4U8HA

Crystal structure of mammalian period-cryptochrome complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
490
structure length
490
Chain Sequence
b'ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
molecule tags Circadian clock protein/transcription
source organism Mus musculus
publication title Molecular assembly of the period-cryptochrome circadian transcriptional repressor complex.
pubmed doi rcsb
total genus 146
structure length 490
sequence length 490
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4u8hA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u8hA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4u8hA01
2CFOA 5J58A 2A1TS 3P52A 3CLUD 1EFVA 3CVVA 4MVXA 3S3TA 4CQNA 1O97C 4EG7A 4U63A 4QREA 3MMXA 3AG5A 2HMAA 3K32A 1GN8A 1U7DA 2GOYA 5LM3A 1JGTA 1WY5A 3TZEA 4MVCA 1IHOA 1IRXA 1MOPA 1NYLA 4HJRA 4EG1A 1Q15A 3PNBA 4ZCPA 1KP2A 1MB2A 3N2YA 1N2BA 4TS1A 3FHJA 3CLUC 4AS1A 4DE5A 3X1MA 1EFPB 4HJXA 1N2GA 3N8HA 3MLBA 1IH8A 3P0HA 1O0CA 4GU5A 1YULA 3UC5A 2Z08A 3DO8A 4ZCQA 3CVUA 3FIUA 2PFSA 1T6ZA 1T9GR 1K92A 3ND6A 4ZT4A 1NUUA 1M8FA 3A4IA 3L93A 4K0RA 3FWKA 3HL4A 3H99A 2PXHA 1F4LA 5BNZA 1TYCA 4DDMA 1WJGA 2PZ8A 2QJTA 3HGMA 2A88A 3SZ3A 3AFHA 2D54A 1IQUA 1TYAE 3DV2A 3F3MA 2NSYA 3A04A 4KKVA 3UY4A 4YMIA 5J5AA 5LFAA 4MW7A 3QTBA 1U7XA 1QRUA 1WXIA 1O96A 2A1UA 3NV7A 4JYZA 2DEUA 1KQNA 1EE1A 3TNJA 4L2IA 1PG2A 2A84A 3H05A 2PZAA 1N2EA 1GLNA 2TS1A 4MW4A 3KT0A 2WB2A 1RQGA 2AKEA 2JA2A 1H3FA 1EJ2A 2YY5A 1R6TA 3CLSC 1KORA 4NDAA 4JXXA 2H2AA 1WXGA 2Z3VA 3H9BA 4E1AA 1MJHA 2QUKA 1O6BA 1ILEA 2ZUEA 1YIAA 4MLPA 2WSIA 3SEQA 4X0EA 2ZP1A 1EUYA 2PIDA 2VTBB 3SYTA 1JEEA 2V0GA 4EG4A 3RHSA 5HG0A 1NURA 2X1LA 1FFYA 3X1JA 4G5YA 4MW5A 1EFVB 3PNYA 4DLPA 4F4HA 1F9AA 3G5AA 3MLAA 1MB9A 2QJFA 4L2IB 4CDNA 4YP5A 2A86A 4JZYA 1FYDA 3FH0A 3G6KA 1OWNA 4Q93A 1KAQA 3ND7A 2DPLA 1KH2A 3IOCA 5AHWA 3ZIUA 1H1TA 1CT9A 3Q12A 3A05A 4KPUB 4MUJA 4OUDB 2DR2A 5KHAA 2VTBA 3LCJA 1M8PA 1O95D 4UZFA 4MUEA 1PFVA 3IVXA 2C5SA 1QU2A 1EXDA 2QUJA 4PBSA 1GTSA 2A1TR 1YUNA 3ND5A 2BYTA 3FI0A 1MAWA 4MUNA 3FETA 4MUFA 3I05A 4DJAA 5K0TA 4XFDA 1O95C 3IODA 1TEZA 1I6LA 1TQ8A 1COZA 4YP7A 2QUHA 1V8FA 1VBKA 3RK1A 1G8FA 4U7JA 4ND6A 4KR6A 3PNVA 3GUZA 3TZLA 1WXHA 2DLCX 4MWEA 1P7PA 5TEWA 3IH5A 3FOCA 2A1UB 3VGJA 1NI5A 1XNHA 1YI8A 2HZ7A 2DXIA 4JFAA 5J59A 2CSXA 4EF6A 1TFUA 3UMVA 1N2HA 3E27A 3L92A 3X1KA 4K03A 1N2JA 2D13A 2X3FA 3G59A 3MUEA 5HUJA 1U3DA 2PG3A 2XRYA 1M1ZA 2AG6A 3IOEA 2J09A 4NAHA 3LE8A 2YWBA 1QTQA 1G8HA 3FDXA 4ZT3A 3MXTA 1NUQA 1LW7A 4QRDA 1KQOA 1QRTA 3QE4A 4WSOA 2X1MA 1VLHA 1KH3A 1J1UA 1VL2A 3HV0A 3CVWA 3PRHA 4MUIA 3OP1A 3RJZA 2I1LA 3KT6A 3AIIA 2CV2A 3DLAA 3IMCA 1MAUA 4ZT5A 3COYA 3INNA 2CYAA 3IVCA 1NUTA 1OBCA 1KH1A 5JBNA 2CT8A 4ZCTA 2ZUFA 3QTTA 2RE8A 2CV1A 1PG0A 2GM3A 5IJXA 1N77A 1O94C 3ELBA 1OD6A 1QQTA 3IMGA 3RBAA 3CLTC 1BS2A 3RK0A 2JANA 4EG8A 1HYBA 3ZJUA 1GZUA 4I6JA 1K4KA 3ZXIA 1I6MA 1GTRA 1X6VA 3VU8A 1OBHA 1WQ3A 3M5WA 3FY4A 3ZJTA 1NUSA 1KP3A 4RUKA 4NZPA 4Q16A 1QRSA 1IFXA 1N2IA 4A91A 3SDBA 1EFPA 1Q77A 1JIJA 3ZUGA 5K0SA 2IELA 1OWMA 4ZCSA 3D6VA 4YBRA 2E89A 4KR9A 1T6XA 4EGAA 2WQ7A 2GKSA 3HFJA 5TGTA 1M83A 2AZXA 4WNYA 4OUDA 3NBAA 3JXEA 2QTRA 4KR7A 1O5TA 2VXOA 2J07A 1G8GA 5H16A 1YIDA 2QUIA 3P0IA 1M8JA 1JILA 3KT3A 4MUHA 4J76A 4ARIA 1I2DA 1UFVA 2Z09A 4ARCA 4HPWA 3IUBA 4I6GA 1KKUA 3AKZA 1F7UA 1U0BB 4ZT7A 4OJMX 2YWCA 5HUHA 2A4MA 1D2RA 2OQ2A 1PFUA 4MULA 1K4MA 5EKDA 4ZT6A 2E18A 2NZ2A 1U3CA 3D6UA 3A2KA 3SEZA 1PFYA 1JECA 3KT8A 1M8KA 4EG3A 4G5FA 3ISJA 4KPUA 2H29A 4YP6A 1JMVA 3TQOA 2PZBA 5H7XA 3SP1A 1WZ2A 5DEOA 1N75A 2EL7A 5DB4A 2J08A 1IQRA 1G59A 1O94D 3COWA 4NATA 4EG6A 1X8XA 1VBMA 3AG6A 1ZUNA 1OWOA 4S1OA 4XFJA 1Q19A 2DETA 2RD2A 3ZGZA 5DASA 3COVA 4MVYA 4PBRA 3H9CA 1TYDE 1H3NA 4ZT2A 4R0NA 1K97A 3COZA 1J1ZA 4BWVA 1MRZA 3H97A 2J4DA 2OV4A 1MBZA 4MW0A 2E21A 1QU3A 2CYBA 1OWLA 3UK2A 4HK4A 4ZCRA 1N2OA 4F3RA 1IQ0A 2CV0A 4G6ZA 3SZGA 4PY2A 5IHXA 4R2MA 3N05A 1IVSA 1NSYA 2V0CA 3RFFA 1M8GA 4XSVA 1O96B 4MVWA 3U1VA 2A7XA 1ZH6A 4MW2A 4NX2A 3TQIA 3K9WA 2G36A 3HMQA 1J20A 3N9IA 1N78A 2JAXA 1A8HA 1J09A 2J5BA 3ZJVA 1WQ4A 1GPMA 1JEDA 1JZQA 3P0JA 1Y42X 1PFWA 2R5WA 2O8VA 5FO1A 1KR2A 1WXEA 1ULHA 4CDMA 2CUZA 4FZJA 4DNXA 4DDHA 2B7LA 2D5BA 1NUPA 2XRZA 1JHDA 2YXNA 3CLSD 1MC1A 1N3LA 5TEVA 3TS1A 1JIIA 1H3EA 2QJOA 3CR8A 1WOYA 3ZXSA 2CYCA 3OTWA 2O5RA 3VRHA 4EFKA 1JIKA 1NP7A 1SURA 1XJQA 4GRIA 1KQPA 4PBTA 3HZRA 2WQ6A 4MAFA 2QTMA 1YUMA 1Q11A 1O0BA 1J70A 4P2BA 3Q10A 4JXZA 4MUKA 4MW1A 1ZH0A 1F7VA 2DUMA 1QJCA 3UOWA 4MUGA 4MQ6A 1T9GS 1DNPA 1J21A 4CT0A 1R6UA 3IMEA 1S4MA 3AL0C 1TYBE 1R6XA 5FNZA 4NAUA 4U8HA 1WXFA 1GAXA 2IJGX 1B6TA 3KFLA 4MWDA 3CVYA 3CVXA 4MW6A 4EG5A 4ND7A 3ILVA 4MW9A 5F23A 3C8ZA 3CLRC 2EJCA 4H3SA 1LI5A 5KCMA 2IP1A 2DERA 5FO0A 1ZJWA 4AQ7A 1N1DA 4I6EA 5KWVA 3LOQA 3FNRA 3DPIA 1WKBA 3CA8A 1LI7A 4QBTA 1XNJA 3IUEA 2X0KA 4RPIA 5DK4A 1VBNA 3IDFA 3CLTD 3NBKA 3BL5A 1V47A 1O97D 4R2LA 5LLTA 1T6YA 3CLRD 4UZEA 2HGZA 3PXUA 1EUQA 4MWBA 3IVGA 1QNFA 3FG9A 1I6KA 1KAMA 1JZSA 1XNGA 2E0IA 4MWCA 3GLVA 5TS2A 2BTEA 4J75A 1NZJA 2QTNA 3GMIA 1OWPA 3Q4GA 3IOBA 4DDKA
chains in the Genus database with same CATH superfamily
3TZKA 3E9YA 3LM8A 3ONVA 3Q7SA 1CUSA 1YL5A 3LP5A 3QNUA 3NEJA 1I1NA 4PN7A 3PDNA 2JGKA 2QRJA 5BYKA 3PHJA 2IPMA 1JMKC 4TUYA 3H1PA 2ZBVA 2FN3A 3NONA 3MJVA 3MWFA 3QIVA 1QUFA 2CVPA 2PGDA 4I4LA 1WB6A 2FRXA 3HXKA 4U7GA 4E46A 3IRUA 1EVJA 3LDUA 4RHUA 4YAWA 2UXDB 1SEPA 1NYLA 2XQVA 4JYBA 5A71A 3AVQA 2PKRA 1JG7A 3GUYA 2P11A 4WZBE 5TARA 2FW7A 4DPMA 2D6FA 4GT1A 2XYVA 3I4RB 4XUDA 2ZB8A 5FPYA 2HO5A 2CLCX 1AM4D 3HU2A 3PRKE 4OHOA 5AH0A 4JQZA 3QP9A 3RBZA 4G1FA 3ONNA 3TMAA 3BK7A 4WBSA 4Y2JA 4L5YA 3ZGLA 4NJOA 3N2EA 3N8HA 4LKRA 3PPVA 4NDNE 1ZIPA 2C2XA 1A3CA 4NZOA 1O0CA 2FFAA 2BRUC 2V97A 3EFEA 2A33A 5IC4A 2FE4A 2YUIA 5LP6B 2OGWA 2FWMX 3OCCA 3WMGA 5AUPB 5FWDA 2C99A 4R7GA 3DEIA 5JO0A 2PU5A 1KYZA 2ZE5A 3GRAA 1QS0A 5K3CA 2F90A 2E4UA 2IDKA 2YMMA 2FZEA 2GFQA 3ABIA 3V4PB 4DFDA 3LKZA 3HL4A 3FZEA 5KJCA 2Y0PA 2P3LA 3LQKA 1YZFA 2A5FA 2OCKA 4DA4A 3FYCA 3IHYA 4IP0A 1ZJYA 3OFSA 1PYDA 5GQSA 2JGJA 1G2PA 2Q9UA 1TCBA 1O6FA 4OQXA 5CB6A 4G0MA 4E51A 3PTZA 2J3EA 3U39A 5HZMA 3OZSA 3K20A 4LNUD 1EP1B 3UNXA 2ZSHA 4QQNA 4X84A 3RVRA 4BJ3A 2HH9A 4A0SA 1GV1A 2AR0A 3LTNC 3EZNA 4HWSA 4I9GA 4HSEA 4UPEA 3ZKAA 3I09A 3JUEA 1CRLA 4CL0A 1SPXA 2FXVA 5CRIA 3CR7A 3D3WB 1DAFA 2BBTA 1Z2DA 2WSYB 2XAAA 5DGHA 3CG0A 4L1KA 1EE1A 5C46F 1NF3A 4QGAA 4MP3A 1MT0A 1GCGA 2ALJA 5IDWA 4G26A 4GR5A 2I2OA 3FGOA 2XMRA 3QKWA 4OCZA 4WVFA 3TOVA 5CBPB 2IEDA 3V4SA 1LD3A 2DB3A 1N5LA 4DI3A 1BVYF 1K6JA 2ID7A 2MMCA 1PD1A 2OOEA 2OHJA 4RPHA 2J0VA 1FA9A 3H2BA 5IM4A 3M1YA 4LJRA 4KQGA 4PW0A 4DLZA 2FLKA 4RG6A 1SR8A 3BU8A 3OECA 1Y5IA 2LWIA 2VYQA 2YBEA 1I1QB 5BUZA 3JD0A 3LC0A 3IA2A 3IUMA 4IQGA 4S2UA 3N53A 2BMVA 1NG1A 3VPDA 3SVTA 2NVWA 2BC9A 5ER6A 4YXWD 2DRIA 4LE1A 1G9SA 4U8VD 1GZ7A 2JJMA 3A11A 5F7ZA 2KC7A 2J7KA 4PYOA 3TLXA 3W77A 1ZR2A 2WKRA 4MXDA 5ENSD 1JI3A 3RV4A 2WJHA 3DMNA 2IBMA 2D1SA 5ENNA 3ZYKA 1A0OA 2ASEA 2NZVG 4GVLA 4RH3A 1MB9A 4QOSA 4WXRA 4J6FA 2X8AA 1TUIA 1XDWA 1Y80A 3B60A 4O4LF 2ZQ5A 1ZO8A 4OK5A 4OMCA 3MFYA 4P53A 4M49A 4IYRA 3KKLA 2IUSA 3SNHA 1XEXA 3I52A 4Q93A 3RSOA 1VZ2A 1WDKA 1NAIA 2PCJA 2V8OA 5A3VA 1P2UA 2AHOA 4LKOA 3ZDZB 3R6GA 4BQSA 5H4HA 3T15A 3GEIA 3QLVC 3P2KA 4RVGA 4YRPA 2VTBA 4EPYA 4F4FA 1TFRA 4HNAB 1UQTA 3AC0A 3QXSA 1BSVA 4H6PA 4JI1B 2PTHA 2JJQA 4XEUA 1EFTA 3EHEA 1TNYA 4C87A 3T94A 1GZSA 4QEZA 5JT1A 3MGAA 2X6TA 2MIIA 2BHTA 4XYGA 3WRYA 4YXFA 3CX8A 5ESXA 1D2NA 1GA6A 3FI0A 4MUNA 5ALRA 4ZQBA 4YJ3A 3K70D 4LQ4A 2ZBEA 3PU6A 4RFLA 3VR5D 1I0ZA 1XR3A 4BDTA 2CXSA 4WA8A 1ZJ4A 4EI2A 5FNVF 3L4JA 2RJNA 2RBGA 3IODA 5E8RA 1COZA 1LC0A 3RT1A 1CUAA 2XDWA 1MGPA 4ESEA 2OP0A 3EGCA 2EJUA 5BW8A 2NXNA 1K98A 4MR8B 5K0CA 2P4EA 4I50F 5DK6A 1DOHA 3BMXA 4XKBA 1MFPA 1EIZA 2ETAA 3PYLA 3P71T 4HVAA 3ZQ4A 3CU5A 3A6FA 2WIBA 5ITVA 3ESDA 3KE9A 3RVJA 4HI9A 1FUIA 3OIDA 3HCFA 3ZU6A 1NFIE 1I1OA 3O31A 3WSWA 5IXSA 1E2DA 3FU6A 5JQGF 4IVNA 3UTDA 2EFEB 1N3YA 1QHNA 1W52X 1W34A 3TXNA 3GPBA 3IUNA 3L0IB 3NHJA 4D92A 5MN4A 2NXPA 2TYSB 4OHBA 3TXMA 2GCPA 4ER7A 1V8PA 7YASA 2WA1A 2IEJA 4HNRA 4N8DA 4QPCA 4A82A 3MXTA 1NATA 1HE8A 4QRDA 1A1SA 1H6BA 2HA6A 5LC1A 3UO8B 4WSOA 3BIXA 3DL2A 1U3UA 1SQSA 4OGLA 5C32A 4QT4A 3AZOA 2D59A 4BV9A 2PWYA 2P1ZA 3KAEA 3BAZA 3DWIA 4QU5A 3G9UA 4YK7A 5CLGA 2CV2A 2FWIA 2ZSAA 1W0JD 4KYVA 4RK0A 1E4VA 3HYMB 1CUEA 1E1KA 2E4VA 4EWLA 3QH4A 2OO7A 4XPIB 4ZU6X 1S1CA 3HFGA 3RFVA 4O1OA 1YC5A 4MPDA 1A4XA 2YHEA 4HMPA 4O1PA 4UBIA 4Q9HA 4FZ3A 1XMSA 2MOWA 4OAVB 2ZUFA 1NVVR 4MA5A 3RYCA 3U5ZB 1ISFA 4QC2A 3RU3A 3TR5A 2R6JA 1ZM7A 2VHXA 1GR1A 3V55A 3UWPA 4K9KA 3ZX4A 3G8AA 1D5CA 2XKAA 3OSZA 1M7GA 4RQUA 1G5PA 1J22A 4MEAA 1NOJA 1XQWA 2WZCA 3N5CA 3QWFA 4C2AA 1HYBA 3FUEA 2H2DA 4A2PA 1YRQA 4BUJA 4S0ZA 4YCSA 1QG6A 2DBVO 1JVBA 2MYNA 4RDCA 4XGKA 1YZTA 2ADFA 2XMGA 1T2EA 2GHQA 2JFHA 2ZUUA 1TKBA 4Q3BA 5AI5A 3ZXIA 1I6MA 1Q3HA 2N47A 1PO7A 1X6VA 1ZOOA 2HEIA 4QO7A 3A3KA 3CW9A 4JH0A 4MV8A 2FSGA 3TRDA 5FTPA 3VR6D 1MOZA 4TV9A 4J3NA 3KC2A 3R77A 4WGFA 2QX9A 2O1XA 2H07A 5CYFA 1MXFA 3U3MA 4PYMA 4YTEA 1LDYA 1L4MA 3OPNA 1OWMA 1YOBA 4JOBA 4Q7JB 4BO3A 1W36C 2WP8J 4MR7B 3VM6A 1QOQB 5CW1A 5BN4A 5DGCA 4YBRA 3ORHA 1PVOA 4NQRA 4OQPA 1VIYA 4BMNA 3AY3A 1ZFNA 4HOSA 3A1SA 1PZHA 3TWQA 1M5TA 4JC0A 4R5MA 4WZBA 2X2EA 3GD5A 1WULS 1PLKA 5DULA 1Y3AA 3JQGA 4LCBA 1WV1A 4R7LA 4EYQA 4R2IA 1RCFA 2J3LA 4F3KA 4MV9A 5E1BA 3LUGA 2KLBA 2WC1A 1HDRA 1XZEA 3O5AA 3Q4AB 1ZA2A 1XEXB 5JI2E 1XVTA 2PVCA 3GT0A 1CFJA 4Q4DA 4XGNA 2H7CA 2OECA 2YN0A 3BC1A 5BSMA 3E34A 4WLEA 1S70B 3DBVO 3EQ9A 1XU7A 3T1OA 3KEAA 4MJ3A 4HXYA 5KSWB 3USES 3GRUA 5EIAA 1H4TA 1NJSA 2GI4A 1N8TA 4Q69A 3Q40A 3VJMA 4DMUB 5LLDA 1P77A 2R6AA 1KO7A 2ZRJA 1EEXB 2QIOA 5KYGA 1HUQA 5HUHA 4ETWA 2UV8A 4NU0A 5AN8A 1QV9A 2AYXA 1TNBA 2HY7A 4BEWA 1CUJA 3BD6A 3PFWO 1SPBS 2G9VA 3OFND 4A2CA 4HCJA 1YRAA 3RVSA 1D1QA 4Z7OB 4C7OA 4NZ9A 3VZRA 4CTJA 5BSUA 1V9SA 1MV5A 5CFPA 1SOWA 3G0CA 1M8KA 4K6MA 4BMYA 1FTWA 1LK7A 4C7BA 4U8YD 3OBIA 3QXXA 5FTKA 4Q3OA 2WT8A 4UULA 4BTEA 3E5MA 4XJTA 1V6AA 1IM5A 4XJSA 5JDIA 1CQIB 2VQ3A 3ZLTA 1K1EA 3V1UA 3AHCA 3D6HA 1MA3A 1YRLA 3C97A 5K6AC 1G59A 3RR2A 1XZIA 4P5DA 2Y1XA 4GTMA 1POXA 1K7FB 1UJ6A 3GP5A 1PR1A 4BNDA 2C9YA 4MYSA 5IAJA 4DEVA 4IUDS 3OZCA 1XC7A 4M8NE 3CK8A 4N82A 5JVDB 1AHHA 4C6RA 4CG1A 3EDTB 5I4KA 3GW4A 1L1RA 3QV1A 4GLFA 2BSQA 3VJRA 2B6NA 4DLUA 3EEBA 5D0OD 5DISB 4U07A 1RE1A 2ZT7A 1Q95A 4JODA 5LDHA 2WZBA 1JR3E 3NBQA 4IL5A 2X4IA 3V8MA 4BCDA 4D4LA 4PBRA 1C7IA 4PGHA 4CF7A 2VH5R 3HO1A 4B44A 1HYHA 1WVGA 3PZ4A 2B5OA 2X40A 2CXTA 1N94A 1BHQ1 4RULA 3GRKA 1E94E 1U63A 1I01A 1O4WA 2JGDA 1LLDA 1TAHA 1X14A 3R6LA 2VIIA 3RGGA 1ZL2A 3EVZA 5DHUA 2QGZA 1MBZA 2XOXA 4UWKA 2H9IA 2BHLA 1UKZA 3Q85A 4C4AA 4DNQA 2C2OA 4INZA 5SZJA 1EUZA 2D1TA 1NLUA 2BGUA 5AT1A 5K8LA 3U5TA 4TVOA 1O6CA 1FDOA 2W0MA 4NV0A 4OQZA 3PE3A 1G7CA 3WK9A 5CA0A 2GRRB 1LPSA 3BDIA 5DCYA 1BMFD 1U2DA 4TLEA 3WWOA 5IH7A 1W4CA 2UUPA 4CEJB 2ZUTA 3NT2A 4XSVA 4BQFA 2G17A 3I9LA 2A7XA 4EW3A 3LRTA 2RGYA 2OAQ1 3OZXA 1Z47A 5F7XA 1AS3A 1V8DA 2WBLC 1ZJJA 1N78A 1ONSA 2E37A 1QM5A 1AURA 1PTJA 3K9QO 4YT5A 3MJSA 3CH7A 4XYLA 5JVDF 5J2TA 1E59A 3DE2X 2E6UX 3ZJVA 1Z4QA 3G0DA 4B79A 3R9WA 1ABEA 4Q37A 3KTFA 4JENA 3NEAA 1QAMA 4TMZA 1XLUA 3R7SA 4PIPA 3QMMA 3WIEA 3WBKA 2AOXA 2UY1B 3NVAA 4UTPA 2WG2A 2YXNA 3CLSD 2WJ4A 3PE6A 5IAGA 3WYDA 4QXOA 5I9NA 5FINA 4IOMA 2YINC 2ZXFA 5DXFA 3C3PA 1KARA 3MWGA 2X77A 2OG1A 5E4JA 3TL3A 3ZY6A 4C4RA 1JCSA 5H9VA 4UNIA 4TSRA 1X70A 3BWMA 4NK4A 4QPZA 1NDUA 3LVRE 1WVIA 3COPA 4C3UA 4LSWA 1JKIA 3VHLB 2KBXA 5K01A 1JEYB 1TVKA 2D2XA 4J43A 3WE7A 1QU2A 1XCGB 1KLXA 4L15A 4IHKA 3ELDA 3SC2A 2LNDA 4DRXE 2D8AA 2DFDA 3EZ9A 5ARBA 4U7EB 1J5PA 2P6UA 3AW8A 1B93A 3N0XA 5E7MA 2XBMA 2RD0A 5U4XA 3ZHXA 3ZE6A 4L4RA 3RBXA 2Q1XA 1Q2XA 3BD8A 4PG5A 4WLOA 621PA 5T4YA 1HL7A 3QB2A 2RGWA 3UOGA 2YWEA 1SHLA 1A2OA 1HF8A 4I9EA 4OU4A 4FQ5A 1JR3A 521PA 1JZTA 2XV1A 2MYUA 1CKEA 1F9EA 2KSQA 1SRRA 1RZUA 3B7PA 3D6TB 4MS3A 2IOFA 3KLPX 4PCVA 4V3BA 4HAZA 3RRJA 4HV4A 4XWYA 3GN2A 1KSJA 2B6HA 3DE3X 4H7XA 1ECFA 3CO5A 5AW0A 4G85A 1R6XA 2C9CA 1YB4A 2NQ8A 3GFPA 4N7JA 5A9SA 3VXKA 1ZN9A 4ANWA 2JLBA 2IU0A 1U1DA 1KT0A 3V4OA 5KKCA 4FR5A 1GFWA 3EXG1 3M2PA 2PMFA 3IAS1 1Z6TA 2IIBA 2QYOA 3K05A 1OV4A 3GMDA 1P1IA 1JCQA 4S12A 3B95A 3OZIA 1E8MA 4TZ0A 4JBNA 1H0SA 1LDNA 1CJKC 4UD6A 2GN9A 3SG0A 1NF9A 2VXBA 3B7UX 1WCYA 3HKBA 1OFTA 2M98A 1DBRA 1TMYA 3A32A 3HRHA 3MINA 3WJ1A 4LF9B 2BRUA 1R5OA 2DJIA 2BFPA 4XCQA 3Q7AA 4GWGA 1L4KA 2YV5A 3RT9A 4QUHA 3P9PA 2J9FB 2MSCB 3UG7A 4KC0A 3E3NA 2QQGA 5LBTA 2XTNA 2XSZA 4PZZA 4R9UC 3AS4A 3B8HA 3OAWA 2DHRA 2GVNA 5D3ZA 5FI0B 3ER8A 1TUBB 1OGIA 3KB8A 2JJ2A 3SF8A 4D2IA 2FEOA 1TU0A 2QRKA 5G3ZA 1D2CA 1HTBA 4X1OA 2C7OA 1DXQA 2N3ZA 4ZEMA 1PJBA 2AZMA 3RIGA 3ZZTA 4OLFA 3T8KA 5ALVA 3GPCA 2GQ0A 3A2NA 2BGTA 2ZUWA 3BUSA 3F74A 3IIKA 5DTEA 3J5QB 3VR6H 5CFZA 5IFKA 3E1SA 4CV2A 1EVYA 2KQUA 2DLNA 1CEXA 1VKNA 4HDNA 3FU0A 4JT4A 1JAIA 3L4KA 4C4PA 3O4JA 1E3MA 3T9DA 1XRQA 3QXGA 5CLHA 2I7TA 4PFJA 2Z98A 2C20A 1JZSA 3S7ZA 4ZFHA 1QORA 3CISA 3H3FA 2PMBA 1IE3A 4IICA 4P3KA 3SZUA 4UUNA 3TQQA 3UCFA 2GZDA 5U9CA 1SKQA 4BETA 2V3WA 2CBGA 3NNSA 1NZJA 4W5TA 3EDCA 3FUTA 3HXEA 2PA0A 4TVSA 3L0BA 3FTEA 1ZJ6A 4CTOA 2D4HA 2J0UB 2J0SA 2GPTA 2ZT8A 3L82B 1S6YA 3H2KA 3I1JA 2B8JA 2R11A 3JYPA 1I80A 5FQOA 2AG8A 2A1TS 3IESA 3P52A 5KC9A 2BI4A 2EG9A 2Z6VA 4W7IA 3S68A 2HWKA 1SG0A 3QLUC 4JA7A 5DKFA 5K3AA 2X22A 2AUTA 3HGTA 2QLFA 5B1AE 3OJCA 2Y1EA 3TVYA 4L3WA 4EG7A 4WNGA 4FWIB 4YV7A 5DV9A 3SMVA 5DSZA 4OFXA 1JGTA 3GLHA 4GBED 5K8TA 3QAQA 3ZPXA 1KZ4A 2D06A 3ZEFA 1D1PA 4FHCA 1JLHA 4XTRA 5HQTA 1VCHA 1CUVA 3KHTA 3RC9A 1BU9A 3M4NA 1BDIA 2B6CA 2XHZA 3FWPA 4RZ2A 3PNBA 5J1SB 2BWJA 5JNTA 4Y6PA 4JLJA 4PZLA 3AYXB 1PT8A 4KE7A 4MB2A 2FEPA 2OEWA 2GUGA 3DUWA 4QX6A 5E1DA 5FOTA 1L5LA 2I62A 2ODEA 1VRWA 3X3HA 3WAJA 4N5CA 3O8QA 2JFYA 4OLJA 2LXNA 3L16A 3K0EA 3FRIA 3P9KA 4PDXA 4NTZA 1DAIA 1E1YA 1MORA 3V7YA 1GCOA 1QIJA 1X80B 2UY1A 3F5MA 4A6EA 4UTZA 5EG5A 3CZCA 3L0ZA 4TYWA 3ZQUA 2HXGA 1T6ZA 3Q7TA 4CQLA 2VH2A 1BHO1 2O23A 4FMCB 1BCRA 3M1LA 3CK9A 4M22A 3JSAA 4EX6A 5AKYA 3K5HA 2RGAA 2FZLA 3H99A 3P5SA 3V42A 4CJXA 1YFJA 4HEHA 4K9QA 2ZJZA 2JNWA 3PLRA 4E6HA 2IYZA 3L6RA 3AU8A 1EBFA 4YX9A 1XZCA 4BNIA 2Q45A 2CVZA 5I3ZA 2HV9A 3O0DA 4CMJA 1RXIA 3NNNA 5BSFA 1VLLA 2PZ8A 2VUHB 4Y1FA 5KSYA 2A88A 2TRSB 5IVDA 2VBFA 3N71A 3FVTA 2RGXA 3LQFA 3E7WA 1VPTA 3E35A 1TYAE 1Z7EA 2B7CA 3KJFA 3S28A 1Q7CA 3UY4A 1T8SA 4X24A 5B58T 2Q5LA 1CJBA 1BPOA 3HJAA 2RIPA 3MWEA 3WLOA 1UP4A 3HLKA 1QRUA 2Q6TA 5JO9A 4LY9A 1E6LA 4L8FA 5C8ZA 5P8WA 2DBQA 6LDHA 1DINA 3TNJA 4UWGA 1QPBA 1PG2A 1IZ0A 3NB2A 1QAOA 2AS0A 2Z2JA 3E7FA 4KNVA 4A2WA 4KZPA 1YASA 3VDQA 4B6QA 1YJQA 1I4WA 4WBNA 1N8KA 2VJPA 2PIAA 5FNVB 2EP5A 4Z9YA 4HQDA 1BA2A 3DXFA 4DMKA 1P9NA 4DDUA 1FTNA 1N9GA 1RXEA 2B36A 2FUKA 2IYRA 1PSZA 3KJIA 1Z7BA 4JBXA 4RIGA 5K8IA 3DJFA 1Y63A 2A9QA 4BNDB 1RM5A 2VI5A 3MOIA 4IKOA 4LSGA 3D7MA 2BD0A 5BSRA 4BFUA 1RXVA 3VGPA 1CUZA 5BR7A 4BLVA 1LXCA 3HDJA 1UPCA 4IXWA 2B7BA 2JD1A 5BPFA 4MLPA 2FWRA 4YR7A 1R6AA 1C30A 3WOHA 3WB0A 3SYTA 1NQTA 3V79K 1IHUA 2PUJA 3B48A 4JT2A 4J0KA 4QOJA 5DLPA 1E7VA 3N0WA 4UUQA 2NVUA 1FFYA 2J87A 1ZZEA 5IT9A 1FRFS 3ONWA 2PZEA 4EJSA 1J0AA 3SBDA 5BURA 1JLLB 3OUZA 1NN5A 1W0CA 5AJYA 4DGSA 4F91B 2ZR0A 2BEDA 4LOIA 2WUFA 2P4UA 2G1AA 3T38A 4U2GA 3ZW7A 1UBEA 4AZVA 1WAO1 1E3SA 1WZCA 3HLYA 2DPLA 3TR0A 2ZS7A 2OZKA 1KY3A 3T5TA 3RIBA 1A9QA 1E1CB 1CQWA 1V7QA 3K09C 3E58A 3NKVA 4IW3B 2AEMA 1Z83A 4KPUB 4YRJA 5AJDA 4OUDB 3KK0A 3UINC 4BATA 3TWVA 4QRIA 2P6MA 3I1YA 2JG3A 4H0CA 1P17A 4KQCA 1O95D 3ZCPA 3I5PA 3DZFA 2OMKA 3ZN3A 3AR8A 3FMFA 3TEJA 4F2GA 4YRNA 2J85A 2JAWA 5C8XA 1G98A 1MRSA 4IJQA 4XM1A 5AAOA 3KX2A 5SYMA 1B89A 4UMEA 1FBTA 2BEKA 2C94A 2E6KA 3D3MA 4DIEA 3PYXA 1C3JA 4QHTA 2ZKLA 4OYYA 1QRRA 3RC1A 3I5YA 3TRFA 4JP5A 3BXHA 1E0KA 1S64A 2HNKA 1KJNA 3PJFA 5KNDH 1ECLA 4BFLA 1M2FA 2ZROA 4WXPA 1VBKA 2OBXA 4N48A 3M9XA 4C04A 3I2HA 2ZTMA 3GRZA 5LP6F 2GXQA 2ZWVA 2W4IA 1PWXA 2WWYA 1CRPA 1HT1E 1WPQA 3G13A 3H83A 1NBME 1E64A 4H7YA 1HBJA 3TJPA 1WXHA 3ID6C 3OZUA 2HBRA 2VDWB 3LBNA 2W5UA 3OXGA 2C54A 2C3PA 2OOSA 4LI3X 2YKGA 2VQ6A 1JLRA 1EUDA 2YFYA 1N34B 1AXEA 2QLLA 4JC8A 3EARA 5IZCA 4FCWA 1U81A 3FPGA 5ESRA 2GHIA 2AIRA 4LJLA 5DTIA 1L4EA 4XI9A 3U26A 5C3UA 1SKYB 3BWDD 4U3JB 2VTKA 2ZJ0A 3C3CA 1GG2A 1L1FA 1J5EB 4D4GA 1Y3FE 2PGIA 4WKBA 3P9CA 2V6MA 2B92A 2DWOA 2PG3A 5D01A 4CHTA 2NACA 4K46A 5BWLA 3AX6A 3LUDA 4YP1A 3AFIA 3GBPA 2BMFA 2JHGA 1RWPA 3N8GA 5IK2D 4BE7B 1TF5A 2QV7A 3B53X 1U8YA 2F4VB 3QVGA 5JD3A 4C0XA 3H3JA 3M5DA 2YXPX 4AG6A 1UZLA 5CVTA 1V4NA 2ORVA 1QVWA 3B38A 2G63A 4PLCA 4J29A 1X87A 5A5DA 3RO2A 1UBJS 5HF8A 5A5FA 3UENA 5FBLB 4WLNA 4EFLA 3MTEA 5JU6A 3E7PA 3TAUA 3RC8A 4WV3A 1OV6A 4UVGA 4I66A 3ROTA 1A27A 1H22A 5FBVB 1D2HA 1FNBA 3AUTA 1UPTA 3FYUB 3DVRX 3IAS6 5GJCA 5HDBB 2FO1E 2EJTA 3LWBA 1G8AA 5HQ8A 1T4GA 3L7DA 3U3OA 5JSQA 4IG4A 3ZXYA 4AJ1A 2PJUA 3ZYCA 1YQWA 2Z3ZA 3QBTA 4Y9UA 3X44A 4DQKA 1X7WB 1OU4A 3F73A 2GPJA 5JECA 5FUYA 3OQOA 3JQAD 5JAOA 4YRAA 5JMND 2HXYA 1JHMA 3S2YA 2DSNA 1V39A 2Y77A 1KEEA 2G40A 2H2FA 2WWHA 3RO3A 3H1GA 3NHLA 4JS0A 3RKRA 3MOSA 3UAXA 3L0DA 1OGYA 5BV2P 2BELA 5FRDA 1L5NA 4BV3A 2LBPA 4C88A 1EK6A 4M9UA 5FPPA 1ZRMA 1V3QE 6REQA 5LYJA 4BMVA 3UT0A 4LOHA 4YMTA 3VDXA 2EC5A 4CKWB 2X3MA 1D07A 1SUAA 2NAFA 3W4IA 3WMXA 3OPMA 2ABWA 4EKEA 4CMHA 5KVQA 2RHGB 3VPAA 2G83A 2IX9A 2SKDA 4KQ2A 2C4VA 1U0OC 4LOAA 3VU8A 5EJ2A 2IEZA 4RX1A 1SM4A 3D3JA 1E62A 4Q96A 1NFQA 1NUSA 2FMIA 5AW6A 3FLEA 4WH0A 4FOSA 3T3IA 5K7SA 3KOOA 4V0LA 1QC5B 5CNIA 2MT9A 4A91A 1UJCA 1OI7A 4OHYA 1E0AA 1MTZA 3R2JA 3DQQA 2QU8A 4MQUA 1ADYA 2ZJ5A 4JLWA 3RRZA 1DDIA 2UAGA 3D7RA 4JDPA 4RV4A 5F1KA 1YACA 3I3SR 5FYQA 2A8YA 3VR4H 2Q0SA 1R50A 4FU0A 2P5SA 4B3IA 3EAGA 5ERYA 2FZWA 4UM9D 4B43A 4F72A 1H6PA 2C9ZA 4LEIA 3A6PC 2BJVA 2P2DA 1N25A 2O5VA 2VHEA 4KGVA 4WNYA 5EZ5A 5AKEA 1QUEA 4DIDA 4ZYVA 1BGXT 3CJRA 1Z16A 5FOUA 2NVBA 4GYKA 4MIEA 4NZNA 4KOEC 3K92A 4ZAYA 5H16A 2HIAA 4HWGA 2HMYB 3I3NA 1HFWA 1GJRA 4RXMA 4JGBA 4O5AA 4XIYA 4MS4B 1K86A 1ZHFA 3H5OA 4F9TA 4YYZA 3I5XA 5HBGA 2HCJB 2P62A 2YWRA 4KXUA 1RQRA 4KK4A 4UHJA 4ZQHA 1UFRA 4UJ3A 2PGOA 4Z1MD 2O5CA 2CMKA 2GM9A 2VEDA 2WRZA 4LMAA 1J42A 2WFLB 2P3OA 4IEFB 1QP4A 2IBSA 2YYSA 3SR4A 5DCWA 4NDZA 3WXXA 1D2RA 5DBFA 4JOQA 4WZ6A 5EEHA 5ARGA 5TT0A 5EKDA 3V31A 2MINA 3UQYS 3RUCA 1TYEB 2R8EA 1P7YA 2QZSA 5BXQC 1EESA 2P9NG 2ISQA 5DGXA 4Z1OA 1NXXA 3FOEC 1T0JB 2RH4A 1CZRA 2LRHA 5ARFA 1GQ2A 2IZZA 4I7EA 4ENWA 4UUPA 1ZRHA 2QJRA 2YIVX 1GZ4A 1OMOA 4DUGD 3PXEA 4EHDA 3ISJA 3MCVA 1AZLA 1NBEA 3FWHA 3PVSA 4EPVA 4FFLA 5CK4A 4Q9AA 4ATNA 1IHDA 2QZPA 3DE4X 4RFVA 2XOKD 4HMQA 4KYTA 4GPIB 3L4BC 1N75A 2RG1A 3WQRA 4D02A 3SQVA 1ODJA 1KAOA 2F43A 4XD2A 3PNKA 4E1VA 3B1KA 3OCUA 4TWAA 2O8BB 2REBA 3ASNE 3QF4A 4UE2A 2JVJA 3VR2A 3AIOA 4F1PA 1ZUNA 4EEKA 4QQIA 1PX0A 1NBWB 1FSGA 3HCPA 4OL0A 1H1LB 1EM8B 2OFWA 2EL9A 2V54A 3NM5A 3AG4E 3OIWA 4RCVA 3HUDA 1GAWA 1CRZA 2IH5A 1E20A 1ND5A 3ILXA 2RK3A 4CMIA 5E7JA 2IZ7A 5THKA 3TNLA 4GX2A 3VO9A 3H97A 1TZJA 3TI7A 3ZE9A 3BWYA 3RG2A 1E66A 1V4VA 1NW3A 1XL1A 3C72A 1CJVC 1ZNWA 3VTKA 1Z4OA 3IERA 1DJLA 4C05A 3UKOA 1WOMA 2AJAA 1YO6A 4JJZA 1N2OA 5KYXA 4RTNA 3RKVA 3OHSX 4MDYA 1GCUA 4G6ZA 4KIUA 3GOQA 3HHMA 4ESVA 3K70C 2ZRLA 5CU7A 1TW3A 2ATEA 5HA5A 5IM5A 5T8KA 4HBZA 4KXQA 3A14A 3MCWA 1O96B 1TNDA 1YSCA 2PO7A 2V7BA 3CUYA 3MC1A 3Q3IA 3T95A 3SFZA 5HQ3B 4V2IA 2H3EA 2G36A 1TVEA 1WSDA 2ZIXA 2VK1A 3PQ4A 5DWQA 4K81B 1DQRA 2ONKA 3F3KA 5BSWA 1RI2A 2HL6A 3OX1A 1B6GA 1LFAA 2HU5A 4NBKA 3EZXA 4YJHA 3ZGNA 4PH4B 2ZGDA 2HNBA 3QF7A 2H63A 3LHSA 3KSUA 1Z6XA 3GG9A 4B5LA 4Z54A 4D96A 2IUEA 1QHHA 3MN1A 1UMDA 4MCAA 2W6ZA 5SZHB 3EXFA 2AV6A 4CM9D 5JD4A 2BN4A 3QNMA 1KR2A 3C3JA 3KJXA 4L0MA 3THWB 2Q4EA 1NX9A 4RDIA 5DNYB 2BCJQ 2D5BA 4G1BA 3HABA 3VU9A 4JIGA 1RXSA 3BK2A 3ETDA 3LW8A 4KPFC 4F04A 3M6IA 3HJFA 3KR0A 3UJDA 3WIUA 3O75A 1MEOA 4J2TA 3T41A 3O38A 5IF3A 5CVDA 3PGVA 1TMKA 3DBLA 3EEOA 1K9VF 3U7IA 4L5BA 3ZV3A 2H8GA 3JV7A 3LP6A 4G5XA 2QY7A 1C0PA 4DBZA 3G0OA 4MK4A 2C2YA 3BXOA 3GLQA 3ZCTA 3WYCA 2ZZMA 3C3WA 5A6SA 4ZJZA 1XGKA 1KQ3A 1NHGA 4I1OA 4AKEA 2E4WA 2C2KA 2F2TA 1JIVA 1G3RA 2AEFA 1MIHA 2XZPA 3EN0A 3ENWA 3O9VA 4FT4A 4WW0A 2UVPA 1J70A 1P4SA 3L1HA 2JGNA 5DHQA 4HGYA 4JXZA 1SHKA 1W8IA 5J5CA 4UAJA 3LPLA 4N6NA 3UOWA 5CCMA 3MS7A 3FH5A 5DRYA 3UZUA 3KJQA 421PA 3ZZ0A 1YMPA 1DEAA 2Q7FA 4ZOLF 3CZ5A 2I66A 1SK9A 1TKAA 4TQ9A 3WGIA 2Z9CA 1W2HA 4MS3B 1UWVA 3CEHA 5E2AA 4MBGA 5CFQA 4AO8A 3CVJA 5K0BA 3LPZA 1JLKA 3C3OA 1SBQA 3L6UA 4P36A 2ZPUA 2DERA 3FNEA 4DDTA 2WF8A 1DAGA 1NU8A 2YQZA 1QYWA 4WASA 4ZVNA 4DCUA 2C4WA 4GYWA 2IYYA 5J1TB 2IEBA 3PC8C 1S8AA 2J5KA 3HBAA 4G8LA 3IQEA 2Z2YA 4OHPA 4YFYA 2WJIA 4KEAA 2QDXA 3CVXA 2ZYDA 3SC2B 1U2PA 4O1MA 3SFXA 1RM4A 3VJLA 3OXLA 4X93A 3QUBA 4G0ZA 4K9MA 4Y30A 4F4JA 5B1BE 1B73A 1CY6A 4MO2A 3BZBA 4MI9A 1RBZA 4WADA 1E6MA 2Q8QA 2Z8YA 1II8A 4A8JC 5EMMA 4D3SA 1NR1A 1T6NA 1S2GA 2HRRA 5FO0A 3WC4A 2XB9A 3HMKA 4V0SA 4CLEA 3DM5A 3T7RA 1H4QA 2XEEA 2RHMA 3CS3A 3PS9A 2GJ4A 3GQBB 2V1UA 2WF5A 3E6AA 4H18A 3EUAA 3KZOA 4A6XA 4EF5A 4ETMA 4FGWA 5BPHA 1WU7A 2GERA 4UMVA 1O77A 4P08A 2IHYA 2XZDA 3GEPA 3OCXA 4TLCA 2IRWA 4PINA 1GZHB 1G4HA 4I50A 2PUWA 3AJ8A 5TC4A 1A77A 3B78A 4C0EA 4M3OA 2IKQA 2LSUA 3EWSA 4MRVA 5ALPA 1L7VC 3QKSA 4F3VA 4LGMA 3GFFA 3SBSA 1XRPA 2A35A 4G1MB 3N76A 4RA6B 3QK0A 4BQEA 2VDVE 3NOXA 5AUQA 1R16A 1X77A 1JDUA 4FYKA 3ZWDA 3NWPA 4B3JA 5FXMA 5DLEA 5A3SA 4HQOA 3GNLA 5IMBA 3UF0A 4B73A 4QNNA 3KJHA 5JBQA 4NONA 4KLAA 3RYIA 4GF5A 1F17A 3ENZA 4JKIA 5ALHA 5GOZA 2FPKA 5CLIA 1HDOA 2BI7A 2IPNA 4KQIA 1Y37A 4YRDA 4I4TA 4UDYX 5KYKA 2GBCA 2V74B 4OSPA 5COQA 3OPYA 4NEQA 5EX0A 5JD6A 1WCWA 2HDWA 4DQLA 4H4DA 4TTVA 2ZPAA 1V71A 2EBUA 4QJIA 5JS6A 1Z28A 3JASB 2N0SA 4J7XA 1XNQB 4NV1A 3I4FA 3MMXA 2ZEJA 1GN8A 3NP7A 4G4JA 1MFZA 3DMDA 4RVOA 1JDTA 1F51E 1FFGA 3HEMA 5AWFC 2OAEA 4I55F 4MWSA 3DC2A 4RENA 3F3SA 3KALA 1NW8A 4WNDA 1M6NA 1QOPB 2BFFA 2R6CA 1ZGJA 3SE0A 4WJLA 3R5HA 4OEHA 1DZ3A 3WB1A 1JSLA 5AW9A 3WJ7A 5FWAA 4AS1A 1ISGA 3GZSA 4OGGA 4IFIA 3V7UA 4CIXA 3AEUB 2ZYUX 3DTTA 3PDCA 3W6UA 1G41A 1M0SA 4EAAA 4KL8S 3U7FB 4QFVA 1NQXA 1UPUA 2NMVA 3PJGA 4RSRA 3F98A 4GU5A 3IHVA 4B87A 3KHUA 4EKYA 2GK4A 5HRUA 4J8SA 3LUCA 4LRSB 5T3YA 4CMKA 2NYJA 2ZGVA 3T4UA 1L7NA 5DJ5A 4P4SB 4D8TA 4HOUA 1LKZA 1ZNQO 1ZVJA 3ETJA 4JUFA 4X3CA 2OD9A 3P0EA 3V3KA 1A5EA 1PZNA 2QTFA 4UNQA 4YV1A 1NUUA 3FJYA 5K5EA 4BOYA 4B33A 3OFVA 4IIEA 4QJ3A 5CB8A 1MHTA 3DYVA 3ZU2A 2ZXEA 3IFSA 4O4JF 4N9WA 4D4IA 1II0A 2Y9MB 1HSZA 3W9BA 2XD9A 3HCCA 4E7PA 1BA3A 2PXHA 2ZUSA 3K73O 2DAPA 1RTKA 1DQPA 1IK4A 2WFAA 3CEAA 3GT7A 1TYCA 4JUCA 1P1BA 1KVRA 2W90A 1OZ0A 5F1YA 3DPDA 3HGMA 4FS3A 5ER9A 1ZG3A 2I55A 4XR9A 2FG6C 4ROSA 3S5JA 4FLHA 4O25A 3D31A 4KKVA 4WOKA 3CHPA 2VNAA 4RL6A 2UVQA 5CCLA 5JRZA 4TRJA 3OEHD 3TZHA 3VOBA 4ALJA 3ZD6A 5LFAA 3Q79A 3FPEA 3LBIA 1KAEA 3CPEA 3VUEA 4H7PA 5BQ3A 1KERA 4JYZA 3QHPA 4MWOA 3N0VA 3AJAA 3PI6A 3KHSA 4UCXA 1N0VC 5TGDA 3P0FA 3KDAA 1L4HA 2QZJA 4FFMA 1ZOIA 4P9NA 2Y0BG 3OX4A 4V02A 4PFQA 1KQFA 1U9IA 2J9GA 1EXWA 2FWPA 3HXQA 3BH6A 4GA2A 3EBLA 3PH0C 1P31A 2OD7A 2RC6A 4O4JA 3T4XA 2AKEA 1PQPA 1NBIA 4PSVA 4G8JA 4NMHA 1HH8A 3N2GA 5E6UA 1A5ZA 4E07A 4EX7A 2BGKA 4MYTA 4JBWA 4V39A 2YZ2A 1HFEL 4N18A 3YASA 2VQFB 1WXGA 3PUZA 4V0ME 3TCNA 2FHPA 1ZM9A 5T4EA 3WGJA 4DX6D 4KZKA 1V8BA 5JJIA 4G3XA 1H8EA 1BXGB 2LKCA 2ZLBA 4GICA 2X3UA 4HB0A 4X0EA 4ALLA 4BJ6A 4NHEA 4ZAGA 1PLLA 1AOXA 2VSOA 3G17A 4UEWA 1YK1A 5BR4A 3C43A 4X45A 5DGDA 3Q3VA 2IY0C 1FX0B 1UMKA 2FZ5A 4G5YA 4HHEA 4QGBA 1EFVB 5ALLA 3T06B 1XMOB 5JJKA 1D2AA 4Y0VA 3MLAA 4L2IB 3EOBI 1Y1RA 4RACA 1OXTA 5C8VA 1FNSA 2O6HA 4GTVA 3FTSA 3TGWA 4J0CA 3TTSA 4B5KA 2JH3A 1YFKA 4HOTA 3BCHA 3BRWA 5KREA 2HSEA 3NAGA 3ZY5A 4C48B 2I2CA 2O6LA 3MJRA 1J25A 2QTBA 4MMXB 4C22A 3H6GA 8ABPA 5IP5A 4DCGA 1THZA 3A05A 4P84A 5DVZA 3VC3A 4MUJA 4F6RD 5BSVA 2PNFA 1OXJA 2V96A 2QMQA 4L28A 3SOZA 5ICMA 4JW1A 1DBPA 1XI2A 1ZI9A 2A5YB 2BFBB 1WMFA 1Y6QA 3B7GA 3AERB 4IR7A 3F3YA 4GQIA 4RGBA 5HKOA 4ZD6A 2NT4A 4B1FA 2WQZA 3GLTA 4U6SA 3W7VA 5HM6A 3DL4A 3RV3A 2R6DA 1TNZA 2H1OA 2RH8A 3AS5A 3AETB 3FPFA 3PX3A 4UM8B 1B42A 1TM3E 3H3XA 4G5GA 5EE9A 3KHKA 1VB5A 3FETA 3TIVA 3TFOA 1OAKA 1P73A 3QEKA 4HYQA 5B1HA 1DJPA 1DU4A 5T7BA 2YDYA 2C00A 4UM5A 1H2EA 4AC9A 2IOHA 3HWRA 1VIAA 4HWOA 4DG8A 5L6MB 3ECCA 5E6SB 2XXAB 4A27A 2PT9A 4UEQA 1YS2X 2DBAA 4KVZA 3DYIA 1GGEA 3A1WA 5C4GB 1IXVA 3QZUA 3UAZA 1WSAA 2PBLA 3I9KA 4TOIA 3TUIC 3GA5A 3QWAA 4LAFA 4UEJA 1P7PA 3HBLA 3WL6A 2IFUA 1L7PA 4OO3A 3AEQB 4C6SA 5BOSA 1Q0LA 3B9RA 5JDIC 3K0AB 3RVKA 1YBHA 3OTOB 1CZOA 1U0JA 2TMDA 1I4DD 3SSMA 2C4MA 1Q7RA 1Y7TA 3R5FA 4Q1AA 1UN8A 5DNCA 3E37A 1DG1G 3R24A 1NI4B 3L6EA 2II6A 3E82A 3E3LA 4FTWA 2H92A 2XCQA 4KIWA 2QTGA 4UM7A 3AVTA 1XD2A 3PEYA 1DUVG 4JLVA 4OLHA 4DQ0A 5JSZA 3MKRA 1TQ4A 1WNTA 3PNSA 3LE8A 4NFSA 3V2HA 3QKTA 4YJGA 1Z29A 1CE8A 1YJ5A 3EOAI 3FDXA 5JAIA 3GLGA 4D0SA 2I6XA 3U44A 3JATA 5KNDD 1E2HA 2VYCA 3ZJ4A 4CKBA 5KDDA 5LA6B 5HI7A 2O2EA 2P6PA 1VTKA 1YAHA 3HXTA 3BEDA 4BZXA 3OPXA 4U0JA 3OM9A 3Q7RA 1PJ4A 5JXIA 4IMPA 3LWNA 2XOKA 3RJZA 1OH6A 1FP2A 5CFRA 1LPBB 4X5OA 4AQDA 4AIRA 1G55A 2WF9A 4YONB 2GN2A 2V7QD 3ITNA 1VPVA 4OLBA 2B82A 2JFNA 3K8ZA 1HPLA 1W96A 4YDSA 3GPLA 1MO4A 1GGVA 1KTIA 1TZKA 1CUGA 3EGOA 1A5TA 2C2GA 2DTEA 4LJSA 4LXYA 5JV5A 2RHJA 3NOQA 4MKIA 6YASA 1BX1A 4PHCA 1SAYA 3CGWA 5FJIA 4G2TA 4HGQA 1OD6A 2P67A 5EJ4A 1D03A 5G05J 3LH5A 4RV9A 4ZDJA 5LWHA 1FJXA 4M7CA 5FWQA 5LOVA 4LN1A 4CF4A 4X8QA 4IIJA 4M0PA 2IGTA 3ACBA 5JH7A 1CUFA 1PTKA 1I4LD 1TM1E 2HWYA 4UUOA 3TOZA 5C8YF 5AFSA 2FZKA 2AXPA 4WTOA 1QYXA 1REQA 1QTRA 1EWTA 1P1JA 3CE6A 2F1IA 4KZ0A 3DQPA 3M5WA 5A5VA 3RAJA 1VSVA 5EE3A 3ZJTA 1KK3A 5L3QB 5JEEA 2ZISA 1COWD 3OP4A 1A97A 3WHLA 3EDRA 4QTTB 3L43A 4C1NA 1CZUA 2FSUA 4BVGA 3ZUGA 2LP4Y 2A0WA 2XW6A 1C9JA 4OAPA 4BKPA 3PP8A 4FB5A 2JJ8A 3GGDA 2ST1A 1YTLA 3E9EA 3R23A 3LI2A 3U7HB 2C9OA 4KUGA 2R00C 5F5XA 4BSXA 2FW1A 3HJTA 4F4CA 5DI9A 2AZXA 3ENVA 4Y2SA 2YQ8A 1GYPA 1E98A 2QTRA 4QXMA 2BM9A 3B3GA 3SXJA 2BHSA 3CHMA 1EG7A 5CMYA 2O57A 4FYJA 1UP7A 3N8DA 4JB8P 4N12A 4RVNA 3DH0A 3JALB 3KYCB 4EJSB 2NTVA 4DUYB 2R4TA 4BKQA 2YNMD 1KE1A 1QZXA 4J76A 1I2DA 3FR8A 1DCEA 4XFKA 1VP9A 4I08A 1H2VC 1I4TD 2V58A 3N2NA 2QT0A 1AE1A 3EY9A 4PTYA 4EA9A 2VPXA 3UICA 4R1SA 2QUAA 4AURA 4UTXA 1YMQA 3H42B 2YINA 1WPRA 3EPRA 4KACA 1APBA 1GAEO 4NENA 5LKAA 2FCRA 1Y3CE 4UWHA 3B51X 1PFUA 1E1MA 1O8CA 3R3SA 5FAKA 2YZGA 5D2CA 3JYHA 2W2XA 1EJBA 1E96A 4QDTA 4O3MA 3D9HA 2B4KA 2FTKE 4D5EA 2XS8A 1PFYA 2K7ZA 2EX0A 1JECA 4R84A 1JXQA 1DC4A 4RMHA 3HRAA 1DO0A 1G9XA 4G5FA 3QUAA 1JT2A 1RAAA 1GP2A 1MEJA 1XROA 2AZDA 2H8KA 3LL7A 2RDMA 2PZBA 3ZYQA 4LYGA 4YP6A 2Q9BA 4C6HA 4C4XA 1ZGBA 5H7XA 3SP1A 1UDWA 1CWUA 2XA2A 3IXMA 3R3HA 4MS4A 4O02B 5HCNA 1TE2A 5HKLA 3C14C 3G2VA 5AYWD 3G88A 2J08A 3DXXA 4PGFA 1FMLA 3T35A 3WKEA 4QVGA 3O2JA 3OM8A 1DC8A 1E1DA 4EL5A 3LC7O 3KR1A 1A8QA 3NC1C 3ZGVA 1ODSA 3WLTA 5HZKA 1U80A 1UQRA 2NIPA 3MSXA 3O4RA 4FQ8A 1BC5A 3TK1A 3U9TA 9LDTA 5AQ9A 1GGHA 1QZTA 1VLZA 2FUG1 3NIWA 4M9ZA 4F1JA 4CKEB 2X6KA 4IDGA 4DCSA 4DLNA 3WG7E 1NSTA 2MSWA 3NAWA 2GX6A 3COVA 3IO3A 4K86A 3PUKA 5H3CA 4BCBA 1MPXA 1RZRA 1ATIA 4M7RA 5TXGA 1SUPA 3HB5X 4IIYA 3HCDA 4OXXA 3VC1A 3IE1A 2CG2A 1E1NA 4N3NA 2CL7X 4JJ8A 3WFIA 4Z4HA 4ZU1X 4HB5A 4LXUA 3V4FA 4BZZA 2C7PA 1TVCA 1GYQA 1IJBA 3FUHA 2BJHA 1SXJD 2EKZA 3PV0A 4NF2A 4BGUA 1JFTA 3CF2A 5DHRA 1YKFA 3TL2A 1ZI6A 4CR7A 4PLTA 3Q7IA 5H1YA 4CT4B 4YLGA 5DTMA 3ODPA 5A62A 3NV9A 5KJNA 3ZG6A 3OU7A 4HH0A 2R1TA 1C9YA 4L9AA 4QM6A 4WK4B 2B5WA 3M6AA 4YRGA 2PL1A 3ON5A 2ZW9A 4Y2XA 4MRAA 1GD1O 4UZSA 1LBSA 3UJ6A 1IKND 4PHTA 1UCFA 4B7AA 1OY3D 3M4XA 2WSSD 1XEWX 3T4EA 2QENA 1U28C 1OFIA 3HMQA 3IKTA 4ZI7B 3UWSA 4P22A 1UN9A 1GCIA 2QAGB 3RSFA 4ARZB 3JWGA 4X8LA 3GMSA 4KLNA 4XZ4A 1XZKA 2R65A 4GKJB 3CUSA 4XLZA 1PFWA 3CHOA 4KBQA 1SA0A 2CNKA 4PSUA 1JWBB 4BFTA 1ZAYA 1ULHA 3UIOC 4HQFA 2B7LA 2VP3A 3DMRA 3SE7A 1XT6A 1P4GA 3ZZNA 2HDHA 5JJTA 3JWHA 3O0TA 3Q15C 2AEJA 4JT9A 2YJTD 4GYOA 1OQAA 3KEZA 5EJFA 1ZEJA 5EDSA 3UWMA 3QE2A 3KB1A 1MX9A 4Q9IA 4LYJA 1PK9A 4EZBA 3I61A 2XWJI 1RVDA 3ERCA 1H2BA 2H54A 2QR2A 2V0NA 1JT9A 4I2WA 2PX0A 3JYQA 4OQQA 2Q6IA 3N59A 4TKZA 3IKMB 3IP5A 3L8GA 3QLUA 2VCEA 1GPKA 3F5QA 3Q88A 5CG1A 4XM0A 2J3HA 5FBQB 4FYYA 1VGVA 4NJMA 5IU6A 2BMJA 5J08A 1A69A 3PD7A 1F8XA 1GQYA 5E7IA 3RIXA 2GM4A 3BF8A 3NPMA 4FSXA 1E7QA 2BFDB 5I4CA 3UM0A 1QBKC 1RR6A 2P68A 1EUDB 2XQFA 3FNBA 1RMQA 1WHTB 5B4UA 1DNPA 1KYVA 2Y2UA 3K15A 4W9NC 1ZSVA 2I0FA 2DWZA 2B69A 2POQX 3MB5A 3FUJA 3KR9A 3QVGB 4D1YA 5CHEE 3HCRA 2GNAA 3RVOA 3ZJUA 4DLBA 1ICEA 4KXFB 1KJYA 1IHGA 1CQIA 2NWQA 5SV2A 3KZNA 3B7TA 3F0TA 4GOXA 4CGWA 4Z99A 4E09A 3FDFA 1GA1A 3AXTA 3BMQA 4TT3A 4KSBA 2I1JA 4S1VA 1BDJA 5EWLB 3ESCA 4EG0A 4UNSA 5A4KA 1GRRA 1TTPB 2JLSA 3PQ3A 4AY5A 1YJXA 2OHOA 4KX3A 2D1YA 3EODA 4FK8A 1RWWA 3LZ6A 5DLDA 1KMQA 1JW9B 3AVOA 1BKDR 3HFRA 1RBYA 5KYUB 3HBJA 4GWKA 2CG3A 2O3JA 3KKNA 5EXPA 3N8IA 4PONA 2C2ZA 1Q20A 2WTAA 2RGEA 1ZCAA 2B25A 2QRHA 5DP1A 2H1CA 3DFZA 1E1LA 2YN4A 3NU1A 3PKZA 1C9MA 1YQGA 1Z15A 4MARA 5EKXA 5LDGA 5JCOC 3ZOKA 2HJGA 1D6NA 5I9MA 1NNEA 2WE8A 4MJLA 2JCVA 3MB8A 4NR0A 3I8XA 3O3MB 2PJDA 4KJXA 4AFNA 2AD5A 2VJMB 3BXEA 1X1CA 1V47A 3DKRA 2FHSA 2IU4A 2IY7A 3PQCA 3IR7A 4FCCA 4IMIB 1WD5A 1RIIA 3VYVA 2WFLA 4I4CA 4D8WA 3IXLA 5LVAA 2IYAA 1XWWA 1B8VA 4LVNA 2QAJA 4ARSA 1SMKA 3C4VA 3TBKA 4DKXA 3J81k 3KYBA 2P0AA 1D2GA 1QZUA 1OZFA 4XUGB 1JRLA 2NW6A 2EBFX 1SXJC 3FZYA 1RZVA 4LMBA 5TS2A 2PGNA 5KJLA 4F93B 5KPDA 4B75A 1N32B 2JFPA 3ED1A 2B2NA 4PPYA 3QV2A 3TPFA 4GKAA 2EFGA 2ZIGA 3LPDA 4DPLA 4YH1A 3IOBA 3T5CA 1HOXA 2HMUA 2IU3A 4UWFA 5EJAA 2YR0A 4D0NA 5JDCA 1GPUA 2FPGB 1FZQA 1ZD2P 2XDQB 3GEEA 4L4SA 2V4HC 4PZ9A 4JAVC 4QT0A 1HDCA 1QVZA 4ZXPA 2HYDA 2GXAA 3HP7A 4D9CA 1QP7A 1GAQA 3CYFA 4IZ6A 1XQ1A 1PK8A 3AG5A 4X91A 1Y3BE 4Y0NA 1OHHD 4CU5A 4TXRA 3ES9A 3TIGA 3ZK7A 1TZ2A 2WUVA 3DCYA 2GESA 1W4RA 3CW2A 2X8JA 4MWZA 4AZ0A 4QLBA 4URZR 2VHZA 1ZP6A 1PAUA 2N75A 1H2TC 5D0QD 3BWXA 3C39A 3U3KA 4U5QA 2PS9A 4ENUA 1QZ2A 4HXFB 4QGGA 3WK4A 3OE4A 1VFNA 1W29A 1N0QA 1VE7A 2GZ2A 2O7VA 3DAPA 3EZLA 4XYMA 3UWOA 1GPAA 4BS9A 4ZZ1A 5DNUA 1OX4A 2HR2A 1P5JA 1FBNA 4U2DA 3BK1A 5EYLA 4Z86A 3EY4A 5CCDA 1MDBA 5D87A 2Z08A 3DO8A 1U31A 1PGJA 5JCPA 2ZU0C 2HUPA 2GK6A 5TLSA 3REFA 1K8RA 2K5UA 5LOZA 2WJYA 4HDMB 4YRCA 3D2AA 3S1SA 3PR2B 3SI5A 1MJGA 3F5FA 5EMKA 3T3MB 2BIFA 3O8QB 5AP9A 2WU8A 3KFXA 4DS3A 2BEVB 3GB9A 1VKZA 3CNEA 4GXTA 4OGKA 3A28A 3IBCA 3IPXA 4AX4A 1DLIA 3FX2A 1LLQA 1S2MA 3L8FA 1QQBA 3M81A 1H2ZA 4KODA 1NC3A 4Y2TA 5CT5A 3RS4A 5BNZA 5CXUA 2GZHA 4J49A 4DJDC 5F77A 2EFDB 3WGGA 2JFBA 1RFGE 1JDVA 1SCBA 3L7YA 4QODA 5PGMA 4AM8A 1VL8A 2AR9A 3TFQA 2DULA 3R9XB 3M89A 5EMJA 4P0PB 3WO1A 5JE8A 4QE3A 5I7AA 1GKYA 3G0HA 3HKDB 6AT1A 2IWHA 2AXZA 1BYIA 4HI0E 7REQB 3R7QA 1B4DA 4QQKA 4UI9C 4UAGA 3EGXA 3IRVA 5DTJA 1T9HA 1D5WA 1L4FA 3LLSA 3MJEA 1GGJA 1L4BA 1YVDA 4UU1A 3R7DA 2R47A 1OH8A 4KIFA 2P2SA 5B3SE 4XYBA 4QEDA 4ZYXA 5ICSA 4IVQA 2B8EA 3N3AC 3LDHA 5KNDA 5CT4A 2P9KG 3QWPA 3W6OA 3ZKWA 2FOXA 4F3NA 3ENNA 1PV2A 1KBZA 2QSYA 1OTXA 5B6IA 3J7AC 4J8DA 1DTWB 2RGRA 1SBIA 3DBHA 4ZPXA 4CE6A 4KWCA 5KVVA 1R0YA 3PDUA 1T4DA 2XZTA 2FAXA 4GTSA 4L08A 2JIZD 3OURA 1R5BA 1A2KC 1U3VA 3UCXA 3WSVA 1SUEA 2G1UA 2NT3A 1XP5A 3OO0A 3QOFA 4IOKA 3ZTYA 4MVJA 2YIMA 4L9SA 4IDQA 5CDUA 3TG8A 1TLTA 1E8DA 3PCXA 4OM8A 1IXYA 2WNIA 2YZ7A 2PIDA 3P9QA 5BVHB 721PA 4I8XA 2OZEA 4I9HA 4R6XA 4EVRA 3APCA 2IHJA 2GYUA 3EFOB 3KTDA 5AJXA 5C1BA 5C51B 4PZCA 8MHTA 2JCBA 4I5GA 5IDQA 1WETA 4P3YA 4DJTA 5B57C 3KIPA 1FC0A 1KZ7B 2WK1A 2ZI9A 2ONZA 2QM8A 3BJEA 4MINA 4R41A 3EGIA 1YZNA 4RK5A 4PYNA 3IMFA 3UH1A 1AUXA 1V6CA 5ELXA 1XTQA 4FWBA 1IYGA 1TQ2A 4XRRA 5AHWA 3IBTA 2EIKE 3AYZB 2Z5VA 2DUNA 3A6LA 2LUHA 3AUSA 2X6IA 2DR3A 4D82A 5BVHA 1IOLA 2GPBA 3IVXA 2RBKA 2VJLA 1OYVA 2ZRPA 1SZ9A 1Y89A 1YU9A 2ZYTX 4LNUB 1VCOA 5ALGA 5LD2C 1ZGZA 3CCCA 3W78A 2X9LA 1MP0A 4TMKA 3W8EA 2CCKA 1HE5A 4KXMA 1IBSA 3DOUA 3T1QA 3L7MA 1EU1A 1DQNA 3V2GA 4EFMA 3UMFA 3WHKA 1DBIA 4MUFA 4LGVA 4F9FA 3CRNA 1Z36A 5HVNA 3QEAZ 1UJNA 3D9QX 1KI3A 2PBFA 3OJ0A 1TADA 1T0UA 4US2R 3ZDCA 1TEZA 3KKKA 1ZD9A 2PANA 1A9TA 2JGEA 4CKBB 4J0EA 2VTEA 3UJNA 4Y2QA 5GPBA 4YV0A 4M7PA 5EHXA 1H94A 1Z5OA 4KMSA 3RK1A 2JFXA 4B4DA 3G9TA 4OXRA 1Y48E 4H08A 2WKQA 2JD0A 3MAGA 1KRHA 1CFZA 4MWEA 5GAJA 4JI5B 1UP6A 1MO5A 1J8FA 3KVNA 5IULC 4DJFC 5EIFA 4HC4A 4NQZA 1NI5A 4IM7A 3H9UA 1SCAA 1QHIA 1BX0A 1U3TA 4W6QA 5DHSA 3U17A 1DFHA 1GTVA 3A3YA 3DB2A 1WNFA 2VDPB 3H86A 3H5VA 3NZSA 3MNFA 3M6MD 3BL8A 4JELA 2X3FA 3B6ZA 2XWBF 1ZGHA 3BKXA 4IIGA 4HLCA 4YCAA 4LZOA 4XZ3A 1LY1A 5G0SA 3WWEA 3GRFA 5SZKB 1V43A 2HPVA 4FEGA 2QY9A 2ZUCA 4R8SA 5B2FA 1BKYA 2B1IA 3C45A 2AN1A 4ITVA 1JHOA 3IT0A 1U7PA 3M6VA 3VLFA 4BNWA 2XUDA 5GGXA 5CRUA 1KH3A 3WGQA 5LQCA 2XE6A 3CVWA 3GZJA 3DZCA 3RFCA 3PXCX 4ABTA 3CCBA 1W19A 2ACVA 3PIDA 1AF4A 1EXNA 2NTEA 3U3ZA 4WNCA 1A9ZA 3E9QA 2I1LA 3RC2A 1SUIA 3NYWA 3LRPA 2V59A 2RK6A 5EZSA 4BAGA 2R02A 4HQLA 3VH3A 3ZZ1A 2ZK7A 2EILE 2DE0X 3SU8A 1WUKS 3OZAA 4RWZA 3KWJA 3O2NA 3ZWNA 2Z30A 5I7WA 2PXCA 2H4XA 1JDZA 1MVNA 2AUNA 2BM0A 1RYBA 3S2ZA 1ABFA 1B3BA 1VG0B 1Z88A 3W6NA 4BNYA 4BVLA 1PUIA 5EIEA 4FHZA 4XUCA 3TPZA 2IYWA 1FPPA 5LOVB 1NG9A 1Z5UA 1AKTA 1Q2ZA 3OCWA 4JD2G 1NJ1A 1BS1A 2GPYA 2ZJ6A 4GHWA 3SBXA 4V1CB 3NALA 1F8FA 3BTOA 3R8XA 4ARAA 3K7EA 3NF1A 4L0DA 2VUSA 2GF2A 2D5CA 3PFBA 1X1EA 2XEDA 4G8CA 4OBXA 4UHCA 4ZOQI 2E4ZA 3Q8MA 1M7BA 2F1KA 3MUFA 4RKFA 3AEQA 4WAUA 4G5QA 1VDMA 2YASA 3Q3EA 3U16A 3M4ZA 3HKCB 2H57A 1DCQA 3FFAA 4B9AA 2JL1A 1C7FA 3SPXA 4F2WA 2R9VA 5AW1A 1JQBA 2C78A 3DEKA 5JS2A 1Z82A 4GOOD 5CFLA 1KRXA 3ZWWA 1HQYE 3HXPA 2BFAA 1SCKA 3PUXA 1Z8DA 1PRYA 2WE7A 3F4BA 2WXQA 1XMJA 3PXXA 1RKUA 1IAVA 1PE0A 2X1HA 3QVSA 4L8LA 3RQSA 1IFXA 4ACBA 5KS2A 3RU9A 5JSFA 5M7EA 1IBLB 3MHTA 4B85A 1MJFA 3JRWA 1Q77A 3TVDA 2QQFA 2J5XA 4GMFA 5BVGB 4URFA 1MU0A 1ZGCA 4DLYA 4RQBA 1HTTA 2C42A 4CM8A 1J9GA 2NADA 1DKPA 3T99A 2QVGA 3RRXA 2PRIA 4NCIA 3BIOA 3GR6A 5JAPA 3UB2A 2JJ2D 2EBHX 1KEUA 3AO0B 1VHDA 1U1IA 2HHCA 2D5IA 2VEOA 1UMCB 4JQYA 2CFRA 4PRYA 5GZ3A 4HDRB 3C3RA 5C5IA 3OO1A 4WVLA 2Q3DA 3HSSA 5JVDA 2IYOA 3ZHZA 4LTNA 3EHRA 4E15A 4F3YA 1LQTA 1GUDA 2FETA 4RY8A 4HEQA 4EUNA 2RI6A 3W5CA 1XPUA 2P2LA 3OD5A 4FFDA 1MB0A 1YGPA 1T0IA 5FI3A 1MPTA 4DSAA 5B64A 5JY1A 2JLZA 1GT91 4FBMA 2MCFA 4ZGGA 3DMGA 1KGSA 2MYOA 1IOWA 3AF5A 3MAJA 4MYHA 2PX2A 3IT1A 1QXSA 4H0NA 4NK5A 2D3WA 3JVEA 1HRKA 2EYQA 1BD3A 3L0SA 1TJ5A 4HDNB 4ER0A 3MYVA 3OFJA 1DIBA 1E9SA 4YQEA 3UXYA 1ZISA 4OJMX 4EHJA 2EGGA 5G2OA 1C9NA 1FFHA 3GVHA 2YWCA 4NCJA 1SHUX 4O2AA 1FQWA 5DM2A 5FLEX 4GAEA 5T57A 4I14A 4MULA 2EWWA 2WU3A 2AWNA 2E18A 4KXKB 1S8OA 4FBLA 2QPTA 4HB3A 2XXAA 3WLPA 2ZU6A 4TLDA 3GJTA 3NR2A 4LHYA 3TCKA 1GPNA 5KVCA 1AH2A 4ROTA 4WFQA 2H6IA 1S3SA 4W9RA 1SU6A 2G08A 2LTAA 3PTLA 4QYSA 1TCAA 1GNRA 4N47A 3W0LB 2X6RA 1KK0A 1P7ZA 3UUEA 1XQXA 1MH9A 5EXXA 4DAOA 1KI7A 3RARA 3BMOB 1HE4A 2YIDA 4OMFG 2QKYA 2POCA 1X42A 3PEFA 1EBUA 1P80A 2F64A 2YFHA 2CCGA 4MLCA 3N07A 4BP9A 3SHQA 2R48A 1EQ2A 3TGLA 3ZVVA 3UEOA 1V8OA 1POWA 4WCFA 4XQ0A 1QX3A 4INPA 3UMJA 3C3QA 1NN1A 1UEJA 4A0HA 1B7GO 5KSZA 5LWQA 1PW5A 2O3UA 4X9XA 4BJ5A 2AWOA 4W8OA 3A6ZA 1F60A 4QQRA 1CULC 3I6MA 3JWJA 5FFMA 3ZLBA 2Z1NA 4RKYA 5AIAA 5FAXA 5CLJA 4S1OA 4Y7DA 1JG2A 1FCHA 2F67A 2NZJA 2R7NA 1SZJG 3FJOA 2OENG 3HR7A 4Q3KA 1RPJA 1TMOA 3JQ1A 1DAKA 1B0UA 2E5WA 1G8SA 2GBIA 1OTHA 2M1XA 3MILA 3O03A 1DAOA 1FSSA 3LLVA 3QY9A 4J6EA 4E4TA 4YRIA 5CDHA 5DH9A 1GOTA 5LQRA 4GRDA 3AEKA 1E5VA 3UIEA 5HFAA 1K97A 4PC2A 3ZDAA 1J1ZA 3SQOA 3DZBA 3OG9A 4CNBA 5JJ5A 2G6BA 4X7PA 2G88A 1AGNA 1ZOLA 2WG0A 3GYBA 5CHEA 2EKQA 1QB8A 1Y8QA 4ID9A 2HN9A 3JTMA 3CZQA 1CX9B 1AKUA 4C5BA 2XNJA 3UJPA 1T9DA 4MDHA 4ZCRA 4DHWA 1R0KA 3EULA 1O87A 4Z9AA 1IQ0A 2QRGA 3D8RA 5GONA 2G7MC 1XTPA 3WGYA 1Z22A 3ZS8A 4NOLA 2VO1A 2ZVDA 3RUHA 4QKQA 3Q7QA 3AUKA 3OJFA 4J0UA 2FX3A 221PA 3FAKA 5DXJA 2BGWA 2B1JA 2QP4A 3UAYA 4BLPA 3WRVA 2XIQA 4MO9A 1SN7A 3U1TA 1J49A 3A4TA 5EZ6B 2NYUA 3FROA 3WP1B 3GGOA 3OEED 4KQ6A 2ID9A 4MZXA 5CEFA 1KPSB 1I32A 4BASA 1XQVA 4NHOA 1NM5C 3Q5EA 4H35A 2PYDA 3T5BA 5F35A 2IEGA 3QPCA 1KI6A 1WQ4A 3IP3A 3GV0A 2YHIB 5J43A 4M0FA 2YYAA 2I8CA 3M4YA 4S04A 3DW1X 4NU6A 3TX6A 5JS7A 2H00A 3HJGA 1V54E 1IAQA 2FF4A 1FTSA 1FDSA 1NDHA 1XEWY 2PKXA 3FE2A 3FUWA 3K35A 3ZGOA 4RZXA 3O8CA 1O9HA 2AJBA 1KDYA 1BGWA 2WAMA 2CF6A 4FE3A 1H3EA 1R9GA 2CXPA 3RSCA 3E8MA 3EG9A 2WYUA 3ZVKA 1GTMA 4Y2HA 1YS6A 4KR0A 5BRNA 2V6JA 1SD5A 3T3DA 1T0BA 1N7IA 1T91A 2DSTA 3B5EA 1XJQA 2ZS8A 2Z9DA 3FN4A 3LBFA 3O8RA 1HNXB 3K4PA 3SHWA 2LD4A 5JAMA 1YRWA 3KQVA 5FBHA 5HMMA 2VBIA 3O95A 4MAFA 4FSDA 4C0BA 2Y93A 4CYMA 3IQZA 3OQIA 2ECQA 3OHMA 5J40A 4MAAA 5MGBA 1VBFA 2QAGC 2B1QA 4WCDA 4XJXA 1OT3A 1QONA 2E3JA 2R00A 3H5AA 2FFQA 4FULA 2FF7A 2LR0A 1XK7A 3K1YA 3M70A 4JU8A 3Q47B 3BCSA 1W4ZA 3LDZA 3C6MA 3TNDA 3VVBA 1M2OB 3TTTA 4JDUA 4ENTA 2HR1A 2W2TA 3GGCA 2BFEA 1H69A 1TYBE 2BR5A 1Z63A 1NMYA 1XZHA 2WTXA 4LZPA 4Z49A 5KJFA 4ZOBA 4D81A 5FV4A 3OPQA 4DV4B 4DSOA 1INZA 2IJGX 2HFJA 1G8JA 2G9QA 1J97A 5ES3A 2F55A 2GT1A 1I0IA 4NMXB 3NVKI 1P45A 3NBUA 3ZI0A 5JATA 5JTUA 1K88A 2ON6A 3ONFA 4DMGA 1CUBA 1II9A 5AKJA 3WBJA 1QIDA 2IWRA 2KBFA 3JYLA 4B3CA 2OC9A 3FHCB 1ZMXA 2EGHA 2JCYA 1U0EA 4PR3A 3UB3A 4Z9XA 4BFWA 4CETA 5BSTA 3JVDA 1DRVA 1JHYA 1HEUA 5DT2A 3D9JA 5AW4A 1FXUA 3FJ1A 1WXDA 1J2YA 3O82A 1N54A 1LBIA 2UYGA 1RW2A 3UM1A 4XB2A 1IC6A 1XAIA 4X90A 2AQHA 2IO3C 3CSDA 2AFHB 2OK8A 2WYWA 4GPD1 2I7CA 3ZWMA 1KWKA 3C7KA 2RBEA 2Z1DA 2PR2A 2A9OA 3TQCA 2F9LA 2V6BA 2PH7A 3DM9B 1GTZA 1W9MA 2FUCA 3CUWA 4AO7A 3CX6A 3OZBA 3SNKA 5LMZA 1XJ5A 2C5BA 2VF7A 3BL5A 2G7ZA 3P4XA 5BQFA 3UTCA 1PC2A 4F8JA 5CVVA 3ZI7A 2ZDGA 2VTVA 4BNXA 3RU7A 2PLWA 2K6GA 5D7BA 2ENWA 4PO3X 5FA8A 4FGJA 4AS2A 2NYAA 4A8PA 3L8MA 1JF8A 3TLKA 5IZ4A 2V7UA 2QSUA 4IXTA 2FEMA 2ZRKA 2LAHA 1SVNA 3IKLA 4Q4AB 1M0EA 3KZKA 4KZCA 4YMSA 4MWCA 4XCVA 3FMGA 2VK8A 5TMPA 1JXMA 4HNSA 2EFYA 4M1WA 5DHPA 3K9BA 4H3KB 5AYVA 1QKJA 3AY6A 5KKAA 4M36A 2XBUA 3VKWA 2CFOA 3AUAA 1RYEA 1KP9A 4A9AA 5JW6A 4ZAVA 4IIXA 1UBCA 3U7QB 3S3TA 2VQ2A 5F52A 1D4ZA 4A63B 1NXTA 4U96D 1Z68A 3VU0A 2QL7A 4D3ZA 1U2QA 2HMAA 3M6WA 3EPKA 2GOYA 1U7DA 5F23A 4RMNA 4BV2A 2ZRQA 5AK4A 5DNDA 1N5KA 5E9WA 2ZRBA 3IEXA 2BKVA 3SY8A 1Z73A 2QT9A 4EJ2A 4MYUA 5K0ZA 1G6HA 3N7AA 5CPFA 3SQLA 4O4LA 3TTWA 1J99A 1EWVA 1JN0A 1R0CA 3ST7A 1Q1QA 2VP9A 2JFFA 5DP2A 1AKMA 1KO1A 3K1AB 1HLGA 3C8HA 1UK8A 4YRBA 5JFOA 1N2CE 1IK6A 1WKVA 2HM7A 3LBYA 3FSGD 2PM7A 3FUDA 1QNLA 2AE1A 4II3A 1IH8A 1Z4PX 3FVQA 2C77A 1WX1A 3NB0A 1D04A 2YS7A 1E2FA 3JWEA 3K1JA 1X9IA 1UMBA 1V48A 4ZYYA 2Y27A 3B5JA 1SA0B 2XPIA 1AKEA 1YC2A 4INJA 2QN7A 4M9CA 4O2BB 2OESA 3CUTA 2F37A 2GJ8A 2MMGA 2OAP1 5KUTA 4Q7EA 1E77A 2XGOA 1QHGA 3S44A 5LJLA 4AKHA 1TGVA 2IXDA 4R68A 1TJ3A 1DIGA 3L13A 1Z4NA 2CL0X 2ZSIA 3ZC3A 4NI5A 3NORA 1QHXA 5A7HA 4R0MA 4QDJA 1M6EX 5BUCA 3LHIA 1PJ3A 2SCUB 3S8YA 1SVMA 1O9BA 2EW8A 2FKAA 5LXTF 4TWRA 5IYZB 2FUNB 4BT8A 1G8MA 1ZC4A 1XG5A 3VTZA 4M1OA 4D41A 3UMYA 4I3GA 1F4LA 4TSFD 3E48A 5T3RA 1XKXA 2BZGA 3UJ3X 3W5IA 2VDOB 4NNJA 4PHFA 1LCIA 4B76A 1Z26A 4C0JA 1X3SA 3BVPA 3FBGA 4LRXA 2P2NA 5T6MA 2D54A 1A1VA 2K2QB 1IG0A 4QJ5A 2WXIA 1L4NA 2QAGA 3F3MA 4Q7LA 1FP4B 3DF9A 4MAMA 5FI5A 4R7ZA 1GO2A 2H16A 4MW7A 3U80A 3QFFA 3O8LA 1U0TA 2A4KA 2Y92A 3QF4B 2Y05A 4AMVA 2R17C 1HG2A 1I7SB 3W5HA 4TTIA 2OD2A 2C2BA 2A84A 5BT8A 6GPBA 3DBSA 1SKMA 1ECBA 2TS1A 4TN5A 5LZ9A 1I2MA 1T3HA 1OA0A 4GBJA 5LZ2A 1LDBA 3A9WA 4NACA 1OX4B 3CONA 3PQ7A 4JOSA 1FY2A 2QNIA 3NBFA 3CZRA 4PG7A 3ZWYA 1UM8A 2A58A 3I2YX 1QLHA 4IDDA 4QG3A 1C80A 1R6TA 5KOIA 4DF3A 1JIXA 3R7NA 2GJ9A 2Q41A 2W6ID 3H7AA 2PD3A 1RS0A 4XQ9A 3OF5A 2Q4RA 4AV7A 3FCOA 1DXYA 2NM0A 3L7LA 4WNAA 4WZAB 1N6LA 1E7RA 4N3AA 3I58A 3EHNA 2BY4A 4EBAA 3OCJA 5C7YA 3PEWA 2FG5A 2ZULA 5B7PA 1MHQA 2AG0A 1IUPA 4E03A 5DHTA 1W7AA 3E53A 3GCZA 4NQ0A 3CXUA 4H7HA 4IDAA 4IY1A 4MYRA 5K3FA 1FMTA 1NWHA 1OAOC 4M8KA 2I34A 1FMCA 1Z35A 2D1QA 4LJ8A 4PLGA 1WAMA 2Q5EA 4TROA 2FPMA 3TDMA 5GOTA 2IT1A 3BJZA 3HPQA 3RDPA 1NC1A 2OBBA 4UBKA 2H7YA 2JGDB 1ZBPA 4TMYA 5ILQA 3ND7A 2B21A 3FVRA 3NFYA 4RYDA 4UFPA 2CHQA 3PQ6A 1V37A 2H17A 4IDNA 1SVLA 3L40A 3ZK8A 2H1HA 1HR0B 1M73E 1NJGA 1YQ9A 2O7NA 3FPCA 3KAJA 1E8WA 1H2RS 4UZFA 5E0KB 2CXUA 5H59A 4X85A 3T3EA 2PL2A 3HG7A 5DYNA 1SCIA 5FLXA 2YHBA 2K7FA 5T6BA 4RHTA 2F3SA 2VNKA 1NRWA 4DT1A 3ZVMA 2EW1A 3T3NA 2A1TR 1PV4A 2EFCB 5FIOA 1SC4A 2ZTHA 4TUMA 4I8IA 4NPHA 3RSQA 2NSLA 4GRAA 1Z5PA 3K8YA 3I05A 5LCXA 1WMSA 1XLTC 4RVBA 2ENUA 4ES6A 1ZK2A 2AEEA 4TS4A 4S05A 3ZE2B 1FLVA 4FFOA 2VDKB 1Z2EA 4KJZA 2J8ZA 1U4OA 1HE2A 2ZBFA 1BCSA 3BCRA 1Q0TA 4KVFA 3SF4A 2SBTA 2UYOA 4KN5A 4F12A 3SGLA 1HZZC 3WZLA 4ANFA 4DLSA 4TTAA 1ODCA 3EVNA 3NHRA 1Q0QA 1ULTA 3VZSA 4A4DA 1E0SA 2A1UB 3EQZA 4EGJA 4W1PA 3WJAA 1P9LA 4I36A 4L02A 5TPZA 3VAYA 5I51A 4GA1A 3VHRA 3ZD7A 2ZIXB 4PYJA 5HSGA 2B9EA 2IW3A 3QFCA 3QPAA 3QEBZ 5H8WA 1M2VA 1H6OA 1OBOA 2W22A 5A6CA 2ZZKA 2LUOA 3D3EA 4FXPA 3EB9A 4R1NA 3KKOA 4YP0A 5DHFA 3PUYA 1J8VA 3T3HA 3DDCA 2VDNB 4NAVA 1M34E 2MR5A 3ZQJA 3T61A 2O59A 4WIAA 4RLSA 1SIWA 5MF6A 4ZT3A 2TSYB 2QRMA 1QRTA 1E2PA 1M2GA 3EJ6A 4MKFA 1LJ8A 2F00A 3NHKA 2W2LA 2GO7A 1Z4MA 5EHQA 4OHZA