1SZAA

The rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
144
structure length
144
Chain Sequence
MDHDTEVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQKLYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGLPLFEGSALEKIEQFLIKASAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PCF11 protein
publication title Recognition of RNA polymerase II carboxy-terminal domain by 3'-RNA-processing factors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 51
structure length 144
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1szaA00
3G2WA 1VDYA 3D9NA 3ONLA 3G2TA 1H0AA 1DVPA 1JPLA 1SZAA 3ZYQA 1HF8A 2DIWA 3D9KA 1EDUA 3ZYMA 1XGWA 1UJKA 1JWGA 3RRUA 1HG2A 5LP0A 4FLBA 4Q94A 3LDZA 1ELKA 2V8SE 2QY7A 3D9IA 2MOWA 3ZYLA 3D9OA 2KM4A 1EYHA 3D9JA 1INZA 2LO6A 2BF0X 1LF8A 2DCPA 2L0TB 4JXTA 1HG5A 5LOZA 3CLJA 3D9MA 1X5BA 1UJJA 4HFGA 1SZ9A 3G2SA 1HX8A 4GZCA 4AVXA 1HFAA 4GZDA 1MHQA 3G2UA 3D9LA 1JUQA 3ZYKA 1JWFA 4FU3A 5CMYA 5J08A 4Q96A 3ONKA 4NACA 1PY1A 2L0IA 3G2VA 5CMWA 3D9PA
chains in the Genus database with same CATH superfamily
1N9AA 3U9WA 1AWCB 2F8XK 1KZOA 2CFZA 4AY6A 3FTXA 4AV7A 2ETAA 4CDMA 3TGOA 2RD0A 3B13A 4YDWA 3CK8A 2L0TB 4DX2A 4HRLA 2IONA 3HXFA 4JVSA 2XRYA 5KJKA 3CVLA 2AXUA 3SNXA 3BUAA 1U3DA 3MX3A 2PQRA 2IOSA 3TAXA 4MRUA 4ZFHA 4UWGA 3FU0A 3T8MA 3HIZA 1YA0A 2JEKA 3DRAA 1RW2A 4I6GA 4E85A 3APDA 3L9TA 2WXFA 3ZRHA 3FP3A 3WG7E 4PS7A 2VJ8A 3KD7A 4U8HA 4C0MA 2DYSE 3B7BA 5ENNA 4UWHA 2C0MA 3Q49B 1NA3A 3DSWA 4CDNA 4DX6D 1JWGA 1TYQG 4RLYA 1UG3A 3L16A 3OXFA 4EZKA 3E4BA 2FO1E 4DPRA 4HFGA 3CHSA 4HBDA 1UOHA 3C72A 4CGVA 2XEEA 3L6AA 3IKOB 1Y6IA 2LSUA 1DCEA 4G24A 3QNKA 3SHFA 3FUEA 4B89A 4GYOA 2J4BA 3IBEA 2PNNA 1MX6A 4U96D 5LFAA 2WXNA 1BI7B 4U0SA 1MQSA 3FTYA 1QNFA 4DUIA 3D9JA 2DZNA 2J09A 2LO6A 1LF8A 5AJDA 3FY4A 1JCQA 1SZ9A 1HFAA 3BQOA 4A1GA 3QDNA 1Y8MA 3LJNA 3TXMA 1G3NB 5B1AE 4L23A 3NBNB 2I1JA 3Q78A 3T5XA 1RZ4A 4JZYA 1H6OA 4UI9K 1JWFA 3UKUG 3ONKA 1L5JA 3DPDA 2QYJA 2OVBA 5HKPA 5CBOA 3ISMC 4TUUA 4H7XA 4I9EA 3U3WA 3E30A 3FTVA 3GZ1A 3LCAA 5T8IA 3JYSA 4JHRA 3SZ7A 2HYZA 5CEDB 3E37A 2NYJA 5H7PA 3L22A 1QZ2A 3FFLA 5DIZA 2X38A 3MKQB 1HF8A 1N4PA 4J8EA 4J8YA 1OT8A 2XZTG 2IO2C 4B93B 3B7RL 5CBNA 4K5AB 2LXLA 3UM3A 4RQIA 1NZNA 5KJNA 1FPPA 2VTBA 3RAUA 3PEVB 3O4ZA 3TXNA 1H2TC 4KT6B 1ELKA 4B8AA 5T4YA 3ABLE 3D9OA 4AIFA 4GA0A 4KXKB 5JHBA 2VGXB 5A23A 4LRZA 2EIKE 1NL4A 4GU5A 3NZSA 4JEHA 3EU9A 1E8XA 1UN8A 2P9LG 3LVRE 3FH8A 3FUDA 3ULYA 4I43A 4A3TA 3GZSA 2EILE 3EHQA 3QAQA 4BTAA 2V8SE 1KT0A 2ZGGA 4O1OA 4U07A 3O48A 2J9QA 4APOA 4DLQA 3SBSA 3FHEA 3Q7AA 3D9LA 4ILIA 3SBTB 2VSXE 5EIBE 4H7YA 4EPZA 5HQ8A 5ENTD 3JQ0A 5FJYA 3KEAA 4DI4A 3FWVA 1KZPA 2J08A 3AS4A 1H2UA 4OYSA 1OWMA 4ANWA 1N94A 5A7DB 4GZDA 4EBAA 3B95A 2VGEA 2B0OE 2V0PA 3PNTB 4O60A 2VQ2A 4GCNA 5BNWA 4V3IA 3HVEB 5B1BE 4GZ3A 2X6HA 3LS8A 4U0UA 3PZDA 3UT4A 1E8YA 3JUIA 3MKRA 4UI9J 1H2VC 3P2BA 4YDYA 4URKA 3QWPA 1TJFA 3CVUA 4HOUA 4BX9A 4FLHA 2ETCA 2QFCA 2WXKA 4IN3B 2XS1A 2VSYA 1E90A 4GTVA 5FQ8A 3UPVA 1IHBA 3ESKA 1O1RA 1MZCA 2IY0C 4WNEA 3ULQA 4BETA 3D3MA 2R05A 1O1TA 4GA1A 4A55A 2WQ7A 2HM8A 3EDTB 5JJTA 5KWDA 4LNUD 2DVWA 1N11A 1IXVA 4BEPA 4Y6WA 5JMND 3U66A 4HB5A 2IOLA 3CKCA 1AP7A 3R7RA 3V30A 1OCCE 2PZIA 2XRZA 1W3BA 3I4RB 3WXXA 4HXIA 3SFYA 2MYOA 4F3VA 1A5EA 3D9KA 4ABNA 3PE3A 2L6JA 3URZA 3CVWA 3RK6A 4FHKA 2ZXWE 3UMVA 3PZ3A 4DX7D 3UKRG 5EKQD 4HLEA 4TV3A 3ZYMA 4J0UA 3TWWA 2RG8A 2R03A 4G11A 2IF4A 5T3RA 3FTUA 1D8EA 4ZHBA 5FZQA 2L0IA 3ML9A 4CT0A 2H6IA 4XIFA 5BXUA 5ENOD 3CHQA 4B0ZA 1GW6A 1YYHA 4KYOB 1Z3YA 3MCXA 4UWKA 2UY1B 3C3OA 1QBQA 3BG1B 3OAWA 1ELRA 3QB2A 4KZCA 5IY5E 3VLEA 3DBSA 4QQIA 3G2WA 4F1SA 3FUHA 1LD8A 1IYGA 2XZDG 1S0PA 4Q94A 2OV8A 1OY3D 5ARGA 3IHVA 4XI0A 4HNAD 1HXIA 3ASOE 2YNQA 4EECA 1JUQA 3ZNGA 5EDSA 2VGYA 4K0RA 3QOUA 4GAAA 1BI8B 2P9UG 3CHRA 4RVBA 5FIOA 4EZJA 5ENQD 5EX0A 2ZGDA 5G2NA 3CVVA 5G05J 3TJPA 2HR2A 1DNPA 2OOEA 3AS8A 3L17A 4HRMB 4L2LA 1V55E 4YVOA 3W9GA 4GTPA 2EINE 3E34A 3RSEG 4WWNA 5HI7A 2H6HA 2E2EA 3FUFA 4ANXA 2QY7A 4CCAA 2P58C 3NAWA 3TWQA 3DWLG 2AJAA 4WNDA 3UXGA 4HOQA 3ZXPA 4TXQA 4YNDA 3E33A 4I1OB 5AAOA 2CG2A 3PVLA 1E7VA 5ENRD 2FI7A 3ASHA 3TWRA 2FULA 2BUGA 5LCWC 3PNLB 4NIKA 1H19A 1Z5SC 4DRXE 3DEPA 2QYUA 4XE0A 2V5QC 1BLXB 4RG6A 2CFUA 5ANRA 4WUYA 3NQPA 3ENEA 3U4TA 4FADA 5BXOA 4DI3A 3MV2B 4DJAA 3ZN3A 4J8DA 3CR3A 4U63A 2A4ZA 4JD2G 5G04C 4OAUC 3PZ2A 3RRMB 3PZ1A 2QC9A 4IULA 1UJKA 1O5MA 2C2LA 3ABME 1E7UA 5EIDA 4HRNA 4U8YD 3RRNB 2HO1A 4U0ZA 2R17C 2WXPA 4TXPA 5CHEE 4BERA 2HE0A 5FZSA 2EIJE 3T5VA 1H6KA 4MLPA 2GRRB 3DXMG 4BTBA 2MRIA 3HXBA 2WXLA 2CHWA 2CHXA 3ZYLA 1U2VG 2KM4A 2YHEA 2XQ0A 4UWFA 4G2VA 2PQNA 3C3QA 1HZ4A 2X6KA 2IFUA 3HHMA 4B94A 4GZCA 5D2MC 3AG4E 3MGBA 1YCSB 5KNGA 1D8DA 2GRPB 1U3CA 3Q5MA 3CHOA 2EQXA 4KVOA 4XEIG 1UN9A 4TUMA 3NZUA 2R02A 2L9BA 3CVQA 4JHJA 3PRZA 4BSZB 4Y6CA 3KAEA 4GYYA 2RFMA 1ZB1A 2VYIA 1K3ZD 1SA4A 2WPVA 3NOGD 2AW6A 2IQCA 1HO8A 3DEOA 3S2AA 3AAAC 2XPYA 3T8KA 1FVHA 1S64A 3SY2A 3G2VA 5HRYA 1H0AA 4I2WA 3UTMA 4WWOA 3TG5A 4ATGA 5D0OD 1B89A 1UJJA 3DSUA 4L7TA 3ZYKA 4EQFA 3FUKA 1IHGA 1VDYA 4TRQA 3G2TA 4JHKA 5JJ7A 3MV3B 3R9AB 3U64A 4XX5A 3GW4A 2WXHA 3RO2A 2DZOA 3TG4A 4MKTA 1E96B 1OXJA 3MKQA 3QK0A 3CLJA 4D10C 4UQZA 2B6CA 3UT7A 2WXJA 3RO3A 3OXLA 5LCWJ 4JEUA 2J8SD 3ZFWA 2H6GA 3IXEA 1UW4B 2JLBA 3DSSA 3RIBA 3PREA 4A63B 1HH8A 2DBAA 5LOZA 2LUHA 2IJGX 3NB2A 2A5EA 4AXHA 1NI1A 2XHEA 5M72A 3EUVA 2DWZA 2VGXA 3LY9A 3J5QB 3TL5A 2J07A 3IHYA 2FEZA 2GRNB 2X6FA 3S7BA 4CRWA 2KZTB 4JPSA 3PDNA 3Q79A 4CEMA 4F6RD 4BT9A 3SQVA 2V5FA 3GZ2A 4OVUA 5CERB 5ENSD 4G8LA 1IQUA 4GPMA 4E6HA 4N2SA 3FUJA 4EHMA 2X6JA 4O6FA 1N4RA 3AU4A 4HOSA 3LDZA 4GPKA 1DC2A 3EHRA 1ZU2A 3Q4AB 3BU8A 3LXUX 4G25A 5AQ7A 3K9IA 1OWPA 2WXRA 3HVEA 4B8CB 2GW1A 3W9FA 1FT2A 3DSTA 1TNUA 5CEAA 2BEDA 4GYWA 2LSVA 1FVFA 2ONDA 2J4DA 3EIJA 3FTSA 3Q73A 2KBXA 3T9KA 2Y0BG 3ZKJA 4ANUA 3ZHEB 4EBAG 1OCRE 3HXEA 4DLOA 4AEZC 5EYLA 2OEWA 3I5PA 1EDUA 1LD7A 4MS6A 2WXIA 4O1PA 5D66A 4YVQC 4LUNU 1N0RA 1NFIE 2WQ6A 4ATZD 3ZXSA 3QJZA 4NACA 3IV0A 1FT1A 1WY6A 3FDHA 4TXRA 2WB2A 3Q9NC 2DYRE 2L6BA 4GMJA 2XCCA 4JA9A 4N2QA 3I3NA 1PAQA 2RKKA 1X81A 2P9IG 1DCQA 3OXGA 5B3SE 4ANVA 5JHAA 3Q15A 3LY8A 3TWTA 1PY1A 4KBQA 3B7TA 1FCHA 3CVNA 4GZ6A 5AENA 3L54A 3FU3A 3UI2A 3UT8A 4YDEA 3S7FA 1OWLA 5BW8C 3VLDA 4FU3A 1JCRA 4I6EA 3VLFA 4JW1A 4BX8A 2WXGA 2I2OA 4AY5A 2BTDA 4PUCA 1S63A 4NRHB 3G2SA 2UY1A 2KXPC 5EX3A 5J08A 4G1TA 3LKUA 3FU5A 2V4HC 1KLXA 5AQAA 4DX1A 1WG0A 1SZAA 4C48B 4N3BA 1E8ZA 4XI9A 3TWUA 1EYHA 3FTWA 3RJVA 5ARFA 3R9MA 2Y4TA 3RU0A 4F7AA 2WM9A 2AXZA 3PUJA 4JC8A 4UWLA 3SI5A 4J7WA 1EF1C 1K1AA 1HS6A 3ZUVB 4G26A 1QYMA 5CCLA 1HG2A 4W9RA 5AYWD 3FTZA 2R5SA 3FEXA 1N54A 1IQRA 2CHZA 4ACKA 4N5CA 4J6IA 2BF0X 4FP7A 2AVPA 3TWSA 3NF1A 1N4QA 3CK7A 3CQCB 2XPZA 2NSZA 5BUZA 4LNBA 2XS8A 3LEWA 3FUNA 3MA5A 2BKGA 1NA0A 1TEZA 3AS5A 3CK9A 3JQ1A 3QKYA 2VSOE 4WNFA 1E8WA 3CVPA 2VSNA 2WXOA 1A17A 3UIPC 2XGMA 1JPLA 3ZYQA 3E32A 2E0IA 4FLBA 3Q9UC 3F6QA 2KCLA 5AJLA 4JXTA 4NURA 3SF4A 1XNFA 3EHNA 3Q75A 2FBNA 3SFXA 4QFVA 4L2YA 3D9NA 3JXIA 1MX4A 1OCOE 2P2CP 3Q47B 2WMOA 5HS0A 4ILGA 4YDOA 3DXKG 4FHJA 3G2UA 5KBAA 3CQGB 2GROB 4PS8A 4RG9A 4LCTA 2GRMA 4GTQA 4J8FA 4L1BA 4GCOA 1ZBPA 1OWNA 4C9BB 3EIQC 1OUVA 5G55A 3TWVA 4ILHB 4M3OA 4JB8P 4AM9A 1N95A 4Q96A 4K03A 3AU5A 3PS6A 1WAO1 3UM2A 3UINC 1P5QA 5AN8A 2WMNA 3LPZA 4K5BA 3KEZA 1LTXA 2V4LA 3MYVA 4GB9A 4LNGA 2GGFA 4BY6A 2XPIA 1N52A 2R59A 4X8QA 4AP2A 4U8VD 3D9HA 3MZLB 3SO8A 3N71A 2I9CA 4HQDA 3VTXA 2P9PG 4P29A 5BT1A 2ILRA 3UM1A 4HORA 4KMOA 2KC7A 4LEUA 5BV1A 1TN7A 2FO7A 1HU3A 3CIAA 2YINA 3ONLA 3ZGQA 1BD8A 5KCMA 2KCVA 4I6JA 1TJCA 3UUXA 1SW6A 3ESLA 3JUEA 4IRUA 3APFA 1SA5A 5ITZF 4N39A 3V2OA 2A5UA 1MJ0A 4AVXA 1O1SA 3FUMA 3S7JA 3HG0D 1K8KG 2PM7A 3NOCD 4GTOA 3APCA 3DSVA 3KS2A 3ZPJA 4KVMA 1EPUA 4AJWA 3FEYA 4F53A 4WWPA 3ASNE 4LSZE 1TR4A 3ABKE 4OVVA 4UI9C 4XZ4A 4HLLA 3SGHA 4GZ5A 3L13A 3CVYA 5BPPA 4BT8A 3B7SA 2YHCA 2WVIA 1TN8A 4CDRA 1HE8A 5FT9A 5C1DA 3B7UX 3FH5A 1BU9A 5JA4D 4DK5A 3CKBA 3DPYA 4G8KA 3LY7A 5CCMA 3L82A 4I17A 3ML8A 4HI9A 2Y4UA 2WQHA 2GRQB 2NC9A 2XEVA 4WAFA 3HXDA 4MBGA 2KATA 1H6PA 2R2LA 3ASDA 2PL2A 2H6FA 5FZRA 3I4GA 2GRLA 1JCSA 5EN5D 4FJZA 2PM6A 4XKCA 3OTNA 5FQ4A 2KZTA 2F8YA 4GTMA 4JL0A 3AJIA 3ASGA 3V2XA 2LAHA 5G04J 4U95D 2OVFA 4FC8A 1TNYA 2XCBA 4U04A 4BSXA 2WXMA 4U7EB 5CMWA 1TNZA 1SVXA 3JCKC 4FA6A 3ZIMA 1NP7A 3ZU7B 3X2QE 4C0EA 2MHKA 4BESA 2VTBB 3CVXA 1YMPA 1X5BA 4I2ZA 1HX8A 3PUKA 3Q7FA 1TNBA 3QARA 5JJ6A 4LG6A 1OCZE 3EHMA 4N5QA 1WDYA 3SFZA 4F1PA 4M7CA 5LP0A 4GTRA 1MYOA 1V54E 2IU1A 4GTTA 3PH0C 3HYMB 5E75A 2IEJA 5EILA 4A1SA 2XGSA 4ME2A 4EZLA 2F37A 3P1UA 3ZHEA 2LXMA 1D9SA 3QWVA 5C2YA 4LERA 1QQEA 2JABA 3UX4A 3QWWA 5FTPA 2C0LA 4IYPA 4K5CA 1TNOA 3FUIA 3FH7A 5AQBA 5AARA 3MEKA 4Q69A 3ZVVA 5G05C 3D9PA 2I6HA 1KPSB 3CHMA 3CHPA 2LNIA 2NXPA 1SQMA 5FQ6A 3ULEG 3MJWA 3IEGA 2MOWA 2XEHA 3UIOC 4Z68A 3ZEFA 3DSXA 4GMRA 5ENPD 5CRUA 3ZW3A 1Z3XA 5CECB 2CG3A 4FJYA 5D0QD 4CYMD 3S7DA 1N4SA 2ETBA 3CGHA 2DCPA 5FWQA 5LX8A 4A3VA 2ZU6B 2XGOA 3LYAA 4HS2A 5FINA 5KJMA 4HOTA 3SD5A 4I1MA 3V31A 4DX5D 4J8SA 3AG1E 5FQ7A 2KCKA 4WNGA 3C3RA 4CT4A 1S70B 1IKND 5KJLA 3EJNA 5AIJA 1Q2ZA 2IO3C 5EYPF 2M63A 2X3MA 4APFA 3CEQA 3V79K 3KSQA 1XGWA 1ELWA 3FULA 1N0QA 3D9IA 3UQ3A 2X6IA 1INZA 2AXVA 1HG5A 3PEUB 4BWRA 2AWIA 2WXQA 2QZAA 2UWJG 3AG2E 4ACLA 4PDXA 1OWOA 2EIME 2XENA 3QC1A 4I9CA 2J49A 3C5RA 3AG3E 4KZ0A 5DBKA 2RFAA 2YQ8A 4AOFA 1KT1A 2Y69E 4FULA 2OEVA 4HI8A 5BV0A 4BFRA 2DIWA 2P9SG 3UM0A 4HVBA 3RRUA 4UUCA 1K1BA 3ASFA 2ZIRA 4UQYA 3CV0A 3CSFA 3D9MA 4N3AA 4I1AA 3HDXA 5CMYA 3L08A 3BEEA 5CRVA 3PZ4A 1DVPA 1BPOA 3EU5A 1Z6TA 2Y3AA 3PE4A 3R7QA 4NQ0A 3J5PA 3BG0B 3JXJA 3CSTA 3HRAA 3TWXA 3VTYA 5KNHD 2P9NG 3LJ3A 4N3CA 5AQ9A 4JA7A 4OAVB 2P9KG 2Y1LE 5E76A 4CGWA 2FF4A 4PH4B 2F0YA 3FU6A 2I1KA 2BKKB 2Q7FA 3KSLA 4R7LA 4L9PA 4PS3A 1PC2A 5J90A 1MX2A 1WM5A 3RKVA 3C98A 3LVQE 2LAIA 2OCCE 4CZ2D 3HXCA 4GMLA 4UQXA 5A6CA 1TN6A 4GTSA 4G23A 4XKBA 1MHQA 4GA2A 5ANLA 3GYZA 2ZISA 4RSYA
chains in the Genus database with same CATH topology
5EKQD 4XZ4A 4HLEA 3U9WA 4TV3A 2X6JA 4O6FA 3SGHA 4GZ5A 3ZYMA 4J0UA 3L13A 3AU4A 2CFZA 4AY6A 3CVYA 4HOSA 5BPPA 2RG8A 4BT8A 3FTXA 3LDZA 3B7SA 4G11A 4AV7A 4GPKA 4CDMA 1ZU2A 3Q4AB 3TGOA 2YHCA 3LXUX 4G25A 2RD0A 3B13A 2IF4A 3CK8A 2L0TB 3K9IA 2WVIA 1OWPA 4CDRA 2IONA 5T3RA 1HE8A 2WXRA 3HVEA 5FT9A 3FTUA 4B8CB 2GW1A 5C1DA 3B7UX 4JVSA 5FZQA 2L0IA 2XRYA 3ML9A 4CT0A 3FH5A 4XIFA 5KJKA 3CHQA 4GYWA 3CVLA 2LSVA 1GW6A 2AXUA 4B0ZA 1FVFA 3SNXA 4KYOB 2ONDA 4DK5A 1U3DA 3CKBA 3MX3A 1Z3YA 2J4DA 3EIJA 3FTSA 3MCXA 2PQRA 4UWKA 3LY7A 2UY1B 2IOSA 5CCMA 3TAXA 4I17A 3ML8A 4ANUA 3ZHEB 3BG1B 4MRUA 3OAWA 4EBAG 1ELRA 2Y4UA 3QB2A 4KZCA 4DLOA 4UWGA 3FU0A 3T8MA 4AEZC 3HIZA 3DBSA 3VLEA 1YA0A 2WQHA 3G2WA 4F1SA 3I5PA 2JEKA 2NC9A 2XEVA 3FUHA 4WAFA 4I6GA 1EDUA 4E85A 2KATA 1IYGA 3ASDA 3APDA 1S0PA 4MS6A 4Q94A 2WXFA 2OV8A 2WXIA 3ZRHA 2PL2A 5FZRA 5ARGA 3FP3A 4PS7A 3I4GA 2GRLA 3IHVA 4XI0A 1HXIA 4FJZA 2VJ8A 4YVQC 3KD7A 2PM6A 4U8HA 4LUNU 4C0MA 2YNQA 2WQ6A 5ENNA 4UWHA 4EECA 1JUQA 3ZXSA 5EDSA 2VGYA 2C0MA 3QJZA 4K0RA 3OTNA 3QOUA 4NACA 4XKCA 3IV0A 5FQ4A 1WY6A 2WB2A 3FDHA 2KZTA 3Q49B 4GAAA 3CHRA 4RVBA 1NA3A 4GMJA 2XCCA 4EZJA 4CDNA 1JWGA 5EX0A 4JA9A 4N2QA 5G2NA 4JL0A 3I3NA 1PAQA 3ASGA 1UG3A 2LAHA 4UI9C 5G04J 3CVVA 3L16A 2OVFA 3OXFA 4EZKA 5G05J 3E4BA 4FC8A 3TJPA 2HR2A 1DNPA 2OOEA 4HFGA 4DPRA 3AS8A 3OXGA 3L17A 4ANVA 3CHSA 2XCBA 3Q15A 4L2LA 4U04A 4BSXA 3LY8A 5JHAA 1PY1A 2WXMA 4YVOA 5CMWA 4CGVA 4KBQA 3B7TA 1FCHA 3CVNA 4GZ6A 4WWNA 3JCKC 4FA6A 5AENA 3L54A 3ZIMA 3L6AA 3IKOB 5HI7A 1Y6IA 2LSUA 1NP7A 2E2EA 3FU3A 4C0EA 3FUFA 4G24A 3UT8A 2QY7A 4ANXA 3QNKA 4CCAA 2P58C 2MHKA 3SHFA 3S7FA 3FUEA 2VTBB 3CVXA 1OWLA 1X5BA 4I2ZA 4WNDA 4HOQA 1HX8A 4YNDA 3PUKA 4I1OB 5BW8C 3VLDA 4FU3A 3QARA 4B89A 4I6EA 5JJ6A 3VLFA 2CG2A 4GYOA 2J4BA 3IBEA 3PVLA 4JW1A 4BX8A 2WXGA 3EHMA 2I2OA 1E7VA 4AY5A 5LFAA 2FI7A 2WXNA 3SFZA 5LP0A 4U0SA 1MQSA 3ASHA 3FTYA 1QNFA 2BTDA 2IU1A 2FULA 3D9JA 4PUCA 2J09A 2LO6A 2BUGA 4NRHB 1LF8A 5LCWC 5AJDA 3PNLB 3PH0C 3HYMB 5E75A 3FY4A 1H19A 1SZ9A 3G2SA 4A1SA 1HFAA 4A1GA 4XE0A 2UY1A 5EX3A 2XGSA 5J08A 4G1TA 4ME2A 3QDNA 3P1UA 4EZLA 3LKUA 3FU5A 4RG6A 1Y8MA 1KLXA 2CFUA 5ANRA 3ZHEA 1SZAA 4WUYA 3TXMA 4N3BA 1E8ZA 4XI9A 3QWVA 3NQPA 3ENEA 3U4TA 4L23A 2I1JA 5C2YA 4FADA 4LERA 1QQEA 1EYHA 3T5XA 3UX4A 3FTWA 3QWWA 3MV2B 5FTPA 3RJVA 4JZYA 4DI3A 4DJAA 2C0LA 4IYPA 5ARFA 3FUIA 3ZN3A 2Y4TA 3FH7A 3RU0A 4J8DA 4F7AA 2WM9A 2AXZA 3CR3A 4U63A 3PUJA 2A4ZA 4JC8A 4UI9K 1JWFA 5G04C 4UWLA 3MEKA 4Q69A 3ZVVA 3ONKA 5G05C 3D9PA 1L5JA 2I6HA 3SI5A 3DPDA 3CHMA 3RRMB 2OVBA 3CHPA 1EF1C 2LNIA 2NXPA 1HS6A 1SQMA 4G26A 4TUUA 5CCLA 4IULA 1UJKA 4H7XA 1HG2A 4I9EA 5FQ6A 4W9RA 3U3WA 5AYWD 2C2LA 3MJWA 3FTVA 3FTZA 1E7UA 3GZ1A 2R5SA 3FEXA 3IEGA 1N54A 1IQRA 2MOWA 3LCAA 5T8IA 2CHZA 4ACKA 4N5CA 3JYSA 4JHRA 4J6IA 2BF0X 3RRNB 2HO1A 3SZ7A 3ZEFA 4FP7A 4U0ZA 2HYZA 2AVPA 2R17C 2WXPA 3NF1A 5CHEE 3CK7A 5FZSA 3CQCB 3T5VA 2XPZA 1H6KA 3L22A 2NSZA 4MLPA 5BUZA 3ZW3A 1QZ2A 1Z3XA 3FFLA 5DIZA 2X38A 3LEWA 3MKQB 1HF8A 3FUNA 3MA5A 1NA0A 2CG3A 4FJYA 2MRIA 4J8EA 2WXLA 5D0QD 4BTBA 3S7DA 1TEZA 3AS5A 2CHWA 2CHXA 3ZYLA 3B7RL 2KM4A 2YHEA 2XQ0A 4UWFA 4G2VA 3CGHA 3CK9A 2PQNA 3JQ1A 2DCPA 5FWQA 3QKYA 2VSOE 5LX8A 4A3VA 1HZ4A 4WNFA 2X6KA 2IFUA 3HHMA 4B94A 2ZU6B 4GZCA 1E8WA 3CVPA 2XGOA 3LYAA 4HS2A 2VSNA 5KJMA 4HOTA 2WXOA 3MGBA 1NZNA 4I1MA 3SD5A 5KJNA 1A17A 2VTBA 2XGMA 4J8SA 5FQ7A 3PEVB 1JPLA 3ZYQA 3O4ZA 3TXNA 1H2TC 4KT6B 2E0IA 4FLBA 1ELKA 2KCKA 4WNGA 4B8AA 1U3CA 3Q5MA 3CHOA 5T4YA 3D9OA 2EQXA 4CT4A 4KVOA 4AIFA 2KCLA 4GA0A 1UN9A 4KXKB 5AJLA 3NZUA 4JXTA 4NURA 5JHBA 5KJLA 3EJNA 2VGXB 5AIJA 3SF4A 5A23A 4LRZA 1XNFA 3EHNA 2L9BA 2M63A 3CVQA 4GU5A 3PRZA 4JHJA 3NZSA 2FBNA 4Y6CA 4JEHA 3KAEA 4GYYA 1E8XA 1UN8A 2X3MA 3D9NA 4L2YA 4QFVA 3CEQA 3LVRE 4APFA 3FH8A 3FUDA 4A3TA 4I43A 3GZSA 1XGWA 1ELWA 3FULA 3QAQA 2VYIA 4BTAA 2V8SE 3D9IA 3UQ3A 2X6IA 1KT0A 4U07A 1INZA 2WPVA 2AW6A 3Q47B 2AXVA 2IQCA 2WMOA 3O48A 2J9QA 1HO8A 1HG5A 4APOA 4ILGA 3PEUB 4DLQA 3S2AA 3SBSA 2XPYA 4FHJA 3FHEA 1FVHA 3D9LA 3G2UA 3CQGB 4ILIA 4BWRA 2AWIA 3SBTB 2WXQA 3G2VA 4PS8A 4RG9A 2UWJG 4LCTA 2GRMA 2VSXE 4H7YA 4EPZA 5HQ8A 1H0AA 4ACLA 4J8FA 4I2WA 4PDXA 4L1BA 1OWOA 3JQ0A 5FJYA 3QC1A 4DI4A 4I9CA 2J49A 4GCOA 4WWOA 4KZ0A 3FWVA 3TG5A 1ZBPA 5DBKA 2J08A 3AS4A 1H2UA 4OYSA 1OWNA 2YQ8A 1OWMA 4AOFA 4ANWA 4ATGA 4C9BB 3EIQC 1B89A 1OUVA 1UJJA 5D0OD 4ILHB 1KT1A 4M3OA 5G55A 5A7DB 4AM9A 4GZDA 4L7TA 3ZYKA 4EQFA 4FULA 4EBAA 3FUKA 4Q96A 1IHGA 5BV0A 1VDYA 4TRQA 2V0PA 4K03A 4BFRA 3G2TA 4JHKA 3PNTB 5JJ7A 3AU5A 3MV3B 3R9AB 2DIWA 3PS6A 3U64A 2VQ2A 3RRUA 4HVBA 4GCNA 5BNWA 1WAO1 4V3IA 3HVEB 4XX5A 4GZ3A 2X6HA 1P5QA 3ASFA 2WXHA 3GW4A 3LS8A 4U0UA 3RO2A 3TG4A 2WMNA 3PZDA 3UT4A 4MKTA 1E96B 1E8YA 3JUIA 3LPZA 3MKRA 3KEZA 3MKQA 3QK0A 1H2VC 3P2BA 4UQYA 4UI9J 3CV0A 3CSFA 3CLJA 3D9MA 2V4LA 4D10C 3MYVA 4N3AA 4UQZA 4URKA 4GB9A 3QWPA 2GGFA 4BY6A 1TJFA 2XPIA 4I1AA 3HDXA 5CMYA 1N52A 2R59A 3L08A 3CVUA 4HOUA 4BX9A 3BEEA 3UT7A 2WXJA 4FLHA 4AP2A 2QFCA 3RO3A 2WXKA 3OXLA 5LCWJ 1DVPA 3MZLB 4IN3B 4JEUA 3N71A 3ZFWA 1UW4B 1BPOA 2I9CA 2JLBA 2VSYA 3VTXA 1Z6TA 3RIBA 4P29A 3PREA 2Y3AA 3PE4A 1E90A 3R7QA 5BT1A 2ILRA 5FQ8A 3UPVA 1HH8A 3ESKA 2DBAA 4NQ0A 4HORA 4KMOA 5LOZA 2IJGX 2KC7A 4LEUA 3BG0B 5BV1A 3CSTA 4WNEA 3ULQA 4AXHA 3VTYA 2XHEA 3D3MA 5M72A 2FO7A 1HU3A 3CIAA 2YINA 3LJ3A 4GA1A 4N3CA 2HM8A 2VGXA 3ONLA 4A55A 3ZGQA 2WQ7A 4JA7A 3EDTB 5JJTA 5KCMA 2KCVA 3LY9A 4I6JA 1TJCA 3UUXA 3ESLA 4Y6WA 2J07A 4IRUA 3TL5A 3APFA 3IHYA 5E76A 2FEZA 2X6FA 4CGWA 3S7BA 3U66A 2FF4A 4N39A 4PH4B 4CRWA 2IOLA 2KZTB 4JPSA 3CKCA 3FU6A 2I1KA 2A5UA 3PDNA 4AVXA 3R7RA 3FUMA 4CEMA 3S7JA 2Q7FA 4R7LA 2PZIA 4PS3A 2XRZA 1W3BA 1PC2A 2PM7A 3I4RB 3WXXA 1WM5A 4BT9A 5J90A 4HXIA 4F3VA 3APCA 3RKVA 3KS2A 3C98A 3ZPJA 3LVQE 3D9KA 4KVMA 2V5FA 3GZ2A 1EPUA 2LAIA 4OVUA 4ABNA 3PE3A 4AJWA 2L6JA 3URZA 3FEYA 4GMLA 4F53A 3RK6A 3CVWA 4WWPA 4FHKA 1IQUA 4UQXA 5A6CA 3UMVA 4G23A 4E6HA 4XKBA 4N2SA 4OVVA 1MHQA 4GA2A 5ANLA 3FUJA 3GYZA 4RSYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2W A;  1VDY A;  3D9N A;  3ONL A;  3G2T A;  1H0A A;  1DVP A;  1JPL A;  1SZA A;  3ZYQ A;  1HF8 A;  2DIW A;  3D9K A;  1EDU A;  3ZYM A;  1XGW A;  1UJK A;  1JWG A;  3RRU A;  1HG2 A;  5LP0 A;  4FLB A;  4Q94 A;  3LDZ A;  1ELK A;  2V8S E;  2QY7 A;  3D9I A;  2MOW A;  3ZYL A;  3D9O A;  2KM4 A;  1EYH A;  3D9J A;  1INZ A;  2LO6 A;  2BF0 X;  1LF8 A;  2DCP A;  2L0T B;  4JXT A;  1HG5 A;  5LOZ A;  3CLJ A;  3D9M A;  1X5B A;  1UJJ A;  4HFG A;  1SZ9 A;  3G2S A;  1HX8 A;  4GZC A;  4AVX A;  1HFA A;  4GZD A;  1MHQ A;  3G2U A;  3D9L A;  1JUQ A;  3ZYK A;  1JWF A;  4FU3 A;  5CMY A;  5J08 A;  4Q96 A;  3ONK A;  4NAC A;  1PY1 A;  2L0I A;  3G2V A;  5CMW A;  3D9P A; 
#chains in the Genus database with same CATH topology
 1N9A A;  3U9W A;  1AWC B;  2F8X K;  1KZO A;  2CFZ A;  4AY6 A;  3FTX A;  4AV7 A;  2ETA A;  4CDM A;  3TGO A;  2RD0 A;  3B13 A;  4YDW A;  3CK8 A;  2L0T B;  4DX2 A;  4HRL A;  2ION A;  3HXF A;  4JVS A;  2XRY A;  5KJK A;  3CVL A;  2AXU A;  3SNX A;  3BUA A;  1U3D A;  3MX3 A;  2PQR A;  2IOS A;  3TAX A;  4MRU A;  4ZFH A;  4UWG A;  3FU0 A;  3T8M A;  3HIZ A;  1YA0 A;  2JEK A;  3DRA A;  1RW2 A;  4I6G A;  4E85 A;  3APD A;  3L9T A;  2WXF A;  3ZRH A;  3FP3 A;  3WG7 E;  4PS7 A;  2VJ8 A;  3KD7 A;  4U8H A;  4C0M A;  2DYS E;  3B7B A;  5ENN A;  4UWH A;  2C0M A;  3Q49 B;  1NA3 A;  3DSW A;  4CDN A;  4DX6 D;  1JWG A;  1TYQ G;  4RLY A;  1UG3 A;  3L16 A;  3OXF A;  4EZK A;  3E4B A;  2FO1 E;  4DPR A;  4HFG A;  3CHS A;  4HBD A;  1UOH A;  3C72 A;  4CGV A;  2XEE A;  3L6A A;  3IKO B;  1Y6I A;  2LSU A;  1DCE A;  4G24 A;  3QNK A;  3SHF A;  3FUE A;  4B89 A;  4GYO A;  2J4B A;  3IBE A;  2PNN A;  1MX6 A;  4U96 D;  5LFA A;  2WXN A;  1BI7 B;  4U0S A;  1MQS A;  3FTY A;  1QNF A;  4DUI A;  3D9J A;  2DZN A;  2J09 A;  2LO6 A;  1LF8 A;  5AJD A;  3FY4 A;  1JCQ A;  1SZ9 A;  1HFA A;  3BQO A;  4A1G A;  3QDN A;  1Y8M A;  3LJN A;  3TXM A;  1G3N B;  5B1A E;  4L23 A;  3NBN B;  2I1J A;  3Q78 A;  3T5X A;  1RZ4 A;  4JZY A;  1H6O A;  4UI9 K;  1JWF A;  3UKU G;  3ONK A;  1L5J A;  3DPD A;  2QYJ A;  2OVB A;  5HKP A;  5CBO A;  3ISM C;  4TUU A;  4H7X A;  4I9E A;  3U3W A;  3E30 A;  3FTV A;  3GZ1 A;  3LCA A;  5T8I A;  3JYS A;  4JHR A;  3SZ7 A;  2HYZ A;  5CED B;  3E37 A;  2NYJ A;  5H7P A;  3L22 A;  1QZ2 A;  3FFL A;  5DIZ A;  2X38 A;  3MKQ B;  1HF8 A;  1N4P A;  4J8E A;  4J8Y A;  1OT8 A;  2XZT G;  2IO2 C;  4B93 B;  3B7R L;  5CBN A;  4K5A B;  2LXL A;  3UM3 A;  4RQI A;  1NZN A;  5KJN A;  1FPP A;  2VTB A;  3RAU A;  3PEV B;  3O4Z A;  3TXN A;  1H2T C;  4KT6 B;  1ELK A;  4B8A A;  5T4Y A;  3ABL E;  3D9O A;  4AIF A;  4GA0 A;  4KXK B;  5JHB A;  2VGX B;  5A23 A;  4LRZ A;  2EIK E;  1NL4 A;  4GU5 A;  3NZS A;  4JEH A;  3EU9 A;  1E8X A;  1UN8 A;  2P9L G;  3LVR E;  3FH8 A;  3FUD A;  3ULY A;  4I43 A;  4A3T A;  3GZS A;  2EIL E;  3EHQ A;  3QAQ A;  4BTA A;  2V8S E;  1KT0 A;  2ZGG A;  4O1O A;  4U07 A;  3O48 A;  2J9Q A;  4APO A;  4DLQ A;  3SBS A;  3FHE A;  3Q7A A;  3D9L A;  4ILI A;  3SBT B;  2VSX E;  5EIB E;  4H7Y A;  4EPZ A;  5HQ8 A;  5ENT D;  3JQ0 A;  5FJY A;  3KEA A;  4DI4 A;  3FWV A;  1KZP A;  2J08 A;  3AS4 A;  1H2U A;  4OYS A;  1OWM A;  4ANW A;  1N94 A;  5A7D B;  4GZD A;  4EBA A;  3B95 A;  2VGE A;  2B0O E;  2V0P A;  3PNT B;  4O60 A;  2VQ2 A;  4GCN A;  5BNW A;  4V3I A;  3HVE B;  5B1B E;  4GZ3 A;  2X6H A;  3LS8 A;  4U0U A;  3PZD A;  3UT4 A;  1E8Y A;  3JUI A;  3MKR A;  4UI9 J;  1H2V C;  3P2B A;  4YDY A;  4URK A;  3QWP A;  1TJF A;  3CVU A;  4HOU A;  4BX9 A;  4FLH A;  2ETC A;  2QFC A;  2WXK A;  4IN3 B;  2XS1 A;  2VSY A;  1E90 A;  4GTV A;  5FQ8 A;  3UPV A;  1IHB A;  3ESK A;  1O1R A;  1MZC A;  2IY0 C;  4WNE A;  3ULQ A;  4BET A;  3D3M A;  2R05 A;  1O1T A;  4GA1 A;  4A55 A;  2WQ7 A;  2HM8 A;  3EDT B;  5JJT A;  5KWD A;  4LNU D;  2DVW A;  1N11 A;  1IXV A;  4BEP A;  4Y6W A;  5JMN D;  3U66 A;  4HB5 A;  2IOL A;  3CKC A;  1AP7 A;  3R7R A;  3V30 A;  1OCC E;  2PZI A;  2XRZ A;  1W3B A;  3I4R B;  3WXX A;  4HXI A;  3SFY A;  2MYO A;  4F3V A;  1A5E A;  3D9K A;  4ABN A;  3PE3 A;  2L6J A;  3URZ A;  3CVW A;  3RK6 A;  4FHK A;  2ZXW E;  3UMV A;  3PZ3 A;  4DX7 D;  3UKR G;  5EKQ D;  4HLE A;  4TV3 A;  3ZYM A;  4J0U A;  3TWW A;  2RG8 A;  2R03 A;  4G11 A;  2IF4 A;  5T3R A;  3FTU A;  1D8E A;  4ZHB A;  5FZQ A;  2L0I A;  3ML9 A;  4CT0 A;  2H6I A;  4XIF A;  5BXU A;  5ENO D;  3CHQ A;  4B0Z A;  1GW6 A;  1YYH A;  4KYO B;  1Z3Y A;  3MCX A;  4UWK A;  2UY1 B;  3C3O A;  1QBQ A;  3BG1 B;  3OAW A;  1ELR A;  3QB2 A;  4KZC A;  5IY5 E;  3VLE A;  3DBS A;  4QQI A;  3G2W A;  4F1S A;  3FUH A;  1LD8 A;  1IYG A;  2XZD G;  1S0P A;  4Q94 A;  2OV8 A;  1OY3 D;  5ARG A;  3IHV A;  4XI0 A;  4HNA D;  1HXI A;  3ASO E;  2YNQ A;  4EEC A;  1JUQ A;  3ZNG A;  5EDS A;  2VGY A;  4K0R A;  3QOU A;  4GAA A;  1BI8 B;  2P9U G;  3CHR A;  4RVB A;  5FIO A;  4EZJ A;  5ENQ D;  5EX0 A;  2ZGD A;  5G2N A;  3CVV A;  5G05 J;  3TJP A;  2HR2 A;  1DNP A;  2OOE A;  3AS8 A;  3L17 A;  4HRM B;  4L2L A;  1V55 E;  4YVO A;  3W9G A;  4GTP A;  2EIN E;  3E34 A;  3RSE G;  4WWN A;  5HI7 A;  2H6H A;  2E2E A;  3FUF A;  4ANX A;  2QY7 A;  4CCA A;  2P58 C;  3NAW A;  3TWQ A;  3DWL G;  2AJA A;  4WND A;  3UXG A;  4HOQ A;  3ZXP A;  4TXQ A;  4YND A;  3E33 A;  4I1O B;  5AAO A;  2CG2 A;  3PVL A;  1E7V A;  5ENR D;  2FI7 A;  3ASH A;  3TWR A;  2FUL A;  2BUG A;  5LCW C;  3PNL B;  4NIK A;  1H19 A;  1Z5S C;  4DRX E;  3DEP A;  2QYU A;  4XE0 A;  2V5Q C;  1BLX B;  4RG6 A;  2CFU A;  5ANR A;  4WUY A;  3NQP A;  3ENE A;  3U4T A;  4FAD A;  5BXO A;  4DI3 A;  3MV2 B;  4DJA A;  3ZN3 A;  4J8D A;  3CR3 A;  4U63 A;  2A4Z A;  4JD2 G;  5G04 C;  4OAU C;  3PZ2 A;  3RRM B;  3PZ1 A;  2QC9 A;  4IUL A;  1UJK A;  1O5M A;  2C2L A;  3ABM E;  1E7U A;  5EID A;  4HRN A;  4U8Y D;  3RRN B;  2HO1 A;  4U0Z A;  2R17 C;  2WXP A;  4TXP A;  5CHE E;  4BER A;  2HE0 A;  5FZS A;  2EIJ E;  3T5V A;  1H6K A;  4MLP A;  2GRR B;  3DXM G;  4BTB A;  2MRI A;  3HXB A;  2WXL A;  2CHW A;  2CHX A;  3ZYL A;  1U2V G;  2KM4 A;  2YHE A;  2XQ0 A;  4UWF A;  4G2V A;  2PQN A;  3C3Q A;  1HZ4 A;  2X6K A;  2IFU A;  3HHM A;  4B94 A;  4GZC A;  5D2M C;  3AG4 E;  3MGB A;  1YCS B;  5KNG A;  1D8D A;  2GRP B;  1U3C A;  3Q5M A;  3CHO A;  2EQX A;  4KVO A;  4XEI G;  1UN9 A;  4TUM A;  3NZU A;  2R02 A;  2L9B A;  3CVQ A;  4JHJ A;  3PRZ A;  4BSZ B;  4Y6C A;  3KAE A;  4GYY A;  2RFM A;  1ZB1 A;  2VYI A;  1K3Z D;  1SA4 A;  2WPV A;  3NOG D;  2AW6 A;  2IQC A;  1HO8 A;  3DEO A;  3S2A A;  3AAA C;  2XPY A;  3T8K A;  1FVH A;  1S64 A;  3SY2 A;  3G2V A;  5HRY A;  1H0A A;  4I2W A;  3UTM A;  4WWO A;  3TG5 A;  4ATG A;  5D0O D;  1B89 A;  1UJJ A;  3DSU A;  4L7T A;  3ZYK A;  4EQF A;  3FUK A;  1IHG A;  1VDY A;  4TRQ A;  3G2T A;  4JHK A;  5JJ7 A;  3MV3 B;  3R9A B;  3U64 A;  4XX5 A;  3GW4 A;  2WXH A;  3RO2 A;  2DZO A;  3TG4 A;  4MKT A;  1E96 B;  1OXJ A;  3MKQ A;  3QK0 A;  3CLJ A;  4D10 C;  4UQZ A;  2B6C A;  3UT7 A;  2WXJ A;  3RO3 A;  3OXL A;  5LCW J;  4JEU A;  2J8S D;  3ZFW A;  2H6G A;  3IXE A;  1UW4 B;  2JLB A;  3DSS A;  3RIB A;  3PRE A;  4A63 B;  1HH8 A;  2DBA A;  5LOZ A;  2LUH A;  2IJG X;  3NB2 A;  2A5E A;  4AXH A;  1NI1 A;  2XHE A;  5M72 A;  3EUV A;  2DWZ A;  2VGX A;  3LY9 A;  3J5Q B;  3TL5 A;  2J07 A;  3IHY A;  2FEZ A;  2GRN B;  2X6F A;  3S7B A;  4CRW A;  2KZT B;  4JPS A;  3PDN A;  3Q79 A;  4CEM A;  4F6R D;  4BT9 A;  3SQV A;  2V5F A;  3GZ2 A;  4OVU A;  5CER B;  5ENS D;  4G8L A;  1IQU A;  4GPM A;  4E6H A;  4N2S A;  3FUJ A;  4EHM A;  2X6J A;  4O6F A;  1N4R A;  3AU4 A;  4HOS A;  3LDZ A;  4GPK A;  1DC2 A;  3EHR A;  1ZU2 A;  3Q4A B;  3BU8 A;  3LXU X;  4G25 A;  5AQ7 A;  3K9I A;  1OWP A;  2WXR A;  3HVE A;  4B8C B;  2GW1 A;  3W9F A;  1FT2 A;  3DST A;  1TNU A;  5CEA A;  2BED A;  4GYW A;  2LSV A;  1FVF A;  2OND A;  2J4D A;  3EIJ A;  3FTS A;  3Q73 A;  2KBX A;  3T9K A;  2Y0B G;  3ZKJ A;  4ANU A;  3ZHE B;  4EBA G;  1OCR E;  3HXE A;  4DLO A;  4AEZ C;  5EYL A;  2OEW A;  3I5P A;  1EDU A;  1LD7 A;  4MS6 A;  2WXI A;  4O1P A;  5D66 A;  4YVQ C;  4LUN U;  1N0R A;  1NFI E;  2WQ6 A;  4ATZ D;  3ZXS A;  3QJZ A;  4NAC A;  3IV0 A;  1FT1 A;  1WY6 A;  3FDH A;  4TXR A;  2WB2 A;  3Q9N C;  2DYR E;  2L6B A;  4GMJ A;  2XCC A;  4JA9 A;  4N2Q A;  3I3N A;  1PAQ A;  2RKK A;  1X81 A;  2P9I G;  1DCQ A;  3OXG A;  5B3S E;  4ANV A;  5JHA A;  3Q15 A;  3LY8 A;  3TWT A;  1PY1 A;  4KBQ A;  3B7T A;  1FCH A;  3CVN A;  4GZ6 A;  5AEN A;  3L54 A;  3FU3 A;  3UI2 A;  3UT8 A;  4YDE A;  3S7F A;  1OWL A;  5BW8 C;  3VLD A;  4FU3 A;  1JCR A;  4I6E A;  3VLF A;  4JW1 A;  4BX8 A;  2WXG A;  2I2O A;  4AY5 A;  2BTD A;  4PUC A;  1S63 A;  4NRH B;  3G2S A;  2UY1 A;  2KXP C;  5EX3 A;  5J08 A;  4G1T A;  3LKU A;  3FU5 A;  2V4H C;  1KLX A;  5AQA A;  4DX1 A;  1WG0 A;  1SZA A;  4C48 B;  4N3B A;  1E8Z A;  4XI9 A;  3TWU A;  1EYH A;  3FTW A;  3RJV A;  5ARF A;  3R9M A;  2Y4T A;  3RU0 A;  4F7A A;  2WM9 A;  2AXZ A;  3PUJ A;  4JC8 A;  4UWL A;  3SI5 A;  4J7W A;  1EF1 C;  1K1A A;  1HS6 A;  3ZUV B;  4G26 A;  1QYM A;  5CCL A;  1HG2 A;  4W9R A;  5AYW D;  3FTZ A;  2R5S A;  3FEX A;  1N54 A;  1IQR A;  2CHZ A;  4ACK A;  4N5C A;  4J6I A;  2BF0 X;  4FP7 A;  2AVP A;  3TWS A;  3NF1 A;  1N4Q A;  3CK7 A;  3CQC B;  2XPZ A;  2NSZ A;  5BUZ A;  4LNB A;  2XS8 A;  3LEW A;  3FUN A;  3MA5 A;  2BKG A;  1NA0 A;  1TEZ A;  3AS5 A;  3CK9 A;  3JQ1 A;  3QKY A;  2VSO E;  4WNF A;  1E8W A;  3CVP A;  2VSN A;  2WXO A;  1A17 A;  3UIP C;  2XGM A;  1JPL A;  3ZYQ A;  3E32 A;  2E0I A;  4FLB A;  3Q9U C;  3F6Q A;  2KCL A;  5AJL A;  4JXT A;  4NUR A;  3SF4 A;  1XNF A;  3EHN A;  3Q75 A;  2FBN A;  3SFX A;  4QFV A;  4L2Y A;  3D9N A;  3JXI A;  1MX4 A;  1OCO E;  2P2C P;  3Q47 B;  2WMO A;  5HS0 A;  4ILG A;  4YDO A;  3DXK G;  4FHJ A;  3G2U A;  5KBA A;  3CQG B;  2GRO B;  4PS8 A;  4RG9 A;  4LCT A;  2GRM A;  4GTQ A;  4J8F A;  4L1B A;  4GCO A;  1ZBP A;  1OWN A;  4C9B B;  3EIQ C;  1OUV A;  5G55 A;  3TWV A;  4ILH B;  4M3O A;  4JB8 P;  4AM9 A;  1N95 A;  4Q96 A;  4K03 A;  3AU5 A;  3PS6 A;  1WAO 1;  3UM2 A;  3UIN C;  1P5Q A;  5AN8 A;  2WMN A;  3LPZ A;  4K5B A;  3KEZ A;  1LTX A;  2V4L A;  3MYV A;  4GB9 A;  4LNG A;  2GGF A;  4BY6 A;  2XPI A;  1N52 A;  2R59 A;  4X8Q A;  4AP2 A;  4U8V D;  3D9H A;  3MZL B;  3SO8 A;  3N71 A;  2I9C A;  4HQD A;  3VTX A;  2P9P G;  4P29 A;  5BT1 A;  2ILR A;  3UM1 A;  4HOR A;  4KMO A;  2KC7 A;  4LEU A;  5BV1 A;  1TN7 A;  2FO7 A;  1HU3 A;  3CIA A;  2YIN A;  3ONL A;  3ZGQ A;  1BD8 A;  5KCM A;  2KCV A;  4I6J A;  1TJC A;  3UUX A;  1SW6 A;  3ESL A;  3JUE A;  4IRU A;  3APF A;  1SA5 A;  5ITZ F;  4N39 A;  3V2O A;  2A5U A;  1MJ0 A;  4AVX A;  1O1S A;  3FUM A;  3S7J A;  3HG0 D;  1K8K G;  2PM7 A;  3NOC D;  4GTO A;  3APC A;  3DSV A;  3KS2 A;  3ZPJ A;  4KVM A;  1EPU A;  4AJW A;  3FEY A;  4F53 A;  4WWP A;  3ASN E;  4LSZ E;  1TR4 A;  3ABK E;  4OVV A;  4UI9 C;  4XZ4 A;  4HLL A;  3SGH A;  4GZ5 A;  3L13 A;  3CVY A;  5BPP A;  4BT8 A;  3B7S A;  2YHC A;  2WVI A;  1TN8 A;  4CDR A;  1HE8 A;  5FT9 A;  5C1D A;  3B7U X;  3FH5 A;  1BU9 A;  5JA4 D;  4DK5 A;  3CKB A;  3DPY A;  4G8K A;  3LY7 A;  5CCM A;  3L82 A;  4I17 A;  3ML8 A;  4HI9 A;  2Y4U A;  2WQH A;  2GRQ B;  2NC9 A;  2XEV A;  4WAF A;  3HXD A;  4MBG A;  2KAT A;  1H6P A;  2R2L A;  3ASD A;  2PL2 A;  2H6F A;  5FZR A;  3I4G A;  2GRL A;  1JCS A;  5EN5 D;  4FJZ A;  2PM6 A;  4XKC A;  3OTN A;  5FQ4 A;  2KZT A;  2F8Y A;  4GTM A;  4JL0 A;  3AJI A;  3ASG A;  3V2X A;  2LAH A;  5G04 J;  4U95 D;  2OVF A;  4FC8 A;  1TNY A;  2XCB A;  4U04 A;  4BSX A;  2WXM A;  4U7E B;  5CMW A;  1TNZ A;  1SVX A;  3JCK C;  4FA6 A;  3ZIM A;  1NP7 A;  3ZU7 B;  3X2Q E;  4C0E A;  2MHK A;  4BES A;  2VTB B;  3CVX A;  1YMP A;  1X5B A;  4I2Z A;  1HX8 A;  3PUK A;  3Q7F A;  1TNB A;  3QAR A;  5JJ6 A;  4LG6 A;  1OCZ E;  3EHM A;  4N5Q A;  1WDY A;  3SFZ A;  4F1P A;  4M7C A;  5LP0 A;  4GTR A;  1MYO A;  1V54 E;  2IU1 A;  4GTT A;  3PH0 C;  3HYM B;  5E75 A;  2IEJ A;  5EIL A;  4A1S A;  2XGS A;  4ME2 A;  4EZL A;  2F37 A;  3P1U A;  3ZHE A;  2LXM A;  1D9S A;  3QWV A;  5C2Y A;  4LER A;  1QQE A;  2JAB A;  3UX4 A;  3QWW A;  5FTP A;  2C0L A;  4IYP A;  4K5C A;  1TNO A;  3FUI A;  3FH7 A;  5AQB A;  5AAR A;  3MEK A;  4Q69 A;  3ZVV A;  5G05 C;  3D9P A;  2I6H A;  1KPS B;  3CHM A;  3CHP A;  2LNI A;  2NXP A;  1SQM A;  5FQ6 A;  3ULE G;  3MJW A;  3IEG A;  2MOW A;  2XEH A;  3UIO C;  4Z68 A;  3ZEF A;  3DSX A;  4GMR A;  5ENP D;  5CRU A;  3ZW3 A;  1Z3X A;  5CEC B;  2CG3 A;  4FJY A;  5D0Q D;  4CYM D;  3S7D A;  1N4S A;  2ETB A;  3CGH A;  2DCP A;  5FWQ A;  5LX8 A;  4A3V A;  2ZU6 B;  2XGO A;  3LYA A;  4HS2 A;  5FIN A;  5KJM A;  4HOT A;  3SD5 A;  4I1M A;  3V31 A;  4DX5 D;  4J8S A;  3AG1 E;  5FQ7 A;  2KCK A;  4WNG A;  3C3R A;  4CT4 A;  1S70 B;  1IKN D;  5KJL A;  3EJN A;  5AIJ A;  1Q2Z A;  2IO3 C;  5EYP F;  2M63 A;  2X3M A;  4APF A;  3CEQ A;  3V79 K;  3KSQ A;  1XGW A;  1ELW A;  3FUL A;  1N0Q A;  3D9I A;  3UQ3 A;  2X6I A;  1INZ A;  2AXV A;  1HG5 A;  3PEU B;  4BWR A;  2AWI A;  2WXQ A;  2QZA A;  2UWJ G;  3AG2 E;  4ACL A;  4PDX A;  1OWO A;  2EIM E;  2XEN A;  3QC1 A;  4I9C A;  2J49 A;  3C5R A;  3AG3 E;  4KZ0 A;  5DBK A;  2RFA A;  2YQ8 A;  4AOF A;  1KT1 A;  2Y69 E;  4FUL A;  2OEV A;  4HI8 A;  5BV0 A;  4BFR A;  2DIW A;  2P9S G;  3UM0 A;  4HVB A;  3RRU A;  4UUC A;  1K1B A;  3ASF A;  2ZIR A;  4UQY A;  3CV0 A;  3CSF A;  3D9M A;  4N3A A;  4I1A A;  3HDX A;  5CMY A;  3L08 A;  3BEE A;  5CRV A;  3PZ4 A;  1DVP A;  1BPO A;  3EU5 A;  1Z6T A;  2Y3A A;  3PE4 A;  3R7Q A;  4NQ0 A;  3J5P A;  3BG0 B;  3JXJ A;  3CST A;  3HRA A;  3TWX A;  3VTY A;  5KNH D;  2P9N G;  3LJ3 A;  4N3C A;  5AQ9 A;  4JA7 A;  4OAV B;  2P9K G;  2Y1L E;  5E76 A;  4CGW A;  2FF4 A;  4PH4 B;  2F0Y A;  3FU6 A;  2I1K A;  2BKK B;  2Q7F A;  3KSL A;  4R7L A;  4L9P A;  4PS3 A;  1PC2 A;  5J90 A;  1MX2 A;  1WM5 A;  3RKV A;  3C98 A;  3LVQ E;  2LAI A;  2OCC E;  4CZ2 D;  3HXC A;  4GML A;  4UQX A;  5A6C A;  1TN6 A;  4GTS A;  4G23 A;  4XKB A;  1MHQ A;  4GA2 A;  5ANL A;  3GYZ A;  2ZIS A;  4RSY A; 
#chains in the Genus database with same CATH homology
 5EKQ D;  4XZ4 A;  4HLE A;  3U9W A;  4TV3 A;  2X6J A;  4O6F A;  3SGH A;  4GZ5 A;  3ZYM A;  4J0U A;  3L13 A;  3AU4 A;  2CFZ A;  4AY6 A;  3CVY A;  4HOS A;  5BPP A;  2RG8 A;  4BT8 A;  3FTX A;  3LDZ A;  3B7S A;  4G11 A;  4AV7 A;  4GPK A;  4CDM A;  1ZU2 A;  3Q4A B;  3TGO A;  2YHC A;  3LXU X;  4G25 A;  2RD0 A;  3B13 A;  2IF4 A;  3CK8 A;  2L0T B;  3K9I A;  2WVI A;  1OWP A;  4CDR A;  2ION A;  5T3R A;  1HE8 A;  2WXR A;  3HVE A;  5FT9 A;  3FTU A;  4B8C B;  2GW1 A;  5C1D A;  3B7U X;  4JVS A;  5FZQ A;  2L0I A;  2XRY A;  3ML9 A;  4CT0 A;  3FH5 A;  4XIF A;  5KJK A;  3CHQ A;  4GYW A;  3CVL A;  2LSV A;  1GW6 A;  2AXU A;  4B0Z A;  1FVF A;  3SNX A;  4KYO B;  2OND A;  4DK5 A;  1U3D A;  3CKB A;  3MX3 A;  1Z3Y A;  2J4D A;  3EIJ A;  3FTS A;  3MCX A;  2PQR A;  4UWK A;  3LY7 A;  2UY1 B;  2IOS A;  5CCM A;  3TAX A;  4I17 A;  3ML8 A;  4ANU A;  3ZHE B;  3BG1 B;  4MRU A;  3OAW A;  4EBA G;  1ELR A;  2Y4U A;  3QB2 A;  4KZC A;  4DLO A;  4UWG A;  3FU0 A;  3T8M A;  4AEZ C;  3HIZ A;  3DBS A;  3VLE A;  1YA0 A;  2WQH A;  3G2W A;  4F1S A;  3I5P A;  2JEK A;  2NC9 A;  2XEV A;  3FUH A;  4WAF A;  4I6G A;  1EDU A;  4E85 A;  2KAT A;  1IYG A;  3ASD A;  3APD A;  1S0P A;  4MS6 A;  4Q94 A;  2WXF A;  2OV8 A;  2WXI A;  3ZRH A;  2PL2 A;  5FZR A;  5ARG A;  3FP3 A;  4PS7 A;  3I4G A;  2GRL A;  3IHV A;  4XI0 A;  1HXI A;  4FJZ A;  2VJ8 A;  4YVQ C;  3KD7 A;  2PM6 A;  4U8H A;  4LUN U;  4C0M A;  2YNQ A;  2WQ6 A;  5ENN A;  4UWH A;  4EEC A;  1JUQ A;  3ZXS A;  5EDS A;  2VGY A;  2C0M A;  3QJZ A;  4K0R A;  3OTN A;  3QOU A;  4NAC A;  4XKC A;  3IV0 A;  5FQ4 A;  1WY6 A;  2WB2 A;  3FDH A;  2KZT A;  3Q49 B;  4GAA A;  3CHR A;  4RVB A;  1NA3 A;  4GMJ A;  2XCC A;  4EZJ A;  4CDN A;  1JWG A;  5EX0 A;  4JA9 A;  4N2Q A;  5G2N A;  4JL0 A;  3I3N A;  1PAQ A;  3ASG A;  1UG3 A;  2LAH A;  4UI9 C;  5G04 J;  3CVV A;  3L16 A;  2OVF A;  3OXF A;  4EZK A;  5G05 J;  3E4B A;  4FC8 A;  3TJP A;  2HR2 A;  1DNP A;  2OOE A;  4HFG A;  4DPR A;  3AS8 A;  3OXG A;  3L17 A;  4ANV A;  3CHS A;  2XCB A;  3Q15 A;  4L2L A;  4U04 A;  4BSX A;  3LY8 A;  5JHA A;  1PY1 A;  2WXM A;  4YVO A;  5CMW A;  4CGV A;  4KBQ A;  3B7T A;  1FCH A;  3CVN A;  4GZ6 A;  4WWN A;  3JCK C;  4FA6 A;  5AEN A;  3L54 A;  3ZIM A;  3L6A A;  3IKO B;  5HI7 A;  1Y6I A;  2LSU A;  1NP7 A;  2E2E A;  3FU3 A;  4C0E A;  3FUF A;  4G24 A;  3UT8 A;  2QY7 A;  4ANX A;  3QNK A;  4CCA A;  2P58 C;  2MHK A;  3SHF A;  3S7F A;  3FUE A;  2VTB B;  3CVX A;  1OWL A;  1X5B A;  4I2Z A;  4WND A;  4HOQ A;  1HX8 A;  4YND A;  3PUK A;  4I1O B;  5BW8 C;  3VLD A;  4FU3 A;  3QAR A;  4B89 A;  4I6E A;  5JJ6 A;  3VLF A;  2CG2 A;  4GYO A;  2J4B A;  3IBE A;  3PVL A;  4JW1 A;  4BX8 A;  2WXG A;  3EHM A;  2I2O A;  1E7V A;  4AY5 A;  5LFA A;  2FI7 A;  2WXN A;  3SFZ A;  5LP0 A;  4U0S A;  1MQS A;  3ASH A;  3FTY A;  1QNF A;  2BTD A;  2IU1 A;  2FUL A;  3D9J A;  4PUC A;  2J09 A;  2LO6 A;  2BUG A;  4NRH B;  1LF8 A;  5LCW C;  5AJD A;  3PNL B;  3PH0 C;  3HYM B;  5E75 A;  3FY4 A;  1H19 A;  1SZ9 A;  3G2S A;  4A1S A;  1HFA A;  4A1G A;  4XE0 A;  2UY1 A;  5EX3 A;  2XGS A;  5J08 A;  4G1T A;  4ME2 A;  3QDN A;  3P1U A;  4EZL A;  3LKU A;  3FU5 A;  4RG6 A;  1Y8M A;  1KLX A;  2CFU A;  5ANR A;  3ZHE A;  1SZA A;  4WUY A;  3TXM A;  4N3B A;  1E8Z A;  4XI9 A;  3QWV A;  3NQP A;  3ENE A;  3U4T A;  4L23 A;  2I1J A;  5C2Y A;  4FAD A;  4LER A;  1QQE A;  1EYH A;  3T5X A;  3UX4 A;  3FTW A;  3QWW A;  3MV2 B;  5FTP A;  3RJV A;  4JZY A;  4DI3 A;  4DJA A;  2C0L A;  4IYP A;  5ARF A;  3FUI A;  3ZN3 A;  2Y4T A;  3FH7 A;  3RU0 A;  4J8D A;  4F7A A;  2WM9 A;  2AXZ A;  3CR3 A;  4U63 A;  3PUJ A;  2A4Z A;  4JC8 A;  4UI9 K;  1JWF A;  5G04 C;  4UWL A;  3MEK A;  4Q69 A;  3ZVV A;  3ONK A;  5G05 C;  3D9P A;  1L5J A;  2I6H A;  3SI5 A;  3DPD A;  3CHM A;  3RRM B;  2OVB A;  3CHP A;  1EF1 C;  2LNI A;  2NXP A;  1HS6 A;  1SQM A;  4G26 A;  4TUU A;  5CCL A;  4IUL A;  1UJK A;  4H7X A;  1HG2 A;  4I9E A;  5FQ6 A;  4W9R A;  3U3W A;  5AYW D;  2C2L A;  3MJW A;  3FTV A;  3FTZ A;  1E7U A;  3GZ1 A;  2R5S A;  3FEX A;  3IEG A;  1N54 A;  1IQR A;  2MOW A;  3LCA A;  5T8I A;  2CHZ A;  4ACK A;  4N5C A;  3JYS A;  4JHR A;  4J6I A;  2BF0 X;  3RRN B;  2HO1 A;  3SZ7 A;  3ZEF A;  4FP7 A;  4U0Z A;  2HYZ A;  2AVP A;  2R17 C;  2WXP A;  3NF1 A;  5CHE E;  3CK7 A;  5FZS A;  3CQC B;  3T5V A;  2XPZ A;  1H6K A;  3L22 A;  2NSZ A;  4MLP A;  5BUZ A;  3ZW3 A;  1QZ2 A;  1Z3X A;  3FFL A;  5DIZ A;  2X38 A;  3LEW A;  3MKQ B;  1HF8 A;  3FUN A;  3MA5 A;  1NA0 A;  2CG3 A;  4FJY A;  2MRI A;  4J8E A;  2WXL A;  5D0Q D;  4BTB A;  3S7D A;  1TEZ A;  3AS5 A;  2CHW A;  2CHX A;  3ZYL A;  3B7R L;  2KM4 A;  2YHE A;  2XQ0 A;  4UWF A;  4G2V A;  3CGH A;  3CK9 A;  2PQN A;  3JQ1 A;  2DCP A;  5FWQ A;  3QKY A;  2VSO E;  5LX8 A;  4A3V A;  1HZ4 A;  4WNF A;  2X6K A;  2IFU A;  3HHM A;  4B94 A;  2ZU6 B;  4GZC A;  1E8W A;  3CVP A;  2XGO A;  3LYA A;  4HS2 A;  2VSN A;  5KJM A;  4HOT A;  2WXO A;  3MGB A;  1NZN A;  4I1M A;  3SD5 A;  5KJN A;  1A17 A;  2VTB A;  2XGM A;  4J8S A;  5FQ7 A;  3PEV B;  1JPL A;  3ZYQ A;  3O4Z A;  3TXN A;  1H2T C;  4KT6 B;  2E0I A;  4FLB A;  1ELK A;  2KCK A;  4WNG A;  4B8A A;  1U3C A;  3Q5M A;  3CHO A;  5T4Y A;  3D9O A;  2EQX A;  4CT4 A;  4KVO A;  4AIF A;  2KCL A;  4GA0 A;  1UN9 A;  4KXK B;  5AJL A;  3NZU A;  4JXT A;  4NUR A;  5JHB A;  5KJL A;  3EJN A;  2VGX B;  5AIJ A;  3SF4 A;  5A23 A;  4LRZ A;  1XNF A;  3EHN A;  2L9B A;  2M63 A;  3CVQ A;  4GU5 A;  3PRZ A;  4JHJ A;  3NZS A;  2FBN A;  4Y6C A;  4JEH A;  3KAE A;  4GYY A;  1E8X A;  1UN8 A;  2X3M A;  3D9N A;  4L2Y A;  4QFV A;  3CEQ A;  3LVR E;  4APF A;  3FH8 A;  3FUD A;  4A3T A;  4I43 A;  3GZS A;  1XGW A;  1ELW A;  3FUL A;  3QAQ A;  2VYI A;  4BTA A;  2V8S E;  3D9I A;  3UQ3 A;  2X6I A;  1KT0 A;  4U07 A;  1INZ A;  2WPV A;  2AW6 A;  3Q47 B;  2AXV A;  2IQC A;  2WMO A;  3O48 A;  2J9Q A;  1HO8 A;  1HG5 A;  4APO A;  4ILG A;  3PEU B;  4DLQ A;  3S2A A;  3SBS A;  2XPY A;  4FHJ A;  3FHE A;  1FVH A;  3D9L A;  3G2U A;  3CQG B;  4ILI A;  4BWR A;  2AWI A;  3SBT B;  2WXQ A;  3G2V A;  4PS8 A;  4RG9 A;  2UWJ G;  4LCT A;  2GRM A;  2VSX E;  4H7Y A;  4EPZ A;  5HQ8 A;  1H0A A;  4ACL A;  4J8F A;  4I2W A;  4PDX A;  4L1B A;  1OWO A;  3JQ0 A;  5FJY A;  3QC1 A;  4DI4 A;  4I9C A;  2J49 A;  4GCO A;  4WWO A;  4KZ0 A;  3FWV A;  3TG5 A;  1ZBP A;  5DBK A;  2J08 A;  3AS4 A;  1H2U A;  4OYS A;  1OWN A;  2YQ8 A;  1OWM A;  4AOF A;  4ANW A;  4ATG A;  4C9B B;  3EIQ C;  1B89 A;  1OUV A;  1UJJ A;  5D0O D;  4ILH B;  1KT1 A;  4M3O A;  5G55 A;  5A7D B;  4AM9 A;  4GZD A;  4L7T A;  3ZYK A;  4EQF A;  4FUL A;  4EBA A;  3FUK A;  4Q96 A;  1IHG A;  5BV0 A;  1VDY A;  4TRQ A;  2V0P A;  4K03 A;  4BFR A;  3G2T A;  4JHK A;  3PNT B;  5JJ7 A;  3AU5 A;  3MV3 B;  3R9A B;  2DIW A;  3PS6 A;  3U64 A;  2VQ2 A;  3RRU A;  4HVB A;  4GCN A;  5BNW A;  1WAO 1;  4V3I A;  3HVE B;  4XX5 A;  4GZ3 A;  2X6H A;  1P5Q A;  3ASF A;  2WXH A;  3GW4 A;  3LS8 A;  4U0U A;  3RO2 A;  3TG4 A;  2WMN A;  3PZD A;  3UT4 A;  4MKT A;  1E96 B;  1E8Y A;  3JUI A;  3LPZ A;  3MKR A;  3KEZ A;  3MKQ A;  3QK0 A;  1H2V C;  3P2B A;  4UQY A;  4UI9 J;  3CV0 A;  3CSF A;  3CLJ A;  3D9M A;  2V4L A;  4D10 C;  3MYV A;  4N3A A;  4UQZ A;  4URK A;  4GB9 A;  3QWP A;  2GGF A;  4BY6 A;  1TJF A;  2XPI A;  4I1A A;  3HDX A;  5CMY A;  1N52 A;  2R59 A;  3L08 A;  3CVU A;  4HOU A;  4BX9 A;  3BEE A;  3UT7 A;  2WXJ A;  4FLH A;  4AP2 A;  2QFC A;  3RO3 A;  2WXK A;  3OXL A;  5LCW J;  1DVP A;  3MZL B;  4IN3 B;  4JEU A;  3N71 A;  3ZFW A;  1UW4 B;  1BPO A;  2I9C A;  2JLB A;  2VSY A;  3VTX A;  1Z6T A;  3RIB A;  4P29 A;  3PRE A;  2Y3A A;  3PE4 A;  1E90 A;  3R7Q A;  5BT1 A;  2ILR A;  5FQ8 A;  3UPV A;  1HH8 A;  3ESK A;  2DBA A;  4NQ0 A;  4HOR A;  4KMO A;  5LOZ A;  2IJG X;  2KC7 A;  4LEU A;  3BG0 B;  5BV1 A;  3CST A;  4WNE A;  3ULQ A;  4AXH A;  3VTY A;  2XHE A;  3D3M A;  5M72 A;  2FO7 A;  1HU3 A;  3CIA A;  2YIN A;  3LJ3 A;  4GA1 A;  4N3C A;  2HM8 A;  2VGX A;  3ONL A;  4A55 A;  3ZGQ A;  2WQ7 A;  4JA7 A;  3EDT B;  5JJT A;  5KCM A;  2KCV A;  3LY9 A;  4I6J A;  1TJC A;  3UUX A;  3ESL A;  4Y6W A;  2J07 A;  4IRU A;  3TL5 A;  3APF A;  3IHY A;  5E76 A;  2FEZ A;  2X6F A;  4CGW A;  3S7B A;  3U66 A;  2FF4 A;  4N39 A;  4PH4 B;  4CRW A;  2IOL A;  2KZT B;  4JPS A;  3CKC A;  3FU6 A;  2I1K A;  2A5U A;  3PDN A;  4AVX A;  3R7R A;  3FUM A;  4CEM A;  3S7J A;  2Q7F A;  4R7L A;  2PZI A;  4PS3 A;  2XRZ A;  1W3B A;  1PC2 A;  2PM7 A;  3I4R B;  3WXX A;  1WM5 A;  4BT9 A;  5J90 A;  4HXI A;  4F3V A;  3APC A;  3RKV A;  3KS2 A;  3C98 A;  3ZPJ A;  3LVQ E;  3D9K A;  4KVM A;  2V5F A;  3GZ2 A;  1EPU A;  2LAI A;  4OVU A;  4ABN A;  3PE3 A;  4AJW A;  2L6J A;  3URZ A;  3FEY A;  4GML A;  4F53 A;  3RK6 A;  3CVW A;  4WWP A;  4FHK A;  1IQU A;  4UQX A;  5A6C A;  3UMV A;  4G23 A;  4E6H A;  4XKB A;  4N2S A;  4OVV A;  1MHQ A;  4GA2 A;  5ANL A;  3FUJ A;  3GYZ A;  4RSY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...