1EF1C

Crystal structure of the moesin ferm domain/tail domain complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
AEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords MOESIN
total genus 22
structure length 90
sequence length 90
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.1020 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ef1C01
1EF1C 2I1KA 2I1JA
chains in the Genus database with same CATH superfamily
2VSOE 2J4DA 2RG8A 4CT4A 2L9BA 1D8DA 1KT0A 1KZPA 1DVPA 1EDUA 3SQVA 3ULQA 4GAAA 2WVIA 4Q69A 2PQRA 3E37A 3Q9NC 3PREA 4UQZA 5HS0A 3CLJA 4WNEA 4CEMA 2OCCE 5ENTD 4HRNA 1NA3A 4QFVA 5FINA 1S63A 4APFA 1FT2A 3G2SA 2ETAA 5BUZA 5EX3A 4CRWA 3PEVB 5JHBA 4I9CA 1JCSA 3CIAA 5AARA 2FO1E 4RSYA 5ENOD 3LXUX 2XRYA 3JUIA 2Y69E 2R5SA 2IO3C 3PE4A 3TWUA 3EHNA 3O4ZA 4Y6WA 3FHEA 2BF0X 4HRLA 4G24A 4U07A 3UKRG 2LUHA 3CVUA 1BU9A 4JD2G 5AQ7A 3EHQA 5A6CA 1HX8A 3U4TA 3D9MA 1SQMA 4F7AA 3TXMA 5E76A 1NZNA 3FUJA 3UIPC 3RRMB 5AIJA 1S64A 3JUEA 3RRNB 2BKGA 4GTQA 3ABME 1Q2ZA 3LY7A 4CGVA 1RW2A 4BSZB 4PS8A 3AS8A 1WDYA 3UQ3A 2HO1A 2DBAA 3IEGA 3S7JA 4UI9J 5B3SE 3V2OA 3D9NA 3OXLA 4F53A 2A5EA 1N94A 3T9KA 3S7BA 2OOEA 2VTBB 4HI9A 1N95A 3O48A 1QQEA 4C0MA 4JHKA 3FEXA 2Y1LE 4F1PA 3DPYA 4A63B 2C2LA 3BQOA 2VGEA 4MBGA 5KNHD 2YQ8A 3PH0C 3RKVA 3NZUA 3CVNA 1NI1A 4HS2A 2XPIA 3QWWA 5LCWC 5AQ9A 3FH8A 2R03A 3D9LA 4ZHBA 2Y4UA 3MV2B 4XEIG 5ENPD 2YINA 3P2BA 4HOSA 4GZCA 5ENQD 1EYHA 5BT1A 1DCEA 1TR4A 4I1MA 1Y6IA 5HQ8A 4GA1A 4DX7D 4DLQA 3FU3A 3L17A 3TL5A 5J90A 5JA4D 4GU5A 3F6QA 4NQ0A 2J4BA 3VLEA 2EIME 3E34A 5FZQA 3UT7A 3HDXA 2YHEA 3HXCA 4CCAA 1JCQA 3ZKJA 1ZB1A 4BFRA 4GTVA 2KATA 3S7FA 4C9BB 4LNGA 3LYAA 3JQ1A 5JJ6A 1U2VG 4BERA 3PNLB 5LP0A 4IULA 3UIOC 4CYMD 4GCNA 2WXOA 5EDSA 4DRXE 4L9PA 2QY7A 1N4RA 1Y8MA 3SD5A 2AXVA 1IKND 3SGHA 1A5EA 3PRZA 4APOA 4BTAA 3FUDA 3LPZA 4H7XA 3ZIMA 3FH7A 1MJ0A 4JXTA 4AIFA 4BESA 3OAWA 3S7DA 1XNFA 2R2LA 4DI4A 3D9JA 3TWRA 5G2NA 2VGXA 4U04A 3FTVA 2YHCA 3FUFA 2XEVA 2ZGDA 3FDHA 1OUVA 2XS1A 4AP2A 3CKCA 3CHRA 3C3OA 5FZSA 2GRLA 4XZ4A 4DUIA 1N4PA 2EINE 4K5BA 4B94A 5JHAA 1JCRA 5HKPA 3DSXA 4JEHA 3FUEA 5CERB 3R9AB 3FWVA 3B7UX 4KBQA 4PDXA 3BU8A 3TG5A 1KLXA 1QNFA 4ILGA 2KXPC 3C5RA 1AWCB 2PNNA 3APFA 2P9UG 1BI8B 1MX4A 3NF1A 3AAAC 3DRAA 2WPVA 5DBKA 2EIKE 4YVQC 1FT1A 5EYLA 2KCVA 3ZXPA 4J8YA 3DEPA 2C0MA 4MS6A 4BETA 4L23A 2MHKA 3C72A 4ATGA 3WG7E 3RSEG 4WNFA 3UM2A 2X6HA 4FP7A 3PDNA 1BD8A 3EU5A 4UWKA 5IY5E 4CT0A 3BG0B 4I1AA 3ABLE 3NZSA 3R7QA 4EHMA 2GGFA 1TN8A 2EILE 3B7SA 4JHRA 4J8FA 2R02A 3U64A 4L7TA 3IKOB 3LJ3A 2L0TB 1WG0A 1TNUA 3B7BA 2AVPA 2CG2A 3U3WA 1S70B 3JQ0A 4GZ6A 1WY6A 2UY1B 5CCLA 4LERA 3CVPA 2XGMA 2AWIA 1UOHA 1KZOA 3CVYA 1MQSA 4L2YA 3APDA 3EHMA 2X6KA 5AJDA 4RG6A 2Y4TA 2F37A 1N52A 4A1GA 3Q9UC 3ZXSA 3I5PA 2CHZA 3APCA 3D9PA 5ENNA 4AEZC 2XZTG 2M63A 5G04J 3UXGA 5LOZA 2MYOA 4XE0A 5FQ6A 1N0RA 4LSZE 3MKRA 4OAVB 3IV0A 5EN5D 5CECB 4FHJA 3FU5A 5EIBE 5ANLA 4JW1A 3LY9A 3Q7FA 1E7UA 4C48B 3ZYQA 3ML8A 2WQHA 2P9IG 3ASDA 2UWJG 4EZKA 2L6JA 2L0IA 4PS7A 3MYVA 1OWMA 4UWLA 3RU0A 2CHXA 4I43A 4JVSA 2I1JA 4KT6B 2XRZA 3GZ2A 4KXKB 1OWNA 1HZ4A 3ZYLA 3UX4A 2IFUA 2KCKA 2I2OA 1A17A 3DSSA 3KSQA 4K0RA 2XGOA 3QK0A 3CR3A 1QYMA 1BPOA 1OCRE 2Q7FA 3KEZA 4YDEA 4BY6A 3HVEA 3PNTB 2LXLA 3G2VA 3NOGD 2OVFA 1X81A 5A7DB 3TWVA 1LTXA 4ANXA 3CVQA 5B1BE 4KZ0A 5ENSD 3ZVVA 2FO7A 1MX2A 4HXIA 2X6IA 3K9IA 1G3NB 2HM8A 4HNAD 4GZ3A 3BG1B 4J8EA 2LSUA 5BW8C 4LEUA 3ZYMA 2DZNA 2V5FA 4EQFA 4YDYA 4EECA 2ZGGA 4GA2A 4JA7A 1ELRA 2DVWA 2JABA 3JYSA 4U0ZA 4GZDA 3ZRHA 3UM3A 3FTZA 4HOQA 3PZ1A 1HFAA 3Q5MA 3OXGA 5FQ8A 5CRUA 4ABNA 3NAWA 4N3BA 2XENA 2V0PA 3UPVA 1VDYA 2XEEA 1OXJA 5C2YA 5AAOA 5AQAA 4HRMB 5CEAA 2ZXWE 4AY5A 4BTBA 3QJZA 3ASHA 3EIQC 2IOLA 4J7WA 2AXZA 4ME2A 3ULEG 2IEJA 5G55A 1N54A 4MLPA 2WXQA 3DPDA 3NOCD 3G2WA 2CHWA 4M7CA 2XPZA 1YCSB 3ONKA 3MKQA 4EZJA 1HU3A 2IOSA 4G25A 5HRYA 1IHGA 2LAIA 3LS8A 4G2VA 1FVFA 4UI9K 3SBSA 4DX5D 4ZFHA 1IYGA 5FWQA 3ASOE 4BT8A 3R9MA 3UM0A 1E90A 4XI0A 4UWFA 1LD7A 2QYUA 4MKTA 3CKBA 3MV3B 2KBXA 1EF1C 4G26A 3LEWA 4AY6A 4O1PA 1HXIA 3UKUG 3LY8A 4U63A 5HI7A 3VLDA 4AJWA 2Y3AA 4BT9A 4ACKA 3GW4A 2J49A 5EKQD 1W3BA 4Q96A 1DC2A 1ZU2A 2QYJA 4GTOA 3FP3A 5AYWD 1YA0A 2WXLA 1Z6TA 4CGWA 3JCKC 2R05A 5A23A 5CCMA 3GYZA 5AJLA 4JB8P 4N3CA 1IQUA 3TAXA 2WQ7A 3UT8A 4L1BA 4UUCA 4AXHA 3DWLG 2DWZA 5T8IA 3DSUA 4WNDA 2IJGX 3TWXA 2VSNA 4K5CA 3V2XA 2IU1A 3CEQA 4DX6D 2XZDG 2GRPB 5T3RA 2FF4A 3B95A 2XGSA 4F1SA 4B0ZA 3LVRE 2ETCA 4KVMA 1TJCA 1K1BA 1OWLA 2WXFA 5G04C 2V8SE 3Q75A 5BXUA 5AN8A 5BXOA 3ZUVB 4JZYA 3SFXA 4J6IA 3PZ2A 4GZ5A 3Q7AA 2L6BA 1OWOA 3FUIA 5FT9A 3D3MA 4A3TA 3FEYA 2Y0BG 4FU3A 1U3DA 1DNPA 4YNDA 2F0YA 3FTXA 4DJAA 3Q4AB 2FI7A 1MHQA 3ONLA 2WXGA 4B89A 3E32A 5ARFA 4AOFA 3L22A 2NXPA 4X8QA 5ANRA 5FQ7A 4E85A 3CSFA 4FULA 1HF8A 4O60A 3PS6A 2RFMA 4GPMA 4I2WA 4I1OB 4UI9C 3UI2A 3CSTA 3SO8A 1ELWA 2IQCA 3FUHA 3PEUB 5KJKA 2I9CA 3AJIA 5CMWA 5KJLA 3TGOA 3ENEA 3D9KA 3G2UA 4LNUD 4WWOA 2YNQA 5BPPA 2CFZA 5D0QD 3SHFA 3DXKG 4NRHB 3J5PA 2RD0A 2H6GA 2A5UA 3QDNA 3KEAA 1E7VA 3TG4A 2X3MA 2J09A 5FJYA 5LFAA 3D9HA 3AG2E 4BX9A 4HFGA 2H6HA 2OEWA 1LD8A 3CHSA 1NA0A 3Q79A 3QKYA 2OEVA 1NL4A 3Q47B 1V55E 4ACLA 3AU4A 3MJWA 4FC8A 3I3NA 4LNBA 4F3VA 3FUKA 4N39A 4EBAA 4RQIA 1UJKA 4GYWA 2PZIA 3LDZA 4XKBA 2R59A 3TJPA 4TXPA 5KNGA 1X5BA 4UQXA 3CVXA 1OCOE 1UW4B 2DIWA 5LCWJ 4UWHA 4B8CB 5CBNA 2VSXE 1P5QA 3RRUA 3AG4E 2FEZA 1LF8A 2C0LA 4CDRA 3ZU7B 4N2QA 1IXVA 3PE3A 4G1TA 2DZOA 4J8SA 3QWVA 4GTPA 2ZU6B 5T4YA 4L2LA 2A4ZA 3S2AA 3PUJA 3KD7A 2FBNA 2V4HC 1AP7A 1N0QA 4LG6A 3LJNA 3CQCB 2V5QC 2VGXB 3UTMA 4WWNA 5KJMA 2XQ0A 4U95D 4DI3A 5M72A 3DSWA 3PZ4A 3MZLB 3V30A 4HLEA 3CVLA 4ANVA 4YDOA 3D9OA 3HRAA 1SZAA 4C0EA 3HYMB 2KZTB 3SI5A 3FULA 3VTXA 1SA5A 5AENA 5E75A 1O5MA 1H6OA 5B1AE 3Q49B 5CHEE 3UT4A 4IYPA 4OVVA 4A3VA 3ZYKA 2KCLA 3GZ1A 4I9EA 4DX1A 4BX8A 4D10C 4E6HA 3SFYA 5FQ4A 2V4LA 3ESLA 2J9QA 2QFCA 2WXRA 2GROB 1L5JA 2HE0A 2KM4A 4DK5A 3HXBA 3L54A 4HORA 3ZN3A 4HLLA 4EBAG 3CHMA 1YYHA 3ZGQA 4NACA 3L08A 4TUUA 1XGWA 3L9TA 3TWWA 1OWPA 1D9SA 1B89A 4NURA 5ITZF 3KAEA 3V31A 3PZ3A 4GMRA 1O1TA 1ZBPA 4AV7A 4N3AA 4I6GA 4U0SA 3QARA 4I6EA 3ASGA 5CBOA 3QNKA 1DCQA 2ILRA 1HS6A 3VTYA 3DBSA 3JXJA 5KCMA 1U3CA 4A1SA 5FIOA 4CDNA 2F8XK 2XPYA 4ANWA 4HQDA 4HB5A 4GCOA 2E0IA 3IHVA 2AXUA 3AG3E 3MX3A 5D0OD 3FY4A 2P9SG 3MKQB 1INZA 5CEDB 2DCPA 3JXIA 4DLOA 2VTBA 2P9LG 3CHOA 4B8AA 2BEDA 4N5CA 4N2SA 5G05J 4V3IA 5EILA 2I1KA 3HVEB 3L16A 2BKKB 2CFUA 4O1OA 4G23A 1MZCA 4YVOA 2H6IA 4CDMA 1MYOA 4OVUA 2WXKA 4J0UA 4DX2A 3B13A 3C3QA 1PAQA 2KZTA 1UG3A 2HYZA 4HOTA 2RFAA 2LNIA 1TNOA 4FLHA 1H2TC 1SZ9A 1TNYA 4FA6A 3EHRA 2GW1A 4W9RA 2WXJA 2F8YA 3CK9A 3ZNGA 2LO6A 2QC9A 4FLBA 3ZHEB 1FCHA 1NFIE 3B7RL 2OVBA 5KWDA 3VLFA 2P9NG 2LXMA 2WMOA 4K5AB 3DXMG 5FTPA 4KZCA 4RVBA 5EX0A 1K3ZD 5BV0A 4F6RD 4U8VD 3W9GA 3Q73A 1HG5A 3BEEA 3QOUA 4TXQA 4KYOB 5FZRA 4GYYA 3P1UA 4EZLA 2JLBA 3SF4A 2IF4A 3EIJA 1H2UA 2H6FA 2NSZA 3ML9A 1KPSB 4LCTA 1EPUA 2MOWA 2PL2A 3UMVA 4KVOA 1K8KG 5H7PA 3PUKA 4N5QA 3WXXA 1TNBA 1S0PA 4I2ZA 3EUVA 1JWGA 3MEKA 1E96B 4NIKA 1IHBA 5AQBA 4OAUC 4BSXA 3FUNA 3CHPA 1O1SA 3FUMA 4G11A 1TNZA 3HHMA 2GRNB 3NBNB 2PQNA 1JPLA 2J08A 3TXNA 4URKA 5EYPF 1SVXA 3DSVA 4IN3B 3T5VA 3CK8A 4U7EB 2BTDA 1IQRA 4KMOA 3AU5A 3SNXA 1PY1A 4XX5A 2WXMA 2XS8A 3UM1A 4I17A 2NYJA 3ULYA 3L82A 3TWTA 3SBTB 2GRRB 2FULA 1H6PA 4K03A 1SW6A 3FU0A 4JC8A 2VYIA 2XCBA 1K1AA 3E33A 2IY0C 3SY2A 3SFZA 3URZA 1MX6A 3FU6A 5D2MC 3HXEA 3T8KA 2J07A 5ENRD 3AS4A 5DIZA 2B6CA 3CHQA 3T5XA 4AVXA 4B93B 1RZ4A 3ZHEA 5LX8A 1H0AA 3MGBA 2PM7A 2KC7A 2WMNA 2ONDA 1H19A 4XKCA 3ASFA 3OTNA 3FTYA 5BV1A 4GYOA 3CQGB 3N71A 5CRVA 3KSLA 3LKUA 2UY1A 3ZW3A 4A55A 3RK6A 4LRZA 4GPKA 4EPZA 4AM9A 4GMJA 4H7YA 1E8WA 4U8YD 2P9PG 1YMPA 3DSTA 3U9WA 5C1DA 3FTSA 2DYRE 3RJVA 3MCXA 2VJ8A 3CV0A 4JHJA 2WXPA 2BUGA 4QQIA 4WUYA 3RIBA 1GW6A 3KS2A 4BWRA 1N11A 4BEPA 2AW6A 3GZSA 2AJAA 3E30A 3EJNA 4OYSA 1E8ZA 1Z5SC 1HE8A 3C98A 3FTWA 3V79K 3PVLA 1UJJA 2IO2C 3OXFA 2B0OE 3E4BA 3ASNE 4JA9A 5J08A 1HG2A 2CG3A 5EIDA 3B7TA 1PC2A 2GRMA 2P2CP 1N9AA 5JMND 3SZ7A 2WXNA 5D66A 3EDTB 2XEHA 4Z68A 2DYSE 4WWPA 2XCCA 3L6AA 1JUQA 1TYQG 3QWPA 3U66A 4TV3A 1FPPA 3RAUA 5KJNA 3HXFA 3NQPA 1N4SA 4G8LA 4FJZA 4PH4B 1BLXB 4JEUA 3D9IA 4U0UA 1SA4A 4GMLA 2EIJE 1N4QA 2I6HA 3G2TA 1UN8A 3ZFWA 3PZDA 2NC9A 2WQ6A 4PUCA 2MRIA 1H6KA 1TJFA 4GTRA 3AG1E 3ZEFA 5JJ7A 4UQYA 3CVWA 2XHEA 1TN7A 4GTMA 5G05C 1V54E 3RO3A 2IONA 4J8DA 4HOUA 3MA5A 3RO2A 3X2QE 2WM9A 3ISMC 4RG9A 5JJTA 4CZ2D 4YDWA 4ATZD 3W9FA 3ABKE 1E8XA 1Z3XA 1H2VC 4FADA 3UINC 4TXRA 4LUNU 4R7LA 4DPRA 4Q94A 4GA0A 4G8KA 3HXDA 1Z3YA 2VGYA 2E2EA 1TEZA 3LVQE 4RLYA 3TWQA 2R17C 3QB2A 1E8YA 2WXHA 4U96D 4HBDA 4ILHB 4U8HA 4I6JA 2WB2A 3ZPJA 4GTSA 4O6FA 4ANUA 3T8MA 2RKKA 3I4RB 4ILIA 3BUAA 1FVHA 3TWSA 3AS5A 3QAQA 4FJYA 1HH8A 2EQXA 3L13A 1OCZE 4GB9A 3DEOA 1KT1A 5BNWA 4WNGA 2OV8A 1JWFA 3IHYA 1BI7B 1UN9A 4JL0A 1OT8A 4TRQA 1TN6A 1WAO1 3Q78A 3J5QB 1OCCE 4Y6CA 4HI8A 3NB2A 3FFLA 2P9KG 3CVVA 5ARGA 2X6FA 2WXIA 2J8SD 3IXEA 4JPSA 2GRQB 4M3OA 3FH5A 4WAFA 2LSVA 2VSYA 3LCAA 1D8EA 1HO8A 2HR2A 1QBQA 2ZISA 1OY3D 2X38A 4HVBA 4FHKA 1NP7A 2VQ2A 2PM6A 4P29A 4IRUA 2ZIRA 4XIFA 5CMYA 3HG0D 2JEKA 1ELKA 5KBAA 3IBEA 3R7RA 3C3RA 4XI9A 3I4GA 2X6JA 4TUMA 2P58C 3Q15A 4UWGA 3HIZA 4PS3A 3QC1A 3CK7A 3UUXA 1WM5A 3EU9A 3CGHA 1QZ2A 3FTUA 3ESKA 1O1RA 4GTTA 4MRUA 2LAHA 2QZAA 2ETBA
chains in the Genus database with same CATH topology
3APCA 3D9PA 3HHMA 2VSOE 2J4DA 5ENNA 4AEZC 2RG8A 5CMWA 5KJLA 3TGOA 4CT4A 3ENEA 3D9KA 3G2UA 2L9BA 2PQNA 1KT0A 1JPLA 4WWOA 2YNQA 5BPPA 2CFZA 2M63A 1DVPA 5D0QD 3SHFA 5G04J 1EDUA 4NRHB 3ULQA 2J08A 5LOZA 3TXNA 4URKA 4DLQA 2RD0A 4GAAA 2WVIA 4Q69A 2A5UA 4XE0A 2PQRA 4IN3B 5FQ6A 3QDNA 1E7VA 3T5VA 3TG4A 3CK8A 3MKRA 3IV0A 2X3MA 2J09A 2BTDA 5FJYA 5LFAA 3PREA 1IQRA 4UQZA 4FHJA 4KMOA 3AU5A 4BX9A 3FU5A 3SNXA 1PY1A 3CLJA 4HFGA 4WNEA 5ANLA 4JW1A 4CEMA 3LY9A 4XX5A 2WXMA 1E7UA 3CHSA 4I17A 1NA0A 3QKYA 1NA3A 3ZYQA 3ML8A 4QFVA 2WQHA 3ASDA 4APFA 3G2SA 3Q47B 2UWJG 4EZKA 4ACLA 2L6JA 3SBTB 5BUZA 2FULA 3AU4A 3MJWA 4K03A 2L0IA 5EX3A 4PS7A 4CRWA 3FU0A 3MYVA 1OWMA 4UWLA 3RU0A 3PEVB 4JC8A 5JHBA 4I9CA 2VYIA 4FC8A 2CHXA 4I43A 4JVSA 2I1JA 4KT6B 2XCBA 3CIAA 3I3NA 2XRZA 3GZ2A 4RSYA 3SFZA 4KXKB 3URZA 1OWNA 1HZ4A 3LXUX 3ZYLA 3FU6A 2IFUA 3UX4A 2XRYA 2KCKA 2I2OA 3JUIA 4F3VA 1A17A 2J07A 3FUKA 4K0RA 2R5SA 4N39A 3AS4A 4EBAA 3PE4A 2XGOA 5DIZA 3QK0A 1UJKA 4GYWA 3EHNA 3CR3A 3O4ZA 1BPOA 3CHQA 4Y6WA 3T5XA 4AVXA 5KJKA 3FHEA 2BF0X 2PZIA 4G24A 4U07A 3LDZA 3ZHEA 4XKBA 5LX8A 1H0AA 2Q7FA 3MGBA 2PM7A 2KC7A 2WMNA 3KEZA 3CVUA 2ONDA 1H19A 2R59A 4BY6A 3HVEA 4XKCA 3PNTB 3TJPA 3ASFA 1X5BA 3OTNA 3G2VA 4UQXA 5A6CA 3CVXA 1HX8A 1UW4B 2OVFA 2DIWA 3U4TA 3D9MA 5LCWJ 5A7DB 1SQMA 4F7AA 3TXMA 5E76A 1NZNA 3FTYA 3FUJA 3CVQA 4UWHA 4B8CB 4ANXA 3RRMB 5AIJA 5BV1A 2VSXE 3CQGB 4GYOA 1P5QA 3N71A 4KZ0A 3ZVVA 3RRNB 3RRUA 2FEZA 2FO7A 1LF8A 2C0LA 4HXIA 3LY7A 4CGVA 3LKUA 2X6IA 3K9IA 4CDRA 2UY1A 3ZW3A 4N2QA 4A55A 4PS8A 3RK6A 2HM8A 3AS8A 4LRZA 4GPKA 4EPZA 4AM9A 3PE3A 4G1TA 4GZ3A 3BG1B 4J8EA 2LSUA 4J8SA 5BW8C 3UQ3A 4GMJA 2HO1A 3QWVA 2DBAA 2ZU6B 4H7YA 4LEUA 1E8WA 3ZYMA 5T4YA 3IEGA 3S7JA 2V5FA 4EQFA 4UI9J 4L2LA 4EECA 3D9NA 2A4ZA 3U9WA 5C1DA 3S2AA 3FTSA 3OXLA 4GA2A 4F53A 3PUJA 4JA7A 3KD7A 2FBNA 3RJVA 1ELRA 3MCXA 2VJ8A 3JYSA 3S7BA 2OOEA 3CV0A 4GZDA 4U0ZA 2VTBB 3O48A 4JHJA 2WXPA 3ZRHA 2BUGA 1QQEA 3CQCB 4WUYA 3RIBA 1GW6A 3FTZA 3KS2A 4C0MA 4HOQA 2VGXB 4JHKA 3FEXA 4BWRA 4WWNA 2AW6A 2C2LA 5KJMA 2XQ0A 4DI3A 3GZSA 5M72A 2YQ8A 3PH0C 3RKVA 1HFAA 3NZUA 3MZLB 3Q5MA 3OXGA 4HLEA 3CVNA 5FQ8A 3EJNA 4OYSA 1E8ZA 3CVLA 1HE8A 3C98A 3FTWA 4HS2A 4ABNA 4ANVA 3PVLA 2XPIA 3D9OA 2V0PA 4N3BA 3UPVA 1SZAA 1UJJA 3OXFA 1VDYA 4C0EA 5C2YA 3HYMB 3E4BA 2KZTB 3QWWA 5LCWC 3FH8A 3SI5A 3FULA 3VTXA 3D9LA 5AENA 2Y4UA 3MV2B 4JA9A 5E75A 4AY5A 4BTBA 5J08A 1HG2A 2YINA 2CG3A 3B7TA 3QJZA 3Q49B 5CHEE 3UT4A 3P2BA 3ASHA 3EIQC 4IYPA 4OVVA 1PC2A 4HOSA 2IOLA 2GRMA 4GZCA 4A3VA 3SZ7A 3ZYKA 1EYHA 2KCLA 2WXNA 3GZ1A 5BT1A 4I1MA 4I9EA 2AXZA 3EDTB 4ME2A 4BX8A 1Y6IA 4D10C 4E6HA 4GA1A 5HQ8A 4WWPA 5G55A 5FQ4A 2XCCA 1N54A 1JUQA 2V4LA 3ESLA 3FU3A 3L6AA 2J9QA 2QFCA 2WXRA 4MLPA 3L17A 3QWPA 2WXQA 3DPDA 3TL5A 5J90A 3U66A 3G2WA 4TV3A 2CHWA 1L5JA 5KJNA 2KM4A 3NQPA 4GU5A 2XPZA 4DK5A 3L54A 4FJZA 4PH4B 3ONKA 4HORA 4NQ0A 2J4BA 3ZN3A 3MKQA 3VLEA 4JEUA 4EZJA 1HU3A 3D9IA 4EBAG 4U0UA 3CHMA 4GMLA 2IOSA 2I6HA 4G25A 3ZGQA 1IHGA 3G2TA 1UN8A 5FZQA 2LAIA 4NACA 3L08A 3UT7A 3HDXA 1XGWA 2YHEA 4TUUA 3LS8A 4G2VA 3ZFWA 4CCAA 3PZDA 1OWPA 1FVFA 4UI9K 3SBSA 2NC9A 2WQ6A 4PUCA 1IYGA 1B89A 4NURA 2MRIA 4BFRA 3KAEA 2KATA 1H6KA 3S7FA 5FWQA 1TJFA 4C9BB 3LYAA 4BT8A 1ZBPA 3JQ1A 5JJ6A 5LP0A 3PNLB 4AV7A 3ZEFA 4N3AA 4IULA 5JJ7A 4I6GA 1E90A 4UQYA 4U0SA 3CVWA 2XHEA 4GCNA 4XI0A 4UWFA 4MKTA 2WXOA 3CKBA 3MV3B 3QARA 4I6EA 3ASGA 5EDSA 1EF1C 2QY7A 3QNKA 1Y8MA 4G26A 3LEWA 5G05C 3RO3A 4AY6A 2ILRA 2IONA 1HS6A 1HXIA 4J8DA 4HOUA 3VTYA 3DBSA 3LY8A 3SD5A 3MA5A 2AXVA 4U63A 3RO2A 5KCMA 3SGHA 3PRZA 1U3CA 4A1SA 4APOA 4CDNA 4BTAA 3FUDA 3LPZA 4H7XA 2WM9A 5HI7A 3VLDA 2XPYA 3ZIMA 4AJWA 4RG9A 2Y3AA 5JJTA 4ANWA 3FH7A 4BT9A 4ACKA 4JXTA 4GCOA 3GW4A 2E0IA 3IHVA 2AXUA 3OAWA 3S7DA 1XNFA 3MX3A 2J49A 4AIFA 4DI4A 5EKQD 1E8XA 1Z3XA 3D9JA 1H2VC 5D0OD 3FY4A 4FADA 1W3BA 3MKQB 5G2NA 4Q96A 2VGXA 4LUNU 3FTVA 4R7LA 4U04A 1ZU2A 2YHCA 4DPRA 1INZA 3FUFA 2DCPA 4DLOA 2XEVA 3FP3A 3FDHA 2VTBA 1OUVA 4Q94A 5AYWD 4GA0A 3CKCA 4AP2A 3CHOA 4B8AA 1YA0A 1Z3YA 4N5CA 2VGYA 2WXLA 4N2SA 3CHRA 2E2EA 1Z6TA 5FZSA 3JCKC 5G05J 4V3IA 4CGWA 1TEZA 2GRLA 5A23A 5CCMA 3GYZA 5AJLA 2I1KA 3LVQE 3HVEB 1IQUA 3L16A 4N3CA 4XZ4A 2CFUA 3TAXA 2WQ7A 3UT8A 4L1BA 2R17C 3QB2A 1E8YA 2WXHA 4G23A 4B94A 4YVOA 5JHAA 4AXHA 4ILHB 4U8HA 4I6JA 4JEHA 3FUEA 3ZPJA 4CDMA 2WB2A 3R9AB 3FWVA 3B7UX 5T8IA 4OVUA 2WXKA 4O6FA 4KBQA 4J0UA 4ANUA 3B13A 4PDXA 4WNDA 1PAQA 3TG5A 3T8MA 1KLXA 2IJGX 3I4RB 4ILIA 2KZTA 1QNFA 1UG3A 2VSNA 4ILGA 1FVHA 2HYZA 3AS5A 2IU1A 4HOTA 3QAQA 4FJYA 2LNIA 1HH8A 3APFA 2EQXA 3CEQA 3L13A 4FLHA 5T3RA 2FF4A 3NF1A 1H2TC 2XGSA 1SZ9A 4GB9A 4FA6A 4F1SA 4B0ZA 3LVRE 2GW1A 1KT1A 2WPVA 4KVMA 4W9RA 1TJCA 5BNWA 2WXJA 4WNGA 1OWLA 2WXFA 3CK9A 5G04C 5DBKA 2V8SE 4YVQC 2LO6A 2OV8A 1JWFA 2KCVA 4FLBA 3IHYA 3ZHEB 1FCHA 3B7RL 2C0MA 1UN9A 4MS6A 4JL0A 2OVBA 4TRQA 3VLFA 1WAO1 2WMOA 4L23A 2MHKA 4ATGA 5FTPA 4KZCA 4RVBA 4JZYA 4J6IA 5EX0A 4Y6CA 5BV0A 4GZ5A 4WNFA 3FFLA 1OWOA 1HG5A 3FUIA 3BEEA 2X6HA 3CVVA 4FP7A 3PDNA 5ARGA 3QOUA 5FT9A 2X6FA 2WXIA 4JPSA 4KYOB 5FZRA 4UWKA 4M3OA 3D3MA 4GYYA 3P1UA 3FH5A 4A3TA 4WAFA 3FEYA 4CT0A 4EZLA 2LSVA 3BG0B 4FU3A 2VSYA 2JLBA 4I1AA 3LCAA 3NZSA 1U3DA 3SF4A 1DNPA 3R7QA 1HO8A 2IF4A 2HR2A 4YNDA 3EIJA 2GGFA 1H2UA 2NSZA 2X38A 3B7SA 4HVBA 4JHRA 3ML9A 4FHKA 3FTXA 3Q4AB 4J8FA 1NP7A 4LCTA 2VQ2A 2FI7A 3U64A 1MHQA 2PM6A 4DJAA 3ONLA 2WXGA 1EPUA 4L7TA 4IRUA 4P29A 3IKOB 2MOWA 3LJ3A 4B89A 2L0TB 4XIFA 2PL2A 3UMVA 5CMYA 2JEKA 1ELKA 4KVOA 2AVPA 2CG2A 3IBEA 3U3WA 5ARFA 3R7RA 3JQ0A 4GZ6A 4XI9A 1WY6A 2UY1B 3I4GA 4AOFA 3L22A 2NXPA 3PUKA 2X6JA 5ANRA 5CCLA 3WXXA 4LERA 1S0PA 5FQ7A 4E85A 2P58C 4I2ZA 3CSFA 3CVPA 3Q15A 4FULA 1HF8A 2AWIA 2XGMA 4UWGA 1JWGA 3PS6A 3MEKA 3HIZA 3CVYA 4PS3A 3QC1A 1E96B 1MQSA 3CK7A 4I2WA 4L2YA 4I1OB 3UUXA 3APDA 3EHMA 1WM5A 2X6KA 4UI9C 3CGHA 5AJDA 4BSXA 4RG6A 1QZ2A 3FTUA 2Y4TA 3CSTA 3ESKA 3FUNA 4MRUA 3CHPA 1ELWA 1N52A 2LAHA 2IQCA 3FUHA 3FUMA 4A1GA 3ZXSA 3PEUB 2I9CA 3I5PA 2CHZA 4G11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EF1 C;  2I1K A;  2I1J A; 
#chains in the Genus database with same CATH topology
 2VSO E;  2J4D A;  2RG8 A;  4CT4 A;  2L9B A;  1D8D A;  1KT0 A;  1KZP A;  1DVP A;  1EDU A;  3SQV A;  3ULQ A;  4GAA A;  2WVI A;  4Q69 A;  2PQR A;  3E37 A;  3Q9N C;  3PRE A;  4UQZ A;  5HS0 A;  3CLJ A;  4WNE A;  4CEM A;  2OCC E;  5ENT D;  4HRN A;  1NA3 A;  4QFV A;  5FIN A;  1S63 A;  4APF A;  1FT2 A;  3G2S A;  2ETA A;  5BUZ A;  5EX3 A;  4CRW A;  3PEV B;  5JHB A;  4I9C A;  1JCS A;  3CIA A;  5AAR A;  2FO1 E;  4RSY A;  5ENO D;  3LXU X;  2XRY A;  3JUI A;  2Y69 E;  2R5S A;  2IO3 C;  3PE4 A;  3TWU A;  3EHN A;  3O4Z A;  4Y6W A;  3FHE A;  2BF0 X;  4HRL A;  4G24 A;  4U07 A;  3UKR G;  2LUH A;  3CVU A;  1BU9 A;  4JD2 G;  5AQ7 A;  3EHQ A;  5A6C A;  1HX8 A;  3U4T A;  3D9M A;  1SQM A;  4F7A A;  3TXM A;  5E76 A;  1NZN A;  3FUJ A;  3UIP C;  3RRM B;  5AIJ A;  1S64 A;  3JUE A;  3RRN B;  2BKG A;  4GTQ A;  3ABM E;  1Q2Z A;  3LY7 A;  4CGV A;  1RW2 A;  4BSZ B;  4PS8 A;  3AS8 A;  1WDY A;  3UQ3 A;  2HO1 A;  2DBA A;  3IEG A;  3S7J A;  4UI9 J;  5B3S E;  3V2O A;  3D9N A;  3OXL A;  4F53 A;  2A5E A;  1N94 A;  3T9K A;  3S7B A;  2OOE A;  2VTB B;  4HI9 A;  1N95 A;  3O48 A;  1QQE A;  4C0M A;  4JHK A;  3FEX A;  2Y1L E;  4F1P A;  3DPY A;  4A63 B;  2C2L A;  3BQO A;  2VGE A;  4MBG A;  5KNH D;  2YQ8 A;  3PH0 C;  3RKV A;  3NZU A;  3CVN A;  1NI1 A;  4HS2 A;  2XPI A;  3QWW A;  5LCW C;  5AQ9 A;  3FH8 A;  2R03 A;  3D9L A;  4ZHB A;  2Y4U A;  3MV2 B;  4XEI G;  5ENP D;  2YIN A;  3P2B A;  4HOS A;  4GZC A;  5ENQ D;  1EYH A;  5BT1 A;  1DCE A;  1TR4 A;  4I1M A;  1Y6I A;  5HQ8 A;  4GA1 A;  4DX7 D;  4DLQ A;  3FU3 A;  3L17 A;  3TL5 A;  5J90 A;  5JA4 D;  4GU5 A;  3F6Q A;  4NQ0 A;  2J4B A;  3VLE A;  2EIM E;  3E34 A;  5FZQ A;  3UT7 A;  3HDX A;  2YHE A;  3HXC A;  4CCA A;  1JCQ A;  3ZKJ A;  1ZB1 A;  4BFR A;  4GTV A;  2KAT A;  3S7F A;  4C9B B;  4LNG A;  3LYA A;  3JQ1 A;  5JJ6 A;  1U2V G;  4BER A;  3PNL B;  5LP0 A;  4IUL A;  3UIO C;  4CYM D;  4GCN A;  2WXO A;  5EDS A;  4DRX E;  4L9P A;  2QY7 A;  1N4R A;  1Y8M A;  3SD5 A;  2AXV A;  1IKN D;  3SGH A;  1A5E A;  3PRZ A;  4APO A;  4BTA A;  3FUD A;  3LPZ A;  4H7X A;  3ZIM A;  3FH7 A;  1MJ0 A;  4JXT A;  4AIF A;  4BES A;  3OAW A;  3S7D A;  1XNF A;  2R2L A;  4DI4 A;  3D9J A;  3TWR A;  5G2N A;  2VGX A;  4U04 A;  3FTV A;  2YHC A;  3FUF A;  2XEV A;  2ZGD A;  3FDH A;  1OUV A;  2XS1 A;  4AP2 A;  3CKC A;  3CHR A;  3C3O A;  5FZS A;  2GRL A;  4XZ4 A;  4DUI A;  1N4P A;  2EIN E;  4K5B A;  4B94 A;  5JHA A;  1JCR A;  5HKP A;  3DSX A;  4JEH A;  3FUE A;  5CER B;  3R9A B;  3FWV A;  3B7U X;  4KBQ A;  4PDX A;  3BU8 A;  3TG5 A;  1KLX A;  1QNF A;  4ILG A;  2KXP C;  3C5R A;  1AWC B;  2PNN A;  3APF A;  2P9U G;  1BI8 B;  1MX4 A;  3NF1 A;  3AAA C;  3DRA A;  2WPV A;  5DBK A;  2EIK E;  4YVQ C;  1FT1 A;  5EYL A;  2KCV A;  3ZXP A;  4J8Y A;  3DEP A;  2C0M A;  4MS6 A;  4BET A;  4L23 A;  2MHK A;  3C72 A;  4ATG A;  3WG7 E;  3RSE G;  4WNF A;  3UM2 A;  2X6H A;  4FP7 A;  3PDN A;  1BD8 A;  3EU5 A;  4UWK A;  5IY5 E;  4CT0 A;  3BG0 B;  4I1A A;  3ABL E;  3NZS A;  3R7Q A;  4EHM A;  2GGF A;  1TN8 A;  2EIL E;  3B7S A;  4JHR A;  4J8F A;  2R02 A;  3U64 A;  4L7T A;  3IKO B;  3LJ3 A;  2L0T B;  1WG0 A;  1TNU A;  3B7B A;  2AVP A;  2CG2 A;  3U3W A;  1S70 B;  3JQ0 A;  4GZ6 A;  1WY6 A;  2UY1 B;  5CCL A;  4LER A;  3CVP A;  2XGM A;  2AWI A;  1UOH A;  1KZO A;  3CVY A;  1MQS A;  4L2Y A;  3APD A;  3EHM A;  2X6K A;  5AJD A;  4RG6 A;  2Y4T A;  2F37 A;  1N52 A;  4A1G A;  3Q9U C;  3ZXS A;  3I5P A;  2CHZ A;  3APC A;  3D9P A;  5ENN A;  4AEZ C;  2XZT G;  2M63 A;  5G04 J;  3UXG A;  5LOZ A;  2MYO A;  4XE0 A;  5FQ6 A;  1N0R A;  4LSZ E;  3MKR A;  4OAV B;  3IV0 A;  5EN5 D;  5CEC B;  4FHJ A;  3FU5 A;  5EIB E;  5ANL A;  4JW1 A;  3LY9 A;  3Q7F A;  1E7U A;  4C48 B;  3ZYQ A;  3ML8 A;  2WQH A;  2P9I G;  3ASD A;  2UWJ G;  4EZK A;  2L6J A;  2L0I A;  4PS7 A;  3MYV A;  1OWM A;  4UWL A;  3RU0 A;  2CHX A;  4I43 A;  4JVS A;  2I1J A;  4KT6 B;  2XRZ A;  3GZ2 A;  4KXK B;  1OWN A;  1HZ4 A;  3ZYL A;  3UX4 A;  2IFU A;  2KCK A;  2I2O A;  1A17 A;  3DSS A;  3KSQ A;  4K0R A;  2XGO A;  3QK0 A;  3CR3 A;  1QYM A;  1BPO A;  1OCR E;  2Q7F A;  3KEZ A;  4YDE A;  4BY6 A;  3HVE A;  3PNT B;  2LXL A;  3G2V A;  3NOG D;  2OVF A;  1X81 A;  5A7D B;  3TWV A;  1LTX A;  4ANX A;  3CVQ A;  5B1B E;  4KZ0 A;  5ENS D;  3ZVV A;  2FO7 A;  1MX2 A;  4HXI A;  2X6I A;  3K9I A;  1G3N B;  2HM8 A;  4HNA D;  4GZ3 A;  3BG1 B;  4J8E A;  2LSU A;  5BW8 C;  4LEU A;  3ZYM A;  2DZN A;  2V5F A;  4EQF A;  4YDY A;  4EEC A;  2ZGG A;  4GA2 A;  4JA7 A;  1ELR A;  2DVW A;  2JAB A;  3JYS A;  4U0Z A;  4GZD A;  3ZRH A;  3UM3 A;  3FTZ A;  4HOQ A;  3PZ1 A;  1HFA A;  3Q5M A;  3OXG A;  5FQ8 A;  5CRU A;  4ABN A;  3NAW A;  4N3B A;  2XEN A;  2V0P A;  3UPV A;  1VDY A;  2XEE A;  1OXJ A;  5C2Y A;  5AAO A;  5AQA A;  4HRM B;  5CEA A;  2ZXW E;  4AY5 A;  4BTB A;  3QJZ A;  3ASH A;  3EIQ C;  2IOL A;  4J7W A;  2AXZ A;  4ME2 A;  3ULE G;  2IEJ A;  5G55 A;  1N54 A;  4MLP A;  2WXQ A;  3DPD A;  3NOC D;  3G2W A;  2CHW A;  4M7C A;  2XPZ A;  1YCS B;  3ONK A;  3MKQ A;  4EZJ A;  1HU3 A;  2IOS A;  4G25 A;  5HRY A;  1IHG A;  2LAI A;  3LS8 A;  4G2V A;  1FVF A;  4UI9 K;  3SBS A;  4DX5 D;  4ZFH A;  1IYG A;  5FWQ A;  3ASO E;  4BT8 A;  3R9M A;  3UM0 A;  1E90 A;  4XI0 A;  4UWF A;  1LD7 A;  2QYU A;  4MKT A;  3CKB A;  3MV3 B;  2KBX A;  1EF1 C;  4G26 A;  3LEW A;  4AY6 A;  4O1P A;  1HXI A;  3UKU G;  3LY8 A;  4U63 A;  5HI7 A;  3VLD A;  4AJW A;  2Y3A A;  4BT9 A;  4ACK A;  3GW4 A;  2J49 A;  5EKQ D;  1W3B A;  4Q96 A;  1DC2 A;  1ZU2 A;  2QYJ A;  4GTO A;  3FP3 A;  5AYW D;  1YA0 A;  2WXL A;  1Z6T A;  4CGW A;  3JCK C;  2R05 A;  5A23 A;  5CCM A;  3GYZ A;  5AJL A;  4JB8 P;  4N3C A;  1IQU A;  3TAX A;  2WQ7 A;  3UT8 A;  4L1B A;  4UUC A;  4AXH A;  3DWL G;  2DWZ A;  5T8I A;  3DSU A;  4WND A;  2IJG X;  3TWX A;  2VSN A;  4K5C A;  3V2X A;  2IU1 A;  3CEQ A;  4DX6 D;  2XZD G;  2GRP B;  5T3R A;  2FF4 A;  3B95 A;  2XGS A;  4F1S A;  4B0Z A;  3LVR E;  2ETC A;  4KVM A;  1TJC A;  1K1B A;  1OWL A;  2WXF A;  5G04 C;  2V8S E;  3Q75 A;  5BXU A;  5AN8 A;  5BXO A;  3ZUV B;  4JZY A;  3SFX A;  4J6I A;  3PZ2 A;  4GZ5 A;  3Q7A A;  2L6B A;  1OWO A;  3FUI A;  5FT9 A;  3D3M A;  4A3T A;  3FEY A;  2Y0B G;  4FU3 A;  1U3D A;  1DNP A;  4YND A;  2F0Y A;  3FTX A;  4DJA A;  3Q4A B;  2FI7 A;  1MHQ A;  3ONL A;  2WXG A;  4B89 A;  3E32 A;  5ARF A;  4AOF A;  3L22 A;  2NXP A;  4X8Q A;  5ANR A;  5FQ7 A;  4E85 A;  3CSF A;  4FUL A;  1HF8 A;  4O60 A;  3PS6 A;  2RFM A;  4GPM A;  4I2W A;  4I1O B;  4UI9 C;  3UI2 A;  3CST A;  3SO8 A;  1ELW A;  2IQC A;  3FUH A;  3PEU B;  5KJK A;  2I9C A;  3AJI A;  5CMW A;  5KJL A;  3TGO A;  3ENE A;  3D9K A;  3G2U A;  4LNU D;  4WWO A;  2YNQ A;  5BPP A;  2CFZ A;  5D0Q D;  3SHF A;  3DXK G;  4NRH B;  3J5P A;  2RD0 A;  2H6G A;  2A5U A;  3QDN A;  3KEA A;  1E7V A;  3TG4 A;  2X3M A;  2J09 A;  5FJY A;  5LFA A;  3D9H A;  3AG2 E;  4BX9 A;  4HFG A;  2H6H A;  2OEW A;  1LD8 A;  3CHS A;  1NA0 A;  3Q79 A;  3QKY A;  2OEV A;  1NL4 A;  3Q47 B;  1V55 E;  4ACL A;  3AU4 A;  3MJW A;  4FC8 A;  3I3N A;  4LNB A;  4F3V A;  3FUK A;  4N39 A;  4EBA A;  4RQI A;  1UJK A;  4GYW A;  2PZI A;  3LDZ A;  4XKB A;  2R59 A;  3TJP A;  4TXP A;  5KNG A;  1X5B A;  4UQX A;  3CVX A;  1OCO E;  1UW4 B;  2DIW A;  5LCW J;  4UWH A;  4B8C B;  5CBN A;  2VSX E;  1P5Q A;  3RRU A;  3AG4 E;  2FEZ A;  1LF8 A;  2C0L A;  4CDR A;  3ZU7 B;  4N2Q A;  1IXV A;  3PE3 A;  4G1T A;  2DZO A;  4J8S A;  3QWV A;  4GTP A;  2ZU6 B;  5T4Y A;  4L2L A;  2A4Z A;  3S2A A;  3PUJ A;  3KD7 A;  2FBN A;  2V4H C;  1AP7 A;  1N0Q A;  4LG6 A;  3LJN A;  3CQC B;  2V5Q C;  2VGX B;  3UTM A;  4WWN A;  5KJM A;  2XQ0 A;  4U95 D;  4DI3 A;  5M72 A;  3DSW A;  3PZ4 A;  3MZL B;  3V30 A;  4HLE A;  3CVL A;  4ANV A;  4YDO A;  3D9O A;  3HRA A;  1SZA A;  4C0E A;  3HYM B;  2KZT B;  3SI5 A;  3FUL A;  3VTX A;  1SA5 A;  5AEN A;  5E75 A;  1O5M A;  1H6O A;  5B1A E;  3Q49 B;  5CHE E;  3UT4 A;  4IYP A;  4OVV A;  4A3V A;  3ZYK A;  2KCL A;  3GZ1 A;  4I9E A;  4DX1 A;  4BX8 A;  4D10 C;  4E6H A;  3SFY A;  5FQ4 A;  2V4L A;  3ESL A;  2J9Q A;  2QFC A;  2WXR A;  2GRO B;  1L5J A;  2HE0 A;  2KM4 A;  4DK5 A;  3HXB A;  3L54 A;  4HOR A;  3ZN3 A;  4HLL A;  4EBA G;  3CHM A;  1YYH A;  3ZGQ A;  4NAC A;  3L08 A;  4TUU A;  1XGW A;  3L9T A;  3TWW A;  1OWP A;  1D9S A;  1B89 A;  4NUR A;  5ITZ F;  3KAE A;  3V31 A;  3PZ3 A;  4GMR A;  1O1T A;  1ZBP A;  4AV7 A;  4N3A A;  4I6G A;  4U0S A;  3QAR A;  4I6E A;  3ASG A;  5CBO A;  3QNK A;  1DCQ A;  2ILR A;  1HS6 A;  3VTY A;  3DBS A;  3JXJ A;  5KCM A;  1U3C A;  4A1S A;  5FIO A;  4CDN A;  2F8X K;  2XPY A;  4ANW A;  4HQD A;  4HB5 A;  4GCO A;  2E0I A;  3IHV A;  2AXU A;  3AG3 E;  3MX3 A;  5D0O D;  3FY4 A;  2P9S G;  3MKQ B;  1INZ A;  5CED B;  2DCP A;  3JXI A;  4DLO A;  2VTB A;  2P9L G;  3CHO A;  4B8A A;  2BED A;  4N5C A;  4N2S A;  5G05 J;  4V3I A;  5EIL A;  2I1K A;  3HVE B;  3L16 A;  2BKK B;  2CFU A;  4O1O A;  4G23 A;  1MZC A;  4YVO A;  2H6I A;  4CDM A;  1MYO A;  4OVU A;  2WXK A;  4J0U A;  4DX2 A;  3B13 A;  3C3Q A;  1PAQ A;  2KZT A;  1UG3 A;  2HYZ A;  4HOT A;  2RFA A;  2LNI A;  1TNO A;  4FLH A;  1H2T C;  1SZ9 A;  1TNY A;  4FA6 A;  3EHR A;  2GW1 A;  4W9R A;  2WXJ A;  2F8Y A;  3CK9 A;  3ZNG A;  2LO6 A;  2QC9 A;  4FLB A;  3ZHE B;  1FCH A;  1NFI E;  3B7R L;  2OVB A;  5KWD A;  3VLF A;  2P9N G;  2LXM A;  2WMO A;  4K5A B;  3DXM G;  5FTP A;  4KZC A;  4RVB A;  5EX0 A;  1K3Z D;  5BV0 A;  4F6R D;  4U8V D;  3W9G A;  3Q73 A;  1HG5 A;  3BEE A;  3QOU A;  4TXQ A;  4KYO B;  5FZR A;  4GYY A;  3P1U A;  4EZL A;  2JLB A;  3SF4 A;  2IF4 A;  3EIJ A;  1H2U A;  2H6F A;  2NSZ A;  3ML9 A;  1KPS B;  4LCT A;  1EPU A;  2MOW A;  2PL2 A;  3UMV A;  4KVO A;  1K8K G;  5H7P A;  3PUK A;  4N5Q A;  3WXX A;  1TNB A;  1S0P A;  4I2Z A;  3EUV A;  1JWG A;  3MEK A;  1E96 B;  4NIK A;  1IHB A;  5AQB A;  4OAU C;  4BSX A;  3FUN A;  3CHP A;  1O1S A;  3FUM A;  4G11 A;  1TNZ A;  3HHM A;  2GRN B;  3NBN B;  2PQN A;  1JPL A;  2J08 A;  3TXN A;  4URK A;  5EYP F;  1SVX A;  3DSV A;  4IN3 B;  3T5V A;  3CK8 A;  4U7E B;  2BTD A;  1IQR A;  4KMO A;  3AU5 A;  3SNX A;  1PY1 A;  4XX5 A;  2WXM A;  2XS8 A;  3UM1 A;  4I17 A;  2NYJ A;  3ULY A;  3L82 A;  3TWT A;  3SBT B;  2GRR B;  2FUL A;  1H6P A;  4K03 A;  1SW6 A;  3FU0 A;  4JC8 A;  2VYI A;  2XCB A;  1K1A A;  3E33 A;  2IY0 C;  3SY2 A;  3SFZ A;  3URZ A;  1MX6 A;  3FU6 A;  5D2M C;  3HXE A;  3T8K A;  2J07 A;  5ENR D;  3AS4 A;  5DIZ A;  2B6C A;  3CHQ A;  3T5X A;  4AVX A;  4B93 B;  1RZ4 A;  3ZHE A;  5LX8 A;  1H0A A;  3MGB A;  2PM7 A;  2KC7 A;  2WMN A;  2OND A;  1H19 A;  4XKC A;  3ASF A;  3OTN A;  3FTY A;  5BV1 A;  4GYO A;  3CQG B;  3N71 A;  5CRV A;  3KSL A;  3LKU A;  2UY1 A;  3ZW3 A;  4A55 A;  3RK6 A;  4LRZ A;  4GPK A;  4EPZ A;  4AM9 A;  4GMJ A;  4H7Y A;  1E8W A;  4U8Y D;  2P9P G;  1YMP A;  3DST A;  3U9W A;  5C1D A;  3FTS A;  2DYR E;  3RJV A;  3MCX A;  2VJ8 A;  3CV0 A;  4JHJ A;  2WXP A;  2BUG A;  4QQI A;  4WUY A;  3RIB A;  1GW6 A;  3KS2 A;  4BWR A;  1N11 A;  4BEP A;  2AW6 A;  3GZS A;  2AJA A;  3E30 A;  3EJN A;  4OYS A;  1E8Z A;  1Z5S C;  1HE8 A;  3C98 A;  3FTW A;  3V79 K;  3PVL A;  1UJJ A;  2IO2 C;  3OXF A;  2B0O E;  3E4B A;  3ASN E;  4JA9 A;  5J08 A;  1HG2 A;  2CG3 A;  5EID A;  3B7T A;  1PC2 A;  2GRM A;  2P2C P;  1N9A A;  5JMN D;  3SZ7 A;  2WXN A;  5D66 A;  3EDT B;  2XEH A;  4Z68 A;  2DYS E;  4WWP A;  2XCC A;  3L6A A;  1JUQ A;  1TYQ G;  3QWP A;  3U66 A;  4TV3 A;  1FPP A;  3RAU A;  5KJN A;  3HXF A;  3NQP A;  1N4S A;  4G8L A;  4FJZ A;  4PH4 B;  1BLX B;  4JEU A;  3D9I A;  4U0U A;  1SA4 A;  4GML A;  2EIJ E;  1N4Q A;  2I6H A;  3G2T A;  1UN8 A;  3ZFW A;  3PZD A;  2NC9 A;  2WQ6 A;  4PUC A;  2MRI A;  1H6K A;  1TJF A;  4GTR A;  3AG1 E;  3ZEF A;  5JJ7 A;  4UQY A;  3CVW A;  2XHE A;  1TN7 A;  4GTM A;  5G05 C;  1V54 E;  3RO3 A;  2ION A;  4J8D A;  4HOU A;  3MA5 A;  3RO2 A;  3X2Q E;  2WM9 A;  3ISM C;  4RG9 A;  5JJT A;  4CZ2 D;  4YDW A;  4ATZ D;  3W9F A;  3ABK E;  1E8X A;  1Z3X A;  1H2V C;  4FAD A;  3UIN C;  4TXR A;  4LUN U;  4R7L A;  4DPR A;  4Q94 A;  4GA0 A;  4G8K A;  3HXD A;  1Z3Y A;  2VGY A;  2E2E A;  1TEZ A;  3LVQ E;  4RLY A;  3TWQ A;  2R17 C;  3QB2 A;  1E8Y A;  2WXH A;  4U96 D;  4HBD A;  4ILH B;  4U8H A;  4I6J A;  2WB2 A;  3ZPJ A;  4GTS A;  4O6F A;  4ANU A;  3T8M A;  2RKK A;  3I4R B;  4ILI A;  3BUA A;  1FVH A;  3TWS A;  3AS5 A;  3QAQ A;  4FJY A;  1HH8 A;  2EQX A;  3L13 A;  1OCZ E;  4GB9 A;  3DEO A;  1KT1 A;  5BNW A;  4WNG A;  2OV8 A;  1JWF A;  3IHY A;  1BI7 B;  1UN9 A;  4JL0 A;  1OT8 A;  4TRQ A;  1TN6 A;  1WAO 1;  3Q78 A;  3J5Q B;  1OCC E;  4Y6C A;  4HI8 A;  3NB2 A;  3FFL A;  2P9K G;  3CVV A;  5ARG A;  2X6F A;  2WXI A;  2J8S D;  3IXE A;  4JPS A;  2GRQ B;  4M3O A;  3FH5 A;  4WAF A;  2LSV A;  2VSY A;  3LCA A;  1D8E A;  1HO8 A;  2HR2 A;  1QBQ A;  2ZIS A;  1OY3 D;  2X38 A;  4HVB A;  4FHK A;  1NP7 A;  2VQ2 A;  2PM6 A;  4P29 A;  4IRU A;  2ZIR A;  4XIF A;  5CMY A;  3HG0 D;  2JEK A;  1ELK A;  5KBA A;  3IBE A;  3R7R A;  3C3R A;  4XI9 A;  3I4G A;  2X6J A;  4TUM A;  2P58 C;  3Q15 A;  4UWG A;  3HIZ A;  4PS3 A;  3QC1 A;  3CK7 A;  3UUX A;  1WM5 A;  3EU9 A;  3CGH A;  1QZ2 A;  3FTU A;  3ESK A;  1O1R A;  4GTT A;  4MRU A;  2LAH A;  2QZA A;  2ETB A; 
#chains in the Genus database with same CATH homology
 3APC A;  3D9P A;  3HHM A;  2VSO E;  2J4D A;  5ENN A;  4AEZ C;  2RG8 A;  5CMW A;  5KJL A;  3TGO A;  4CT4 A;  3ENE A;  3D9K A;  3G2U A;  2L9B A;  2PQN A;  1KT0 A;  1JPL A;  4WWO A;  2YNQ A;  5BPP A;  2CFZ A;  2M63 A;  1DVP A;  5D0Q D;  3SHF A;  5G04 J;  1EDU A;  4NRH B;  3ULQ A;  2J08 A;  5LOZ A;  3TXN A;  4URK A;  4DLQ A;  2RD0 A;  4GAA A;  2WVI A;  4Q69 A;  2A5U A;  4XE0 A;  2PQR A;  4IN3 B;  5FQ6 A;  3QDN A;  1E7V A;  3T5V A;  3TG4 A;  3CK8 A;  3MKR A;  3IV0 A;  2X3M A;  2J09 A;  2BTD A;  5FJY A;  5LFA A;  3PRE A;  1IQR A;  4UQZ A;  4FHJ A;  4KMO A;  3AU5 A;  4BX9 A;  3FU5 A;  3SNX A;  1PY1 A;  3CLJ A;  4HFG A;  4WNE A;  5ANL A;  4JW1 A;  4CEM A;  3LY9 A;  4XX5 A;  2WXM A;  1E7U A;  3CHS A;  4I17 A;  1NA0 A;  3QKY A;  1NA3 A;  3ZYQ A;  3ML8 A;  4QFV A;  2WQH A;  3ASD A;  4APF A;  3G2S A;  3Q47 B;  2UWJ G;  4EZK A;  4ACL A;  2L6J A;  3SBT B;  5BUZ A;  2FUL A;  3AU4 A;  3MJW A;  4K03 A;  2L0I A;  5EX3 A;  4PS7 A;  4CRW A;  3FU0 A;  3MYV A;  1OWM A;  4UWL A;  3RU0 A;  3PEV B;  4JC8 A;  5JHB A;  4I9C A;  2VYI A;  4FC8 A;  2CHX A;  4I43 A;  4JVS A;  2I1J A;  4KT6 B;  2XCB A;  3CIA A;  3I3N A;  2XRZ A;  3GZ2 A;  4RSY A;  3SFZ A;  4KXK B;  3URZ A;  1OWN A;  1HZ4 A;  3LXU X;  3ZYL A;  3FU6 A;  2IFU A;  3UX4 A;  2XRY A;  2KCK A;  2I2O A;  3JUI A;  4F3V A;  1A17 A;  2J07 A;  3FUK A;  4K0R A;  2R5S A;  4N39 A;  3AS4 A;  4EBA A;  3PE4 A;  2XGO A;  5DIZ A;  3QK0 A;  1UJK A;  4GYW A;  3EHN A;  3CR3 A;  3O4Z A;  1BPO A;  3CHQ A;  4Y6W A;  3T5X A;  4AVX A;  5KJK A;  3FHE A;  2BF0 X;  2PZI A;  4G24 A;  4U07 A;  3LDZ A;  3ZHE A;  4XKB A;  5LX8 A;  1H0A A;  2Q7F A;  3MGB A;  2PM7 A;  2KC7 A;  2WMN A;  3KEZ A;  3CVU A;  2OND A;  1H19 A;  2R59 A;  4BY6 A;  3HVE A;  4XKC A;  3PNT B;  3TJP A;  3ASF A;  1X5B A;  3OTN A;  3G2V A;  4UQX A;  5A6C A;  3CVX A;  1HX8 A;  1UW4 B;  2OVF A;  2DIW A;  3U4T A;  3D9M A;  5LCW J;  5A7D B;  1SQM A;  4F7A A;  3TXM A;  5E76 A;  1NZN A;  3FTY A;  3FUJ A;  3CVQ A;  4UWH A;  4B8C B;  4ANX A;  3RRM B;  5AIJ A;  5BV1 A;  2VSX E;  3CQG B;  4GYO A;  1P5Q A;  3N71 A;  4KZ0 A;  3ZVV A;  3RRN B;  3RRU A;  2FEZ A;  2FO7 A;  1LF8 A;  2C0L A;  4HXI A;  3LY7 A;  4CGV A;  3LKU A;  2X6I A;  3K9I A;  4CDR A;  2UY1 A;  3ZW3 A;  4N2Q A;  4A55 A;  4PS8 A;  3RK6 A;  2HM8 A;  3AS8 A;  4LRZ A;  4GPK A;  4EPZ A;  4AM9 A;  3PE3 A;  4G1T A;  4GZ3 A;  3BG1 B;  4J8E A;  2LSU A;  4J8S A;  5BW8 C;  3UQ3 A;  4GMJ A;  2HO1 A;  3QWV A;  2DBA A;  2ZU6 B;  4H7Y A;  4LEU A;  1E8W A;  3ZYM A;  5T4Y A;  3IEG A;  3S7J A;  2V5F A;  4EQF A;  4UI9 J;  4L2L A;  4EEC A;  3D9N A;  2A4Z A;  3U9W A;  5C1D A;  3S2A A;  3FTS A;  3OXL A;  4GA2 A;  4F53 A;  3PUJ A;  4JA7 A;  3KD7 A;  2FBN A;  3RJV A;  1ELR A;  3MCX A;  2VJ8 A;  3JYS A;  3S7B A;  2OOE A;  3CV0 A;  4GZD A;  4U0Z A;  2VTB B;  3O48 A;  4JHJ A;  2WXP A;  3ZRH A;  2BUG A;  1QQE A;  3CQC B;  4WUY A;  3RIB A;  1GW6 A;  3FTZ A;  3KS2 A;  4C0M A;  4HOQ A;  2VGX B;  4JHK A;  3FEX A;  4BWR A;  4WWN A;  2AW6 A;  2C2L A;  5KJM A;  2XQ0 A;  4DI3 A;  3GZS A;  5M72 A;  2YQ8 A;  3PH0 C;  3RKV A;  1HFA A;  3NZU A;  3MZL B;  3Q5M A;  3OXG A;  4HLE A;  3CVN A;  5FQ8 A;  3EJN A;  4OYS A;  1E8Z A;  3CVL A;  1HE8 A;  3C98 A;  3FTW A;  4HS2 A;  4ABN A;  4ANV A;  3PVL A;  2XPI A;  3D9O A;  2V0P A;  4N3B A;  3UPV A;  1SZA A;  1UJJ A;  3OXF A;  1VDY A;  4C0E A;  5C2Y A;  3HYM B;  3E4B A;  2KZT B;  3QWW A;  5LCW C;  3FH8 A;  3SI5 A;  3FUL A;  3VTX A;  3D9L A;  5AEN A;  2Y4U A;  3MV2 B;  4JA9 A;  5E75 A;  4AY5 A;  4BTB A;  5J08 A;  1HG2 A;  2YIN A;  2CG3 A;  3B7T A;  3QJZ A;  3Q49 B;  5CHE E;  3UT4 A;  3P2B A;  3ASH A;  3EIQ C;  4IYP A;  4OVV A;  1PC2 A;  4HOS A;  2IOL A;  2GRM A;  4GZC A;  4A3V A;  3SZ7 A;  3ZYK A;  1EYH A;  2KCL A;  2WXN A;  3GZ1 A;  5BT1 A;  4I1M A;  4I9E A;  2AXZ A;  3EDT B;  4ME2 A;  4BX8 A;  1Y6I A;  4D10 C;  4E6H A;  4GA1 A;  5HQ8 A;  4WWP A;  5G55 A;  5FQ4 A;  2XCC A;  1N54 A;  1JUQ A;  2V4L A;  3ESL A;  3FU3 A;  3L6A A;  2J9Q A;  2QFC A;  2WXR A;  4MLP A;  3L17 A;  3QWP A;  2WXQ A;  3DPD A;  3TL5 A;  5J90 A;  3U66 A;  3G2W A;  4TV3 A;  2CHW A;  1L5J A;  5KJN A;  2KM4 A;  3NQP A;  4GU5 A;  2XPZ A;  4DK5 A;  3L54 A;  4FJZ A;  4PH4 B;  3ONK A;  4HOR A;  4NQ0 A;  2J4B A;  3ZN3 A;  3MKQ A;  3VLE A;  4JEU A;  4EZJ A;  1HU3 A;  3D9I A;  4EBA G;  4U0U A;  3CHM A;  4GML A;  2IOS A;  2I6H A;  4G25 A;  3ZGQ A;  1IHG A;  3G2T A;  1UN8 A;  5FZQ A;  2LAI A;  4NAC A;  3L08 A;  3UT7 A;  3HDX A;  1XGW A;  2YHE A;  4TUU A;  3LS8 A;  4G2V A;  3ZFW A;  4CCA A;  3PZD A;  1OWP A;  1FVF A;  4UI9 K;  3SBS A;  2NC9 A;  2WQ6 A;  4PUC A;  1IYG A;  1B89 A;  4NUR A;  2MRI A;  4BFR A;  3KAE A;  2KAT A;  1H6K A;  3S7F A;  5FWQ A;  1TJF A;  4C9B B;  3LYA A;  4BT8 A;  1ZBP A;  3JQ1 A;  5JJ6 A;  5LP0 A;  3PNL B;  4AV7 A;  3ZEF A;  4N3A A;  4IUL A;  5JJ7 A;  4I6G A;  1E90 A;  4UQY A;  4U0S A;  3CVW A;  2XHE A;  4GCN A;  4XI0 A;  4UWF A;  4MKT A;  2WXO A;  3CKB A;  3MV3 B;  3QAR A;  4I6E A;  3ASG A;  5EDS A;  1EF1 C;  2QY7 A;  3QNK A;  1Y8M A;  4G26 A;  3LEW A;  5G05 C;  3RO3 A;  4AY6 A;  2ILR A;  2ION A;  1HS6 A;  1HXI A;  4J8D A;  4HOU A;  3VTY A;  3DBS A;  3LY8 A;  3SD5 A;  3MA5 A;  2AXV A;  4U63 A;  3RO2 A;  5KCM A;  3SGH A;  3PRZ A;  1U3C A;  4A1S A;  4APO A;  4CDN A;  4BTA A;  3FUD A;  3LPZ A;  4H7X A;  2WM9 A;  5HI7 A;  3VLD A;  2XPY A;  3ZIM A;  4AJW A;  4RG9 A;  2Y3A A;  5JJT A;  4ANW A;  3FH7 A;  4BT9 A;  4ACK A;  4JXT A;  4GCO A;  3GW4 A;  2E0I A;  3IHV A;  2AXU A;  3OAW A;  3S7D A;  1XNF A;  3MX3 A;  2J49 A;  4AIF A;  4DI4 A;  5EKQ D;  1E8X A;  1Z3X A;  3D9J A;  1H2V C;  5D0O D;  3FY4 A;  4FAD A;  1W3B A;  3MKQ B;  5G2N A;  4Q96 A;  2VGX A;  4LUN U;  3FTV A;  4R7L A;  4U04 A;  1ZU2 A;  2YHC A;  4DPR A;  1INZ A;  3FUF A;  2DCP A;  4DLO A;  2XEV A;  3FP3 A;  3FDH A;  2VTB A;  1OUV A;  4Q94 A;  5AYW D;  4GA0 A;  3CKC A;  4AP2 A;  3CHO A;  4B8A A;  1YA0 A;  1Z3Y A;  4N5C A;  2VGY A;  2WXL A;  4N2S A;  3CHR A;  2E2E A;  1Z6T A;  5FZS A;  3JCK C;  5G05 J;  4V3I A;  4CGW A;  1TEZ A;  2GRL A;  5A23 A;  5CCM A;  3GYZ A;  5AJL A;  2I1K A;  3LVQ E;  3HVE B;  1IQU A;  3L16 A;  4N3C A;  4XZ4 A;  2CFU A;  3TAX A;  2WQ7 A;  3UT8 A;  4L1B A;  2R17 C;  3QB2 A;  1E8Y A;  2WXH A;  4G23 A;  4B94 A;  4YVO A;  5JHA A;  4AXH A;  4ILH B;  4U8H A;  4I6J A;  4JEH A;  3FUE A;  3ZPJ A;  4CDM A;  2WB2 A;  3R9A B;  3FWV A;  3B7U X;  5T8I A;  4OVU A;  2WXK A;  4O6F A;  4KBQ A;  4J0U A;  4ANU A;  3B13 A;  4PDX A;  4WND A;  1PAQ A;  3TG5 A;  3T8M A;  1KLX A;  2IJG X;  3I4R B;  4ILI A;  2KZT A;  1QNF A;  1UG3 A;  2VSN A;  4ILG A;  1FVH A;  2HYZ A;  3AS5 A;  2IU1 A;  4HOT A;  3QAQ A;  4FJY A;  2LNI A;  1HH8 A;  3APF A;  2EQX A;  3CEQ A;  3L13 A;  4FLH A;  5T3R A;  2FF4 A;  3NF1 A;  1H2T C;  2XGS A;  1SZ9 A;  4GB9 A;  4FA6 A;  4F1S A;  4B0Z A;  3LVR E;  2GW1 A;  1KT1 A;  2WPV A;  4KVM A;  4W9R A;  1TJC A;  5BNW A;  2WXJ A;  4WNG A;  1OWL A;  2WXF A;  3CK9 A;  5G04 C;  5DBK A;  2V8S E;  4YVQ C;  2LO6 A;  2OV8 A;  1JWF A;  2KCV A;  4FLB A;  3IHY A;  3ZHE B;  1FCH A;  3B7R L;  2C0M A;  1UN9 A;  4MS6 A;  4JL0 A;  2OVB A;  4TRQ A;  3VLF A;  1WAO 1;  2WMO A;  4L23 A;  2MHK A;  4ATG A;  5FTP A;  4KZC A;  4RVB A;  4JZY A;  4J6I A;  5EX0 A;  4Y6C A;  5BV0 A;  4GZ5 A;  4WNF A;  3FFL A;  1OWO A;  1HG5 A;  3FUI A;  3BEE A;  2X6H A;  3CVV A;  4FP7 A;  3PDN A;  5ARG A;  3QOU A;  5FT9 A;  2X6F A;  2WXI A;  4JPS A;  4KYO B;  5FZR A;  4UWK A;  4M3O A;  3D3M A;  4GYY A;  3P1U A;  3FH5 A;  4A3T A;  4WAF A;  3FEY A;  4CT0 A;  4EZL A;  2LSV A;  3BG0 B;  4FU3 A;  2VSY A;  2JLB A;  4I1A A;  3LCA A;  3NZS A;  1U3D A;  3SF4 A;  1DNP A;  3R7Q A;  1HO8 A;  2IF4 A;  2HR2 A;  4YND A;  3EIJ A;  2GGF A;  1H2U A;  2NSZ A;  2X38 A;  3B7S A;  4HVB A;  4JHR A;  3ML9 A;  4FHK A;  3FTX A;  3Q4A B;  4J8F A;  1NP7 A;  4LCT A;  2VQ2 A;  2FI7 A;  3U64 A;  1MHQ A;  2PM6 A;  4DJA A;  3ONL A;  2WXG A;  1EPU A;  4L7T A;  4IRU A;  4P29 A;  3IKO B;  2MOW A;  3LJ3 A;  4B89 A;  2L0T B;  4XIF A;  2PL2 A;  3UMV A;  5CMY A;  2JEK A;  1ELK A;  4KVO A;  2AVP A;  2CG2 A;  3IBE A;  3U3W A;  5ARF A;  3R7R A;  3JQ0 A;  4GZ6 A;  4XI9 A;  1WY6 A;  2UY1 B;  3I4G A;  4AOF A;  3L22 A;  2NXP A;  3PUK A;  2X6J A;  5ANR A;  5CCL A;  3WXX A;  4LER A;  1S0P A;  5FQ7 A;  4E85 A;  2P58 C;  4I2Z A;  3CSF A;  3CVP A;  3Q15 A;  4FUL A;  1HF8 A;  2AWI A;  2XGM A;  4UWG A;  1JWG A;  3PS6 A;  3MEK A;  3HIZ A;  3CVY A;  4PS3 A;  3QC1 A;  1E96 B;  1MQS A;  3CK7 A;  4I2W A;  4L2Y A;  4I1O B;  3UUX A;  3APD A;  3EHM A;  1WM5 A;  2X6K A;  4UI9 C;  3CGH A;  5AJD A;  4BSX A;  4RG6 A;  1QZ2 A;  3FTU A;  2Y4T A;  3CST A;  3ESK A;  3FUN A;  4MRU A;  3CHP A;  1ELW A;  1N52 A;  2LAH A;  2IQC A;  3FUH A;  3FUM A;  4A1G A;  3ZXS A;  3PEU B;  2I9C A;  3I5P A;  2CHZ A;  4G11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...