3C5RA

Crystal structure of the bard1 ankyrin repeat domain and its functional consequences
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
125
structure length
125
Chain Sequence
PFTNHRGETLLHIASIKGDIPSVEYLLQNGSDPNVKDHAGWTPLHEACNHGHLKVVELLLQHKALVNTTGYQNDSPLHDAAKNGHVDIVKLLLSYGASRNAVNIFGLRPVDYTDDESMKSLLLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords BRCA1-associated RING domain protein 1
publication title Crystal Structure of the BARD1 Ankyrin Repeat Domain and Its Functional Consequences.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 125
sequence length 125
chains with identical sequence B
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2008-02-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00023 Ank Ankyrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 3c5rA00
4O1OA 4ATZD 2XEEA 4BSZB 2PNNA 3DEOA 4CZ2D 5BXOA 5CBNA 3JXIA 4HI8A 1MX6A 5CEAA 1YYHA 4U8YD 4J7WA 1A5EA 2AJAA 3B95A 4G8KA 4A63B 1N11A 4NIKA 3T9KA 1WG0A 3JUEA 4QFVA 5ENPD 5KNGA 1AWCB 1D9SA 4LSZE 5AQ7A 5KNHD 5CERB 5ENSD 2BKGA 4U96D 4YDYA 3NOGD 4DRXE 2RFMA 3F6QA 3UTMA 2FO1E 3Q9NC 4TUMA 2V5QC 5HKPA 4DX6D 4HNAD 1IKND 2QYJA 4HLLA 3ZNGA 2JABA 5EIDA 4OAUC 2KBXA 2MYOA 2ZGGA 1OT8A 2F37A 4N5QA 5BXUA 3V79K 4Z68A 4GMRA 4RLYA 2V4HC 5AQBA 2J8SD 3J5QB 5EN5D 5EYPF 4K5AB 3V2OA 3UXGA 5AAOA 2F8YA 2ETCA 3W9FA 2XZDG 3V30A 2XZTG 1AP7A 2HE0A 3EHQA 3ZUVB 4YDWA 3SO8A 5EYLA 3V31A 5FINA 4ZFHA 2DZNA 4BEPA 1QYMA 1MYOA 5ENRD 4CYMD 2XENA 1N0RA 5EIBE 2DZOA 3ZKJA 5ENTD 2VGEA 4HB5A 5JMND 4HQDA 5KWDA 4LG6A 1SW6A 4F1PA 4HBDA 1MJ0A 2RFAA 3W9GA 3NOCD 4O60A 3AAAC 3JXJA 5D66A 5FIOA 1K3ZD 4B93B 1DCQA 4JB8P 1IHBA 4DUIA 1WDYA 3D9HA 2DVWA 5CEDB 1N0QA 3B7BA 4U95D 3UI2A 2XEHA 2B0OE 3ZU7B 5AARA 4ZHBA 4HRMB 5JA4D 3NBNB 3TWRA 5CBOA 1K1AA 3Q9UC 3DEPA 4GPMA 5ENOD 1BU9A 3HRAA 4LNUD 1MX2A 3LJNA 5AN8A 5AQAA 4QQIA 4DX2A 2L6BA 1G3NB 2QC9A 4J8YA 4DX7D 1S70B 2DWZA 4F6RD 2ZGDA 4BETA 4BESA 3T8KA 2KXPC 1TR4A 4U8VD 2BKKB 3TWWA 5ITZF 3C5RA 4HRNA 1YCSB 4DX5D 5CECB 1MX4A 2ETBA 3HG0D 3J5PA 5EILA 3EHRA 3TWUA 4DX1A 2P2CP 3AJIA 3TWVA 1K1BA 3TWSA 2NYJA 4UUCA 1NFIE 1SVXA 4G8LA 1OY3D 2ETAA 5AQ9A 5HRYA 2F8XK 3EU9A 3TWTA 4HI9A 3TWQA 3IXEA 1BD8A 3TWXA 4BERA 2A5EA 4O1PA 1DC2A 1UOHA 5HS0A 1BI8B 3V2XA 2Y1LE 5KBAA 4HRLA 4K5BA 1YMPA 3KEAA 1BI7B 4K5CA 5ENQD 4OAVB 1IXVA 4C48B 1BLXB 2Y0BG
chains in the Genus database with same CATH superfamily
3EHNA 4DJAA 4AOFA 2VSYA 5CBNA 4N3CA 4J7WA 2WXKA 2WB2A 1WG0A 5KNGA 2HO1A 1QBQA 1IQRA 5FQ6A 3PZ3A 4DRXE 3LS8A 3MGBA 3HVEB 1IKND 2FO7A 4AY5A 2VTBB 2IONA 2KBXA 2ZGGA 5G04J 4Z68A 4J8SA 1PAQA 3MV2B 5AQBA 3HVEA 2I9CA 4CCAA 4BX9A 3BG1B 2R59A 3UXGA 2VTBA 3ZRHA 4LERA 3EIQC 3RRNB 5D0QD 4LEUA 1QNFA 4GTOA 2VGYA 3BG0B 3BU8A 4O60A 3HIZA 1K3ZD 4J6IA 2J4DA 3U3WA 3FTSA 4WWNA 2VSOE 4JZYA 3FUKA 4PS8A 4OVUA 3CVWA 3ZHEB 4B94A 3EHMA 3SBTB 4QQIA 2H6IA 4U8HA 3RJVA 2P9UG 1H6KA 3IBEA 2BKKB 5CMWA 4I6EA 3FULA 4ANXA 4HVBA 4KT6B 4J8DA 2L6JA 3KAEA 1E7UA 1OCZE 2V5FA 5D0OD 1OWNA 3SY2A 3OTNA 2V0PA 4UQYA 5B1BE 2I2OA 4JEUA 4DLQA 3D9KA 1HU3A 3E4BA 5G55A 3U4TA 4GB9A 4G25A 1A5EA 2XGMA 4LNBA 1VDYA 2KZTB 3GZ1A 5CERB 2BKGA 2GRLA 5FZRA 3ZYKA 3B7TA 2DYSE 1EPUA 1Y6IA 1EDUA 5ANLA 4ABNA 3CGHA 3FTVA 3UX4A 2WQ7A 3J5QB 2DIWA 1HO8A 2F8YA 3LKUA 3CQCB 4A55A 2XGOA 4GA2A 4I6JA 1N0RA 4J0UA 3RO2A 3SFXA 4Q96A 3PEVB 4DUIA 1S63A 2MRIA 3O4ZA 2AXUA 3ML9A 5EKQD 3ZU7B 4HRMB 4JEHA 3FEXA 4I9EA 1E8WA 4GPKA 5ITZF 4U0UA 3ML8A 1YCSB 3L16A 2ETBA 3DXMG 2IJGX 2R05A 3HXDA 4MKTA 4M3OA 4H7XA 3ZGQA 5KBAA 5B3SE 3C3QA 3TXNA 2XGSA 4ACKA 3DEOA 4KVOA 1KZOA 2OV8A 4R7LA 2XCBA 3D9MA 1TNYA 4NIKA 1D9SA 3FUHA 5ENSD 3T8MA 2BEDA 2LUHA 2MOWA 3UTMA 2P9SG 2GRMA 4GMJA 1INZA 3R7RA 2ZISA 4J8FA 5BXUA 3KEZA 3ONKA 2J8SD 5EN5D 4F1SA 5AAOA 1PC2A 3Q49B 3ZUVB 3DXKG 2LO6A 3HXFA 3D9LA 3RIBA 3SFZA 5FQ8A 4IRUA 2P9NG 2VYIA 3ABKE 2X6KA 1N0QA 3FTXA 5FWQA 5E76A 5T3RA 3UI2A 3D9PA 4MLPA 2XRYA 2NSZA 3L08A 4FADA 1Z3YA 1G3NB 1N4QA 2CFUA 4EECA 3QK0A 3HG0D 3EHRA 1TN7A 3LCAA 2X38A 3FEYA 3DRAA 3ASDA 3Q73A 4N2QA 2Y1LE 3GZ2A 2LXMA 3Q75A 4CEMA 3C3OA 3TXMA 1LTXA 3OXFA 2AJAA 3RAUA 1FPPA 1K8KG 5AYWD 4E85A 5BUZA 1MZCA 4WNGA 2J4BA 2XPYA 2UY1A 3PREA 3FU5A 2LAHA 4HLLA 4JXTA 2PZIA 2OOEA 2OEWA 3U66A 3Q5MA 5KJKA 5JJ7A 2R03A 4ACLA 2PQRA 4B0ZA 4BT9A 5JHBA 2J07A 5BNWA 3APCA 5IY5E 1H2UA 2HE0A 2J08A 4WNDA 4BEPA 3ZPJA 3MX3A 5CRUA 3LY8A 3QDNA 3QWPA 3PNTB 3ASNE 4LG6A 1SW6A 4HBDA 2IOSA 2HM8A 4BSXA 2EQXA 2H6GA 4B93B 2BTDA 1JCRA 1UW4B 3HXCA 4G2VA 2XEHA 1N4SA 4ZHBA 2KM4A 3L22A 1S0PA 5DIZA 4WUYA 3E32A 1SZ9A 2WXRA 3AS4A 4TXPA 3G2VA 2H6FA 4PS3A 3EDTB 1V54E 5G04C 1E8YA 4DLOA 1TN6A 2KCVA 1SVXA 1OY3D 2ETAA 4DK5A 1EYHA 1OCCE 2Y4UA 1SA5A 3KEAA 1IXVA 3UKRG 3ASFA 4YVQC 3CIAA 3LY7A 3D9JA 1YYHA 3L54A 4GTTA 5BV1A 1RZ4A 2XPZA 4QFVA 5CCLA 1LF8A 1HX8A 3ZXSA 3F6QA 4GMLA 5CMYA 5LP0A 3AU4A 2V8SE 3I4GA 5AIJA 2NXPA 1JWGA 2A4ZA 4IYPA 1OCOE 4NURA 3R9AB 1IHGA 1L5JA 3ZVVA 5EIBE 3L6AA 4HB5A 1SZAA 2A5UA 3ZFWA 4FLHA 1MJ0A 2RFAA 4JL0A 1DCQA 3LEWA 2EIKE 4AJWA 2YHCA 2WXHA 1E96B 4CT0A 1UN8A 3QC1A 3Q9UC 4EBAA 1D8DA 5AN8A 4JHKA 4XKCA 3AG3E 3FUNA 3UM0A 3AG2E 4JA7A 4MRUA 4U63A 2AXZA 3L13A 2NC9A 3Q7AA 2NYJA 3UMVA 3UT4A 2WXIA 2IU1A 3FH7A 1TNBA 3QKYA 4EQFA 3D3MA 1Z6TA 3E30A 3DPYA 3VTYA 4E6HA 4EBAG 1YMPA 1BI7B 3FFLA 4C48B 4CZ2D 2R17C 4XE0A 3FDHA 2HYZA 2R02A 1ELKA 3EJNA 4Y6WA 4I1MA 4WWPA 4MBGA 3UT7A 2FULA 3BUAA 4WWOA 2QYJA 1TNZA 3PZ2A 3MYVA 4FJZA 4RLYA 3V2OA 4FHKA 1O1TA 3W9FA 4KZ0A 1IQUA 4GZ6A 3SO8A 2CG2A 1HFAA 3IHYA 2OVBA 4K0RA 1OWLA 5FQ7A 3AG4E 3D9IA 4F1PA 1KLXA 3Q78A 4HXIA 3JXJA 4EZJA 3FHEA 4JB8P 4XI9A 4KZCA 4BT8A 3NAWA 2VGXB 2X3MA 4BY6A 3DPDA 3LJNA 4JD2G 4CRWA 3TWWA 4HRNA 3JQ0A 2QZAA 1H6OA 2EIME 3PVLA 3VLFA 3Q15A 4I43A 4BWRA 4L23A 3ASHA 3ZXPA 4HRLA 4HOSA 2C0LA 2PNNA 3E37A 4HI8A 1EF1C 3ESLA 3ZHEA 2VSXE 3FWVA 1UJKA 3MCXA 3OXGA 3ZEFA 3RRUA 3BQOA 4DX6D 4D10C 1E7VA 5EIDA 4I2ZA 2L0TB 4WNEA 1E8XA 3I5PA 2X6HA 4KMOA 4J8EA 2I1KA 3WXXA 4N39A 1YA0A 5FINA 3FU3A 2Y69E 4XKBA 1Z5SC 2XENA 2KZTA 3CKCA 3ZYLA 4GAAA 1Q2ZA 3AS8A 5FT9A 4ILHB 3PDNA 4GTSA 3UIPC 2ZU6B 4JPSA 5ANRA 3UM3A 3U64A 4IULA 5FTPA 2LSUA 3GZSA 2P9IG 1U3DA 1QQEA 1FVHA 2KXPC 2IO2C 5EILA 4WAFA 4GTVA 3MA5A 3FP3A 1NFIE 3IEGA 3G2WA 4G8LA 3EU9A 3TWTA 1U2VG 5ENNA 1HF8A 4L9PA 5KCMA 4DX7D 3I4RB 4O1OA 3CVUA 3ZW3A 2LSVA 3UT8A 4U8YD 5G2NA 5KJMA 4KYOB 4ANVA 3NZSA 1AWCB 5AQ7A 2WPVA 3QJZA 2WXFA 5BV0A 3CHMA 5HKPA 4L2YA 4HNAD 5BPPA 5A23A 3PH0C 4FULA 4LNGA 4A1GA 5M72A 2F37A 3NF1A 1TNOA 3RU0A 3S7BA 3PZ4A 2AVPA 4K5AB 3C72A 3CVNA 3NB2A 2KATA 4NRHB 1AP7A 5EYLA 1OWMA 3O48A 1HXIA 1ZBPA 3ZKJA 5KWDA 4M7CA 3PUJA 1RW2A 4RG9A 1TJCA 2R2LA 4RQIA 4AY6A 4LCTA 5ENOD 3AG1E 2WXJA 3DSXA 3TAXA 5AQAA 2L6BA 3UKUG 1JCQA 4EZKA 3MZLB 5LCWC 3E33A 4FC8A 3K9IA 3AJIA 5J90A 3LYAA 4BFRA 4JA9A 1WY6A 3PUKA 3ULEG 3TWQA 3DSSA 4N2SA 1TYQG 2A5EA 3KS2A 5G05J 2GRPB 3ASGA 3JCKC 3CVQA 4C0EA 4FP7A 4UI9J 4AIFA 4UWKA 1JWFA 4I1AA 4U07A 4C0MA 5KJLA 3JXIA 4GZ5A 4CT4A 4AM9A 4V3IA 2XS8A 4G8KA 3B95A 5BT1A 2ZXWE 3G2SA 2FF4A 2LAIA 4GYYA 4TUMA 5C1DA 3SHFA 2MYOA 4GTPA 5FZSA 2Y4TA 4EPZA 4GMRA 2JEKA 5AENA 2IQCA 1O5MA 4HS2A 2V4LA 5BW8C 1FT2A 4ILGA 2LXLA 2CFZA 3FH8A 4ILIA 2WQHA 4CGVA 4HQDA 4PUCA 3TL5A 3FUDA 2PL2A 2EINE 3D9HA 4NACA 3FU6A 5AARA 1N4RA 3TWRA 4GPMA 2HR2A 2XS1A 4NQ0A 2DCPA 4TRQA 3CK8A 2QC9A 4JW1A 1S70B 2WXMA 3T8KA 1KT0A 4L1BA 1Y8MA 4DX1A 3TWVA 5J08A 3LDZA 2LNIA 2GW1A 2WM9A 2E0IA 1OUVA 1BI8B 5FZQA 3CVPA 1HS6A 4IN3B 5ENQD 1N54A 2QFCA 3CSTA 2Y0BG 4KXKB 2H6HA 5CCMA 3G2UA 4O6FA 3MEKA 4GU5A 4EZLA 3MJWA 1N11A 1N94A 3JUEA 3ESKA 1XNFA 3OXLA 1D8EA 3URZA 3ZYMA 1OXJA 4OAUC 5T8IA 1SQMA 5AJLA 5C2YA 3TG4A 3HYMB 1UJJA 1MYOA 4CYMD 3RKVA 3CQGB 3VLDA 5ENTD 1ZB1A 4PDXA 4YNDA 4HLEA 1UN9A 1KT1A 5FIOA 3SBSA 4TXQA 4CDRA 2YNQA 4CDNA 3HXBA 5CBOA 3R7QA 3N71A 4Q69A 5LFAA 1H6PA 4BETA 2F0YA 3AU5A 4U8VD 3QARA 3RK6A 3EIJA 5CECB 2Q7FA 4CDMA 3TWUA 5JHAA 3E34A 4ATGA 5AQ9A 3MKQB 3IXEA 4BERA 3TGOA 3ZN3A 4RSYA 3APFA 4K5BA 4OYSA 2GROB 4UWGA 4G11A 5EX3A 2L0IA 3MKQA 5BXOA 3PE3A 2FBNA 1JUQA 5A7DB 3DSUA 3FUEA 1V55E 4GTQA 4GZCA 3PS6A 1LD7A 3DSWA 1H19A 4ANUA 3CVYA 2BF0X 3QAQA 1TEZA 2XQ0A 3CHSA 2WXPA 1N95A 2RKKA 4RG6A 3HHMA 4TXRA 4GYWA 3BEEA 4JVSA 3S7JA 1PY1A 3EHQA 1QYMA 3SD5A 4I9CA 1X5BA 3RRMB 3SNXA 4FLBA 5CRVA 4HOQA 2P58C 1WDYA 3CKBA 4AEZC 3CVVA 3FTWA 2B0OE 4RVBA 3DWLG 3CVLA 4LNUD 4N5CA 2VQ2A 2RD0A 4F6RD 2ZGDA 4AVXA 4BESA 1TR4A 3B7UX 1E8ZA 4ANWA 4AV7A 3DSVA 5E75A 4JHJA 3IHVA 2P2CP 3UQ3A 4TV3A 2F8XK 3TG5A 2J9QA 1DC2A 1B89A 5HS0A 3WG7E 2WXOA 2B6CA 2P9LG 1HE8A 4ATZD 1H0AA 4LUNU 2VGXA 4N3BA 2J49A 1WAO1 4A63B 4LSZE 3ZYQA 1QZ2A 2XRZA 2WXGA 3Q9NC 2V5QC 2IOLA 2OCCE 3SZ7A 1XGWA 3I3NA 2KCLA 1TNUA 3FUMA 3CHRA 2AWIA 2Y3AA 1JPLA 4CGWA 2V4HC 2XCCA 2JLBA 5D2MC 2XZDG 2XZTG 1Z3XA 3CV0A 3PE4A 4YDWA 4ZFHA 3LVRE 5ENRD 4U7EB 4HOTA 5G05C 1NL4A 3S7FA 4C9BB 3X2QE 3JYSA 5ARGA 4UI9C 3T5VA 3UPVA 3AAAC 3JQ1A 4UWHA 3CHPA 2QY7A 4G24A 2ZIRA 3CEQA 1H2TC 1K1AA 4TUUA 4UWLA 4G23A 1P5QA 4JHRA 2CG3A 2PQNA 2WXLA 3AS5A 1W3BA 3FUJA 2UWJG 3C5RA 4GZDA 1JCSA 3PZ1A 3ZIMA 1A17A 3CSFA 1LD8A 3KD7A 4A3VA 3LXUX 4BTAA 3RSEG 1HG2A 4O1PA 2P9KG 3ULYA 3S2AA 4F3VA 4YDEA 2FEZA 5T4YA 3P2BA 3EUVA 5B1AE 4P29A 5CEAA 2KCKA 2M63A 4A3TA 3DSTA 4LRZA 2OEVA 3B13A 4I6GA 5KNHD 4OVVA 4YDYA 4I17A 2C2LA 2FO1E 2GGFA 4L7TA 5LOZA 3B7SA 1N9AA 3ZNGA 2EILE 3DBSA 5HI7A 4APOA 1OT8A 3C3RA 4UQZA 2X6IA 5EYPF 5H7PA 2ILRA 3G2TA 4GCOA 3V30A 3QB2A 2P9PG 5EX0A 3S7DA 1ELRA 4WNFA 2GRRB 3UM2A 3JUIA 2CHZA 4B89A 3SQVA 2CHWA 1IHBA 4YDOA 3NZUA 3KSQA 2DVWA 2PM6A 5CHEE 1ZU2A 2WXQA 2R5SA 3GW4A 1WM5A 4DX2A 2VSNA 3ABLE 2C0MA 3PZDA 2QYUA 1OWOA 1MHQA 3OAWA 1DCEA 3U9WA 1FCHA 4N3AA 3Q79A 4KBQA 5HRYA 3NQPA 3HXEA 2XHEA 3TWXA 4G26A 1O1RA 3ONLA 4U0ZA 4B8AA 4GA0A 2GRQB 5FQ4A 4HORA 3FY4A 2YQ8A 3QNKA 2WMNA 1OCRE 3ABME 4U04A 1NZNA 3QWVA 4B8CB 3C98A 4URKA 4GTMA 2RG8A 1SA4A 4FHJA 1KPSB 2WVIA 2IO3C 2X6FA 3HDXA 4N5QA 3VTXA 4FJYA 3CK7A 3D9NA 3V31A 4UWFA 1MQSA 3D9OA 5LX8A 2DZOA 2VGEA 1GW6A 3L82A 5JMND 3SF4A 2FI7A 4U0SA 3W9GA 2VJ8A 4DI4A 3Q7FA 3CLJA 5JJ6A 4MS6A 1N52A 1E90A 1NA0A 3B7BA 5JA4D 3NBNB 2IY0C 2PM7A 4H7YA 1BU9A 3HRAA 1DVPA 1MX2A 1OWPA 1NP7A 4J8YA 4Y6CA 2DWZA 3FUFA 1ELWA 4DX5D 2E2EA 2GRNB 3IV0A 1MX4A 4X8QA 5ARFA 2OVFA 1S64A 2UY1B 4I1OB 4KVMA 4UUCA 3P1UA 1O1SA 3VLEA 3MKRA 1DNPA 4AXHA 3APDA 1FT1A 4K5CA 3T5XA 4OAVB 5HQ8A 2YINA 2KC7A 2XEEA 4BSZB 4F53A 2MHKA 3SGHA 4DI3A 3PEUB 1FVFA 3T9KA 4BTBA 4YVOA 3R9MA 3CHOA 3SI5A 4PS7A 3NOGD 2RFMA 4AP2A 4XIFA 1UG3A 2IFUA 3ASOE 4K03A 3CR3A 2XEVA 3FH5A 3V79K 3RO3A 2YHEA 5DBKA 3Q4AB 2ETCA 2ONDA 3UUXA 3B7RL 1BPOA 4UQXA 4XI0A 2DZNA 4UI9K 1H2VC 3SFYA 4PH4B 1IYGA 3UIOC 2J09A 4FA6A 3PNLB 3FTYA 4JC8A 1X81A 2BUGA 3UM1A 2CHXA 4U95D 2WQ6A 3DEPA 3KSLA 2AW6A 3LVQE 2IEJA 3PRZA 4XX5A 3CK9A 4EHMA 3J5PA 3QWWA 3TWSA 3L17A 4FU3A 4APFA 1KZPA 3CHQA 5A6CA 5EDSA 4A1SA 4GYOA 4DPRA 1BD8A 1NI1A 2I6HA 4I2WA 1UOHA 5FJYA 3V2XA 2EIJE 4GA1A 1NA3A 1BLXB 3TJPA 5LCWJ 5JJTA 4BX8A 3UINC 4G1TA 1MX6A 3L9TA 4XZ4A 5ENPD 1HH8A 2I1JA 4U96D 2JABA 3EU5A 5KJNA 4L2LA 3FU0A 3FTUA 1N4PA 2L9BA 4HFGA 4GTRA 2WXNA 2WMOA 4F7AA 3CVXA 2AXVA 3QOUA 3ENEA 2DYRE 3LPZA 3GYZA 3ULQA 4ME2A 3NOCD 4XEIG 5D66A 1U3CA 3LY9A 1TJFA 3Q47B 5CEDB 2IF4A 2X6JA 4W9RA 3LJ3A 1HG5A 4Q94A 3ISMC 2XPIA 3MV3B 3IKOB 3FTZA 1K1BA 4GZ3A 4HOUA 1TN8A 1HZ4A 4HI9A 4GCNA 5AJDA 3FUIA 2DBAA
chains in the Genus database with same CATH topology
4O1OA 4ATZD 2XEEA 4BSZB 2PNNA 3DEOA 4CZ2D 5BXOA 5CBNA 3JXIA 4HI8A 1MX6A 5CEAA 1YYHA 4U8YD 4J7WA 1A5EA 2AJAA 3B95A 4G8KA 4A63B 1N11A 4NIKA 3T9KA 1WG0A 3JUEA 4QFVA 5ENPD 5KNGA 1AWCB 1D9SA 4LSZE 5AQ7A 5KNHD 5CERB 5ENSD 2BKGA 4U96D 4YDYA 3NOGD 4DRXE 2RFMA 3F6QA 3UTMA 2FO1E 3Q9NC 4TUMA 2V5QC 5HKPA 4DX6D 4HNAD 1IKND 2QYJA 4HLLA 3ZNGA 2JABA 5EIDA 4OAUC 2KBXA 2MYOA 2ZGGA 1OT8A 2F37A 4N5QA 5BXUA 3V79K 4Z68A 4GMRA 4RLYA 2V4HC 5AQBA 2J8SD 3J5QB 5EN5D 5EYPF 4K5AB 3V2OA 3UXGA 5AAOA 2F8YA 2ETCA 3W9FA 2XZDG 3V30A 2XZTG 1AP7A 2HE0A 3EHQA 3ZUVB 4YDWA 3SO8A 5EYLA 3V31A 5FINA 4ZFHA 2DZNA 4BEPA 1QYMA 1MYOA 5ENRD 4CYMD 2XENA 1N0RA 5EIBE 2DZOA 3ZKJA 5ENTD 2VGEA 4HB5A 5JMND 4HQDA 5KWDA 4LG6A 1SW6A 4F1PA 4HBDA 1MJ0A 2RFAA 3W9GA 3NOCD 4O60A 3AAAC 3JXJA 5D66A 5FIOA 1K3ZD 4B93B 1DCQA 4JB8P 1IHBA 4DUIA 1WDYA 3D9HA 2DVWA 5CEDB 1N0QA 3B7BA 4U95D 3UI2A 2XEHA 2B0OE 3ZU7B 5AARA 4ZHBA 4HRMB 5JA4D 3NBNB 3TWRA 5CBOA 1K1AA 3Q9UC 3DEPA 4GPMA 5ENOD 1BU9A 3HRAA 4LNUD 1MX2A 3LJNA 5AN8A 5AQAA 4QQIA 4DX2A 2L6BA 1G3NB 2QC9A 4J8YA 4DX7D 1S70B 2DWZA 4F6RD 2ZGDA 4BETA 4BESA 3T8KA 2KXPC 1TR4A 4U8VD 2BKKB 3TWWA 5ITZF 3C5RA 4HRNA 1YCSB 4DX5D 5CECB 1MX4A 2ETBA 3HG0D 3J5PA 5EILA 3EHRA 3TWUA 4DX1A 2P2CP 3AJIA 3TWVA 1K1BA 3TWSA 2NYJA 4UUCA 1NFIE 1SVXA 4G8LA 1OY3D 2ETAA 5AQ9A 5HRYA 2F8XK 3EU9A 3TWTA 4HI9A 3TWQA 3IXEA 1BD8A 3TWXA 4BERA 2A5EA 4O1PA 1DC2A 1UOHA 5HS0A 1BI8B 3V2XA 2Y1LE 5KBAA 4HRLA 4K5BA 1YMPA 3KEAA 1BI7B 4K5CA 5ENQD 4OAVB 1IXVA 4C48B 1BLXB 2Y0BG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O1O A;  4ATZ D;  2XEE A;  4BSZ B;  2PNN A;  3DEO A;  4CZ2 D;  5BXO A;  5CBN A;  3JXI A;  4HI8 A;  1MX6 A;  5CEA A;  1YYH A;  4U8Y D;  4J7W A;  1A5E A;  2AJA A;  3B95 A;  4G8K A;  4A63 B;  1N11 A;  4NIK A;  3T9K A;  1WG0 A;  3JUE A;  4QFV A;  5ENP D;  5KNG A;  1AWC B;  1D9S A;  4LSZ E;  5AQ7 A;  5KNH D;  5CER B;  5ENS D;  2BKG A;  4U96 D;  4YDY A;  3NOG D;  4DRX E;  2RFM A;  3F6Q A;  3UTM A;  2FO1 E;  3Q9N C;  4TUM A;  2V5Q C;  5HKP A;  4DX6 D;  4HNA D;  1IKN D;  2QYJ A;  4HLL A;  3ZNG A;  2JAB A;  5EID A;  4OAU C;  2KBX A;  2MYO A;  2ZGG A;  1OT8 A;  2F37 A;  4N5Q A;  5BXU A;  3V79 K;  4Z68 A;  4GMR A;  4RLY A;  2V4H C;  5AQB A;  2J8S D;  3J5Q B;  5EN5 D;  5EYP F;  4K5A B;  3V2O A;  3UXG A;  5AAO A;  2F8Y A;  2ETC A;  3W9F A;  2XZD G;  3V30 A;  2XZT G;  1AP7 A;  2HE0 A;  3EHQ A;  3ZUV B;  4YDW A;  3SO8 A;  5EYL A;  3V31 A;  5FIN A;  4ZFH A;  2DZN A;  4BEP A;  1QYM A;  1MYO A;  5ENR D;  4CYM D;  2XEN A;  1N0R A;  5EIB E;  2DZO A;  3ZKJ A;  5ENT D;  2VGE A;  4HB5 A;  5JMN D;  4HQD A;  5KWD A;  4LG6 A;  1SW6 A;  4F1P A;  4HBD A;  1MJ0 A;  2RFA A;  3W9G A;  3NOC D;  4O60 A;  3AAA C;  3JXJ A;  5D66 A;  5FIO A;  1K3Z D;  4B93 B;  1DCQ A;  4JB8 P;  1IHB A;  4DUI A;  1WDY A;  3D9H A;  2DVW A;  5CED B;  1N0Q A;  3B7B A;  4U95 D;  3UI2 A;  2XEH A;  2B0O E;  3ZU7 B;  5AAR A;  4ZHB A;  4HRM B;  5JA4 D;  3NBN B;  3TWR A;  5CBO A;  1K1A A;  3Q9U C;  3DEP A;  4GPM A;  5ENO D;  1BU9 A;  3HRA A;  4LNU D;  1MX2 A;  3LJN A;  5AN8 A;  5AQA A;  4QQI A;  4DX2 A;  2L6B A;  1G3N B;  2QC9 A;  4J8Y A;  4DX7 D;  1S70 B;  2DWZ A;  4F6R D;  2ZGD A;  4BET A;  4BES A;  3T8K A;  2KXP C;  1TR4 A;  4U8V D;  2BKK B;  3TWW A;  5ITZ F;  3C5R A;  4HRN A;  1YCS B;  4DX5 D;  5CEC B;  1MX4 A;  2ETB A;  3HG0 D;  3J5P A;  5EIL A;  3EHR A;  3TWU A;  4DX1 A;  2P2C P;  3AJI A;  3TWV A;  1K1B A;  3TWS A;  2NYJ A;  4UUC A;  1NFI E;  1SVX A;  4G8L A;  1OY3 D;  2ETA A;  5AQ9 A;  5HRY A;  2F8X K;  3EU9 A;  3TWT A;  4HI9 A;  3TWQ A;  3IXE A;  1BD8 A;  3TWX A;  4BER A;  2A5E A;  4O1P A;  1DC2 A;  1UOH A;  5HS0 A;  1BI8 B;  3V2X A;  2Y1L E;  5KBA A;  4HRL A;  4K5B A;  1YMP A;  3KEA A;  1BI7 B;  4K5C A;  5ENQ D;  4OAV B;  1IXV A;  4C48 B;  1BLX B;  2Y0B G; 
#chains in the Genus database with same CATH topology
 3EHN A;  4DJA A;  4AOF A;  2VSY A;  5CBN A;  4N3C A;  4J7W A;  2WXK A;  2WB2 A;  1WG0 A;  5KNG A;  2HO1 A;  1QBQ A;  1IQR A;  5FQ6 A;  3PZ3 A;  4DRX E;  3LS8 A;  3MGB A;  3HVE B;  1IKN D;  2FO7 A;  4AY5 A;  2VTB B;  2ION A;  2KBX A;  2ZGG A;  5G04 J;  4Z68 A;  4J8S A;  1PAQ A;  3MV2 B;  5AQB A;  3HVE A;  2I9C A;  4CCA A;  4BX9 A;  3BG1 B;  2R59 A;  3UXG A;  2VTB A;  3ZRH A;  4LER A;  3EIQ C;  3RRN B;  5D0Q D;  4LEU A;  1QNF A;  4GTO A;  2VGY A;  3BG0 B;  3BU8 A;  4O60 A;  3HIZ A;  1K3Z D;  4J6I A;  2J4D A;  3U3W A;  3FTS A;  4WWN A;  2VSO E;  4JZY A;  3FUK A;  4PS8 A;  4OVU A;  3CVW A;  3ZHE B;  4B94 A;  3EHM A;  3SBT B;  4QQI A;  2H6I A;  4U8H A;  3RJV A;  2P9U G;  1H6K A;  3IBE A;  2BKK B;  5CMW A;  4I6E A;  3FUL A;  4ANX A;  4HVB A;  4KT6 B;  4J8D A;  2L6J A;  3KAE A;  1E7U A;  1OCZ E;  2V5F A;  5D0O D;  1OWN A;  3SY2 A;  3OTN A;  2V0P A;  4UQY A;  5B1B E;  2I2O A;  4JEU A;  4DLQ A;  3D9K A;  1HU3 A;  3E4B A;  5G55 A;  3U4T A;  4GB9 A;  4G25 A;  1A5E A;  2XGM A;  4LNB A;  1VDY A;  2KZT B;  3GZ1 A;  5CER B;  2BKG A;  2GRL A;  5FZR A;  3ZYK A;  3B7T A;  2DYS E;  1EPU A;  1Y6I A;  1EDU A;  5ANL A;  4ABN A;  3CGH A;  3FTV A;  3UX4 A;  2WQ7 A;  3J5Q B;  2DIW A;  1HO8 A;  2F8Y A;  3LKU A;  3CQC B;  4A55 A;  2XGO A;  4GA2 A;  4I6J A;  1N0R A;  4J0U A;  3RO2 A;  3SFX A;  4Q96 A;  3PEV B;  4DUI A;  1S63 A;  2MRI A;  3O4Z A;  2AXU A;  3ML9 A;  5EKQ D;  3ZU7 B;  4HRM B;  4JEH A;  3FEX A;  4I9E A;  1E8W A;  4GPK A;  5ITZ F;  4U0U A;  3ML8 A;  1YCS B;  3L16 A;  2ETB A;  3DXM G;  2IJG X;  2R05 A;  3HXD A;  4MKT A;  4M3O A;  4H7X A;  3ZGQ A;  5KBA A;  5B3S E;  3C3Q A;  3TXN A;  2XGS A;  4ACK A;  3DEO A;  4KVO A;  1KZO A;  2OV8 A;  4R7L A;  2XCB A;  3D9M A;  1TNY A;  4NIK A;  1D9S A;  3FUH A;  5ENS D;  3T8M A;  2BED A;  2LUH A;  2MOW A;  3UTM A;  2P9S G;  2GRM A;  4GMJ A;  1INZ A;  3R7R A;  2ZIS A;  4J8F A;  5BXU A;  3KEZ A;  3ONK A;  2J8S D;  5EN5 D;  4F1S A;  5AAO A;  1PC2 A;  3Q49 B;  3ZUV B;  3DXK G;  2LO6 A;  3HXF A;  3D9L A;  3RIB A;  3SFZ A;  5FQ8 A;  4IRU A;  2P9N G;  2VYI A;  3ABK E;  2X6K A;  1N0Q A;  3FTX A;  5FWQ A;  5E76 A;  5T3R A;  3UI2 A;  3D9P A;  4MLP A;  2XRY A;  2NSZ A;  3L08 A;  4FAD A;  1Z3Y A;  1G3N B;  1N4Q A;  2CFU A;  4EEC A;  3QK0 A;  3HG0 D;  3EHR A;  1TN7 A;  3LCA A;  2X38 A;  3FEY A;  3DRA A;  3ASD A;  3Q73 A;  4N2Q A;  2Y1L E;  3GZ2 A;  2LXM A;  3Q75 A;  4CEM A;  3C3O A;  3TXM A;  1LTX A;  3OXF A;  2AJA A;  3RAU A;  1FPP A;  1K8K G;  5AYW D;  4E85 A;  5BUZ A;  1MZC A;  4WNG A;  2J4B A;  2XPY A;  2UY1 A;  3PRE A;  3FU5 A;  2LAH A;  4HLL A;  4JXT A;  2PZI A;  2OOE A;  2OEW A;  3U66 A;  3Q5M A;  5KJK A;  5JJ7 A;  2R03 A;  4ACL A;  2PQR A;  4B0Z A;  4BT9 A;  5JHB A;  2J07 A;  5BNW A;  3APC A;  5IY5 E;  1H2U A;  2HE0 A;  2J08 A;  4WND A;  4BEP A;  3ZPJ A;  3MX3 A;  5CRU A;  3LY8 A;  3QDN A;  3QWP A;  3PNT B;  3ASN E;  4LG6 A;  1SW6 A;  4HBD A;  2IOS A;  2HM8 A;  4BSX A;  2EQX A;  2H6G A;  4B93 B;  2BTD A;  1JCR A;  1UW4 B;  3HXC A;  4G2V A;  2XEH A;  1N4S A;  4ZHB A;  2KM4 A;  3L22 A;  1S0P A;  5DIZ A;  4WUY A;  3E32 A;  1SZ9 A;  2WXR A;  3AS4 A;  4TXP A;  3G2V A;  2H6F A;  4PS3 A;  3EDT B;  1V54 E;  5G04 C;  1E8Y A;  4DLO A;  1TN6 A;  2KCV A;  1SVX A;  1OY3 D;  2ETA A;  4DK5 A;  1EYH A;  1OCC E;  2Y4U A;  1SA5 A;  3KEA A;  1IXV A;  3UKR G;  3ASF A;  4YVQ C;  3CIA A;  3LY7 A;  3D9J A;  1YYH A;  3L54 A;  4GTT A;  5BV1 A;  1RZ4 A;  2XPZ A;  4QFV A;  5CCL A;  1LF8 A;  1HX8 A;  3ZXS A;  3F6Q A;  4GML A;  5CMY A;  5LP0 A;  3AU4 A;  2V8S E;  3I4G A;  5AIJ A;  2NXP A;  1JWG A;  2A4Z A;  4IYP A;  1OCO E;  4NUR A;  3R9A B;  1IHG A;  1L5J A;  3ZVV A;  5EIB E;  3L6A A;  4HB5 A;  1SZA A;  2A5U A;  3ZFW A;  4FLH A;  1MJ0 A;  2RFA A;  4JL0 A;  1DCQ A;  3LEW A;  2EIK E;  4AJW A;  2YHC A;  2WXH A;  1E96 B;  4CT0 A;  1UN8 A;  3QC1 A;  3Q9U C;  4EBA A;  1D8D A;  5AN8 A;  4JHK A;  4XKC A;  3AG3 E;  3FUN A;  3UM0 A;  3AG2 E;  4JA7 A;  4MRU A;  4U63 A;  2AXZ A;  3L13 A;  2NC9 A;  3Q7A A;  2NYJ A;  3UMV A;  3UT4 A;  2WXI A;  2IU1 A;  3FH7 A;  1TNB A;  3QKY A;  4EQF A;  3D3M A;  1Z6T A;  3E30 A;  3DPY A;  3VTY A;  4E6H A;  4EBA G;  1YMP A;  1BI7 B;  3FFL A;  4C48 B;  4CZ2 D;  2R17 C;  4XE0 A;  3FDH A;  2HYZ A;  2R02 A;  1ELK A;  3EJN A;  4Y6W A;  4I1M A;  4WWP A;  4MBG A;  3UT7 A;  2FUL A;  3BUA A;  4WWO A;  2QYJ A;  1TNZ A;  3PZ2 A;  3MYV A;  4FJZ A;  4RLY A;  3V2O A;  4FHK A;  1O1T A;  3W9F A;  4KZ0 A;  1IQU A;  4GZ6 A;  3SO8 A;  2CG2 A;  1HFA A;  3IHY A;  2OVB A;  4K0R A;  1OWL A;  5FQ7 A;  3AG4 E;  3D9I A;  4F1P A;  1KLX A;  3Q78 A;  4HXI A;  3JXJ A;  4EZJ A;  3FHE A;  4JB8 P;  4XI9 A;  4KZC A;  4BT8 A;  3NAW A;  2VGX B;  2X3M A;  4BY6 A;  3DPD A;  3LJN A;  4JD2 G;  4CRW A;  3TWW A;  4HRN A;  3JQ0 A;  2QZA A;  1H6O A;  2EIM E;  3PVL A;  3VLF A;  3Q15 A;  4I43 A;  4BWR A;  4L23 A;  3ASH A;  3ZXP A;  4HRL A;  4HOS A;  2C0L A;  2PNN A;  3E37 A;  4HI8 A;  1EF1 C;  3ESL A;  3ZHE A;  2VSX E;  3FWV A;  1UJK A;  3MCX A;  3OXG A;  3ZEF A;  3RRU A;  3BQO A;  4DX6 D;  4D10 C;  1E7V A;  5EID A;  4I2Z A;  2L0T B;  4WNE A;  1E8X A;  3I5P A;  2X6H A;  4KMO A;  4J8E A;  2I1K A;  3WXX A;  4N39 A;  1YA0 A;  5FIN A;  3FU3 A;  2Y69 E;  4XKB A;  1Z5S C;  2XEN A;  2KZT A;  3CKC A;  3ZYL A;  4GAA A;  1Q2Z A;  3AS8 A;  5FT9 A;  4ILH B;  3PDN A;  4GTS A;  3UIP C;  2ZU6 B;  4JPS A;  5ANR A;  3UM3 A;  3U64 A;  4IUL A;  5FTP A;  2LSU A;  3GZS A;  2P9I G;  1U3D A;  1QQE A;  1FVH A;  2KXP C;  2IO2 C;  5EIL A;  4WAF A;  4GTV A;  3MA5 A;  3FP3 A;  1NFI E;  3IEG A;  3G2W A;  4G8L A;  3EU9 A;  3TWT A;  1U2V G;  5ENN A;  1HF8 A;  4L9P A;  5KCM A;  4DX7 D;  3I4R B;  4O1O A;  3CVU A;  3ZW3 A;  2LSV A;  3UT8 A;  4U8Y D;  5G2N A;  5KJM A;  4KYO B;  4ANV A;  3NZS A;  1AWC B;  5AQ7 A;  2WPV A;  3QJZ A;  2WXF A;  5BV0 A;  3CHM A;  5HKP A;  4L2Y A;  4HNA D;  5BPP A;  5A23 A;  3PH0 C;  4FUL A;  4LNG A;  4A1G A;  5M72 A;  2F37 A;  3NF1 A;  1TNO A;  3RU0 A;  3S7B A;  3PZ4 A;  2AVP A;  4K5A B;  3C72 A;  3CVN A;  3NB2 A;  2KAT A;  4NRH B;  1AP7 A;  5EYL A;  1OWM A;  3O48 A;  1HXI A;  1ZBP A;  3ZKJ A;  5KWD A;  4M7C A;  3PUJ A;  1RW2 A;  4RG9 A;  1TJC A;  2R2L A;  4RQI A;  4AY6 A;  4LCT A;  5ENO D;  3AG1 E;  2WXJ A;  3DSX A;  3TAX A;  5AQA A;  2L6B A;  3UKU G;  1JCQ A;  4EZK A;  3MZL B;  5LCW C;  3E33 A;  4FC8 A;  3K9I A;  3AJI A;  5J90 A;  3LYA A;  4BFR A;  4JA9 A;  1WY6 A;  3PUK A;  3ULE G;  3TWQ A;  3DSS A;  4N2S A;  1TYQ G;  2A5E A;  3KS2 A;  5G05 J;  2GRP B;  3ASG A;  3JCK C;  3CVQ A;  4C0E A;  4FP7 A;  4UI9 J;  4AIF A;  4UWK A;  1JWF A;  4I1A A;  4U07 A;  4C0M A;  5KJL A;  3JXI A;  4GZ5 A;  4CT4 A;  4AM9 A;  4V3I A;  2XS8 A;  4G8K A;  3B95 A;  5BT1 A;  2ZXW E;  3G2S A;  2FF4 A;  2LAI A;  4GYY A;  4TUM A;  5C1D A;  3SHF A;  2MYO A;  4GTP A;  5FZS A;  2Y4T A;  4EPZ A;  4GMR A;  2JEK A;  5AEN A;  2IQC A;  1O5M A;  4HS2 A;  2V4L A;  5BW8 C;  1FT2 A;  4ILG A;  2LXL A;  2CFZ A;  3FH8 A;  4ILI A;  2WQH A;  4CGV A;  4HQD A;  4PUC A;  3TL5 A;  3FUD A;  2PL2 A;  2EIN E;  3D9H A;  4NAC A;  3FU6 A;  5AAR A;  1N4R A;  3TWR A;  4GPM A;  2HR2 A;  2XS1 A;  4NQ0 A;  2DCP A;  4TRQ A;  3CK8 A;  2QC9 A;  4JW1 A;  1S70 B;  2WXM A;  3T8K A;  1KT0 A;  4L1B A;  1Y8M A;  4DX1 A;  3TWV A;  5J08 A;  3LDZ A;  2LNI A;  2GW1 A;  2WM9 A;  2E0I A;  1OUV A;  1BI8 B;  5FZQ A;  3CVP A;  1HS6 A;  4IN3 B;  5ENQ D;  1N54 A;  2QFC A;  3CST A;  2Y0B G;  4KXK B;  2H6H A;  5CCM A;  3G2U A;  4O6F A;  3MEK A;  4GU5 A;  4EZL A;  3MJW A;  1N11 A;  1N94 A;  3JUE A;  3ESK A;  1XNF A;  3OXL A;  1D8E A;  3URZ A;  3ZYM A;  1OXJ A;  4OAU C;  5T8I A;  1SQM A;  5AJL A;  5C2Y A;  3TG4 A;  3HYM B;  1UJJ A;  1MYO A;  4CYM D;  3RKV A;  3CQG B;  3VLD A;  5ENT D;  1ZB1 A;  4PDX A;  4YND A;  4HLE A;  1UN9 A;  1KT1 A;  5FIO A;  3SBS A;  4TXQ A;  4CDR A;  2YNQ A;  4CDN A;  3HXB A;  5CBO A;  3R7Q A;  3N71 A;  4Q69 A;  5LFA A;  1H6P A;  4BET A;  2F0Y A;  3AU5 A;  4U8V D;  3QAR A;  3RK6 A;  3EIJ A;  5CEC B;  2Q7F A;  4CDM A;  3TWU A;  5JHA A;  3E34 A;  4ATG A;  5AQ9 A;  3MKQ B;  3IXE A;  4BER A;  3TGO A;  3ZN3 A;  4RSY A;  3APF A;  4K5B A;  4OYS A;  2GRO B;  4UWG A;  4G11 A;  5EX3 A;  2L0I A;  3MKQ A;  5BXO A;  3PE3 A;  2FBN A;  1JUQ A;  5A7D B;  3DSU A;  3FUE A;  1V55 E;  4GTQ A;  4GZC A;  3PS6 A;  1LD7 A;  3DSW A;  1H19 A;  4ANU A;  3CVY A;  2BF0 X;  3QAQ A;  1TEZ A;  2XQ0 A;  3CHS A;  2WXP A;  1N95 A;  2RKK A;  4RG6 A;  3HHM A;  4TXR A;  4GYW A;  3BEE A;  4JVS A;  3S7J A;  1PY1 A;  3EHQ A;  1QYM A;  3SD5 A;  4I9C A;  1X5B A;  3RRM B;  3SNX A;  4FLB A;  5CRV A;  4HOQ A;  2P58 C;  1WDY A;  3CKB A;  4AEZ C;  3CVV A;  3FTW A;  2B0O E;  4RVB A;  3DWL G;  3CVL A;  4LNU D;  4N5C A;  2VQ2 A;  2RD0 A;  4F6R D;  2ZGD A;  4AVX A;  4BES A;  1TR4 A;  3B7U X;  1E8Z A;  4ANW A;  4AV7 A;  3DSV A;  5E75 A;  4JHJ A;  3IHV A;  2P2C P;  3UQ3 A;  4TV3 A;  2F8X K;  3TG5 A;  2J9Q A;  1DC2 A;  1B89 A;  5HS0 A;  3WG7 E;  2WXO A;  2B6C A;  2P9L G;  1HE8 A;  4ATZ D;  1H0A A;  4LUN U;  2VGX A;  4N3B A;  2J49 A;  1WAO 1;  4A63 B;  4LSZ E;  3ZYQ A;  1QZ2 A;  2XRZ A;  2WXG A;  3Q9N C;  2V5Q C;  2IOL A;  2OCC E;  3SZ7 A;  1XGW A;  3I3N A;  2KCL A;  1TNU A;  3FUM A;  3CHR A;  2AWI A;  2Y3A A;  1JPL A;  4CGW A;  2V4H C;  2XCC A;  2JLB A;  5D2M C;  2XZD G;  2XZT G;  1Z3X A;  3CV0 A;  3PE4 A;  4YDW A;  4ZFH A;  3LVR E;  5ENR D;  4U7E B;  4HOT A;  5G05 C;  1NL4 A;  3S7F A;  4C9B B;  3X2Q E;  3JYS A;  5ARG A;  4UI9 C;  3T5V A;  3UPV A;  3AAA C;  3JQ1 A;  4UWH A;  3CHP A;  2QY7 A;  4G24 A;  2ZIR A;  3CEQ A;  1H2T C;  1K1A A;  4TUU A;  4UWL A;  4G23 A;  1P5Q A;  4JHR A;  2CG3 A;  2PQN A;  2WXL A;  3AS5 A;  1W3B A;  3FUJ A;  2UWJ G;  3C5R A;  4GZD A;  1JCS A;  3PZ1 A;  3ZIM A;  1A17 A;  3CSF A;  1LD8 A;  3KD7 A;  4A3V A;  3LXU X;  4BTA A;  3RSE G;  1HG2 A;  4O1P A;  2P9K G;  3ULY A;  3S2A A;  4F3V A;  4YDE A;  2FEZ A;  5T4Y A;  3P2B A;  3EUV A;  5B1A E;  4P29 A;  5CEA A;  2KCK A;  2M63 A;  4A3T A;  3DST A;  4LRZ A;  2OEV A;  3B13 A;  4I6G A;  5KNH D;  4OVV A;  4YDY A;  4I17 A;  2C2L A;  2FO1 E;  2GGF A;  4L7T A;  5LOZ A;  3B7S A;  1N9A A;  3ZNG A;  2EIL E;  3DBS A;  5HI7 A;  4APO A;  1OT8 A;  3C3R A;  4UQZ A;  2X6I A;  5EYP F;  5H7P A;  2ILR A;  3G2T A;  4GCO A;  3V30 A;  3QB2 A;  2P9P G;  5EX0 A;  3S7D A;  1ELR A;  4WNF A;  2GRR B;  3UM2 A;  3JUI A;  2CHZ A;  4B89 A;  3SQV A;  2CHW A;  1IHB A;  4YDO A;  3NZU A;  3KSQ A;  2DVW A;  2PM6 A;  5CHE E;  1ZU2 A;  2WXQ A;  2R5S A;  3GW4 A;  1WM5 A;  4DX2 A;  2VSN A;  3ABL E;  2C0M A;  3PZD A;  2QYU A;  1OWO A;  1MHQ A;  3OAW A;  1DCE A;  3U9W A;  1FCH A;  4N3A A;  3Q79 A;  4KBQ A;  5HRY A;  3NQP A;  3HXE A;  2XHE A;  3TWX A;  4G26 A;  1O1R A;  3ONL A;  4U0Z A;  4B8A A;  4GA0 A;  2GRQ B;  5FQ4 A;  4HOR A;  3FY4 A;  2YQ8 A;  3QNK A;  2WMN A;  1OCR E;  3ABM E;  4U04 A;  1NZN A;  3QWV A;  4B8C B;  3C98 A;  4URK A;  4GTM A;  2RG8 A;  1SA4 A;  4FHJ A;  1KPS B;  2WVI A;  2IO3 C;  2X6F A;  3HDX A;  4N5Q A;  3VTX A;  4FJY A;  3CK7 A;  3D9N A;  3V31 A;  4UWF A;  1MQS A;  3D9O A;  5LX8 A;  2DZO A;  2VGE A;  1GW6 A;  3L82 A;  5JMN D;  3SF4 A;  2FI7 A;  4U0S A;  3W9G A;  2VJ8 A;  4DI4 A;  3Q7F A;  3CLJ A;  5JJ6 A;  4MS6 A;  1N52 A;  1E90 A;  1NA0 A;  3B7B A;  5JA4 D;  3NBN B;  2IY0 C;  2PM7 A;  4H7Y A;  1BU9 A;  3HRA A;  1DVP A;  1MX2 A;  1OWP A;  1NP7 A;  4J8Y A;  4Y6C A;  2DWZ A;  3FUF A;  1ELW A;  4DX5 D;  2E2E A;  2GRN B;  3IV0 A;  1MX4 A;  4X8Q A;  5ARF A;  2OVF A;  1S64 A;  2UY1 B;  4I1O B;  4KVM A;  4UUC A;  3P1U A;  1O1S A;  3VLE A;  3MKR A;  1DNP A;  4AXH A;  3APD A;  1FT1 A;  4K5C A;  3T5X A;  4OAV B;  5HQ8 A;  2YIN A;  2KC7 A;  2XEE A;  4BSZ B;  4F53 A;  2MHK A;  3SGH A;  4DI3 A;  3PEU B;  1FVF A;  3T9K A;  4BTB A;  4YVO A;  3R9M A;  3CHO A;  3SI5 A;  4PS7 A;  3NOG D;  2RFM A;  4AP2 A;  4XIF A;  1UG3 A;  2IFU A;  3ASO E;  4K03 A;  3CR3 A;  2XEV A;  3FH5 A;  3V79 K;  3RO3 A;  2YHE A;  5DBK A;  3Q4A B;  2ETC A;  2OND A;  3UUX A;  3B7R L;  1BPO A;  4UQX A;  4XI0 A;  2DZN A;  4UI9 K;  1H2V C;  3SFY A;  4PH4 B;  1IYG A;  3UIO C;  2J09 A;  4FA6 A;  3PNL B;  3FTY A;  4JC8 A;  1X81 A;  2BUG A;  3UM1 A;  2CHX A;  4U95 D;  2WQ6 A;  3DEP A;  3KSL A;  2AW6 A;  3LVQ E;  2IEJ A;  3PRZ A;  4XX5 A;  3CK9 A;  4EHM A;  3J5P A;  3QWW A;  3TWS A;  3L17 A;  4FU3 A;  4APF A;  1KZP A;  3CHQ A;  5A6C A;  5EDS A;  4A1S A;  4GYO A;  4DPR A;  1BD8 A;  1NI1 A;  2I6H A;  4I2W A;  1UOH A;  5FJY A;  3V2X A;  2EIJ E;  4GA1 A;  1NA3 A;  1BLX B;  3TJP A;  5LCW J;  5JJT A;  4BX8 A;  3UIN C;  4G1T A;  1MX6 A;  3L9T A;  4XZ4 A;  5ENP D;  1HH8 A;  2I1J A;  4U96 D;  2JAB A;  3EU5 A;  5KJN A;  4L2L A;  3FU0 A;  3FTU A;  1N4P A;  2L9B A;  4HFG A;  4GTR A;  2WXN A;  2WMO A;  4F7A A;  3CVX A;  2AXV A;  3QOU A;  3ENE A;  2DYR E;  3LPZ A;  3GYZ A;  3ULQ A;  4ME2 A;  3NOC D;  4XEI G;  5D66 A;  1U3C A;  3LY9 A;  1TJF A;  3Q47 B;  5CED B;  2IF4 A;  2X6J A;  4W9R A;  3LJ3 A;  1HG5 A;  4Q94 A;  3ISM C;  2XPI A;  3MV3 B;  3IKO B;  3FTZ A;  1K1B A;  4GZ3 A;  4HOU A;  1TN8 A;  1HZ4 A;  4HI9 A;  4GCN A;  5AJD A;  3FUI A;  2DBA A; 
#chains in the Genus database with same CATH homology
 4O1O A;  4ATZ D;  2XEE A;  4BSZ B;  2PNN A;  3DEO A;  4CZ2 D;  5BXO A;  5CBN A;  3JXI A;  4HI8 A;  1MX6 A;  5CEA A;  1YYH A;  4U8Y D;  4J7W A;  1A5E A;  2AJA A;  3B95 A;  4G8K A;  4A63 B;  1N11 A;  4NIK A;  3T9K A;  1WG0 A;  3JUE A;  4QFV A;  5ENP D;  5KNG A;  1AWC B;  1D9S A;  4LSZ E;  5AQ7 A;  5KNH D;  5CER B;  5ENS D;  2BKG A;  4U96 D;  4YDY A;  3NOG D;  4DRX E;  2RFM A;  3F6Q A;  3UTM A;  2FO1 E;  3Q9N C;  4TUM A;  2V5Q C;  5HKP A;  4DX6 D;  4HNA D;  1IKN D;  2QYJ A;  4HLL A;  3ZNG A;  2JAB A;  5EID A;  4OAU C;  2KBX A;  2MYO A;  2ZGG A;  1OT8 A;  2F37 A;  4N5Q A;  5BXU A;  3V79 K;  4Z68 A;  4GMR A;  4RLY A;  2V4H C;  5AQB A;  2J8S D;  3J5Q B;  5EN5 D;  5EYP F;  4K5A B;  3V2O A;  3UXG A;  5AAO A;  2F8Y A;  2ETC A;  3W9F A;  2XZD G;  3V30 A;  2XZT G;  1AP7 A;  2HE0 A;  3EHQ A;  3ZUV B;  4YDW A;  3SO8 A;  5EYL A;  3V31 A;  5FIN A;  4ZFH A;  2DZN A;  4BEP A;  1QYM A;  1MYO A;  5ENR D;  4CYM D;  2XEN A;  1N0R A;  5EIB E;  2DZO A;  3ZKJ A;  5ENT D;  2VGE A;  4HB5 A;  5JMN D;  4HQD A;  5KWD A;  4LG6 A;  1SW6 A;  4F1P A;  4HBD A;  1MJ0 A;  2RFA A;  3W9G A;  3NOC D;  4O60 A;  3AAA C;  3JXJ A;  5D66 A;  5FIO A;  1K3Z D;  4B93 B;  1DCQ A;  4JB8 P;  1IHB A;  4DUI A;  1WDY A;  3D9H A;  2DVW A;  5CED B;  1N0Q A;  3B7B A;  4U95 D;  3UI2 A;  2XEH A;  2B0O E;  3ZU7 B;  5AAR A;  4ZHB A;  4HRM B;  5JA4 D;  3NBN B;  3TWR A;  5CBO A;  1K1A A;  3Q9U C;  3DEP A;  4GPM A;  5ENO D;  1BU9 A;  3HRA A;  4LNU D;  1MX2 A;  3LJN A;  5AN8 A;  5AQA A;  4QQI A;  4DX2 A;  2L6B A;  1G3N B;  2QC9 A;  4J8Y A;  4DX7 D;  1S70 B;  2DWZ A;  4F6R D;  2ZGD A;  4BET A;  4BES A;  3T8K A;  2KXP C;  1TR4 A;  4U8V D;  2BKK B;  3TWW A;  5ITZ F;  3C5R A;  4HRN A;  1YCS B;  4DX5 D;  5CEC B;  1MX4 A;  2ETB A;  3HG0 D;  3J5P A;  5EIL A;  3EHR A;  3TWU A;  4DX1 A;  2P2C P;  3AJI A;  3TWV A;  1K1B A;  3TWS A;  2NYJ A;  4UUC A;  1NFI E;  1SVX A;  4G8L A;  1OY3 D;  2ETA A;  5AQ9 A;  5HRY A;  2F8X K;  3EU9 A;  3TWT A;  4HI9 A;  3TWQ A;  3IXE A;  1BD8 A;  3TWX A;  4BER A;  2A5E A;  4O1P A;  1DC2 A;  1UOH A;  5HS0 A;  1BI8 B;  3V2X A;  2Y1L E;  5KBA A;  4HRL A;  4K5B A;  1YMP A;  3KEA A;  1BI7 B;  4K5C A;  5ENQ D;  4OAV B;  1IXV A;  4C48 B;  1BLX B;  2Y0B G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...