4U8HA

Crystal structure of mammalian period-cryptochrome complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
490
structure length
490
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Circadian clock protein/transcription
molecule keywords Cryptochrome-2
publication title Molecular assembly of the period-cryptochrome circadian transcriptional repressor complex.
pubmed doi rcsb
source organism Mus musculus
total genus 146
structure length 490
sequence length 490
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4u8hA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u8hA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4u8hA01
1NI5A 4MUNA 1KQNA 1O96A 1I6MA 2CUZA 1NUUA 4NAUA 2PIDA 5DB4A 4MAFA 5J59A 1QTQA 2VTBA 1ZUNA 1N78A 2J09A 3MXTA 4MWDA 3MLAA 3SEZA 1KP3A 3SZ3A 5IJXA 2A7XA 1NSYA 1VLHA 1NURA 1O96B 2D5BA 4MUEA 2X1MA 5FNZA 2WB2A 3TZLA 2YWCA 1QRTA 1KQPA 1WQ4A 1QRSA 4U63A 2VTBB 3D6VA 1EFPA 4X0EA 2I1LA 4U7JA 3HMQA 2CYAA 1K4KA 3IMCA 1H3FA 4E1AA 5IHXA 4MWCA 2GOYA 3DV2A 2CYBA 3HZRA 3ISJA 1ZJWA 4MVCA 4EG7A 1H3NA 1N75A 3COZA 2OQ2A 3RBAA 4XFJA 3E27A 2DEUA 1WOYA 2DETA 1EFVB 1QJCA 1M8GA 1KORA 3A05A 3ND5A 4KR6A 5KWVA 1T6XA 4XFDA 1ILEA 2E0IA 3SYTA 3UK2A 4K0RA 1JZSA 4EG5A 3IVGA 1O95D 1MRZA 2O8VA 4ZT4A 4MVWA 4EG8A 3LE8A 4MUGA 5F23A 3TQIA 1RQGA 2V0CA 4EFKA 1WJGA 4MW4A 4HK4A 2E89A 1OWNA 4MULA 3UY4A 3CLRC 4CT0A 3ZJVA 2BTEA 1KR2A 1X6VA 3H9BA 2J08A 4ZT6A 2JAXA 1H3EA 4L2IA 3HGMA 4ZCQA 4K03A 1D2RA 2DPLA 4A91A 2OV4A 3ZUGA 1MAUA 4RPIA 2DLCX 4HJXA 3FWKA 1GTRA 3U1VA 3UOWA 3SDBA 3RHSA 1VL2A 2QUHA 1WXGA 2A4MA 5TGTA 4BWVA 4L2IB 3M5WA 4EG3A 4MWEA 3UMVA 3L93A 4EG4A 4G6ZA 1VBKA 2V0GA 4MLPA 3DO8A 4ZCPA 4JXZA 3CLSD 5KHAA 1NUPA 3IODA 1N1DA 3AKZA 3GMIA 2QTMA 2QJOA 4TS1A 2IELA 1MB2A 4DJAA 3COYA 1EXDA 1XNHA 3VRHA 4MW9A 2RD2A 1N2BA 2ZP1A 4MUJA 3COWA 1R6TA 1VBMA 3P0HA 5LFAA 3COVA 4NZPA 4R0NA 2NZ2A 3ZGZA 2A1TS 3AFHA 3PNBA 3IH5A 3P52A 3TZEA 4JFAA 3F3MA 4YBRA 4WSOA 1V47A 1O5TA 1T9GR 1ULHA 2EJCA 1WZ2A 2AKEA 4ZT7A 1ZH0A 3FH0A 4YP5A 4UZEA 3SP1A 3CLUD 1G8FA 2D13A 2QUKA 2Z3VA 1IVSA 3MMXA 2WQ6A 2DXIA 4EG6A 5AHWA 3MUEA 1BS2A 2E21A 1GAXA 1JMVA 5EKDA 2PG3A 3IVCA 2WSIA 1EJ2A 1G8GA 1O97C 1S4MA 1MJHA 3D6UA 4PY2A 2IJGX 2A86A 5DK4A 2CSXA 2DR2A 2DERA 2Z08A 1NZJA 1KAMA 2CYCA 4QREA 4MUKA 2QUIA 2O5RA 2EL7A 5TEWA 1K92A 1YUNA 3LCJA 3SEQA 3NBKA 1NYLA 4ZT5A 2JA2A 1KP2A 1HYBA 3ILVA 1H1TA 4KR7A 2CFOA 3BL5A 2A1TR 5HG0A 1N2GA 3DPIA 1SURA 1O94D 1M8KA 1EFPB 1V8FA 2AG6A 3H9CA 3QTBA 3X1MA 2CV2A 1QQTA 5DASA 5JBNA 4HJRA 1J09A 5KCMA 1N2EA 4DDMA 2YY5A 3HL4A 1JEEA 4NX2A 1KH1A 3KT0A 4ZT2A 2RE8A 3RK0A 1FYDA 1K97A 2YWBA 2PZAA 1PG0A 1PG2A 3ZXIA 1NUTA 3CVWA 1PFUA 1WXFA 1F4LA 3KT8A 2B7LA 2CT8A 4JYZA 2YXNA 3FY4A 5H16A 3H99A 3IMGA 3KT6A 2XRYA 3G6KA 3ZJUA 4JXXA 3S3TA 3X1JA 2QTRA 3INNA 5HUHA 1JHDA 3SZGA 1GTSA 3CA8A 1WKBA 3ND6A 2ZUEA 3NV7A 3LOQA 3K9WA 3OP1A 1GLNA 1GN8A 3IDFA 3IUEA 3FNRA 1QRUA 2HMAA 1Q77A 3RFFA 1TYCA 1X8XA 1UFVA 1OD6A 3ELBA 4MQ6A 3RJZA 4G5YA 1IRXA 1R6XA 4MW0A 3N9IA 1MOPA 3IOBA 4YMIA 3G59A 1EUQA 3N05A 2QUJA 1KAQA 3AG5A 4ZCRA 1JIJA 3IOCA 1JIIA 4MUIA 4QRDA 4GRIA 3VGJA 4I6JA 4FZJA 5TS2A 3L92A 4DNXA 3QE4A 2J07A 4DDKA 1M8JA 1KH3A 4EG1A 1TYBE 4MVYA 1N2JA 3CLUC 4CDMA 3DLAA 3ZIUA 1MBZA 2R5WA 4J76A 2E18A 1Y42X 4HPWA 2TS1A 1IFXA 3TS1A 3NBAA 3VU8A 3N8HA 2DUMA 1MAWA 3FIUA 2BYTA 4NATA 4R2MA 1I2DA 3TNJA 4OUDA 3CLRD 4S1OA 3PXUA 1KKUA 1TQ8A 3CLTD 5LLTA 4R2LA 4WNYA 1J1ZA 1JILA 4KPUA 2CV0A 1U0BB 1OWLA 1J20A 1EUYA 2XRZA 2PXHA 1GZUA 1MB9A 2CV1A 1YI8A 3CVVA 1EE1A 4OUDB 3IMEA 3IUBA 3Q12A 3PNYA 4ZCTA 1N2IA 1T6YA 5J5AA 1LI5A 3AIIA 3A04A 1YULA 4GU5A 3FG9A 4ND7A 1WXEA 2PZ8A 2QJTA 3G5AA 2H29A 2NSYA 3CR8A 2AZXA 1OWPA 1O94C 3UC5A 5K0SA 1OBCA 3FHJA 1NP7A 3A2KA 1IH8A 4Q93A 2PZBA 4RUKA 4I6EA 4CDNA 4OJMX 1FFYA 4F4HA 1LI7A 1IQ0A 3HV0A 5DEOA 3H97A 4DDHA 1U3DA 4P2BA 2H2AA 2QJFA 2X0KA 4MW2A 4U8HA 1N77A 1F7VA 1O95C 1OWMA 1TYAE 3ZXSA 2QTNA 1O0CA 4F3RA 1J70A 4MW7A 1F9AA 4ZCSA 3KT3A 4PBRA 1WXHA 1I6KA 1M8FA 1Q15A 1GPMA 1Q19A 1WXIA 4NAHA 4DE5A 4DLPA 4EF6A 4MUHA 4YP6A 1PFWA 3C8ZA 1T6ZA 2Z09A 4EGAA 1YIAA 1M83A 1COZA 1TFUA 1IQRA 5FO1A 4CQNA 2C5SA 1EFVA 3FOCA 3ND7A 1O97D 4ARCA 3K32A 1CT9A 3N2YA 2VXOA 4J75A 5TEVA 3MLBA 1LW7A 4KKVA 4ARIA 1XNJA 1NUQA 1JGTA 4JZYA 4PBTA 1U7XA 4AS1A 3P0JA 1N3LA 3OTWA 4QBTA 5K0TA 2D54A 3CLSC 3IOEA 1G8HA 1I6LA 1P7PA 3PRHA 1J21A 1M1ZA 2X1LA 1WY5A 3CVYA 3QTTA 1KH2A 4H3SA 2A84A 1OBHA 1ZH6A 4ZT3A 4MW6A 1B6TA 1M8PA 3FDXA 3TQOA 5H7XA 3P0IA 2X3FA 4AQ7A 1O0BA 1JZQA 2ZUFA 4MW1A 4G5FA 1XNGA 3I05A 3IVXA 3CVUA 3JXEA 3CLTC 4MVXA 1QU2A 3CVXA 3GUZA 2GM3A 1QU3A 2G36A 1JEDA 2PFSA 1T9GS 2JANA 1F7UA 2J4DA 1J1UA 1O6BA 1TEZA 4MW5A 1U7DA 1N2HA 3PNVA 3ZJTA 3GLVA 3FETA 5BNZA 3HFJA 5FO0A 1OWOA 1YIDA 1YUMA 1XJQA 4MUFA 5HUJA 4NDAA 1JECA 3X1KA 1DNPA 5J58A 1G59A 1A8HA 3KFLA 1QNFA 2WQ7A 4PBSA 1MC1A 4MWBA 1PFVA 4YP7A 3AG6A 2HZ7A 1PFYA 3Q4GA 1IQUA 3Q10A 1WQ3A 1Q11A 2A1UA 1N2OA 1TYDE 3H05A 4KPUB 4Q16A 2GKSA 1U3CA 5LM3A 4KR9A 3A4IA 4XSVA 2IP1A 1IHOA 2HGZA 4I6GA 2A1UB 3RK1A 3FI0A 1R6UA 4ND6A 4UZFA 1NUSA 3AL0C 1KQOA 1K4MA 1JIKA 1VBNA 2J5BA 2A88A
chains in the Genus database with same CATH superfamily
3UATA 4M83A 3ZE7A 3K1AB 1EYHA 2CLHB 2CB0A 4UNQA 1XKTA 3H5AA 5IJXA 2PK3A 1N0IA 2GZ2A 4BPRA 5CYOA 3SY8A 3M6IA 4NBVA 5LBIA 3QXCA 1MFPA 1V9LA 2ZIFA 4GMJA 5E75A 4GWGA 2FSFA 3P9IA 2CNLA 2WXNA 5BR4A 5HZHA 3M4XA 1GCAA 2I2AA 1DKLA 3MMNA 3KQSA 3K6RA 4EY4A 4B4KA 4LY9A 2O1XA 1J06A 4U07A 1G9TA 1V5WA 3E22A 4OK3A 2R9VA 2FSUA 2PEZA 2OHGA 1E2NA 4JR0A 1A8UA 1A88A 1YKFA 4LZLA 1XQYA 4ZCLA 3ZQJA 5HW0A 3OWXA 2ZGDA 3AEXA 421PA 1NY6A 1FJ2A 3IV6A 3AKDA 1QYIA 1TAQA 3CCBA 2R65A 2VCYA 4DPKA 2QJOA 4Q94A 1PWYE 4GS5A 3FZGA 4BV2A 3K2EA 4I5GA 3ZYZA 3PYMA 4J16C 1CY0A 3AFHA 3IH5A 3KB8A 3OQ6A 5KJ1A 2ZUBA 2G17A 1HMPA 1I4EB 1T0UA 5AYVA 1ZK4A 2FK7A 4KWCA 4LSWA 4UTXA 3JYOA 2P2CA 2PD3A 3IVCA 3EY9A 2ZWIA 5E1MA 3GA7A 3FKSD 2Y0BA 5K3AA 2A5EA 1MB0A 2WF8A 5ARCA 3V55A 2WM3A 4KO2S 1IRIA 2NO0A 3R5KA 3CJQA 3NHZA 1U28A 3QKSB 3W9GA 3U3XA 4M86A 4S3MA 3UMJA 3ZWPA 3M6UA 4CL8A 3F6YA 1J25A 1JJFA 1G8PA 1NUHA 1R5OA 2PZAA 4YNBA 4XE5A 1TKAA 4DCPA 2IWRA 2JLYA 4DX6D 1GA4A 1QVZA 2PRYA 2ZIXB 3VLEA 3AH8A 1YI0A 4CLXA 1CE8B 5GIPE 2QUBA 3GJTA 2IXBA 2UZAA 5GM1A 1QWOA 2ZUDA 1GNLA 1P1BA 4ZKEA 1H2FA 4OV6B 4YJ3B 2DFVA 3CUKA 4LF4B 1T9KA 1BCRA 2QZSA 3UUWA 2Z2JA 3M4NA 3QVVA 1E2JA 2YDXA 3NIGB 2J9FA 1KO8A 2AZTA 5FUYA 4J0UA 4KUHA 1XK6A 3S29A 1JSZA 4W4TA 1NN0A 4GGMX 1GVNB 3K0EA 3W6NA 2CZQA 3T1HB 3LJ3A 1XMIA 1QCDA 3OF3A 1RCFA 3EF3A 5EUCA 2E1PA 4QGBA 2X5OA 1FTYA 1ID8A 3GRFA 3G13A 1H0SA 3GLGE 5D0QD 4YK7A 3MTEA 3GRYA 2N3ZA 1YKGA 5FO1A 2Z2YA 3LL4A 4PHHA 3TYXA 3K0HA 1EX6A 2WDZA 1PTJC 4EB6A 4ZN6A 1P0FA 3OU6A 1BE8A 2PRKA 4PANA 4HMPA 2HCTA 2LR0A 2BDEA 3QYJA 4GPMA 1B2RA 4H3SA 3MT9A 5AXBA 2ZTLA 1SWVA 3ECCA 1VKJA 3HVRA 1P5QA 1EM6A 2BFEB 4PHTA 1SVOA 3DKKA 4MVXA 3TWSA 3DMTC 4OJYA 3L6UA 3K8OE 3R6LA 1TEZA 2R8YA 3FA2A 3FUJA 1O89A 1XA4A 5DNEA 3GJXC 2X6RA 3GZNA 1XMJA 5KJ6A 4ANXA 3ZXPA 4DUGD 2V7QD 2IVFA 2J33A 3IP5A 3PDIB 5EKUA 1R0BA 4M22A 1K3ZD 5AJYA 3UIPC 1QIKA 4L50A 4BNUA 4GI5A 5D1HA 1AXEA 1O58A 3IIMA 3HVIA 2OG2A 3G2MA 1GQQA 1TQDA 2WXKA 4LNUB 3QWFA 2I2OA 4TWRA 3TJPA 3TKAA 3R5TA 3EXIA 4P1ZA 1WLYA 2VZ0A 1NUUA 4S1PA 2NYJA 4HEHA 1QE3A 4MWDA 3ZCRA 4LCEA 1EFDN 1U0TA 4WKPA 3FN4A 1KOLA 1UXJA 2GN8A 3MM4A 3MB5A 3WK8A 1FJGB 3K30A 1JG6A 1ZD2P 2VUUA 3OE5A 2IQCA 2AFIB 1XEXA 5MGNA 4J6FA 1JI0A 1XZPA 4B76A 2QVYX 5DLQC 2CE7A 1OAOA 4GFDA 1T4CA 3VR5D 2XQJA 4QFCA 2O2XA 1IHBA 2ZITA 2X6HA 1ONNA 5FBHA 1G2OA 2WJVA 3EFOB 5K0NA 1IDN1 1TMKA 2KZTA 2KBXA 2PA3A 1U7UA 1D7AA 1GUFA 4Y2UA 2AJDA 2WD7A 2QN6A 2DM6A 3UNXA 1VPEA 1NOKA 3FZQA 3L43A 4OQXA 5IBCA 4GCOA 4WL0A 1YAHA 1ZVKA 2MU1A 2R68A 3KQNA 2RKKA 3HM2A 4G5SA 2LRHA 4RKWA 1K5HA 4IULA 1KE2A 3IAS6 3C1TA 4MA4A 3QPBA 4NC9A 1KXZA 2WE7A 5K4AA 4MB6A 3JVVA 3OECA 2P3OA 3GX1A 3PGJA 3RJVA 4H18A 4XEHA 2JFUA 3ZWYA 1XXHE 4Q69A 2IYZA 4O2BA 4RTQA 1PLJA 3O48A 2AN5A 3LRPA 3QVLA 1K63A 4LPKA 3IPLA 1AUVA 4IHJB 4D9HA 4ZHQF 3PZ2A 3THXA 3H2BA 1ZNZA 3KT6A 3MJRA 1YOVA 1H5UA 1FS4A 3G79A 2XS1A 3QF4B 4UBIA 4Y6CA 1WKBA 4RMHA 4M7CA 2I55A 3ZU6A 2VA8A 3IDFA 1ZM7A 1YA8A 3WDSA 3E1SA 3HUFA 3AYZB 2WEKA 5G4KA 1E3EA 4OATA 2E4YA 2CFIA 4Z3OA 4C3UA 2NQ2C 3ED1A 1KH3A 2XENA 1FMJA 1PT8A 4E2ZA 1FNMA 3MERA 4RDIA 4KQJA 2DPXA 5DBIA 1GADO 1GTL1 5KTMA 3ZI4A 5LDDC 4NF2A 2BWJA 1BOFA 3DA8A 2ZJBA 4ZRMA 4UQLA 3IPXA 3THOA 1T1GA 1SUPA 3HZZA 3PD1A 2KCVA 4BERA 2VS1A 4LHSA 2PY6A 5D3KA 2BBOA 5IP5A 1N3YA 2PXAA 1E64A 4UCXA 5EX0A 2GCOB 4G5OA 3FNGA 1GDTA 3S99A 3KLBA 4PXAA 2ZT6A 4H3VA 4J7WA 4Y0VA 1UKBA 3DO6A 2GEDA 1WUIS 3BTOA 3HXEA 4UUCA 3QIAA 1CDDA 2FQYA 3JR7A 4HNUA 1VKOA 3P7MA 1XVIA 1J56A 4L15A 1QIEA 1UN8A 1RRGA 3ES9A 1ATZA 1UBSB 1ISHA 3HXKA 1K1EA 4MWTA 3PC2A 4ARIA 1UOPA 2YJGA 1EH5A 4URKA 3V8PA 3WHLA 2QPOA 1ZGZA 4MV6A 5L3SB 1TM1E 2QJRA 3QE0A 5KHLB 5DBOA 3BB4A 3FULA 3WXMA 4J29A 4L23A 1W9MA 2RJ3A 4K9QA 4L57A 1OI3A 3UKJA 2VBFA 5ADVA 3NVMB 3E34A 4BCBA 2OXFA 4K3UA 1DMSA 4L8FA 2HADA 3DDWA 3IILA 1H05A 2LPMA 2FW6A 4TLDA 3PEVA 2DAPA 5FFNA 3FETA 5D5HA 1JJAA 1ZJ6A 1HFAA 3F5MA 5J58A 3BXPA 1BROA 3BK1A 4WKOA 1CUCA 4JC8A 3REGA 1AP7A 2V6MA 2V9PA 4KG7A 1AGYA 4PZUA 1VPTA 5LOVA 1A8IA 2YBEA 2FF5A 2RGNC 1EEHA 1LWOA 4R98A 5BSRA 1KDRA 1QIIA 3H5NA 4EY7A 2GZMA 3BRWD 2V4LA 4Q7MB 5H9VA 4IPTA 1GTMA 1Q0LA 4RPKA 4IJMA 1EFPA 3ETLA 1WHTA 4OHVA 1PJRA 1E62A 1LBSA 4GM1A 2I87A 1MT3A 1XJ5A 4RA6B 5A9RA 1I4TD 3E61A 4NU5A 3LL7A 4ENQA 2E7ZA 3GGPA 2PMEA 2XVYA 3O9ZA 5E6RA 1YB7A 5GIOE 4E2FA 1KI2A 1USKA 5B6PA 4MKIA 3WIBA 1Y8ZA 1FFWA 3EQZA 3VJRA 2GHQA 3ZCSA 3H5IA 5AUPB 3PCXA 2IV3A 1ZU2A 2Q4EA 4R1UA 1ICIA 2BMJA 3DPDA 1WSAA 2XEEA 2RSLA 121PA 1U1GA 4ZO7A 5EPOA 2JGLA 3CLSD 2CDCA 4RANA 5F3DA 3EIFA 4M0PA 2F55A 3BS4A 4CR6A 2OC4A 4MMXB 3PPXA 3FRJA 2YASA 1A5AB 4QVGA 5K09A 3OOEA 1SZAA 1IJFA 2C4WA 3WYAA 3LCUA 1FMTA 2VYVD 4CLRA 3GGJA 1BW9B 1YZUA 1H4QA 3MB8A 3L22A 2R8XA 1VDMA 3WK7A 1Q3TA 3G8YA 5F73A 2XYHA 3K0AA 2X9GA 1WZIA 3RAPR 1GZHB 4IGFA 1KOJA 4B3SB 1J7JA 1FNNA 1MC4A 1CZUA 4KQCA 4OH7A 4BFXA 3ZBTA 1G291 3AWIA 2C8JA 1WUYA 4DPMA 1PFUA 4GZ6A 4IF6A 1SXQA 3CPSA 1FUUA 4RIEA 1Y89A 3D59A 2W6PA 3H5RA 4YGXB 2JG3A 1NATA 4P3PA 5ULLA 4EP1A 5GINE 3PNLA 2OKCA 4LGYA 3N28A 2AOUA 3PUWA 4BNWA 3CEPB 3T61A 1USWA 4GX0A 1XA3A 1JQBA 2EBWA 1C9MA 2VA9A 5B5SA 3RKRA 4HQLA 5FNVB 4Q21A 5B57C 3K4HA 4CDMA 3F3KA 1DQNA 2E18A 5C4IA 3DEHA 4YDRA 3KR1A 2R47A 5FPPA 5T5QA 4YFYA 3C87A 5EZ5A 2OQVA 3KQMA 3QMMA 4R9UC 1C9DB 3DLHA 3VYTB 2L6BA 5JJ6A 1EFRD 2UY1B 1RC0A 4M0EA 3OESA 4F8YA 1XD2B 2C7QA 2YNMC 2ZYIA 2HDWA 3V1TC 2R5FA 2G67A 2CHZA 5FWAA 1WY7A 1A9PA 3ONNA 4I1OB 1NXXA 3Q41A 4DEXA 5ALLA 4C7MA 1FVHA 2WIBA 4UVEA 2WTNA 4M55A 1F9AA 1JRLA 2RIPA 2YQ4A 5G55A 1P31A 4AMGA 4UU8A 1W76A 3D9JA 3LSTA 5D3ZA 1COZA 1P2UA 4R9SA 3DKRA 3H2KA 1DC3A 3R5SA 2A58A 3CX6A 3PWKA 3RU3A 3NW9A 1D1QA 1JGTA 1E94E 3A9TA 1NKVA 2HA4A 3BJMA 4YRKA 3TOCA 3OOSA 5ALQA 3T7CA 3QKIA 3QTTA 4GPEA 1X0VA 2XCQA 5T8KA 1BWPA 2I5PO 3D6FA 1NRIA 2X13A 3QU7A 4DMRA 3FUIA 3P8ZA 4GMLA 3ZHXA 2Q6VA 2WG1A 2HN9A 2FP4A 4G1EB 2Y2VA 1ZK1A 3DBHB 4Z1OA 4ILEA 1W96A 2IU3A 3B3QA 3HCEA 4Y18A 4HGOA 1IBCA 1JNXX 2RJOA 1D2EA 3WK6A 2XEDA 3HJBA 1A77A 3D3MA 1P61B 1EFKA 2FOIA 1Y4DE 1XLTA 2I6SA 3LDAA 4EA8A 3RIHA 3OJXA 2QRLA 1OJ7A 1DCQA 2YDYA 1U4NA 4I99A 2AXNA 2WIJA 1JTVA 2HEIA 2E4XA 3SHFA 3W8RA 3SYKA 2BGRA 4ONEA 2JJMA 1KP3A 3C5VA 1YRLA 3VR5H 1A8PA 1PJAA 4G0XA 3QIVA 1XJ0A 2PBLA 1TYEB 1FUIA 4QXQA 2PJRA 3B7SA 5AW4A 4GKVA 3MYRA 4XQEA 1XZIA 3OJWA 3L40A 3K9CA 5FQOA 2UXBB 2RONA 4RESA 4N8SA 3URKA 2AYYA 4Q7EA 4UUQA 3RVSA 4JHXA 4X62B 2EGUA 3TZHA 3B52X 3TIXB 2CMGA 2NSZA 4EJSC 3AAAC 3C5CA 1B26A 2H06A 5CK5A 2HYDA 3NGMA 4JSTA 5C4GB 2IE8A 1LLDA 3T9FA 3CV3A 3JVEA 4XZ3A 2A3RA 3A4NA 1RWPA 3CT4A 1Z75A 4V3IA 4DIBA 3PHBE 3VDNB 1ZUD1 4OKSA 1OA0A 2QE7D 3JR3A 5LP1A 3ZE9A 3RRYA 3FTPA 4OI0A 1YMUA 1YS7A 1VMIA 1V41E 1G7RA 1MB2A 3L9XA 5JXWA 3V8EA 5CDSA 3TLMA 4TKMA 4HQFA 4PLTA 2V5QC 4H7FA 1XWIA 1B4DA 3F3MA 5EIAA 1T3HA 5T8IA 5JPDA 1ADYA 4E6HA 1ISJA 1G5TA 3TR6A 1WXWA 2BFOA 3QEAZ 1Y81A 4WOBA 3FLMA 3MC1A 3DCNA 3VNRA 2I1VB 1UBLS 3NZUA 3EIQC 2NQTA 3OLCX 4D3FA 1CUWA 3HM9A 4XUGB 3DFIA 1Z0DA 1W3BA 3N3AC 2Y4NA 1OREA 4O6FA 4P3OA 1DJQA 4EFNA 4C7BA 2P4HX 4HNAA 4JU8A 1KQFA 1BJKA 4V0LA 1P45A 3A4MA 2GERA 1L5QA 4GTTA 5DXAA 5C81A 1RKBA 1MO6A 4J0IA 3ZVVA 1BHO1 2DJIA 3CY6A 2F6RA 4LJ8A 3LT4A 4W6QA 3OE1A 5E9AA 2DQKA 4DV3B 2GLXA 2ADFA 1YZKA 4LOJA 3LQ4A 3FFTA 3EULA 3IOBA 4CV3A 5FTNA 2HU2A 5F2OA 1I7PA 3CZRA 1JIJA 1S8OA 1QR2A 3EGEA 1S8AA 3NOOA 1JVNA 4QOEA 3ZBQA 4XKJA 1FFHA 5EMLA 1L5NA 2Q3MA 3P2EA 1FLDA 4PX9A 1GTG1 2P9EA 2PIAA 3WG9A 1DUSA 4Z0PA 3HBNA 1YK0A 2R6ZA 1GNPA 2YN4A 3WR5A 1AY0A 4M3NA 1THTA 4W99A 2ZRAA 4W8GA 4XWGA 5B30A 4PN7A 1S3FA 2Q4RA 1PT6A 3E48A 3Q3JB 4OGFA 3HVKA 2O1EA 1SUCA 2OUKA 2P9BA 3TFOA 4ND7A 4AG5A 3G5AA 4EBFA 1SCBA 4Z8XA 3GCXA 4FILA 4F4IA 5DYYA 1B42A 4CF5A 3U3MA 1XD8A 3SLGA 3K9FC 4CTOA 4B94A 2ET6A 3PNMA 2H2AA 5B3JA 5LCXA 4PYQA 3AESA 1XTJA 3M2PA 3AM5A 1CBUA 2HI0A 1X80A 2JLSA 3V4PB 2I6HA 3FH8A 4ENTA 3V1KA 2RAPA 3HB7A 1GEGA 2XD4A 4QSHA 1VXRA 4I4LA 3K32A 1NW7A 3FUKA 1KIFA 3BILA 4DSUA 4DI3A 3QPUA 2Q27A 1J2RA 1ESEA 1MPTA 3OJOA 1V11B 4KBQA 2R87A 2UV8A 1ADGA 1GV1A 3UKRG 2BBWA 4FHCA 3LBYA 4AQ7A 4AMVA 4BFZA 1ZCZA 3BICA 2FWJA 1GYQA 3L1IA 1DRWA 4JB8P 1UK8A 4B44A 3QI2A 1V9CA 3V3KA 1D8AA 2BP7B 2IPOA 3NNNA 3K16A 1ZGGA 4DJTA 4NBWA 3RBVA 4YDEA 1T9HA 2VDRB 2NUPA 2I66A 2H6GA 1IQUA 1WQ3A 5BT1A 5BSHA 3ZNQA 3QB2A 4XSVA 3G2KA 4ISCA 4JKIA 4TMKA 4D10C 3DG9A 4RPJA 4E07A 1OH8A 2GRMA 1TC2A 4A8TA 2XMCA 5HR5A 4DJFC 4TSFD 3KZOA 1B2LA 1CQJA 4JWKA 2EJBA 1KFKB 1C2YA 2CXRA 1WPXA 4MP3A 5EJ8A 5IVKA 4AO6A 3D6VA 3TJRA 3HMKA 4E1AA 4YVFA 4GZ3A 2HJSA 3KEGA 3I5YA 3SZMA 5CXXA 4MWGA 2VUTA 2WAXA 5BR1A 1AO0A 3T5PA 3HU5A 4IQ4A 3NFRA 3B3GA 4HVCA 3W05A 4EGJA 3L6CA 4HYTA 4ZI7B 1OU0A 2YWDA 3JCKC 3QA3E 3K9NA 1JWLA 3O47A 3RREA 4BWRA 3AUAA 2I7XA 3VA7A 1E9DA 1HDOA 5ECWA 1EK6A 5ALDA 4R81A 2DLCX 1HQKA 3MZ0A 3UOWA 3NBZC 2X2EA 3SF4A 4COOA 3QWPA 4XKBA 2X4GA 2I1JA 2ZIVB 3VPDA 3DBVO 5SYMA 3DO8A 4EECA 2Y1LE 2VHEA 1OAAA 4GT1A 1EXDA 3AP3A 3COWA 3EQ9A 2IUFA 5JO9A 1GFSA 4EGSA 1QC5B 3G2JA 3BREA 4CZ2A 2P0AA 5CT9A 2WKSA 4AJOA 3HJAA 1TZCA 4D96A 2EU8A 3SDZA 4GYWA 1UXGA 2FZVA 2XCIA 5DM2A 1UXIA 1JQ5A 4YAFA 4L02A 1VQ1A 4U7GA 4HQDA 5FOVA 3RYTC 1ZD5A 2PGOA 3EISA 4JUDX 5CX1B 3MBOA 1JA1A 1OXVA 8AT1A 4CKZA 4B84A 3FCOA 3AQ4A 1KP2A 2JIBA 3AJ8A 1YZYA 3KEZA 2FEXA 1RD4A 2ZTHA 1JHVA 4IQ0A 4RFLA 4O4IA 4F7DA 2OHJA 3RK0A 3TPCA 4KW7A 2JGAA 2CSUA 4Y6OA 4UBOA 5ECYA 4JVSA 4FC6A 4R1TA 2W00A 4MGEA 4RPCA 4YBZA 4Y2SA 2ZVPX 1YJ5A 2TSYB 4IR7A 1FS5A 3IBYA 1SXJA 3LDGA 3DMYA 5KOHA 5HKPA 4QOSA 3MAJA 2WIKA 1N8SA 2XGJA 2IU0A 3I64A 3CLHA 3WLEA 1N1MA 5EXSA 1PNQA 1I2CA 2AT1A 4EF4A 1NFIE 3EG5A 2RGDA 3RRFA 1DT3A 3IUSA 2FG6C 4TWBA 3G85A 3R7SA 1X7ZA 1JJVA 3ZBUA 1P8AA 1J2JA 2QNIA 4L9PA 1Y1RA 3A6PC 4BZZA 1EX9A 3HB1A 1TCVA 2D74A 1I2AA 2CLCX 4BNTA 3FSRA 4PZDA 4AMUA 2XWBF 4OJMX 2D00A 2BEVB 4RY0A 3UW3A 3SICE 4GF5A 4QAJA 2ZXEA 1QB8A 3U7FB 2QMEA 5JPIA 2R8BA 1OX4A 1O95C 4JP1A 4JYAB 1KI6B 3K05A 2MSEB 5AARA 3MJWA 5EWLB 4FOLA 1EK2A 5J2UB 3BL6A 1Q0SA 5C1BA 2XLBA 2PBRA 3WTBA 1ZVMA 3GOHA 4FCCA 3OFJA 4C21A 1O5OA 3FUFA 4DLUA 3N71A 1KKMA 3IQFA 1VCHA 2QJWA 4WLOA 3W5CA 1E6MA 1UJJA 2QF7A 4JBLA 1DT5A 1PR0A 4YRSA 4CGWA 2Q5CA 3BKWA 3O84A 2X1HA 2H17A 1MEJA 4JC0A 1YJCA 5IS2A 2UXDB 4ZIRA 3AETA 3ZG6A 4DCMA 4C0JA 2PQNA 5KNCA 4Q1BA 1ORHA 1MORA 3IBSA 1GFWA 5JJ7A 3WNZA 2OWEA 1P29A 3E0QA 4NFSA 3L2OB 2XTMA 3IKMB 3ICVA 2JLXA 3E7WA 1JA0A 2H5IA 1YAJA 3MA5A 2BTQA 5EZYF 5JFTA 1TTHA 2B4AA 4IJUA 3PJFA 5BOVA 1KVQA 1KJ9A 3ZWBA 5FI0B 4MQLA 4R71A 1G8MA 2Y77A 2OO5A 4QE3A 1RC8A 2P69A 3IQIX 1TM2A 3NM6B 3SC4A 3PF9A 1HX7A 2F1OA 3HB0A 3RK1A 4YRMA 2FFAA 1BMTA 5ALSA 5DB4A 3PFIA 1BKSB 4R1QA 2ZRQA 4OQFA 1Z33A 3OZEA 1Z6AA 4F53A 1Z12A 3VUEA 3Q15C 3O8OA 5JMPA 1JBEA 1A17A 2C03A 5AM5A 3JYNA 2YN0A 3EIUA 2YINC 1PQWA 3N6XA 2W11A 1RW4A 4L8YA 2Z5GA 3ZI7A 4WEQA 4XFJA 4PNPA 4NPAA 5K0BA 4KN5A 1V95A 4TWIA 3N0WA 4HTFA 5THKA 3LDFA 4MA5A 1C3EA 2YYYA 3ZJYA 4U2KA 4YMTA 1X6VA 1CUBA 1H3EA 1V48A 2E4VA 2P9GA 2VXYA 4ZMRA 4UXIA 4JP5A 2QRVB 1A0OA 1ZUWA 1CW2B 3DTNA 3NIWA 5HBGA 1ZH2A 3VR6A 5DNVA 3EXG2 2EWMA 5E9JA 4GL2A 1I0IA 1RRPA 2Y1FA 2QVZX 2O2GA 3LUKA 4ZODA 2GAJA 3EHMA 4MVJF 4KI0A 4JEMA 3MT8A 4XX5A 5DW0A 4OSOA 3LCRA 4YT8A 3W4KA 1TI7A 1RI3A 2NO1A 2PVPA 4BMYA 2VG8A 3U7HB 3IR6A 1SD5A 3KZXA 1A9RA 3AGQA 4UM9D 4PSAA 1YGYA 5CB4F 2PH3A 4KQWA 1I9CA 4B5KA 1BGXT 3HA2A 1SUFA 4BEBA 2DPYA 3F4KA 2Q28A 4IJVA 4ZVQA 1OV4A 1F8XA 4MZDA 3OZ7A 3LY8A 2YYSA 3RBZA 1ZKDA 3V4FA 1Y3DE 4PICA 3IE1A 3VOSA 3RASA 4Q96A 4PG4A 4DQXA 3KZVA 2JC3A 4C7OB 3A6HA 2J32A 2BGWA 1P7WA 3ZUPA 4ZVKA 2XZLA 3EGDA 5E9QA 4P36A 1OLUB 4YXWD 4HZGA 1E3MA 2DPHA 3L92A 2UZ4A 1LJ8A 5I7AA 3MZLB 2IZOA 1DO0A 1EX1A 2O1SA 1I32A 1DWPA 2MYTA 1NOJA 2V58A 2FHSA 1XWWA 1H69A 4I55B 3CG4A 2ZWVA 1FY2A 4EVIA 3PXUA 1ECCA 4UFPA 5LXTA 5EIXA 2AK2A 3NDBB 3IBGA 3Q7RA 3UXGA 4A5SA 3PZ3A 1JR4A 3GAFA 4IDFA 3S8YA 4G9BA 2ES4A 4PFSA 1J8YF 3PFBA 2A9VA 4A1GA 5FQ8A 4B81A 4YTEA 1NW5A 4CU2A 4W5TA 3I1JA 4H1HA 2P62A 1ELWA 1AUXA 3R4CA 1E4VA 4TSRA 5H3HA 4AJ9A 1FUYB 3NOGD 4FEYA 1Q15A 1WVIA 2WWFA 5FWYA 2OHXA 4XB6B 2MTBA 1PLKA 2I34A 4WTOA 1ZJYA 2P9ZA 4GSLA 3I3OA 5JALA 4I46A 4P32A 1J24A 1CR1A 4BCCA 4WDQA 2H31A 3ZE2B 3K6SB 2G0NA 3IXQA 2BKXA 1XZHA 1WU8A 2B92A 3B70A 5EIBC 3VJKA 3PXCX 2XB6A 3T54A 5DYTA 3NAGA 2NSDA 5EE9A 1OR8A 5EJGA 4HGNA 3QBDA 5JJ5A 3E8XA 1KZHA 5I4BA 4ZQCB 2HRCA 4Y9TA 1M66A 3QUTA 2ZQZA 2ZB2A 3DKPA 4AMYA 3SR3A 4G25A 1EUCB 1VJTA 4P4GA 5LQDA 1HEYA 5HE8A 3SKXA 2CK3A 3OJEA 3EVDA 2Q0HA 1OX5A 1KLXA 5IEBA 1D9SA 4MUNA 1QKKA 1ODTC 2Z8XA 1GZ3A 3CPEA 4PLHA 2PGLA 4R2HA 2WJHA 1S2MA 5DRTA 3N3BC 3PVCA 3A9CA 4LEIA 1DBRA 4QQ8A 4WCFA 2I4RA 4P6VF 4KQXA 2QY6A 4PIVA 2FXVA 1RJ9B 3A31A 4RYDA 3KYCB 1TEXA 3Q9NC 1VSBA 1KDPA 1GUZA 1GKLA 4YNDA 4KOEC 5CDFE 3NB2A 1B14A 4CQLA 1K0UA 4JENA 3AVWA 3OG9A 3L6EA 2X6KA 1GZ6A 2C3YA 3HGMA 3WQHA 1FRNA 1SHUX 1MB3A 1RADA 1NX6A 1U0EA 2HU5A 3FTNA 4H7IA 3QJ5A 5LP6A 4U0KA 1PQUA 2PM6A 1VBKA 2WY2D 3PNPA 2R5NA 4OLAA 1M72A 2MSLA 1E3IA 1NT4A 5F77A 3WLHA 1E0DA 3NWOA 3FOEC 2NO4A 1BD4A 1PK7A 3OCWA 4JFAA 5TR9A 4JBWA 1N92A 4OGKA 4B3XA 3ML9A 2DXIA 2LWIA 4F9EA 4HQKA 1R4ZA 1GAXA 2LBPA 1IN4A 3G2UA 3MGBA 5FINA 2PM8A 2TMDA 3CVLA 4DG5A 1R0CA 5A6SB 4DLNA 1JYFA 2D0PB 1G2PA 2FZ5A 3C8HA 3HTXA 2ZJ4A 2WIDA 4R1PA 1R4NA 1V2GA 5JECA 3ZZNA 4LI0A 1IUKA 2D1YA 4R7LA 2CG2A 3WLSA 3PQ6A 1DG3A 3KSZO 2FQXA 1N0VC 2IGTA 1KVUA 1RWMA 1NPYA 3B60A 3V8RA 4CGVA 3M81A 2IUSA 4WZAE 2QYHA 3X43A 3RRBA 2HMAA 3ASDA 1ACLA 4P7FA 2UZ1A 1O54A 3AUKA 3FBWA 4D8TA 3QOWA 3RROA 5CGZA 4GI2A 2QP3A 1ZH4A 4WUYA 1M34B 2C5GA 1W73A 3OQNA 4PYMA 1B1AA 4B46A 4PZLA 2D8MA 5INTA 3PLNA 5D6OA 2BJHA 5A23A 3E8SA 4LRQA 3QBVA 1XBTA 1LI5A 1U65A 1CWUA 5IM4A 3ZIDA 3KXKA 1SZJG 4C04A 1OBCA 3QWHA 2IY0C 2PZBA 4R1NA 2NU8A 3EDMA 3TWVA 4J3JA 5TMBA 1U8XX 3ET5A 4H4CA 4M2LA 2VK1A 1GT91 3HH8A 1TYAE 3ZCQA 5CBPB 1OASA 2OL4A 2ETCA 3CVNA 3MIZA 1SXHA 1T29A 4UXJA 1PVOA 2NMVA 4YAEA 4Y2QA 2MHKA 1KQGA 4P38A 4L0CA 1WQ1R 1OIVA 1TM7E 2ZCVA 4DSOA 3H5LA 4IGIA 4B2YA 3WIOA 4DMHA 3ASGA 2V7EA 3I5PA 4EHNA 2J46A 3B5IA 1SKBA 2NZYA 3BSYA 1DZIA 5H7XA 5CA0B 4C43A 2RG8A 2RH5A 4HQ6A 4EI9A 3NDRA 4N3AA 1HK7A 1I3MA 2K7ZA 3RUIA 2R8OA 1TCAA 2JANA 3TRKA 4WBNA 2C1ZA 3PNTB 3H18A 3HNPA 1DAIA 4Q66C 5HUJA 2HHLA 3HCWA 1V5FA 4NCNA 1PFVA 3M6AA 1VECA 4X60A 4Q18A 1K4YA 3H4TA 3UPDA 3ODPA 5IUKC 3QXGA 1WX1A 3C6QA 1GA6A 2E6UX 1GNVA 2I4MA 4Y1RB 3ST7A 5DBEX 3G0DA 1FVOA 4FCWA 1DFIA 3RABA 2X8LA 3HKDA 3VMFA 5AKLA 1YBFA 2H51A 3FZEA 4ME2A 4BNMA 4QLOA 2YICA 4NZ9A 4LDRA 2LGJA 4AY4A 3KJNA 3OQIA 3L08A 4KXMA 4RBNA 1RAGA 3C6MA 4A36A 4WW0A 5TLSA 1JFFA 4HRYA 4I1PA 3IALA 3RVOA 3QKRB 2J4BA 1H42A 3KD2A 4OA5A 1YL6A 4UHDA 3NC1C 3TI7A 3LBNA 4J0GA 3EPJA 2L9BA 1ZOPA 1KQ3A 1KZ6A 1XQWA 1YZGA 3GHYA 3P9RA 2DZDA 1C3OA 2Q0XA 2JAOA 2Q21A 3PYLA 4DV7B 5FUBA 1KO1A 3MHPA 4EL0A 4WWHA 3D6NB 1YE5A 5E3JA 4FSHA 4N8DA 4M54A 5DWVA 3UUGA 2XMQA 1ZCJA 1XNRB 4AXBA 1PEAA 4TUMA 2A8YA 2A2ZA 5CX4A 2DYSE 1R66A 1YZFA 1V8BA 4RMGA 3TIFA 3C3WA 4BVGA 3QG5A 5CEJA 4EKEA 5JNWA 1K06A 3T5DA 2IW1A 2V98A 5IJ9B 4UHBA 4FKMA 4LI3X 2FR0A 4DQKA 4L9WA 4DBZA 3HJRA 3T3PB 5KX5B 3QXHA 1VI5A 3I9JA 3OI7A 3WYBA 3KKZA 2A86A 4RH3A 3DP7A 1J8DA 3DBLB 1S6YA 3PEYA 4ZVPA 1Y7HA 1IWPB 3C48A 3MGAA 3HDQA 1YQUA 1JDSA 5DHRA 2ZAIA 1IPEA 3OC0A 2VH2A 3DL2A 2VHYA 3SFXA 5ENQD 3MTQA 1U7PA 3F4BA 3OIYA 3CKLA 2QZ9A 5IC4A 4EL5A 3NJRA 1YF3A 2XHEA 3G1UA 2VHUA 4XWOA 2IRWA 4NNJA 2CWWA 2BF7A 1YK1A 1EFLA 5IDQA 1HTTA 3ZNOA 4QGAA 3EZXA 3OZSA 4L6CA 4R3UC 4M21A 3GVIA 3NAWA 1BVUA 3RVPA 6AT1A 4DEVA 5KU7A 1E3SA 3KPVA 4ATNA 3L0SA 4LHEA 4HPWA 2JASA 3NBAA 1VHDA 4GOMD 3Q47B 1EB8A 1WCXA 3UPUA 4YX9A 2B2NA 1Y9AA 1TO1E 3NTLA 3D4OA 4PG6A 3CGGA 4QJ5A 1GZUA 2R0QC 1E1YA 5H9WA 4RJKA 3W5IA 2VPZA 2B8JA 1QFXA 4Q7JB 3UM0A 2HWYA 4XM1A 1CQIB 3UJAA 4WJKB 3MTJA 2O8BA 1N6PA 3EPKA 3EEBA 4NNOA 4J3FA 5ESRA 4JOCA 2JLWA 1ADCA 4ZCSA 3TF5A 1V7PC 3LT2A 4XIJA 4C06A 1EJBA 5HWSA 4RJ2A 4UCQA 3KEMA 3ZI0A 5TEVA 3HO8A 3V2OA 4CMAA 2HF2A 3P4YA 2XBLA 3N2NA 1E5TA 1NMEA 1WCWA 3UHPA 4FNGA 5CNMA 2EW2A 4KO3S 4NNPA 4UXHA 3T3NA 3TSOA 3VI3B 5BOSB 1PR3A 1UL1X 1QHGA 1B93A 2X3FA 5AHOA 3H2JA 5KC8A 5DGHA 3GUZA 1GVHA 1JDZA 2IKQA 3BXXA 3B3JA 1TUBB 5C1PA 1JPUA 3ZV3A 1I24A 4OOFA 2VBIA 2R751 2HXYA 4WCDA 5A4MS 3PI6A 1Q0QA 1O6FA 5KJCA 4LXIA 4PG7A 4HP8A 4HT3B 3ZHVA 3H8WA 4JLJA 1PFYA 4I1MA 3DZKA 3RIGA 4RF5A 1VE7A 1WEKA 1K3FA 4RSRA 5J2TB 3S70A 1DG9A 1AKWA 3N6VA 3IOYA 1U4OA 3WWYA 1M2EA 1PJLA 4ABNA 4CIVA 1UM8A 1SVIA 4JVLA 4LV8B 1KYTA 2VNJA 1Y5IA 1XSEA 1EKXA 3PQDA 4RKQA 1C30B 3B1FA 1VLHA 3IUQA 2XUKA 3MOGA 2XVAA 3B8EA 3L8GA 3HO6A 2ZRGA 5EXXA 3S1LA 3H1PA 1WULS 1FEZA 1V16B 1V39A 3BD7A 2GOYA 1DINA 4JL8A 4N0MA 4TRMA 5FOWA 4RTNA 3GFTA 2AE1A 3SU8A 3U0BA 3RSLA 3OEED 1NXVA 1M5UA 2X0IA 3AZQA 5D2CA 1ZCAA 5LWHA 4ZQEA 2F1KA 3F74A 1ZXBA 5JVDB 2NIPA 1PGJA 4D8XA 3TSYA 4MDYA 2QLTA 1RSZA 4KAXA 3TOZA 4JLWA 1FPPA 2EIHA 4HJXA 1SC4A 4AM8A 3EZ2A 2ETBA 2KCKA 1OY3D 4KVOA 1N1DA 4BJ3A 4O0LA 4S1WA 3SS8A 3OZGA 2ZP1A 3WBBA 4LSMA 4ZJYA 1N0WA 5JDCC 4FGWA 3KKKA 1DI0A 3PT5A 3UT6A 3U64A 5TPWA 3RT1A 3ZDFA 3R3JA 4Z9YA 4QKQA 3CQCB 4JU9A 5AJWA 2PZEA 2BFCA 1MN6A 1OHHD 4X64B 1GPJA 3T9CA 2IHYA 3DL0A 4M46A 2NM0A 2I2CA 1LDMA 1U8EA 2Z9CA 1CUVA 1VYTA 1MYOA 2JARA 3BHMA 4KXNA 2HHAA 3CR7A 3B9RA 4UFOA 3SEFA 1UK7A 4Q4CA 5BUCA 5D1NA 5I4CA 3G6WA 4RD0A 4GPAA 2H4XA 3RYFB 3LM8A 4GPKA 4YA6A 1O4VA 4EUHA 3G2PA 1T15A 1LDYA 2QT1A 2X8BA 3OF2A 5AQEA 3HKEB 2HO1A 4K40A 4Q4LA 1P2GA 1Z36A 2YWFA 1UFOA 1LPNA 4ND8A 1H9BA 1KS2A 1T1SA 3H1TA 1XKXA 1R4AA 4D8UA 3ILXA 1KERA 2NU9A 1ECPA 3DMFA 1CUJA 4QPDA 4FOOA 3QOUA 1X5BA 2AOWA 2VHJA 3RO7A 3SFTA 1XHEA 3EGIA 3IP6A 1JN0A 1TK2A 3ZU3A 2J48A 2VOEA 2P9PG 2B7CA 1T6YA 1ZWLA 2WJPA 4OYHA 4HAWA 3L77A 2F62A 1TUEA 2XT0A 1BU5A 1RJWA 1HDXA 4DT1B 4KN8A 5FZRA 5AKEA 4YJHA 2A9QA 1W93A 1HU3A 4MW2A 2RG1A 4HUJA 3CCCA 2G82A 3GHHA 4NAHA 1B00A 1ZM9A 1ZNQO 1C3VA 4Q39A 3R8CA 1XCLA 4AG3A 3UIOC 4V1CI 4LRXA 3Q0TA 3BQNB 3GJSA 3BWXA 5BXUA 2OM2A 3IBTA 3ZLBA 1P2VA 1R5JA 3HIZA 3KOMA 3V1LA 3CLSC 2JK0A 2BGUA 2RJNA 3FWPA 2VOJA 3VLDA 4N49A 1GFZA 5FORA 2P75A 4MW1A 5G2NA 3A9UA 1EFHA 3AT1A 1E1QD 3PFWO 5CAEA 1JQAA 5AHRA 4B8WA 1N9ZA 2OZPA 5SZIA 2UVPA 4FLMA 4L16A 2VFAA 1D6MA 4JJEA 3L6BA 2ZJ8A 5EIFA 2PE5A 3ZWVA 2OPHA 1GNTA 2WTEA 3TGOA 1YCSB 4Z1MA 4UMFA 4YYZA 2QLFA 1TJ3A 2J0SA 3L04A 1AGRA 3IEIA 2H5JA 2NO6A 5CVTA 1MC8A 2QZ4A 2BMEA 4XSHA 2Y1EA 4ZJPA 2YV4A 5LIPA 3M5PA 3B9BA 4D0GA 3M6VA 1QP4A 3TQRA 2JGDB 5IULC 2A7QA 3H11A 1SOVA 3TLZA 3D2AA 4ZQHA 2LAIA 3D7RA 5T41A 5A7FA 4MAMA 1P60A 3H42B 4KBFA 3KSUA 3LJKA 2G70A 5F1YA 4ZGGA 4HX5A 4XFKA 1EFTA 3RSOA 4LJ4A 2V6GA 3TCKA 1W47A 4MVCA 4EG7A 4EZBA 1X7WB 1QIFA 1RW2A 5TQ0A 1NQWA 3SQNA 2W6ZA 3IT3A 1EGHA 4QPJC 4OO3A 3HKCA 4KVZA 1TIBA 1T91A 2FN9A 3GEIA 4DX5D 3QENA 1PI3A 3ENZA 2POQX 2W2XA 3NYIA 1CJTC 1R9NA 2UKDA 4R3NA 1IEQA 3UY4A 2QRUA 1N9GA 4AULA 3MWYW 3APDA 4UUMA 4MPPA 4N65A 1U02A 3TFQA 4DBLC 2C82A 1Y1KE 3C6XA 3WSVA 3M34A 4LSZE 1GQRA 2CLSA 3N75A 2R00A 1C1HA 2KBFA 1PZEA 3IA2A 1Q16A 3CK8A 2VZ9A 4FJ2A 5C7IO 3S2AA 4F6RD 3NTUA 3EEIA 2EARA 5DVZA 1XA0A 2AW3A 4GOND 1U31A 2C00A 3GUUA 4IEFB 4V1CB 2YZMA 2D2XA 4S35A 3A1CA 2ATCA 4JNKA 3BDAA 4F5WA 4RM3A 1MJHA 4L5AA 3RC9A 4KE7A 2DHEA 2X40A 1QORA 2GM9A 5C5IA 4B2LA 3LCJA 4ZK6A 2B1JA 3PVSA 1C1DB 2O0MA 3PUYA 3BCHA 4ZC8A 4YCCA 1Z26A 1DAFA 4GBJA 2NSLA 2BV3A 4ITUA 2XXAB 4BTBA 1B43A 4M6WA 4B7XA 5BN3A 2FEMA 3GQBA 1JMKC 1MHQA 4RYLA 4PX3A 1BN6A 2C4TA 1I5RA 5C37A 3C7KA 4KIGA 3HYTA 1NBHA 4BKRA 4Y6LA 3C70A 1CR0A 4UAUA 3U39A 2G80A 5CT8A 1M6EX 3I4GA 1UMKA 1A5ZA 1HO8A 3DT6A 4P34A 4EY8A 2NC9A 4WWNA 3RYHA 3CF6R 3M5CA 4YRAA 2FGJA 3W5UA 3D8SA 3RW9A 3FUEA 3DLAA 4K6CA 3C39A 2BLNA 3N7TA 3WLOA 1FTQA 3T15A 2BGKA 1KKUA 5FBRB 4D3XA 1E5QA 1JR2A 3LPDA 4WXHA 1K66A 2NVOA 4FSDA 2P5YA 5B58T 5EXDA 1DXQA 3AG4E 5BYKA 1EFCA 1UQUA 3GBVA 4L9SA 3CNBA 3HP1A 4FS3A 1DX4A 5EWJA 3ASHA 4Q9KA 3RC3A 3KQOA 4YAIA 4PXSA 3GH3A 1MQSA 2XE7A 3TRIA 2EFJA 4NYMR 2KE5A 7REQB 3MBKA 5DI9A 1G3NB 3RR2A 3BA1A 2JVJA 4ZVUA 2I6XA 2XE4A 4QBKA 4K1XA 1DRUA 2Y9PB 4Q5IA 1UBCA 1TL7C 5AH0A 4JZKA 3V1YA 5K3FA 3EF1A 3OUUA 1HDCA 2GASA 5IC5A 1PVVA 1V43A 3AR8A 1KPSB 4HBZA 5CDYA 4YDQA 2XTNA 2VDPB 3QEMA 2IUEA 3EA0A 3D0QA 4LEUA 3PUVA 1FNBA 1W25A 2P8SA 4LGCA 5K99A 1F7UA 3FFWA 3UGQA 2VT3A 2O3UA 3HE3A 2AXVA 3AJ9A 4WFQA 3R44A 5BNZA 5AFSA 5G41A 3HA3A 3UJ9A 3AG6A 3A6DA 4HHEA 4N5DA 5IG2A 3OX2A 3IR7A 1YZTA 4U6NA 2VSYA 3FI0A 2GCEA 1TD1A 2BEWA 4Z7OB 2WC1A 3HU1A 4XDGA 1Y0BA 3RNLA 5LQNA 2VTBA 1ZM2A 4YR9A 3JPYA 3OZXA 4MQMA 1PVDA 1OH5A 4KQHA 1JDBC 2DQZA 4ZAFA 5LQKA 1BVYF 5GGYA 3WFIA 1J4AA 2RHCA 1GZ5A 1UEIA 2Q9BA 1F0PA 2OUIA 1UZUA 2LCFA 4OFBA 2H59A 3ZXYA 2EL9A 4E2WA 4LYJA 4AZSA 4RY9A 2RBGA 2QMHA 1SKMA 2X58A 4UTPA 1E3QA 3RSSA 2HLHA 4C0KA 1DHRA 4FC7A 3L13A 1NA3A 5HQ3B 4QXAA 4JGBA 2IA5A 4BZWA 1SC6A 4JJ8A 1RZ3A 3K9LA 2V4UA 2UUAB 2AYZA 5EHZA 5JHBA 2R59A 4LF6B 1LH0A 4LPSA 4H7YA 4WOPA 3GEEA 3SJAA 5AK6A 5F2EA 2VPIA 2DULA 4EHLA 4YBRA 2GPAA 5EILA 5D5PA 3SXJA 1ZH0A 1FX0A 1U11A 3JASA 2FBNA 1YDGA 5CM9C 2B9VA 4FNAA 4OK6A 4PG8A 4FHKA 4XRRA 2OO7A 5FCDA 4KQFA 4QJBA 1C8VB 1SEPA 4BECA 3LS8A 4XB1A 1OTXA 4BVLA 1MDFA 3FPCA 2ZBPA 3H5OA 2A1TR 2PU7A 3PUHA 4CM1A 4CIBA 1ZP6A 1OI4A 2HKIA 4LMRA 1M8KA 1KTIA 4PRZA 3BBPA 1Y34E 4HNGA 3M49A 1I1NA 3K5HA 1UN9A 3RRUA 1Q1ZA 2VHXA 5CHEA 1RI1A 1C5KA 2BFFA 3WGJA 4JQYA 4X71A 4QDUA 3QLUA 2YX1A 2EC5A 1QRUA 3B5JA 2C3OA 3RS4A 4H4EA 2VL7A 4BV3A 5E8JA 4WFJA 2JHCA 1QAQA 3EBLA 5I5GA 1EDEA 2Q4BA 2RHLA 4YJ3F 1KYWA 2OCAA 1IG3A 1U0SY 1R00A 3GCWA 5TRTA 4NATA 3QTLA 1I2DA 3TECE 4AICA 4IX9A 3AV3A 5C3UA 3DSVA 2FPPA 1E0SA 1J9ZA 2F2TA 3EY4A 1RXSA 2CV1A 3DLTA 4B4UA 4DGQA 1KRHA 1JTFA 5A4AA 1JQ3A 4C29A 4X7RA 1WMFA 4IO1A 1PK8A 4MR8B 5HX7A 1C9NA 2EXXA 5JCXA 3QOYA 2YV5A 4LZZA 4P83A 3H7IA 4EX7A 1CLEA 5KYTA 3CC8A 2ILTA 1RI2A 3SBXA 4RO0A 1XLUA 3UK7A 1CX9B 4G4IA 3DEKA 2L42A 4ME6A 3F6RA 2EJVA 1CC1S 1EFVA 3D3NA 5IUJC 3HWSA 3WADA 2DG2A 4EA9A 3VNQA 4XZ4A 4XWWA 3AB7A 3WMEA 2B6NA 4B3FX 5CG2A 5KDOA 5L3VA 5FLYA 2O8EA 4YJGB 2L6JA 4WFKA 4BNHA 1KH2A 2FMIA 3ZTYA 4AECA 2IIQA 2CBGA 1SU7A 1YI1A 1UC5B 4AU1A 4WINA 1HZZC 5PNTA 3A3KA 4O4JB 1Z7BA 3H9GA 2NTVA 2YIDA 2AQKA 4MUFA 4E5VA 4BVBA 3Q72A 3IQHX 5CVJA 3ERCA 4IHAA 1SUEA 2GZ1A 2WTMA 5IFKA 1N2OA 1HNXB 4X8QA 2B30A 1ITZA 1WU7A 3P9YA 4AY2A 2I6QA 5CIYA 4B33A 5FOTA 3DZFA 4J8EA 3ZDRA 5AJZA 3LY9A 3AHCA 3Q3HA 5CM8B 4P3YA 1NXSA 5BSGA 2I65A 1E7YA 3GB9A 3BGDA 4IJKA 4ZU3A 1U2PA 2XCSB 4OTZA 3FCEA 3Q7FA 2XF2A 1YHYA 4UOZA 4LQCA 1Z39A 1XT6A 3HBJA 2X7HA 4DNPA 2CJXA 1SUSA 4HLNA 2GEFA 4LC1A 3R24A 3TVDA 3DAFA 2WMOA 2CUKA 4MA0A 3QQ5A 4HK4A 3U3WA 3F9CA 1PDWA 3R5XA 1N7GA 3BTVA 3FHTA 1B23P 2OR3A 4EOGA 2F8MA 2X1VA 2VDOB 3F6QA 3K0BA 3DONA 2W4IA 1SB8A 1NW8A 4LXXA 5D87A 2VYCA 1MENA 3LPAA 2QTTA 1JEQA 2Z5FA 4ZYUA 2WLTA 4ND5A 1NSTA 3BDVA 3TLYA 4CM4B 3I1YA 4A8JC 1NX9A 2ZRDA 2AVDA 1E8MA 4RMIA 5AQ1A 3BF7A 3JQ8A 1LD7A 4PNHA 5AKYA 3EN0A 2WTAA 1M1YB 2F9MA 4KNYA 1IOWA 1EMDA 5IBPA 2O54A 3OCCA 4JLAA 3T52A 1X42A 4U9HS 3EPRA 4GZLA 3NDPA 1Y1SA 2CVZA 5JAQA 4H16A 3O03A 2XA2A 3HLYA 3EFEA 2P9HA 2WICA 1O94D 4JP8A 2AG6A 2D59A 4H27A 2I7CA 1H8ED 1UP4A 3EVBA 1WPRA 3BHIA 3ZDZB 3EVFA 1EIWA 4W5JA 3QPVA 2IX9A 1U9IA 1FFAA 3FYDA 4IHJF 3VVMA 1RXIA 4FDVA 2B78A 1JHPA 5A04A 4XD2A 4MSUA 3U16A 4QU0A 3TM5A 2CL6X 5IDXA 4IWNA 2V1UA 1ONOA 2RI6A 4WESB 5CVDA 5KKCA 4LYFA 5AI6A 3GO4A 2XYQA 2GWHA 1W75A 5JI3E 5EDSA 3FUNA 2G5TA 2V6IA 3AJIA 1P1KA 4Z49A 2EP7A 3DOJA 4KACA 5FB3A 4YC7A 1WETA 1SIOA 4B09A 1HEIA 3BE6A 4UARA 2V8OA 3QWVA 1N6LA 3JX9A 1YGPA 1TAUA 2QL5A 3ABQB 4HRAA 1X81A 5CITA 4POOA 2I3AA 1QDUA 4M9XA 5IK2D 3ZD7A 3BGOS 1OLXA 1WP4A 3SQXA 4PFKA 2O8DB 3GG9A 2D4AA 1XWFA 1E79D 4FWIB 3UT5B 4HNSA 2I3DA 4WJLA 5L7WA 5G1PA 2QR2A 3FCYA 2CUNA 3TI9A 3TGWA 1TJ4A 3NXKA 4P53A 3D1LA 5FJIA 2ZAGA 4DHWA 2C7RA 3URMA 2X8JA 5T6MA 2XUDA 2BH2A 3HV2A 2FO7A 1G2QA 3CPJB 1H1DA 2IHJA 1ENOA 5DXFA 2GESA 1J2YA 2FDRA 3G0IA 4AOFA 5EJ2A 1VRVA 5TMDA 2HO4A 1N2XA 3ZK8A 2JS7A 3IHLA 4FNOA 4G1UC 5CLFA 4AJ4A 5CURA 4PRKA 1BSVA 3TTWA 1UM9A 1YRWA 2XMSA 5LN1A 2QMOA 5FL7D 5G02A 4JVOA 1T9GS 1TMGE 4GPZA 1UDWA 5EIHA 4FADA 5GM2A 2WD8A 1QGED 3I3NA 3CZCA 2OCPA 3SZUA 2X42A 2QTCA 1JECA 1NBWB 2XD9A 5FHRA 1G20B 2YQ8A 1Q11A 4IJ6A 3QRWA 2H1LA 1MG0A 3BEDA 5IAEA 1CYEA 4CKWA 3TLKA 4BIMA 5HXAA 2IITA 4JXKA 3HGQA 3LCAA 3MBIA 1NVKA 1K68A 1CF4A 2ZQ5A 4MEJA 5L4NA 3OPVA 2QW1A 3CTMA 4FFPA 1XVAA 2PCLA 1X86B 2HM7A 2OEWA 2E49A 1ORDA 3FPLA 1YRYE 4JKOA 4CLOB 1T25A 3QV2A 1XDUA 5IBRA 1BVHA 2YJ5A 4J0DA 4KLCA 3K1YA 4TT8A 1FQJA 2AV6A 3GRVA 1A5TA 2GD6A 4DBLE 2VGXA 4K9OA 4L74A 3VNAA 3CXUA 1F0KA 4E5SA 2LUOA 2OVFA 5FZQA 2PXCA 2LXMA 3N2GB 3PFNA 1AHHA 1QONA 1CVIA 3Q2IA 3Q9UA 4AJWA 4HDAA 4F60A 4NDNE 4BT9A 2C3MA 5HCNA 3E3NA 2XX3A 1Z73A 1MAUA 5FLKA 1H2BA 4MZXA 5A5EA 3VC1A 4L2IB 4NBRA 4PC7A 3U4GA 2R4UA 1O57A 3IHTA 3N8NA 3CUUA 4B5LA 1G98A 1ZU5A 1KZ4A 1W5TA 2RI1A 3LIPA 4BQSA 3FDIA 2UZ0A 2X38A 4MROA 2AIRA 3RSQA 3SZLA 3VC7A 2INGX 1NJ8A 1N9KA 3RIXA 1MX2A 1SU6A 1V47A 4JBNA 1KETA 4AJ1A 3DS8A 3D3JA 1TA9A 4G0PA 4CL0A 4OSPA 3GEGA 3GRZA 3C5HA 1FDIA 4O4LB 5JD4A 3N7AA 4A6PA 4NMXB 1RVDA 2QRZA 1NMSA 1YCDA 1K92A 2AMVA 2V3CC 2NUAA 1ZS9A 5JY6A 5EI5A 4Y9RA 2WUEA 1CUIA 4EHJA 1PW7A 2R6AA 4UHCA 2YFQA 2FDCA 2KX7A 3QBTA 3AEUB 2E85A 2ZR0A 1JCRA 3P19A 2HW8A 1QMGA 3SBEA 4DLBA 5DM70 2RG7A 3T5BA 3J7TA 1QIMA 4HLUC 4RDCA 5J43A 2YXNA 3SSAA 4HH1A 2ZU0C 4H60A 5DGDA 1RS0A 3WAKA 4MIKA 5HRAA 3H13A 4KE6A 2QAJA 4M1KA 3CSUA 4ZAGA 5P21A 4BQRA 2C8KA 3MJHA 2XZPA 5KUTA 4MDFA 5IEJA 1PJQA 4ER3A 1HT3A 5C51B 4GOXA 1P91A 2BKGA 5FNVF 1AKYA 3TRFA 4BZPA 4C5AA 4TV8B 5FA5A 1CRQA 2C3PA 1KARA 3ZHEA 1CZOA 2D3TA 3RAGA 2P9FA 1E2PA 3I61A 5B1EA 3TINA 2NZ8A 5U4QA 4NULA 4ZV7A 3L4KA 1PJSA 4TWZA 2EG5A 1LK5A 2PDAA 5FV4A 5KIAA 3A9RA 1QFZA 3C6BA 5ELMA 1E8DA 3G2VA 4Q4JA 3PE6A 4LVUA 5BWLA 5H59A 1TJNA 1T1JA 3A4YA 3RLIA 3UQZA 3L0DA 2CVOA 4B40A 2CJWB 4QICA 4YAOA 1Y6IA 2HLDD 4IIXA 2WU4A 1OXUA 3LLVA 5EXPA 3OEYA 4ZHBA 3CB4A 3OE4A 1V5EA 2A94A 3T3IA 1M74A 3UMRA 1UAAA 1MJFA 5D8DA 1EX7A 2QS9A 3QNKA 3IUJA 1EXVA 2QQEA 3T3MB 2C5LA 4DY6A 4OQYA 5IJ0B 3O7WA 4PG5A 2Q99A 5KKAA 3R1IA 2JW5A 4MV9A 1NKTA 3AF4A 4BDTA 2GPTA 5EIWA 4UQOA 3E5RA 1JI3A 4RMJA 4OHZA 5D6NA 3CVYA 3HJUA 3D54D 3AB3A 5BQOA 1Z38A 2RK4A 4CEJB 1UFRA 4LF5B 5CFZA 3WHPA 2ADOA 3MPOA 4WE3A 1L2TA 4R1MA 1ZXLA 3K15A 1UK9A 3WRVA 2OAEA 2YRFA 5AK0A 5LDGA 2B3DA 4YUWA 1T2EA 3SIXA 1HDYA 4FYVA 2W37A 2P5UA 1S9HA 2HZ7A 2FUKA 3UJCA 1L7EA 2B98A 1JSRA 2EJUA 2XMBA 1QLHA 2FW8A 3AL0C 1NJ6A 5KDLA 1XZQA 1T36B 4H6PA 2OXTA 4MS4B 3DKVA 5ESXA 2W2LA 2QZZA 3I01A 4HOUA 2Z4SA 3L6AA 2KM4A 1L7QA 3JALA 1JFSA 3C3KA 2PYZA 4O8CA 2V0PA 1U0OC 4IMIB 3M1AA 3LKDA 2OYCA 5AK3A 3IE2A 1AH2A 2NO7A 4ZHQA 3LY7A 3CFYA 5C8ZA 1IATA 2FW0A 1KEVA 3PIRA 3SD5A 2E6KA 4H15A 4DLZA 1M8GA 2FLKA 4WLVA 4JITA 4GL4A 1QV6A 4NI5A 4FJ1A 3U1BA 1ZC4A 2DR3A 2HT1A 4QYIA 2E87A 2PEYA 5REQB 2AF4C 4F9TA 2Y76A 2Q45A 4DNOA 2WRZA 1RTTA 1KR2A 5KJKA 1AX9A 3AU8A 2XCBA 4HMOA 1KZYC 3LVBA 3R0VA 1CD5A 4PPQA 2BI4A 1S01A 3AR7A 1FU4A 4LZWA 2EFCB 3TPFA 3FUUA 4L3VA 3ZX4A 1GITA 5KOIA 3ER8A 1U8YA 4PAOA 4HS2A 3PSHA 5I3ZA 3UA4A 1SCUA 3O4FA 1LJUA 2UUCB 3HY6A 3NTRA 3L5KA 1JQJC 1JP7A 2GHIA 4D99A 1RMQA 4XVCA 1HURA 3KOZA 5HF8A 1UWLA 2HV9A 3E1KA 3MWEA 3SP1A 3OZBA 1ZNWA 3NM4A 2HRBA 3UGKA 1RLMA 1RM4A 4P9NA 2VJPA 4UATA 1RWOA 5LZ4A 1X94A 3JSAA 2QTHA 4WLUA 3VZSA 4BCDA 4GQAA 4L76A 3DV0A 3ILVA 3MW8A 5HG0A 2ABWA 3AJAA 4ENPA 1NVVR 1VCIA 3CRQA 1KPHA 4RL6A 2I7TA 2WWRA 1B8UA 3KQHA 3BHJA 3D9LA 4KDFA 2P2YA 2R05A 4JL6A 4YDOA 3RARA 2FI7A 3T7IA 3WLFA 3SF0A 4K28A 1PK9A 5A62A 1UBNA 2DFPA 2LSVA 2FUG1 2Q4TA 3EAFA 1VIYA 1ABBA 3PDHA 3ONEA 1MGPA 1N6IA 3F8TA 2XYRA 5AXCA 4EO4A 4HORA 1RBYA 2AD5A 1R9MA 1N0UA 3LK6A 3F8SA 3TW8B 3GLFA 3ISTA 3OA0A 2BR4A 1UAGA 3V7FA 4GSKA 2WVHA 4CKXA 1ZSYA 1ZW1A 1C41A 3OH8A 5I7UA 4G84A 4NBSA 1N6KA 3KC2A 3EIOA 1JJIA 1J20A 2WVGA 4BLOA 3Q9SA 3QVKA 4DCGA 3V9AA 3K94A 1PZHA 3BMNA 4F91B 4BNDB 3JXJA 3ONDA 5FP0A 2H4JA 5LDHA 4A2QA 5B53A 1IHXA 3GAAA 3P1JA 4N47A 5KOJB 2B20A 3IHWA 4HBDA 5CXSA 1ZNXA 3MUOA 3BG0B 2VP6A 5LJIA 3FPSA 1ZD4A 3C3RA 1PGOA 2XCOA 3PQ2A 4IW3B 3EXFB 1Z5PA 4IIEA 5CHYA 3DJYA 3TQFA 3M4ZA 2BHLA 2QTNA 4OKIA 4F3RA 1X19A 2CXXA 4MRRA 3MWDA 3BMOA 3ANMA 1PJBA 2C5BA 3NJ4A 3V5NA 3IKLA 4P08A 4J2OA 5NULA 3RF6A 3D7LA 4WNFA 2PMCA 2REQB 3X3HA 1WR8A 3FP3A 2PR2A 3VM6A 1T5HX 4KBYA 1ZJJA 4M7OA 3DTVA 3P0JA 4OMCA 1Z15A 3FROA 3JU3A 2O3QA 3U60B 1D1PA 2I99A 4YXFA 1O3YA 1MW8X 2OBLA 4HDRB 1X7YA 4RW0A 1K5PA 1KMIY 2OV8A 5AJHA 3EC2A 3RHZA 4A16A 2VZ8A 1KFCB 1NJ1A 1QMPA 3S2EA 1YIDA 2FJPA 3GH1A 1V1RB 4TX1A 3QVSA 4NIMA 3SFZA 5FAXA 4JP2A 2ZRIA 4ID3A 3COSA 2W8BA 4F2PA 5LPNA 5ARGA 2HMVA 2QG6A 2OGTA 4QXPA 3TG8A 2R96A 4QYTA 2Y0DA 1TK3A 5AVYA 3EVTA 3W5HA 5F78A 4DTCA 2ZWPA 1YL7A 3O3CA 1PN3A 4K5CA 1UBGA 1ZIXA 3OKCA 3TZLA 3G5TA 3TCNA 3TH5A 4JGIA 4PO3X 2Y71A 1U3TA 1LGYA 1O77A 5JLJA 1BXGB 2DLNA 1E9RA 2AG1A 1MAAA 5JRZA 2CLOB 1ECGA 5DTJA 5I4IA 2ZETA 4E4YA 2XE8A 1R18A 4B32A 4HWRA 3GLGB 2D6FA 4P86A 4ZI7F 4EYSA 2W2NA 2JIOA 2B9EA 3IJEB 1S2NA 3Q7PA 2EBFX 3A0RB 3T1OA 3HXCA 4D02A 1OMOA 3H6GA 2N47A 3LJNA 1QIGA 4JLBA 1I9GA 2Z04A 2P0EA 2ZYAA 2WU3A 1OCRE 4JI4B 4O4JF 5KNDA 4B87A 5C1DA 4U0JA 2ZREA 1WB4A 8OHMA 4WOCA 3WHKA 2RGUA 1E7QA 4HSEA 1DLIA 4FD3A 5BWOA 2CXUA 1VYHA 3I28A 3IFSA 2WF7A 1XV5A 4F4DA 1OKKA 1WKCA 3I9FA 4HDKA 3LNTA 3U62A 1D9XA 2IK8A 4XUDA 1GQOA 1U2GA 3BFXA 3VTFA 4TZTA 5LBTA 4FX2A 1FVXA 1R0WA 4DWWA 2CXPA 2O5RA 3BMCB 3WP0A 5LMUB 2VJBA 1UOHA 4F4CA 4RORA 5F12A 4EJFA 4HH0A 1KJWA 4NZNA 1KMHA 1GG8A 3OP4A 3KVRA 2AMFA 3LCMA 1LX7A 3EA5A 2RE8A 3C45A 2ZDHA 4EDFA 4F38A 3FU5A 1E2IA 1WO8A 2OY0A 2Q9UA 4ED9A 3QKYA 1W0CA 4OEHA 1DWQA 1CKEA 1JT2A 1XMXA 2RHOA 1YNOA 4JJ6A 3CX7A 2COUA 2CFTA 4G0QA 2JKYA 2OD9A 1ZOSA 3N76A 4PZYA 1P7ZA 5K0EA 1NC1A 2XE6A 5E76A 3DXYA 1MX9A 5C31A 1C7QA 2DE0X 1Q6ZA 4YCNA 2IKSA 4LDNA 4UE6A 1U5BA 1VCNA 1W94A 1M8JA 1XYGA 1YZHA 2ZGVA 4DV0B 4LY0A 4TTQA 3ZCUA 1XF9A 5CJ2A 1LLQA 2W2KB 4CT4B 4A0FA 4WNYA 3O1HB 2QD3A 2J9RA 4WBXC 2B6HA 2VJLA 1T5TA 3G2TA 2EJTA 4ZVSA 4IOJA 2IHKA 1GDHA 3FFXA 1BGWA 4Y7DA 1H4SA 4N0EA 1PS9A 2AFHE 4G8BA 4ILGA 3VU9B 4RNDB 4Q4DA 3UWOA 4UE3S 3OFVA 3RK4A 2OMKA 1RAHA 2EDAA 2QN9A 3THRA 2FXIA 4ZAYA 4FWTA 4G2NA 4Z0HO 2IEIA 2QJFA 2IYTA 2IPXA 3MJDA 4B9AA 1NC3A 1JHQA 3L49A 4PZ9A 3P5BA 1J70A 2HE0A 4NJEB 2QAGA 3W6UA 3CHOA 2KHZA 3MCWA 2CL5A 4JS0A 4EGAA 2Z95A 3TLXA 5J2UF 1AE1A 5FRDA 3IJPA 1MZPA 4YCBA 3AR2A 3DSWA 4GMFA 2IOQA 1XXHB 4FQ7A 4MEBA 3RODA 2PNFA 3FAZA 4HEA1 2JLCA 1E2QA 1MH1A 3ZYMA 2QX7A 5I7VA 3GDGA 5C0OE 4OKNA 3WBKA 3TE7A 3R9AB 3D3EA 4GTRA 4KODA 1TT5B 1LFDB 4DLYA 3NTOA 3L8CA 3A2NA 3IUPA 2ACKA 1WPGA 2TMGA 5EQJB 4HADA 1UCFA 2PO5A 3CUYA 3EHRA 2PUVA 4HNTA 3T9AA 2O23A 1OW3B 2C92A 4N39A 5BYJA 4KPUB 3W6ZA 1LS6A 4Z4IA 1TCCA 2FN4A 4KSBA 5KTYA 2HFJA 3I8OA 5DI3A 3ZZTA 1DX9A 1LVHA 5EAIA 5B3LA 1NI5A 2HWKA 1KI7A 4JYPA 3HJCA 1WB5A 2IWHA 4CM8A 5JOQA 2FEZA 4PX2A 1RQRA 2ID8A 3OHMA 2GEJA 4XQCA 5JCJA 4BLTA 4L4UA 3TLAA 2Z5LA 2CYAA 5DM60 3H8JA 5K05A 3U19A 2PGJA 4KK3A 3THWA 1OFTA 3GFPA 4QJIA 3RRZA 1XZMA 1CNFA 1AQJA 3NEJA 5BWBA 2C2KA 3EIWA 5KWVA 2H11A 2AMJA 3RBXA 1L7BA 3NUQA 3NOVA 1M3SA 2FP3A 2Z6QA 4MUGA 2V55B 3D43A 4JFRA 1WUKS 4JKYA 4DIEA 3EVAA 3KSAC 4TUYB 2EQ5A 4DCVA 1ESCA 1CZLA 1II8A 5E6SA 2NAPA 2H4WA 1KZ9A 4KLNA 4US1R 3WLPA 1DTWA 4ZAWA 5JSZB 3T7SA 1MMFB 4NE9A 2YHCA 1USIA 2WT8A 3ANSA 3CXRA 4UBNA 1KJIA 1X1AA 4LCBA 1NN3A 4O08A 2VYNA 3TAXA 4ZYZA 4KPGA 1EXNA 1Y8CA 4X54A 3L7CA 1EXMA 5LR6A 1QRDA 2O8NA 3K5IA 3BE8A 1E3TA 3KQYA 3EOZA 1G38A 3WRXC 3LU1A 3G7SA 4ZEVA 2YH2A 4V0KA 2B94A 1IZ8A 4IDOA 1R9GA 3BFVA 2GCGA 2Q0QA 2FPIB 2X0FA 1HM5A 4AP2A 1XMQB 1C2TA 3MS7A 3RHFA 5FV7A 2QUZA 3G8AA 3KE8A 5EMNA 4AROA 2P2CP 3ENQA 1BQ4A 3AU9A 2GTIA 3DDZX 1T3LA 2BL4A 2VTKA 1T9CA 4LK3A 4RVGA 5EIBE 3JCZA 4BAUA 5KJMA 4HFRA 2X76A 3RIMA 1SFRA 4UI9C 4FGKA 1UKYA 2FULA 4FN4A 3B7UX 1TAGA 4IIJB 1D5CA 4HVLA 4MW0A 1H23A 3UYLA 2O3TA 3HU2A 1P5JA 4ANFA 2CZGA 3B7RL 4U95D 1P6QA 3OKFA 2IUTA 2ZUCA 3OQOA 1Y63A 1YQDA 5A3VA 3MTAA 1YO6A 4QVKA 4IVRA 4Q9IA 5IX8A 4MS1B 4MEAA 4LRZA 1Y4AE 4I14A 1DWOA 4I55F 1YR3A 4ND3A 5CW2A 1Z8FA 3RSGA 1YR9A 2I8LA 3QXSA 1T0BA 5AM3A 2VVTA 1NBEA 1Z6QA 4O4LF 4FGZA 1TW2A 5JSUA 4WERA 3UAZA 5HBRA 3IULA 3DAPA 5K4HA 1IN8A 2YNQA 4BQOA 2VDVE 1GPMA 3IYLW 5AVXA 4KDRA 1BYUA 5YASA 5BWCA 2VP5A 1L5SA 1J07A 2NYVA 3EG9A 2FWNA 3R7AA 3L16A 1KGDA 3D1VA 3L1VA 5A1TA 3C8MA 4E03A 3HHMA 2EHJA 4U7DA 1XX6A 2YHEA 3GLHE 3GLIE 3W3AA 1O8BA 3Q0IA 5JQGB 3UT8A 4IFTA 1G21E 2VDKB 2IXAA 3R3VA 1RKVA 3W8NA 2JHFA 3Q3VA 2XH8A 1QO0A 4IAOA 4RQBA 3E3LA 4GUDA 4JUFA 3DSRA 4Y0NA 5HJEA 1FYWA 3VU0A 5AUNB 4F0JA 1FL9A 4A1OA 4GNRA 2WNHA 1XZGA 2GYYA 3PQFA 4MCIA 1YUBA 3LUCA 2VF7A 1E32A 1R6DA 1JFLA 4RZXA 1GGNA 2NOAA 4URUR 1Z4KA 5DBKA 2BDTA 4HSGA 1P5ZB 2NVUB 2P9CA 4M0DA 5FLXA 2P1RA 1EK5A 1VGRA 5IAKA 2XXBA 5JCOC 2GMWA 3G2OA 1O96B 3KJZA 4RVSA 4BEPA 2OO3A 2AFIA 3QXJA 1GSHA 3HO1A 4KH0A 1N1GA 4I9NA 3NBMA 1W6UA 3B6IA 2OENG 1C1XA 1U3UA 1J0DA 4BLPA 4HLQB 1HZJA 4APFA 1WLSA 2Y0EA 1CDEA 5B2EA 4HB2A 1D3AA 5AYWD 1EVYA 2B82A 4BMNA 3EC7A 5AVSA 5EIEA 5FOUA 1BDBA 3EFOA 3H9EO 3OLWA 4RTOA 1X1EA 3K7EA 4UVIA 2BTEA 4UBLA 3PGLA 2CLFB 3B6KA 1B6SA 5A3QA 1NQUA 5AW0A 5FOQA 4JQCA 4KR0A 4HNAD 2HSEA 4HWGA 3ZU4A 4G6ZA 2HSJA 4XWKA 1ZEJA 1P4SA 3SX2A 2G5GX 4L6IA 1KRXA 2I29A 5C7YA 4AO8A 1ZMTA 1XN1A 2PMWB 3PGA1 4Y1GA 2JIQA 2WINI 2WQ6A 4NS1A 3RVKA 3QLEA 2XS8A 5EKXA 5JAUA 3AKYA 3TNYA 3ASNE 2PWBA 3BVPA 1FT2A 2QV0A 2GUWA 2XCTB 4GMGA 3UMBA 2XEXA 2R5SA 4CKBB 5BW4A 3HABA 1TJCA 2QTAA 4BX3A 2FRVA 3ZLJA 1X3SA 3CIAA 3SC2B 1N5LA 1QX3A 1RHJA 3DEIA 3TG5A 1V4BA 3NOQA 3ZDYB 4KXKB 4X90A 1SY7A 4YAWA 1CQZA 5J90A 4UAJA 4M4SA 4PYNA 3WIEA 1AKUA 4UQYA 1C14A 4BO6A 3DFMA 2HPZA 1NVXQ 3LO5A 3D81A 2YJ3A 3NUGA 3U26A 3I2HA 4V24A 1L5HA 5EZYA 4ZCRA 2EDCA 3ZYQA 2NX2A 3FTCA 3LTEA 1UJKA 2C83A 2ICAA 1QQ5A 4MHOA 1LY1A 4QSMA 2JJ1A 3JYLA 5EOVA 4GM0A 3D9OA 2QHXA 2XIJA 2A35A 3WRYC 3WYNA 2R5WA 1RCUA 3DPUA 5ENNA 1UIRA 2DUMA 4NEGA 2GEBA 3DWIA 3RTAA 3SAJA 3LUDA 3U9LA 5JHHB 4B34A 3V34A 1TQ8A 2QGNA 3UO8B 3UA3A 1SR8A 3JWIA 4M1TA 4GRDA 4Q3NA 2F59A 1W0JA 2A5LA 3S27A 5EJEA 1LBQA 5B1YA 2H29A 3MCTA 4WOKA 3LZ6A 2RHGB 3WOVA 1XQXA 4AV7A 5JAIA 1G17A 1P3Y1 4MPTA 1PNVA 1XMPA 3KSBC 4YACA 5FX2A 4KR3A 2ROQA 2YVKA 2R8PA 3LD9A 3DLBA 5C52B 1P5FA 1UC9A 1SELA 5TXGA 3FPFA 1NLYA 4WEOA 4YP6A 5AMXA 4CKCB 4YRFA 2HREA 4BKPA 4C4SA 3ZKWA 1XVTA 3F9IA 1KPGA 3KDAA 2X23A 1FVFA 1KO5A 3PS9A 1DAGA 2SHKA 1YL5A 1RZ4A 3TJZA 2C2WA 4E1VA 2EW8A 2J6IA 3PQ8A 1BJRE 3A8TA 3GZ1A 3JTEA 3LUAA 1I13A 3AILA 1GL7A 1I5OA 5CA0F 2POCA 4E5PA 1N11A 3MGGA 2BI7A 4WNEA 1AS2A 1HORA 3WICA 1P1JA 2QW8A 4RZQA 3HCDA 1LK7A 3HCCA 1I7SB 5BN4B 1EP9A 2PS3A 3R5JA 5EWMB 4MVJA 4PH4B 1U90A 1DNPA 5J4LA 4AZ0B 5FBZA 3TZCA 2FRDC 3GDOA 1XZCA 2O0JA 2GN2A 4F3TA 1ESDA 4FK8A 2OCXA 1YZLA 3CINA 1LLCA 2PUHA 2P2SA 4IQGA 1CEQA 4K46A 2PQ6A 2WKRA 2HMUA 1BU8A 3PHGA 1UODA 3TFWA 1I3OA 1H19A 3IUMA 1JWAB 2CXOA 1TW3A 1C9JA 4OX9B 5CB4A 4URZR 4GB9A 3LYUA 1GZDA 2JNWA 2IY9A 4Q9LA 1WDLA 1E1LA 3ZEAA 3T5AA 4F1SA 3GUYA 5CCEA 4YLEA 4GCNA 4CZ2D 1XLVA 5AR1A 4E31A 4REQA 3OOYA 1JWGA 1N75A 1W6RA 2R2GA 1XYVA 1LV7A 1N2CE 2FH5B 5FQNA 1MXFA 4M1SA 2WHEA 4MV4A 4GLBA 5BUSA 2J5QA 1JXOA 3HG7A 2ALJA 3PENA 2PX0A 1W85B 3TQHA 1NQXA 3IXEA 1MVLA 2H3EA 1CIPA 2V03A 1VZ3A 1QZXA 4LZJA 2UYCA 2ZVDA 3F7OA 1H2XA 1N6HA 1OZGA 3DVRX 2ORYA 2CVQA 2VK8A 1NXWA 1U4SA 4NDZA 3R5FA 1E9AA 2WYHA 1KJJA 1IXRC 3GMIA 4WIAA 5A4JA 5GVRA 3QWBA 2JFNA 1XU7A 4MUJA 3OZAA 4CXMA 2X9NA 3EPPA 3CNOA 2R4TA 3B7TA 1X77A 2WWTA 1SXJD 2G6BA 2EJCA 2XDWA 2A3NA 4WNAA 3OX4A 5KX5F 5AHKA 3WK4A 2B1GA 3L8DA 5ERXA 4F11A 3QU9A 4XYBA 4N3CA 1ZZEA 3H9JA 2ZIZA 1QG6A 2JAQA 3DMDA 3M4JA 4OI1A 5AN8A 2PUBA 1CPYA 1NQOA 3H75A 4HJRA 4QOIA 3MS2A 4NX2A 4ASUA 1HS6A 2J3JA 5IVIA 2IZ7A 4L9RA 1FXUA 5G3YA 3W5SA 1ZK2A 1X1SA 5I9MA 3JRXA 1BO6A 2QTRA 1O2DA 4FW8A 5IJWA 4LE0A 1GAJA 4RZ2A 2R6DA 4BSXA 2X8WA 3UT4A 5CH5A 1KIAA 2BRUC 1Y7LA 1TGVA 2ZSUA 2HIHA 4EEZA 4AKHA 1QHHA 1AURA 3I73A 1VDZA 3PJGA 4MRSA 1PHRA 1DCKA 1WZCA 2GA8A 3V8BA 1KJ8A 3I9KA 2BJWA 4H1WA 1XZAA 4BNLA 4PN3A 4FZRA