4U8HA

Crystal structure of mammalian period-cryptochrome complex
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
490
structure length
490
Chain Sequence
ASSVHWFRKGLRLHDNPALLAAVRGARCVRCVYILDPWFAASSSVGINRWRFLLQSLEDLDTSLRKLNSRLFVVRGQPADVFPRLFKEWGVTRLTFEYDSEPFGKERDAAIMKMAKEAGVEVVTENSHTLYDLDRIIELNGQKPPLTYKRFQALISRMELPKKPAVAVSSQQMESCRAEIQENHDDTYGVPSLEELGFPTEGLGPAVWQGGETEALARLDKHLERKAWVANYERPRMNANSLLASPTGLSPYLRFGCLSCRLFYYRLWDLYKKVKRNSTPPLSLFGQLLWREFFYTAATNNPRFDRMEGNPICIQIPWDRNPEALAKWAEGKTGFPWIDAIMTQLRQEGWIHHLARHAVACFLTRGDLWVSWESGVRVFDELLLDADFSVNAGSWMWLSCSAFFQQFFHCYCPVGFGRRTDPSGDYIRRYLPKLKGFPSRYIYEPWNAPESVQKAAKCIIGVDYPRPIVNHAETSRLNIERMKQIYQQLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cryptochrome-2
publication title Molecular assembly of the period-cryptochrome circadian transcriptional repressor complex.
pubmed doi rcsb
source organism Mus musculus
molecule tags Circadian clock protein/transcription
total genus 146
structure length 490
sequence length 490
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00875 DNA_photolyase DNA photolyase
A PF03441 FAD_binding_7 FAD binding domain of DNA photolyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.579.10 Mainly Alpha Orthogonal Bundle DNA Cyclobutane Dipyrimidine Photolyase, subunit A; domain 3 DNA Cyclobutane Dipyrimidine Photolyase, subunit A, domain 3 4u8hA03
1.25.40.80 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4u8hA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4u8hA01
3SYTA 1O94D 1TEZA 1K4MA 2J5BA 3AIIA 5TEWA 3IVXA 2E21A 4XSVA 3P0JA 1M8KA 1YI8A 1CT9A 1MOPA 2A1UB 1COZA 3A05A 3COWA 2VXOA 5DEOA 3SEZA 3CVWA 3MXTA 3IMEA 3N05A 1H3EA 4CT0A 4DJAA 2A1UA 3KFLA 2H29A 3ZJTA 1MAUA 4MWBA 3SEQA 1QNFA 2HGZA 1WQ3A 5DK4A 4J75A 1Y42X 3X1MA 1F7VA 3ZJUA 1I2DA 3HV0A 1FFYA 1WXIA 3TNJA 1WJGA 1KQNA 3IOCA 2PIDA 3KT6A 3PXUA 3L92A 4CDMA 1YIAA 3CLRC 4ZCSA 2PZAA 2D54A 4EFKA 3NBAA 3CVUA 4X0EA 3COVA 2OV4A 4MUIA 1N75A 4YMIA 3IOEA 4XFJA 4YP6A 4YBRA 3N9IA 3VGJA 2A86A 2A7XA 1BS2A 2CT8A 1U7XA 1KORA 3ZGZA 3KT3A 1K97A 2A88A 3PNYA 1WOYA 4ZT5A 4K03A 1O96A 3UOWA 5EKDA 1O95D 3FETA 1EUQA 1NURA 5KHAA 1GTSA 1KH2A 3IMCA 1N77A 3ILVA 3K32A 1ILEA 4EG8A 1TYCA 1JGTA 1LI5A 2TS1A 4EGAA 3KT8A 2GM3A 5BNZA 4QRDA 3Q4GA 1JECA 3IUBA 1QTQA 1T9GS 2X3FA 1ZJWA 1J21A 3UC5A 3G5AA 3HZRA 3Q12A 1G59A 1WQ4A 1I6MA 3AL0C 1JHDA 3UMVA 1ULHA 2Z08A 1XNGA 2DEUA 4NAUA 3CVYA 4ZCPA 3H97A 2JA2A 3NBKA 1OBHA 4JXZA 3ZJVA 1Q77A 1NYLA 3ZXSA 1IHOA 3N2YA 3JXEA 4KR9A 3FWKA 3Q10A 1UFVA 4S1OA 1N1DA 3SDBA 1IQ0A 3K9WA 1LW7A 2CUZA 1J70A 3LE8A 1KQPA 1U3CA 1T6ZA 4ZT2A 2DPLA 1IVSA 2ZUEA 1H1TA 4MUKA 3CLUC 5H7XA 1PFVA 1F4LA 4U7JA 1P7PA 4MUJA 4R2MA 4MUFA 1OWPA 5FNZA 2A4MA 1R6XA 4R2LA 3HGMA 2A1TS 3CLSC 3RK0A 3N8HA 1OWOA 3H9CA 3FNRA 4WNYA 1O97C 3IDFA 1MRZA 1T6XA 1X8XA 3H05A 2X1LA 2QJTA 4MW6A 5LLTA 1KP2A 4JXXA 2QJFA 1KH1A 3NV7A 3RBAA 2E18A 2O5RA 2D5BA 2YXNA 5TGTA 1EUYA 1ZH6A 4ARIA 2PXHA 1GLNA 2VTBB 1H3NA 1JMVA 1VL2A 1VBMA 3CLTC 1MJHA 4E1AA 3IH5A 1A8HA 4G6ZA 3CVXA 4P2BA 3HL4A 3G59A 1J1UA 1VLHA 2VTBA 4HJXA 3MUEA 1F9AA 3FY4A 2CYCA 1G8GA 3PNBA 4L2IB 3FG9A 4J76A 2V0GA 3VRHA 1H3FA 1XNHA 3FHJA 4EG5A 4EG1A 1VBNA 4MW9A 1I6KA 1NZJA 3DLAA 4UZEA 5J58A 4L2IA 1N2BA 3UK2A 1HYBA 3KT0A 4KPUB 4ZT6A 1J09A 5LM3A 3INNA 1XNJA 1PG2A 1MB9A 4MLPA 2E0IA 1N2HA 1Q19A 1MB2A 3RFFA 4DDMA 1PFYA 3OTWA 4H3SA 4MWCA 4KPUA 1FYDA 2XRZA 2GKSA 3U1VA 4JYZA 3HFJA 2I1LA 3DO8A 1JIKA 2V0CA 3ND6A 4HPWA 1TYDE 5J5AA 1Q11A 4ZCQA 2YY5A 2E89A 1R6TA 4NX2A 1GN8A 4PBTA 4GU5A 1O0BA 1JEDA 3PRHA 1OWNA 4MUEA 4EG3A 1EJ2A 3MLAA 4AS1A 3CLUD 2DLCX 4YP7A 4MAFA 3UY4A 2CV2A 4MWEA 4MVCA 1KR2A 1O5TA 3IOBA 1N2JA 3BL5A 3LCJA 3X1JA 3A04A 3CLSD 2QTRA 2CFOA 4I6EA 5K0TA 1O94C 2RD2A 1N78A 1U0BB 3FI0A 2AG6A 2JAXA 1M83A 4MW2A 2QUIA 3S3TA 1OD6A 2CV1A 1OWLA 2AZXA 2IJGX 1JZSA 3A2KA 4ND7A 1YUNA 1MAWA 4U8HA 1M8GA 2WQ6A 1JEEA 1N3LA 1PFUA 1JIIA 2OQ2A 3P52A 1F7UA 1SURA 1N2OA 2IELA 2PZ8A 4PY2A 5TS2A 4GRIA 3FDXA 5H16A 4WSOA 4KR7A 3FOCA 3IUEA 3IVCA 4JFAA 4JZYA 4KR6A 3ZIUA 4U63A 2DR2A 3TS1A 4ND6A 1B6TA 1OBCA 1QRSA 1EFVB 4FZJA 1PG0A 3CLRD 3MLBA 2B7LA 5HG0A 1WZ2A 3H9BA 1IQRA 1OWMA 4I6JA 1KKUA 3CR8A 4EF6A 3MMXA 4TS1A 1M8FA 1T9GR 2EL7A 2BTEA 4YP5A 4ZT7A 1EFVA 1EXDA 4ZCRA 2QUKA 1X6VA 5FO0A 2AKEA 1G8FA 2CYBA 4DDHA 2C5SA 1NUQA 3TZLA 3AG6A 1WY5A 1IH8A 1DNPA 1XJQA 1NUPA 3ND5A 3RK1A 1RQGA 3L93A 2Z09A 5KWVA 4EG6A 3IMGA 4NDAA 3D6UA 3OP1A 1K4KA 3D6VA 4Q93A 1NSYA 4UZFA 4NATA 2ZUFA 3M5WA 4QREA 2NSYA 1PFWA 5TEVA 4ARCA 4DNXA 1S4MA 3AKZA 4RUKA 1M8PA 1QU3A 3COYA 1O6BA 1ZH0A 3CA8A 4EG4A 1LI7A 1TFUA 3QTTA 5FO1A 3G6KA 2J09A 4MW1A 1KQOA 2X0KA 2HMAA 3CVVA 1WKBA 1V8FA 3QTBA 2A1TR 3QE4A 4MVWA 2A84A 1EFPB 3ND7A 2ZP1A 1IRXA 5HUJA 4F3RA 1GPMA 3AFHA 4K0RA 1QQTA 1EFPA 3E27A 1JZQA 2CYAA 4MW7A 4Q16A 5DASA 5IJXA 3AG5A 1V47A 2PZBA 4MUNA 4CDNA 3TQOA 2J08A 1TQ8A 1NUSA 3IVGA 3IODA 1IFXA 1TYAE 3C8ZA 4NZPA 4R0NA 4F4HA 1QRUA 1NP7A 2Z3VA 2G36A 3GUZA 2QUHA 2WB2A 2XRYA 1R6UA 4NAHA 4MVYA 4OUDB 4PBRA 1VBKA 1M8JA 2YWBA 3H99A 5HUHA 1D2RA 1YULA 5K0SA 3TQIA 2GOYA 4G5YA 4OUDA 1O96B 1QU2A 2X1MA 4PBSA 4ZCTA 1QRTA 1GTRA 1T6YA 3GLVA 1I6LA 1YUMA 4KKVA 3ZXIA 1O97D 1WXGA 5IHXA 4BWVA 1Q15A 2HZ7A 2IP1A 4DE5A 4CQNA 2DXIA 3RJZA 4MW5A 2QUJA 3SZGA 1NI5A 1WXEA 3ISJA 1N2GA 4A91A 1NUTA 4AQ7A 2DUMA 4ZT4A 2EJCA 4MVXA 3P0IA 5KCMA 3CLTD 3SP1A 2YWCA 3GMIA 1MC1A 1JIJA 4MUGA 4G5FA 1GAXA 2PFSA 4MW0A 3FIUA 4HJRA 2QTMA 3FH0A 1KAQA 3ELBA 4ZT3A 2RE8A 3ZUGA 4MULA 1N2EA 3HMQA 5DB4A 2WSIA 4XFDA 4HK4A 1N2IA 1WXHA 2CSXA 3PNVA 4QBTA 4RPIA 3A4IA 1GZUA 3TZEA 1KP3A 1NUUA 2CV0A 2O8VA 1M1ZA 3LOQA 4MWDA 4DDKA 3COZA 1WXFA 2WQ7A 5J59A 2H2AA 1J20A 1J1ZA 5F23A 4MW4A 1QJCA 1O95C 1ZUNA 3F3MA 2J07A 4OJMX 1U3DA 2PG3A 3I05A 1IQUA 1K92A 3X1KA 4EG7A 2QTNA 2DETA 2NZ2A 4I6GA 2R5WA 1TYBE 2DERA 5AHWA 1KH3A 1U7DA 4MUHA 1O0CA 2BYTA 1EE1A 2JANA 3VU8A 1YIDA 3DPIA 3RHSA 2D13A 4DLPA 1G8HA 3P0HA 1MBZA 5LFAA 5JBNA 1JILA 1KAMA 3DV2A 2J4DA 3SZ3A 2QJOA 4MQ6A
chains in the Genus database with same CATH superfamily
4L51A 1PIWA 3OMXA 1GPLA 1GGJA 1PAQA 1EPUA 4M7WA 4ZAYA 2HK9A 3L8CA 1EDEA 3DMTA 1XEAA 4E2WA 1DT5A 2PL3A 4L8YA 4YRNA 1Y42X 1JXOA 4UE2A 3CYFA 3I5PA 2WJVA 1XJ5A 1CZUA 1KJZA 1XMPA 3N0RA 2NWQA 4ZI3A 1IYZA 1PX2A 2PWPA 1CW2B 1N7HA 4C05A 1P2TA 1MQSA 4P4UA 4PLPA 1YQWA 3DPSA 2V5AA 1JWLA 3ZZ0A 1KDVA 1AF4A 1R8JA 1JSXA 2P6RA 3AHFA 1S3GA 4PS8A 4LBVA 3CVYA 3LKDA 2ZS7A 1TDJA 2P9EA 3CKLA 1CJUC 1Y1TA 4EUSA 4S05A 4XWOA 4KI7A 3QPCA 2BI7A 3TSAA 2XOEA 3K53A 3ZD8A 2VWHA 2J0UB 3RROA 3SC2B 1SBQA 2MCFA 4JLOA 3CPEA 3SQDA 4PDXA 1CF4A 2PJRA 5NLLA 3BIWA 1NRIA 4Y3UA 1RZRA 1J23A 4AJEA 3L05A 4G6ZA 4N2SA 4P86A 4EABA 1J1UA 3M4JA 4ED9A 4LG6A 1F2UA 4U3JA 2H1FA 3MCWA 3VYRB 2AJLI 2R8ZA 4YV1A 2JABA 4OAOA 1GL7A 3WP1B 5KHLB 4KL8S 1G9SA 5LDGA 5IXYA 4BWGA 2AH5A 3Q8WA 1K9SA 1L1EA 1KU0A 3UA3A 2C20A 3RUEA 3MXOA 4Y6PA 4ME6A 4HLDA 4KK3A 4FOSA 1RR6A 1FUYB 2Q21A 3OCVA 2Z2JA 5JAUA 2VJDA 3GRYA 2IX3A 3UJ7A 4GB9A 2OVBA 5GOTA 1RJWA 2CV1A 2ENWA 1XEXB 5JWRA 2RGGA 3G2KA 5GZ1A 5H7PA 4BFWA 4B3JA 4ZAFA 1T5SA 5JZVA 3KO8A 3AJIA 2DJIA 4GHWA 2ZIRA 4CUZA 3JUEA 2HO4A 3EARA 3G2LA 3R5TA 4DDVA 2CHZA 1GN9A 3EH1A 3OLVA 1GUBA 1T2UA 4WTOA 2WVHA 3HO1A 3WWOA 2I80A 4XGQA 1WZ2A 2BAGA 1H69A 4BX0A 3S55A 2B6NA 3LHFA 4F21A 4NQZA 1SH7A 4X24A 1XBTA 3EFBA 3F8WA 3LHKA 3IBEA 1H85A 1JSZA 2NSHA 3SHTA 5T3YA 2ZAYA 3NHPA 1IY1A 1U3VA 5LWHA 4BLVA 4NOKA 5JMWA 1WTAA 1ECFA 2FWNA 4ENQA 1EFLA 1ZUD1 4B71A 2IWRA 2Y67A 2A84A 2IUYA 4G1CA 5DEIA 1WW3A 2HR2A 4ZQGA 3SF8B 2B37A 2VPTA 2REQA 3WGUA 5DWVA 5JA4D 5AXCA 5AI5A 5KBYA 1EDZA 5EHQA 3LDGA 1QHHB 3IIEA 4ZQHA 3CKMA 4UWFA 4ZANA 4ZPXA 2CHVA 4RTKA 1F5SA 3KQMA 3ABKE 5ADVA 5JPIA 2FEOA 2ZBGA 3H2YA 4PVDA 4JVLA 2JLWA 2GAAA 4RWEA 4KPEC 2C9DA 2PKWA 1DAOA 3K1JA 1NAIA 2HXGA 4XFDA 1M74A 1CBUA 3NTXA 4YFVA 1HK7A 4X54A 2P3LA 4S1WA 3PQ2A 4H4DA 1W2WB 4OK5A 3CVNA 1GL3A 4ZVTA 1RM5A 4C0MA 4FGWA 1LX6A 3U44A 4AJ2A 4ENUA 3AKYA 3IR6A 1FOEB 2XUHA 2GSDA 2C2WA 1IY0A 3FTDA 4AUEA 2ZCJA 1U5CA 3TCXB 3OJWA 1E3JA 5EZYB 1IK4A 2AZMA 4DX5D 4GL4A 4M8NE 3GELA 4C0AC 1UKAA 3K4PA 3V32A 1Z6QA 3C97A 1K3UB 1A69A 3RS5A 2PIDA 1GUZA 3L92A 5HP4A 3GV0A 4MV0A 2D54A 1O57A 1YMPA 3BE6A 3B7RL 2V4LA 1P2GA 4CCSA 4NENA 3GEEA 1F06A 4K03A 4N6GA 3FAKA 3A4TA 4NIKA 1PQPA 3DEPA 1T0JB 2WEKA 4UHFA 1C4WA 2QQEA 1A4XA 2DIWA 4OHPA 5IEBA 2QL7A 3L7MA 2YBEA 5A4JA 4E5UA 3V42A 2WU0A 4MR7B 1HKUA 2I3BA 2C58A 3FW1A 1R15A 1WZEA 2H4ZA 3QNMA 1PT7A 4Z8YA 1KYXA 2M1ZA 3OZAA 2LR0A 3H8WA 3HCFA 4NHEA 4UM8B 1GG2A 3RVOA 2LSUA 3W1VA 4FDTA 2YWJA 4E15A 4I8DA 5IKPA 2XHZA 4P34A 1DBPA 1P1RA 3GAAA 4YPFA 5KSPA 3INGA 3P71T 1FMJA 2YY6A 3LPMA 3UM0A 2BKEA 1CDZA 4QDJA 4DL9A 3VR4A 5JAIA 5HFAA 1BQEA 4FMDF 5AFSA 3FNFA 3V1LA 2VK4A 1I51A 1HBJA 2ZFUA 3FGOA 4FP7A 1MB2A 3NC4A 1GR0A 1TIPA 1QS0B 2NW6A 2Z2KA 4JBHA 3GGJA 1DC7A 4B79A 3GMDA 4IUYA 3FF4A 1SVOA 4M37A 3EQ6A 3FPSA 4QT4A 1JIQA 3OUUA 2DYKA 4C6HA 2RD2A 3GEPA 5JALA 3ASGA 4FYKA 1Z62A 2FX5A 3T5DA 1WAMA 5E2IA 3ABQB 4QHYA 5FIUA 2O3QA 4D4JA 4KXLA 3HXEA 4YNDA 4DQ0A 4U8HA 2Z4SA 5K1ZA 3G3EA 3F46A 2QRPA 4EBBA 4WGFA 4E21A 2QRVA 4WE3A 1XU4A 4KBYA 1QGAA 1RLJA 3QNWA 4UUOA 4BVHA 3EZLA 3RDPA 3AHJA 1YONA 5DSXA 4N8EA 2MR6A 1XZ8A 2O14A 1DOHA 4A6PA 4N47A 2WFLA 3GLGB 4QTUB 3ND5A 3OPXA 5TMBA 3D4LA 4YV2A 4FLFA 2O57A 1Q1AA 4FEGA 4QVIA 1LJUA 2P2ZA 2C92A 2QQ5A 1EIZA 4D3DA 2EFDB 3UCEA 2A5FA 3EFOA 2SBTA 1QIFA 5L6LB 1I14A 2HMAA 2M6SA 3FUNA 4CM6A 4XGRA 3NPAA 4ME2A 4DQVA 4IIYA 4Q16A 2C2XA 4V1CA 3E9NA 1G21A 3RVPA 1KDZA 3CW9A 2G8LA 3HYRA 2VP2A 1U1GA 1O94A 1A95A 3JQ0A 4WNGA 1O96B 3AR7A 2C59A 2H92A 2P5UA 4DDWA 2V5UA 3QW4B 1ZD9A 1XTVA 3Q1LA 2ODQA 4XEHA 1BHJA 4EVIA 2ANCA 4K1XA 3RVRA 5D01A 1LF0A 5AM5A 3VO9A 4JA0A 1OIWA 2QRNA 5KQPA 2PFSA 3F5FA 3C1AA 3D02A 2IYVA 5D3QA 4NMLA 5DM0A 1RXWA 4F5ZA 1EEHA 1WDTA 4ROTA 4WCDA 1ZCFA 4F72A 2P9QA 2XDAA 4GAEA 1ZUNB 4D8YA 3KUDA 3W5HA 1TMYA 2VUSA 2PWYA 5KYXB 3AUXA 4I1UA 2NZ2A 1M2OA 4M21A 3PU6A 4C89A 1J0BA 2XJ4A 3PEVB 1JILA 2BFBA 1SKYE 4UC0A 1V5IA 4KO8A 5IAKA 1DT3A 4PCUA 5EWJA 4DNQA 5CRVA 2P7HA 3ZS8A 4EA6A 1LB1B 2Z8ZA 4Q9JA 3HR8A 3I2GA 1U2DC 3I2KA 3B1ZA 5JRZA 2AWIA 3LG2A 2BZ0A 3IESA 4JBWA 1QGYA 1JQJC 4UVDA 1FSZA 3EZ2A 4ECEA 2AG1A 1O6FA 1P9NA 4CEIB 3BAFA 5JSKA 4YRAA 4QU5A 2VP4A 3M6UA 2WG1A 1Q7EA 1X8LA 4KV7A 4W1SA 3ZYMA 4LV5B 4FQ7A 2N3ZA 2BH9A 1P5RA 4MS1A 1KA9H 1LPPA 1ZHHA 4LF5B 4ENTA 4S0XA 1ZC4A 1YDFA 3B5EA 2R1UA 3K96A 4YY3B 4PAQA 3S40A 2H3HA 3C5EA 3QOWA 2F9MA 5LYJB 3SI5A 3WSWA 4O29A 4EMTA 2IUSA 1J2EA 1WR8A 4D42A 4CRWB 3B2QA 1I3CA 1QG2A 1T0PA 2W4IA 5DYIA 1YZGA 2VGXA 4HAIA 3R5XA 1QGUA 1VJDA 2X14A 1D8AA 3GRZA 2GRPB 2X1LA 4TYPA 3ZLBA 5KWDA 4Q1BA 1QDLB 1RFGE 1E61A 1UFOA 1MX1A 4CG1A 2AJAA 2WYUA 4QTTB 1A5AB 3MUEA 3C45A 4H1UA 1OY3D 3V7FA 3ZGLA 3FHJA 1E2GA 5I9SA 4PO1A 2HJHA 7REQA 2G9UA 1ZGZA 3NBYC 3THSA 3SEAA 3ISMC 3SZOA 2YMLA 4HNSA 4NCIA 3QPUA 4F38A 3DNMA 1Z73A 3D7RA 4D9EA 1WMEA 3SBSA 1RLIA 4CUKA 2ZSUA 3ECCA 4AKIA 1XDZA 4E4TA 2PS9A 4EB6A 1KS2A 2WM3A 2ECOA 3DR5A 2ICAA 4UBLA 2J9FA 5IDQA 5DGHA 3THYA 1P19A 3ADKA 3WC4A 3QTLA 4W6ZA 1T2EA 3WNQA 2W9XA 2R6HA 2V7QA 3Q9LA 5E6UB 3I09A 5IDXA 1IB0A 2OK8A 1W6RA 1P5ZB 2IBMA 4C7BA 1Y34E 3PXDA 1PFGA 3P2IA 1U2GA 3JWJA 5CA0B 3LQYA 3IUPA 3TI7A 3C7TA 2YOFA 2LCIA 4GM0A 2NO7A 1AHNA 1VJRA 1Y7HA 2JBHA 3T1TA 1UKYA 4O1MA 3AXSA 1AGXA 5DT2A 2JC3A 1E1YA 1ZGGA 4H2DA 2OZLB 1QK4A 1ADGA 1G8AA 1TN6A 1MOQA 4RK4A 1PJ4A 5AKEA 1IE3A 4RIEA 3LX8A 4CDNA 2WQHA 1ZVJA 1OV4A 5T67A 1LLQA 2MHCA 5FQOA 1CDDA 2X23A 4OUDA 1AA6A 1WBBA 5EEHA 5C31A 4TGLA 3WLQA 4LNUB 3VPDA 1JALA 3ZIAD 3RLIA 1HTBA 4H4CA 1Y7PA 3P2BA 5J2TA 5LMUB 2AX4A 2C2HA 2YYYA 5J4LA 3IA7A 2X6JA 4G5FA 3RIEA 3SI7A 3ITDA 3T1VA 2A5LA 3ZWDA 5CX1B 2C2OA 1C8KA 4L3OA 4KYVA 3W2EA 4KMMA 2ZBRA 3RT1A 2CB0A 2UWJG 4YCNA 4ZDWA 4ZEWA 4F7DA 5J90A 5K8JB 3ENZA 5KAPA 5ANLA 3K0CC 2Q9CA 3JASB 4I1OB 3LCAA 4M53A 2VP6A 1CUHA 2PX5A 4OV6B 4UEWA 3PD7A 1F0NA 1EE1A 3IHLA 3AS4A 1OY1A 2B5VA 2G9QA 3MCUA 2V03A 3MM4A 3OFSA 3MKRA 3WQQA 5GM2A 3ZU3A 4C6TB 5M04A 4IH1A 3VPBA 4ATNA 4KGZA 2L17A 5K3FA 3ZCXA 1ZUHA 1U2ZA 4K6OA 5DEOA 2GI4A 3P9ZA 4A23A 3MXTA 3VJLA 1N9GA 3KSMA 1YS7A 3DPYA 1BW9B 1OCEA 3UN1A 4WUVA 3ZJUA 1WXIA 1WJGA 5KNBD 1K7XB 3JR3A 2IPOA 1JW9B 3Q7FA 2ORWA 4LIPD 4R68A 4Y1RB 3THWB 2GUWA 2JAQA 4ZXFA 4UU8A 3FFWA 2IHYA 2O2JA 2FPSA 4G8KA 1TN7A 5JSUA 3IDZA 1U80A 5IN4A 3RUFA 2IA5A 3C8MA 3AB8A 3CZPA 4O2RA 2EKPA 3CC8A 3QEJA 3JTEA 3OEYA 2H1CA 2QT1A 2PD6A 1NI4B 1IONA 1ZVKA 3VDXA 4CM4B 1G7TA 1SUWA 5FEUA 5EIXA 3NVKI 2ZDHA 4EYOA 1Z22A 1S6YA 1COWD 4TX1A 3ANLA 5JRDS 3DP7A 1LC3A 5CTAA 3G0CA 2ZUEA 3VZSA 2V5VA 2YV3A 5AKYA 1UBOS 1YFZA 2WFAA 5I4IA 2AI2A 4WLFA 5KYYB 3H9CA 1Z2EA 3NI2A 4RKYA 1ECJA 2ILRA 3ND9A 1V25A 2E1PA 1E89A 2Q6TA 5KYWA 4TMZA 1N0HA 3OTQA 3ILXA 1V35A 2WP8J 3EN0A 3WLLA 2A6PA 2AMLA 4YX9A 1HDRA 3H4MA 1Y89A 3IH5A 2VC2B 4C20A 1SBCA 4HJXA 4PAWA 4B44A 1DWUA 3I92A 2IF0A 2Q5FA 3IAHA 1I13A 5SY9A 2BWJA 1G7SA 4RSRA 1XIVA 2HMUA 1W46A 2IYOA 3G6WA 1K1BA 4FBGA 16PKA 5BSWA 4MLPA 4A4DA 4BO0A 1BTOA 3ZYLA 3DH0A 4E6EA 3DFUA 1OHHA 3DAGA 1JP7A 2K4MA 3WL8A 2I7DA 2JFBA 1XSEA 2UUPA 3D0OA 2GTIA 3GWGA 1DRKA 2F4NA 2CMFA 3HRHA 4AN0A 2JIBA 3QEBZ 5CBPA 5CT6A 1EE2A 4TWRA 1E0SA 1GVHA 1ZLYA 5HMLA 2IYFA 3EUWA 1J8QA 4W8HA 2FN3A 2F2TA 1GG8A 3U09A 2WUFA 3UC9A 3WHIA 1WEKA 4A55A 4PC3A 5JQGB 1X0XA 4ER7A 4Q9NA 4LWZA 1E6EA 2WJ4A 1WCXA 4HOUA 2Z1DA 4YP5A 4UFOA 3UATA 3CNNA 2D2XA 3I1IA 1F8UA 4JSRA 2BFAA 4RF2A 2WJPA 3UHOA 4DIKA 1GKIA 1FQKA 4WZAA 3IERA 3UK6A 2FR8C 2DBRA 1SHLA 4JLPA 4DRXB 1QZTA 2ANBA 1JQ3A 1T5HX 5NULA 5DHTA 3K5HA 1FCJA 1TQHA 4TN1A 1YR8A 2O0JA 1AP7A 3LDHA 4ZI5A 1M75A 4XM2A 1AXRA 3JD0A 1KRHA 1MORA 3GG2A 4LERA 2WHQA 3C7AA 5CYFA 4C3UA 2Q46A 5KOHA 4C5BA 1GW6A 3MS4A 2G63A 1ECCA 2J85A 5DMXA 2YWBA 1Z5PA 4E0BA 2GR9A 5FWAA 4NPAA 3KSDO 2G8NA 2P2CA 3TTXA 4EK9A 4AXHA 3GLVA 1V39A 3CKYA 3TFOA 2HF8A 4B3HA 1LDGA 2Q2WA 3S8YA 3LW7A 5IVKA 2P68A 2OUKA 4BXOB 5G0TA 2B1JA 1CZRA 4I66A 3V1NA 5A5GA 1XPUA 3G8CA 1Y80A 2Q0XA 2I4IA 2ZR9A 3KZMA 3EUEA 1Z0DA 3GH3A 5FOWA 2FQYA 4O1HA 5BNTA 4QDUA 3U49A 1VI2A 1PK8A 2MSCB 2FQ1A 2OXIA 3CKKA 4P35A 2R65A 5DCLA 5CX4A 2YWDA 3A1TA 2ILVA 1DHRA 1FVHA 4QODA 1SBZA 5REQB 1IIBA 2H85A 3N39C 4KE8A 4DC1A 5GP1A 3D1VA 3L7NA 4XUDA 4RFSA 4BKRA 4FYVA 2QU8A 4NJEA 5B7PA 4EPWA 5FWXA 1X3LA 1BKSB 3EE6A 5ALYA 1F2VA 2XUKA 4CT0A 3JWEA 1U7WA 3KPJA 5TDHA 3O73A 4CZ2D 3DMTC 5DV9A 2XNDD 3PC7A 3I9NA 4US1R 4PRZA 2WXGA 5DLPA 4D9BA 5CK4A 4LTDA 1ZNWA 2X9QA 2CL5A 5T41A 2HYIC 1LNQA 4DMRA 3UOWA 1X80A 2GXQA 2OMKA 3R7WB 4Z3OA 2NVBA 3Q9UA 3EGCA 3NM6B 2X9VA 2AUTA 1NU8A 4QPCA 4QQKA 5KPDA 1E8WA 1VHDA 4WOJA 1BWRA 2V3WA 5JYEA 3KVVA 1R27A 1YB6A 3VTYA 2J3QA 1CXZA 5FIOA 1L5MA 2VH1A 3EDMA 3G2JA 1DJNA 2BKUA 2YN4A 3R7RA 4UREA 4RK7A 4GBMA 4KVMA 2BCJQ 1V6AA 4YJ2B 3ST7A 4MAAA 4BQQA 4ZT2A 3NF1A 4YN3A 1O9HA 5FNZA 4FJYA 1FUKA 2X7HA 3L6DA 2QY7A 2NZUG 2H7XA 1D6JA 2BGJA 4GQBA 1PJLA 4R3WA 4NV0A 3OEHA 2H31A 4GXRA 4K9PA 3D1JA 4XJVA 2Q6OA 4E4RA 4LMPA 5JO9A 1HV8A 5L7WA 1RRMA 3CLTC 3L7AA 4OHFA 2CE7A 1SQMA 5C32A 3U66A 1HXIA 1WCV1 2XRFA 1UAGA 3H5IA 4QXAA 1EBBA 1WSWA 1BVUA 1D4AA 3F71A 1IN4A 2XWPA 4KQ6A 5K0BA 1U1CA 2Q3FA 1CY2A 1OCCE 1NY6A 3ORHA 2XRZA 1Q22A 3ZEIA 1UINA 3H1GA 2R6JA 3DQPA 3KSUA 1QWSA 5DM60 1L5GB 1OCRE 5ENQD 4RWZA 4HQNA 4EY7A 4YDQA 4UXHA 4WDRA 3JQ1A 3EC7A 1Z0IA 1QC5A 2FZEA 5AJHA 2C54A 4LXUA 4REQB 2DFKB 1Z8FA 4CYMD 4WXPA 5HFJA 2B0OE 1NJ2A 3GQBA 3VM6A 3WO0A 1K75A 2X13A 5A05A 1YE3A 2MMGA 3Q7IA 3SBEA 4FQ5A 3B12A 4NS4A 1PVDA 4I0WB 3HO8A 3K4QA 3W9UA 2WXRA 1EGAA 2YASA 3AY7A 3OP4A 3PITA 4C0HA 3FNEA 3GDHA 5HM6A 4LDAA 2CLIB 5L3ZA 4FE3A 4RJKA 4KP7A 1Z2NX 3NJ4A 4HWTA 3NBNB 4Q93A 1S89A 3NZEA 2ST1A 2ZUFA 1NDUA 4YRZA 3P45A 1NASA 5BN1A 3JU3A 2PT6A 1E1QA 3R0IA 1KK1A 2I7CA 3WIOA 2X0JA 2O2YA 4D9HA 4G86A 5K99A 3FUTA 3L7YA 3LQ2A 3CEPB 1VI6A 3C8ZA 1NP7A 5AW4A 4NI5A 2X1MA 1PSDA 4O2BF 1L4YA 1QLJA 1WZNA 3R9MA 3ROTA 5GAJA 4DCOA 2ZGVA 3N8DA 2J9YB 1U1FA 2RDMA 1D2NA 4YDSA 4TT3A 4XVCA 3HS3A 4AQ7A 1A7UA 2OV3A 1Y7IA 4B8AA 3N2GB 3LA8A 5JVDF 1RAEA 1GAXA 1DZ3A 3F8TA 4JLKA 2JATA 5AVYA 3FH8A 4Z7QB 5AK3A 1THZA 2HBZA 4GPKA 2VNIA 3IJPA 1H2BA 1Z5ZA 3GD7A 1M1ZA 3TJRA 2H4FA 4BAGA 1KETA 4D43A 4FB4A 5J59A 2AW6A 3H75A 4IXTA 3R74A 2PBLA 4JKYA 5IBPA 1XMVA 2VQ3A 5ESRA 1LGYA 4YRMA 1F48A 4JSTA 3RTBA 1KY5A 2FU5C 2OZVA 2YWEA 3DW1X 2B8JA 2RGXA 3HDGA 1E9SA 2XDQA 2FVXA 2R2GA 3UEOA 4TTQA 2H2IA 5AK6A 4YPVA 3U5TA 3K09C 4JUFA 2IHZA 3EBPA 2L82A 3HO6A 5JSQA 2PNNA 3FLMA 4RY2A 2A3RA 3ZWXA 5FQ7A 3ZLTA 4YACA 3RYHB 2HIGA 1MOZA 2B4QA 1Q74A 2XYVA 1BRTA 1RTTA 5CFZA 1NXSA 4IRUB 1YS1X 1G2QA 2VL7A 4AJNA 2WM9A 4M0EA 1M0SA 1T8TA 4D99A 2I2AA 3Q41A 3U1BA 1OX6A 3MMZA 3FTYA 2A92A 3AMVA 1O6CA 1Z3CA 5JEEA 3FWNA 1M1NA 1GRNA 5KKCA 2GEJA 3C14C 3D8BA 4YRSA 3BFVA 2J31A 4G1VA 1M0TA 5GONF 2DSNA 1O95A 1U65A 3JYHA 3QA9A 4EUNA 3TB6A 5CA1A 5FPHA 1W9MA 1R9MA 2XOXA 1R4MA 1SFRA 1SMKA 3CZAA 4QJ4A 2GEVA 2IYPA 2WWHA 3HCWA 4CEJB 4OMDA 3RK0A 3NEJA 1YJ8A 1ZRNA 4PC7A 4DVJA 4Y7DA 2VDKB 4I1AA 1JHOA 4QHSA 3IMFA 3WMEA 1NVMB 2A4KA 3G1UA 4BN4A 8ABPA 3GD5A 2G70A 4DV7B 4I2VA 4KYOB 3EJWA 2JFGA 1SBHA 1JWAB 1DUIA 2IEZA 2ZWPA 1IY9A 3FUJA 2YVQA 3MJWA 2PWZA 1SEVA 4D0GA 4JNKA 2OFFA 2VYQA 5MFPA 2YIMA 4F5YA 4R6XA 1JDSA 3J5PA 1U8FO 1UWVA 4EPRA 3LWNA 3ZDXB 4P53A 2WD9A 4JT8A 3IOBA 1S64A 1UL1X 1VLJA 1YSCA 1KEZA 1VIDA 4P92A 2CD9A 4BCBA 3KHTA 4IOJA 2ODBA 3JSAA 2O8CA 4X8OA 3CPSA 5FORA 4V0SA 2AZXA 3AKCA 3DV0B 2HDWA 5AVRA 5EP4A 4YCBA 1RI1A 3VPGA 3EZ7A 4JQZA 1TUIA 1DI0A 3FB1A 4RW0A 5HF6A 3KELA 2QM8A 2VZ9A 1XRJA 4B35A 5H68A 2HEIA 2FMIA 2P58C 2ATXA 2VCEA 4QBIA 5G02A 1WW8A 2QPLA 2QUKA 1T34A 4PXAA 3WA6A 1WVMA 2ZRPA 3L9XA 3C8UA 4UVIA 1GV1A 3SM3A 3MGCA 3OOEA 4NTZA 3JYQA 3Q3HA 1C8BA 1T5IA 3FNGA 1N8TA 4LA4A 2MYPA 3DSTA 3EDYA 1OTYA 4RMIA 5FPTA 3CY6A 1E1NA 4I14A 1N2CA 3CVVA 1N4DA 4E5KA 5H81A 3PVZA 4K2HA 3HB9A 1JT2A 4D9NA 3TQOA 3PNLB 2J7KA 2GM5A 3Q7TA 4AFNA 4MKXA 3HU3A 2H6EA 2Q9BA 3EHMA 1HZJA 2R60A 5FQ8A 1UP6A 3O4IA 3I8OA 2PE5A 1C4OA 4BGEA 4QKQA 2NU8A 5CIYA 1ESDA 4GZLA 3SF4A 1AK9A 2PV0A 3I9KA 1LTQA 1XKXA 1DKRA 3QPVA 2XMBA 4N3CA 1UJ6A 3ONKA 3VSAA 4R83A 4H15A 2EU8A 1MTOA 4UTVA 4G3XA 2M6LA 3EASA 1VMKA 2ZTMA 4QXQA 1KERA 4Q1FA 3QKIA 4YVOA 3R3VA 4J8DA 3OQIB 5JZMA 2R00A 1QE3A 4DDKA 2IPLA 4JB3A 3EXIA 3S29A 4AG3A 4Z9BA 5IKOA 3O3CA 4YDEA 3L6OO 3FU6A 4BO3A 4X3PA 3L8FA 2IFTA 3WSTA 1CETA 2Y1CA 4GSKA 3SMVA 3PK0A 5FNVA 3LY7A 1OLSB 1LDYA 2O2HA 3NOOA 3H2IA 2ASEA 1V9CA 2XQVA 2Y6VA 5AVTA 5FDFA 1ZIPA 1V1RB 4ANUA 2DC1A 4JW1A 4MROA 2HE0A 1Z0SA 4QPNA 2AXEA 5DK4A 4RHUA 4EHDA 1H2EA 3MJFA 1KZ9A 4D92A 4JASB 1UMKA 2O7NA 3PUYA 4CIYA 3R6TA 2JIQA 1NN0A 2QL5A 4OREX 2FLKA 1O96A 1G2PA 3WYCA 4JD2G 5AW2A 5K01A 3FSJX 4D3SA 3K2QA 4ZJPA 1CERA 4L16A 1D0SA 1Y4AE 1YZHA 3UAVA 2B4KA 3ETHA 4AC9A 4MWOA 4HFGA 2WWXA 4JOCA 1JDZA 4UQZA 4JBGA 3DT6A 3HVIA 3QH4A 2AZTA 1ND5A 5K4AA 2XKJE 1TC2A 3JSXA 4NDZA 4U9HS 4JVMA 4KQWA 1HL3A 1CEYA 1LTKA 2XT9A 3MT7A 1VECA 2I0FA 1H6PA 2HR1A 1N1DA 4GNKA 1GUFA 4O33A 1S02A 1E69A 2XGGA 2Z3ZA 3K8YA 3EK2A 1ISFA 3A4YA 4ZGWA 3TVYA 5DBOA 1DEAA 3H04A 1QZ2A 1EP3B 3S44A 1P4JA 3AGPA 5DM4A 5BWMA 3LIPA 1S7GA 4DQLA 4NF2A 4KLRA 1V9LA 4G9BA 3GGGA 1HG1A 5ALLA 4YAIA 2OO5C 1R8QA 5GVSA 4CM9A 1Q0TA 1I32A 5E8JA 1GLVA 3OC6A 2EEPA 1ZEMA 1KEWA 4H0CA 5FEMA 2A9FA 2P3OA 3SBOA 2CFIA 4XX0B 3ZJ4A 3U1TA 3F73A 1WE2A 3FPHA 5BWBA 1XNQB 4Y2PA 2W5UA 3CSSA 3AXTA 3BM5A 3LPZA 2JGDA 5B55A 4C0JA 4C01A 5EKSA 3B2NA 1UPAA 4JEIA 2VSOA 2QNIA 3ELWA 4FE4A 4MYHA 5KHOC 4G11A 5ILGA 5BQXA 3T7CA 4CM8A 2QOEA 1WIWA 2NV2B 1XJWA 2VDLB 5KSZA 3J81A 5ALKA 4OUKX 4TSFA 3QLUA 1ULAA 2XMSA 2WWYA 2I99A 3EGXA 3NWBA 5LWQA 1RZRD 5TS2A 5C5DA 4YGXB 1KVUA 4YFYA 2ZYUX 4GC5A 2UUAB 1VJ5A 2JS7A 3JQGB 5KOJB 4FXOA 4RTQA 4HLLA 3E8SA 1NQ5A 4A26A 2VDNB 1U0EA 1XCGB 1N8NA 2VPPA 3KWMA 2UAGA 2CL6X 3MGBA 3HY3A 2L0XA 4Q69A 2C0QA 4NACA 1NMEA 3O91A 5EY5B 2XQGA 2W6JA 5ALUA 3S1AB 2PLAA 2PH1A 3VU9A 1P81A 2CGEA 4NNOA 4RY9A 4WESB 3K0BA 2FMTA 3SQVA 3D3QA 2WDPA 5KUTA 1X74A 1ESZA 1W85B 3L3BA 1KMHA 4MKZA 2W2LA 4YUAA 1GPBA 2PZBA 4CF6A 4RL4A 1L1FA 4QGGA 2H1IA 3HJFA 5TVGA 3WL7A 4D74A 5AW8A 4DZRA 3PPYA 5HUHA 1YULA 1QP8A 3RT9A 4X7BA 2I9CA 3IUQA 1NV9A 2ACKA 3E1GA 2PYDA 1MZCA 4FEEA 4BBZA 2EJCA 3QYAA 3P0IA 3NWPA 5CJPA 1F4VA 4MVJH 4ZALA 3VH3A 5IVIA 3MYYA 5LP6A 4QBKA 3CVPA 3N5CA 4KAXA 1H5QA 2KMLA 4RKEA 2NV6A 1TRHA 4RZ2A 4GOXA 4FW9A 2RHWA 3CMMA 4TLBA 1RHUA 1XYGA 3HEMA 2OCLA 1U3DA 4MB0A 4U6SA 1MF7A 4NWIA 3HJNA 4G8BA 2DFVA 5D3KA 3I4FA 1E79A 1RKXA 5LB4A 3WIUA 3KC2A 1NXOA 1H65A 2CHWA 1W0KA 2OZLA 1FQWA 4DBVO 5JE8A 1ZUWA 5A3SA 1EK2A 3GUHA 4I1PA 3FUEA 2R7NA 1VG9B 1KEEB 4ZCSA 1C3OB 5EERA 4YXWD 3H13A 3ENVA 2A86A 2OLEA 4WNIA 3SYNA 1UDRA 5LCXA 2W2XA 3B3AA 3ZV5A 3OPYA 2XHEA 1QP7A 3FOWA 1V16B 4RH3A 1KRWA 3U4TA 4KNVA 1RHRA 1KOLA 4IZ6A 1L6RA 2XDYA 3BJMA 3HBAA 4EL5A 3P2OA 4CMEA 4I3FA 2RBKA 3M9WA 1BEUB 4TXMA 3UUGA 1Q57A 5ECDA 2ZUUA 3KLNA 5LMNB 1FUIA 1KYYA 3Q10A 5CTJA 1G64A 4ILHB 2BRUC 3P4UA 5IP5A 5A02A 3CLSC 3N8HA 3UJ9A 4MWZA 1RPNA 5EIHA 1ZJ6A 2QLLA 4MJ7A 5CH8A 3MFQA 1U99A 3MPOA 3G8DA 4XYLA 5DLYA 3FNHA 2FPMA 1G9TA 2XH8A 2VDPB 1GLNA 2YHCA 1Y8CA 3GLFA 4FJ1A 1M7HA 4P2BA 3VZQA 5TPWA 4F45A 2J5XA 5EQTA 2C1EA 4HKTA 3Q3VA 5JFOA 5BSRA 2PO5A 1KO8A 4ASUD 2CHUA 2KZTA 1Z68A 1J09A 5LM3A 4B3DA 4TTIA 4HSEA 3QVVA 1U8YA 4IPTA 5HZGA 2PUHA 3RBXA 2XCOA 1N2ZA 4RJJA 2GRRB 2PQMA 4MX8A 2F64A 5A62A 4W5HA 3I6BA 2OORA 2R5NA 4YREA 2WSSA 3USCS 5FBKA 3T0FA 4MDYA 3L02A 5IHPA 4MRSA 2CV2A 4MWEA 4L0MA 3TJZA 2HYDA 3DMPA 4TQUS 4ZHQF 3UCFA 1KKLA 1U0BB 2NXEA 4G9EA 4V0RA 4KLNA 3W04A 5DHFA 1NW9B 4D80A 5LXTA 2PMWB 1TKAA 4F5EA 1I4EB 3EDTB 3GZNA 4CQMB 4QOJA 4ZOEA 2XMQA 3A2LA 2DWQA 3I62A 3L8DA 2I4RA 1XXHB 1YC5A 4BJ5A 2QZSA 3SS9X 1A7KA 1EVJA 3HYNA 3GA7A 4CEHA 3LZ6A 3QPAA 4HQRA 4JHLA 5CLLA 3MQFA 4NFHA 1C5KA 2Y1DA 1MFZA 1ORDA 1FJ2A 2JHPA 2DFLA 4OX9B 1DNPA 1XF9A 2ZT5A 1R6BX 1E5QA 5HK8A 3OTHA 4AJKA 5GQSA 2FPWA 4X00A 1W76A 1P6XA 1V0JA 5KNDD 1H6OA 2PM7A 1FXWA 3EF1A 1V55E 4DWJA 2NUPA 2NXWA 3F3KA 1AKVA 2Z2IA 3A11A 2EIME 4YQFA 3DD5A 4YQYA 4L02A 2XUQA 1UKBA 1DINA 2X3UA 4UU1A 1KXJA 1OH6A 2H16A 4CR7A 1Z0AA 1FX0A 2NM0A 2RBGA 2JGKA 3B13B 3E82A 3PKIA 5KYNA 3PD1A 1JJBA 3FTPA 2AR0A 2DXIA 4J4HA 3R7SA 4MXDA 1E64A 4GUDA 5CVDA 5CW1A 3QVGB 2FG7C 4HAUA 1HNWB 3CF4A 1YZLA 4AF8A 3WL4A 2ATVA 1Z26A 4PX5A 4OGKA 3HJAA 4D8UA 2QN1A 5HX7A 2NOAA 3T7EA 1MAVA 1M2VA 1G5IA 2XLCA 4XIJA 1DDIA 4D8XA 3DZGA 2Q5JA 2H2AA 3EIUA 4I2NA 2QA5A 2OZEA 1R0CA 5B53A 3V2HA 2WF5A 3V48A 5B2ZA 3E8MA 2WIKA 2BGLA 4BS9A 2Z1MA 4EHBA 3AC0A 2UZAA 4ZEMA 3V3TA 1V6CA 1USGA 2J4DA 3IULA 1NUAA 1O94D 2FWAA 1FS4A 1D04A 2OY0A 4DRXA 2V5FA 5KMGA 3R6GA 3F4BA 5EUBA 5TQ2B 4W5NA 4X1IB 3RU0A 5JJTA 3KHKA 5FBVB 4DR4B 2KBXA 2W71A 1ISRA 4MS3B 2XVXA 2QC9A 1XLTC 5CYGA 3SEFA 4TYMA 1KQNA 1I24A 1TQ2A 1XAJA 721PA 3O9VA 4PTYA 3CVJA 3JYNA 3QM1A 3BT7A 1JR4A 5DHRA 3A4NA 2TRSB 4K8OA 3HTXA 5AI0A 5IN5A 4E3ZA 3IXMA 2TS1A 2C0MA 4LHYA 4M87A 3ENNA 2Y1WA 4IL5A 3AWDA 1SNYA 1TFRA 3EVDA 1QQ6A 1G59A 1JEQB 1P5HA 2YV1A 1UDCA 4U0KA 3ZKAA 2JA2A 4FHFA 5K0ZA 1QLWA 1TLLA 3C3DA 3ML8A 2VTKA 2OXCA 3WB1A 5B1EA 3ONFA 3OIWA 1Z88A 3D3WB 4HYQA 4XPIA 4PAGA 3PDJA 1DELA 1HH4A 1RWPA 3F2IA 1VPDA 1OVGA 2EP8A 3NHWA 4U6NA 2I2BA 2OLJA 4KVAA 4ENVA 1MAHA 4OH7A 3E5NA 3UHJA 4Q4AA 1XOIA 1EM6A 4XEIG 5JH7B 3G59A 3ZKWB 3TZQA 4KFTA 4AZWA 1TYQG 1ZVMA 3X2EA 1FQOA 1BC5A 4D7AA 2G9RA 4B87A 1Y1RA 4F4FA 3Q5GA 3ZHYA 4M76B 3PICA 3CWQA 4PWYA 3GZ4A 3A7EA 4HI9A 3WLPA 4JJAA 1Z2DA 5JXJA 1I4TD 4WVLA 1YZQA 1N5JA 4R1NA 5IM4A 3GT4A 3ZCTA 4AL4A 2UKDA 2CLLB 3LUJA 1GDTA 3MBOA 1SVLA 3HP1A 3R7WA 2WU1A 2VHZA 1BEZA 1WF3A 3DCNA 3ZJYA 3KJEA 5CFOA 4AP9A 1BEEA 1G5FA 3LV8A 1B73A 2HNBA 4ZTBA 3SSAA 3S1LA 1K5PA 1TM1E 1HE3A 2FPGA 2A3NA 2P40A 2NPFA 4O2AF 5MGBA 4F86A 3ITEA 3NGMA 3HCEA 4IJQA 4Z4CA 4S1PA 2WUGA 3PJFA 1UBTS 3EVEA 4FNOA 4MKTA 4IVNA 4PLCA 4PG5A 5L3QA 3L93A 1C3XA 4QQNA 4JQYA 2HDNB 3VU0A 2Z04A 1BH2A 1M8PA 1RABA 3UGTA 1IHDA 4B8YA 2PT9A 4RC9A 4E33A 1QH8B 3PVSA 2VEDA 4LEUA 5EJ2A 4C0SA 1QCCA 5IAGA 3IE2A 3H5VA 4D9KA 3UWKA 2XWQA 4JLAA 2E4ZA 4FBLA 2DCMA 1G4HA 4TRMA 4B75A 1SQSA 5BSEA 5KVVA 4JZKA 5JZBA 1SVWA 3RS4A 4ZVOA 4COKA 1KTVA 5BW8C 4OA8A 4PCLA 3D81A 2HA0A 3AG3E 1PV2A 3BB1A 2VG8A 4RTMA 5E9WA 4G8JA 2GHQA 4MVXA 3DL7A 3H5LA 4WIAA 4ZOLA 5G40A 3AY3A 1G4UR 2A33A 4H16A 5EP2A 3I30X 5JNSA 4JDPA 3ZBPA 1WVGA 4DPMA 3PHCA 2IH5A 2PAFA 4AKHA 1MJNA 3E7DA 4HB4A 4NCNA 5DWQA 2C4UA 4FHZA 3MG9A 3NUGA 1RTKA 4BTVA 3HCAA 4W4TA 2NZJA 1HQCA 3DV9A 4XASA 2I78A 2FTKE 3LT1A 1S2GA 3W0LB 2QYSA 5LFAA 2QX9A 3L7CA 2IRWA 4TL6A 1FMFA 4B2LA 3DC2A 2FPXA 4XCVA 2B7CA 4ZZ1A 4EL0A 4XJTA 3D2AA 5T8IA 2YN2A 3UT5B 4W9MC 3CVWA 5EMJA 3RG2A 2HGZA 4FCCA 4GMDA 3R7AA 1ZRSA 1OLUA 2IC5A 5AN8A 3QU9A 2ZJ3A 3R23A 4K9OA 3R9XB 2OV4A 1ZWKA 3C1TA 2HRZA 2Q27A 3GHHA 3CGWA 2YDXA 2NPOA 5JAPA 3EWNA 1VE5A 2O0MA 2C2GA 3GRVA 2XUPA 1G20B 5EKDA 1E9BA 5BR1A 5KHAA 5UKDA 1E62A 1TYCA 1MG5A 3EEIA 4QQ8A 4S24A 4BLOA 4R05A 4EP1A 3DFZA 2JFFA 4JBNA 3BL6A 2DEUA 4L8VA 2F1JA 1WVIA 4A73A 1TEXA 1T6BY 2WG0A 4FGZA 5EZ6B 1P1JA 2K5UA 5KJEA 5CXXA 3PNTB 3OFNA 2QFCA 5JD4A 4PR0A 3Q87B 8MHTA 1PVOA 4QJ3A 4XR4A 3AO0B 1PHRA 1SVNA 4V39A 1H5UA 1M72A 3G2NA 1IN5A 2ATCA 4MHSA 1DCTA 2ADFA 3DWIA 1BS9A 1GM5A 1X7YB 4BKOA 3AH8A 3FTCA 4L2IA 5JAMA 4LQLA 3K5IA 3ZTTA 3S7JA 5K0NA 1Q7BA 4UWGA 3DXMG 1X7WB 3G88A 3TWOA 2IEAA 3I6QA 5ILOA 1TIKA 4Y1FA 4B7AA 4KWIA 5E3JA 2IIQA 4ZV4A 1GV0A 4Q82A 2BE9A 5JLAA 4DA6A 2VJMA 2W4QA 2D2IA 1SCAA 3DL0A 4XDZA 3CLSD 2EFGA 5IAJA 5A1TA 2Y3AA 3WWEA 4KOAA 2D06A 5EP3A 3APDA 3TLBA 3GYGA 3M4ZA 2IXBA 4TKZA 4GR5A 1EJ0A 1G8YA 1XG5A 1FQJA 1H0RA 4B6EA 4GRIA 1UPTA 2PMCA 3HUDA 2QLFA 4RPHA 1HY3A 2BEDA 5LOVA 3OT1A 5FAXA 4DA0A 3D7KA 2WMYA 4TZ6A 1TO6A 4ZHBA 1CP2A 2HOQA 1Y9JA 1ML4A 1DJLA 3B6MA 1IL0A 2G1UA 3JTMA 4HATA 1ZAYA 4FINA 1P7VA 1DARA 1RFLA 3L1UA 2NNWB 5I7UA 2EGGA 4KUGA 5K3CA 2NSYA 4BJHB 1SG6A 1WCWA 2W2QA 3EIFA 3H5WA 1B7GO 4AZ3B 2G77B 2NO0A 3CJRA 2OCAA 3VYSB 3T7IA 4LJ5A 4JSYA 4KX3A 2IY8A 2BD0A 4LHXA 5I9BA 2QRQA 4BNNA 1M1XB 4KVFA 1WBJB 5LCWC 2GPTA 1W87A 4YUYA 4QARA 4H59A 3L8MA 4HB2A 4HTFB 4DE5A 2IDJA 3T54A 1VSVA 3H65A 3CF6R 1QBKC 1YNOA 4H0NA 5CVJA 2M6KA 3DBSA 3DR3A 1N9ZA 5K3BA 1JR6A 1RZ4A 2WXFA 5AJZA 3NW9A 5TF4A 2J3DA 4NEQA 4CDGA 1OI4A 3A1NA 4PQEA 2HSEA 1JFLA 4I2WA 5DCYA 4CLHA 3R7QA 4LG1A 5F2OA 2HT1A 1OB2A 1ZCJA 1RWBA 1J0DA 3B53X 5ENOD 4DV6B 2V9PA 3BRWA 3CRQA 2PUBA 2Q4RA 1TMKA 4CLXA 3VU8A 1T8SA 3UKUG 4ZVVA 3IAS6 4N5DA 2OENG 3FDJA 4R16A 2DKNA 4CI0B 4EDHA 3AV0B 1XCLA 3R5FA 3TLXA 4ZTUB 2QX4A 1ZW1A 4J49A 1CT9A 4A92A 1HQDA 4MS6A 3ZWWA 3WSVA 2X5KO 3CKCA 2OM2A 4N6OA 2AW5A 5EWMB 2PGDA 1DUSA 1H42A 1I7QB 4GDFA 4CODB 2IS1A 4A10A 1W7AA 2W2PA 4NJOA 5A9TA 4EYGA 2CNWD 2BONA 1RU3A 3LF2A 4FEAA 3E7FA 3A70A 2OQIA 1XAGA 4LTNA 4J3FA 2ZTHA 4FS8A 2P9YA 2AK2A 2AUNA 1XRPA 4TV8A 1O8CA 1JR2A 1A9RA 2NXNA 3E22A 5FL7A 4BNVA 4WK6A 4C0LA 1JZTA 3EG9B 4B0ZA 3HHMA 3I1JA 2ZRKA 3BFXA 3GW4A 4BCCA 1LI5A 2VYNA 1YHYA 3OJFA 1JHRA 6ABPA 5FTPA 1RJ9B 3BWCA 4B76A 1M5RA 1VE6A 2CMDA 4RQBA 5K0EA 5KTOA 2OSBA 5LA6F 3WZMA 2OD9A 3RRXA 4MYUA 4BWFB 3T41A 3N3AC 1K8ZB 1H4VB 1NXQA 4YGYA 3BFKA 1OXTA 5I7FA 2JHGA 1DX6A 1RT9A 4MUJA 2ZANA 1M34E 3WNCA 3HACA 5GV7A 2ZWAA 3BRQA 2P75A 3HWSA 4JVSA 4C6SA 5FOVA 4E70A 1EUYA 2GN4A 4RIGA 5ENZA 1IZYA 3SZLA 3UV3A 4YJ3B 2ZI4A 1PUJA 2Y92A 5ITZF 2DQ4A 5JSZA 4CKBB 2VAXA 4RK5A 1VBNA 5LUAA 4YJDA 5IFLA 4O4IB 1ETHA 4IWYA 4IHJA 4H1HA 3ETLA 4BO7A 3GT0A 5EA2A 1YH3A 1AKRA 4RZSA 2HHAA 1MEOA 2FETA 2GA8A 2YNQA 4DLTA 3M6LA 4MV1A 2GNAA 4GX5A 2P41A 2HC9A 2H48A 3V79K 8AT1A 2DLCX 1SAYA 2P9BA 1NW7A 3FPAA 5KYTA 1P17A 2YWXA 3HCOA 5FBQB 3N71A 1E58A 1E90A 3X2QE 2BCGY 1PJRA 3ICVA 3LHSA 3FLEA 4LJKA 2H8KA 1FSSA 3GQVA 2VFAA 2C2ZA 1QHSA 2HWYA 1MIOB 4YI5A 2FY8A 1VPLA 2PXAA 2VA9A 3HKDB 4P81A 1BD4A 1KIAA 2NVOA 4OQMA 4UU7A 3KZXA 4IIJB 5AVWA 4AKGA 3GCDA 4LXXA 2Q8NA 2BUCA 1IY2A 2AGVA 1EHIA 2PUDA 3KALA 3FBGA 3GRPA 3R7DA 2AF3C 4CKCA 2J9ZB 4G1TA 5M72A 4FEYA 4O4LA 2VPYA 3CSDA 4EEKA 3KG2A 1O6BA 4IYPA 3GG9A 3WLHA 4OGWA 3TRKA 2GNPA 4KVGA 2FJPA 3FTSA 2F1HA 3KXDA 4BFRA 1AQNA 4GAAA 2P30A 3Q15A 3CF4G 2RHRA 1ODSA 5EESA 3RC3A 3U56A 2PWAA 2QLNA 4RM2A 3WB0A 1P6QA 5EUMA 1PT5A 2GZSA 5K8VA 3NHAA 4BESA 4QU8A 4AVYA 1E9CA 4O8ZA 4FQ8A 3UB2A 3ZLUA 4RVFA 2FAXA 1T10A 3BJEA 2WP0A 2F6RA 3UUWA 1K63A 2YHAA 1Q15A 4YBZA 2P2YA 1F2TA 3GW8A 2EG9A 3U3OA 3HI6A 2O8BA 1TXGA 3A1CA 3AU5A 3FHEA 2VDQB 3A6HA 1H8EA 2F0YA 5HQ3A 1Y4DE 3CONA 3CK7A 1EHYA 3ELBA 2IS2A 3OCJA 3A32A 3R20A 5LP6C 3ZEAA 3DA8A 2R8RA 3D31A 4XGIA 1E1QD 4DWWA 2FVYA 4DA4A 4I50A 3IPLA 1J2JA 4GGMX 3IHWA 3WB2A 4WZBA 4BNDA 2YDYA 4J9VA 4HHEA 5FADA 5D7BA 2C4WA 1V71A 3ZDAA 1BDMA 4X5OA 5TJHA 3FD8A 2KW5A 1V7QA 4IDAA 2WXKA 3JQ9A 4W1QA 3THOA 4KG7A 1NQWA 1NZDA 4I99A 3W4JA 1YDWA 4FWTA 2A0UA 5A71A 4GT1A 1DXHA 4XSVA 4YI3A 3SXJA 3PFKA 4FULA 2Q3CA 1ST3A 1WETA 4KPYA 3CNOA 3ESCA 1ODTC 4TT3D 4FFRA 1B1CA 2A94A 4EZJA 2AYZA 4WFJA 4J8FA 2PKXA 4M9RA 4G4SO 3DDNA 3BF8A 2MINB 3F4LA 1MMFB 1DP4A 2EC5A 3IOEA 4RANA 5I7AA 4NG5A 1RPZA 2WE8A 4WVFA 4LZOA 4DZZA 3OU2A 3ZV3A 1UWKA 4FNAA 3PH0C 2XNCA 1ACJA 1U98A 3HABA 3IRUA 4UM7A 5EIWA 3FBTA 4PYOA 2PM8A 4I1VA 4DT1B 1KMNA 5FFMA 5BWLA 3CUUA 4FMCB 3E18A 1MD9A 5THKA 2Z0MA 4P84A 1P75A 3A14A 4XQCA 3FCAA 5LCWJ 2XZDA 4FZRA 3UIOC 3ZHEB 1TM4E 5BR7A 1MO2A 3VSEA 4DLQA 4L6AA 3FPLA 3J7AC 8ATCA 5TS3A 4MQLA 2UYGA 5IC6A 4TYNA 5ECWA 4KZ0A 3T9EA 2J0UA 3SC2A 1XZDA 3C6ZA 4RPLA 1KZGB 9MHTA 1XZGA 5AUOB 1WY6A 2QROA 3T5TA 2GESA 5A4KA 4NZOA 3QJ5A 1FYEA 2R25B 2FUKA 4XLLA 3I23A 3E0QA 2FA9A 5H3CA 3LX5A 4TTJA 5IVHA 2AYYA 1YL7A 3BREA 4MEJA 4P58A 3L7LA 2ZIFA 3EYWA 3PPVA 1UPFA 4BMNA 2JFPA 2IUTA 1ZBDA 4NPCA 2C7PA 4HG2A 3U7IA 2Y66A 3KDPA 5DHQA 4CTNA 4I5DA 4U0ZA 2OORC 2FCRA 3ZK9A 3TBFA 1E96B 2AD5A 1OZHA 3GUUA 5A03A 1V16A 1KFCB 4WUTA 3VH4A 2LIPA 2GEDA 1XQ9A 2YXPX 3COPA 3PPIA 4G56A 3VHRA 5C3MA 1XEXA 2DLDA 2J48A 3ZH9B 2OQ2A 1SURA 2AHOA 2VHUA 4JXKA 2XCIA 4GZDA 4TXNA 4EA8A 4GZ5A 3L9WA 4BMDA 2NQTA 2WAOA 4OIFA 3OMWA 5D8DA 2K7FA 1KL7A 3FU3A 4M9ZA 3LGAA 4DIDA 4TS1A 1XEWX 3R1IA 3AFIA 1RE0A 4URHA 2DTDA 3H4IA 1DO0A 3WGTA 1CFJA 1T1GA 1I4WA 3TWQA 3CBQA 2H1LA 1WLYA 2OL4A 5B3JA 3F9CA 3OHMA 3M5WA 2XVAA 2JVKA 2QY9A 4BO5A 3LCMA 1MPXA 2ECKA 4OB6A 3GNQA 3IAXA 1ECGA 4BNXA 3UOAB 1GOTA 3X0DA 4FYWA 1HLFA 4A6DA 3P19A 3LT5A 2V6BA 3SF8A 1UAYA 2VNKA 2CEAA 3WWPA 1Z83A 4PAMA 4ZYUA 1JHYA 2JCSA 4RTJA 3BWVA 4QBFA 2ZR7A 4Q9LA 5ERYA 1PWYE 1QHHA 1FTWA 5EJEA 3HRKA 4JLNA 2WC1A 3KSAC 1UAAA 2QL9A 4BBAA 2AN1A 3B85A 1SQFA 3NH6A 4PGAA 3M1IA 1YDGA 3AI7A 1NI3A 1JR3A 1G5RA 4UWHA 3QVKA 3KWFA 4P3YA 4RE6A 3H11B 1WUKS 2BKKB 3AYZB 4N0EA 2HU8A 1F20A 2BEUB 1PZNA 3EZYA 3VU3A 3QRWA 2N1BA 1SA0B 5JJ6A 1XKTA 2GRMA 4NNPA 5DP2A 1U94A 2OHHA 4F11A 3UMBA 3ABSB 1SCJA 3ADBA 3FGNA 5KAMA 3EVGA 2ET6A 1L9KA 1TQ4A 4D5GA 1QZXA 2ZBQA 2IYRA 4R7LA 2L42A 5FA8A 1R64A 1BPOA 2DF8A 5KQRA 1C2TA 1LV8A 2B8TA 2AFIE 5EZYA 5EJAA 1HE5A 1DOZA 3U7QB 1RQ2A 3DBIA 2CMGA 1KFJB 3TNJA 2QRGA 2E5FA 4A3SA 3X2SA 2EZ9A 2I6QA 3F7TA 2QNRA 4ETWA 3UJHA 4BFTA 1FNSA 1V1MB 1IYGA 1E2QA 4TVBA 4GMXA 3D1LA 1NQOA 3ZEFA 3FTUA 1KJIA 2HK8A 1ZI8A 3KYBA 1YO6A 5ALOA 4KMSA 4MVJA 3WJ7A 2KWIA 2GN2A 3PDHA 4M1YA 2PSEA 3ZW7A 3SZMA 3LX4A 2PX2A 1SIBE 1VMDA 3A8TA 5JNVA 2A58A 3S7FA 4IUCS 2YW2A 4MR7A 4NP6A 1HTWA 3OLWA 3DVAB 4MA4A 5HS6A 1O1RA 3J7TA 2V4HC 4S3MA 1VXOA 1NUHA 4KQ1A 3TQTA 3L0ZA 1ZK1A 3FNRA 5ITVA 1DQSA 2RI1A 2P0EA 1FC0A 3WK8A 1BXRB 1ZUIA 3REQB 3TD6A 3UAGA 5L40A 3MV2B 3P9CA 1A8HA 1HPLA 4F1WA 3HA2A 4HRYA 3LQ1A 1TPZA 4QA9A 1OA1A 2NUBA 4NPHA 2O19A 4HFJA 2GXUA 4JCCA 2BFFB 3ZCUA 1RQNA 5FTLA 2Q3HA 4NMXB 1BVRA 1GN8A 2B20A 1QS0A 3AF2A 1CR0A 3OLQA 3L1JA 1OKKA 3UJ8A 5JD3A 2R4QA 3AFGA 5H1YA 3A04A 1XTIA 1O94C 3D6NB 4KO3S 4EUHA 1G6KA 2AG6A 4LSZE 2G4VA 5DX0A 1IUOA 4HQ6A 5IJZA 4R1QA 2JFWA 2C4KA 3LBFA 5IBCA 4F3KA 1CNMA 1LZLA 2ZI9A 3SY2A 5DLEA 3B7TA 1N9AA 2YYAA 3GRRA 3M5PA 3M5CA 4TXHA 4HADA 5DNVA 1YKSA 4LJYA 2RGNA 2J0SA 3L18A 3TLEA 5IRCD 5B7GA 5KVCA 5F64A 3NTVA 1F8YA 1ZK4A 4U8YD 3CPJB 3ZHXA 1H23A 3AT1A 1H6AA 1H2RS 1W30A 4EG0A 4TMYA 2Z09A 3GLGA 4EBAA 3WKBA 1RCUA 2Z30A 2ZDQA 3KOMA 2PH7A 1SEPA 5FO1A 3KQPA 1Y5RA 2LKCA 4PLTA 4Q3BA 1RRCA 4QUJA 2VAPA 1HE8B 4L5BA 4OQLA 4GBJA 1LH0A 5HILA 4TSFD 2F43B 4E30A 3D4PA 3F6SA 4OBEA 2PL5A 1H2UA 2O5VA 3T1NA 3FU0A 3TXYA 1U0RA 4ZKDA 4ND8B 3TYXA 4ZCLA 1O08A 1DMRA 1WHSB 4D4GA 2PQ0A 1E6MA 4AS2A 3PQCA 4LDZA 2Y9MB 3BCUA 3O3NB 4DMLA 4K5AB 4IM7A 4N3NA 1RQXA 2VQ2A 4XGKA 2HHJA 3KKMA 2HA6A 4ISBA 2NYVA 1GPWB 2OQRA 1SIWA 3H5RA 1VYVA 3MD0A 3T99A 5FRDA 4ITRC 4C1NA 3KPUA 4AJJA 1GKLA 1TZKA 1ZUNA 1U0FA 2PG3A 3ACCA 2F8YA 4IINA 3SQLA 5KYXA 4EPYA 5CT5A 4FFPA 5IG2A 5CDFA 1EAMA 4OQXA 4N8SA 3JW8A 2I3AA 3PEVA 4R1LA 2NGRA 4KRXA 4OVVA 4FJ0A 1ENPA 5EEGA 3ZJTA 4JKOA 4YIKA 1ADYA 2Y0PA 1HORA 2PZAA 5JHHB 1RAAA 3LPCA 1HDIA 3QSYA 3BUSA 1PVVA 2YYSA 1A4UA 5F1PA 1NMQA 1WSBA 1L5JA 4DGSA 1ATZA 4PRKA 1E9FA 1VKRA 2IHTA 3NQ41 3SS7X 4CEIA 4FTWA 3LC2O 3JVEA 3F5MA 4XQGA 1KZ6A 3C3WA 3GNLA 4WFIA 4XWTA 2QKYA 4CR6A 5FV4A 1T4CB 1Y8RB 1N0IA 1D4OA 3Q49B 5HBGA 3C72A 1XTKA 3U7EB 2CVFA 3B8HA 3OCWA 3M6MD 1PW7A 3DE0X 1QB7A 2FUEA 3V46A 3A6PC 1K98A 1E79D 2XENA 3NBKA 1VE1A 5C8ZA 5LYJA 1FU4A 2M6RA 3AIOA 3NP9A 3PD0A 2BOVA 4AXBA 2AN3A 1LBSA 1TAHA 4KBFA 3C16C 1W0KD 1X87A 1PD0A 1H5NA 3D5EA 2AXNA 4JNCA 1S3FA 4CRWA 1QE0A 3RYIB 1JJVA 3VJRA 4D82A 221PA 4DCNA 2PNFA 4ND1A 3JD2A 2QP4A 3M3PA 2MSLA 4PE5B 1U2GC 2V1XA 5B3AA 2P9IG 4AOFA 1ZCBA 2D5BA 2OHJA 3BMQB 4L9SA 3IEVA 1XCMA 3M6VA 3DS8A 2NO5A 2OVFA 1QFXA 3GJXC 4LKRA 1PUXA 2YMPA 5AWFC 4Z2YA 1WPXA 1O0SA 4ZAWA 1A0OA 1M1UA 1Q0UA 3EHNA 4UCXA 3OAWA 2CBXA 3GYBA 1M6WA 1XNJA 4GR9A 4OQFA 5LMZA 3U3WA 4IX9A 3I04M 3NEPX 4YRCA 4G41A 2YY5A 2NTNA 3FMOB 3HUTA 3KJQA 1YDMA 1W34A 3PRHA 2PUCA 2IIBA 5HCNA 4MVCA 2UU9B 1TU3A 1PSWA 3CNBA 1MRSA 2AZDA 4K6FA 4AB1A 4P0PB 2J4FA 1WBDA 1GAJA 4PM4A 2IYYA 3K0HA 4C07A 1GEGA 1VIVA 3LM8A 3EHQA 2VXYA 1H05A 5BQPA 4BO6A 1ODJA 4HNVA 2P9KG 5HEKA 4PPFA 4F3VA 1N2OA 1P45A 2G25A 2PANA 1NM5A 3NYWA 3FOCA 1PGQA 5E6UA 1YB5A 2AA3A 2CXNA 2ECQA 2LW7A 1CU1A 5B6PA 2IH2A 3V4RA 3UGKA 4QQRA 1JHXA 4KGXA 2QP9X 4I46A 2QPAA 2V8OA 2Q3EA 2J3IA 5CA0A 3F6PA 3ND8A 2C2LA 4QU9A 4TTVA 3I3SR 4D9IA 3WFIA 4O4HF 3RUIA 3BH7A 1HM5A 2H08A 1QYIA 4DPKA 4YIHA 4Q6WA 4B73A 2R7KA 4M1OA 2IHKA 4P22A 1LFDB 3WLOA 2Q5LA 3OIUA 4JYBA 4CL8A 1NF2A 3G1WA 4RK6A 5IF3A 4Q47A 2C4NA 1EX1A 3DLBA 2ZBUA 3Q4AB 4BYMA 4HXYA 4M0LA 3GCZA 3NOQA 2ZKIA 3B70A 3E1KA 4E2YA 4PBRA 1LK0A 1Z5UA 2UZ0A 3HRIA 2QUZA 3L2OB 1Y7TA 1DEXA 2ZAOA 4Z0HO 3LZDA 4QYXA 4WQMA 3T9CA 4FPXA 1DKPA 2HZ7A 1OGIA 2GDZA 4UEKA 3H8JA 4BQEA 4LNUA 2YHEA 3HYMB 3GLHB 5BQ3A 2PUFA 2RGRA 2CXQA 5IDVA 3CEHA 2IS4A 3E3MA 5JT1A 3JYSA 5I9NA 1KFBB 1ONOA 4PPGA 3HMQA 4X6UA 2XCSB 5CX1A 3C74A 3KZVA 2C7GA 1SXGA 4EMSA 4QT0A 3GUYA 1CQPA 4RD3A 2RSLA 2GT1A 2TMDA 4YDOA 3VJKA 4GOKA 1YQXA 4L8WB 1O0CA 3JASA 2NU9B 4I1OA 3NC0C 1KOGA 4P93A 5DSTA 3K73O 3OO0A 3SZ3A 3F98A 2GB4A 3HDQA 3IKVA 2EBWA 2OG1A 2YXDA 2F1IA 1MX4A 3M70A 4C6TA 4IVRA 1K8QA 4B5LA 3PGXA 4ZC8A 2Z6UA 4DLNA 2B36A 4BMYA 3O92A 3V8EA 4KFRA 3TAXA 2ZUVA 3F6RA 4ABTA 5K8LA 2B5WA 1GQYA 1NULA 2AJCA 1BW9A 3ZU5A 2Q9AA 1J06A 3A0RB 5E4JA 4TTRA 3R9IA 3LJNA 3UF0A 2CT8A 2XZDG 3GPBA 3LO5A 4AO7A 4R40A 1Z0FA 5L51A 1QHIA 3H4TA 3NJRA 2IS6A 4Y1RA 1E94E 1JI0A 3THWA 5AAOA 2R4TA 1JYFA 3L04A 4UFNA 5B3SE 1BJKA 4FJ2A 4K5QA 3D6FA 2C4MA 3MA5A 4YDRA 1KI7A 4J7CA 2X7XA 4J0KA 1EBUA 3DAFA 1W0CA 1GPH1 4OHXA 3NTRA 4ZVPA 1L8OA 4N0DA 3NOXA 3E6AA 1CUDA 5HPYB 1Y5MA 4Z2AA 3LS2A 1PWXA 4CM3A 5IZCA 3FCXA 1JKFA 1NI4A 2VJAA 2OD7A 2KX7A 3G0BA 4RBNA 2VDMB 4CM4A 1L5HB 5F4ZA 2PGIA 1P9LA 3GNSA 1DADA 1UFVA 3Q8LA 4FU3A 5AKZA 5FZSA 4YUXA 3UK1A 3VR4D 3FHTA 3FOFC 1GFWA 3HXCA 1K5GA 1E9VA 4M1EA 5I47A 3L0YA 3K92A 4HX2A 1L1RA 3NEYA 4C7VA 1MQ9A 5KYYA 4GKVA 2XDWA 1A9XB 1V96A 3ASVA 1EX7A 2GK6A 2VRCA 3KX2A 2ZUCA 1C30B 3EXHB 2CYCA 3TPFA 3OSZA 1E4YA 1BNCA 3OD1A 1CY1A 2E9SA 5CLIA 4KFUA 3PIIA 1EK0A 5BXOA 2J41A 4HC4A 5AHOA 3IVRA 1KYQA 1TKRA 3S2EA 4J9UE 2QLBA 2DHEA 4C0QC 4YJHB 2W42A 2XI4A 2GEUA 2AC4A 3MUFA 1QIKA 1YD7A 1YB2A 3JALB 3SFYA 4Z53A 3G5LA 3E2PA 2E4VA 3VPCA 4UHJA 4Y1EA 4DOMA 3R09A 2R6CA 3BGDA 4JI4B 1RMYA 2BEKA 2E1RA 3K9QO 4PZLA 4X62B 4KJZA 5E7QA 2BCEA 5LVAA 3GAZA 1JAYA 1OXBB 2I9KA 4J0IA 3TLMA 3PGVA 4PZZA 2IEDA 1F7UA 1GU1A 5DVZA 3BG1B 1M3SA 3ADPA 4MIOA 3SGLA 1K7YA 2G5GX 5JXWA 1JHPA 3HB5X 1FA9A 3RKRA 1U1EA 1D1PA 5ALPA 4NBVA 3TZCA 4B3GA 4E08A 5JQGA 3DOJA 3PX2A 1KKUA 2BM0A 4UU0A 5IH3A 1ZOPA 3REOA 1G8FA 3SR4A 3HXOA 3KR9A 4CKZA 1KSHA 4YMHA 1SA4A 2FEXA 2V6MA 4W5OA 3RWOA 4BX3A 4MWTA 1N4AA 1UK9A 1N3YA 4FR2A 1DXYA 2V58A 2B78A 1JNXX 4EI8A 1M2JA 4XFKA 2IHBA 1YCSB 4B2PA 3P9SA 1YOBA 4MKGA 3AVUA 4Y2XA 4IH9A 4B89A 4LJ9A 5G1OA 3BBLA 4XARA 1H22A 2GLUA 1M1YB 3KWJA 4DUPA 1QYMA 5DH9A 1L4FA 3EMKA 4BT8A 3L6BA 4DRYA 3VNBA 2GJAA 4JYMA 1V3VA 5DM70 1TLFA 2FPPB 4LQ4A 3M9LA 5LNK1 3GVXA 2P4HX 2XMZA 4EFDA 4KNWA 4J91A 1E2UA 1NMSA 1SG0A 1EWVA 1JDUA 4NCJA 1G8MA 3WGLA 2Q3MA 4L28A 3T8MA 2BVNA 3SS8A 3Q9UC 5HRAA 3ZCPA 3TDKA 2YQ4A 4FKZA 4QUDA 4YWHA 4Z9YA 4BXOA 3HDYA 4GYKA 3ELYA 3MTGA 1KMMA 1Z8HA 1Z45A 1NR7A 5HMMA 3W34A 5FD8A 1Z39A 1UOOA 4AV7A 4NJMB 1RYEA 2G67A 1ISSA 2DBAA 4AVXA 2G06A 2BI8A 5JNLA 2FULA 4I6GA 2GJ9A 4M8LA 5BYAA 4DX1A 1PT6A 3DWFA 5CXSA 2ZSIA 3MQ4A 2QVXX 3A3YA 3E23A 5REQA 3DV2A 4II3A 2P65A 3FCEA 3GUCA 2RH9B 4EFNA 1RRGA 3DTVB 4ERNA 2PK3A 4MVJG 2BR4A 3QNUA 1C4XA 1QHYA 2PLFA 1V5FA 5CERB 3WGHA 3QI7A 3EGIA 1AK2A 2VBGA 1CS0B 2B30A 3KB1A 4RGBA 3L0SA 3NATA 2H5EA 2C31A 4WBNB 3ZBTA 1YKGA 2GASA 1YZFA 4H60A 4GX1A 5EJFA 2EEZA 4I17A 1XZCA 2A5EA 2PA3A 3BIXA 3ILVA 4Q9IA 2AQKA 2PKCA 4PUCA 1N25A 3VYVA 4FGJA 4FHGA 3VTAA 5EXDA 1QTQA 3MS2A 3G5AA 3TQCA 1V4VA 3Q9NA 1WQ1R 1AC5A 3PGLA 4WASA 1HETA 1PLLA 1LK5A 1AZTA 2OC9A 4TRRA 4OQNA 1L3CA 2A8YA 2ODAA 2YV5A 3K9WA 3CRNA 4JUCA 1DJMA 1MGPA 3V97A 3T12A 4MYDA 4FDUA 1EFRA 5IUNC 4YJ2A 3FR7A 1I4OA 5AKJA 4ZAXA 4RSGA 4X8MA 2X6FA 1ZP6A 4B40A 3DL2A 3ZE8A 2WU3A 4G0ZA 3OQMA 3DE3X 9GPBA 1FPPA 4KFSA 5CR9A 4HDAA 4QOEA 3DB1A 3WI7A 3ECSA 4RZHA 2F3UA 1E32A 2CUNA 2E4UA 4GM1A 3DLAA 1G5QA 3IDAA 3TPCA 4YCSA 1SOAA 1BHO1 1YZNA 5DXAA 2I8LA 4QIHA 1V11B 3OXLA 3FOZA 1I0LA 2V7QD 2B34A 5ANRB 3ROMA 4CGWA 3D9OA 2OZPA 3GGSA 1LJLA 4KQFA 4QG3A 4I2ZA 3OFND 4K6GA 1R4NB 4U00A 1A04A 2FW6A 2KSQA 1N4QA 3R41A 3ZE6A 5DI9A 4IIVA 4LJLA 1M83A 3ZDFA 4U8GA 1FBTA 5ESWA 4IFEA 5G2NA 1NKVA 2FSHA 3QMVA 5DCUA 2ZGDA 4REQA 3PREA 5DLDA 2J9QA 2ISCA 4PZ9A 4PCVA 3V4FA 4XZ3A 2ZVDA 1DIHA 4L3VA 3V4OA 5E9JA 2BFCB 2OUIA 5JMPA 3TB4A 3KDAA 2JJMA 3UINC 4G4GA 3N8NA 3GH1A 3DLTA 4ZO8A 3WKDA 1GNVA 2C3UA 3EG5A 5EHNA 1IN1A 4AMZA 4IHKA 5FOSA 1DG9A 1RVV1 1WW2A 2NG1A 3WGGA 4DLOA 2OLKA 4KIJA 3GEBA 4TUYF 2BHSA 3ORRA 1PO7A 3LQRA 2OE2A 1OZ0A 5TARA 2QN3A 2G4LA 3CRMA 1V8FA 3OOJA 4GH5A 1XE3A 2ILTA 1ISHA 5DOZA 3N6VA 4BGUA 4Y2SA 3JD3A 1KBQA 3GFTA 4U2GA 4HP8A 2UVQA 1ZW6A 3GI1A 3FDZB 1D2RA 3G02A 1HFAA 3ZU7B 2FWJA 4DUIA 3FTXA 4BVGA 4DSTA 3FNIA 2A1IA 2XIJA 2Q8PA 2XNSA 3RJZA 3EJNA 2LWIA 4A2QA 1ECPA 5EHZA 1NIJA 4A91A 1HNNA 3F96A 4EJ2A 1JDPA 1JIJA 1Y6IA 3CSTA 4E88A 3EAQA 1UEIA 5DBKA 4B7ZA 3N2GA 1P2VA 1EESA 1OGJA 1BO6A 2CNKA 1DO8A 4X60A 1P4HA 2PU7A 4KXFB 4NFSA 2AMYA 5AHXA 2QLMA 2QQFA 2IF2A 1Q3HA 1O95C 3FAZA 8LDHA 2Y2VA 4FZ3A 2ZZMA 4NBRA 4H1VA 3WYFA 5D2CA 1S0PA 2GWRA 4NBWA 5E6RB 3PFNA 1W4RA 1IK6A 1W49A 4J0GA 3WY9A 3GMSA 1S8OA 3OPNA 1CKEA 3WV5A 3SR3A 3FTEA 3JVIA 3FRJA 4YRFA 5LZ7A 2VJYA 4ISCA 4DJAA 4V0OA 3VR5H 3DOCA 3JZFA 4I19A 4YRKA 1AZSC 3KT6A 4FK8A 5KWEA 4J4TA 3B1VA 1P39A 1PKEA 4IXWA 3PNOA 4YBRA 1GSIA 4L07A 3LLUA 1IEXA 4RYLA 5B6IA 3RYHA 1KJYA 4WY5A 1ZIYA 2GF2A 3WBBA 5CH3A 4XR9A 2GSWA 2QZ9A 4IRUA 1LX7A 1C0EA 2JAOA 3BRWD 4J8EA 1GZDA 5DSZA 1TU0A 5HE9A 1SZCA 3M82A 3RB8A 3M6AA 4NQ0A 2Y99A 1ZA1A 3I4RB 4KRFA 5HTOA 3QBTA 4ACAA 5KSWB 4LE2A 1VMIA 2E55A 5C35A 1T2NA 4L8LA 1OBHA 4Z7JA 2JVJA 3VTZA 4QFDA 4UHHA 3UWSA 5LJIA 1NJ5A 1DTEA 4I55B 4FNGA 1BX0A 4R2LA 4XX5A 3B9QA 4P0QB 5CDHA 4CEJA 4OBBA 5KNHD 5A06A 3OESA 1N6PA 1KP2A 5B36A 3GLTA 3PUKA 1OHHD 4JUBA 1JLRA 2W0SA 3AHIA 1H2FA 3NIGB 2X6TA 3I9JA 4YMWA 2AKAB 3F6EX 1T5TA 4HGRA 1P7ZA 3P1JA 2WXOA 3S27A 3UGQA 3N53A 1FFSA 2P77A 4AJIA 3UJNA 3IV7A 1A7JA 1G63A 3H8VA 4N3BA 3KKPA 1TJFA 4S12A 7YASA 4CM7A 2IXGA 2DYSE 2M2IA 2N1MA 4ZI7F 3D2BA 2N42A 4A7PA 4KQKA 2FSVA 3R0VA 5IUJC 4HMQA 3ILHA 4ZHSA 4X6YA 4IGAA 4J07A 4DLUA 4BFUA 4A8HA 3HB7A 3CGHA 1KI4A 3KYDB 3EVBA 3DV0A 4KGDA 2X22A 5AJVB 1SWWA 3HNPA 4HDRB 1JA9A 5LUBA 1SKQA 1PR2A 1PG0A 2FXVA 3D2CA 1I9GA 4II2A 4IFTA 2R00C 4QGFA 1UADA 4MPDA 3HFSA 3ORYA 3R0XA 3AG6A 3DKVA 1S2OA 2L0TB 1E5VA 3REQA 2EKLA 3T7DA 1YU6A 1DRVA 1CTQA 3C7KA 1Q2UA 2DVMA 5ADWA 1KY3A 1FCHA 3NVDA 2J3LA 5D51S 2IXDA 2NVUB 2VJOA 5BVGB 4IXDA 2QYJA 3KSZO 1KSGA 4D45A 1JLKA 2DVWA 1DIGA 3H2HA 2WUDA 3PB3A 1Q0QA 3PNLA 2Y1LA 2B2CA 5AIJA 1H9CA 5KVQA 4KB5A 4NCHA 3AF5A 1NQTA 1T13A 3LSYA 4RMNA 1Y1SA 2BKGA 3UMFA 1NQXA 3QITA 1VZ2A 2BEJA 3C1UA 4GLBA 1RHQA 1VCIA 2RG8A 4YT4A 4F3YA 1RWMA 2AMVA 2HSZA 4GX2A 4BNTA 5H9VA 4ROSA 3CH4B 5HI7A 1A2BA 1MN6A 2V7BA 4GOLD 3E9YA 3WXXA 3DE1X 3G9ZA 4M0PA 4GI1A 1INLA 2O0HA 3SM9A 3MRTA 3NAGA 5H59A 3HVKA 3ONVA 1BAPA 4YP0A 4UHCA 1UZNA 4F4CA 3IUJA 3ZXXA 2C88A 3K0KA 3OQIA 2R47A 4FIDA 3DAHA 4HAYA 1LBIA 5AOAA 2OM6A 2YVKA 4HWOA 4J0JA 1YS4A 3F8SA 2MU1A 2HRDA 2PMEA 3PFFA 3PJGA 1EB8A 1QOQB 5EMKA 3AIIA 1HE1C 2RKBA 2X3YA 1XD2B 1OLSA 3O75A 3GFPA 5SZJA 4AM8A 5A9RA 3EGVA 1V1RA 1CPYA 3PXUA 1YIAA 3K1YA 4P4NA 4FOTA 4UTZA 3K6JA 1FNDA 3O4RA 3ZWBA 1TC1A 3RTEA 3G9TA 2W70A 2AXZA 4DI3A 3HA3A 4JLMA 1QTIA 2FX3A 1M6EX 2I7VA 1UUFA 2Z43A 1DO2A 5DF1A 1JAZA 5F77A 3VQTA 4OM8A 5JHGB 5BUSA 1SC9A 1XMXA 5LR6A 1Q1EA 2IU3A 3OEHD 3PEYA 3QKSB 5EI5A 1KDTA 2GEBA 2DHDA 4EZEA 3QLUC 1UDXA 2HWKA 3M3DA 4Z4GA 1BWSA 3NDBB 4EFLA 3P27A 2D3TA 2E87A 3G8AA 2N47A 2BFOA 2OBLA 3WIVA 2A1TS 4DMGA 4R0MA 4ACLA 4E51A 5JCPA 3SHFA 1MRZA 4K9MA 2R5FA 4NBLA 1UWCA 2FJ0A 4UNPA 1L4MA 3LPAA 2E7ZA 3ROEA 2WZCA 3FRHA 4PLZA 2F7SA 1RHMA 3FULA 2YWHA 3MT8A 2XEHA 3BKXA 3VVLA 3D2LA 3JY6A 3EHDA 1AUQA 3MAGA 3RAUA 4Z8XA 4XX0A 2Z1NA 4XPZA 6REQB 1M0EA 3UK0A 4TLAA 2VHJA 4PC6A 4EG3A 1KI9A 1N5OX 3OX2A 4HRVA 1KR2A 2JGJA 3TECE 1SRQA 2H9IA 2OYCA 1L8LA 2XZLA 2C97A 1F60A 1GNLA 3WYEA