3C5RA

Crystal structure of the bard1 ankyrin repeat domain and its functional consequences
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
PFTNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BRCA1-associated RING domain protein 1
publication title Crystal Structure of the BARD1 Ankyrin Repeat Domain and Its Functional Consequences.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 42
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3c5rA00
4U8VD 4BERA 4O60A 3AJIA 5EIBE 3JUEA 4LNUD 4A63B 3UXGA 2F8XK 2Y0BG 1YMPA 5ENOD 4HI8A 2BKGA 3HRAA 3JXJA 2RFAA 2XEEA 4HRMB 4HRNA 5ENRD 2DVWA 4HB5A 4NIKA 5FINA 3TWSA 1DC2A 3TWTA 1MX2A 4HLLA 4Z68A 4U95D 3TWXA 2DZOA 2DZNA 3DEPA 4BSZB 5CEAA 3B95A 3ZU7B 1OT8A 5AQ9A 2DWZA 5ENSD 2HE0A 1K1BA 3LJNA 3V2XA 1YYHA 2MYOA 3EHQA 4GPMA 4N5QA 4QFVA 4ATZD 4F6RD 5AAOA 3TWRA 1IXVA 3B7BA 2J8SD 2V4HC 4CZ2D 3W9FA 5CEDB 5ENTD 5HRYA 5ENQD 3TWVA 3W9GA 5D66A 2JABA 1DCQA 1MX4A 3V79K 4K5AB 4O1PA 1G3NB 4HBDA 4JB8P 3UTMA 4BESA 5BXOA 1WDYA 4UUCA 5KNHD 2PNNA 2XEHA 4GMRA 1MYOA 5HS0A 1SVXA 2P2CP 3J5PA 3Q9NC 4K5BA 2ZGDA 4K5CA 1OY3D 5EILA 5HKPA 4DX2A 5CBOA 1TR4A 3UI2A 1S70B 2Y1LE 2F37A 2XZTG 2V5QC 5BXUA 4HRLA 3KEAA 3Q9UC 4ZHBA 5CERB 2BKKB 4DRXE 2ZGGA 1UOHA 3F6QA 5EIDA 3NOCD 4OAUC 5KWDA 5AQBA 3D9HA 3V31A 1BI7B 1IHBA 1NFIE 3EHRA 3NOGD 2ETBA 3SO8A 3V2OA 3C5RA 2L6BA 3IXEA 4J7WA 4LG6A 5ENPD 2QC9A 4U96D 5KNGA 2ETCA 4QQIA 1YCSB 5EYPF 4ZFHA 4DX7D 4HQDA 3ZUVB 3JXIA 1AP7A 1WG0A 4DX5D 2F8YA 3T8KA 3ZKJA 2KXPC 4DX6D 2FO1E 3EU9A 5CBNA 5KBAA 1MJ0A 4TUMA 5EYLA 2NYJA 4HI9A 1MX6A 3AAAC 1N11A 4LSZE 2KBXA 5JA4D 4J8YA 4BEPA 4C48B 4RLYA 5ITZF 1AWCB 2ETAA 1BU9A 3DEOA 3NBNB 5EN5D 4HNAD 1A5EA 2VGEA 4CYMD 1N0QA 4U8YD 2XENA 4G8LA 4DX1A 4YDYA 2AJAA 1BLXB 2B0OE 1D9SA 4G8KA 4BETA 1QYMA 4F1PA 1K1AA 4YDWA 3TWQA 2A5EA 1N0RA 5FIOA 1IKND 1BD8A 4B93B 3TWWA 3HG0D 4DUIA 5CECB 5AQ7A 4OAVB 5JMND 5AN8A 1BI8B 1SW6A 1K3ZD 3T9KA 3J5QB 3ZNGA 5AARA 4O1OA 5AQAA 2RFMA 2XZDG 3V30A 3TWUA 2QYJA
chains in the Genus database with same CATH superfamily
3QARA 2L0IA 3LYAA 3UXGA 3URZA 1KT0A 3MKRA 2AVPA 2WXPA 4URKA 4HFGA 1U3DA 1DC2A 1HS6A 2NC9A 1U2VG 2KZTA 3GYZA 1XNFA 1ZU2A 3C3QA 2DWZA 3D9LA 4GTVA 4YVOA 5T4YA 3ABKE 2X6HA 5D66A 1MX4A 4H7XA 4XZ4A 3RRNB 5BXOA 1Z6TA 4TXRA 5KJLA 3FDHA 5LCWC 3CK8A 3ML8A 3MX3A 4ATGA 1FT2A 3LCAA 5KJMA 4DRXE 3SD5A 3WG7E 1TNZA 5G55A 3D9HA 1OCOE 1O5MA 3EHRA 3L22A 4Y6CA 2QC9A 4F3VA 3LXUX 4UI9K 1O1SA 4HORA 1KPSB 3EU5A 3Q79A 2DYRE 4CT0A 3MYVA 1ZB1A 2C0MA 4EZLA 4J8YA 4BEPA 2VGXA 3CVXA 3DSTA 1A5EA 1E90A 5AJLA 3DSVA 2I6HA 4AVXA 2IOSA 1D9SA 2J07A 4M3OA 3ZYMA 2VSNA 2XCCA 3CVVA 1BI8B 4RSYA 3APDA 2WM9A 3ZRHA 5CRVA 4DK5A 1TNYA 1OCZE 3PRZA 2OOEA 4GTMA 2A4ZA 1TN7A 2GRNB 5FINA 2R02A 2V5FA 3ZW3A 2AW6A 5G04J 3PUJA 3UX4A 4G24A 3EUVA 4FULA 3PZDA 2CFUA 3V2XA 4U07A 2R03A 1E7UA 4IULA 3BUAA 4BTAA 2VGYA 5FZRA 5HI7A 2X6KA 1QQEA 4HBDA 3DPDA 1H2UA 2P2CP 5EDSA 2CHXA 2BEDA 1TR4A 1TNOA 1VDYA 2WXIA 3AS5A 5BXUA 4L2LA 3CHSA 4IYPA 3HDXA 3SF4A 3DSUA 3NOGD 2XQ0A 1TJCA 4LG6A 1EF1C 2P9IG 2XPYA 4U96D 1SZ9A 1KT1A 3ZVVA 5JHBA 3NF1A 2LNIA 4DX6D 4YDEA 4TUMA 3IV0A 4B8AA 3S7FA 4KMOA 5EN5D 2R2LA 5C1DA 4YDYA 1ELKA 1ELWA 4YDWA 1UN8A 4E6HA 4WNDA 1IKND 3Q73A 2IF4A 4O6FA 2P9PG 3R9AB 5IY5E 4C0MA 4J8FA 5AARA 3ZXPA 2XZDG 2WXQA 3LY7A 3FH5A 2WQ7A 2Y0BG 2EIJE 1L5JA 3KSLA 3JUIA 1HO8A 4XIFA 2WXMA 1IYGA 2B6CA 4RG6A 3ZXSA 3CHQA 3UM2A 3U3WA 5D0QD 4GYOA 1K1BA 3FTSA 3R9MA 1ELRA 4ILGA 3TWRA 4PS8A 3FTYA 4ILHB 4I17A 3AG3E 4JC8A 4KT6B 3W9GA 4O1PA 3UTMA 4JB8P 4UWGA 1E8XA 2WXOA 4TXQA 1EPUA 3KEAA 2BKKB 2J4DA 3B7RL 2GRLA 3PEUB 5AQBA 4A1SA 4LRZA 2L6BA 2H6HA 2NXPA 4FA6A 2MOWA 1NI1A 2QZAA 1MJ0A 2KZTB 3DSWA 4A55A 4GTRA 1KZOA 4LSZE 1OWMA 1XGWA 2ETAA 3DBSA 2VSXE 4U8YD 3SZ7A 1BLXB 3UT7A 3UIOC 1N0RA 3E34A 1S0PA 3E37A 5G05J 1PY1A 3JQ0A 4JZYA 1MQSA 3ZNGA 5AENA 3U66A 2ZISA 4JL0A 2AXUA 4LCTA 3IKOB 4JHJA 1H2TC 4LNGA 4UI9C 4HRNA 3QAQA 3PREA 3TWSA 3FH8A 2VYIA 3FUFA 4Q69A 4HLEA 4R7LA 3ASDA 2I2OA 3PNLB 4EZJA 3QJZA 4DJAA 1TNUA 3QOUA 4BSXA 4GTOA 4BX8A 2NSZA 3EHMA 2R17C 4AY5A 3ASHA 3ONLA 2VGXB 4KZ0A 4BESA 5A6CA 4OAUC 1QNFA 5AYWD 5JJTA 3Q9NC 3ZGQA 1OWPA 1N54A 4FLBA 5CERB 3PZ2A 5BPPA 4GMJA 1WY6A 4X8QA 3IXEA 4WWOA 3ESKA 1MZCA 2XGMA 3AG2E 2E0IA 2KXPC 3DWLG 5KBAA 5EYLA 4HI9A 3AAAC 3PEVB 3PZ4A 1E96B 4CEMA 1UJKA 2WQHA 4HXIA 3ZN3A 4C9BB 3RSEG 3MV2B 4DX1A 5LOZA 1Y8MA 1K1AA 5LFAA 2HYZA 5G2NA 1Q2ZA 3L82A 4DUIA 3CQGB 2UY1A 5J08A 2J4BA 3T9KA 2ONDA 2QYJA 3RKVA 5AJDA 1YMPA 1N4SA 2V0PA 4I6GA 2XEEA 2MRIA 1FCHA 3UM0A 4JA7A 4KVOA 3PH0C 2GRMA 4Z68A 3MKQA 5FQ6A 3I3NA 1RZ4A 5ENNA 2YHCA 4GZDA 3S2AA 4GTSA 2MYOA 1JCQA 2Y69E 4K03A 1HE8A 3FUKA 3FUEA 3CR3A 3CK7A 3OTNA 4K5BA 3QWWA 4GMLA 5CBOA 3RU0A 3FWVA 3ZEFA 1UOHA 1H2VC 3AS4A 1N52A 5KWDA 4JXTA 2CG2A 5DIZA 2P9SG 1MHQA 5T8IA 2FO1E 2LUHA 1N4QA 2MHKA 1E7VA 4WUYA 1N11A 1H6OA 4AP2A 2YQ8A 1AWCB 2GGFA 3FTVA 3RAUA 5BT1A 1EYHA 1IHGA 3TWQA 2XGSA 4ACLA 3CIAA 3ENEA 3I4RB 3MCXA 2OEVA 4BERA 4KZCA 5ANRA 3KD7A 3JUEA 1LTXA 2WXNA 3G2SA 2GW1A 1OXJA 5ANLA 3EDTB 3UT8A 3TWXA 2L0TB 5EKQD 3CLJA 2XS8A 3CHPA 3UT4A 4G2VA 4G11A 4J8EA 3EJNA 2WMNA 1D8EA 2J49A 4JD2G 4I1MA 4ANVA 3IEGA 3RO2A 2C0LA 1OWOA 4XEIG 5HS0A 3IHVA 1SA5A 2P9LG 4U8HA 4LNBA 4ZHBA 4PS7A 2P58C 4TXPA 1NZNA 3C5RA 3FHEA 4JPSA 4EECA 3JXIA 2FEZA 4AEZC 5FQ4A 4RLYA 5ITZF 1FVHA 3TL5A 4LEUA 3ONKA 4P29A 1HFAA 1K8KG 4K0RA 3U64A 2XENA 3QWVA 4F7AA 2L9BA 1QYMA 4UWKA 1BD8A 5JJ6A 4I2WA 4B93B 3D9PA 5JMND 3OXGA 3FTXA 4A3TA 5J90A 1U3CA 1HF8A 4HOUA 3PZ1A 4A63B 2WXHA 4HI8A 3L6AA 3HRAA 2XPZA 4GTQA 5A7DB 4RQIA 4KVMA 3DXMG 4CT4A 2LXMA 4YVQC 4RG9A 5CEAA 2EQXA 3ZU7B 2YNQA 4GTTA 3R7RA 4GTPA 3EHQA 3CHOA 4GYWA 2WVIA 4JHKA 1N9AA 2J8SD 3CGHA 3TAXA 4U0ZA 4F53A 1FVFA 1V54E 3Q47B 4MBGA 5EILA 2UWJG 2AXVA 2F37A 2UY1B 2QYUA 5EIDA 2EIKE 2ILRA 1BPOA 1IHBA 4QQIA 1YCSB 4ZFHA 4DX7D 1JWFA 3TGOA 3MKQB 4N39A 1OCRE 4RVBA 4N3AA 5EX3A 4C48B 2J9QA 3L9TA 4GPKA 3CSTA 4CYMD 4N5CA 4KBQA 4AM9A 5JHAA 2PL2A 1KZPA 4APOA 3HYMB 2YHEA 4FHKA 4JW1A 4NQ0A 4OAVB 1TN6A 5AN8A 1K3ZD 5LCWJ 3HIZA 4U0SA 3PE3A 2Y3AA 3TWUA 3FU0A 1O1TA 4GZCA 5ENOD 3ML9A 4I1OB 2Y4TA 1UW4B 1OWLA 3KAEA 3L08A 2P9KG 2V8SE 5KJNA 1H6PA 4L23A 5HRYA 3SY2A 1UG3A 2JABA 3LY9A 3SHFA 3ESLA 4UWFA 3FH7A 4W9RA 3V31A 3PNTB 3BG1B 3LVRE 4WNFA 4HQDA 3CHRA 2WXJA 5BNWA 1MX6A 3CVLA 4NRHB 4CGWA 3DEOA 3FEYA 2VGEA 2IOLA 3E30A 2LO6A 4KYOB 1N94A 2CFZA 1DNPA 4HOTA 4TRQA 3CSFA 4ME2A 1TN8A 2I1JA 3HXFA 4G25A 5HQ8A 2WXRA 3AJIA 3D9KA 2OCCE 4FHJA 1H19A 3VLEA 3HVEA 3U9WA 3FUMA 4WNEA 3TWTA 4FU3A 3EHNA 2HO1A 3AU4A 4J8DA 4GCNA 3LY8A 4B0ZA 3B95A 1OT8A 4FJYA 3NAWA 3X2QE 1NL4A 5KJKA 5KCMA 4EZKA 2PM6A 5CEDB 1H0AA 5ENTD 3EIJA 3ZYLA 4WNGA 5DBKA 1G3NB 2QFCA 3FUIA 2PNNA 5FZSA 1Y6IA 1TEZA 1P5QA 3K9IA 3AU5A 3FUDA 3Q5MA 3FUHA 3G2WA 3ZFWA 4U04A 4ANWA 4AXHA 2GRQB 3C72A 5KNGA 4N2SA 4E85A 3GZ1A 2LAHA 1WG0A 3TXNA 3ULEG 3EU9A 4MRUA 4J0UA 4BFRA 3DPYA 5FQ7A 3PZ3A 1PAQA 1A17A 3NBNB 3C3OA 4DPRA 1N0QA 2EINE 1O1RA 2B0OE 3CKBA 2I1KA 4ACKA 4BTBA 4IRUA 1UN9A 3P1UA 4MKTA 3TWWA 3ZPJA 3VTYA 2IJGX 3S7BA 1TNBA 1GW6A 1QZ2A 4O1OA 4B89A 4LERA 3QKYA 3CVPA 2EILE 2HM8A 2R59A 4HRMB 1E8YA 3L17A 3TJPA 3DEPA 4I6JA 5ENSD 3QB2A 3D9JA 2EIME 3LPZA 3SBSA 3DSSA 5B1BE 3ASNE 2R5SA 1MYOA 2CG3A 2FBNA 4K5CA 5H7PA 3UI2A 2IONA 2J08A 2KCLA 2C2LA 2DCPA 4TUUA 3SBTB 2LAIA 1UJJA 5ENPD 3PE4A 4UI9J 3I5PA 3O4ZA 2LXLA 4EQFA 1EDUA 3QK0A 5D2MC 5CRUA 2XHEA 2KM4A 1H6KA 4I1AA 2X38A 4PS3A 4JEHA 4U7EB 5E76A 3JYSA 4FP7A 4GA2A 3PUKA 5D0OD 5BV1A 4AOFA 5FIOA 3QWPA 3RO3A 5CECB 2R05A 2WXFA 3ABME 2V4LA 3VLFA 2IEJA 3ZHEB 5AQAA 4CDMA 4O60A 5EIBE 2F8XK 3BQOA 5CMWA 4DLQA 3MA5A 4M7CA 3B13A 3I4GA 3D9IA 3UKRG 1QBQA 3MV3B 2Q7FA 3TXMA 4GYYA 4FC8A 1TJFA 4XKCA 3NQPA 2VTBA 3ABLE 4I9CA 3B7TA 2IO2C 3BG0B 3W9FA 3MGBA 1DCQA 3VLDA 3LKUA 3LS8A 4EPZA 3Q4AB 4DX2A 1JCSA 4WAFA 2XZTG 3KS2A 2HR2A 3Q49B 5ARGA 4Y6WA 4UQZA 4MS6A 3Q78A 3PDNA 1BI7B 3MEKA 3E32A 4GA1A 3WXXA 1RW2A 1Z5SC 3FEXA 3FUJA 1W3BA 3U4TA 3HVEB 5G04C 4EHMA 4XE0A 2FO7A 4GB9A 2WB2A 3UM3A 1DVPA 3CKCA 2VSOE 1OUVA 4GZ3A 5BV0A 2KBXA 3L54A 3GZ2A 3AG1E 1IQRA 4L9PA 1BU9A 4BT8A 4F1SA 3DXKG 2P9UG 3VTXA 2CHZA 4DI4A 3KEZA 2DBAA 5FJYA 2X6JA 4YDOA 3ZIMA 4AJWA 4CDRA 2GRRB 1V55E 5C2YA 4APFA 2ZXWE 4LNUD 2RD0A 3D9NA 4G1TA 2IFUA 2X3MA 4Q96A 2P9NG 2F0YA 2WPVA 1Z3YA 2VQ2A 3BEEA 4N3CA 2HE0A 1Z3XA 4F6RD 4XI9A 2V4HC 4C0EA 4OVVA 1TYQG 5ENQD 3TWVA 1WAO1 4B8CB 4K5AB 2XRZA 1X81A 5KNHD 4L1BA 2WXLA 3B7SA 2LSVA 4HS2A 3T5VA 5B1AE 2VSYA 2XCBA 3HXDA 2AXZA 2H6IA 2ZGGA 3EIQC 3CK9A 3L16A 2WMOA 1AP7A 2DYSE 3ASFA 4PH4B 1HX8A 5FT9A 3SFYA 4HNAD 4J6IA 4G8LA 4BWRA 2AJAA 5B3SE 5EX0A 3ULYA 3D9MA 4BETA 5CHEE 2IQCA 3FP3A 3SFZA 3HXCA 2BF0X 3GW4A 3AS8A 1OWNA 4DLOA 2M63A 2JLBA 2XRYA 2ZIRA 2AWIA 1FPPA 4NIKA 3L13A 4HLLA 4NACA 4EBAG 1JPLA 2KATA 5CCMA 3FTWA 4BSZB 4GZ5A 2X6IA 4UWLA 1D8DA 3LJNA 2KCVA 3O48A 3ISMC 1YYHA 4N5QA 2PQNA 3Q7FA 5LP0A 2IU1A 4CDNA 5CMYA 4AY6A 4I43A 3CVYA 4G23A 4WWNA 4GA0A 2RG8A 4FJZA 5G05C 1OY3D 5E75A 5BW8C 4BY6A 2Y1LE 3FY4A 3NZSA 2J09A 1FT1A 3DRAA 3F6QA 3SFXA 4HOQA 3RRUA 2FF4A 2E2EA 1NFIE 1SQMA 4G26A 4GAAA 4N2QA 4JHRA 1HU3A 4U0UA 4DX5D 2ZU6B 4TV3A 2GROB 4U63A 3ZHEA 2PM7A 3Q7AA 3FU6A 4CCAA 4KXKB 3C3RA 5JA4D 3LJ3A 2VTBB 2L6JA 1LF8A 4V3IA 4HOSA 3RK6A 2X6FA 3LEWA 3PS6A 1SA4A 2PQRA 3NB2A 4GZ6A 2I9CA 2BUGA 3UPVA 2RFMA 4U8VD 3RRMB 3R7QA 4WWPA 3T8MA 3HHMA 4FADA 5ARFA 3FU3A 3G2UA 3CHMA 1INZA 4U95D 5CCLA 2DZNA 1S64A 2GRPB 1OCCE 4L7TA 5AQ9A 3UUXA 4GPMA 4QFVA 1KLXA 3TG5A 3CVNA 3QNKA 4XKBA 3B7BA 2H6FA 1NP7A 3UKUG 2FULA 4CGVA 1SVXA 3J5PA 4I6EA 2ZGDA 1JWGA 4AV7A 4GCOA 2V5QC 4HRLA 5FZQA 5A23A 2XS1A 5FWQA 4UQXA 4J8SA 1DCEA 4EBAA 5FQ8A 1HG2A 3KSQA 4UQYA 2ETCA 2WXKA 5EYPF 4FLHA 3QDNA 3UINC 3OXLA 4HVBA 3LDZA 2FI7A 2NYJA 1NA0A 3E33A 4YNDA 2JEKA 2XGOA 2BTDA 4Q94A 3CQCB 3CVWA 3Q75A 2PZIA 3ZYQA 3UIPC 4DI3A 3OAWA 3E4BA 4G8KA 3ASGA 4F1PA 3QC1A 4L2YA 3HXBA 2RKKA 4OYSA 2OVFA 4NURA 3NZUA 3APFA 1HZ4A 3SGHA 4JA9A 3FUNA 4JVSA 2DIWA 1HG5A 2BKGA 2RFAA 2DVWA 4HB5A 5LX8A 5T3RA 4LUNU 2H6GA 2WQ6A 1WM5A 1PC2A 2OV8A 4CRWA 3UMVA 3IHYA 2YINA 4MLPA 4ATZD 3APCA 5AAOA 3OXFA 5FTPA 3AG4E 2CHWA 3TG4A 3S7JA 1YA0A 1X5BA 4GMRA 2OVBA 4BX9A 3S7DA 1N4PA 3RIBA 3G2VA 5HKPA 1S63A 1B89A 1N95A 1ZBPA 1S70B 3MZLB 3Q9UC 3BU8A 4PDXA 4OVUA 1JCRA 1SZAA 3SNXA 3SO8A 2ETBA 1LD8A 3CV0A 3ZUVB 5BUZA 3ZKJA 4N3BA 2IY0C 2IO3C 5JJ7A 3PVLA 5M72A 4ILIA 4D10C 3P2BA 3FULA 1E8WA 1HH8A 3G2TA 3ULQA 4ANXA 3IBEA 5AQ7A 2A5UA 1SW6A 4ABNA 3J5QB 3LVQE 3V30A 2KCKA 4A3VA 3JXJA 3C98A 5ENRD 5AIJA 3JCKC 1MX2A 1HXIA 3CVQA 2QY7A 2DZOA 3Q15A 3RJVA 4H7YA 4I2ZA 2LSUA 4JEUA 1E8ZA 3D3MA 3FTZA 3CVUA 3B7UX 1NA3A 1IXVA 4GU5A 4CZ2D 4AIFA 3V79K 3JQ1A 3MJWA 1JUQA 1WDYA 4UUCA 2XEHA 2XPIA 3FTUA 3DSXA 4XX5A 2VJ8A 3SQVA 3SI5A 1IQUA 3NOCD 3FU5A 3V2OA 4UWHA 3N71A 4J7WA 3FFLA 3T5XA 3D9OA 4ANUA 3ZYKA 2XEVA 2F8YA 3T8KA 5CBNA 3ASOE 2Y4UA 1LD7A 4IN3B 2OEWA 4BT9A 2WXGA 4B94A 4XI0A 3UM1A 4A1GA 3CEQA 3GZSA 1N4RA 2A5EA 3HG0D 4I9EA 3UQ3A 4PUCA 2KC7A 3HXEA
chains in the Genus database with same CATH topology
4U8VD 4BERA 4O60A 3AJIA 5EIBE 3JUEA 4LNUD 4A63B 3UXGA 2F8XK 2Y0BG 1YMPA 5ENOD 4HI8A 2BKGA 3HRAA 3JXJA 2RFAA 2XEEA 4HRMB 4HRNA 5ENRD 2DVWA 4HB5A 4NIKA 5FINA 3TWSA 1DC2A 3TWTA 1MX2A 4HLLA 4Z68A 4U95D 3TWXA 2DZOA 2DZNA 3DEPA 4BSZB 5CEAA 3B95A 3ZU7B 1OT8A 5AQ9A 2DWZA 5ENSD 2HE0A 1K1BA 3LJNA 3V2XA 1YYHA 2MYOA 3EHQA 4GPMA 4N5QA 4QFVA 4ATZD 4F6RD 5AAOA 3TWRA 1IXVA 3B7BA 2J8SD 2V4HC 4CZ2D 3W9FA 5CEDB 5ENTD 5HRYA 5ENQD 3TWVA 3W9GA 5D66A 2JABA 1DCQA 1MX4A 3V79K 4K5AB 4O1PA 1G3NB 4HBDA 4JB8P 3UTMA 4BESA 5BXOA 1WDYA 4UUCA 5KNHD 2PNNA 2XEHA 4GMRA 1MYOA 5HS0A 1SVXA 2P2CP 3J5PA 3Q9NC 4K5BA 2ZGDA 4K5CA 1OY3D 5EILA 5HKPA 4DX2A 5CBOA 1TR4A 3UI2A 1S70B 2Y1LE 2F37A 2XZTG 2V5QC 5BXUA 4HRLA 3KEAA 3Q9UC 4ZHBA 5CERB 2BKKB 4DRXE 2ZGGA 1UOHA 3F6QA 5EIDA 3NOCD 4OAUC 5KWDA 5AQBA 3D9HA 3V31A 1BI7B 1IHBA 1NFIE 3EHRA 3NOGD 2ETBA 3SO8A 3V2OA 3C5RA 2L6BA 3IXEA 4J7WA 4LG6A 5ENPD 2QC9A 4U96D 5KNGA 2ETCA 4QQIA 1YCSB 5EYPF 4ZFHA 4DX7D 4HQDA 3ZUVB 3JXIA 1AP7A 1WG0A 4DX5D 2F8YA 3T8KA 3ZKJA 2KXPC 4DX6D 2FO1E 3EU9A 5CBNA 5KBAA 1MJ0A 4TUMA 5EYLA 2NYJA 4HI9A 1MX6A 3AAAC 1N11A 4LSZE 2KBXA 5JA4D 4J8YA 4BEPA 4C48B 4RLYA 5ITZF 1AWCB 2ETAA 1BU9A 3DEOA 3NBNB 5EN5D 4HNAD 1A5EA 2VGEA 4CYMD 1N0QA 4U8YD 2XENA 4G8LA 4DX1A 4YDYA 2AJAA 1BLXB 2B0OE 1D9SA 4G8KA 4BETA 1QYMA 4F1PA 1K1AA 4YDWA 3TWQA 2A5EA 1N0RA 5FIOA 1IKND 1BD8A 4B93B 3TWWA 3HG0D 4DUIA 5CECB 5AQ7A 4OAVB 5JMND 5AN8A 1BI8B 1SW6A 1K3ZD 3T9KA 3J5QB 3ZNGA 5AARA 4O1OA 5AQAA 2RFMA 2XZDG 3V30A 3TWUA 2QYJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U8V D;  4BER A;  4O60 A;  3AJI A;  5EIB E;  3JUE A;  4LNU D;  4A63 B;  3UXG A;  2F8X K;  2Y0B G;  1YMP A;  5ENO D;  4HI8 A;  2BKG A;  3HRA A;  3JXJ A;  2RFA A;  2XEE A;  4HRM B;  4HRN A;  5ENR D;  2DVW A;  4HB5 A;  4NIK A;  5FIN A;  3TWS A;  1DC2 A;  3TWT A;  1MX2 A;  4HLL A;  4Z68 A;  4U95 D;  3TWX A;  2DZO A;  2DZN A;  3DEP A;  4BSZ B;  5CEA A;  3B95 A;  3ZU7 B;  1OT8 A;  5AQ9 A;  2DWZ A;  5ENS D;  2HE0 A;  1K1B A;  3LJN A;  3V2X A;  1YYH A;  2MYO A;  3EHQ A;  4GPM A;  4N5Q A;  4QFV A;  4ATZ D;  4F6R D;  5AAO A;  3TWR A;  1IXV A;  3B7B A;  2J8S D;  2V4H C;  4CZ2 D;  3W9F A;  5CED B;  5ENT D;  5HRY A;  5ENQ D;  3TWV A;  3W9G A;  5D66 A;  2JAB A;  1DCQ A;  1MX4 A;  3V79 K;  4K5A B;  4O1P A;  1G3N B;  4HBD A;  4JB8 P;  3UTM A;  4BES A;  5BXO A;  1WDY A;  4UUC A;  5KNH D;  2PNN A;  2XEH A;  4GMR A;  1MYO A;  5HS0 A;  1SVX A;  2P2C P;  3J5P A;  3Q9N C;  4K5B A;  2ZGD A;  4K5C A;  1OY3 D;  5EIL A;  5HKP A;  4DX2 A;  5CBO A;  1TR4 A;  3UI2 A;  1S70 B;  2Y1L E;  2F37 A;  2XZT G;  2V5Q C;  5BXU A;  4HRL A;  3KEA A;  3Q9U C;  4ZHB A;  5CER B;  2BKK B;  4DRX E;  2ZGG A;  1UOH A;  3F6Q A;  5EID A;  3NOC D;  4OAU C;  5KWD A;  5AQB A;  3D9H A;  3V31 A;  1BI7 B;  1IHB A;  1NFI E;  3EHR A;  3NOG D;  2ETB A;  3SO8 A;  3V2O A;  3C5R A;  2L6B A;  3IXE A;  4J7W A;  4LG6 A;  5ENP D;  2QC9 A;  4U96 D;  5KNG A;  2ETC A;  4QQI A;  1YCS B;  5EYP F;  4ZFH A;  4DX7 D;  4HQD A;  3ZUV B;  3JXI A;  1AP7 A;  1WG0 A;  4DX5 D;  2F8Y A;  3T8K A;  3ZKJ A;  2KXP C;  4DX6 D;  2FO1 E;  3EU9 A;  5CBN A;  5KBA A;  1MJ0 A;  4TUM A;  5EYL A;  2NYJ A;  4HI9 A;  1MX6 A;  3AAA C;  1N11 A;  4LSZ E;  2KBX A;  5JA4 D;  4J8Y A;  4BEP A;  4C48 B;  4RLY A;  5ITZ F;  1AWC B;  2ETA A;  1BU9 A;  3DEO A;  3NBN B;  5EN5 D;  4HNA D;  1A5E A;  2VGE A;  4CYM D;  1N0Q A;  4U8Y D;  2XEN A;  4G8L A;  4DX1 A;  4YDY A;  2AJA A;  1BLX B;  2B0O E;  1D9S A;  4G8K A;  4BET A;  1QYM A;  4F1P A;  1K1A A;  4YDW A;  3TWQ A;  2A5E A;  1N0R A;  5FIO A;  1IKN D;  1BD8 A;  4B93 B;  3TWW A;  3HG0 D;  4DUI A;  5CEC B;  5AQ7 A;  4OAV B;  5JMN D;  5AN8 A;  1BI8 B;  1SW6 A;  1K3Z D;  3T9K A;  3J5Q B;  3ZNG A;  5AAR A;  4O1O A;  5AQA A;  2RFM A;  2XZD G;  3V30 A;  3TWU A;  2QYJ A; 
#chains in the Genus database with same CATH topology
 3QAR A;  2L0I A;  3LYA A;  3UXG A;  3URZ A;  1KT0 A;  3MKR A;  2AVP A;  2WXP A;  4URK A;  4HFG A;  1U3D A;  1DC2 A;  1HS6 A;  2NC9 A;  1U2V G;  2KZT A;  3GYZ A;  1XNF A;  1ZU2 A;  3C3Q A;  2DWZ A;  3D9L A;  4GTV A;  4YVO A;  5T4Y A;  3ABK E;  2X6H A;  5D66 A;  1MX4 A;  4H7X A;  4XZ4 A;  3RRN B;  5BXO A;  1Z6T A;  4TXR A;  5KJL A;  3FDH A;  5LCW C;  3CK8 A;  3ML8 A;  3MX3 A;  4ATG A;  1FT2 A;  3LCA A;  5KJM A;  4DRX E;  3SD5 A;  3WG7 E;  1TNZ A;  5G55 A;  3D9H A;  1OCO E;  1O5M A;  3EHR A;  3L22 A;  4Y6C A;  2QC9 A;  4F3V A;  3LXU X;  4UI9 K;  1O1S A;  4HOR A;  1KPS B;  3EU5 A;  3Q79 A;  2DYR E;  4CT0 A;  3MYV A;  1ZB1 A;  2C0M A;  4EZL A;  4J8Y A;  4BEP A;  2VGX A;  3CVX A;  3DST A;  1A5E A;  1E90 A;  5AJL A;  3DSV A;  2I6H A;  4AVX A;  2IOS A;  1D9S A;  2J07 A;  4M3O A;  3ZYM A;  2VSN A;  2XCC A;  3CVV A;  1BI8 B;  4RSY A;  3APD A;  2WM9 A;  3ZRH A;  5CRV A;  4DK5 A;  1TNY A;  1OCZ E;  3PRZ A;  2OOE A;  4GTM A;  2A4Z A;  1TN7 A;  2GRN B;  5FIN A;  2R02 A;  2V5F A;  3ZW3 A;  2AW6 A;  5G04 J;  3PUJ A;  3UX4 A;  4G24 A;  3EUV A;  4FUL A;  3PZD A;  2CFU A;  3V2X A;  4U07 A;  2R03 A;  1E7U A;  4IUL A;  3BUA A;  4BTA A;  2VGY A;  5FZR A;  5HI7 A;  2X6K A;  1QQE A;  4HBD A;  3DPD A;  1H2U A;  2P2C P;  5EDS A;  2CHX A;  2BED A;  1TR4 A;  1TNO A;  1VDY A;  2WXI A;  3AS5 A;  5BXU A;  4L2L A;  3CHS A;  4IYP A;  3HDX A;  3SF4 A;  3DSU A;  3NOG D;  2XQ0 A;  1TJC A;  4LG6 A;  1EF1 C;  2P9I G;  2XPY A;  4U96 D;  1SZ9 A;  1KT1 A;  3ZVV A;  5JHB A;  3NF1 A;  2LNI A;  4DX6 D;  4YDE A;  4TUM A;  3IV0 A;  4B8A A;  3S7F A;  4KMO A;  5EN5 D;  2R2L A;  5C1D A;  4YDY A;  1ELK A;  1ELW A;  4YDW A;  1UN8 A;  4E6H A;  4WND A;  1IKN D;  3Q73 A;  2IF4 A;  4O6F A;  2P9P G;  3R9A B;  5IY5 E;  4C0M A;  4J8F A;  5AAR A;  3ZXP A;  2XZD G;  2WXQ A;  3LY7 A;  3FH5 A;  2WQ7 A;  2Y0B G;  2EIJ E;  1L5J A;  3KSL A;  3JUI A;  1HO8 A;  4XIF A;  2WXM A;  1IYG A;  2B6C A;  4RG6 A;  3ZXS A;  3CHQ A;  3UM2 A;  3U3W A;  5D0Q D;  4GYO A;  1K1B A;  3FTS A;  3R9M A;  1ELR A;  4ILG A;  3TWR A;  4PS8 A;  3FTY A;  4ILH B;  4I17 A;  3AG3 E;  4JC8 A;  4KT6 B;  3W9G A;  4O1P A;  3UTM A;  4JB8 P;  4UWG A;  1E8X A;  2WXO A;  4TXQ A;  1EPU A;  3KEA A;  2BKK B;  2J4D A;  3B7R L;  2GRL A;  3PEU B;  5AQB A;  4A1S A;  4LRZ A;  2L6B A;  2H6H A;  2NXP A;  4FA6 A;  2MOW A;  1NI1 A;  2QZA A;  1MJ0 A;  2KZT B;  3DSW A;  4A55 A;  4GTR A;  1KZO A;  4LSZ E;  1OWM A;  1XGW A;  2ETA A;  3DBS A;  2VSX E;  4U8Y D;  3SZ7 A;  1BLX B;  3UT7 A;  3UIO C;  1N0R A;  3E34 A;  1S0P A;  3E37 A;  5G05 J;  1PY1 A;  3JQ0 A;  4JZY A;  1MQS A;  3ZNG A;  5AEN A;  3U66 A;  2ZIS A;  4JL0 A;  2AXU A;  4LCT A;  3IKO B;  4JHJ A;  1H2T C;  4LNG A;  4UI9 C;  4HRN A;  3QAQ A;  3PRE A;  3TWS A;  3FH8 A;  2VYI A;  3FUF A;  4Q69 A;  4HLE A;  4R7L A;  3ASD A;  2I2O A;  3PNL B;  4EZJ A;  3QJZ A;  4DJA A;  1TNU A;  3QOU A;  4BSX A;  4GTO A;  4BX8 A;  2NSZ A;  3EHM A;  2R17 C;  4AY5 A;  3ASH A;  3ONL A;  2VGX B;  4KZ0 A;  4BES A;  5A6C A;  4OAU C;  1QNF A;  5AYW D;  5JJT A;  3Q9N C;  3ZGQ A;  1OWP A;  1N54 A;  4FLB A;  5CER B;  3PZ2 A;  5BPP A;  4GMJ A;  1WY6 A;  4X8Q A;  3IXE A;  4WWO A;  3ESK A;  1MZC A;  2XGM A;  3AG2 E;  2E0I A;  2KXP C;  3DWL G;  5KBA A;  5EYL A;  4HI9 A;  3AAA C;  3PEV B;  3PZ4 A;  1E96 B;  4CEM A;  1UJK A;  2WQH A;  4HXI A;  3ZN3 A;  4C9B B;  3RSE G;  3MV2 B;  4DX1 A;  5LOZ A;  1Y8M A;  1K1A A;  5LFA A;  2HYZ A;  5G2N A;  1Q2Z A;  3L82 A;  4DUI A;  3CQG B;  2UY1 A;  5J08 A;  2J4B A;  3T9K A;  2OND A;  2QYJ A;  3RKV A;  5AJD A;  1YMP A;  1N4S A;  2V0P A;  4I6G A;  2XEE A;  2MRI A;  1FCH A;  3UM0 A;  4JA7 A;  4KVO A;  3PH0 C;  2GRM A;  4Z68 A;  3MKQ A;  5FQ6 A;  3I3N A;  1RZ4 A;  5ENN A;  2YHC A;  4GZD A;  3S2A A;  4GTS A;  2MYO A;  1JCQ A;  2Y69 E;  4K03 A;  1HE8 A;  3FUK A;  3FUE A;  3CR3 A;  3CK7 A;  3OTN A;  4K5B A;  3QWW A;  4GML A;  5CBO A;  3RU0 A;  3FWV A;  3ZEF A;  1UOH A;  1H2V C;  3AS4 A;  1N52 A;  5KWD A;  4JXT A;  2CG2 A;  5DIZ A;  2P9S G;  1MHQ A;  5T8I A;  2FO1 E;  2LUH A;  1N4Q A;  2MHK A;  1E7V A;  4WUY A;  1N11 A;  1H6O A;  4AP2 A;  2YQ8 A;  1AWC B;  2GGF A;  3FTV A;  3RAU A;  5BT1 A;  1EYH A;  1IHG A;  3TWQ A;  2XGS A;  4ACL A;  3CIA A;  3ENE A;  3I4R B;  3MCX A;  2OEV A;  4BER A;  4KZC A;  5ANR A;  3KD7 A;  3JUE A;  1LTX A;  2WXN A;  3G2S A;  2GW1 A;  1OXJ A;  5ANL A;  3EDT B;  3UT8 A;  3TWX A;  2L0T B;  5EKQ D;  3CLJ A;  2XS8 A;  3CHP A;  3UT4 A;  4G2V A;  4G11 A;  4J8E A;  3EJN A;  2WMN A;  1D8E A;  2J49 A;  4JD2 G;  4I1M A;  4ANV A;  3IEG A;  3RO2 A;  2C0L A;  1OWO A;  4XEI G;  5HS0 A;  3IHV A;  1SA5 A;  2P9L G;  4U8H A;  4LNB A;  4ZHB A;  4PS7 A;  2P58 C;  4TXP A;  1NZN A;  3C5R A;  3FHE A;  4JPS A;  4EEC A;  3JXI A;  2FEZ A;  4AEZ C;  5FQ4 A;  4RLY A;  5ITZ F;  1FVH A;  3TL5 A;  4LEU A;  3ONK A;  4P29 A;  1HFA A;  1K8K G;  4K0R A;  3U64 A;  2XEN A;  3QWV A;  4F7A A;  2L9B A;  1QYM A;  4UWK A;  1BD8 A;  5JJ6 A;  4I2W A;  4B93 B;  3D9P A;  5JMN D;  3OXG A;  3FTX A;  4A3T A;  5J90 A;  1U3C A;  1HF8 A;  4HOU A;  3PZ1 A;  4A63 B;  2WXH A;  4HI8 A;  3L6A A;  3HRA A;  2XPZ A;  4GTQ A;  5A7D B;  4RQI A;  4KVM A;  3DXM G;  4CT4 A;  2LXM A;  4YVQ C;  4RG9 A;  5CEA A;  2EQX A;  3ZU7 B;  2YNQ A;  4GTT A;  3R7R A;  4GTP A;  3EHQ A;  3CHO A;  4GYW A;  2WVI A;  4JHK A;  1N9A A;  2J8S D;  3CGH A;  3TAX A;  4U0Z A;  4F53 A;  1FVF A;  1V54 E;  3Q47 B;  4MBG A;  5EIL A;  2UWJ G;  2AXV A;  2F37 A;  2UY1 B;  2QYU A;  5EID A;  2EIK E;  2ILR A;  1BPO A;  1IHB A;  4QQI A;  1YCS B;  4ZFH A;  4DX7 D;  1JWF A;  3TGO A;  3MKQ B;  4N39 A;  1OCR E;  4RVB A;  4N3A A;  5EX3 A;  4C48 B;  2J9Q A;  3L9T A;  4GPK A;  3CST A;  4CYM D;  4N5C A;  4KBQ A;  4AM9 A;  5JHA A;  2PL2 A;  1KZP A;  4APO A;  3HYM B;  2YHE A;  4FHK A;  4JW1 A;  4NQ0 A;  4OAV B;  1TN6 A;  5AN8 A;  1K3Z D;  5LCW J;  3HIZ A;  4U0S A;  3PE3 A;  2Y3A A;  3TWU A;  3FU0 A;  1O1T A;  4GZC A;  5ENO D;  3ML9 A;  4I1O B;  2Y4T A;  1UW4 B;  1OWL A;  3KAE A;  3L08 A;  2P9K G;  2V8S E;  5KJN A;  1H6P A;  4L23 A;  5HRY A;  3SY2 A;  1UG3 A;  2JAB A;  3LY9 A;  3SHF A;  3ESL A;  4UWF A;  3FH7 A;  4W9R A;  3V31 A;  3PNT B;  3BG1 B;  3LVR E;  4WNF A;  4HQD A;  3CHR A;  2WXJ A;  5BNW A;  1MX6 A;  3CVL A;  4NRH B;  4CGW A;  3DEO A;  3FEY A;  2VGE A;  2IOL A;  3E30 A;  2LO6 A;  4KYO B;  1N94 A;  2CFZ A;  1DNP A;  4HOT A;  4TRQ A;  3CSF A;  4ME2 A;  1TN8 A;  2I1J A;  3HXF A;  4G25 A;  5HQ8 A;  2WXR A;  3AJI A;  3D9K A;  2OCC E;  4FHJ A;  1H19 A;  3VLE A;  3HVE A;  3U9W A;  3FUM A;  4WNE A;  3TWT A;  4FU3 A;  3EHN A;  2HO1 A;  3AU4 A;  4J8D A;  4GCN A;  3LY8 A;  4B0Z A;  3B95 A;  1OT8 A;  4FJY A;  3NAW A;  3X2Q E;  1NL4 A;  5KJK A;  5KCM A;  4EZK A;  2PM6 A;  5CED B;  1H0A A;  5ENT D;  3EIJ A;  3ZYL A;  4WNG A;  5DBK A;  1G3N B;  2QFC A;  3FUI A;  2PNN A;  5FZS A;  1Y6I A;  1TEZ A;  1P5Q A;  3K9I A;  3AU5 A;  3FUD A;  3Q5M A;  3FUH A;  3G2W A;  3ZFW A;  4U04 A;  4ANW A;  4AXH A;  2GRQ B;  3C72 A;  5KNG A;  4N2S A;  4E85 A;  3GZ1 A;  2LAH A;  1WG0 A;  3TXN A;  3ULE G;  3EU9 A;  4MRU A;  4J0U A;  4BFR A;  3DPY A;  5FQ7 A;  3PZ3 A;  1PAQ A;  1A17 A;  3NBN B;  3C3O A;  4DPR A;  1N0Q A;  2EIN E;  1O1R A;  2B0O E;  3CKB A;  2I1K A;  4ACK A;  4BTB A;  4IRU A;  1UN9 A;  3P1U A;  4MKT A;  3TWW A;  3ZPJ A;  3VTY A;  2IJG X;  3S7B A;  1TNB A;  1GW6 A;  1QZ2 A;  4O1O A;  4B89 A;  4LER A;  3QKY A;  3CVP A;  2EIL E;  2HM8 A;  2R59 A;  4HRM B;  1E8Y A;  3L17 A;  3TJP A;  3DEP A;  4I6J A;  5ENS D;  3QB2 A;  3D9J A;  2EIM E;  3LPZ A;  3SBS A;  3DSS A;  5B1B E;  3ASN E;  2R5S A;  1MYO A;  2CG3 A;  2FBN A;  4K5C A;  5H7P A;  3UI2 A;  2ION A;  2J08 A;  2KCL A;  2C2L A;  2DCP A;  4TUU A;  3SBT B;  2LAI A;  1UJJ A;  5ENP D;  3PE4 A;  4UI9 J;  3I5P A;  3O4Z A;  2LXL A;  4EQF A;  1EDU A;  3QK0 A;  5D2M C;  5CRU A;  2XHE A;  2KM4 A;  1H6K A;  4I1A A;  2X38 A;  4PS3 A;  4JEH A;  4U7E B;  5E76 A;  3JYS A;  4FP7 A;  4GA2 A;  3PUK A;  5D0O D;  5BV1 A;  4AOF A;  5FIO A;  3QWP A;  3RO3 A;  5CEC B;  2R05 A;  2WXF A;  3ABM E;  2V4L A;  3VLF A;  2IEJ A;  3ZHE B;  5AQA A;  4CDM A;  4O60 A;  5EIB E;  2F8X K;  3BQO A;  5CMW A;  4DLQ A;  3MA5 A;  4M7C A;  3B13 A;  3I4G A;  3D9I A;  3UKR G;  1QBQ A;  3MV3 B;  2Q7F A;  3TXM A;  4GYY A;  4FC8 A;  1TJF A;  4XKC A;  3NQP A;  2VTB A;  3ABL E;  4I9C A;  3B7T A;  2IO2 C;  3BG0 B;  3W9F A;  3MGB A;  1DCQ A;  3VLD A;  3LKU A;  3LS8 A;  4EPZ A;  3Q4A B;  4DX2 A;  1JCS A;  4WAF A;  2XZT G;  3KS2 A;  2HR2 A;  3Q49 B;  5ARG A;  4Y6W A;  4UQZ A;  4MS6 A;  3Q78 A;  3PDN A;  1BI7 B;  3MEK A;  3E32 A;  4GA1 A;  3WXX A;  1RW2 A;  1Z5S C;  3FEX A;  3FUJ A;  1W3B A;  3U4T A;  3HVE B;  5G04 C;  4EHM A;  4XE0 A;  2FO7 A;  4GB9 A;  2WB2 A;  3UM3 A;  1DVP A;  3CKC A;  2VSO E;  1OUV A;  4GZ3 A;  5BV0 A;  2KBX A;  3L54 A;  3GZ2 A;  3AG1 E;  1IQR A;  4L9P A;  1BU9 A;  4BT8 A;  4F1S A;  3DXK G;  2P9U G;  3VTX A;  2CHZ A;  4DI4 A;  3KEZ A;  2DBA A;  5FJY A;  2X6J A;  4YDO A;  3ZIM A;  4AJW A;  4CDR A;  2GRR B;  1V55 E;  5C2Y A;  4APF A;  2ZXW E;  4LNU D;  2RD0 A;  3D9N A;  4G1T A;  2IFU A;  2X3M A;  4Q96 A;  2P9N G;  2F0Y A;  2WPV A;  1Z3Y A;  2VQ2 A;  3BEE A;  4N3C A;  2HE0 A;  1Z3X A;  4F6R D;  4XI9 A;  2V4H C;  4C0E A;  4OVV A;  1TYQ G;  5ENQ D;  3TWV A;  1WAO 1;  4B8C B;  4K5A B;  2XRZ A;  1X81 A;  5KNH D;  4L1B A;  2WXL A;  3B7S A;  2LSV A;  4HS2 A;  3T5V A;  5B1A E;  2VSY A;  2XCB A;  3HXD A;  2AXZ A;  2H6I A;  2ZGG A;  3EIQ C;  3CK9 A;  3L16 A;  2WMO A;  1AP7 A;  2DYS E;  3ASF A;  4PH4 B;  1HX8 A;  5FT9 A;  3SFY A;  4HNA D;  4J6I A;  4G8L A;  4BWR A;  2AJA A;  5B3S E;  5EX0 A;  3ULY A;  3D9M A;  4BET A;  5CHE E;  2IQC A;  3FP3 A;  3SFZ A;  3HXC A;  2BF0 X;  3GW4 A;  3AS8 A;  1OWN A;  4DLO A;  2M63 A;  2JLB A;  2XRY A;  2ZIR A;  2AWI A;  1FPP A;  4NIK A;  3L13 A;  4HLL A;  4NAC A;  4EBA G;  1JPL A;  2KAT A;  5CCM A;  3FTW A;  4BSZ B;  4GZ5 A;  2X6I A;  4UWL A;  1D8D A;  3LJN A;  2KCV A;  3O48 A;  3ISM C;  1YYH A;  4N5Q A;  2PQN A;  3Q7F A;  5LP0 A;  2IU1 A;  4CDN A;  5CMY A;  4AY6 A;  4I43 A;  3CVY A;  4G23 A;  4WWN A;  4GA0 A;  2RG8 A;  4FJZ A;  5G05 C;  1OY3 D;  5E75 A;  5BW8 C;  4BY6 A;  2Y1L E;  3FY4 A;  3NZS A;  2J09 A;  1FT1 A;  3DRA A;  3F6Q A;  3SFX A;  4HOQ A;  3RRU A;  2FF4 A;  2E2E A;  1NFI E;  1SQM A;  4G26 A;  4GAA A;  4N2Q A;  4JHR A;  1HU3 A;  4U0U A;  4DX5 D;  2ZU6 B;  4TV3 A;  2GRO B;  4U63 A;  3ZHE A;  2PM7 A;  3Q7A A;  3FU6 A;  4CCA A;  4KXK B;  3C3R A;  5JA4 D;  3LJ3 A;  2VTB B;  2L6J A;  1LF8 A;  4V3I A;  4HOS A;  3RK6 A;  2X6F A;  3LEW A;  3PS6 A;  1SA4 A;  2PQR A;  3NB2 A;  4GZ6 A;  2I9C A;  2BUG A;  3UPV A;  2RFM A;  4U8V D;  3RRM B;  3R7Q A;  4WWP A;  3T8M A;  3HHM A;  4FAD A;  5ARF A;  3FU3 A;  3G2U A;  3CHM A;  1INZ A;  4U95 D;  5CCL A;  2DZN A;  1S64 A;  2GRP B;  1OCC E;  4L7T A;  5AQ9 A;  3UUX A;  4GPM A;  4QFV A;  1KLX A;  3TG5 A;  3CVN A;  3QNK A;  4XKB A;  3B7B A;  2H6F A;  1NP7 A;  3UKU G;  2FUL A;  4CGV A;  1SVX A;  3J5P A;  4I6E A;  2ZGD A;  1JWG A;  4AV7 A;  4GCO A;  2V5Q C;  4HRL A;  5FZQ A;  5A23 A;  2XS1 A;  5FWQ A;  4UQX A;  4J8S A;  1DCE A;  4EBA A;  5FQ8 A;  1HG2 A;  3KSQ A;  4UQY A;  2ETC A;  2WXK A;  5EYP F;  4FLH A;  3QDN A;  3UIN C;  3OXL A;  4HVB A;  3LDZ A;  2FI7 A;  2NYJ A;  1NA0 A;  3E33 A;  4YND A;  2JEK A;  2XGO A;  2BTD A;  4Q94 A;  3CQC B;  3CVW A;  3Q75 A;  2PZI A;  3ZYQ A;  3UIP C;  4DI3 A;  3OAW A;  3E4B A;  4G8K A;  3ASG A;  4F1P A;  3QC1 A;  4L2Y A;  3HXB A;  2RKK A;  4OYS A;  2OVF A;  4NUR A;  3NZU A;  3APF A;  1HZ4 A;  3SGH A;  4JA9 A;  3FUN A;  4JVS A;  2DIW A;  1HG5 A;  2BKG A;  2RFA A;  2DVW A;  4HB5 A;  5LX8 A;  5T3R A;  4LUN U;  2H6G A;  2WQ6 A;  1WM5 A;  1PC2 A;  2OV8 A;  4CRW A;  3UMV A;  3IHY A;  2YIN A;  4MLP A;  4ATZ D;  3APC A;  5AAO A;  3OXF A;  5FTP A;  3AG4 E;  2CHW A;  3TG4 A;  3S7J A;  1YA0 A;  1X5B A;  4GMR A;  2OVB A;  4BX9 A;  3S7D A;  1N4P A;  3RIB A;  3G2V A;  5HKP A;  1S63 A;  1B89 A;  1N95 A;  1ZBP A;  1S70 B;  3MZL B;  3Q9U C;  3BU8 A;  4PDX A;  4OVU A;  1JCR A;  1SZA A;  3SNX A;  3SO8 A;  2ETB A;  1LD8 A;  3CV0 A;  3ZUV B;  5BUZ A;  3ZKJ A;  4N3B A;  2IY0 C;  2IO3 C;  5JJ7 A;  3PVL A;  5M72 A;  4ILI A;  4D10 C;  3P2B A;  3FUL A;  1E8W A;  1HH8 A;  3G2T A;  3ULQ A;  4ANX A;  3IBE A;  5AQ7 A;  2A5U A;  1SW6 A;  4ABN A;  3J5Q B;  3LVQ E;  3V30 A;  2KCK A;  4A3V A;  3JXJ A;  3C98 A;  5ENR D;  5AIJ A;  3JCK C;  1MX2 A;  1HXI A;  3CVQ A;  2QY7 A;  2DZO A;  3Q15 A;  3RJV A;  4H7Y A;  4I2Z A;  2LSU A;  4JEU A;  1E8Z A;  3D3M A;  3FTZ A;  3CVU A;  3B7U X;  1NA3 A;  1IXV A;  4GU5 A;  4CZ2 D;  4AIF A;  3V79 K;  3JQ1 A;  3MJW A;  1JUQ A;  1WDY A;  4UUC A;  2XEH A;  2XPI A;  3FTU A;  3DSX A;  4XX5 A;  2VJ8 A;  3SQV A;  3SI5 A;  1IQU A;  3NOC D;  3FU5 A;  3V2O A;  4UWH A;  3N71 A;  4J7W A;  3FFL A;  3T5X A;  3D9O A;  4ANU A;  3ZYK A;  2XEV A;  2F8Y A;  3T8K A;  5CBN A;  3ASO E;  2Y4U A;  1LD7 A;  4IN3 B;  2OEW A;  4BT9 A;  2WXG A;  4B94 A;  4XI0 A;  3UM1 A;  4A1G A;  3CEQ A;  3GZS A;  1N4R A;  2A5E A;  3HG0 D;  4I9E A;  3UQ3 A;  4PUC A;  2KC7 A;  3HXE A; 
#chains in the Genus database with same CATH homology
 4U8V D;  4BER A;  4O60 A;  3AJI A;  5EIB E;  3JUE A;  4LNU D;  4A63 B;  3UXG A;  2F8X K;  2Y0B G;  1YMP A;  5ENO D;  4HI8 A;  2BKG A;  3HRA A;  3JXJ A;  2RFA A;  2XEE A;  4HRM B;  4HRN A;  5ENR D;  2DVW A;  4HB5 A;  4NIK A;  5FIN A;  3TWS A;  1DC2 A;  3TWT A;  1MX2 A;  4HLL A;  4Z68 A;  4U95 D;  3TWX A;  2DZO A;  2DZN A;  3DEP A;  4BSZ B;  5CEA A;  3B95 A;  3ZU7 B;  1OT8 A;  5AQ9 A;  2DWZ A;  5ENS D;  2HE0 A;  1K1B A;  3LJN A;  3V2X A;  1YYH A;  2MYO A;  3EHQ A;  4GPM A;  4N5Q A;  4QFV A;  4ATZ D;  4F6R D;  5AAO A;  3TWR A;  1IXV A;  3B7B A;  2J8S D;  2V4H C;  4CZ2 D;  3W9F A;  5CED B;  5ENT D;  5HRY A;  5ENQ D;  3TWV A;  3W9G A;  5D66 A;  2JAB A;  1DCQ A;  1MX4 A;  3V79 K;  4K5A B;  4O1P A;  1G3N B;  4HBD A;  4JB8 P;  3UTM A;  4BES A;  5BXO A;  1WDY A;  4UUC A;  5KNH D;  2PNN A;  2XEH A;  4GMR A;  1MYO A;  5HS0 A;  1SVX A;  2P2C P;  3J5P A;  3Q9N C;  4K5B A;  2ZGD A;  4K5C A;  1OY3 D;  5EIL A;  5HKP A;  4DX2 A;  5CBO A;  1TR4 A;  3UI2 A;  1S70 B;  2Y1L E;  2F37 A;  2XZT G;  2V5Q C;  5BXU A;  4HRL A;  3KEA A;  3Q9U C;  4ZHB A;  5CER B;  2BKK B;  4DRX E;  2ZGG A;  1UOH A;  3F6Q A;  5EID A;  3NOC D;  4OAU C;  5KWD A;  5AQB A;  3D9H A;  3V31 A;  1BI7 B;  1IHB A;  1NFI E;  3EHR A;  3NOG D;  2ETB A;  3SO8 A;  3V2O A;  3C5R A;  2L6B A;  3IXE A;  4J7W A;  4LG6 A;  5ENP D;  2QC9 A;  4U96 D;  5KNG A;  2ETC A;  4QQI A;  1YCS B;  5EYP F;  4ZFH A;  4DX7 D;  4HQD A;  3ZUV B;  3JXI A;  1AP7 A;  1WG0 A;  4DX5 D;  2F8Y A;  3T8K A;  3ZKJ A;  2KXP C;  4DX6 D;  2FO1 E;  3EU9 A;  5CBN A;  5KBA A;  1MJ0 A;  4TUM A;  5EYL A;  2NYJ A;  4HI9 A;  1MX6 A;  3AAA C;  1N11 A;  4LSZ E;  2KBX A;  5JA4 D;  4J8Y A;  4BEP A;  4C48 B;  4RLY A;  5ITZ F;  1AWC B;  2ETA A;  1BU9 A;  3DEO A;  3NBN B;  5EN5 D;  4HNA D;  1A5E A;  2VGE A;  4CYM D;  1N0Q A;  4U8Y D;  2XEN A;  4G8L A;  4DX1 A;  4YDY A;  2AJA A;  1BLX B;  2B0O E;  1D9S A;  4G8K A;  4BET A;  1QYM A;  4F1P A;  1K1A A;  4YDW A;  3TWQ A;  2A5E A;  1N0R A;  5FIO A;  1IKN D;  1BD8 A;  4B93 B;  3TWW A;  3HG0 D;  4DUI A;  5CEC B;  5AQ7 A;  4OAV B;  5JMN D;  5AN8 A;  1BI8 B;  1SW6 A;  1K3Z D;  3T9K A;  3J5Q B;  3ZNG A;  5AAR A;  4O1O A;  5AQA A;  2RFM A;  2XZD G;  3V30 A;  3TWU A;  2QYJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...