1EF1C

Crystal structure of the moesin ferm domain/tail domain complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
AEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords MOESIN
total genus 22
structure length 90
sequence length 90
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.1020 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ef1C01
1EF1C 2I1KA 2I1JA
chains in the Genus database with same CATH superfamily
3SQVA 4L2LA 1JCQA 2KATA 5AAOA 3SFYA 2F0YA 2RG8A 3FU5A 1S63A 4CDMA 4UUCA 4LNGA 1OWOA 2LO6A 3E4BA 5DBKA 1HF8A 1TN6A 3UT4A 3FULA 2ETCA 3NOCD 4R7LA 2CHWA 1K8KG 3QC1A 2BEDA 3CGHA 1BI7B 2OEVA 2KZTA 1UG3A 4JL0A 4Y6CA 1YA0A 2KC7A 3I4RB 3Q75A 4W9RA 2ZGDA 2NC9A 3L6AA 4F6RD 5J08A 1NP7A 1UN9A 2GRQB 3DBSA 4JB8P 4GTVA 2IOSA 3PZ3A 4WNGA 4HI8A 4K5BA 1XNFA 1HH8A 3UIPC 4UWLA 3PE3A 4A63B 2ETAA 2ZIRA 3MA5A 5ANLA 4BTBA 3CHRA 4DUIA 4I2WA 2WQ6A 4GZ5A 3OXLA 4U07A 3IV0A 2WQ7A 4I1MA 1E90A 4U04A 5G05J 2VTBA 2XCBA 4IULA 4AP2A 5EIDA 1IYGA 1TJCA 3APFA 2WXIA 5EX3A 2AWIA 2DZNA 4GMJA 1SW6A 4C0MA 3EUVA 1TNYA 2L6BA 5HKPA 4FADA 2LSUA 4E85A 3R9AB 4CGVA 2WPVA 3L22A 3AG3E 2Q7FA 2WMOA 1KT0A 3C3RA 4ANVA 3RAUA 2FBNA 3D9HA 3MKQB 4HB5A 2J8SD 3NBNB 2XCCA 2NYJA 4I1AA 4G8LA 3ASDA 4FHKA 2MHKA 2P9LG 3E33A 4ANWA 1HG2A 1NZNA 3RRNB 2RFMA 5KJLA 3FP3A 3FUDA 1IHBA 3MV2B 4N5CA 2J49A 2R03A 3TGOA 2BKGA 2DWZA 5FQ6A 4F3VA 1A5EA 3ML8A 3ASHA 5JHAA 4O1OA 3GW4A 3Q4AB 5ARGA 3S7DA 3PZ1A 1WM5A 4U0UA 4BTAA 3D9MA 3MV3B 3JXIA 1N0QA 2DZOA 5BUZA 4GYYA 5FTPA 4I6EA 3TG4A 3CEQA 3ZN3A 1TEZA 3CVVA 3DRAA 4I17A 1ZBPA 2IJGX 3EU5A 3ENEA 2X6FA 2GRMA 3LVRE 2L6JA 2P9SG 3UX4A 1BPOA 3U9WA 1HXIA 2Y0BG 4GTTA 3D3MA 3ULYA 1TN7A 2OCCE 4KXKB 2J07A 3FUIA 4BX8A 2VSOE 4LG6A 4EECA 2WXRA 3TWVA 2C2LA 5LCWJ 5BPPA 3FH8A 5M72A 3KS2A 1K1BA 3SBTB 3OTNA 1KLXA 3LVQE 3HG0D 5H7PA 1H0AA 1OXJA 4M3OA 5ENQD 2PZIA 5CHEE 2WXFA 3KSQA 4RSYA 3Q9NC 1KPSB 3DSTA 2WXGA 3PVLA 5G05C 3MGBA 1IHGA 1KT1A 3DEOA 4B93B 3U3WA 1N4PA 1N95A 5CBOA 5FT9A 4YNDA 2GRRB 3RU0A 4KT6B 3RO3A 1Z6TA 4B94A 3HYMB 2R05A 2WXMA 2HM8A 3DSXA 3UM0A 1DCEA 1SZAA 5EKQD 1FVHA 4HOSA 1E8ZA 2J4DA 3QWPA 4UI9K 3FUHA 3AG4E 3AG1E 2H6IA 4DI4A 3CK7A 3OAWA 5EX0A 3UM3A 3TAXA 1N11A 3RO2A 5D2MC 3FTUA 1N4SA 1BU9A 2CHXA 2WXHA 2F8YA 1WY6A 3LXUX 2PQRA 2YHEA 2XS8A 2PNNA 5BNWA 1WG0A 2ZGGA 3PEUB 1QNFA 5JJ6A 3T5VA 1OT8A 4U95D 2L0TB 3APDA 4J8FA 4WUYA 3APCA 2RFAA 3EHNA 4OYSA 5LX8A 4ACKA 2XENA 5CMWA 4BSZB 3HXBA 1UN8A 5BW8C 4Q96A 1A17A 3ABKE 3WG7E 1INZA 2NSZA 5FJYA 5ITZF 3EU9A 3W9FA 5AQ7A 2X6JA 3C3QA 4PUCA 4ANXA 4GCNA 1E8XA 5FINA 4DLOA 3CVXA 3Q73A 4LRZA 3ZW3A 4EZJA 3VTXA 4BERA 4J0UA 3SY2A 4TUUA 3G2VA 1TNOA 4O1PA 3CK9A 4I43A 3C98A 4LUNU 2X6IA 2IQCA 1DCQA 3PEVB 3DSSA 3ZYQA 4ATGA 1MX2A 3CVPA 4GPKA 5J90A 1O5MA 4AIFA 1MYOA 3L13A 4F53A 2HE0A 1N4RA 3W9GA 5ENPD 2E2EA 4CEMA 3IKOB 5AQ9A 1SVXA 3CVNA 2WXQA 2GGFA 3G2WA 3ABME 1EF1C 2M63A 3ESLA 4GTMA 3TJPA 4BT8A 2UY1B 2BF0X 2BTDA 3E37A 3V2OA 5B1BE 5D66A 1S0PA 3CV0A 5EYPF 2XZDG 4UWKA 5G2NA 4J8SA 1FPPA 2DYSE 4G2VA 4KZCA 3LY8A 4MBGA 3VLDA 3ZFWA 4UWHA 3ASOE 5LOZA 4CZ2D 4A3TA 2VTBB 2KCVA 2FO1E 1WAO1 4BESA 1K3ZD 4HLLA 1EPUA 3RKVA 4DJAA 1DNPA 3SFZA 5C1DA 4TV3A 3Q7FA 3CVWA 1JUQA 1U2VG 4LNBA 4N2SA 3D9JA 1Q2ZA 3L54A 3FUJA 3TXNA 1NFIE 3OXGA 3O4ZA 3RRUA 4I2ZA 4B89A 1GW6A 3HIZA 1N0RA 4LSZE 1YMPA 4HRLA 4DX5D 2DBAA 3RIBA 4HOUA 2A5UA 3G2UA 2VGXB 3HRAA 4DX7D 1ELRA 5CRUA 4JEHA 4HXIA 1TYQG 3FEXA 2LSVA 2VQ2A 5HRYA 3FTXA 4O60A 2IOLA 3E30A 1FCHA 2P9IG 4FLBA 4JHRA 5ENSD 5ARFA 2XPIA 2VSXE 4PS8A 3BU8A 3RK6A 4JC8A 3SNXA 4DX6D 3FTVA 4UWFA 3GYZA 3MYVA 4YVOA 5FQ4A 3V2XA 3CR3A 2DIWA 3AJIA 3L82A 3KEZA 1SQMA 5AENA 4D10C 2WXNA 1UJKA 1ELWA 3ZXSA 4UI9J 2HYZA 4C9BB 4XZ4A 1OCRE 4ATZD 5JMND 4L2YA 3HVEB 4OVVA 3FUKA 2V8SE 4N3CA 5A6CA 4NQ0A 2XZTG 2MYOA 3FY4A 4GA2A 5G55A 4P29A 4AM9A 3C72A 2YINA 3O48A 2WXOA 5AN8A 3ZHEB 2F37A 2OOEA 4KBQA 4NACA 4LEUA 4DX2A 4MRUA 4L9PA 2EINE 3NQPA 4I1OB 4JW1A 2PM6A 4PS7A 3B7BA 1JWGA 3UMVA 4I6GA 3LCAA 4GA0A 5CRVA 3CHOA 2CHZA 1UW4B 2J08A 1K1AA 4ANUA 3TXMA 5ENTD 4UQZA 3AS5A 4CGWA 4ILHB 1TJFA 3I5PA 4G1TA 4EHMA 1N94A 2R5SA 3FWVA 2NXPA 1RW2A 3IBEA 3MX3A 3FHEA 4A3VA 3ULQA 1Y8MA 4JD2G 2X3MA 1P5QA 3BG1B 4PDXA 4BWRA 2Y4TA 3FFLA 1O1RA 4LERA 2C0LA 4JZYA 2FI7A 2DVWA 2XQ0A 3FTWA 2VYIA 2IU1A 4GTOA 4Z68A 1TNUA 3QJZA 1E7UA 4DPRA 3D9OA 3UPVA 3B95A 2CFZA 2KM4A 3PH0C 2EIKE 3FTZA 1NI1A 4CT0A 2VGEA 3PRZA 3PDNA 3S7FA 2P9KG 4FJYA 3DSVA 3ASGA 1OWNA 4A1GA 2KBXA 4JA7A 3EIJA 4ZFHA 4U8HA 1DC2A 4WWNA 3JQ0A 3UUXA 3UXGA 4FU3A 5G04C 4AY5A 5FZRA 2EIME 5FWQA 3ASFA 1FVFA 5CCMA 3TWSA 2E0IA 5AQAA 2WXJA 4C48B 3ZEFA 4LCTA 3FDHA 3ONKA 4IN3B 4AY6A 4UI9C 2J4BA 4XKCA 1MHQA 1MZCA 2R2LA 1X5BA 5ENOD 2AXUA 4GB9A 2KCKA 3ONLA 4RVBA 3LEWA 5KJMA 3FUEA 4GPMA 2X6KA 4JPSA 3L9TA 1S70B 4H7XA 3MEKA 1E7VA 2V5FA 5EDSA 4AJWA 4KZ0A 2XEVA 4I9CA 1IKND 4U7EB 3LY7A 4KYOB 3G2SA 2YNQA 3QWVA 3ZPJA 2GRLA 3PUKA 1Z3XA 4NIKA 4G8KA 1TNZA 3JUEA 3CKBA 4NRHB 3J5QB 3AU4A 1QYMA 3SBSA 5FQ7A 4HRMB 2P9PG 1MX4A 1D8EA 4HLEA 1IQUA 5JJTA 2QC9A 3FU6A 2R17C 1H6PA 3CHMA 4UQXA 5AIJA 1E8WA 3CQGB 5EYLA 3U66A 4WWPA 5EIBE 2VSNA 5D0QD 4KVOA 1ZB1A 4APOA 5G04J 1H2UA 2A4ZA 3DPDA 4BSXA 4FULA 3UM2A 3X2QE 2QY7A 2J9QA 2H6FA 5AARA 4WNDA 4EZKA 1LD8A 2QYUA 3F6QA 4OAUC 2FF4A 4K03A 4HNAD 4PS3A 3FUNA 3VLEA 3B7SA 2XGSA 5FIOA 3L08A 1L5JA 2PM7A 2I9CA 4U0SA 3S7JA 1O1TA 4ACLA 2IFUA 3D9KA 3N71A 2XRZA 4XI9A 2CG3A 1XGWA 2XPYA 2ZISA 4Y6WA 4YDYA 3ZIMA 2KXPC 3S2AA 4I6JA 5KCMA 5KNHD 1LF8A 4CDNA 3Q49B 3HXEA 3AS4A 3WXXA 4G24A 4BETA 3MKRA 1IXVA 4PH4B 2XEHA 5LP0A 5JHBA 1OUVA 2LNIA 3QAQA 4EQFA 3ISMC 3TWUA 1Z5SC 4B0ZA 2WQHA 4GU5A 3ESKA 1MX6A 5FQ8A 4UWGA 3RRMB 3ZRHA 4AOFA 4TRQA 2Y69E 1TR4A 3QOUA 3B7UX 5BV1A 4GA1A 3TWTA 2GW1A 4J8EA 4GTSA 1HE8A 3ASNE 3DPYA 3T9KA 1TNBA 4BX9A 1OCZE 1D8DA 3FUFA 4GTQA 5KBAA 3ABLE 2I6HA 3L16A 4V3IA 3LYAA 4JXTA 5FZQA 3UT7A 3CHQA 3SF4A 3E32A 4HOTA 1B89A 4FC8A 4RQIA 4TXQA 3ULEG 3I4GA 3ML9A 4OAVB 3Q5MA 4HVBA 3L17A 2IO3C 4XE0A 4L23A 1E96B 2GROB 2XHEA 3Q9UC 3JXJA 2EQXA 2H6HA 5HI7A 2JLBA 1JCSA 3PUJA 1OWLA 1LTXA 3D9IA 4GYWA 3HXFA 4AXHA 2B0OE 1HG5A 3SD5A 3RSEG 4EPZA 3D9NA 5EILA 3UKUG 4HORA 2FO7A 3ZU7B 1OCCE 3NAWA 3ZVVA 4RLYA 2P9UG 3CSTA 1QZ2A 3DWLG 4GCOA 3HHMA 4O6FA 4U8YD 4IYPA 3DSUA 1S64A 4U8VD 4C0EA 1HS6A 4YDEA 2V0PA 3GZ2A 4L1BA 2XGOA 4LNUD 3PREA 4K5CA 3B13A 4J7WA 3V79K 3E34A 4WWOA 1JWFA 2LXMA 3HXCA 5B1AE 4K5AB 4XI0A 1UJJA 4GTRA 4FJZA 2BUGA 3UI2A 2L9BA 2X38A 1W3BA 2A5EA 2RD0A 5ANRA 1PAQA 1N4QA 4CCAA 2LXLA 3C3OA 5BT1A 2KCLA 2DCPA 5BV0A 1KZPA 3CVQA 4GTPA 1BLXB 5EN5D 1H2VC 2ETBA 4HOQA 3UQ3A 2WXLA 3FUMA 4EBAA 1ELKA 4N3BA 3P2BA 4KMOA 3R9MA 4AVXA 5DIZA 2J09A 4U0ZA 2WMNA 3DSWA 1PY1A 4BT9A 1QBQA 1JPLA 1ZU2A 3QK0A 5KWDA 3J5PA 3HVEA 4U63A 3JQ1A 3FTYA 3Q7AA 4XKBA 4CDRA 3PZDA 3ZKJA 3ZYKA 3HDXA 3B7TA 4APFA 2VJ8A 1HU3A 1HFAA 3FU0A 5CEAA 1IQRA 3ZUVB 1DVPA 1NA3A 5AQBA 1SA4A 2YQ8A 4GZ3A 2WB2A 4FHJA 4Q94A 3Q47B 3QDNA 3CHSA 4HI9A 3LJ3A 2CFUA 3IHYA 2IONA 2UWJG 3GZ1A 2XRYA 4J8YA 4ME2A 2V5QC 2MRIA 2Y3AA 3EIQC 2PL2A 2IY0C 3NOGD 3DXMG 1N9AA 4QQIA 3S7BA 2B6CA 3BQOA 3CK8A 2OV8A 3PNTB 3EHMA 3TWXA 3CVUA 2H6GA 2GRNB 3U64A 1OWPA 4FP7A 3ZGQA 4GAAA 4UQYA 4GYOA 3QARA 4RG6A 3Q15A 4GMLA 3TWRA 3FH7A 3C5RA 1JCRA 4ILGA 2R02A 3D9LA 4CT4A 2IEJA 4M7CA 1FT1A 3MZLB 2QZAA 3SZ7A 3BG0B 3IXEA 2LAIA 4G23A 3QWWA 4Q69A 3R7QA 3NF1A 5T4YA 4MS6A 3JUIA 3SHFA 1YCSB 5A23A 2L0IA 4WNFA 4QFVA 4WAFA 3MKQA 4GZ6A 3URZA 4JVSA 1AWCB 2IF4A 4N39A 1QQEA 2WM9A 4TUMA 3KD7A 5IY5E 4OVUA 1U3DA 4JHKA 5LFAA 3JCKC 2UY1A 5CCLA 3UM1A 3EDTB 4DLQA 3UKRG 3CLJA 3T8MA 4HS2A 1N52A 1YYHA 4TXPA 2QFCA 2I2OA 5BXUA 4F1PA 4DK5A 3ZXPA 3ZYLA 1D9SA 4DI3A 3CIAA 4X8QA 3PS6A 1WDYA 2ONDA 3SFXA 3EJNA 2R59A 1G3NB 4MKTA 4A1SA 4ZHBA 3ZYMA 2V4HC 4DRXE 4ILIA 5AYWD 3BUAA 1TN8A 2AXVA 2IO2C 3CVLA 4HFGA 2GRPB 3T5XA 3UINC 4F7AA 2BKKB 2OVFA 2JEKA 3GZSA 3MCXA 2OVBA 3KSLA 5D0OD 2F8XK 3TG5A 2I1JA 5FZSA 2VGYA 3LPZA 4U96D 5JA4D 4XEIG 1H6KA 1N54A 2Y1LE 3DEPA 4GMRA 1OCOE 5CMYA 1OY3D 4N3AA 4YDOA 4K0RA 1U3CA 3PZ2A 5KNGA 3QNKA 3SO8A 4EZLA 1Y6IA 4HBDA 3FU3A 1BD8A 4G11A 2EILE 3KAEA 3NB2A 3P1UA 3PE4A 4FLHA 1SA5A 2CG2A 1Z3YA 4TXRA 2AXZA 4FA6A 3T8KA 1KZOA 4L7TA 1H2TC 3D9PA 1HZ4A 4J8DA 4BFRA 1FT2A 4JEUA 5AJLA 4BEPA 2ZXWE 2X6HA 3UIOC 2AW6A 4JHJA 4G25A 4AV7A 4GZDA 3TWQA 2HO1A 3LKUA 5KJKA 1LD7A 2WXKA 2MOWA 5HQ8A 4MLPA 3IEGA 4KVMA 3Q79A 4URKA 1MQSA 4H7YA 3TWWA 3SI5A 1VDYA 3PZ4A 1V55E 5E75A 3CHPA 1NL4A 2XGMA 3TL5A 3AU5A 2AJAA 3I3NA 3IHVA 3CSFA 3B7RL 3AS8A 3ZNGA 2LAHA 5ENRD 5CBNA 2FEZA 1SZ9A 4I9EA 1EDUA 2XS1A 3JYSA 3LDZA 2KZTB 5AJDA 3QKYA 2ZU6B 2JABA 2ILRA 3CVYA 4XX5A 3QB2A 1V54E 2Y4UA 3FEYA 3UT8A 3NZSA 3Q78A 3U4TA 3HXDA 1H19A 5CERB 3EHRA 2C0MA 1X81A 3ZHEA 3OXFA 1BI8B 1UOHA 3BEEA 5BXOA 4CYMD 4F1SA 4YVQC 1O1SA 2P58C 4A55A 3FH5A 2XPZA 1PC2A 3LS8A 2AVPA 4B8CB 3LY9A 4BY6A 2YHCA 4DX1A 1HX8A 4CRWA 3KEAA 4JA9A 1RZ4A 5C2YA 3VLFA 1OWMA 1MJ0A 5E76A 4RG9A 4N5QA 3MJWA 2OEWA 2PQNA 4AEZC 3DXKG 2WXPA 4ABNA 2HR2A 3PNLB 2WVIA 3K9IA 3AG2E 3EHQA 3SGHA 4J6IA 4HRNA 3V31A 2DYRE 3RJVA 4N2QA 3CQCB 4G26A 4B8AA 3VTYA 5ENNA 4WNEA 3AAAC 1HO8A 2RKKA 5KJNA 3UTMA 4EBAG 2P9NG 3LJNA 4XIFA 3V30A 1AP7A 1E8YA 5JJ7A 5T3RA 3G2TA 4IRUA 5A7DB 5T8IA 2P2CP 5LCWC 3CKCA 4YDWA 5B3SE 5HS0A 2VSYA 3FTSA 2FULA 4NURA 2I1KA 2LUHA 2V4LA 2EIJE 3NZUA 2VGXA 2XEEA 5CEDB 5CECB 2QYJA 4E6HA 4GZCA 3R7RA 1NA0A 1H6OA 1EYHA 4HQDA
chains in the Genus database with same CATH topology
3FH7A 4L2LA 4ATGA 2KATA 2RG8A 4ILGA 3D9LA 3FU5A 3CVPA 4CT4A 4HLEA 4GPKA 5J90A 4CDMA 4AIFA 1IQUA 3L13A 3MZLB 4Q69A 3SZ7A 3BG0B 5JJTA 4F53A 2LAIA 3FU6A 4G23A 2R17C 3QWWA 1OWOA 2E2EA 2LO6A 3IKOB 3CHMA 3NF1A 4UQXA 4MS6A 5T4YA 3R7QA 4CEMA 5AIJA 3JUIA 3E4BA 3CVNA 3SHFA 2WXQA 5DBKA 5A23A 2L0IA 1E8WA 2GGFA 4WNFA 3G2WA 3CQGB 1EF1C 1HF8A 2M63A 3ESLA 3MKQA 4GZ6A 4QFVA 4WAFA 3TJPA 3URZA 4BT8A 4JVSA 2UY1B 2BF0X 2IF4A 3UT4A 2BTDA 3U66A 3FULA 4WWPA 4N39A 1S0PA 3CV0A 2VSNA 1QQEA 4R7LA 2WM9A 2CHWA 4UWKA 3KD7A 5D0QD 5G2NA 4KVOA 3QC1A 4APOA 3CGHA 4OVUA 5G04J 1H2UA 4J8SA 4G2VA 4KZCA 1U3DA 2A4ZA 3DPDA 4BSXA 4JHKA 4FULA 5LFAA 2QY7A 2KZTA 3LY8A 3JCKC 2UY1A 1UG3A 2J9QA 5CCLA 4JL0A 3EDTB 3VLDA 4Y6CA 3ZFWA 4UWHA 4WNDA 4DLQA 4EZKA 1YA0A 5LOZA 2KC7A 3I4RB 4W9RA 4A3TA 3CLJA 3T8MA 2NC9A 3L6AA 2VTBB 4HS2A 5J08A 2KCVA 1NP7A 1N52A 1UN9A 1WAO1 2FF4A 3DBSA 4K03A 1EPUA 2QFCA 4PS3A 3RKVA 3FUNA 2IOSA 3VLEA 2I2OA 4DJAA 1DNPA 4DK5A 3B7SA 4WNGA 2XGSA 3SFZA 5C1DA 4TV3A 1XNFA 3ZYLA 1HH8A 3L08A 4UWLA 3CVWA 3PE3A 1JUQA 4DI3A 1L5JA 3CIAA 4N2SA 3D9JA 2PM7A 2I9CA 3PS6A 4U0SA 3S7JA 3MA5A 3L54A 3FUJA 5ANLA 4ACLA 2IFUA 3D9KA 4BTBA 3N71A 3TXNA 3CHRA 3OXGA 2ONDA 3O4ZA 4I2WA 2WQ6A 2XRZA 4XI9A 3RRUA 2CG3A 4I2ZA 4GZ5A 4B89A 1XGWA 3EJNA 1GW6A 3OXLA 4U07A 3IV0A 2WQ7A 4I1MA 1E90A 2R59A 2XPYA 3HIZA 4U04A 4Y6WA 5G05J 2VTBA 3ZIMA 4MKTA 3S2AA 4A1SA 4I6JA 2DBAA 2XCBA 4IULA 5KCMA 4AP2A 1LF8A 3ZYMA 4CDNA 3RIBA 4HOUA 3Q49B 3AS4A 2A5UA 3G2UA 3WXXA 4G24A 3MKRA 2VGXB 4ILIA 1IYGA 2IQCA 5AYWD 1TJCA 3APFA 2AXVA 4PH4B 2WXIA 5EX3A 3CVLA 2AWIA 4HFGA 5JHBA 5LP0A 4GMJA 1OUVA 1ELRA 2LNIA 4JEHA 4HXIA 3T5XA 3FEXA 4C0MA 2LSVA 2VQ2A 4F7AA 3QAQA 4EQFA 2OVFA 3FTXA 2JEKA 3GZSA 3MCXA 2IOLA 2OVBA 4B0ZA 2WQHA 5D0OD 4FADA 2LSUA 4GU5A 1FCHA 3TG5A 4E85A 3R9AB 2I1JA 3ESKA 4FLBA 4JHRA 5FQ8A 4CGVA 5FZSA 2WPVA 4UWGA 2VGYA 3LPZA 3RRMB 3L22A 3ZRHA 2Q7FA 5ARFA 2XPIA 4TRQA 4AOFA 2WMOA 3QOUA 2VSXE 4PS8A 1H6KA 3B7UX 3RK6A 4JC8A 1N54A 5BV1A 1KT0A 4GA1A 3SNXA 3FTVA 2GW1A 4ANVA 4UWFA 4J8EA 3GYZA 1HE8A 2FBNA 3MYVA 4YVOA 5FQ4A 3CR3A 3MKQB 2DIWA 5CMYA 4N3AA 3KEZA 4K0RA 1SQMA 5AENA 4D10C 4BX9A 2WXNA 1U3CA 2XCCA 1UJKA 3QNKA 4EZLA 1ELWA 1Y6IA 4I1AA 3ZXSA 3ASDA 4FHKA 2MHKA 4UI9J 2HYZA 3FU3A 3FUFA 4ANWA 4C9BB 1HG2A 1NZNA 4XZ4A 3RRNB 2I6HA 3L16A 5KJLA 3FP3A 4V3IA 3LYAA 4G11A 3FUDA 4JXTA 4L2YA 5FZQA 3KAEA 3UT7A 3P1UA 3CHQA 3SF4A 3PE4A 3MV2B 4FLHA 4N5CA 2J49A 3HVEB 4OVVA 2CG2A 1Z3YA 3FUKA 4HOTA 3TGOA 1B89A 2AXZA 4FC8A 4FA6A 2V8SE 4N3CA 5A6CA 4L7TA 4NQ0A 3FY4A 4GA2A 5FQ6A 5G55A 4F3VA 1H2TC 3I4GA 3D9PA 3ML8A 1HZ4A 3ASHA 3ML9A 4J8DA 4P29A 4AM9A 5JHAA 4BFRA 2YINA 3GW4A 3Q4AB 3O48A 2WXOA 3Q5MA 4HVBA 4JEUA 5AJLA 5ARGA 3S7DA 3L17A 3ZHEB 4XE0A 4L23A 2X6HA 1WM5A 2OOEA 2AW6A 4KBQA 4U0UA 4NACA 4LEUA 1E96B 4JHJA 4MRUA 2XHEA 4G25A 4AV7A 4BTAA 4GZDA 2EQXA 3D9MA 2HO1A 3MV3B 3LKUA 3NQPA 5BUZA 4I1OB 5HI7A 4JW1A 5KJKA 2PM6A 2JLBA 4GYYA 5FTPA 4I6EA 3PUJA 2WXKA 2MOWA 5HQ8A 4MLPA 4PS7A 3IEGA 1OWLA 4KVMA 3D9IA 3TG4A 1JWGA 1MQSA 4H7YA 4GYWA 4URKA 3SI5A 4AXHA 3UMVA 3CEQA 1HG5A 1VDYA 4I6GA 3LCAA 4GA0A 3SD5A 3CHOA 3ZN3A 5E75A 3CHPA 1TEZA 3CVVA 4I17A 4EPZA 3D9NA 2XGMA 3TL5A 3AU5A 1ZBPA 2IJGX 2CHZA 3I3NA 1UW4B 3IHVA 3ENEA 4HORA 2J08A 2FO7A 3CSFA 4ANUA 2X6FA 3TXMA 3ZVVA 3B7RL 2GRMA 2LAHA 3AS8A 3CSTA 3LVRE 1QZ2A 4UQZA 3AS5A 4GCOA 4CGWA 2FEZA 2L6JA 3HHMA 1SZ9A 4ILHB 3UX4A 4I9EA 4O6FA 1EDUA 1BPOA 3U9WA 1TJFA 1HXIA 3I5PA 3JYSA 3LDZA 2KZTB 2R5SA 3D3MA 2NXPA 3FWVA 4G1TA 4IYPA 4KXKB 3IBEA 5AJDA 2J07A 3MX3A 2ZU6B 3FUIA 3QKYA 4BX8A 4C0EA 1HS6A 2VSOE 3FHEA 4EECA 2ILRA 2WXRA 2V0PA 4A3VA 2C2LA 3GZ2A 5LCWJ 5BPPA 4XX5A 3ULQA 3CVYA 3FH8A 5M72A 3QB2A 1Y8MA 3KS2A 4L1BA 3SBTB 3OTNA 2XGOA 2Y4UA 1KLXA 2X3MA 3LVQE 1P5QA 3PREA 3FEYA 3BG1B 3NZSA 3B13A 4PDXA 3UT8A 4BWRA 2Y4TA 3U4TA 4WWOA 1H19A 1H0AA 1JWFA 3FFLA 4M3OA 2PZIA 5CHEE 2WXFA 2C0MA 4LERA 4XI0A 1UJJA 2C0LA 4RSYA 4FJZA 3ZHEA 4JZYA 2BUGA 2FI7A 3OXFA 2L9BA 2X38A 1W3BA 2XQ0A 2RD0A 2WXGA 3PVLA 5G05C 3BEEA 1IHGA 1KT1A 3MGBA 5ANRA 3FTWA 3U3WA 2VYIA 2IU1A 1PAQA 3QJZA 1E7UA 5FT9A 4DPRA 4F1SA 4YVQC 4YNDA 4CCAA 2P58C 3D9OA 3UPVA 3RU0A 4A55A 4KT6B 2CFZA 3RO3A 5BT1A 2KCLA 2DCPA 3FH5A 2KM4A 1Z6TA 2XPZA 3PH0C 5BV0A 3CVQA 1PC2A 4B94A 3LS8A 3HYMB 3FTZA 1H2VC 2AVPA 2WXMA 4B8CB 4CT0A 3LY9A 3PRZA 4BY6A 2YHCA 3PDNA 2HM8A 3S7FA 4HOQA 1SZAA 1HX8A 5EKQD 3UQ3A 1FVHA 2WXLA 4CRWA 4HOSA 1E8ZA 4JA9A 2J4DA 3QWPA 4FJYA 5C2YA 3VLFA 1OWMA 3FUMA 4UI9K 4EBAA 1ELKA 3ASGA 1OWNA 4N3BA 5E76A 3FUHA 4A1GA 4RG9A 4JA7A 3P2BA 4KMOA 3MJWA 4AVXA 3EIJA 4U8HA 2J09A 5DIZA 2PQNA 3CK7A 3OAWA 4U0ZA 5EX0A 4DI4A 2WMNA 3TAXA 4WWNA 3JQ0A 3RO2A 3UUXA 4AEZC 3FTUA 1PY1A 2WXPA 4FU3A 5G04C 4BT9A 1JPLA 4AY5A 4ABNA 2CHXA 5FZRA 1ZU2A 2WXHA 3QK0A 2HR2A 3PNLB 1WY6A 3HVEA 4U63A 3JQ1A 5FWQA 2WVIA 1FVFA 3ASFA 3FTYA 3K9IA 5CCMA 4XKBA 2E0IA 3PZDA 4J6IA 3SGHA 4CDRA 3LXUX 3ZYKA 2WXJA 3HDXA 3B7TA 2PQRA 4LCTA 3ZEFA 4APFA 2YHEA 2VJ8A 1HU3A 1HFAA 3FDHA 3FU0A 3RJVA 1IQRA 4N2QA 3CQCB 1DVPA 5BNWA 4G26A 3ONKA 1NA3A 4IN3B 4AY6A 4B8AA 3VTYA 2YQ8A 4UI9C 2J4BA 4WNEA 3PEUB 4GZ3A 1MHQA 1QNFA 4XKCA 5ENNA 5JJ6A 1HO8A 4FHJA 2WB2A 4Q94A 3T5VA 3Q47B 1X5BA 3QDNA 2L0TB 3APDA 5KJNA 4EBAG 4J8FA 4WUYA 3APCA 3CHSA 3EHNA 2AXUA 4OYSA 3LJ3A 4GB9A 4XIFA 5LX8A 4ACKA 2CFUA 3IHYA 2IONA 5CMWA 2KCKA 2UWJG 3GZ1A 3ONLA 4RVBA 2XRYA 3LEWA 1E8YA 5JJ7A 5KJMA 5T3RA 3G2TA 4IRUA 4ME2A 3FUEA 5A7DB 2X6KA 2MRIA 4JPSA 2Y3AA 5T8IA 3EIQC 1UN8A 2PL2A 4H7XA 5BW8C 4Q96A 3MEKA 1E7VA 1A17A 2V5FA 5LCWC 5EDSA 3CKCA 4AJWA 3S7BA 4KZ0A 2XEVA 1INZA 4I9CA 3CK8A 3LY7A 2OV8A 4KYOB 3G2SA 2NSZA 2YNQA 2VSYA 3QWVA 5FJYA 3PNTB 3ZPJA 2GRLA 3FTSA 2X6JA 3PUKA 1Z3XA 3EHMA 4PUCA 4ANXA 4GCNA 2FULA 3CVUA 3U64A 1OWPA 4NURA 1E8XA 2I1KA 4DLOA 4FP7A 3ZGQA 2V4LA 3CKBA 4GAAA 3CVXA 4LRZA 3NZUA 4NRHB 3ZW3A 2VGXA 4EZJA 4UQYA 3VTXA 3AU4A 4GYOA 4J0UA 3QARA 4RG6A 3SBSA 3Q15A 4TUUA 3G2VA 4E6HA 3CK9A 4GMLA 4GZCA 1NA0A 3C98A 4I43A 4LUNU 1EYHA 5FQ7A 3R7RA 2X6IA 3PEVB 3ZYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF1 C;  2I1K A;  2I1J A; 
#chains in the Genus database with same CATH topology
 3SQV A;  4L2L A;  1JCQ A;  2KAT A;  5AAO A;  3SFY A;  2F0Y A;  2RG8 A;  3FU5 A;  1S63 A;  4CDM A;  4UUC A;  4LNG A;  1OWO A;  2LO6 A;  3E4B A;  5DBK A;  1HF8 A;  1TN6 A;  3UT4 A;  3FUL A;  2ETC A;  3NOC D;  4R7L A;  2CHW A;  1K8K G;  3QC1 A;  2BED A;  3CGH A;  1BI7 B;  2OEV A;  2KZT A;  1UG3 A;  4JL0 A;  4Y6C A;  1YA0 A;  2KC7 A;  3I4R B;  3Q75 A;  4W9R A;  2ZGD A;  2NC9 A;  3L6A A;  4F6R D;  5J08 A;  1NP7 A;  1UN9 A;  2GRQ B;  3DBS A;  4JB8 P;  4GTV A;  2IOS A;  3PZ3 A;  4WNG A;  4HI8 A;  4K5B A;  1XNF A;  1HH8 A;  3UIP C;  4UWL A;  3PE3 A;  4A63 B;  2ETA A;  2ZIR A;  3MA5 A;  5ANL A;  4BTB A;  3CHR A;  4DUI A;  4I2W A;  2WQ6 A;  4GZ5 A;  3OXL A;  4U07 A;  3IV0 A;  2WQ7 A;  4I1M A;  1E90 A;  4U04 A;  5G05 J;  2VTB A;  2XCB A;  4IUL A;  4AP2 A;  5EID A;  1IYG A;  1TJC A;  3APF A;  2WXI A;  5EX3 A;  2AWI A;  2DZN A;  4GMJ A;  1SW6 A;  4C0M A;  3EUV A;  1TNY A;  2L6B A;  5HKP A;  4FAD A;  2LSU A;  4E85 A;  3R9A B;  4CGV A;  2WPV A;  3L22 A;  3AG3 E;  2Q7F A;  2WMO A;  1KT0 A;  3C3R A;  4ANV A;  3RAU A;  2FBN A;  3D9H A;  3MKQ B;  4HB5 A;  2J8S D;  3NBN B;  2XCC A;  2NYJ A;  4I1A A;  4G8L A;  3ASD A;  4FHK A;  2MHK A;  2P9L G;  3E33 A;  4ANW A;  1HG2 A;  1NZN A;  3RRN B;  2RFM A;  5KJL A;  3FP3 A;  3FUD A;  1IHB A;  3MV2 B;  4N5C A;  2J49 A;  2R03 A;  3TGO A;  2BKG A;  2DWZ A;  5FQ6 A;  4F3V A;  1A5E A;  3ML8 A;  3ASH A;  5JHA A;  4O1O A;  3GW4 A;  3Q4A B;  5ARG A;  3S7D A;  3PZ1 A;  1WM5 A;  4U0U A;  4BTA A;  3D9M A;  3MV3 B;  3JXI A;  1N0Q A;  2DZO A;  5BUZ A;  4GYY A;  5FTP A;  4I6E A;  3TG4 A;  3CEQ A;  3ZN3 A;  1TEZ A;  3CVV A;  3DRA A;  4I17 A;  1ZBP A;  2IJG X;  3EU5 A;  3ENE A;  2X6F A;  2GRM A;  3LVR E;  2L6J A;  2P9S G;  3UX4 A;  1BPO A;  3U9W A;  1HXI A;  2Y0B G;  4GTT A;  3D3M A;  3ULY A;  1TN7 A;  2OCC E;  4KXK B;  2J07 A;  3FUI A;  4BX8 A;  2VSO E;  4LG6 A;  4EEC A;  2WXR A;  3TWV A;  2C2L A;  5LCW J;  5BPP A;  3FH8 A;  5M72 A;  3KS2 A;  1K1B A;  3SBT B;  3OTN A;  1KLX A;  3LVQ E;  3HG0 D;  5H7P A;  1H0A A;  1OXJ A;  4M3O A;  5ENQ D;  2PZI A;  5CHE E;  2WXF A;  3KSQ A;  4RSY A;  3Q9N C;  1KPS B;  3DST A;  2WXG A;  3PVL A;  5G05 C;  3MGB A;  1IHG A;  1KT1 A;  3DEO A;  4B93 B;  3U3W A;  1N4P A;  1N95 A;  5CBO A;  5FT9 A;  4YND A;  2GRR B;  3RU0 A;  4KT6 B;  3RO3 A;  1Z6T A;  4B94 A;  3HYM B;  2R05 A;  2WXM A;  2HM8 A;  3DSX A;  3UM0 A;  1DCE A;  1SZA A;  5EKQ D;  1FVH A;  4HOS A;  1E8Z A;  2J4D A;  3QWP A;  4UI9 K;  3FUH A;  3AG4 E;  3AG1 E;  2H6I A;  4DI4 A;  3CK7 A;  3OAW A;  5EX0 A;  3UM3 A;  3TAX A;  1N11 A;  3RO2 A;  5D2M C;  3FTU A;  1N4S A;  1BU9 A;  2CHX A;  2WXH A;  2F8Y A;  1WY6 A;  3LXU X;  2PQR A;  2YHE A;  2XS8 A;  2PNN A;  5BNW A;  1WG0 A;  2ZGG A;  3PEU B;  1QNF A;  5JJ6 A;  3T5V A;  1OT8 A;  4U95 D;  2L0T B;  3APD A;  4J8F A;  4WUY A;  3APC A;  2RFA A;  3EHN A;  4OYS A;  5LX8 A;  4ACK A;  2XEN A;  5CMW A;  4BSZ B;  3HXB A;  1UN8 A;  5BW8 C;  4Q96 A;  1A17 A;  3ABK E;  3WG7 E;  1INZ A;  2NSZ A;  5FJY A;  5ITZ F;  3EU9 A;  3W9F A;  5AQ7 A;  2X6J A;  3C3Q A;  4PUC A;  4ANX A;  4GCN A;  1E8X A;  5FIN A;  4DLO A;  3CVX A;  3Q73 A;  4LRZ A;  3ZW3 A;  4EZJ A;  3VTX A;  4BER A;  4J0U A;  3SY2 A;  4TUU A;  3G2V A;  1TNO A;  4O1P A;  3CK9 A;  4I43 A;  3C98 A;  4LUN U;  2X6I A;  2IQC A;  1DCQ A;  3PEV B;  3DSS A;  3ZYQ A;  4ATG A;  1MX2 A;  3CVP A;  4GPK A;  5J90 A;  1O5M A;  4AIF A;  1MYO A;  3L13 A;  4F53 A;  2HE0 A;  1N4R A;  3W9G A;  5ENP D;  2E2E A;  4CEM A;  3IKO B;  5AQ9 A;  1SVX A;  3CVN A;  2WXQ A;  2GGF A;  3G2W A;  3ABM E;  1EF1 C;  2M63 A;  3ESL A;  4GTM A;  3TJP A;  4BT8 A;  2UY1 B;  2BF0 X;  2BTD A;  3E37 A;  3V2O A;  5B1B E;  5D66 A;  1S0P A;  3CV0 A;  5EYP F;  2XZD G;  4UWK A;  5G2N A;  4J8S A;  1FPP A;  2DYS E;  4G2V A;  4KZC A;  3LY8 A;  4MBG A;  3VLD A;  3ZFW A;  4UWH A;  3ASO E;  5LOZ A;  4CZ2 D;  4A3T A;  2VTB B;  2KCV A;  2FO1 E;  1WAO 1;  4BES A;  1K3Z D;  4HLL A;  1EPU A;  3RKV A;  4DJA A;  1DNP A;  3SFZ A;  5C1D A;  4TV3 A;  3Q7F A;  3CVW A;  1JUQ A;  1U2V G;  4LNB A;  4N2S A;  3D9J A;  1Q2Z A;  3L54 A;  3FUJ A;  3TXN A;  1NFI E;  3OXG A;  3O4Z A;  3RRU A;  4I2Z A;  4B89 A;  1GW6 A;  3HIZ A;  1N0R A;  4LSZ E;  1YMP A;  4HRL A;  4DX5 D;  2DBA A;  3RIB A;  4HOU A;  2A5U A;  3G2U A;  2VGX B;  3HRA A;  4DX7 D;  1ELR A;  5CRU A;  4JEH A;  4HXI A;  1TYQ G;  3FEX A;  2LSV A;  2VQ2 A;  5HRY A;  3FTX A;  4O60 A;  2IOL A;  3E30 A;  1FCH A;  2P9I G;  4FLB A;  4JHR A;  5ENS D;  5ARF A;  2XPI A;  2VSX E;  4PS8 A;  3BU8 A;  3RK6 A;  4JC8 A;  3SNX A;  4DX6 D;  3FTV A;  4UWF A;  3GYZ A;  3MYV A;  4YVO A;  5FQ4 A;  3V2X A;  3CR3 A;  2DIW A;  3AJI A;  3L82 A;  3KEZ A;  1SQM A;  5AEN A;  4D10 C;  2WXN A;  1UJK A;  1ELW A;  3ZXS A;  4UI9 J;  2HYZ A;  4C9B B;  4XZ4 A;  1OCR E;  4ATZ D;  5JMN D;  4L2Y A;  3HVE B;  4OVV A;  3FUK A;  2V8S E;  4N3C A;  5A6C A;  4NQ0 A;  2XZT G;  2MYO A;  3FY4 A;  4GA2 A;  5G55 A;  4P29 A;  4AM9 A;  3C72 A;  2YIN A;  3O48 A;  2WXO A;  5AN8 A;  3ZHE B;  2F37 A;  2OOE A;  4KBQ A;  4NAC A;  4LEU A;  4DX2 A;  4MRU A;  4L9P A;  2EIN E;  3NQP A;  4I1O B;  4JW1 A;  2PM6 A;  4PS7 A;  3B7B A;  1JWG A;  3UMV A;  4I6G A;  3LCA A;  4GA0 A;  5CRV A;  3CHO A;  2CHZ A;  1UW4 B;  2J08 A;  1K1A A;  4ANU A;  3TXM A;  5ENT D;  4UQZ A;  3AS5 A;  4CGW A;  4ILH B;  1TJF A;  3I5P A;  4G1T A;  4EHM A;  1N94 A;  2R5S A;  3FWV A;  2NXP A;  1RW2 A;  3IBE A;  3MX3 A;  3FHE A;  4A3V A;  3ULQ A;  1Y8M A;  4JD2 G;  2X3M A;  1P5Q A;  3BG1 B;  4PDX A;  4BWR A;  2Y4T A;  3FFL A;  1O1R A;  4LER A;  2C0L A;  4JZY A;  2FI7 A;  2DVW A;  2XQ0 A;  3FTW A;  2VYI A;  2IU1 A;  4GTO A;  4Z68 A;  1TNU A;  3QJZ A;  1E7U A;  4DPR A;  3D9O A;  3UPV A;  3B95 A;  2CFZ A;  2KM4 A;  3PH0 C;  2EIK E;  3FTZ A;  1NI1 A;  4CT0 A;  2VGE A;  3PRZ A;  3PDN A;  3S7F A;  2P9K G;  4FJY A;  3DSV A;  3ASG A;  1OWN A;  4A1G A;  2KBX A;  4JA7 A;  3EIJ A;  4ZFH A;  4U8H A;  1DC2 A;  4WWN A;  3JQ0 A;  3UUX A;  3UXG A;  4FU3 A;  5G04 C;  4AY5 A;  5FZR A;  2EIM E;  5FWQ A;  3ASF A;  1FVF A;  5CCM A;  3TWS A;  2E0I A;  5AQA A;  2WXJ A;  4C48 B;  3ZEF A;  4LCT A;  3FDH A;  3ONK A;  4IN3 B;  4AY6 A;  4UI9 C;  2J4B A;  4XKC A;  1MHQ A;  1MZC A;  2R2L A;  1X5B A;  5ENO D;  2AXU A;  4GB9 A;  2KCK A;  3ONL A;  4RVB A;  3LEW A;  5KJM A;  3FUE A;  4GPM A;  2X6K A;  4JPS A;  3L9T A;  1S70 B;  4H7X A;  3MEK A;  1E7V A;  2V5F A;  5EDS A;  4AJW A;  4KZ0 A;  2XEV A;  4I9C A;  1IKN D;  4U7E B;  3LY7 A;  4KYO B;  3G2S A;  2YNQ A;  3QWV A;  3ZPJ A;  2GRL A;  3PUK A;  1Z3X A;  4NIK A;  4G8K A;  1TNZ A;  3JUE A;  3CKB A;  4NRH B;  3J5Q B;  3AU4 A;  1QYM A;  3SBS A;  5FQ7 A;  4HRM B;  2P9P G;  1MX4 A;  1D8E A;  4HLE A;  1IQU A;  5JJT A;  2QC9 A;  3FU6 A;  2R17 C;  1H6P A;  3CHM A;  4UQX A;  5AIJ A;  1E8W A;  3CQG B;  5EYL A;  3U66 A;  4WWP A;  5EIB E;  2VSN A;  5D0Q D;  4KVO A;  1ZB1 A;  4APO A;  5G04 J;  1H2U A;  2A4Z A;  3DPD A;  4BSX A;  4FUL A;  3UM2 A;  3X2Q E;  2QY7 A;  2J9Q A;  2H6F A;  5AAR A;  4WND A;  4EZK A;  1LD8 A;  2QYU A;  3F6Q A;  4OAU C;  2FF4 A;  4K03 A;  4HNA D;  4PS3 A;  3FUN A;  3VLE A;  3B7S A;  2XGS A;  5FIO A;  3L08 A;  1L5J A;  2PM7 A;  2I9C A;  4U0S A;  3S7J A;  1O1T A;  4ACL A;  2IFU A;  3D9K A;  3N71 A;  2XRZ A;  4XI9 A;  2CG3 A;  1XGW A;  2XPY A;  2ZIS A;  4Y6W A;  4YDY A;  3ZIM A;  2KXP C;  3S2A A;  4I6J A;  5KCM A;  5KNH D;  1LF8 A;  4CDN A;  3Q49 B;  3HXE A;  3AS4 A;  3WXX A;  4G24 A;  4BET A;  3MKR A;  1IXV A;  4PH4 B;  2XEH A;  5LP0 A;  5JHB A;  1OUV A;  2LNI A;  3QAQ A;  4EQF A;  3ISM C;  3TWU A;  1Z5S C;  4B0Z A;  2WQH A;  4GU5 A;  3ESK A;  1MX6 A;  5FQ8 A;  4UWG A;  3RRM B;  3ZRH A;  4AOF A;  4TRQ A;  2Y69 E;  1TR4 A;  3QOU A;  3B7U X;  5BV1 A;  4GA1 A;  3TWT A;  2GW1 A;  4J8E A;  4GTS A;  1HE8 A;  3ASN E;  3DPY A;  3T9K A;  1TNB A;  4BX9 A;  1OCZ E;  1D8D A;  3FUF A;  4GTQ A;  5KBA A;  3ABL E;  2I6H A;  3L16 A;  4V3I A;  3LYA A;  4JXT A;  5FZQ A;  3UT7 A;  3CHQ A;  3SF4 A;  3E32 A;  4HOT A;  1B89 A;  4FC8 A;  4RQI A;  4TXQ A;  3ULE G;  3I4G A;  3ML9 A;  4OAV B;  3Q5M A;  4HVB A;  3L17 A;  2IO3 C;  4XE0 A;  4L23 A;  1E96 B;  2GRO B;  2XHE A;  3Q9U C;  3JXJ A;  2EQX A;  2H6H A;  5HI7 A;  2JLB A;  1JCS A;  3PUJ A;  1OWL A;  1LTX A;  3D9I A;  4GYW A;  3HXF A;  4AXH A;  2B0O E;  1HG5 A;  3SD5 A;  3RSE G;  4EPZ A;  3D9N A;  5EIL A;  3UKU G;  4HOR A;  2FO7 A;  3ZU7 B;  1OCC E;  3NAW A;  3ZVV A;  4RLY A;  2P9U G;  3CST A;  1QZ2 A;  3DWL G;  4GCO A;  3HHM A;  4O6F A;  4U8Y D;  4IYP A;  3DSU A;  1S64 A;  4U8V D;  4C0E A;  1HS6 A;  4YDE A;  2V0P A;  3GZ2 A;  4L1B A;  2XGO A;  4LNU D;  3PRE A;  4K5C A;  3B13 A;  4J7W A;  3V79 K;  3E34 A;  4WWO A;  1JWF A;  2LXM A;  3HXC A;  5B1A E;  4K5A B;  4XI0 A;  1UJJ A;  4GTR A;  4FJZ A;  2BUG A;  3UI2 A;  2L9B A;  2X38 A;  1W3B A;  2A5E A;  2RD0 A;  5ANR A;  1PAQ A;  1N4Q A;  4CCA A;  2LXL A;  3C3O A;  5BT1 A;  2KCL A;  2DCP A;  5BV0 A;  1KZP A;  3CVQ A;  4GTP A;  1BLX B;  5EN5 D;  1H2V C;  2ETB A;  4HOQ A;  3UQ3 A;  2WXL A;  3FUM A;  4EBA A;  1ELK A;  4N3B A;  3P2B A;  4KMO A;  3R9M A;  4AVX A;  5DIZ A;  2J09 A;  4U0Z A;  2WMN A;  3DSW A;  1PY1 A;  4BT9 A;  1QBQ A;  1JPL A;  1ZU2 A;  3QK0 A;  5KWD A;  3J5P A;  3HVE A;  4U63 A;  3JQ1 A;  3FTY A;  3Q7A A;  4XKB A;  4CDR A;  3PZD A;  3ZKJ A;  3ZYK A;  3HDX A;  3B7T A;  4APF A;  2VJ8 A;  1HU3 A;  1HFA A;  3FU0 A;  5CEA A;  1IQR A;  3ZUV B;  1DVP A;  1NA3 A;  5AQB A;  1SA4 A;  2YQ8 A;  4GZ3 A;  2WB2 A;  4FHJ A;  4Q94 A;  3Q47 B;  3QDN A;  3CHS A;  4HI9 A;  3LJ3 A;  2CFU A;  3IHY A;  2ION A;  2UWJ G;  3GZ1 A;  2XRY A;  4J8Y A;  4ME2 A;  2V5Q C;  2MRI A;  2Y3A A;  3EIQ C;  2PL2 A;  2IY0 C;  3NOG D;  3DXM G;  1N9A A;  4QQI A;  3S7B A;  2B6C A;  3BQO A;  3CK8 A;  2OV8 A;  3PNT B;  3EHM A;  3TWX A;  3CVU A;  2H6G A;  2GRN B;  3U64 A;  1OWP A;  4FP7 A;  3ZGQ A;  4GAA A;  4UQY A;  4GYO A;  3QAR A;  4RG6 A;  3Q15 A;  4GML A;  3TWR A;  3FH7 A;  3C5R A;  1JCR A;  4ILG A;  2R02 A;  3D9L A;  4CT4 A;  2IEJ A;  4M7C A;  1FT1 A;  3MZL B;  2QZA A;  3SZ7 A;  3BG0 B;  3IXE A;  2LAI A;  4G23 A;  3QWW A;  4Q69 A;  3R7Q A;  3NF1 A;  5T4Y A;  4MS6 A;  3JUI A;  3SHF A;  1YCS B;  5A23 A;  2L0I A;  4WNF A;  4QFV A;  4WAF A;  3MKQ A;  4GZ6 A;  3URZ A;  4JVS A;  1AWC B;  2IF4 A;  4N39 A;  1QQE A;  2WM9 A;  4TUM A;  3KD7 A;  5IY5 E;  4OVU A;  1U3D A;  4JHK A;  5LFA A;  3JCK C;  2UY1 A;  5CCL A;  3UM1 A;  3EDT B;  4DLQ A;  3UKR G;  3CLJ A;  3T8M A;  4HS2 A;  1N52 A;  1YYH A;  4TXP A;  2QFC A;  2I2O A;  5BXU A;  4F1P A;  4DK5 A;  3ZXP A;  3ZYL A;  1D9S A;  4DI3 A;  3CIA A;  4X8Q A;  3PS6 A;  1WDY A;  2OND A;  3SFX A;  3EJN A;  2R59 A;  1G3N B;  4MKT A;  4A1S A;  4ZHB A;  3ZYM A;  2V4H C;  4DRX E;  4ILI A;  5AYW D;  3BUA A;  1TN8 A;  2AXV A;  2IO2 C;  3CVL A;  4HFG A;  2GRP B;  3T5X A;  3UIN C;  4F7A A;  2BKK B;  2OVF A;  2JEK A;  3GZS A;  3MCX A;  2OVB A;  3KSL A;  5D0O D;  2F8X K;  3TG5 A;  2I1J A;  5FZS A;  2VGY A;  3LPZ A;  4U96 D;  5JA4 D;  4XEI G;  1H6K A;  1N54 A;  2Y1L E;  3DEP A;  4GMR A;  1OCO E;  5CMY A;  1OY3 D;  4N3A A;  4YDO A;  4K0R A;  1U3C A;  3PZ2 A;  5KNG A;  3QNK A;  3SO8 A;  4EZL A;  1Y6I A;  4HBD A;  3FU3 A;  1BD8 A;  4G11 A;  2EIL E;  3KAE A;  3NB2 A;  3P1U A;  3PE4 A;  4FLH A;  1SA5 A;  2CG2 A;  1Z3Y A;  4TXR A;  2AXZ A;  4FA6 A;  3T8K A;  1KZO A;  4L7T A;  1H2T C;  3D9P A;  1HZ4 A;  4J8D A;  4BFR A;  1FT2 A;  4JEU A;  5AJL A;  4BEP A;  2ZXW E;  2X6H A;  3UIO C;  2AW6 A;  4JHJ A;  4G25 A;  4AV7 A;  4GZD A;  3TWQ A;  2HO1 A;  3LKU A;  5KJK A;  1LD7 A;  2WXK A;  2MOW A;  5HQ8 A;  4MLP A;  3IEG A;  4KVM A;  3Q79 A;  4URK A;  1MQS A;  4H7Y A;  3TWW A;  3SI5 A;  1VDY A;  3PZ4 A;  1V55 E;  5E75 A;  3CHP A;  1NL4 A;  2XGM A;  3TL5 A;  3AU5 A;  2AJA A;  3I3N A;  3IHV A;  3CSF A;  3B7R L;  3AS8 A;  3ZNG A;  2LAH A;  5ENR D;  5CBN A;  2FEZ A;  1SZ9 A;  4I9E A;  1EDU A;  2XS1 A;  3JYS A;  3LDZ A;  2KZT B;  5AJD A;  3QKY A;  2ZU6 B;  2JAB A;  2ILR A;  3CVY A;  4XX5 A;  3QB2 A;  1V54 E;  2Y4U A;  3FEY A;  3UT8 A;  3NZS A;  3Q78 A;  3U4T A;  3HXD A;  1H19 A;  5CER B;  3EHR A;  2C0M A;  1X81 A;  3ZHE A;  3OXF A;  1BI8 B;  1UOH A;  3BEE A;  5BXO A;  4CYM D;  4F1S A;  4YVQ C;  1O1S A;  2P58 C;  4A55 A;  3FH5 A;  2XPZ A;  1PC2 A;  3LS8 A;  2AVP A;  4B8C B;  3LY9 A;  4BY6 A;  2YHC A;  4DX1 A;  1HX8 A;  4CRW A;  3KEA A;  4JA9 A;  1RZ4 A;  5C2Y A;  3VLF A;  1OWM A;  1MJ0 A;  5E76 A;  4RG9 A;  4N5Q A;  3MJW A;  2OEW A;  2PQN A;  4AEZ C;  3DXK G;  2WXP A;  4ABN A;  2HR2 A;  3PNL B;  2WVI A;  3K9I A;  3AG2 E;  3EHQ A;  3SGH A;  4J6I A;  4HRN A;  3V31 A;  2DYR E;  3RJV A;  4N2Q A;  3CQC B;  4G26 A;  4B8A A;  3VTY A;  5ENN A;  4WNE A;  3AAA C;  1HO8 A;  2RKK A;  5KJN A;  3UTM A;  4EBA G;  2P9N G;  3LJN A;  4XIF A;  3V30 A;  1AP7 A;  1E8Y A;  5JJ7 A;  5T3R A;  3G2T A;  4IRU A;  5A7D B;  5T8I A;  2P2C P;  5LCW C;  3CKC A;  4YDW A;  5B3S E;  5HS0 A;  2VSY A;  3FTS A;  2FUL A;  4NUR A;  2I1K A;  2LUH A;  2V4L A;  2EIJ E;  3NZU A;  2VGX A;  2XEE A;  5CED B;  5CEC B;  2QYJ A;  4E6H A;  4GZC A;  3R7R A;  1NA0 A;  1H6O A;  1EYH A;  4HQD A; 
#chains in the Genus database with same CATH homology
 3FH7 A;  4L2L A;  4ATG A;  2KAT A;  2RG8 A;  4ILG A;  3D9L A;  3FU5 A;  3CVP A;  4CT4 A;  4HLE A;  4GPK A;  5J90 A;  4CDM A;  4AIF A;  1IQU A;  3L13 A;  3MZL B;  4Q69 A;  3SZ7 A;  3BG0 B;  5JJT A;  4F53 A;  2LAI A;  3FU6 A;  4G23 A;  2R17 C;  3QWW A;  1OWO A;  2E2E A;  2LO6 A;  3IKO B;  3CHM A;  3NF1 A;  4UQX A;  4MS6 A;  5T4Y A;  3R7Q A;  4CEM A;  5AIJ A;  3JUI A;  3E4B A;  3CVN A;  3SHF A;  2WXQ A;  5DBK A;  5A23 A;  2L0I A;  1E8W A;  2GGF A;  4WNF A;  3G2W A;  3CQG B;  1EF1 C;  1HF8 A;  2M63 A;  3ESL A;  3MKQ A;  4GZ6 A;  4QFV A;  4WAF A;  3TJP A;  3URZ A;  4BT8 A;  4JVS A;  2UY1 B;  2BF0 X;  2IF4 A;  3UT4 A;  2BTD A;  3U66 A;  3FUL A;  4WWP A;  4N39 A;  1S0P A;  3CV0 A;  2VSN A;  1QQE A;  4R7L A;  2WM9 A;  2CHW A;  4UWK A;  3KD7 A;  5D0Q D;  5G2N A;  4KVO A;  3QC1 A;  4APO A;  3CGH A;  4OVU A;  5G04 J;  1H2U A;  4J8S A;  4G2V A;  4KZC A;  1U3D A;  2A4Z A;  3DPD A;  4BSX A;  4JHK A;  4FUL A;  5LFA A;  2QY7 A;  2KZT A;  3LY8 A;  3JCK C;  2UY1 A;  1UG3 A;  2J9Q A;  5CCL A;  4JL0 A;  3EDT B;  3VLD A;  4Y6C A;  3ZFW A;  4UWH A;  4WND A;  4DLQ A;  4EZK A;  1YA0 A;  5LOZ A;  2KC7 A;  3I4R B;  4W9R A;  4A3T A;  3CLJ A;  3T8M A;  2NC9 A;  3L6A A;  2VTB B;  4HS2 A;  5J08 A;  2KCV A;  1NP7 A;  1N52 A;  1UN9 A;  1WAO 1;  2FF4 A;  3DBS A;  4K03 A;  1EPU A;  2QFC A;  4PS3 A;  3RKV A;  3FUN A;  2IOS A;  3VLE A;  2I2O A;  4DJA A;  1DNP A;  4DK5 A;  3B7S A;  4WNG A;  2XGS A;  3SFZ A;  5C1D A;  4TV3 A;  1XNF A;  3ZYL A;  1HH8 A;  3L08 A;  4UWL A;  3CVW A;  3PE3 A;  1JUQ A;  4DI3 A;  1L5J A;  3CIA A;  4N2S A;  3D9J A;  2PM7 A;  2I9C A;  3PS6 A;  4U0S A;  3S7J A;  3MA5 A;  3L54 A;  3FUJ A;  5ANL A;  4ACL A;  2IFU A;  3D9K A;  4BTB A;  3N71 A;  3TXN A;  3CHR A;  3OXG A;  2OND A;  3O4Z A;  4I2W A;  2WQ6 A;  2XRZ A;  4XI9 A;  3RRU A;  2CG3 A;  4I2Z A;  4GZ5 A;  4B89 A;  1XGW A;  3EJN A;  1GW6 A;  3OXL A;  4U07 A;  3IV0 A;  2WQ7 A;  4I1M A;  1E90 A;  2R59 A;  2XPY A;  3HIZ A;  4U04 A;  4Y6W A;  5G05 J;  2VTB A;  3ZIM A;  4MKT A;  3S2A A;  4A1S A;  4I6J A;  2DBA A;  2XCB A;  4IUL A;  5KCM A;  4AP2 A;  1LF8 A;  3ZYM A;  4CDN A;  3RIB A;  4HOU A;  3Q49 B;  3AS4 A;  2A5U A;  3G2U A;  3WXX A;  4G24 A;  3MKR A;  2VGX B;  4ILI A;  1IYG A;  2IQC A;  5AYW D;  1TJC A;  3APF A;  2AXV A;  4PH4 B;  2WXI A;  5EX3 A;  3CVL A;  2AWI A;  4HFG A;  5JHB A;  5LP0 A;  4GMJ A;  1OUV A;  1ELR A;  2LNI A;  4JEH A;  4HXI A;  3T5X A;  3FEX A;  4C0M A;  2LSV A;  2VQ2 A;  4F7A A;  3QAQ A;  4EQF A;  2OVF A;  3FTX A;  2JEK A;  3GZS A;  3MCX A;  2IOL A;  2OVB A;  4B0Z A;  2WQH A;  5D0O D;  4FAD A;  2LSU A;  4GU5 A;  1FCH A;  3TG5 A;  4E85 A;  3R9A B;  2I1J A;  3ESK A;  4FLB A;  4JHR A;  5FQ8 A;  4CGV A;  5FZS A;  2WPV A;  4UWG A;  2VGY A;  3LPZ A;  3RRM B;  3L22 A;  3ZRH A;  2Q7F A;  5ARF A;  2XPI A;  4TRQ A;  4AOF A;  2WMO A;  3QOU A;  2VSX E;  4PS8 A;  1H6K A;  3B7U X;  3RK6 A;  4JC8 A;  1N54 A;  5BV1 A;  1KT0 A;  4GA1 A;  3SNX A;  3FTV A;  2GW1 A;  4ANV A;  4UWF A;  4J8E A;  3GYZ A;  1HE8 A;  2FBN A;  3MYV A;  4YVO A;  5FQ4 A;  3CR3 A;  3MKQ B;  2DIW A;  5CMY A;  4N3A A;  3KEZ A;  4K0R A;  1SQM A;  5AEN A;  4D10 C;  4BX9 A;  2WXN A;  1U3C A;  2XCC A;  1UJK A;  3QNK A;  4EZL A;  1ELW A;  1Y6I A;  4I1A A;  3ZXS A;  3ASD A;  4FHK A;  2MHK A;  4UI9 J;  2HYZ A;  3FU3 A;  3FUF A;  4ANW A;  4C9B B;  1HG2 A;  1NZN A;  4XZ4 A;  3RRN B;  2I6H A;  3L16 A;  5KJL A;  3FP3 A;  4V3I A;  3LYA A;  4G11 A;  3FUD A;  4JXT A;  4L2Y A;  5FZQ A;  3KAE A;  3UT7 A;  3P1U A;  3CHQ A;  3SF4 A;  3PE4 A;  3MV2 B;  4FLH A;  4N5C A;  2J49 A;  3HVE B;  4OVV A;  2CG2 A;  1Z3Y A;  3FUK A;  4HOT A;  3TGO A;  1B89 A;  2AXZ A;  4FC8 A;  4FA6 A;  2V8S E;  4N3C A;  5A6C A;  4L7T A;  4NQ0 A;  3FY4 A;  4GA2 A;  5FQ6 A;  5G55 A;  4F3V A;  1H2T C;  3I4G A;  3D9P A;  3ML8 A;  1HZ4 A;  3ASH A;  3ML9 A;  4J8D A;  4P29 A;  4AM9 A;  5JHA A;  4BFR A;  2YIN A;  3GW4 A;  3Q4A B;  3O48 A;  2WXO A;  3Q5M A;  4HVB A;  4JEU A;  5AJL A;  5ARG A;  3S7D A;  3L17 A;  3ZHE B;  4XE0 A;  4L23 A;  2X6H A;  1WM5 A;  2OOE A;  2AW6 A;  4KBQ A;  4U0U A;  4NAC A;  4LEU A;  1E96 B;  4JHJ A;  4MRU A;  2XHE A;  4G25 A;  4AV7 A;  4BTA A;  4GZD A;  2EQX A;  3D9M A;  2HO1 A;  3MV3 B;  3LKU A;  3NQP A;  5BUZ A;  4I1O B;  5HI7 A;  4JW1 A;  5KJK A;  2PM6 A;  2JLB A;  4GYY A;  5FTP A;  4I6E A;  3PUJ A;  2WXK A;  2MOW A;  5HQ8 A;  4MLP A;  4PS7 A;  3IEG A;  1OWL A;  4KVM A;  3D9I A;  3TG4 A;  1JWG A;  1MQS A;  4H7Y A;  4GYW A;  4URK A;  3SI5 A;  4AXH A;  3UMV A;  3CEQ A;  1HG5 A;  1VDY A;  4I6G A;  3LCA A;  4GA0 A;  3SD5 A;  3CHO A;  3ZN3 A;  5E75 A;  3CHP A;  1TEZ A;  3CVV A;  4I17 A;  4EPZ A;  3D9N A;  2XGM A;  3TL5 A;  3AU5 A;  1ZBP A;  2IJG X;  2CHZ A;  3I3N A;  1UW4 B;  3IHV A;  3ENE A;  4HOR A;  2J08 A;  2FO7 A;  3CSF A;  4ANU A;  2X6F A;  3TXM A;  3ZVV A;  3B7R L;  2GRM A;  2LAH A;  3AS8 A;  3CST A;  3LVR E;  1QZ2 A;  4UQZ A;  3AS5 A;  4GCO A;  4CGW A;  2FEZ A;  2L6J A;  3HHM A;  1SZ9 A;  4ILH B;  3UX4 A;  4I9E A;  4O6F A;  1EDU A;  1BPO A;  3U9W A;  1TJF A;  1HXI A;  3I5P A;  3JYS A;  3LDZ A;  2KZT B;  2R5S A;  3D3M A;  2NXP A;  3FWV A;  4G1T A;  4IYP A;  4KXK B;  3IBE A;  5AJD A;  2J07 A;  3MX3 A;  2ZU6 B;  3FUI A;  3QKY A;  4BX8 A;  4C0E A;  1HS6 A;  2VSO E;  3FHE A;  4EEC A;  2ILR A;  2WXR A;  2V0P A;  4A3V A;  2C2L A;  3GZ2 A;  5LCW J;  5BPP A;  4XX5 A;  3ULQ A;  3CVY A;  3FH8 A;  5M72 A;  3QB2 A;  1Y8M A;  3KS2 A;  4L1B A;  3SBT B;  3OTN A;  2XGO A;  2Y4U A;  1KLX A;  2X3M A;  3LVQ E;  1P5Q A;  3PRE A;  3FEY A;  3BG1 B;  3NZS A;  3B13 A;  4PDX A;  3UT8 A;  4BWR A;  2Y4T A;  3U4T A;  4WWO A;  1H19 A;  1H0A A;  1JWF A;  3FFL A;  4M3O A;  2PZI A;  5CHE E;  2WXF A;  2C0M A;  4LER A;  4XI0 A;  1UJJ A;  2C0L A;  4RSY A;  4FJZ A;  3ZHE A;  4JZY A;  2BUG A;  2FI7 A;  3OXF A;  2L9B A;  2X38 A;  1W3B A;  2XQ0 A;  2RD0 A;  2WXG A;  3PVL A;  5G05 C;  3BEE A;  1IHG A;  1KT1 A;  3MGB A;  5ANR A;  3FTW A;  3U3W A;  2VYI A;  2IU1 A;  1PAQ A;  3QJZ A;  1E7U A;  5FT9 A;  4DPR A;  4F1S A;  4YVQ C;  4YND A;  4CCA A;  2P58 C;  3D9O A;  3UPV A;  3RU0 A;  4A55 A;  4KT6 B;  2CFZ A;  3RO3 A;  5BT1 A;  2KCL A;  2DCP A;  3FH5 A;  2KM4 A;  1Z6T A;  2XPZ A;  3PH0 C;  5BV0 A;  3CVQ A;  1PC2 A;  4B94 A;  3LS8 A;  3HYM B;  3FTZ A;  1H2V C;  2AVP A;  2WXM A;  4B8C B;  4CT0 A;  3LY9 A;  3PRZ A;  4BY6 A;  2YHC A;  3PDN A;  2HM8 A;  3S7F A;  4HOQ A;  1SZA A;  1HX8 A;  5EKQ D;  3UQ3 A;  1FVH A;  2WXL A;  4CRW A;  4HOS A;  1E8Z A;  4JA9 A;  2J4D A;  3QWP A;  4FJY A;  5C2Y A;  3VLF A;  1OWM A;  3FUM A;  4UI9 K;  4EBA A;  1ELK A;  3ASG A;  1OWN A;  4N3B A;  5E76 A;  3FUH A;  4A1G A;  4RG9 A;  4JA7 A;  3P2B A;  4KMO A;  3MJW A;  4AVX A;  3EIJ A;  4U8H A;  2J09 A;  5DIZ A;  2PQN A;  3CK7 A;  3OAW A;  4U0Z A;  5EX0 A;  4DI4 A;  2WMN A;  3TAX A;  4WWN A;  3JQ0 A;  3RO2 A;  3UUX A;  4AEZ C;  3FTU A;  1PY1 A;  2WXP A;  4FU3 A;  5G04 C;  4BT9 A;  1JPL A;  4AY5 A;  4ABN A;  2CHX A;  5FZR A;  1ZU2 A;  2WXH A;  3QK0 A;  2HR2 A;  3PNL B;  1WY6 A;  3HVE A;  4U63 A;  3JQ1 A;  5FWQ A;  2WVI A;  1FVF A;  3ASF A;  3FTY A;  3K9I A;  5CCM A;  4XKB A;  2E0I A;  3PZD A;  4J6I A;  3SGH A;  4CDR A;  3LXU X;  3ZYK A;  2WXJ A;  3HDX A;  3B7T A;  2PQR A;  4LCT A;  3ZEF A;  4APF A;  2YHE A;  2VJ8 A;  1HU3 A;  1HFA A;  3FDH A;  3FU0 A;  3RJV A;  1IQR A;  4N2Q A;  3CQC B;  1DVP A;  5BNW A;  4G26 A;  3ONK A;  1NA3 A;  4IN3 B;  4AY6 A;  4B8A A;  3VTY A;  2YQ8 A;  4UI9 C;  2J4B A;  4WNE A;  3PEU B;  4GZ3 A;  1MHQ A;  1QNF A;  4XKC A;  5ENN A;  5JJ6 A;  1HO8 A;  4FHJ A;  2WB2 A;  4Q94 A;  3T5V A;  3Q47 B;  1X5B A;  3QDN A;  2L0T B;  3APD A;  5KJN A;  4EBA G;  4J8F A;  4WUY A;  3APC A;  3CHS A;  3EHN A;  2AXU A;  4OYS A;  3LJ3 A;  4GB9 A;  4XIF A;  5LX8 A;  4ACK A;  2CFU A;  3IHY A;  2ION A;  5CMW A;  2KCK A;  2UWJ G;  3GZ1 A;  3ONL A;  4RVB A;  2XRY A;  3LEW A;  1E8Y A;  5JJ7 A;  5KJM A;  5T3R A;  3G2T A;  4IRU A;  4ME2 A;  3FUE A;  5A7D B;  2X6K A;  2MRI A;  4JPS A;  2Y3A A;  5T8I A;  3EIQ C;  1UN8 A;  2PL2 A;  4H7X A;  5BW8 C;  4Q96 A;  3MEK A;  1E7V A;  1A17 A;  2V5F A;  5LCW C;  5EDS A;  3CKC A;  4AJW A;  3S7B A;  4KZ0 A;  2XEV A;  1INZ A;  4I9C A;  3CK8 A;  3LY7 A;  2OV8 A;  4KYO B;  3G2S A;  2NSZ A;  2YNQ A;  2VSY A;  3QWV A;  5FJY A;  3PNT B;  3ZPJ A;  2GRL A;  3FTS A;  2X6J A;  3PUK A;  1Z3X A;  3EHM A;  4PUC A;  4ANX A;  4GCN A;  2FUL A;  3CVU A;  3U64 A;  1OWP A;  4NUR A;  1E8X A;  2I1K A;  4DLO A;  4FP7 A;  3ZGQ A;  2V4L A;  3CKB A;  4GAA A;  3CVX A;  4LRZ A;  3NZU A;  4NRH B;  3ZW3 A;  2VGX A;  4EZJ A;  4UQY A;  3VTX A;  3AU4 A;  4GYO A;  4J0U A;  3QAR A;  4RG6 A;  3SBS A;  3Q15 A;  4TUU A;  3G2V A;  4E6H A;  3CK9 A;  4GML A;  4GZC A;  1NA0 A;  3C98 A;  4I43 A;  4LUN U;  1EYH A;  5FQ7 A;  3R7R A;  2X6I A;  3PEV B;  3ZYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...