1EF1C

Crystal structure of the moesin ferm domain/tail domain complex
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
90
structure length
90
Chain Sequence
AEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTANDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords MOESIN
publication title Structure of the ERM protein moesin reveals the FERM domain fold masked by an extended actin binding tail domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 90
sequence length 90
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.1020 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1ef1C01
2I1JA 1EF1C 2I1KA
chains in the Genus database with same CATH superfamily
3TG5A 3GW4A 3HRAA 1OWNA 3QK0A 2UY1B 1YYHA 3EJNA 3E4BA 1OT8A 4N5CA 5KNHD 4TUUA 1FVFA 3TWRA 1SW6A 5JJTA 1E7UA 1BLXB 3FUKA 4GYOA 2XGSA 2EINE 5HQ8A 2ZISA 3Q78A 4XE0A 5ANRA 1NFIE 2DIWA 3FFLA 4GZDA 3CHMA 1TEZA 3CKBA 2R05A 3HXCA 4J0UA 4I6JA 3QDNA 3SZ7A 1TR4A 1LD7A 4A1GA 2IONA 2KCKA 2YQ8A 4UQXA 5CCMA 1GW6A 1N4SA 3L17A 4JA7A 1H6PA 3QWWA 1MX4A 3SQVA 3OXGA 1N4PA 3CQGB 3MKRA 4PS7A 1Q2ZA 3D9JA 2WPVA 4DI3A 2A5EA 3VLFA 4A55A 4PDXA 5DIZA 1UJJA 4GZ3A 3KD7A 2PM6A 2EIKE 5EIBE 3CR3A 3UM2A 2LSVA 1RW2A 4FADA 1QYMA 3FTUA 5H7PA 1OCRE 4LNGA 2WXPA 5CMWA 4H7YA 1V55E 4UWKA 4IULA 5AAOA 1LTXA 4KZ0A 5KWDA 1KZPA 3DSSA 3FWVA 4G25A 1ZBPA 5FT9A 3IBEA 3DSVA 4M3OA 4YDEA 3RRMB 1KPSB 3QJZA 5FTPA 5BXUA 3PH0C 4EECA 1D8DA 3JUIA 3RO2A 5FQ6A 4DX1A 1N9AA 2LAHA 1KT0A 2CG3A 2UWJG 2FBNA 4GTMA 4CDNA 2X38A 3AG3E 4HB5A 4WAFA 3PS6A 3CV0A 1NZNA 3UQ3A 4G23A 4HVBA 5FZQA 3DSUA 1WG0A 4AIFA 3CVWA 1IQRA 3QKYA 3APCA 1S63A 4O60A 4EQFA 3E30A 4F1SA 3CVLA 4HRNA 4BX8A 5M72A 1JWGA 3D9NA 1IHBA 3MKQA 2PQNA 3ASHA 4MKTA 3UX4A 1PC2A 4B0ZA 4JVSA 3CGHA 1SQMA 2WXOA 3DSWA 2P9IG 4JA9A 4ANXA 3D9HA 4LNUD 2H6GA 1FT1A 4CT0A 2XENA 3V31A 1HF8A 4C48B 4BERA 3VTYA 1FVHA 4X8QA 4NURA 3C98A 2NSZA 2XS8A 3ML9A 3T9KA 4RVBA 5D0OD 3EUVA 4CDMA 4U0UA 3IKOB 2YHCA 5FJYA 2R02A 4JHJA 2X6KA 3UM1A 4RG6A 2XQ0A 4L23A 1IKND 4JZYA 2ILRA 1TNOA 4K0RA 3LEWA 4LG6A 3CVUA 1EF1C 3Q4AB 3GZ1A 3QNKA 4I9EA 1NI1A 4LCTA 5A23A 4U07A 4AXHA 4DUIA 2WQ7A 2OVBA 2FEZA 5JJ6A 3PUJA 3HXFA 3O48A 4CT4A 1WAO1 2GRPB 3SBSA 2R2LA 2XPIA 1FPPA 4MS6A 3SFXA 3UM3A 2VJ8A 1E90A 3IEGA 2ONDA 3ESLA 3FTZA 5JHBA 3C3OA 5E75A 1S70B 2C0LA 2XS1A 4GTTA 4LEUA 5FQ8A 4DLOA 4EHMA 2GRLA 4BT9A 3ASOE 2WXJA 4O1OA 2BKGA 3S7BA 3BU8A 4J8SA 2XRZA 2KATA 3ZUVB 2LNIA 3MA5A 2WXLA 2X6IA 3CKCA 4U95D 3FU6A 1SZ9A 2J09A 4EZJA 3L13A 4DJAA 1UN9A 2J07A 3SY2A 4DRXE 1INZA 3FULA 5ANLA 3D9IA 3FUMA 2XGMA 4JD2G 4WWPA 3MZLB 5CEDB 4GPKA 2BTDA 4LNBA 1QNFA 3ZXPA 2DZNA 3NF1A 4ANWA 3JUEA 4MBGA 2Y4UA 3PREA 3OTNA 2QZAA 1HO8A 4WWNA 4KMOA 2P2CP 2GROB 4XX5A 4KZCA 1HS6A 4G24A 3R9MA 2BF0X 1IYGA 4HI8A 2DYSE 2V5QC 4HOQA 4WNEA 3FUDA 3S7FA 5ENPD 3QAQA 4AEZC 4ACKA 2X6FA 3MX3A 3Q73A 5EX3A 2IFUA 4GTPA 3Q75A 3NAWA 2HO1A 2I1KA 2WB2A 5KJNA 3PZ1A 4CDRA 2KZTA 3ZKJA 5EILA 1TNYA 5EYLA 3ONLA 3UUXA 2XEHA 5AENA 4UI9C 3EDTB 1OXJA 4U0ZA 5KJMA 2XPZA 3KSLA 2OCCE 1ZB1A 3ZIMA 4I2WA 5ARFA 3DSXA 4HOSA 3BG1B 5T4YA 3CIAA 5KJLA 4FLBA 4GTVA 2XEEA 4IRUA 3V2XA 3UI2A 4UWLA 3EHQA 2OEVA 3FHEA 4AY5A 3EIQC 1BI8B 5KJKA 4U96D 4WNFA 2BKKB 2MHKA 3FY4A 2ZGGA 4URKA 4UUCA 2WXGA 2LXMA 3ISMC 3ZPJA 3NOGD 5CRUA 2YINA 3APDA 4UWFA 5AJLA 4XIFA 3FUHA 3QWPA 5AJDA 1X5BA 3HVEB 4JB8P 3CVQA 5AIJA 3ULQA 3J5QB 2CHZA 3W9GA 1L5JA 4XEIG 3T5VA 4A3TA 1S64A 4KVOA 3PZ2A 1E8XA 5G05C 4DX6D 1BU9A 3ULYA 4FJZA 3G2WA 3TWWA 3ZGQA 3CVNA 3LVRE 4GA0A 1WY6A 3LVQE 4CEMA 3JXJA 5CHEE 4MRUA 3B13A 4N3BA 4L2YA 5LCWC 1DCEA 5J90A 3GZSA 4F6RD 3AAAC 5LP0A 1OCCE 3IHYA 3D3MA 4ABNA 4XI0A 3UT4A 3L16A 4FJYA 4LSZE 3FTSA 4JEHA 3CVVA 4AP2A 3UXGA 1Y6IA 3RK6A 3D9KA 4OAUC 4J8YA 1TNUA 3EHRA 4UWHA 1TNBA 4HLLA 1N94A 1TN6A 2DWZA 4PS8A 2WVIA 2JLBA 3V30A 4HRLA 3ABKE 4XKCA 3ZW3A 4N2SA 3BQOA 3ZNGA 4BFRA 5J08A 5A7DB 5G04J 1HH8A 1K1BA 2VGXA 4OVUA 3RIBA 3PZ3A 3Q79A 3U64A 4YDYA 1TJCA 2WQ6A 3VLDA 3L82A 2OEWA 3FTYA 3PEVB 2YHEA 3JQ1A 5C2YA 3B95A 4J8DA 3ENEA 1N0RA 1DVPA 2Y69E 3C3QA 2IOLA 1P5QA 4CGVA 4HXIA 3ASGA 2DZOA 1FT2A 5BNWA 3LDZA 3LPZA 1N4RA 5KBAA 3FTWA 3SD5A 1DCQA 2AJAA 1MX2A 3AS4A 2L0IA 3W9FA 3DWLG 2YNQA 4EBAG 5BUZA 2FO7A 3I5PA 4N3CA 1U3CA 2ETCA 5ITZF 4NACA 4D10C 2OV8A 3FH8A 2XZTG 2PNNA 4WNGA 1PY1A 4TUMA 3DBSA 1KLXA 4EZLA 3DXKG 2XHEA 4I17A 3MKQB 4Q69A 4N39A 2ZIRA 4L1BA 3ZN3A 1OCOE 1OWLA 4GTRA 1O1SA 4RLYA 4J7WA 3QC1A 3V79K 3CVPA 4L9PA 1Z3XA 2P9PG 3DSTA 3TL5A 3ZRHA 2WQHA 3FUNA 1SA4A 3EHMA 5BW8C 5LX8A 2PM7A 2ZXWE 2DVWA 5BPPA 1TN8A 2IO3C 2GW1A 4ATGA 1IXVA 2CHWA 1OWMA 3U3WA 4NRHB 3G2UA 1OY3D 3U66A 1N52A 2C0MA 4HBDA 1N11A 3NQPA 5HI7A 2XZDG 1A17A 2NC9A 3BUAA 4KT6B 1TYQG 4ANVA 2Y3AA 1Z5SC 2WXQA 4CZ2D 2IEJA 3PZDA 2MYOA 2CG2A 2WXMA 3I4RB 4U0SA 3EU5A 3DRAA 4LUNU 4BEPA 4FHJA 3RRUA 3TXMA 1XNFA 3OXLA 5BT1A 3FDHA 4GZ6A 4HQDA 2VTBA 5HS0A 4TRQA 3HXEA 2LXLA 3CVYA 1EDUA 2P9NG 4QQIA 1XGWA 2WXHA 3NBNB 2I2OA 1HU3A 4B89A 2F37A 4OVVA 3TWQA 3P2BA 3KAEA 1WDYA 2I6HA 3MCXA 2KC7A 5FIOA 3L54A 3QOUA 5CCLA 1OWOA 3PUKA 5ENNA 2I9CA 3ONKA 3UPVA 3FU3A 1ZU2A 1DC2A 1FCHA 4APOA 4GMLA 2BEDA 4A1SA 4J8EA 3T8MA 2R03A 5CECB 4NIKA 1BI7B 5EIDA 4ILHB 4DX2A 3PVLA 4GTQA 2P9UG 1U3DA 4JL0A 2C2LA 3ABLE 2IO2C 2FO1E 1AP7A 3P1UA 4K5AB 4PH4B 3LS8A 2VQ2A 5HKPA 4JHRA 1N0QA 5AYWD 2HYZA 4EZKA 2VYIA 4BSXA 3TG4A 1NA0A 4BESA 4ZHBA 2FF4A 1EYHA 3L6AA 4Y6CA 3AJIA 3Q5MA 2R5SA 2VSNA 3QARA 3UKRG 4EBAA 1YA0A 4YVOA 3G2VA 2KZTB 5CRVA 4JXTA 5CEAA 4F3VA 4GZCA 3PZ4A 4OAVB 4IN3B 4GA2A 4I1AA 1MQSA 4JC8A 3KEZA 4GMJA 2A4ZA 3LXUX 3UIPC 3T5XA 4F1PA 2WXKA 4I9CA 3HDXA 3GYZA 3Q15A 3R7QA 1AWCB 3ABME 2AXUA 1JPLA 3TAXA 3AG2E 4BY6A 4R7LA 3L08A 3FTVA 3E32A 3N71A 2L6JA 5EYPF 3FUJA 5JJ7A 3ESKA 4ZFHA 4B8CB 3Q9NC 3CHPA 4WUYA 5FQ4A 4E6HA 3ASFA 1YCSB 5BV0A 3I4GA 3EIJA 4GAAA 3ZYLA 4L7TA 2F8YA 3B7BA 4K5CA 2E0IA 1VDYA 2FI7A 2LO6A 2ZGDA 5B1BE 3MEKA 2JEKA 3L9TA 3NB2A 3R7RA 4AVXA 4MLPA 4A3VA 2EILE 1TN7A 4FC8A 4GMRA 3O4ZA 4G26A 5ENSD 2WXFA 3C3RA 5G2NA 1NL4A 5EN5D 4FLHA 1N4QA 3F6QA 1SVXA 1Z6TA 4ACLA 3AS8A 5BV1A 2IJGX 1MX6A 4E85A 4H7XA 1OWPA 2IU1A 2LSUA 4N5QA 1UG3A 1HX8A 5FWQA 2HE0A 2AVPA 3B7SA 2EQXA 3UM0A 2LUHA 3DPDA 4BETA 2GRRB 1W3BA 3B7RL 4YNDA 1K3ZD 2J4DA 3FEYA 3UT7A 2J4BA 2EIME 2KM4A 3TWXA 5AQBA 1KZOA 3PNLB 5LFAA 1D9SA 4UQYA 5ENQD 3Q47B 1UJKA 5D2MC 5KNGA 2WXRA 1YMPA 4FULA 2CFUA 1BD8A 4U8YD 4TXQA 5D66A 4M7CA 1U2VG 3CK8A 2VGXB 4U8VD 4AV7A 4I6GA 5B1AE 3QWVA 2CHXA 4XZ4A 4HFGA 2XGOA 4C9BB 3ASDA 5C1DA 3AS5A 3DEOA 4DK5A 2AXVA 1Z3YA 4GCNA 5G05J 5EKQD 2H6IA 4BTAA 4HRMB 2Y4TA 3EU9A 3VLEA 2X6HA 4GPMA 5DBKA 3VTXA 3TWTA 3EHNA 3NZSA 4B93B 2PL2A 3SI5A 1UW4B 4CGWA 2AXZA 3AG4E 4NQ0A 4K03A 3V2OA 4Q96A 3E37A 3LKUA 1H2TC 2WXIA 3CVXA 5G04C 4KVMA 3RU0A 4F53A 3D9OA 1IQUA 2QY7A 3FEXA 4XKBA 2E2EA 4YDOA 2V0PA 5EDSA 3TGOA 1N95A 3ASNE 1D8EA 2RD0A 3PNTB 1S0PA 3BEEA 5ENOD 4WNDA 1DNPA 3TWSA 2V5FA 2KBXA 5CMYA 1H2UA 1KT1A 3RRNB 4G11A 3CHSA 4G1TA 1QQEA 2V4HC 1V54E 4BSZB 4HNAD 3SO8A 2DBAA 3ML8A 3JXIA 1LF8A 3C5RA 3S2AA 2EIJE 3MV3B 3JYSA 4CCAA 2MRIA 4PS3A 3SFZA 3FU5A 3UTMA 2WMOA 5T3RA 3R9AB 4TXRA 3BG0B 4DPRA 3ULEG 4G8LA 1H6KA 3ZHEA 2J8SD 3URZA 4FA6A 1HXIA 3D9MA 3JCKC 1TJFA 1Y8MA 3ZVVA 3SBTB 3FUIA 5AARA 2XPYA 3UMVA 4ME2A 2OVFA 4FHKA 3TWUA 2UY1A 3B7UX 3CLJA 3RAUA 4UWGA 3RO3A 4RG9A 4A63B 4UQZA 3C72A 1JCSA 4HS2A 1EPUA 3D9LA 3PEUB 3KEAA 4N3AA 3ZU7B 2XCBA 1A5EA 2VSYA 2L6BA 3CQCB 4I6EA 4BT8A 2VTBB 3L22A 3G2TA 4HI9A 4IYPA 4TXPA 1SZAA 2ETBA 2J9QA 3FH7A 4I2ZA 3CEQA 4ILGA 3IV0A 4J6IA 4U04A 4K5BA 1LD8A 2NXPA 3D9PA 4AM9A 4U7EB 4DX5D 2RFMA 2GGFA 5CERB 3DXMG 1HFAA 1K1AA 4AOFA 2QC9A 2GRQB 5G55A 4N2QA 3MYVA 4GYYA 5KCMA 5JA4D 4GTOA 4GU5A 1G3NB 2JABA 4I1MA 1MJ0A 3MV2B 3UT8A 4F7AA 1HE8A 3UINC 5E76A 5EX0A 3SF4A 4DI4A 1RZ4A 4C0EA 2R17C 2X3MA 3E33A 3Q49B 2BUGA 3AG1E 3KS2A 5ENRD 2VGEA 4HOTA 2HM8A 3U4TA 2B0OE 4JEUA 1H6OA 3ZFWA 4U8HA 2AW6A 2Q7FA 2P58C 4CYMD 3ZYQA 1E7VA 1E8ZA 3GZ2A 3ZXSA 2KXPC 2CFZA 2J49A 3LJNA 4RSYA 2B6CA 1WM5A 1JCQA 4JHKA 3CSFA 3AU5A 2QFCA 3NOCD 4GCOA 3B7TA 4LERA 2A5UA 1ELKA 2F8XK 2IF4A 1HZ4A 2H6HA 4ILIA 3PE4A 4O6FA 1H19A 2M63A 1E96B 3CSTA 3CHRA 4Z68A 4C0MA 1K8KG 3IXEA 4GZ5A 4GYWA 3K9IA 2ZU6B 4Q94A 3HXDA 4BTBA 2P9KG 2XCCA 2L9BA 1UN8A 1E8YA 4YVQC 4PUCA 4J8FA 2L0TB 5ARGA 1QBQA 2VSXE 3HHMA 4EPZA 4KBQA 3LJ3A 2IOSA 4GB9A 1MHQA 5FQ7A 3RKVA 2V8SE 5JMND 4LRZA 3RJVA 4I43A 3I3NA 5BXOA 3LY9A 3T8KA 5D0QD 1O1TA 3LY8A 3HIZA 4DX7D 1E8WA 2WXNA 4GA1A 3DEPA 2PQRA 2PZIA 4AJWA 2ETAA 1OCZE 3OXFA 1O1RA 4XI9A 5A6CA 4RQIA 4BX9A 2DCPA 4I1OB 2Y0BG 4APFA 2FULA 3LY7A 3FU0A 3TWVA 3Q7AA 2WMNA 3UIOC 4JPSA 3SGHA 1H2VC 3ZEFA 4G2VA 4JW1A 4WWOA 2XRYA 3WG7E 4HORA 4HOUA 2VGYA 3Q7FA 3U9WA 4V3IA 4CRWA 2KCVA 1N54A 1JWFA 1B89A 4KYOB 3ZYKA 2IQCA 3FUEA 5FZRA 1NP7A 2DYRE 3FUFA 5LOZA 2H6FA 3CK7A 1NA3A 3JQ0A 4W9RA 2R59A 4ATZD 5FZSA 4OYSA 3KSQA 3PRZA 2IY0C 4QFVA 5AQAA 3IHVA 2GRNB 3SFYA 4YDWA 4HLEA 3FP3A 3LCAA 4L2LA 2P9SG 4U63A 4P29A 4KXKB 3UKUG 1X81A 1UOHA 1BPOA 3MJWA 2F0YA 4G8KA 3OAWA 5ENTD 4B94A 4GTSA 1MYOA 3S7DA 4FP7A 2QYJA 5AN8A 1MZCA 3AU4A 4UI9J 1ELRA 2Y1LE 4FU3A 3HG0D 1JCRA 3FTXA 3HXBA 4ANUA 5B3SE 2LAIA 4AY6A 2MOWA 3CHQA 2RFAA 4UI9K 2WM9A 2X6JA 5CBNA 3X2QE 2GRMA 3CK9A 4BWRA 3CHOA 1OUVA 3RSEG 2RG8A 3G2SA 1JUQA 3ZYMA 1ELWA 3FH5A 3DPYA 2I1JA 5JHAA 1PAQA 1HG2A 3SHFA 2V4LA 1H0AA 4Y6WA 3NZUA 2QYUA 3J5PA 3TJPA 2P9LG 3WXXA 3E34A 1TNZA 5IY5E 2VSOE 3MGBA 3S7JA 3APFA 3TXNA 2J08A 5AQ7A 4TV3A 2RKKA 3QB2A 3PE3A 3PDNA 5FINA 3LYAA 5HRYA 5T8IA 3Q9UC 5CBOA 3SNXA 2HR2A 3HYMB 4DLQA 3ZHEB 2AWIA 1HG5A 1QZ2A 5LCWJ 2OOEA 4B8AA 2NYJA 1IHGA 2KCLA 2XEVA 5AQ9A 1O5MA 1SA5A 4O1PA 3HVEA
chains in the Genus database with same CATH topology
3CEQA 4ILGA 3TG5A 5KJMA 3GW4A 1OWNA 3IV0A 3QK0A 2UY1B 2XPZA 4J6IA 3EJNA 3E4BA 4U04A 3ZIMA 4I2WA 5ARFA 4N5CA 4TUUA 3P1UA 4HOSA 4PH4B 3BG1B 3LS8A 2VQ2A 5T4YA 3CIAA 2NXPA 1FVFA 3D9PA 5KJLA 4AM9A 4FLBA 4JHRA 2GGFA 5JJTA 4IRUA 1E7UA 4UWLA 5AYWD 2HYZA 4EZKA 3FUKA 1HFAA 2VYIA 4AOFA 3FHEA 4GYOA 2XGSA 4BSXA 4AY5A 3TG4A 5HQ8A 5G55A 4N2QA 3MYVA 3EIQC 1NA0A 4GYYA 5KCMA 4XE0A 5KJKA 5ANRA 2FF4A 2DIWA 1EYHA 3FFLA 3L6AA 4GZDA 3CHMA 4Y6CA 1TEZA 4WNFA 3Q5MA 2R5SA 2VSNA 3CKBA 4GU5A 3QARA 2MHKA 3FY4A 4J0UA 4URKA 4I6JA 4EBAA 4I1MA 2WXGA 1YA0A 3MV2B 4YVOA 3G2VA 2KZTB 3UT8A 4F7AA 3QDNA 1HE8A 4JXTA 3SZ7A 3ZPJA 5E76A 2YINA 5EX0A 3SF4A 3APDA 4DI4A 4F3VA 4UWFA 4GZCA 4C0EA 5AJLA 4XIFA 2R17C 3FUHA 2X3MA 3QWPA 5AJDA 1X5BA 4A1GA 3HVEB 3CVQA 3Q49B 2IONA 2KCKA 2BUGA 3KS2A 4IN3B 4GA2A 2YQ8A 4I1AA 5AIJA 3ULQA 4HOTA 1MQSA 4JC8A 4UQXA 5CCMA 3KEZA 1GW6A 2HM8A 4GMJA 3U4TA 2A4ZA 3L17A 2CHZA 3LXUX 4JA7A 3T5XA 3QWWA 4JEUA 1L5JA 3ZFWA 3T5VA 4U8HA 2AW6A 4A3TA 3OXGA 2Q7FA 2P58C 2WXKA 4KVOA 3CQGB 1E8XA 4I9CA 3ZYQA 1E7VA 1E8ZA 3GYZA 3GZ2A 3HDXA 3MKRA 3Q15A 4PS7A 5G05C 3R7QA 3D9JA 2WPVA 3ZXSA 4DI3A 4FJZA 3G2WA 2AXUA 2CFZA 2J49A 1JPLA 4RSYA 3TAXA 1WM5A 3ZGQA 3CVNA 3LVRE 3VLFA 4JHKA 4A55A 3CSFA 4PDXA 4BY6A 5DIZA 1UJJA 4R7LA 3L08A 3FTVA 4GA0A 3AU5A 1WY6A 3N71A 2L6JA 2QFCA 4GZ3A 3LVQE 3FUJA 4GCOA 3B7TA 3ESKA 5JJ7A 3KD7A 4LERA 4CEMA 2PM6A 5CHEE 4B8CB 4MRUA 2A5UA 3CR3A 3CHPA 1ELKA 2IF4A 1HZ4A 2LSVA 4FADA 4ILIA 3B13A 3PE4A 4O6FA 1H19A 2M63A 4N3BA 1E96B 4WUYA 3FTUA 5FQ4A 4E6HA 3ASFA 5BV0A 3CSTA 4L2YA 3I4GA 3CHRA 5LCWC 2WXPA 5J90A 3EIJA 3GZSA 4GAAA 4C0MA 5LP0A 4GZ5A 4GYWA 3IHYA 3K9IA 5CMWA 4H7YA 3ZYLA 2ZU6B 4L7TA 3D3MA 4UWKA 4ABNA 4XI0A 3UT4A 4IULA 3L16A 2E0IA 4Q94A 4KZ0A 4FJYA 1VDYA 3FWVA 3FTSA 4BTBA 4JEHA 3CVVA 2FI7A 4AP2A 2XCCA 2LO6A 2L9BA 1UN8A 4G25A 1ZBPA 5FT9A 3MEKA 2JEKA 3IBEA 1Y6IA 3RK6A 3R7RA 3D9KA 4AVXA 1E8YA 4M3OA 4YVQC 4PUCA 4MLPA 3RRMB 4A3VA 4J8FA 3QJZA 5FTPA 4UWHA 2L0TB 3PH0C 5ARGA 4EECA 3JUIA 4PS8A 4FC8A 3RO2A 2VSXE 3O4ZA 4G26A 5FQ6A 2WXFA 2LAHA 5G2NA 1KT0A 2WVIA 2JLBA 3HHMA 2CG3A 4EPZA 4KBQA 3LJ3A 2IOSA 4GB9A 4FLHA 1MHQA 4XKCA 5FQ7A 2V8SE 3RKVA 2UWJG 3ZW3A 2FBNA 4N2SA 4LRZA 1Z6TA 4ACLA 4CDNA 3RJVA 4I43A 3AS8A 2X38A 3I3NA 5BV1A 3LY9A 2IJGX 4BFRA 5D0QD 4E85A 4WAFA 5J08A 5A7DB 4H7XA 3LY8A 5G04J 1HH8A 1OWPA 3HIZA 2VGXA 4OVUA 2IU1A 3CV0A 3PS6A 3RIBA 1NZNA 2LSUA 3UQ3A 4G23A 4HVBA 1E8WA 5FZQA 1UG3A 2WXNA 4GA1A 1HX8A 4AIFA 3U64A 3CVWA 1IQRA 3QKYA 3APCA 2PQRA 2PZIA 4AJWA 1TJCA 4EQFA 2WQ6A 3VLDA 3OXFA 5FWQA 2AVPA 4XI9A 4F1SA 5A6CA 4BX9A 2DCPA 3B7SA 3CVLA 3FTYA 3PEVB 2EQXA 2YHEA 3JQ1A 5C2YA 4J8DA 4I1OB 3ENEA 4BX8A 5M72A 1JWGA 3DPDA 3D9NA 1DVPA 1W3BA 3MKQA 3B7RL 4APFA 2IOLA 2PQNA 3ASHA 4MKTA 1P5QA 4YNDA 3UX4A 4CGVA 2J4DA 3FEYA 1PC2A 2FULA 4B0ZA 3LY7A 3FU0A 3UT7A 4JVSA 3CGHA 2J4BA 1SQMA 2WXOA 4HXIA 2KM4A 3ASGA 4JA9A 4ANXA 3PNLB 5BNWA 5LFAA 3LDZA 3LPZA 4CT0A 1HF8A 4UQYA 2WMNA 3FTWA 3Q47B 3SD5A 1UJKA 4JPSA 3VTYA 3SGHA 3AS4A 1FVHA 2WXRA 2L0IA 2YNQA 4FULA 4EBAG 2CFUA 5BUZA 1H2VC 3ZEFA 4G2VA 2FO7A 3I5PA 4JW1A 4WWOA 4N3CA 4NURA 1U3CA 2XRYA 3C98A 3CK8A 2VGXB 4AV7A 2NSZA 4HORA 4NACA 4HOUA 4I6GA 2VGYA 3ML9A 3U9WA 4D10C 3QWVA 4RVBA 4V3IA 4CRWA 2KCVA 1N54A 2OV8A 2CHXA 5D0OD 1JWFA 4XZ4A 4CDMA 3FH8A 4WNGA 4HFGA 4U0UA 1B89A 2XGOA 1PY1A 4KYOB 3ZYKA 3DBSA 1KLXA 4C9BB 3ASDA 5C1DA 3IKOB 2YHCA 4EZLA 3AS5A 5FJYA 2XHEA 4JHJA 2X6KA 3MKQB 4I17A 4RG6A 2XQ0A 4L23A 2IQCA 4N39A 3FUEA 4JZYA 5FZRA 2ILRA 4DK5A 4Q69A 2AXVA 1NP7A 4K0RA 3LEWA 1Z3YA 3FUFA 4L1BA 5LOZA 3ZN3A 3CK7A 4GCNA 5G05J 1NA3A 3CVUA 5EKQD 1OWLA 3JQ0A 4W9RA 1EF1C 4BTAA 2R59A 3Q4AB 3GZ1A 3QNKA 2Y4TA 5FZSA 4OYSA 3VLEA 2X6HA 4I9EA 3QC1A 5DBKA 3EHNA 3PRZA 3VTXA 3NZSA 4QFVA 4LCTA 5A23A 3CVPA 4U07A 1Z3XA 3IHVA 2PL2A 4AXHA 3SI5A 1UW4B 2WQ7A 2OVBA 4CGWA 2AXZA 2FEZA 3TL5A 3ZRHA 2WQHA 3FUNA 4NQ0A 4K03A 5JJ6A 3FP3A 4HLEA 3PUJA 3LCAA 4Q96A 3LKUA 1H2TC 3EHMA 4L2LA 2WXIA 5BW8C 3O48A 4CT4A 3CVXA 4U63A 5G04C 1WAO1 4P29A 3SBSA 5LX8A 4KVMA 4KXKB 2PM7A 3RU0A 4F53A 3D9OA 1IQUA 2XPIA 4MS6A 2QY7A 2VJ8A 5BPPA 2GW1A 1E90A 3IEGA 3FEXA 4ATGA 4XKBA 1BPOA 3MJWA 2E2EA 2ONDA 3ESLA 3FTZA 5JHBA 2CHWA 3OAWA 1OWMA 5E75A 2V0PA 2C0LA 5EDSA 3TGOA 4LEUA 5FQ8A 4B94A 3U3WA 4DLOA 4NRHB 2RD0A 3G2UA 3PNTB 3S7DA 4FP7A 1S0PA 3BEEA 2GRLA 3U66A 4BT9A 1N52A 2C0MA 2WXJA 3AU4A 4UI9J 1ELRA 4FU3A 4WNDA 3S7BA 1DNPA 4J8SA 2XRZA 2KATA 3NQPA 2V5FA 5CMYA 1H2UA 5HI7A 2LNIA 3MA5A 3FTXA 1KT1A 3RRNB 2WXLA 4G11A 2X6IA 3CKCA 1QQEA 3CHSA 1A17A 4G1TA 2NC9A 4ANUA 4KT6B 2LAIA 3FU6A 2DBAA 1SZ9A 2J09A 4ANVA 4EZJA 4AY6A 3L13A 2MOWA 3ML8A 1LF8A 2Y3AA 3CHQA 3S2AA 4DJAA 2WXQA 3MV3B 1UN9A 2J07A 4UI9K 2WM9A 3PZDA 2X6JA 3JYSA 4CCAA 2CG2A 2WXMA 3I4RB 2MRIA 4U0SA 4PS3A 2GRMA 3CK9A 4BWRA 1INZA 3FULA 3CHOA 5ANLA 3D9IA 4LUNU 1OUVA 3FU5A 3SFZA 2WMOA 3FUMA 4FHJA 3RRUA 3TXMA 1XNFA 2XGMA 5T3RA 2RG8A 3OXLA 3G2SA 3R9AB 4WWPA 5BT1A 1JUQA 3BG0B 3MZLB 1ELWA 3FDHA 4GZ6A 3ZYMA 4DPRA 3FH5A 2VTBA 2I1JA 5JHAA 4GPKA 2BTDA 4TRQA 1PAQA 1HG2A 1H6KA 3SHFA 3ZHEA 1QNFA 2V4LA 3CVYA 1H0AA 3URZA 4FA6A 1EDUA 1HXIA 3D9MA 4Y6WA 1XGWA 3NZUA 2WXHA 2I2OA 3JCKC 3TJPA 1HU3A 3NF1A 1TJFA 4B89A 4ANWA 2Y4UA 3PREA 4OVVA 1Y8MA 3OTNA 3ZVVA 3WXXA 3SBTB 1HO8A 3FUIA 3P2BA 4WWNA 2XPYA 3KAEA 2I6HA 2OVFA 4FHKA 4ME2A 4KMOA 2UY1A 3UMVA 3B7UX 4KZCA 2VSOE 1HS6A 3MGBA 3MCXA 4G24A 2KC7A 3CLJA 4XX5A 3S7JA 2BF0X 3APFA 1IYGA 4UWGA 3RO3A 4RG9A 3TXNA 2J08A 4HOQA 3L54A 4WNEA 3FUDA 4UQZA 4HS2A 3S7FA 3QOUA 1EPUA 4TV3A 3QAQA 4AEZC 3QB2A 3PE3A 3D9LA 3PEUB 5CCLA 4ACKA 3PDNA 1OWOA 2X6FA 3PUKA 5ENNA 2I9CA 3MX3A 4N3AA 3ONKA 2XCBA 5EX3A 3UPVA 3LYAA 5T8IA 2VSYA 2IFUA 3FU3A 3CQCB 4I6EA 2HO1A 3SNXA 4BT8A 1ZU2A 2I1KA 1FCHA 4APOA 2WB2A 5KJNA 4GMLA 2HR2A 2VTBB 3HYMB 4DLQA 3L22A 4A1SA 3ZHEB 3G2TA 2AWIA 4J8EA 3T8MA 4CDRA 1HG5A 1QZ2A 5LCWJ 2OOEA 4B8AA 4IYPA 2KZTA 4ILHB 3PVLA 1IHGA 1U3DA 2KCLA 3ONLA 4JL0A 3UUXA 1SZAA 2XEVA 2J9QA 3FH7A 2C2LA 5AENA 4UI9C 3EDTB 3HVEA 4I2ZA 4U0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I1J A;  1EF1 C;  2I1K A; 
#chains in the Genus database with same CATH topology
 3TG5 A;  3GW4 A;  3HRA A;  1OWN A;  3QK0 A;  2UY1 B;  1YYH A;  3EJN A;  3E4B A;  1OT8 A;  4N5C A;  5KNH D;  4TUU A;  1FVF A;  3TWR A;  1SW6 A;  5JJT A;  1E7U A;  1BLX B;  3FUK A;  4GYO A;  2XGS A;  2EIN E;  5HQ8 A;  2ZIS A;  3Q78 A;  4XE0 A;  5ANR A;  1NFI E;  2DIW A;  3FFL A;  4GZD A;  3CHM A;  1TEZ A;  3CKB A;  2R05 A;  3HXC A;  4J0U A;  4I6J A;  3QDN A;  3SZ7 A;  1TR4 A;  1LD7 A;  4A1G A;  2ION A;  2KCK A;  2YQ8 A;  4UQX A;  5CCM A;  1GW6 A;  1N4S A;  3L17 A;  4JA7 A;  1H6P A;  3QWW A;  1MX4 A;  3SQV A;  3OXG A;  1N4P A;  3CQG B;  3MKR A;  4PS7 A;  1Q2Z A;  3D9J A;  2WPV A;  4DI3 A;  2A5E A;  3VLF A;  4A55 A;  4PDX A;  5DIZ A;  1UJJ A;  4GZ3 A;  3KD7 A;  2PM6 A;  2EIK E;  5EIB E;  3CR3 A;  3UM2 A;  2LSV A;  1RW2 A;  4FAD A;  1QYM A;  3FTU A;  5H7P A;  1OCR E;  4LNG A;  2WXP A;  5CMW A;  4H7Y A;  1V55 E;  4UWK A;  4IUL A;  5AAO A;  1LTX A;  4KZ0 A;  5KWD A;  1KZP A;  3DSS A;  3FWV A;  4G25 A;  1ZBP A;  5FT9 A;  3IBE A;  3DSV A;  4M3O A;  4YDE A;  3RRM B;  1KPS B;  3QJZ A;  5FTP A;  5BXU A;  3PH0 C;  4EEC A;  1D8D A;  3JUI A;  3RO2 A;  5FQ6 A;  4DX1 A;  1N9A A;  2LAH A;  1KT0 A;  2CG3 A;  2UWJ G;  2FBN A;  4GTM A;  4CDN A;  2X38 A;  3AG3 E;  4HB5 A;  4WAF A;  3PS6 A;  3CV0 A;  1NZN A;  3UQ3 A;  4G23 A;  4HVB A;  5FZQ A;  3DSU A;  1WG0 A;  4AIF A;  3CVW A;  1IQR A;  3QKY A;  3APC A;  1S63 A;  4O60 A;  4EQF A;  3E30 A;  4F1S A;  3CVL A;  4HRN A;  4BX8 A;  5M72 A;  1JWG A;  3D9N A;  1IHB A;  3MKQ A;  2PQN A;  3ASH A;  4MKT A;  3UX4 A;  1PC2 A;  4B0Z A;  4JVS A;  3CGH A;  1SQM A;  2WXO A;  3DSW A;  2P9I G;  4JA9 A;  4ANX A;  3D9H A;  4LNU D;  2H6G A;  1FT1 A;  4CT0 A;  2XEN A;  3V31 A;  1HF8 A;  4C48 B;  4BER A;  3VTY A;  1FVH A;  4X8Q A;  4NUR A;  3C98 A;  2NSZ A;  2XS8 A;  3ML9 A;  3T9K A;  4RVB A;  5D0O D;  3EUV A;  4CDM A;  4U0U A;  3IKO B;  2YHC A;  5FJY A;  2R02 A;  4JHJ A;  2X6K A;  3UM1 A;  4RG6 A;  2XQ0 A;  4L23 A;  1IKN D;  4JZY A;  2ILR A;  1TNO A;  4K0R A;  3LEW A;  4LG6 A;  3CVU A;  1EF1 C;  3Q4A B;  3GZ1 A;  3QNK A;  4I9E A;  1NI1 A;  4LCT A;  5A23 A;  4U07 A;  4AXH A;  4DUI A;  2WQ7 A;  2OVB A;  2FEZ A;  5JJ6 A;  3PUJ A;  3HXF A;  3O48 A;  4CT4 A;  1WAO 1;  2GRP B;  3SBS A;  2R2L A;  2XPI A;  1FPP A;  4MS6 A;  3SFX A;  3UM3 A;  2VJ8 A;  1E90 A;  3IEG A;  2OND A;  3ESL A;  3FTZ A;  5JHB A;  3C3O A;  5E75 A;  1S70 B;  2C0L A;  2XS1 A;  4GTT A;  4LEU A;  5FQ8 A;  4DLO A;  4EHM A;  2GRL A;  4BT9 A;  3ASO E;  2WXJ A;  4O1O A;  2BKG A;  3S7B A;  3BU8 A;  4J8S A;  2XRZ A;  2KAT A;  3ZUV B;  2LNI A;  3MA5 A;  2WXL A;  2X6I A;  3CKC A;  4U95 D;  3FU6 A;  1SZ9 A;  2J09 A;  4EZJ A;  3L13 A;  4DJA A;  1UN9 A;  2J07 A;  3SY2 A;  4DRX E;  1INZ A;  3FUL A;  5ANL A;  3D9I A;  3FUM A;  2XGM A;  4JD2 G;  4WWP A;  3MZL B;  5CED B;  4GPK A;  2BTD A;  4LNB A;  1QNF A;  3ZXP A;  2DZN A;  3NF1 A;  4ANW A;  3JUE A;  4MBG A;  2Y4U A;  3PRE A;  3OTN A;  2QZA A;  1HO8 A;  4WWN A;  4KMO A;  2P2C P;  2GRO B;  4XX5 A;  4KZC A;  1HS6 A;  4G24 A;  3R9M A;  2BF0 X;  1IYG A;  4HI8 A;  2DYS E;  2V5Q C;  4HOQ A;  4WNE A;  3FUD A;  3S7F A;  5ENP D;  3QAQ A;  4AEZ C;  4ACK A;  2X6F A;  3MX3 A;  3Q73 A;  5EX3 A;  2IFU A;  4GTP A;  3Q75 A;  3NAW A;  2HO1 A;  2I1K A;  2WB2 A;  5KJN A;  3PZ1 A;  4CDR A;  2KZT A;  3ZKJ A;  5EIL A;  1TNY A;  5EYL A;  3ONL A;  3UUX A;  2XEH A;  5AEN A;  4UI9 C;  3EDT B;  1OXJ A;  4U0Z A;  5KJM A;  2XPZ A;  3KSL A;  2OCC E;  1ZB1 A;  3ZIM A;  4I2W A;  5ARF A;  3DSX A;  4HOS A;  3BG1 B;  5T4Y A;  3CIA A;  5KJL A;  4FLB A;  4GTV A;  2XEE A;  4IRU A;  3V2X A;  3UI2 A;  4UWL A;  3EHQ A;  2OEV A;  3FHE A;  4AY5 A;  3EIQ C;  1BI8 B;  5KJK A;  4U96 D;  4WNF A;  2BKK B;  2MHK A;  3FY4 A;  2ZGG A;  4URK A;  4UUC A;  2WXG A;  2LXM A;  3ISM C;  3ZPJ A;  3NOG D;  5CRU A;  2YIN A;  3APD A;  4UWF A;  5AJL A;  4XIF A;  3FUH A;  3QWP A;  5AJD A;  1X5B A;  3HVE B;  4JB8 P;  3CVQ A;  5AIJ A;  3ULQ A;  3J5Q B;  2CHZ A;  3W9G A;  1L5J A;  4XEI G;  3T5V A;  4A3T A;  1S64 A;  4KVO A;  3PZ2 A;  1E8X A;  5G05 C;  4DX6 D;  1BU9 A;  3ULY A;  4FJZ A;  3G2W A;  3TWW A;  3ZGQ A;  3CVN A;  3LVR E;  4GA0 A;  1WY6 A;  3LVQ E;  4CEM A;  3JXJ A;  5CHE E;  4MRU A;  3B13 A;  4N3B A;  4L2Y A;  5LCW C;  1DCE A;  5J90 A;  3GZS A;  4F6R D;  3AAA C;  5LP0 A;  1OCC E;  3IHY A;  3D3M A;  4ABN A;  4XI0 A;  3UT4 A;  3L16 A;  4FJY A;  4LSZ E;  3FTS A;  4JEH A;  3CVV A;  4AP2 A;  3UXG A;  1Y6I A;  3RK6 A;  3D9K A;  4OAU C;  4J8Y A;  1TNU A;  3EHR A;  4UWH A;  1TNB A;  4HLL A;  1N94 A;  1TN6 A;  2DWZ A;  4PS8 A;  2WVI A;  2JLB A;  3V30 A;  4HRL A;  3ABK E;  4XKC A;  3ZW3 A;  4N2S A;  3BQO A;  3ZNG A;  4BFR A;  5J08 A;  5A7D B;  5G04 J;  1HH8 A;  1K1B A;  2VGX A;  4OVU A;  3RIB A;  3PZ3 A;  3Q79 A;  3U64 A;  4YDY A;  1TJC A;  2WQ6 A;  3VLD A;  3L82 A;  2OEW A;  3FTY A;  3PEV B;  2YHE A;  3JQ1 A;  5C2Y A;  3B95 A;  4J8D A;  3ENE A;  1N0R A;  1DVP A;  2Y69 E;  3C3Q A;  2IOL A;  1P5Q A;  4CGV A;  4HXI A;  3ASG A;  2DZO A;  1FT2 A;  5BNW A;  3LDZ A;  3LPZ A;  1N4R A;  5KBA A;  3FTW A;  3SD5 A;  1DCQ A;  2AJA A;  1MX2 A;  3AS4 A;  2L0I A;  3W9F A;  3DWL G;  2YNQ A;  4EBA G;  5BUZ A;  2FO7 A;  3I5P A;  4N3C A;  1U3C A;  2ETC A;  5ITZ F;  4NAC A;  4D10 C;  2OV8 A;  3FH8 A;  2XZT G;  2PNN A;  4WNG A;  1PY1 A;  4TUM A;  3DBS A;  1KLX A;  4EZL A;  3DXK G;  2XHE A;  4I17 A;  3MKQ B;  4Q69 A;  4N39 A;  2ZIR A;  4L1B A;  3ZN3 A;  1OCO E;  1OWL A;  4GTR A;  1O1S A;  4RLY A;  4J7W A;  3QC1 A;  3V79 K;  3CVP A;  4L9P A;  1Z3X A;  2P9P G;  3DST A;  3TL5 A;  3ZRH A;  2WQH A;  3FUN A;  1SA4 A;  3EHM A;  5BW8 C;  5LX8 A;  2PM7 A;  2ZXW E;  2DVW A;  5BPP A;  1TN8 A;  2IO3 C;  2GW1 A;  4ATG A;  1IXV A;  2CHW A;  1OWM A;  3U3W A;  4NRH B;  3G2U A;  1OY3 D;  3U66 A;  1N52 A;  2C0M A;  4HBD A;  1N11 A;  3NQP A;  5HI7 A;  2XZD G;  1A17 A;  2NC9 A;  3BUA A;  4KT6 B;  1TYQ G;  4ANV A;  2Y3A A;  1Z5S C;  2WXQ A;  4CZ2 D;  2IEJ A;  3PZD A;  2MYO A;  2CG2 A;  2WXM A;  3I4R B;  4U0S A;  3EU5 A;  3DRA A;  4LUN U;  4BEP A;  4FHJ A;  3RRU A;  3TXM A;  1XNF A;  3OXL A;  5BT1 A;  3FDH A;  4GZ6 A;  4HQD A;  2VTB A;  5HS0 A;  4TRQ A;  3HXE A;  2LXL A;  3CVY A;  1EDU A;  2P9N G;  4QQI A;  1XGW A;  2WXH A;  3NBN B;  2I2O A;  1HU3 A;  4B89 A;  2F37 A;  4OVV A;  3TWQ A;  3P2B A;  3KAE A;  1WDY A;  2I6H A;  3MCX A;  2KC7 A;  5FIO A;  3L54 A;  3QOU A;  5CCL A;  1OWO A;  3PUK A;  5ENN A;  2I9C A;  3ONK A;  3UPV A;  3FU3 A;  1ZU2 A;  1DC2 A;  1FCH A;  4APO A;  4GML A;  2BED A;  4A1S A;  4J8E A;  3T8M A;  2R03 A;  5CEC B;  4NIK A;  1BI7 B;  5EID A;  4ILH B;  4DX2 A;  3PVL A;  4GTQ A;  2P9U G;  1U3D A;  4JL0 A;  2C2L A;  3ABL E;  2IO2 C;  2FO1 E;  1AP7 A;  3P1U A;  4K5A B;  4PH4 B;  3LS8 A;  2VQ2 A;  5HKP A;  4JHR A;  1N0Q A;  5AYW D;  2HYZ A;  4EZK A;  2VYI A;  4BSX A;  3TG4 A;  1NA0 A;  4BES A;  4ZHB A;  2FF4 A;  1EYH A;  3L6A A;  4Y6C A;  3AJI A;  3Q5M A;  2R5S A;  2VSN A;  3QAR A;  3UKR G;  4EBA A;  1YA0 A;  4YVO A;  3G2V A;  2KZT B;  5CRV A;  4JXT A;  5CEA A;  4F3V A;  4GZC A;  3PZ4 A;  4OAV B;  4IN3 B;  4GA2 A;  4I1A A;  1MQS A;  4JC8 A;  3KEZ A;  4GMJ A;  2A4Z A;  3LXU X;  3UIP C;  3T5X A;  4F1P A;  2WXK A;  4I9C A;  3HDX A;  3GYZ A;  3Q15 A;  3R7Q A;  1AWC B;  3ABM E;  2AXU A;  1JPL A;  3TAX A;  3AG2 E;  4BY6 A;  4R7L A;  3L08 A;  3FTV A;  3E32 A;  3N71 A;  2L6J A;  5EYP F;  3FUJ A;  5JJ7 A;  3ESK A;  4ZFH A;  4B8C B;  3Q9N C;  3CHP A;  4WUY A;  5FQ4 A;  4E6H A;  3ASF A;  1YCS B;  5BV0 A;  3I4G A;  3EIJ A;  4GAA A;  3ZYL A;  4L7T A;  2F8Y A;  3B7B A;  4K5C A;  2E0I A;  1VDY A;  2FI7 A;  2LO6 A;  2ZGD A;  5B1B E;  3MEK A;  2JEK A;  3L9T A;  3NB2 A;  3R7R A;  4AVX A;  4MLP A;  4A3V A;  2EIL E;  1TN7 A;  4FC8 A;  4GMR A;  3O4Z A;  4G26 A;  5ENS D;  2WXF A;  3C3R A;  5G2N A;  1NL4 A;  5EN5 D;  4FLH A;  1N4Q A;  3F6Q A;  1SVX A;  1Z6T A;  4ACL A;  3AS8 A;  5BV1 A;  2IJG X;  1MX6 A;  4E85 A;  4H7X A;  1OWP A;  2IU1 A;  2LSU A;  4N5Q A;  1UG3 A;  1HX8 A;  5FWQ A;  2HE0 A;  2AVP A;  3B7S A;  2EQX A;  3UM0 A;  2LUH A;  3DPD A;  4BET A;  2GRR B;  1W3B A;  3B7R L;  4YND A;  1K3Z D;  2J4D A;  3FEY A;  3UT7 A;  2J4B A;  2EIM E;  2KM4 A;  3TWX A;  5AQB A;  1KZO A;  3PNL B;  5LFA A;  1D9S A;  4UQY A;  5ENQ D;  3Q47 B;  1UJK A;  5D2M C;  5KNG A;  2WXR A;  1YMP A;  4FUL A;  2CFU A;  1BD8 A;  4U8Y D;  4TXQ A;  5D66 A;  4M7C A;  1U2V G;  3CK8 A;  2VGX B;  4U8V D;  4AV7 A;  4I6G A;  5B1A E;  3QWV A;  2CHX A;  4XZ4 A;  4HFG A;  2XGO A;  4C9B B;  3ASD A;  5C1D A;  3AS5 A;  3DEO A;  4DK5 A;  2AXV A;  1Z3Y A;  4GCN A;  5G05 J;  5EKQ D;  2H6I A;  4BTA A;  4HRM B;  2Y4T A;  3EU9 A;  3VLE A;  2X6H A;  4GPM A;  5DBK A;  3VTX A;  3TWT A;  3EHN A;  3NZS A;  4B93 B;  2PL2 A;  3SI5 A;  1UW4 B;  4CGW A;  2AXZ A;  3AG4 E;  4NQ0 A;  4K03 A;  3V2O A;  4Q96 A;  3E37 A;  3LKU A;  1H2T C;  2WXI A;  3CVX A;  5G04 C;  4KVM A;  3RU0 A;  4F53 A;  3D9O A;  1IQU A;  2QY7 A;  3FEX A;  4XKB A;  2E2E A;  4YDO A;  2V0P A;  5EDS A;  3TGO A;  1N95 A;  3ASN E;  1D8E A;  2RD0 A;  3PNT B;  1S0P A;  3BEE A;  5ENO D;  4WND A;  1DNP A;  3TWS A;  2V5F A;  2KBX A;  5CMY A;  1H2U A;  1KT1 A;  3RRN B;  4G11 A;  3CHS A;  4G1T A;  1QQE A;  2V4H C;  1V54 E;  4BSZ B;  4HNA D;  3SO8 A;  2DBA A;  3ML8 A;  3JXI A;  1LF8 A;  3C5R A;  3S2A A;  2EIJ E;  3MV3 B;  3JYS A;  4CCA A;  2MRI A;  4PS3 A;  3SFZ A;  3FU5 A;  3UTM A;  2WMO A;  5T3R A;  3R9A B;  4TXR A;  3BG0 B;  4DPR A;  3ULE G;  4G8L A;  1H6K A;  3ZHE A;  2J8S D;  3URZ A;  4FA6 A;  1HXI A;  3D9M A;  3JCK C;  1TJF A;  1Y8M A;  3ZVV A;  3SBT B;  3FUI A;  5AAR A;  2XPY A;  3UMV A;  4ME2 A;  2OVF A;  4FHK A;  3TWU A;  2UY1 A;  3B7U X;  3CLJ A;  3RAU A;  4UWG A;  3RO3 A;  4RG9 A;  4A63 B;  4UQZ A;  3C72 A;  1JCS A;  4HS2 A;  1EPU A;  3D9L A;  3PEU B;  3KEA A;  4N3A A;  3ZU7 B;  2XCB A;  1A5E A;  2VSY A;  2L6B A;  3CQC B;  4I6E A;  4BT8 A;  2VTB B;  3L22 A;  3G2T A;  4HI9 A;  4IYP A;  4TXP A;  1SZA A;  2ETB A;  2J9Q A;  3FH7 A;  4I2Z A;  3CEQ A;  4ILG A;  3IV0 A;  4J6I A;  4U04 A;  4K5B A;  1LD8 A;  2NXP A;  3D9P A;  4AM9 A;  4U7E B;  4DX5 D;  2RFM A;  2GGF A;  5CER B;  3DXM G;  1HFA A;  1K1A A;  4AOF A;  2QC9 A;  2GRQ B;  5G55 A;  4N2Q A;  3MYV A;  4GYY A;  5KCM A;  5JA4 D;  4GTO A;  4GU5 A;  1G3N B;  2JAB A;  4I1M A;  1MJ0 A;  3MV2 B;  3UT8 A;  4F7A A;  1HE8 A;  3UIN C;  5E76 A;  5EX0 A;  3SF4 A;  4DI4 A;  1RZ4 A;  4C0E A;  2R17 C;  2X3M A;  3E33 A;  3Q49 B;  2BUG A;  3AG1 E;  3KS2 A;  5ENR D;  2VGE A;  4HOT A;  2HM8 A;  3U4T A;  2B0O E;  4JEU A;  1H6O A;  3ZFW A;  4U8H A;  2AW6 A;  2Q7F A;  2P58 C;  4CYM D;  3ZYQ A;  1E7V A;  1E8Z A;  3GZ2 A;  3ZXS A;  2KXP C;  2CFZ A;  2J49 A;  3LJN A;  4RSY A;  2B6C A;  1WM5 A;  1JCQ A;  4JHK A;  3CSF A;  3AU5 A;  2QFC A;  3NOC D;  4GCO A;  3B7T A;  4LER A;  2A5U A;  1ELK A;  2F8X K;  2IF4 A;  1HZ4 A;  2H6H A;  4ILI A;  3PE4 A;  4O6F A;  1H19 A;  2M63 A;  1E96 B;  3CST A;  3CHR A;  4Z68 A;  4C0M A;  1K8K G;  3IXE A;  4GZ5 A;  4GYW A;  3K9I A;  2ZU6 B;  4Q94 A;  3HXD A;  4BTB A;  2P9K G;  2XCC A;  2L9B A;  1UN8 A;  1E8Y A;  4YVQ C;  4PUC A;  4J8F A;  2L0T B;  5ARG A;  1QBQ A;  2VSX E;  3HHM A;  4EPZ A;  4KBQ A;  3LJ3 A;  2IOS A;  4GB9 A;  1MHQ A;  5FQ7 A;  3RKV A;  2V8S E;  5JMN D;  4LRZ A;  3RJV A;  4I43 A;  3I3N A;  5BXO A;  3LY9 A;  3T8K A;  5D0Q D;  1O1T A;  3LY8 A;  3HIZ A;  4DX7 D;  1E8W A;  2WXN A;  4GA1 A;  3DEP A;  2PQR A;  2PZI A;  4AJW A;  2ETA A;  1OCZ E;  3OXF A;  1O1R A;  4XI9 A;  5A6C A;  4RQI A;  4BX9 A;  2DCP A;  4I1O B;  2Y0B G;  4APF A;  2FUL A;  3LY7 A;  3FU0 A;  3TWV A;  3Q7A A;  2WMN A;  3UIO C;  4JPS A;  3SGH A;  1H2V C;  3ZEF A;  4G2V A;  4JW1 A;  4WWO A;  2XRY A;  3WG7 E;  4HOR A;  4HOU A;  2VGY A;  3Q7F A;  3U9W A;  4V3I A;  4CRW A;  2KCV A;  1N54 A;  1JWF A;  1B89 A;  4KYO B;  3ZYK A;  2IQC A;  3FUE A;  5FZR A;  1NP7 A;  2DYR E;  3FUF A;  5LOZ A;  2H6F A;  3CK7 A;  1NA3 A;  3JQ0 A;  4W9R A;  2R59 A;  4ATZ D;  5FZS A;  4OYS A;  3KSQ A;  3PRZ A;  2IY0 C;  4QFV A;  5AQA A;  3IHV A;  2GRN B;  3SFY A;  4YDW A;  4HLE A;  3FP3 A;  3LCA A;  4L2L A;  2P9S G;  4U63 A;  4P29 A;  4KXK B;  3UKU G;  1X81 A;  1UOH A;  1BPO A;  3MJW A;  2F0Y A;  4G8K A;  3OAW A;  5ENT D;  4B94 A;  4GTS A;  1MYO A;  3S7D A;  4FP7 A;  2QYJ A;  5AN8 A;  1MZC A;  3AU4 A;  4UI9 J;  1ELR A;  2Y1L E;  4FU3 A;  3HG0 D;  1JCR A;  3FTX A;  3HXB A;  4ANU A;  5B3S E;  2LAI A;  4AY6 A;  2MOW A;  3CHQ A;  2RFA A;  4UI9 K;  2WM9 A;  2X6J A;  5CBN A;  3X2Q E;  2GRM A;  3CK9 A;  4BWR A;  3CHO A;  1OUV A;  3RSE G;  2RG8 A;  3G2S A;  1JUQ A;  3ZYM A;  1ELW A;  3FH5 A;  3DPY A;  2I1J A;  5JHA A;  1PAQ A;  1HG2 A;  3SHF A;  2V4L A;  1H0A A;  4Y6W A;  3NZU A;  2QYU A;  3J5P A;  3TJP A;  2P9L G;  3WXX A;  3E34 A;  1TNZ A;  5IY5 E;  2VSO E;  3MGB A;  3S7J A;  3APF A;  3TXN A;  2J08 A;  5AQ7 A;  4TV3 A;  2RKK A;  3QB2 A;  3PE3 A;  3PDN A;  5FIN A;  3LYA A;  5HRY A;  5T8I A;  3Q9U C;  5CBO A;  3SNX A;  2HR2 A;  3HYM B;  4DLQ A;  3ZHE B;  2AWI A;  1HG5 A;  1QZ2 A;  5LCW J;  2OOE A;  4B8A A;  2NYJ A;  1IHG A;  2KCL A;  2XEV A;  5AQ9 A;  1O5M A;  1SA5 A;  4O1P A;  3HVE A; 
#chains in the Genus database with same CATH homology
 3CEQ A;  4ILG A;  3TG5 A;  5KJM A;  3GW4 A;  1OWN A;  3IV0 A;  3QK0 A;  2UY1 B;  2XPZ A;  4J6I A;  3EJN A;  3E4B A;  4U04 A;  3ZIM A;  4I2W A;  5ARF A;  4N5C A;  4TUU A;  3P1U A;  4HOS A;  4PH4 B;  3BG1 B;  3LS8 A;  2VQ2 A;  5T4Y A;  3CIA A;  2NXP A;  1FVF A;  3D9P A;  5KJL A;  4AM9 A;  4FLB A;  4JHR A;  2GGF A;  5JJT A;  4IRU A;  1E7U A;  4UWL A;  5AYW D;  2HYZ A;  4EZK A;  3FUK A;  1HFA A;  2VYI A;  4AOF A;  3FHE A;  4GYO A;  2XGS A;  4BSX A;  4AY5 A;  3TG4 A;  5HQ8 A;  5G55 A;  4N2Q A;  3MYV A;  3EIQ C;  1NA0 A;  4GYY A;  5KCM A;  4XE0 A;  5KJK A;  5ANR A;  2FF4 A;  2DIW A;  1EYH A;  3FFL A;  3L6A A;  4GZD A;  3CHM A;  4Y6C A;  1TEZ A;  4WNF A;  3Q5M A;  2R5S A;  2VSN A;  3CKB A;  4GU5 A;  3QAR A;  2MHK A;  3FY4 A;  4J0U A;  4URK A;  4I6J A;  4EBA A;  4I1M A;  2WXG A;  1YA0 A;  3MV2 B;  4YVO A;  3G2V A;  2KZT B;  3UT8 A;  4F7A A;  3QDN A;  1HE8 A;  4JXT A;  3SZ7 A;  3ZPJ A;  5E76 A;  2YIN A;  5EX0 A;  3SF4 A;  3APD A;  4DI4 A;  4F3V A;  4UWF A;  4GZC A;  4C0E A;  5AJL A;  4XIF A;  2R17 C;  3FUH A;  2X3M A;  3QWP A;  5AJD A;  1X5B A;  4A1G A;  3HVE B;  3CVQ A;  3Q49 B;  2ION A;  2KCK A;  2BUG A;  3KS2 A;  4IN3 B;  4GA2 A;  2YQ8 A;  4I1A A;  5AIJ A;  3ULQ A;  4HOT A;  1MQS A;  4JC8 A;  4UQX A;  5CCM A;  3KEZ A;  1GW6 A;  2HM8 A;  4GMJ A;  3U4T A;  2A4Z A;  3L17 A;  2CHZ A;  3LXU X;  4JA7 A;  3T5X A;  3QWW A;  4JEU A;  1L5J A;  3ZFW A;  3T5V A;  4U8H A;  2AW6 A;  4A3T A;  3OXG A;  2Q7F A;  2P58 C;  2WXK A;  4KVO A;  3CQG B;  1E8X A;  4I9C A;  3ZYQ A;  1E7V A;  1E8Z A;  3GYZ A;  3GZ2 A;  3HDX A;  3MKR A;  3Q15 A;  4PS7 A;  5G05 C;  3R7Q A;  3D9J A;  2WPV A;  3ZXS A;  4DI3 A;  4FJZ A;  3G2W A;  2AXU A;  2CFZ A;  2J49 A;  1JPL A;  4RSY A;  3TAX A;  1WM5 A;  3ZGQ A;  3CVN A;  3LVR E;  3VLF A;  4JHK A;  4A55 A;  3CSF A;  4PDX A;  4BY6 A;  5DIZ A;  1UJJ A;  4R7L A;  3L08 A;  3FTV A;  4GA0 A;  3AU5 A;  1WY6 A;  3N71 A;  2L6J A;  2QFC A;  4GZ3 A;  3LVQ E;  3FUJ A;  4GCO A;  3B7T A;  3ESK A;  5JJ7 A;  3KD7 A;  4LER A;  4CEM A;  2PM6 A;  5CHE E;  4B8C B;  4MRU A;  2A5U A;  3CR3 A;  3CHP A;  1ELK A;  2IF4 A;  1HZ4 A;  2LSV A;  4FAD A;  4ILI A;  3B13 A;  3PE4 A;  4O6F A;  1H19 A;  2M63 A;  4N3B A;  1E96 B;  4WUY A;  3FTU A;  5FQ4 A;  4E6H A;  3ASF A;  5BV0 A;  3CST A;  4L2Y A;  3I4G A;  3CHR A;  5LCW C;  2WXP A;  5J90 A;  3EIJ A;  3GZS A;  4GAA A;  4C0M A;  5LP0 A;  4GZ5 A;  4GYW A;  3IHY A;  3K9I A;  5CMW A;  4H7Y A;  3ZYL A;  2ZU6 B;  4L7T A;  3D3M A;  4UWK A;  4ABN A;  4XI0 A;  3UT4 A;  4IUL A;  3L16 A;  2E0I A;  4Q94 A;  4KZ0 A;  4FJY A;  1VDY A;  3FWV A;  3FTS A;  4BTB A;  4JEH A;  3CVV A;  2FI7 A;  4AP2 A;  2XCC A;  2LO6 A;  2L9B A;  1UN8 A;  4G25 A;  1ZBP A;  5FT9 A;  3MEK A;  2JEK A;  3IBE A;  1Y6I A;  3RK6 A;  3R7R A;  3D9K A;  4AVX A;  1E8Y A;  4M3O A;  4YVQ C;  4PUC A;  4MLP A;  3RRM B;  4A3V A;  4J8F A;  3QJZ A;  5FTP A;  4UWH A;  2L0T B;  3PH0 C;  5ARG A;  4EEC A;  3JUI A;  4PS8 A;  4FC8 A;  3RO2 A;  2VSX E;  3O4Z A;  4G26 A;  5FQ6 A;  2WXF A;  2LAH A;  5G2N A;  1KT0 A;  2WVI A;  2JLB A;  3HHM A;  2CG3 A;  4EPZ A;  4KBQ A;  3LJ3 A;  2IOS A;  4GB9 A;  4FLH A;  1MHQ A;  4XKC A;  5FQ7 A;  2V8S E;  3RKV A;  2UWJ G;  3ZW3 A;  2FBN A;  4N2S A;  4LRZ A;  1Z6T A;  4ACL A;  4CDN A;  3RJV A;  4I43 A;  3AS8 A;  2X38 A;  3I3N A;  5BV1 A;  3LY9 A;  2IJG X;  4BFR A;  5D0Q D;  4E85 A;  4WAF A;  5J08 A;  5A7D B;  4H7X A;  3LY8 A;  5G04 J;  1HH8 A;  1OWP A;  3HIZ A;  2VGX A;  4OVU A;  2IU1 A;  3CV0 A;  3PS6 A;  3RIB A;  1NZN A;  2LSU A;  3UQ3 A;  4G23 A;  4HVB A;  1E8W A;  5FZQ A;  1UG3 A;  2WXN A;  4GA1 A;  1HX8 A;  4AIF A;  3U64 A;  3CVW A;  1IQR A;  3QKY A;  3APC A;  2PQR A;  2PZI A;  4AJW A;  1TJC A;  4EQF A;  2WQ6 A;  3VLD A;  3OXF A;  5FWQ A;  2AVP A;  4XI9 A;  4F1S A;  5A6C A;  4BX9 A;  2DCP A;  3B7S A;  3CVL A;  3FTY A;  3PEV B;  2EQX A;  2YHE A;  3JQ1 A;  5C2Y A;  4J8D A;  4I1O B;  3ENE A;  4BX8 A;  5M72 A;  1JWG A;  3DPD A;  3D9N A;  1DVP A;  1W3B A;  3MKQ A;  3B7R L;  4APF A;  2IOL A;  2PQN A;  3ASH A;  4MKT A;  1P5Q A;  4YND A;  3UX4 A;  4CGV A;  2J4D A;  3FEY A;  1PC2 A;  2FUL A;  4B0Z A;  3LY7 A;  3FU0 A;  3UT7 A;  4JVS A;  3CGH A;  2J4B A;  1SQM A;  2WXO A;  4HXI A;  2KM4 A;  3ASG A;  4JA9 A;  4ANX A;  3PNL B;  5BNW A;  5LFA A;  3LDZ A;  3LPZ A;  4CT0 A;  1HF8 A;  4UQY A;  2WMN A;  3FTW A;  3Q47 B;  3SD5 A;  1UJK A;  4JPS A;  3VTY A;  3SGH A;  3AS4 A;  1FVH A;  2WXR A;  2L0I A;  2YNQ A;  4FUL A;  4EBA G;  2CFU A;  5BUZ A;  1H2V C;  3ZEF A;  4G2V A;  2FO7 A;  3I5P A;  4JW1 A;  4WWO A;  4N3C A;  4NUR A;  1U3C A;  2XRY A;  3C98 A;  3CK8 A;  2VGX B;  4AV7 A;  2NSZ A;  4HOR A;  4NAC A;  4HOU A;  4I6G A;  2VGY A;  3ML9 A;  3U9W A;  4D10 C;  3QWV A;  4RVB A;  4V3I A;  4CRW A;  2KCV A;  1N54 A;  2OV8 A;  2CHX A;  5D0O D;  1JWF A;  4XZ4 A;  4CDM A;  3FH8 A;  4WNG A;  4HFG A;  4U0U A;  1B89 A;  2XGO A;  1PY1 A;  4KYO B;  3ZYK A;  3DBS A;  1KLX A;  4C9B B;  3ASD A;  5C1D A;  3IKO B;  2YHC A;  4EZL A;  3AS5 A;  5FJY A;  2XHE A;  4JHJ A;  2X6K A;  3MKQ B;  4I17 A;  4RG6 A;  2XQ0 A;  4L23 A;  2IQC A;  4N39 A;  3FUE A;  4JZY A;  5FZR A;  2ILR A;  4DK5 A;  4Q69 A;  2AXV A;  1NP7 A;  4K0R A;  3LEW A;  1Z3Y A;  3FUF A;  4L1B A;  5LOZ A;  3ZN3 A;  3CK7 A;  4GCN A;  5G05 J;  1NA3 A;  3CVU A;  5EKQ D;  1OWL A;  3JQ0 A;  4W9R A;  1EF1 C;  4BTA A;  2R59 A;  3Q4A B;  3GZ1 A;  3QNK A;  2Y4T A;  5FZS A;  4OYS A;  3VLE A;  2X6H A;  4I9E A;  3QC1 A;  5DBK A;  3EHN A;  3PRZ A;  3VTX A;  3NZS A;  4QFV A;  4LCT A;  5A23 A;  3CVP A;  4U07 A;  1Z3X A;  3IHV A;  2PL2 A;  4AXH A;  3SI5 A;  1UW4 B;  2WQ7 A;  2OVB A;  4CGW A;  2AXZ A;  2FEZ A;  3TL5 A;  3ZRH A;  2WQH A;  3FUN A;  4NQ0 A;  4K03 A;  5JJ6 A;  3FP3 A;  4HLE A;  3PUJ A;  3LCA A;  4Q96 A;  3LKU A;  1H2T C;  3EHM A;  4L2L A;  2WXI A;  5BW8 C;  3O48 A;  4CT4 A;  3CVX A;  4U63 A;  5G04 C;  1WAO 1;  4P29 A;  3SBS A;  5LX8 A;  4KVM A;  4KXK B;  2PM7 A;  3RU0 A;  4F53 A;  3D9O A;  1IQU A;  2XPI A;  4MS6 A;  2QY7 A;  2VJ8 A;  5BPP A;  2GW1 A;  1E90 A;  3IEG A;  3FEX A;  4ATG A;  4XKB A;  1BPO A;  3MJW A;  2E2E A;  2OND A;  3ESL A;  3FTZ A;  5JHB A;  2CHW A;  3OAW A;  1OWM A;  5E75 A;  2V0P A;  2C0L A;  5EDS A;  3TGO A;  4LEU A;  5FQ8 A;  4B94 A;  3U3W A;  4DLO A;  4NRH B;  2RD0 A;  3G2U A;  3PNT B;  3S7D A;  4FP7 A;  1S0P A;  3BEE A;  2GRL A;  3U66 A;  4BT9 A;  1N52 A;  2C0M A;  2WXJ A;  3AU4 A;  4UI9 J;  1ELR A;  4FU3 A;  4WND A;  3S7B A;  1DNP A;  4J8S A;  2XRZ A;  2KAT A;  3NQP A;  2V5F A;  5CMY A;  1H2U A;  5HI7 A;  2LNI A;  3MA5 A;  3FTX A;  1KT1 A;  3RRN B;  2WXL A;  4G11 A;  2X6I A;  3CKC A;  1QQE A;  3CHS A;  1A17 A;  4G1T A;  2NC9 A;  4ANU A;  4KT6 B;  2LAI A;  3FU6 A;  2DBA A;  1SZ9 A;  2J09 A;  4ANV A;  4EZJ A;  4AY6 A;  3L13 A;  2MOW A;  3ML8 A;  1LF8 A;  2Y3A A;  3CHQ A;  3S2A A;  4DJA A;  2WXQ A;  3MV3 B;  1UN9 A;  2J07 A;  4UI9 K;  2WM9 A;  3PZD A;  2X6J A;  3JYS A;  4CCA A;  2CG2 A;  2WXM A;  3I4R B;  2MRI A;  4U0S A;  4PS3 A;  2GRM A;  3CK9 A;  4BWR A;  1INZ A;  3FUL A;  3CHO A;  5ANL A;  3D9I A;  4LUN U;  1OUV A;  3FU5 A;  3SFZ A;  2WMO A;  3FUM A;  4FHJ A;  3RRU A;  3TXM A;  1XNF A;  2XGM A;  5T3R A;  2RG8 A;  3OXL A;  3G2S A;  3R9A B;  4WWP A;  5BT1 A;  1JUQ A;  3BG0 B;  3MZL B;  1ELW A;  3FDH A;  4GZ6 A;  3ZYM A;  4DPR A;  3FH5 A;  2VTB A;  2I1J A;  5JHA A;  4GPK A;  2BTD A;  4TRQ A;  1PAQ A;  1HG2 A;  1H6K A;  3SHF A;  3ZHE A;  1QNF A;  2V4L A;  3CVY A;  1H0A A;  3URZ A;  4FA6 A;  1EDU A;  1HXI A;  3D9M A;  4Y6W A;  1XGW A;  3NZU A;  2WXH A;  2I2O A;  3JCK C;  3TJP A;  1HU3 A;  3NF1 A;  1TJF A;  4B89 A;  4ANW A;  2Y4U A;  3PRE A;  4OVV A;  1Y8M A;  3OTN A;  3ZVV A;  3WXX A;  3SBT B;  1HO8 A;  3FUI A;  3P2B A;  4WWN A;  2XPY A;  3KAE A;  2I6H A;  2OVF A;  4FHK A;  4ME2 A;  4KMO A;  2UY1 A;  3UMV A;  3B7U X;  4KZC A;  2VSO E;  1HS6 A;  3MGB A;  3MCX A;  4G24 A;  2KC7 A;  3CLJ A;  4XX5 A;  3S7J A;  2BF0 X;  3APF A;  1IYG A;  4UWG A;  3RO3 A;  4RG9 A;  3TXN A;  2J08 A;  4HOQ A;  3L54 A;  4WNE A;  3FUD A;  4UQZ A;  4HS2 A;  3S7F A;  3QOU A;  1EPU A;  4TV3 A;  3QAQ A;  4AEZ C;  3QB2 A;  3PE3 A;  3D9L A;  3PEU B;  5CCL A;  4ACK A;  3PDN A;  1OWO A;  2X6F A;  3PUK A;  5ENN A;  2I9C A;  3MX3 A;  4N3A A;  3ONK A;  2XCB A;  5EX3 A;  3UPV A;  3LYA A;  5T8I A;  2VSY A;  2IFU A;  3FU3 A;  3CQC B;  4I6E A;  2HO1 A;  3SNX A;  4BT8 A;  1ZU2 A;  2I1K A;  1FCH A;  4APO A;  2WB2 A;  5KJN A;  4GML A;  2HR2 A;  2VTB B;  3HYM B;  4DLQ A;  3L22 A;  4A1S A;  3ZHE B;  3G2T A;  2AWI A;  4J8E A;  3T8M A;  4CDR A;  1HG5 A;  1QZ2 A;  5LCW J;  2OOE A;  4B8A A;  4IYP A;  2KZT A;  4ILH B;  3PVL A;  1IHG A;  1U3D A;  2KCL A;  3ONL A;  4JL0 A;  3UUX A;  1SZA A;  2XEV A;  2J9Q A;  3FH7 A;  2C2L A;  5AEN A;  4UI9 C;  3EDT B;  3HVE A;  4I2Z A;  4U0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...