 4LJKA 4P7FA 4QD3A 1UZUA 4C6TB 2G0NA 2ZTMA 4ZEVA 3DD5A 1ZM7A 1ZWKA 3PJEA 3X1MA 3ZDYB 3MILA 1UC4B 5AQ9A 1QR6A 3MERA 2GZMA 4MMZB 1KDOA 2J3EA 1RVV1 4EB6B 4FNOA 2GZDA 2WBLC 2WFLB 1XTZA 3VV2A 1NP6A 1V6CA 4YAWA 4B4UA 4EKDA 5B7PA 1GA1A 4YHHB 1FVHA 1N0UA 4E4YA 3LUAA 1BVRA 4E31A 2HYIC 3FYSA 2WOOA 4PSKA 2EW8A 3TAUA 1Z2AA 1FFWA 1O0CA 5K0LA 1XCMA 3DT8A 1L7NA 3OMXA 4AXXA 3IQHX 4MW1A 3V1MA 1FMLA 1L7OA 3CN9A 2EF0A 5K3OA 4ZOBA 5JMTA 2XAUA 3PZ3A 3AG2E 1G17A 3KHUA 4ZOLA 4P29A 3PZBA 3T7RA 2JC3A 1J56A 1G0NA 1NBIA 2UVDA 3K6KA 5HFAA 3ZH9B 4C4AA 4D79A 2VCHA 4TXRA 3FU0A 3C2QA 4NE7A 2CL5A 2Z2ZA 3HKCB 1HL7A 1N1GA 2WM9B 3QTBA 3ILHA 5CNIA 4D8YA 2I6HA 3P2IA 5ULLA 2OM2A 2KLHA 3TEFA 3TMAA 1C9JA 4ROSA 4RD4A 4RH3A 4JZKA 2CXPA 2PD3A 2ZWVA 5J2UB 2W6CX 2OB2A 5AQ1A 4PZ0A 3RO2A 5JPCA 1L2TA 1MPXA 3MTJA 1VE5A 1BIFA 4WEQA 3VHXB 4BUZA 1K7YA 5KJ6A 2ASVA 2CMHA 1U3TA 1JHOA 3DNMA 3F71A 3ZKWB 5FWXB 3K6SB 4BWRA 4R2MA 4WTOA 3FTXA 4EUKA 4DI4A 1BROA 2BKVA 4OQDA 4EY8A 4UVGA 2VKQA 1I4LD 1LWOA 2QX7A 3BQ9A 4E5VA 4TKVA 3RAUA 2FF5A 1E2HA 1VBMA 3H1EA 1XPOA 3O4HA 1NU6A 4UM7A 4JYBA 1EFKA 2ZTVA 3FF4A 1HE5A 4JD5A 3AVTA 1OXKB 3IO5A 1H2RS 5KQPA 3CVYA 1A9ZA 1L5HA 4J2TA 3ZV3A 3L0BA 5H16A 5FYDA 4MUAA 4L2LA 5IDVA 1PRYA 1BOOA 3MMSA 3V8VA 1A9XB 1E99A 5JD4A 1X1BA 4RETA 1QF6A 2B35A 1U8YA 4G36A 2R6JA 3NFRA 3MTGA 2QN3A 3PGXA 4EG0A 1CG6A 1ORTA 2I65A 1A2BA 4JLMA 4KVGA 1QM5A 5HTKA 1K8YB 4AP9A 1D6SA 1LD8A 2DRIA 4RNDB 3D9IA 1FSSA 2PGNA 3C6XA 1YB2A 1AVTA 4RAQA 2O20A 1DAHA 4J0FA 1VP3A 4M55A 3PDJA 1KC1A 4TS9A 4U6SA 4AZSA 4LJRA 2X2FA 2F8MA 4I5EA 5IAGA 2FEKA 4UULA 5HUJA 1HT0A 2VATA 4DIBA 4I4NA 2E4WA 2QQEA 4IP0A 1RS0A 1W6UA 5ECGC 1JBQA 4ARSA 5F5XA 4MCIA 2IPMA 3ZUPA 5LP6A 4R1NA 5EIHA 4X1IB 1N0QA 4CIXA 4K6MA 1WKCA 3H3XA 2VWGA 3WL7A 2IZZA 3D6VA 3IAS1 3K0HA 5BYBA 3H05A 4L95C 1SPXA 1YDGA 2YX1A 3Q5DA 4G2NA 3L13A 3H11B 1KI3A 5EQFA 2A3NA 4Z9AA 3RRZA 4EMBA 3OXGA 3OLYA 4YDSA 1D2GA 3LGXA 3W2FA 5CRVA 4A0RA 2P91A 4N5QA 4KH1A 2P6RA 1ZK0A 1YJAA 2WXHA 2V4ZA 3AINA 3TPFA 4CMBA 1RADA 4MVJH 1BFKA 1JE0A 1EFTA 2ZE5A 5H1YA 4RYDA 2G6BA 4CQLA 1WF3A 4G89A 3SR3A 4GHWA 1GTRA 1Y9DA 1VYHA 4OXKA 4PRYA 5EMHA 2VBIA 5ILQA 2O8FB 4JGGA 2HUPA 3S2UA 4NRDA 1KJZA 3S1AA 3H5OA 1K2VN 1GU1A 3OETA 5B4UA 3K2QA 2E5FA 5ENRD 3CYFA 4QO7A 1QX4A 4MAMA 4X6YA 3U3RA 3NF1A 1G5RA 4BRZA 3LUGA 1XDSA 4A15A 2NU7A 2BGGA 1YZLA 1SKAA 2A94A 4RGYA 4D3FA 3C3EA 4KXNA 1RWMA 2ZRCA 2W93A 4U7TB 1YFJA 2PAAA 3DWEX 1LDMA 2VHXA 5G40A 2EIKE 3PQ6A 1II0A 5BSUA 3MWEA 4EFKA 4EFNA 3AWDA 2SBTA 3V8MA 3IIJA 2PLFA 4PSAA 4XEUA 2W70A 2YZKA 5DBFA 3V4FA 1FTWA 5DWDA 2ENWA 1KRHA 4DNXA 1K89A 2Q3FA 4MA5A 3PXUA 1CY4A 2XMRA 3EFEA 3DLHA 1RXWA 1NJ6A 1PR3A 4WUTA 3OC6A 2J41A 3M4YA 1EDZA 4ZQIA 1K9VF 1PJLA 5FBZA 3U9LA 4LOHA 2I1KA 3MD9A 4BMZA 3WGTA 4DR2B 3G0BA 3NV9A 4QODA 3OZRA 1QG2A 4FFBA 4MKGA 2Y2UA 4ZAVA 4GEKA 4ILGA 3DA8A 4O6VA 2KI5A 3NWBA 5AP9A 2EBFX 2WQ6A 1LSUA 2GN6A 1ZGHA 1VC2A 4G1VA 1XGKA 3ESYA 3MJTA 4KWIA 1K4KA 4JIGA 4BEVA 2ZYIA 5BN5A 4CKZA 4HHEA 5L3SA 3R2JA 2GM3A 2J87A 4JJZA 2WR8A 1JVSA 3R5JA 4HEQA 2WPDD 1H0HA 4K5QA 4M9RA 4MRNA 4ZZ2A 1RP1A 2J5KA 4B5KA 3T3PB 4BFLA 1TIBA 4P4SA 5AUQA 1WB6A 1H5UA 1GKUB 4WBNF 3C3DA 3RUAA 1Y5MA 3WWPA 4EY5A 3LLSA 1CC1S 2GO7A 5KWJA 5DW0A 3QU5A 1BE8A 3I5UA 4HSEA 2JKVA 3Q87B 2C42A 1G2IA 2UUCB 1FEZA 5A3JA 3H0EA 3T3IA 5BV8A 4PYNA 2XADA 3KSDO 3I2FA 1R3DA 1F3OA 2ZIVB 2CFRA 3LL7A 1UWVA 4QNMA 2CCGA 2O0LA 4WOKA 1E9CA 1A7AA 1EDDA 4FFLA 3ULQA 4EJSC 2QZSA 3DT9A 1NV8A 1DL5A 4HDMB 2VHTA 3MX3A 2BOVA 4R41A 4KXXA 2Q0QA 4AQDA 1EZ4A 3D3NA 5H9WA 1UJ6A 1FUYB 3CKCA 1H5NA 4BKMA 2XODA 3IOMA 2Z5LA 5KAMA 4AMUA 4DG5A 4N0MA 1E9VA 4OXQA 4F21A 4RE6A 4KLCA 1YDEA 3H9UA 3NOGD 4LCTA 1MDFA 3GQBB 4H3SA 4YFVA 2Z8YM 4UAJA 2IYWA 3OBBA 3WHPA 4YQEA 4FCVA 2EGUA 4WJKB 5JO9A 5BQOA 4LW8A 1RQPA 3CVJA 4XB2A 2BGIA 1O54A 3R9AB 5EPEA 1I32A 3JCZA 1ZAYA 4RSMA 3S8MA 1SBQA 2WYHA 2IYQA 3T9BA 3C3QA 4TOIA 1N0HA 4Z6KA 1FFHA 5AJDA 3OF5A 4QUJA 4O2BA 3AVYA 2FE1A 5AUNB 4JUIA 4D1YA 2R7NA 5EI5A 3DZFA 3DDUA 3OFNA 4YVQC 4LTMA 1FYWA 5LIPA 2BBSA 3O21A 5A3SA 5ANRA 1QPZA 5IWAB 3HBLA 1PAUA 3G9UA 4G8BA 4JBXA 1PDVA 3KPUA 1DP4A 1VE9A 3NHKA 4JBGA 2YVAA 3R7QA 1ACLA 2E4UA 3JD3A 4M46A 2DGDA 3O3CA 4PS8A 4MDEA 2QZZA 4KWHA 4FLFA 3D31A 3IPYA 4GLFA 4NNPA 4QA9A 4MUHA 1UAAA 5HXAA 4DGSA 2D3TA 3DFMA 5K8CA 2XCCA 1UBGA 1SVMA 2W2VA 3VU8A 1SG0A 1RQ2A 2W2LA 4CM9A 2V3CC 2NXPA 5TQJA 3CF2A 3VR5D 4CMJA 1IHBA 4X63A 1RZRA 2ZJ5A 5GZ3A 4WSOA 5LQKA 3E3LA 4N5NA 2YBDA 4XJXA 3KBOA 2PJDA 5TSDA 1M2JA 2FMKA 2WXGA 3CLUC 4TUMA 4DMLA 3CZ9A 1K7XB 1KI6B 1OROA 4TLAA 3MCUA 5I7FA 4MWZA 3B70A 4NDAA 4PE5B 2I9PA 5E2IA 3LQ2A 4DWVA 3T1YB 3DZDA 4IV8A 2IUUA 3WGJA 5I47A 2FVXA 3L92A 4QDUA 4UASA 2QYSA 4BFZA 3CJTA 3OJLA 1LPPA 4J6IA 5BRAA 1Y4ZA 1PJ3A 1E5QA 2X15A 4Y6WA 1JWFA 4D4LA 4NAUA 5F78A 1G20A 2XHZA 2BHLA 3Q9LA 4MP8A 4NEGA 3TWUA 4BTAA 1OXXK 3K31A 3M3HA 2PWZA 3OLQA 2YNMC 2FK7A 4IDBA 5HPYB 1ZZGA 2FEMA 4KZKA 4DV1B 4EHJA 2PPVA 3SZRA 1U0LA 4M60A 2IEZA 1U90A 2ID7A 2WVIA 3AKEA 1RYYA 1CD5A 2JAXA 2ODBA 3BMOB 5M3BA 1Q2UA 5LSAA 1QIKA 3X1WA 2F4NA 4JQCA 5FPTA 1KEUA 4D9IA 1SC6A 3NEJA 3SHOA 1AK9A 1UPFA 3DS8A 4M98A 3LHIA 3X44A 5KOJA 4URWR 4YUVA 3ZBQA 1ADJA 3Q85A 1H4SA 2ZI6A 2IYAA 2QTLA 4YREA 3VVMA 1N2IA 3PRHA 5L8VA 3KAEA 4ACLA 1R0RE 3GLUA 3KT0A 3KP1A 1B2RA 3L9TA 1VRCA 3MJ4A 1ZISA 4KWCA 4AMZA 3HB5X 3LOQA 5ER6A 3WGYA 3OM0A 4EBFA 1D2AA 3VR1A 4HAWA 1GA4A 4HG2A 5I45A 3GA5A 4TXMA 4RDHA 2QM8A 4RWZA 3B13B 1MEJA 4FLEA 2XPYA 3TLXA 2D2FA 3B78A 4H6VA 1A9XA 5HYVA 4EVSA 5ICFA 2GPSA 4MW0A 5LLTA 2I6SA 2EATA 3OA0A 4BASA 1PSZA 1V39A 1JMKC 3ASDA 1U0TA 5GAJA 4YRMA 2BFFB 221PA 1R0WA 4XWYA 3W3AH 4EJ0A 1K1BA 4PFJA 3KAKA 4Q94A 1PT8A 2PKQP 2LO6A 3QKWA 4EATA 2ZVQX 5FTNA 3NFYA 5KSWB 4HVBA 4DMUB 2PBRA 4E30A 3GP3A 2JS7A 5JQWA 3L9XA 1D9SA 3RRNA 5ALSA 2GS9A 3T61A 4C0BA 3BAZA 3FHLA 2IEIA 2V5VA 1OZGA 5FFMA 2RHTA 4JZYA 4D3YA 4RHUA 4UDOA 4DOMA 1BCRA 4FOSA 3GW4A 2A9KA 5EZQA 3TBKA 1CRPA 1JEAA 1ZHFA 1QG6A 2DIWA 3I4CA 3B8EA 2I4LA 1CUXA 4B3GA 3M82A 4F93B 3EQZA 4KEAA 5CLHA 4B44A 2RAPA 2QUHA 4U2FA 2O2HA 2DP4E 2RHHA 3A70A 1HS6A 1O94A 2Q4BA 2PZIA 4HB0A 5FOUA 3UO8B 4BRWA 1GL3A 3U09A 3U66A 3EIOA 1NDHA 4BLRA 4XX5A 5F2OA 1HKUA 3R44A 2DT8A 4WESA 4ZAWA 3Q88A 3HN7A 3VPBA 3WMRA 5EKTA 1HSZA 4ZV9A 1GEEA 3D4OA 1GPBA 1Q1AA 1EX1A 1NJFA 2COUA 1GVHA 1WXEA 4E07A 3IQDB 4RK6A 3SN6A 3P9PA 3AVVA 3FETA 1X80B 4LWQA 2VXCA 4BT8A 3T06B 3ZK7A 1PK9A 5AI6A 1GGFA 1WXXA 4EBAG 2PMKA 3BHMA 4MPJA 5DGTA 4QKQA 3X2FA 4PTLA 4FEYA 2SKCA 3P2YA 3V4ZA 3PE3A 2IWHA 2WJWA 4WVFA 3SFXA 5DP2A 2RI6A 5CA1A 5IM4F 2Z9CA 2ZW9A 2HBQA 4B71A 2FKNA 4H7FA 1W2WB 3BZUA 4KO4S 4OAQA 4N39A 1RXUA 4X7RA 1VPLA 4RESA 5DBHX 1HDYA 5CT4A 5LCWJ 1DAEA 1Z07A 1KAQA 1W0CA 2RI0A 2VAXA 3EZ2A 4P22A 4LZAA 1R37A 4GWKA 3GPCA 2RB5A 2V7UA 2LCIA 1W47A 5EJ2A 3FSEA 1SBTA 4L0DA 1SXGA 4M3NA 4F97A 5EMNA 2OV4A 3JYLA 1HE4A 2IX9A 1MX4A 2C7BA 3OQPA 4TN1A 2G4CA 1J20A 1ILEA 3F1KA 4LF9B 3LYHA 4WJLA 4AD8A 4XWGA 2O8DB 3RVKA 4ZYWA 1E2NA 2CMKA 1K7FB 2DHRA 4TZ6A 3F6BX 3A4MA 3S3TA 3GIDA 4GKKB 3CZRA 2A67A 3OE5A 3U44B 3IV0A 3OKAA 4PZPA 3SOPA 3BXOA 4ZC8A 1NBME 5IVIA 5ANLA 1YOVA 1NN1A 2EJCA 2QC9A 2LXNA 3HGQA 3FLMA 4I50A 1KOLA 4D9HA 1LX7A 2CB0A 1T2CA 2TMYA 3HBMA 4GM0A 1WEKA 4UWKA 5CLIA 4DKJA 5KTPA 4GI3A 4AK9A 1QRDA 3HKCA 1SZCA 1IIBA 1PSWA 3BFPA 3N8HA 1VSUA 4A2PA 1YR2A 4GWLA 3WMWA 3COPA 3IERA 4TM7A 1FS5A 1HLFA 5EPUA 4YDQA 5CA0F 3PPIA 1PQ4A 2KW5A 3EG9A 3T3DA 5DX8A 1V6AA 1XCBA 3PIIA 4OFBA 4GYWA 5HWSA 1EFDN 4H7HA 3JPYA 4F46A 4RA6B 5CDFA 1WCIA 5AHOA 3G9TA 2JLBA 1K5PA 2P4HX 3FTSA 2C82A 2VF4X 3PA8A 1E2PA 1PHRA 1M73E 2EL7A 3K5PA 5DT2A 2X8JB 2HO1A 5LMNB 2DYKA 4IVPA 2YIMA 1YKSA 4KOAA 3DCJA 5AJYA 1LDNA 5H82A 3PXEA 3RAEC 3WK4A 2WJZB 4NFLA 2O5CA 2Q0SA 2ZIRA 1W5SA 4O29A 2YXPX 5HE8A 1FS4A 4PHCA 3HKBA 1DAFA 3DMGA 1BWQA 2J9ZB 3Q4GA 4WH0A 3U3XA 1UT8A 1LF8A 2HSEA 3LBNA 1WB5A 1RKVA 3ZE0B 4IYJA 1CNFA 3L7CA 4FBLA 3Q9UA 3Q8KA 1L8AA 3JQ1A 1DRJA 3W2EA 1DIGA 3G5LA 1A8IA 3R9XB 3I8SA 4KN9S 1HYQA 1IXKA 1I1NA 3G02A 3HC7A 4JMLA 4G8KA 1U1CA 4MPDA 4FYJA 4IJKA 4NBWA 4U04A 1C0PA 2DHCA 2XAAA 4ZALA 4E4TA 3H9GA 4BKRA 3WGIA 1KMHA 1DIAA 3IEGA 2HXYA 1KNQA 1E1QA 1T9GR 4GQBA 3W5CA 4B6QA 5FQ6A 1S4QA 1N4PA 4B6GA 1VG8A 1E4EA 1RCTE 1TNYA 4H7KA 1YRYE 2QRHA 3OEHD 3OMLA 3PV0A 4V0QA 2H2HA 3DLBA 1QK4A 5EN4A 1PT9A 3RS8A 5TB5A 3V31A 1CNEA 2IDMA 5C5CA 4EI8A 4HZUB 4EO4A 1Y4SA 2UUOA 2Z5VA 4XW2A 5KDDA 5FWQA 4EZLA 1Z5PA 3ESRA 3EXIB 3PL5A 3LFTA 5KYGA 4ES6A 2J85A 2WJ3A 2ZWAA 3U17A 2XT6A 4EB8A 3KL4A 2ZRPA 3TEJA 3TZ6A 3PQCA 3AY7A 2CD9A 1L9XA 1UEJA 5C3UA 3VTZA 3L1IA 3RSCA 2J5QA 1OFVA 3A26A 4KK4A 3C3KA 2LZ0A 2AX3A 2R5WA 4A8PA 1SZPA 4BU1A 3LI2A 4ONEA 1CUUA 3FPLA 4OX9Y 2KBXA 3Q2IA 5IKXA 3I52A 4YAOA 1UC5B 3D9QX 3KUUA 4HR7A 1NA3A 5L51A 4OXYA 3EZGA 2YWRA 3A9TA 2FWPA 4XSVA 3QFRA 2BBOA 3K20A 3IILA 3QVKA 3FYCA 1GXSB 1IE3A 2CNOA 1WW8A 3P1JA 4WMLA 2H5EA 4EG6A 3MUNA 1EK6A 3KO8A 3STUA 3MTAA 3KQUA 4R84A 2Q2NA 1Y1RA 2JHCA 3HJCA 5TS2A 4EKEA 4YAUA 4UUBA 3KK0A 4ARBA 2RH5A 1XAIA 2QTAA 4FGKA 2ZKIA 1MT3A 4ZD6A 1Z6PA 2WILA 2P0AA 4RTKA 1FLNA 3WLFA 2GFIA 1I2AA 1LVHA 4QELA 2IYNA 5F5LA 1IM5A 3AS8A 3H2JA 4QFBA 3AL3A 3ESDA 5EMMA 2RK3A 3UT0A 4D56A 1ICEA 1LBEA 3RSFA 5JEEA 2COKA 4WINA 4O2AF 1HSOA 3IXLA 3OAAD 4V0ME 3S7ZA 3V97A 5BOSA 4TTRA 2XE8A 3A1NA 3QQPA 4JJGA 2BGLA 3TS1A 5B7QA 1UAYA 3FLBA 2Y0EA 4UUQA 4QAJA 4GGMX 3AEZA 1M3SA 4FFDA 4XAQA 2A5YB 2W00A 3BMQB 3D0RA 1S6YA 2IF0A 2OQVA 4DSZA 7REQB 4HQNA 1EEXB 1IG0A 2DTDA 2EYQA 2HDNB 4YCAA 3SJ7A 5A5DA 1EXWA 3K70B 3FVWA 1KYTA 3A4NA 4G0MA 1P0FA 4MA0A 1BDMA 4JT2A 2ZR8A 5DXAA 2BKEA 5LMCA 2QAGB 2ZJYA 3JAWB 4K05A 2GUGA 3QEMB 1KDRA 3BBPA 1XRJA 3CFYA 4WCFB 2NW6A 1NBOA 4WCFA 4ZT6A 5JLJA 1RHMA 8MHTA 4YO7A 5AIJA 3C87A 1EF1C 1C1HA 2B4RO 1FPMA 3OKCA 5CDGA 1VHJA 4TTQA 2RHLA 2VJMB 5I51A 3G8CA 4Z3OA 2QZ4A 4J0JA 5CVJA 2A6PA 2D1SA 2RK4A 4NESA 5GVSA 1EX7A 1Z16A 4ALMA 2I2OA 4D57A 3ZU6A 2ZUEA 4IMJB 4JXXA 1RD4A 2GTIA 2PUWA 1VIAA 4F7DA 2PKEA 2H51A 4ZJUA 1ZAKA 3FBGA 4UFOA 3TFOA 1RMYA 3UPDA 1J07A 1E3WA 3R3YA 1KEVA 4TZTA 4RM2A 4IDOA 3D4PA 2Q3MA 4J43A 2B9VA 2G07A 4R7ZA 4XEIG 4MB6A 1SHJA 2KCKA 2I6UA 3SC3A 3AESA 4ENPA 3F4KA 4OFWA 4KKXB 3TIFA 3FM9A 5IUJC 5IEBA 4JC4A 1P9WA 3ZW3A 4DR4B 1C1YA 1BX3A 1LPBB 2Y1DA 3OZIA 4MV1A 5F4BA 5FL7D 1DBVO 3W5IA 1JYFA 5E0OA 5FBQB 2PS1A 3L7NA 2OHGA 2AEEA 2ZJBA 4GLLA 4CGZA 1CY1A 2YC2C 1S89A 2P4EA 1A8SA 2Z2IA 5LD2C 3L07A 1XXHB 2C4KA 1I80A 2GEBA 1KH1A 3QKSA 1OB2A 1X7WA 4P34A 5COQA 4UI9C 3L49A 3T0GA 5TMBA 5KDLA 1QP0A 1ZD4A 3RRJA 1NN0A 1U0OC 5BNWA 1EG2A 1FMJA 5HDBB 3S2ZA 3BRWD 1OH7A 2MHCA 1FRNA 3LPZA 2KYRA 1VG1A 1P72A 1KQOA 2NUTB 2Y0CA 2ZBGA 3LBFA 5SY6A 2BFNA 2VA8A 1JW9B 1QC5A 1F51E 3MMZA 3FWPA 4AY4A 1T9GS 3UMMA 1STOA 2ZETA 2HI0A 4WV3A 5TT1A 2XHEA 1WMAA 1T9AA 4X9XA 4ZCSA 3OFKA 1ZC4A 1FUKA 3ZD7A 4EZJA 2A5FA 1PWEA 1QTNA 4TWJA 4DN6A 5JDCC 5T3RA 1JKJA 2CE2X 4GICA 4O4HA 1RXEA 3FNRA 3FYDA 1ELKA 1L8OA 3DAHA 3PQEA 4LXQA 3SYKA 2YJGA 4TSFA 4C29A 3EXIA 3ABRB 4C0MA 4WKCA 5EMLA 4F1KA 3DDCA 4ROTA 2P65A 1TK3A 4JI7B 3MV2B 4ZFNA 3NPMA 3P26A 9ATCA 3MA5A 1C8KA 4BVAA 1RYNA 3K16A 1JHVA 2V7EA 1Q57A 4WA8A 3I2GA 4ESVA 1VA5A 2C9DA 4A5SA 3GCDA 4AG3A 4EKNB 4TWRA 1M2FA 2JIMA 3LGSA 4XYMA 1IL0A 2FETA 3WL5A 4COOA 3OIVA 4AIFA 4NZMA 5EE1A 1OR8A 4ZREA 3TMKA 2C7GA 2OLKA 2XF2A 4RUKA 1CZRA 1FYXA 4HMOA 2WMOA 2DHEA 4GKAA 1KS2A 1VG0B 4QGSA 5AW0A 1QJCA 1R0KA 2V5QC 2O2GA 3F98A 3LWNA 2JVIA 4GGPA 3C3JA 3OE7A 4AZ0A 4DLSA 3KYJB 1G1AA 2J59A 3ZVLA 4XYLA 5AM3A 1N57A 4XYEA 3LQFA 4W1QA 4KMRA 4PCAA 1VPTA 4QJ3A 4RQAA 1E18A 3TWTA 1EWYA 2YL2A 3IT2A 4RCZA 1JSXA 3C5VA 2ZKLA 3PHGA 2JKYA 3R4CA 4KN5A 3BD8A 1KMNA 5GM2A 4EYEA 3GLGB 2KPOA 2GFHA 1GTL1 2XYRA 4R8MA 2GPTA 4UAGA 5IT4A 3PEVB 2J4DA 3CZ4A 3I1JA 2AYYA 2O07A 3OF3A 5BSHA 5L3QB 1FJHA 3UXEA 3L6EA 3WWYA 1XIVA 4UTZA 1XP8A 2C9CA 4OD0A 3VLEA 1W6RA 2ACWA 1AS3A 4IIJB 4JQOA 4GNRA 4TMKA 1CUFA 5K99A 2ZISA 2JHFA 3IKVA 3V4RA 2JAOA 1IZZA 1NZNA 1JJVA 2X9LA 4I14A 4EUHA 3OQNA 4RKQA 4C2TA 4PZCA 4O5OA 2JEOA 4LBZA 1QPBA 1EDEA 2AI1A 1KT0A 5JSYA 4FDTA 4V1CB 4IFBA 2W6PA 2LKDA 2Z2XA 3RARA 3ZG6A 4ALJA 2GCNA 2WXNA 3IFSA 3ITKA 4J3FA 5F52A 3V32A 3WI7A 4BVFA 4PYJA 3FPSA 3ZEAA 1FUIA 4F2HA 2GZ3A 2BJVA 4U9HS 1Z4NA 3H3FA 1TYZA 2ZJ7A 2D5IA 2WJPA 4B34A 4EITA 1IXVA 5K0NA 3E7PA 2LPMA 2WUDA 4HMPA 3JSAA 4DCGA 4M83A 1L8LA 4BNUA 3ZXYA 1E1KA 2VI5A 1GPH1 1B0UA 4M6WB 3W9FA 4YJ3F 3DFKA 5AXBA 1TN8A 3NVKI 4RSHA 2CKMA 5ALGA 3TINA 1LA2A 4S1PA 4RZ2A 1L5ZA 5T64A 1D0SA 1NX9A 1PI3A 1VBNA 2XNDA 3MSCA 1G4HA 3OZEA 4U5XA 2D1FA 1MO5A 5F76A 1HF3A 1NNEA 1Y7HA 3PXAA 5FPQA 3IBGA 2AN3A 2C5EA 5SZKB 4CR8A 6Q21A 3MQ2A 4P31A 4HNGA 2N47A 1GA6A 3W8EA 3C74A 1UP7A 1WDLA 3N2GA 2ZBUA 4GXQA 3ONEA 1GG2A 4RKYA 4UMFA 4LRWA 4KDRA 3R5SA 4CNBA 1KYVA 1ODTC 1P5JA 1KI8A 1S02A 1BU8A 3ESKA 1OXMA 4XSHA 3WLLA 3DM5A 4P3XA 1YB6A 1NLMA 1YASA 1YXMA 4L3OA 3TTXA 5HOEA 5ITZB 1KP3A 1M6VA 1AQLA 2OO3A 2XUJA 3WRXA 2P9TA 5E9AA 2WF7A 3EXFB 3I9JA 3LXMA 3W4KA 1XXHE 2JFQA 3HGTA 3QVOA 3IURA 4J16C 2O3UA 3QKRB 1YA4A 1YOBA 5DN6D 2BKAA 4Q3CA 3AL0C 1PDOA 4J7XA 2X4LA 1TA9A 1PZFA 2V3VA 1AXGA 1UN9A 2YRFA 5JTUA 1SA0B 2GPWA 5GZ1A 1V5IA 4IDNA 3OZVA 3R0JA 5IK2D 1Y6GA 1P1KA 1K5HA 3LPCA 1ISGA 2X6TA 3BBLA 3SVZA 1NRIA 3ETJA 1C3JA 2QN2A 4IIUA 3LRPA 1A1SA 4TLBA 3ML8A 2VT6A 4YK7A 2FRDC 3PXGA 1E8YA 1SCUB 3VC7A 2Q4TA 2X0NA 3PNTB 3S2SA 4OLJA 5CYGA 1T0PA 3GFFA 3RT7A 2FLKA 3FGOA 4JSYA 3EEQA 1I6LA 4RQTA 3E9MA 4R9SA 5AVSA 3CRVA 2XE7A 5DRYA 5KBYA 3W06A 2XECA 3AEKA 3QUQA 4WBNA 3A1UA 3AUYA 5FTPA 2KMLA 1BU9A 3GYBA 4JB2A 5EXEA 2I1JA 4GMXA 3R7LA 4XH9B 4A1OA 4ARZB 3HYCA 5ENZA 1V11B 5E8JA 1E5DA 1DZ3A 4H1VA 3ZWYA 2QORA 4CYMA 3UEOA 4B6SA 3H8WA 3MEQA 4HNQA 1TMOA 2I6QA 1EZ1A 5J40A 5JSHA 1SUPA 2FV8A 3ZYZA 4DQLA 1GDTA 2O0KA 2DCPA 1J2EA 2Z08A 5D3QA 1PJBA 3IV7A 4Y2HA 1BW9B 3V79K 4ZIRB 4DC0A 4JJ4A 4UVEA 1Y6FA 3MOSA 4B45A 4OFZA 2GD0A 4Q4HB 2UYQA 1PT7A 2IA5A 3A3KA 3MZ0A 4EWLA 1L4HA 1ZP6A 3RTGA 4J0GA 3VJRA 4EZIA 4BZZA 3L41A 4RENA 3LNCA 5HX7A 3ZEFA 5CHEE 1GLVA 2OT3B 5FA6A 2IXAA 1ZCAA 2GF9A 2IOHA 1OXBB 3P2EA 5EL0A 2O23A 3STTA 3WGZA 1C9YA 2F59A 3KAQA 4B76A 4XR4A 3OQMA 3O3OB 4YDRA 2JZNA 5L53A 3RC8A 2GRLA 3T41A 3FP3A 1OLSB 4CETA 4L4RA 5TNXA 2FP4A 1ICIA 3R41A 3WZ2A 1XZNA 5K0TA 3FH0A 4C7OB 3L84A 2HZ7A 4FEAA 3SDZA 3DPYA 3TOXA 3JUIA 1N9KA 4H59A 2W6JA 3USZA 5ADVA 1EJ6A 1EFUA 2ROQA 1EEHA 2LXLA 3RRMB 2WMOB 7YASA 5AVZA 3Q79A 1SH7A 4M9UA 4IV5A 2V7QA 2QRJA 1SCIA 1RJWA 3EQ9A 5E0KB 3K1AA 2JCXA 5DWQA 4X6UA 1GT91 4N7BA 4HOSA 5DH9A 1LPSA 2NXNA 2ECOA 2OCDA 1FFXB 3A0UA 3SHWA 3AY6A 3ZE9A 1VHWA 1FPQA 3HHPA 1YCFA 4I2NA 3T9KA 1RRFA 5KBAA 1THTA 3T99A 3ESZA 3K53A 4MRMA 1JQAA 4AT1A 3QEAZ 1PUXA 2O0MA 3EEFA 1ATZA 1AS2A 1I9CA 1RE0A 2Q3DA 2XUKA 3N58A 3NQ41 5CVUA 4CMIB 3UBTA 1U2VG 2H65A 4WHMA 3DMRA 5DK4A 1LY1A 2OAP1 1REQB 3MJEA 4MVJE 4IOLA 2VGEA 1IZ8A 1P73A 1I4OA 3ASUA 4KXWA 1I7SB 4P54A 2H00A 2GNPA 3LBYA 2G8LA 4LN1A 1HFJA 1ELWA 1RAIA 3BSWA 5EIXA 1TZMA 3CVUA 2XD4A 4X45A 3TFWA 1ZUD1 4R2HA 4HF7A 3RYCA 5KOHB 2PS3A 3DE6X 4K8RB 4BLQA 4BRSA 1ZS9A 1FXWA 2ZTSA 4R2LA 4BN5A 3T15A 5KYTA 3GW8A 3WAJA 3LHDA 1YONA 3MGKA 2X9QA 3KEFA 5CMWA 1JIXA 4I9NA 2BKLA 2ANCA 5TQ2B 1D07A 2B7BA 3G17A 4ZMBA 1JXQA 1SUSA 4EYGA 1H3EA 2YV2A 2P69A 4HXEB 4H7JA 3I34X 1YKFA 2XCQA 2PL5A 4WCVA 3IUJA 4B85A 3P32A 4GI1A 4CF6A 4YCMA 3L5OA 4ABTA 2NXJA 1ZQ1A 1KORA 1XZMA 3NDRA 3OWHA 1UZAA 4L50A 3PFFA 1TZBA 5BW4A 3FVTA 4RANA 3KX2A 4X1OA 1OJLA 4G0QA 1U02A 3RYHB 3C43A 4EO9A 2Z9DA 5KJMA 3DRAA 3C16C 4BQPA 2GF0A 3MCAA 3L6UA 4JVSA 1XV5A 2QJFA 3PJGA 4XCQA 3CX6A 2DT5A 4QU9A 3ZXUB 4ZO7A 1LSJA 1YDWA 4S12A 2ATEA 2UYOA 3E9CA 3GCGA 3T8KA 4FIDA 3C3YA 3GY0A 3L7MA 2YR0A 1QZXA 3R7WA 1L4GA 1TUEA 4Y0NA 3QVLA 3EVGA 5D7BA 3WKCA 3JWEA 1OIVA 4J0CA 5JBIA 4Y6RA 4AOFA 1ZOIA 2MYTA 2H6FA 3DVSX 4BFVA 3N7UA 3ZWNA 3EHMA 1V37A 2P2SA 2Y1WA 2A4MA 4Q1BA 4RABA 1MRNA 5GWXA 3UAGA 1QNFA 3V9AA 1Q12A 1Y1SA 4DV6B 2QP4A 1PS8A 3RFTA 5EJAA 2B4KA 1C7JA 4EARA 3UM9A 3P71T 1HDEA 2NU6B 3DDZX 1YK0A 5BN4B 1YT5A 4FLBA 3DW1X 3NM6B 4Q3KA 4XTCS 3T34A 1K4YA 3I6QA 1UP4A 3VDMA 3ELDA 4B9AA 3IAEA 3CSFA 3A32A 3FUDA 2ZCUA 2FPXA 1TVEA 4I5DA 5G0WA 2L6BA 4JJAA 4IHQA 1U63A 1JV2B 2AJDA 3R09A 4OMUA 4JVOA 5DNDA 4LHWA 1GHTA 5JLAA 4JOBA 1NE7A 2QVYX 3RVDA 3W1EA 1EJBA 5TDHA 4A0SA 1UL1X 3MF4A 2PSJA 3KB2A 1ODSA 1YR6A 3UATA 1AGPA 4A8HA 1BN6A 2XVXA 4FHEA 2J30A 3FSGD 4BWVA 1BVYF 2HE0A 2VSXA 2ZJ2A 3KCQA 1Z38A 4OJNA 2WDPA 3FCOA 2FRDA 2UZ0A 1QUFA 2QF7A 4KVAA 4KUGA 2RGRA 3HO1A 1SD5A 2OCCE 2PZAA 1UOOA 1Y8QA 2HA3A 3F73A 1CBUA 3KKKA 1PR0A 3TO5A 1VIVA 1NW7A 2HPHA 3RABA 3RQIA 5EHNA 3NOOA 5EUMA 2VJDA 1HDGO 3FROA 2YIDA 1EDBA 4ER6A 4BJ3A 5I6DA 2V98A 5JS1A 1SVOA 2I29A 4N2SA 3K0AA 1T4GA 3PGA1 1POWA 4TUYA 1EP3B 1S8OA 4MJ7A 1KYWA 3UFXB 2W4IA 3HLTA 2QD5A 4DANA 5HNKA 4ZCTA 3WP1B 4HBZA 1S64A 4ZAXA 5KOHA 2Z5FA 4OQZA 3D8UA 4MYHA 3KSLA 1V45E 3LSTA 2QIPA 4J2HA 3V1LA 1U0GA 1Z5GA 2G36A 2QSUA 1XL1A 2NSZA 3ASZA 5IARA 3IXEA 3SBSA 4WWOA 4HGQA 1KZHA 3AY3A 3TKAA 3BUSA 1F2TA 5HW0A 1LBSA 4H7YA 3RFXA 3FHTA 1JZSA 2OHJA 2RBEA 1W36B 2HWKA 1NULA 1BC5A 2RHBA 5FORA 3K05A 1F60A 1AA9A 3HVJA 2BH2A 2I76A 2OV3A 3JQ0A 2JIZD 1YD7A 3PCTA 4DDTA 5JAUA 1MDBA 1TTHA 1KEEA 2Z43A 5BSTA 1FT1A 1IXZA 2WWVD 2JGIA 1YBAA 2AQIA 4IRXA 4K2HA 2HHAA 1Z4JA 2WAXA 2AW3A 2ZDQA 4FMPA 1NXVA 3QE4A 4KRYA 3S68A 4NBLA 2GD1O 3URZA 3T3EA 2PH3A 4XTRA 3UI2A 4YALA 3WRXC 2IY9A 4Y98A 3UQ3A 3OQBA 4W5RA 1HYHA 2MYOA 2JEZA 3WYBA 4HFNA 4GNKA 3ULEG 4TSKA 4EJFA 2UZIR 3QOUA 2J8ZA 4X6XA 4OHRA 3W2TA 3VZQA 3ZRHA 4B4WA 1VCHA 1MGPA 5BWMA 5JI2E 1J00A 2VT7A 2ZUBA 4PINA 3EFOB 2BGJA 1R18A 3RC7A 1SQ0A 1BHJA 2XUQA 3CRQA 4ZVKA 3CIAA 1BPOA 3TDMA 3U4DA 2I3AA 5KJ1A 3DGEC 1LSOA 2BTOA 4OHMA 5CYOA 3QX3A 3VKWA 1JPNA 4QYWA 3UY4A 4FYMA 4KFRA 2ZXUA 2C2OA 1CJMA 1U6JA 2FMHA 4I8IA 4LXGA 1OLUA 1V5FA 4GR9A 1F0NA 2HCBA 1VPWA 4WNIA 4JNKA 5EE0A 3ZDZB 3L6RA 1D2HA 3LT0A 3QJGA 2M6LA 4JCOA 3DEHA 2JK0A 3ZUVB 4ZDKA 3W5DA 1TYEB 2GR9A 1CRWG 1Q0ZA 2IU4A 3VH2A 1MJ0A 4YP0A 4U7WA 4FZ3A 2V8OA 1KMMA 4KREA 4GTTA 4I4LA 5LXTB 3KV3O 4CG1A 3CZ5A 2WSSD 3BFXA 4UAVA 3BMCB 5IKPA 3EIQA 1P81A 4GTOA 2OXRA 2VP6A 3OE7D 4C08A 4X44A 3G2TA 1XRMA 1N2JA 1UCFA 4UWLA 2YASA 3NB0A 5DT9A 3O1HB 1TO6A 3OZWA 1NW4A 3ETCA 1TJ5A 5DBKA 5LOZA 1MJNA 2DULA 2FH5B 3G2QA 1Y1PA 4JHKA 1ORIA 1SKUA 1ZSNA 3HN2A 3LXRA 4AKSA 2BTEA 3B20A 1XDDA 5A7GA 2YFKA 3KS2A 4HNAD 3HZZA 4S04A 1T6BY 1ZVQA 1GPLA 4U02A 2BCEA 1KJJA 3AVWA 4RKFA 2GLXA 2D54A 4X85A 4ZCPA 4BPBA 1GLNA 4IY1A 4KLRA 2CG2A 4R1MA 1MF7A 2OCBA 1NQOA 3JXEA 4NBKA 4B3DA 2B99A 2R47A 5FXMA 3ZU5A 5A9RA 1VDYA 1PL7A 3R9XA 3FDJA 4I43A 1Z2OX 1D8EA 1MW8X 1KYIA 2CHWA 1EVQA 1JSRA 2QT1A 3YASA 3ONDA 4E6HA 2SCUB 1LEHA 1MABA 1I0IA 4EF5A 4NICA 1Q7TA 3A04A 3PDUA 1ZESA 2IE8A 2IOSA 1FRVA 4I50B 2OHOA 2VJNA 1M6VB 4FVTA 2XBMA 5ALWA 5AM4A 2WKQA 1NVFA 3HYTA 4XDGA 4DZRA 1PNOA 1XNGA 2CMFA 1WPXA 2CK3D 2H0AA 3LDHA 4LJ6A 3HXCA 1T4CA 3GF4A 4A1FA 3L16A 4MW9A 3OIWA 3RAGA 5COAA 4TLCA 4LZLA 4XDHA 3ER8A 4WNEA 4C0AC 3ZYLA 3X1ZA 2CDCA 3ETHA 5BQPA 3HYMB 2GJ9A 3JZAA 1Q2XA 2YHCA 3PT5A 1TNBA 2CN1A 5K9ZA 2IYRA 3HVRA 1M0EA 2DERA 3TGLA 2CSXA 3IE2A 1DO0A 1YL5A 1I51A 2XJ9A 3DP7A 3OEED 2I7CA 4H6XA 2CCKA 4IIVA 2FRXA 4PY2A 4DMFA 2PKXA 1E0JA 1EM6A 2ZIGA 2JGLA 3RYIA 2P9SG 4KQCA 3SC2B 3OG9A 4Q6WA 4WESB 3W1WA 4RZIA 2QLFA 4HRXA 5LM3A 1H6DA 2A9FA 2GH1A 1FYEA 2HD4A 1ESZA 3RHFA 2FUKA 1F2UA 1K98A 2XMBA 1PY1A 2DZOA 2X0KA 1DI0A 3J7TA 1HG5A 1DOZA 3WR5A 2Q5LA 1Z6ZA 5J2TB 4CBVA 5IYZA 3DMPA 4GE0A 2X76A 3P2BA 1KVUA 3LT1A 1P3Y1 4CE6A 4GF5A 2A1UA 4UNQA 2HT6A 2NO5A 2WVAA 3O2QB 2ETXA 2NTYC 4ODIA 3ZCVA 2HY7A 1A4XA 4W7HA 3WY9A 5FFNA 3BGVA 3OO1A 1CT9A 1QBQA 5HILA 2Q5CA 4L76A 1F20A 2F3QA 3CNBA 2R2GA 4MCAA 4FNMA 4TWAA 2IELA 4UCFA 1XZEA 3IYLW 2B30A 3C7TA 5IJZA 4WECA 1E2QA 1C3OB 3OFSA 3UF0A 1P2FA 2XOXA 2CWDA 4NH0A 4UCQA 3W90A 2XXAA 5G02A 1H3FA 2C2BA 4QRHA 1LK7A 2ZBRA 3OOYA 4UTPA 1RJ9A 3M9WA 1WIWA 2H16A 5G2OA 3T94A 4F9FA 2HLHA 2I22A 1X70A 3Q75A 3U9SA 5TJ9A 5CHYA 3MYYA 4LI3X 3M3PA 1P18A 5E3JA 1DIHA 4F4UA 1ZW1A 3JX9A 4HLCA 4R8VA 4FFNA 1AQNA 1USKA 2TRSB 3ORQA 3MMPA 4FT2A 2YINA 3GEMA 4XARA 2FN8A 5AO9A 1VHLA 4UHJA 2JASA 3O8OA 4HS2A 2I54A 4WIAA 5IAKA 1ZYUA 2QNBA 4L1KA 3ZY5A 5M29A 3EK2A 1O4VA 3G9ZA 5TF0A 3CV0A 4DA6A 3ZVKA 3WLSA 4BPRA 4TTTS 3FNQA 4O4JB 3IUBA 2WSSA 2CHUA 3LX8A 4Q1FA 4F85A 3GJ0A 1T26A 1AV7A 2NQ8A 1FL9A 1QIMA 3C8MA 1GSIA 3IKTA 4GX1A 2WYWA 2YMQA 1I4WA 3BH0A 5IY5E 1LD7A 1VRWA 4F3KA 2XCTB 1H4TA 2JVKA 3K73O 1MZVA 2YMLA 4F2DA 1ORDA 3MHTA 2BM8A 2VUHB 1TCUA 2IITA 2JRCA 3HLYA 5IYZB 4JYAB 4CTOA 3FW1A 1GCGA 2H08A 3RBAA 2B94A 2XCIA 2ZSFA 3FBTA 3RR2A 1ZR4A 1ZR2A 4A36A 4LY0A 1KK1A 1AP7A 4GTPA 3QHPA 4O4HB 4LJAA 5J2TF 1JR3A 2XUOA 3HRKA 5JCPA 4N6NA 2PY6A 3TLGA 5JS8A 3QELA 2ANBA 1KIFA 1HE1C 2QL9A 4QOGA 1I94B 4RSYA 3UMFA 2DPXA 3ME5A 1TDJA 3E9ZA 3PF8A 3LVFO 4FHDA 1RWPA 1JHYA 1IQPA 3KXDA 5EVJA 4IWNA 2EF1A 1D2RA 2A1TS 3ETEA 4KQHA 3L7KA 3TNDA 4RDCA 3QLUC 5B3JC 4U63A 3BPSA 4B3XA 3ABZA 2IHJA 4K9RA 4Q21A 1DOAA 4II7A 1P7PA 1SKBA 2YCLA 3RNLA 3ZHZA 4ATNA 1SHLA 4ENWA 2LSUA 5KYWA 2CJFA 2I3DA 2OHXA 2OO7A 3BMOA 4EG4A 1T5IA 4M9XA 1O0BA 1O77A 4MRVA 4RZUA 1RAGA 3HFSA 5DW3A 5EYPA 1ODCA 3G0GA 3KB6A 5K45A 3ROKA 3ACBA 4D99A 2VJ8A 2KSQA 5G1NA 1HI9A 1SEVA 5LBIA 4QOIA 3PPXA 1L5RA 1E62A 2Q41A 4LX8A 4MUMA 3Q8LA 3L06A 1B0ZA 3HJTA 2CHXA 3MUOA 2NYUA 5DB4A 2FCAA 5D3KA 1NSYA 3LD9A 4PS1A 3A6GA 1SXPA 1JKFA 3EHRA 3VR5H 3VSCA 3DLCA 5FLEX 1M2HA 2X0RA 2WXLA 5AJLA 3WE7A 1NMQA 5DYYA 1TMGE 2M6KA 3BWXA 1JBEA 4Q47A 3L7AA 3UT6A 1SG6A 3PKZA 4OGKA 4LV5B 4QVKA 3T9EA 4PS3A 3PFHA 1TUBA 1USWA 2Q1UA 1E9DA 1MB0A 4B8CB 3L6DA 2D1QA 2P3QA 4HDSB 3D1VA 3I3SR 4WFQA 1NJ8A 1OA0A 3CUTA 3G2LA 1KWKA 2OCIA 4AN1A 3KLMX 4I1OA 1N5RA 3MYVA 2WYUA 3CNNA 3ZKJA 3F6EX 2XMZA 2Y0PA 3DOOA 4H4EA 5AVUA 4O2BB 1I4TD 4BLSA 1NVGA 2XCUA 4GAEA 5JH7F 1CUSA 2UV8A 1VSVA 2G17A 1JX6A 3AGQA 5JNSA 2G04A 1FNBA 2F1OA 3GO4A 3QF4A 3AU4A 1MJGM 1D2NA 1FUEA 2FU5C 1VPDA 2V7TA 3CLRC 3FTQA 2OC4A 5H81A 1DKUA 1P0MA 2CBZA 2HTFA 4GMGA 4OQFA 3V7FA 4C0XA 3FFTA 5JOQA 5BN1A 3ML9A 2V4LA 3UXYA 2ZS9A 2GB4A 3FB4A 2BTDA 1WOYA 2WD9A 1MJ5A 1I3MA 1RT9A 4DLPA 3PVCA 2ON6A 3OJ0A 4K7JA 3HCCA 1XALA 4WXPA 3JASA 4DA7A 1MOZA 3MSXA 1N0RA 2X38A 2NTNA 2VDOB 2YJ4A 3CCFA 1RLIA 4MRAA 3HB9A 1AB5A 2PRJA 1J5XA 1RCFA 1AN9A 3V1TC 2PCLA 5EHQA 1IRXA 4CYMD 3TQOA 4D96A 4D7AA 1AZTA 4Z4CA 1DC6A 5SV2A 2JEKA 5JZSA 3MPOA 5L7TA 3DEJA 3NJRA 3QBJA 3KHSA 1KVRA 2EX0A 4MAFA 1JQJC 3V80A 1XELA 2FZWA 4AYTA 3EWAA 1ZDMA 3NUGA 4NJMA 1P2TA 1S63A 2CJPA 3IP8A 4N18A 4WBSA 4JL6A 5CCEA 3LT4A 2YWXA 4YXWA 5P8WA 3MWDB 5FPYA 2AB0A 4RE5A 4NBUA 2QPTA 1SBZA 3PICA 3FIJA 4QXMA 1CRLA 1EB8A 3AVPA 2YQZA 3KZMA 1K27A 1YJXA 4ZAYA 3A9RA 2MOWA 1K3ZD 2Z1MA 5DSTA 2GI4A 1Q1NA 5AQBA 3S27A 2HREA 4EHKA 2QTBA 4YHBA 3KOUA 1FJ2A 4HDMA 2NNLD 2VNJA 3MBIA 3K2EA 4QNRA 4B80A 4E33A 4PZAA 2P62A 5IVDA 2X41A 2AS0A 4JSRA 4R2XA 4BV8A 3AF1A 4YMWA 1QP7A 4P7KA 4R1TA 1SXIA 3JZFA 3V4SA 1U3FA 5KTSA 2Q6OA 4XFKA 3ASOE 3IIEA 3RU3A 4BB5A 5IXSA 2CXHA 3Q9NC 3PZRA 3EVFA 1WMFA 3LY7A 4GM4A 4PG6A 1B26A 1W0JD 3CX8A 4UNIA 4RCYA 3IULA 4LIPD 5ALFA 4G6ZA 3OPVA 4AY2A 1WBJB 1X2BA 2W0MA 5FLXA 1LFDB 1PZMA 2MINA 2IU6A 2X1HA 3KEGA 1DBRA 2KM4A 1JLLA 2D3WA 1U7WA 3BDVA 4M7OA 1S2DA 5CT8A 4EEKA 1YVUA 1EBBA 4JVSB 3QPAA 1KJWA 1JIUA 3RK0A 3UCEA 5AKYA 5K0CA 3QF4B 2FSVA 5J5AA 5BP7A 2ACEA 3DWIA 1UDXA 2LW7A 2WJJA 4NJOA 4MI3A 3RHSA 3OT5A 2W6ZA 4CM7A 4DV7B 4BETA 2HIHA 2VRBA 4K9KA 4DJTA 5H7PA 1S2MA 4Z1MD 1JKXA 1CERA 1Z7EA 1ZH2A 2FE4A 3NMUF 2QXTA 2WG2A 3VC1A 5A3RA 4JLKA 1UJMA 3NKFA 4MQEB 2C84A 5BV0A 1V8PA 2VSOA 4E22A 2HCRA 5BNZA 3ER9A 1N2BA 3ROZA 4Q9IA 1KI9A 3VNQA 2ZVPX 2RJOA 2MU1A 2GAAA 3DZCA 1Y89A 1D4OA 3K09C 2XVAA 1YB7A 2V55B 3OIGA 3LT2A 4RKEA 1UEXC 1KFKB 2FSHA 2V3WA 2X77A 3KEMA 1MHTA 1XKXA 4YUZA 2XGGA 3PUXA 2B1RA 4EBAA 1RRMA 3H2BA 3OM9A 3JVDA 1WXHA 2PBLA 1SIUA 3NIDB 2LD4A 3WMXA 2O8BB 1ADBA 1DSSG 3EGWA 4RD2A 4J76A 4HOQA 4INAA 3DAYA 1I7DA 3N6VA 3OE4A 3FOCA 4MVJF 2H6IA 1WJGA 2BT4A 2FPMA 2BFEA 4FOLA 4IWXA 1C30A 3SXUA 5B2ZA 4A8TA 2V45A 1AN0A 1LJLA 3NRJA 1ZCBA 2W6MA 4L8WB 1TZ2A 4F6LA 4IZIA 3TG8A 1SUBA 4F5ZA 1BH6A 1FZTA 1DHRA 4QTYA 2EW1A 3KYIB 1R6AA 1Q0LA 1LK0A 2OESA 3RIGA 3CVVA 2OCGA 3IEMA 3QY9A 5BT9A 3D3KA 1VKNA 2Z6UA 3TOVA 1N3LA 2NX2A 5HIKA 5IC5A 3C5EA 3MWEB 1MA3A 4E5SA 3O8CA 1YFZA 3KVVA 1UDCA 2WKWA 3NHZA 3W5UA 3FCCA 2Q5FA 2W6ID 3SF0A 4EYSA 1KF0A 1V95A 3KYCA 1FNMA 4LHZA 4ETWA 5K01A 3A1FA 1ABEA 2JFYA 4EG7A 4U2EA 2XRYA 1NNI1 4F60A 4YUAA 1BKDR 1IVYA 3ZZ1A 3BL5A 5L95A 1FSPA 2P6UA 2ZXFA 3NTXA 3L0OA 1TAHA 2GZSA 4AJKA 3H87A 3P9QA 5J9FA 1UT6A 3MCWA 1FP7A 1OE0A 4ZVQA 4B33A 4N40A 3DJFA 1V5WA 3EODA 3QZUA 4MV6A 4EA8A 2XYHA 1INLA 4YAFA 5C32A 3RPEA 1QIDA 1X8XA 2ZYUX 3L43A 4L9RA 4NAHA 1DWQA 2YNMD 3LCAA 3T1NA 1NUAA 4HPJB 3VPGA 2O8FA 2V0PA 1GAXA 3HU5A 2QRMA 5KKAA 5BURA 3QFSA 2R6HA 5CBNA 4N3BA 3IESA 2W48A 5JS2A 5B6JA 2GD6A 3HL4A 4AB1A 1RPZA 1RIIA 4OKNA 5CJ2A 4O5AA 2VHQA 3GMSA 1S9DA 1QQ5A 3IP5A 1W19A 2OQRA 4JR2A 5JEDA 1B6TA 2YOFA 5KS2A 4D9BA 2ZQYA 5H59A 1ZUHA 1LDEA 2V97A 4BNGA 1Z17A 4J0HA 4DUGA 1WB9A 1PR2A 3FKSA 3QU7A 2IXGA 1YQGA 4ZHBA 3GUUA 1T4BA 2QT9A 3U7IA 1L4LA 2XPIA 3IP1A 4BAUA 2WXFA 2OEPA 4L78A 4CLRA 2GO1A 1C1XB 3A3NA 3PFWO 1Z4OA 2D1YA 2XRMA 3JVIA 3GUCA 4N3NA 5LPNA 1HO8A 3NS7A 2X4GA 1OPRA 4FFRA 1V11A 4YRBA 3SC2A 1OC2A 2DSTA 1FTQA 1GU7A 4EFLA 1LQUA 1Z8FA 5B58C 5YASA 2W9XA 5AW5A 4ZPXA 1DJPA 1RC1A 4C0KA 4AJ4A 3QYJA 2J6CA 1D8AA 3G0IA 5C9ZA 3I6ZA 3DBHA 3U16A 2P4QA 5FBRB 3HP7A 5CBKA 1MPTA 1AWCB 2D8MA 4CTJA 1IHUA 4FJYA 3BGDA 1GTMA 4KPUB 4M1YA 4C22A 3ZVNA 2FPSA 3ZDAA 1IM8A 3FBWA 3DD1A 4HLUA 3JQEA 3R0ZA 1BXGB 4EA6A 5JUWA 3ESBA 3JQDA 1C30B 1K3FA 1R8SA 3O4IA 1KYQA 2PEZA 5EUQB 1DIBA 5DYNA 3MTQA 1BDIA 1HEYA 1WVMA 1H2YA 4LWOA 3L0CA 2Y66A 3VNAA 4MR7B 3MJHA 2ZUCA 1SCDA 3BA1A 4MQ5A 4S2UA 2KXPC 3ZY2A 4PC6A 4Z51A 4AECA 1JALA 1SGWA 4N12A 4G4SP 3R9WA 3T3NA 1T2UA 1L7XA 1H2AS 2GZAA 1S01A 3N2YA 3W3AD 1ZH4A 3AETA 4EABA 2IEBA 2AUTA 2O8CB 2B8NA 1TB4A 1DG3A 1RWOA 1ZA2A 2Y92A 3GXBA 1AV6A 1E3IA 1V1RA 1M5UA 1MBZA 1YU6A 3OZBA 1A9YA 4TKLA 2P2GA 2XA9A 1BVUA 1Z22A 4N4AA 1KI4A 2DTEA 2GPNA 4EJSB 4RLSA 3FRIA 4BQIA 4FR0A 4EQ6A 3W5SA 5AM2A 5K7SA 1R0YA 2C2MA 4LCBA 4KRXA 3DV0A 4UEOA 3RROA 5DLEA 1Z45A 2PVSA 5FOTA 2DECA 5HCIA 4PZDA 4E21A 3EPLA 3OIDA 3I9OA 4MARA 3O4ZA 1M1ZA 4UEQA 1EQAA 1U31A 2R2LA 1T5SA 1AG9A 1P4SA 1SXJD 4DQKA 1WRBA 3L01A 1RVDA 2XCSB 4RHTA 3JYQA 4QBKA 1KKMA 3L0SA 4N9QA 5GZ6A 3TPCA 3TTYA 1BRTA 2XMGA 1I6WA 1BS2A 2GJ8A 1VIYA 1XNHA 1TZKA 4LKRA 3SE0A<