1SZAA

The rna polymerase ii ctd in mrna processing: beta-turn recognition and beta-spiral model
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
144
structure length
144
Chain Sequence
MDHDTEVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQKLYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGLPLFEGSALEKIEQFLIKASAAALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PCF11 protein
publication title Recognition of RNA polymerase II carboxy-terminal domain by 3'-RNA-processing factors.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 144
sequence length 144
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2004-04-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.90 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 1szaA00
3G2VA 1UJJA 4FU3A 4Q96A 3ZYKA 1ELKA 1H0AA 1MHQA 1JUQA 3ONLA 1SZ9A 3LDZA 4FLBA 3D9MA 2KM4A 1EDUA 1SZAA 4HFGA 2L0TB 3CLJA 1JPLA 5LP0A 1VDYA 1UJKA 1DVPA 2DIWA 3D9NA 1PY1A 3ONKA 3RRUA 5J08A 3G2TA 3D9IA 4GZDA 2V8SE 4JXTA 2L0IA 2BF0X 1HG5A 2MOWA 3G2UA 3G2WA 1HF8A 4NACA 5CMYA 1HFAA 1JWGA 2LO6A 3D9PA 5LOZA 3ZYLA 5CMWA 1XGWA 1LF8A 1JWFA 3D9JA 3ZYMA 4AVXA 3D9LA 3ZYQA 2QY7A 2DCPA 3D9KA 3D9OA 4Q94A 1INZA 1EYHA 3G2SA 1X5BA 4GZCA 1HG2A 1HX8A
chains in the Genus database with same CATH superfamily
3SHFA 4DJAA 5G05J 2AW6A 1EDUA 3RRMB 2RFAA 2J08A 4BSXA 3LJNA 2MOWA 4U63A 2I1JA 2XCBA 3ZYQA 2WXPA 4O6FA 4ANXA 4B8CB 5HI7A 3C3OA 4JEHA 4CDNA 2A5EA 4UQZA 4EQFA 5AYWD 5EIDA 4V3IA 2E2EA 5EX3A 4RG6A 3LVQE 3PZ1A 4JHRA 2IQCA 1N0QA 1N4RA 4I9CA 5FQ4A 1N54A 3PH0C 4TXRA 3LCAA 2KM4A 5AENA 3CVUA 5LCWJ 4UI9J 5FZSA 2ZGGA 2KZTA 5FWQA 3LPZA 2FBNA 2BUGA 3QAQA 5FQ7A 2X6FA 4URKA 2XZTG 4GTPA 3IBEA 4I1AA 2H6HA 2C0MA 5LX8A 4DUIA 3CVLA 2OV8A 1QBQA 2KZTB 4LSZE 4FA6A 2P58C 2HM8A 4GTVA 5JJTA 3FDHA 1JWGA 1IHBA 4AXHA 5AJDA 3BG1B 3CVVA 3DEPA 3E34A 3TWWA 5BV1A 1OCCE 1K3ZD 1OT8A 3FH8A 3V31A 2EINE 5CHEE 3U9WA 2LXMA 1PY1A 4PS7A 3ZIMA 3Q78A 4BY6A 3IXEA 3TWXA 5D0QD 4PS8A 2VGYA 3I3NA 4GB9A 5BT1A 3UI2A 1RW2A 3UT8A 4JEUA 3NAWA 5HRYA 3AG3E 4BX8A 2BKKB 2H6GA 4TXPA 3QDNA 1IQUA 3EIJA 3TWSA 4Q69A 2I9CA 3VTXA 3EHQA 3Q73A 5JJ7A 4HOSA 4DPRA 3SBTB 2WXOA 1N11A 1OWOA 2F8XK 4BSZB 2V4HC 3DBSA 4BFRA 3FEYA 2A5UA 1O1TA 2LAIA 3ML9A 3E30A 5KJLA 4FJYA 2YHCA 4BEPA 3AAAC 3TWQA 3ZYKA 1IYGA 3UM0A 4LEUA 2ETBA 2UWJG 3RRUA 5H7PA 3D9IA 2NXPA 4G23A 5G04C 4KVOA 1NI1A 4YDYA 2JEKA 3G2WA 1WG0A 3FU6A 3SFXA 5ENQD 1FVFA 3AG2E 3BEEA 2WXKA 4DRXE 1VDYA 3ONKA 3CHSA 3L22A 4YVQC 3MYVA 4J8SA 1G3NB 4UWKA 4BTAA 1HF8A 3E33A 5KJNA 2VJ8A 3CHPA 3ZYMA 2ETAA 1JCRA 4GZCA 3DSUA 1FPPA 3EHRA 4GA1A 4HOQA 2YNQA 3LKUA 1DC2A 2V5FA 4EZJA 2EILE 3RU0A 1E7UA 2VSYA 2I1KA 3T8MA 2DCPA 4DK5A 4HFGA 5E76A 4U8VD 5T3RA 2P9UG 3QWVA 1PAQA 3RKVA 3ZGQA 5AQ9A 3FUIA 3GYZA 1LF8A 4J8FA 3EDTB 4FHKA 5ENNA 3G2SA 2XRZA 5ITZF 1HX8A 1TN7A 4LNUD 3B7SA 3R9MA 4DX6D 4GTSA 3RJVA 3B7TA 3CK9A 4MS6A 4KZCA 3AG4E 2GW1A 1DCQA 4NRHB 1JWFA 4G11A 4NIKA 3PZ3A 2KCVA 3DXKG 4G24A 4U04A 1TNBA 3DRAA 2LAHA 1D9SA 2P9KG 2WXIA 3QK0A 2QC9A 1NP7A 3J5QB 2GRLA 3JQ1A 3GZ2A 1GW6A 3CGHA 3TWRA 1QYMA 2C0LA 1A5EA 2Y69E 4KZ0A 3DWLG 3HYMB 3PREA 3QNKA 2FO7A 3EU9A 3VTYA 2DYRE 4YDOA 3D9LA 1HO8A 3ASOE 4YVOA 3R7RA 3CVNA 2LSVA 3FUHA 1D8EA 2R59A 3O4ZA 4KBQA 3S7JA 2YINA 3I5PA 3KS2A 3HXBA 3AS5A 3D9KA 5HQ8A 4OAUC 3AS4A 4A63B 3MV2B 2VSXE 2X6JA 1DVPA 4CDRA 5KBAA 3PUKA 4JVSA 4N5QA 1YCSB 4PDXA 2XGMA 3QOUA 1UOHA 4B94A 4RG9A 2DYSE 4JA7A 4LRZA 2WB2A 5B1BE 5BXUA 3AS8A 4U0SA 1V54E 4AM9A 4I2WA 4TXQA 3ASDA 3NF1A 4EPZA 1YYHA 4N3AA 4I6JA 3RO3A 3NQPA 3Q9UC 2IONA 2XZDG 3FTYA 2X6KA 2WVIA 3CK7A 4F1PA 3U66A 3QWPA 2R17C 3ML8A 4K0RA 3NOCD 3V79K 5BUZA 1U2VG 3QKYA 5BNWA 2WMNA 4N39A 4JB8P 2GRNB 1BU9A 1HU3A 3FUFA 2M63A 1E8XA 1V55E 2IEJA 4L2LA 4LCTA 3DPYA 5FT9A 1MX4A 4RQIA 1WAO1 4GU5A 5CECB 5FZRA 4AP2A 1FVHA 3Q49B 1JCQA 5EYPF 3R7QA 3CHOA 5KWDA 4I6EA 1K8KG 3ESLA 5HKPA 4B93B 3HDXA 1SW6A 3MA5A 4CEMA 4I6GA 4JL0A 4Q96A 5D0OD 1OXJA 5CBNA 5LP0A 4OVVA 3PEUB 4YDEA 3ZU7B 3ZXPA 1H2UA 3WG7E 2ZU6B 3ASFA 4UI9K 3JUIA 4AY6A 2MHKA 3APDA 3CHMA 1TNOA 3MX3A 2EIKE 5ARFA 4F7AA 1N94A 1Z6TA 4TV3A 3R9AB 4U0UA 4RLYA 4HBDA 4JA9A 1YA0A 1W3BA 3S7FA 1LD8A 4ZHBA 5BV0A 3FTUA 3PE4A 5ENRD 4GMJA 2DWZA 3K9IA 2IJGX 1MX6A 3AU5A 3PZDA 3ZPJA 1LD7A 3JUEA 2HYZA 2ZXWE 2GRQB 1H2TC 3B7RL 3L17A 4KMOA 2FI7A 2R05A 3OTNA 3LJ3A 3D9OA 4CT4A 3D9HA 2P9NG 1OWMA 3ASHA 1MHQA 3ENEA 4FLBA 1D8DA 3CKCA 3HXEA 2X6HA 3JYSA 4XE0A 3HXDA 4I1OB 2JLBA 5CERB 1WM5A 4J0UA 4TRQA 3MKRA 1ELWA 4EZLA 3ZVVA 4XZ4A 4G25A 5KJMA 1SZ9A 5KNGA 1SZAA 2L0TB 4EBAG 2X38A 4F1SA 3LEWA 3ZRHA 5ANLA 1E96B 3Q4AB 3VLDA 5DIZA 1WDYA 3NZUA 3MEKA 4A55A 1SA4A 2LXLA 3PNTB 3ULYA 1U3DA 3B13A 4O60A 4OAVB 4WNFA 5ARGA 3PUJA 4L9PA 4HS2A 2PL2A 4C9BB 2CFZA 5LFAA 4GTTA 1S64A 2X3MA 3PZ2A 4WWOA 4BESA 2KCKA 4DLOA 4A1GA 3LY8A 4NACA 1L5JA 3HHMA 4QQIA 4HOUA 4EECA 3FEXA 2CG2A 4I9EA 4HNAD 5JA4D 1UW4B 3G2TA 2Y1LE 3LXUX 4HQDA 1WY6A 4KVMA 1FT1A 1H6KA 4XKBA 1MZCA 5G05C 1ELKA 3UPVA 3CEQA 5AIJA 4LG6A 4GZDA 4TUUA 2XPYA 4ME2A 1N4SA 4B8AA 4U07A 3ULQA 1HXIA 3PEVB 5ENTD 3NB2A 1Y6IA 4AEZC 2QZAA 4J6IA 4XKCA 2LNIA 5HS0A 2J4DA 3P1UA 2WM9A 3Q7FA 3B7UX 5EN5D 4WWNA 4UQXA 4GPKA 3T8KA 3DSVA 3ASNE 3KEZA 3UXGA 2YHEA 3CKBA 4BX9A 4UI9C 2Q7FA 2J9QA 3Q5MA 2GRRB 2R02A 5A23A 5FQ6A 2YQ8A 5FIOA 2C2LA 1PC2A 4H7XA 1INZA 3OAWA 3ULEG 1TNUA 4FU3A 2CFUA 3LDZA 3HXFA 2VSOE 4N3BA 1E8ZA 3C98A 4KYOB 3SBSA 1SVXA 3SGHA 5T4YA 3CSFA 4PS3A 2CHWA 2DZOA 3C3RA 2F37A 4JW1A 2WXJA 5CCMA 4U95D 4RVBA 3UKUG 3IV0A 3CVXA 4DX5D 4P29A 3QARA 3SY2A 2IY0C 2V5QC 4FADA 2XEEA 5BXOA 4L7TA 2LO6A 3I4GA 2IO2C 3PZ4A 5DBKA 1KZPA 3SZ7A 3F6QA 2XS1A 4FJZA 2P9SG 2WXMA 3OXLA 1UN8A 2AWIA 4GTRA 2R03A 3FWVA 3U64A 3ZW3A 4C0EA 4G2VA 2GROB 1NZNA 2J09A 2AXUA 2ZGDA 1HE8A 3FY4A 2QYUA 2XHEA 1S70B 3MV3B 5ENOD 4HRNA 1YMPA 5G2NA 5AQ7A 2ZIRA 3UMVA 3V2OA 3CIAA 4DI4A 2VTBA 3I4RB 4KT6B 5A7DB 3PS6A 5A6CA 2V4LA 1H19A 4WUYA 1N4PA 4BWRA 5C1DA 2WXGA 4ILGA 4FC8A 3S7DA 4XIFA 4G1TA 3IHVA 3TG4A 5LOZA 2I6HA 4LNGA 2VTBB 3FU3A 5EIBE 2P2CP 1B89A 3CVWA 3PRZA 4WNEA 1RZ4A 2XCCA 1BI7B 4AOFA 1BI8B 3FTSA 4NURA 2BF0X 4FHJA 4UQYA 1LTXA 3NOGD 3GW4A 4Q94A 3IKOB 4ATGA 4HOTA 3ZUVB 2ETCA 4GCNA 4G26A 2HR2A 3D9MA 5ENPD 3VLEA 2BEDA 1TJFA 2F8YA 1NFIE 1N9AA 3MJWA 2P9IG 2RG8A 2HO1A 3BG0B 3FUKA 2NYJA 1E8YA 5G55A 3MKQA 5KJKA 1X5BA 4FP7A 3FTWA 2XS8A 1OCOE 2J49A 3L16A 3TXMA 1E90A 4EHMA 3QWWA 1IHGA 2WQHA 5AJLA 4EBAA 2J07A 3MKQB 4YNDA 4CRWA 1ZB1A 3CVPA 3D9NA 5AAOA 3GZSA 1TJCA 3UQ3A 4HVBA 3FH7A 3O48A 2WXQA 3C72A 3Q15A 1XGWA 5IY5E 1E7VA 3D9JA 2AXZA 1H6OA 1OWLA 4MBGA 3IHYA 1UJJA 5BPPA 4Y6CA 5E75A 1AWCB 4ACLA 5JJ6A 1KPSB 4DX1A 2L6BA 5J90A 2I2OA 3ABKE 3DSWA 1N4QA 3UIOC 4N2QA 3UX4A 3HVEA 3TL5A 4HRLA 4Y6WA 2IF4A 3C5RA 5AQAA 1E8WA 4U7EB 5CEDB 3CV0A 4QFVA 4ILIA 5CMYA 4ABNA 5JMND 3B95A 4GZ5A 2PZIA 3UUXA 2MYOA 3FUMA 5T8IA 5CCLA 4HI9A 3HVEB 3OXFA 4MRUA 3C3QA 3DXMG 3UTMA 3LYAA 3UKRG 4PUCA 2ZISA 3UIPC 3EHMA 4D10C 1NA3A 3D3MA 2PQRA 3UINC 3P2BA 3RIBA 2LSUA 2PM7A 2XPZA 3ASGA 2XGOA 3ZKJA 3APFA 4I17A 3EIQC 4HLEA 4UWFA 2AVPA 3L82A 1UJKA 3ESKA 1HG5A 2XGSA 3Q79A 4XX5A 2VYIA 3SNXA 4LUNU 4GYWA 4GAAA 2JABA 2RFMA 3ABLE 1H0AA 1SA5A 4GMLA 4A3VA 5CBOA 5J08A 3S2AA 2IOLA 3HIZA 2PNNA 4WNDA 3TXNA 2KBXA 4RSYA 2RD0A 3BQOA 1KT1A 4GMRA 4MKTA 3SF4A 1NL4A 4JHJA 3FHEA 3T5VA 1EYHA 4F6RD 2VGXA 4BT9A 2Y3AA 3CLJA 3SI5A 2DIWA 1K1BA 3LVRE 1TNYA 5G04J 4JXTA 2A4ZA 2J4BA 1Z3YA 3HXCA 3VLFA 5B3SE 5C2YA 4XI9A 3APCA 4F53A 4TUMA 2KCLA 2VGXB 4GA2A 3LY9A 2VGEA 3JQ0A 4J8YA 4GYYA 3RK6A 4APFA 2ONDA 4EZKA 4K5BA 3ZYLA 3KSQA 2OCCE 4UUCA 2VQ2A 5AN8A 3CSTA 1HG2A 4GPMA 5CEAA 3ZXSA 1KZOA 4XI0A 4AJWA 3TGOA 4K03A 1ZBPA 3BU8A 1IKND 2CG3A 3ZNGA 5FINA 2UY1A 2NC9A 4WAFA 2P9LG 3RAUA 1MX2A 3DSTA 3JCKC 3DSSA 4C0MA 4IN3B 2WXHA 1MQSA 4ANVA 4B89A 2KXPC 3FH5A 2EQXA 3U4TA 3D9PA 4APOA 1HS6A 4IULA 1N95A 3ZEFA 4GTMA 3CVQA 2UY1B 3FTZA 3GZ1A 2KATA 1JUQA 4J7WA 1FCHA 3ZN3A 1UG3A 3W9FA 3QJZA 1O1SA 4UWLA 2V8SE 1H6PA 3Q75A 4X8QA 2NSZA 4F3VA 1EPUA 4U8HA 4CGVA 3KSLA 3FUEA 4DX2A 1P5QA 4ATZD 1QZ2A 3IEGA 1O5MA 2GRMA 4CDMA 4JZYA 4Z68A 3SFYA 2DZNA 2XPIA 3MZLB 4GYOA 3L13A 3CVYA 2B0OE 3PE3A 2FF4A 3NZSA 3FU0A 4JPSA 5D66A 4BETA 3SQVA 1SQMA 3AG1E 4JC8A 1OUVA 2BTDA 3JXIA 3PVLA 4DLQA 3CHQA 2LUHA 3ONLA 4L23A 2F0YA 2EIME 1TEZA 4LERA 5LCWC 2XENA 4GA0A 4GZ3A 1XNFA 5EILA 4O1OA 2DBAA 3DSXA 3TWVA 2Y4TA 4GTQA 1AP7A 1BLXB 4LNBA 2X6IA 2DVWA 2ILRA 4L1BA 3LY7A 2OVBA 4B0ZA 1IXVA 5BW8C 1KT0A 2AXVA 3KEAA 4E85A 2OOEA 3ZFWA 4CCAA 4E6HA 3CQCB 5FTPA 1ZU2A 4L2YA 3FU5A 3CHRA 3G2VA 4HRMB 4I2ZA 4ANWA 3KD7A 2Y0BG 3CK8A 4G8KA 3EHNA 1ELRA 4G8LA 4IRUA 2H6FA 3AJIA 4WWPA 3G2UA 3OXGA 3NBNB 1HFAA 4U0ZA 4UWGA 5EYLA 3TG5A 1Z5SC 3CQGB 3DEOA 4AIFA 4KXKB 2WQ7A 4R7LA 1QQEA 2OEWA 2Y4UA 4H7YA 1Q2ZA 4N2SA 3MGBA 1HZ4A 3ISMC 3EJNA 2B6CA 1HH8A 1S0PA 2XRYA 4UWHA 3Q7AA 5FZQA 3RSEG 4BT8A 4PH4B 4M3OA 3HRAA 2GGFA 2XQ0A 3FUNA 3L9TA 1TN8A 3AU4A 4GCOA 5EKQD 1OCZE 4O1PA 2R5SA 2AJAA 3RRNB 3X2QE 1N0RA 1IQRA 5EDSA 3J5PA 1OY3D 3SO8A 4N5CA 4AV7A 2V0PA 4I43A 3PDNA 3TAXA 3ABME 1K1AA 1N52A 1MJ0A 1A17A 5CRVA 4DX7D 4YDWA 4ACKA 1BPOA 5JHAA 2PM6A 3T5XA 3MCXA 3E37A 2R2LA 2IU1A 2CHZA 2WQ6A 4J8EA 3U3WA 2VSNA 4CT0A 4NQ0A 2FULA 2BKGA 2XEVA 2CHXA 4AVXA 4OYSA 2QY7A 4FLHA 4HI8A 2L0IA 3TWUA 3QB2A 2RKKA 3UT7A 4BTBA 3LS8A 1O1RA 4W9RA 4GTOA 1DNPA 1FT2A 4FULA 4JHKA 3V30A 1TNZA 5ANRA 1U3CA 5ENSD 3QC1A 3JXJA 3FULA 3T9KA 4CGWA 2J8SD 4HLLA 5AARA 1QNFA 4DI3A 2WXLA 4U8YD 4N3CA 4J8DA 3FFLA 5CRUA 4K5AB 3PNLB 3V2XA 4GZ6A 3TWTA 5B1AE 4HB5A 4ZFHA 1OWPA 2OEVA 4MLPA 2L6JA 4U96D 5M72A 3TJPA 2L9BA 2P9PG 2WXNA 2WMOA 1JPLA 5AQBA 3W9GA 1Z3XA 3DPDA 3UT4A 4K5CA 4M7CA 1KLXA 4OVUA 3FUJA 2EIJE 1X81A 3CR3A 4CZ2D 3E32A 3FTVA 4A3TA 1UN9A 3HG0D 1TN6A 3SD5A 2FO1E 3S7BA 2GRPB 4HXIA 1H2VC 4HORA 4IYPA 3FP3A 4WNGA 5KNHD 2OVFA 1BD8A 2WPVA 3N71A 3UM3A 2QYJA 4C48B 3ZHEA 2FEZA 4ILHB 5FJYA 5KCMA 2KC7A 4XEIG 1JCSA 1MYOA 3EU5A 3FUDA 3L08A 2E0IA 1S63A 4A1SA 1NA0A 3URZA 3RO2A 5EX0A 3FTXA 2HE0A 2IO3C 3Q47B 3ZHEB 4CYMD 2IOSA 1Y8MA 4BERA 1DCEA 3SFZA 1TYQG 5D2MC 5CMWA 5FQ8A 5JHBA 2IFUA 3L54A 3WXXA 2MRIA 3B7BA 3L6AA 1OCRE 3KAEA 4I1MA 2PQNA 2QFCA 4JD2G 2WXRA 2WXFA 4AY5A 3Q9NC 2XEHA 3EUVA 3E4BA 2H6IA 4ANUA 3UM1A 1TR4A 3BUAA 1EF1C 1OWNA 3UM2A
chains in the Genus database with same CATH topology
3SHFA 3FTZA 3OXLA 5G05J 3GZ1A 4DJAA 2KATA 1UN8A 1JUQA 3AS8A 2AW6A 4U0SA 2AWIA 4AM9A 1EDUA 3RRMB 1FCHA 3FWVA 3U64A 3ZN3A 3ZW3A 1UG3A 2J08A 4I2WA 3QJZA 4C0EA 3ASDA 4UWLA 2V8SE 3NF1A 4BSXA 4G2VA 4F3VA 2NSZA 2MOWA 1NZNA 1EPUA 4U63A 2I1JA 2XCBA 4U8HA 4CGVA 2J09A 4EPZA 3FUEA 2AXUA 1P5QA 2WXPA 3ZYQA 1HE8A 3FY4A 1QZ2A 3IEGA 4O6FA 2GRMA 4ANXA 2XHEA 4N3AA 4B8CB 4I6JA 5HI7A 3RO3A 4CDMA 4JZYA 3NQPA 4JEHA 3MV3B 4CDNA 4UQZA 2IONA 4EQFA 3FTYA 5AYWD 2XPIA 3MZLB 5G2NA 4GYOA 3L13A 4V3IA 3CVYA 2E2EA 3PE3A 2X6KA 5EX3A 2WVIA 3CK7A 3UMVA 3U66A 2FF4A 3NZSA 4RG6A 3FU0A 4JPSA 3LVQE 3QWPA 4JHRA 2IQCA 2R17C 1SQMA 3CIAA 4DI4A 4JC8A 2VTBA 1OUVA 2BTDA 3ML8A 4K0RA 3PVLA 5BUZA 3I4RB 4DLQA 4KT6B 4I9CA 3QKYA 5FQ4A 1N54A 3PS6A 3PH0C 3CHQA 5A7DB 5BNWA 5A6CA 2WMNA 4N39A 2V4LA 3LCAA 3ONLA 1H19A 4L23A 2KM4A 4WUYA 5AENA 3CVUA 5LCWJ 4UI9J 5FZSA 1TEZA 4LERA 4BWRA 5C1DA 5LCWC 2WXGA 4GA0A 2KZTA 1HU3A 4GZ3A 5FWQA 3FUFA 4ILGA 1XNFA 4FC8A 3S7DA 2M63A 4XIFA 3LPZA 1E8XA 3IHVA 4G1TA 2FBNA 2DBAA 3TG4A 5LOZA 2BUGA 3QAQA 4L2LA 4LCTA 5FQ7A 2X6FA 2I6HA 5FT9A 4URKA 2Y4TA 2VTBB 3FU3A 3IBEA 4I1AA 1WAO1 2C0MA 5LX8A 4GU5A 1B89A 2X6IA 3CVWA 3PRZA 2ILRA 4WNEA 3CVLA 4L1BA 3LY7A 2OV8A 2OVBA 2XCCA 4B0ZA 5FZRA 4AP2A 1FVHA 5BW8C 4AOFA 1KT0A 3FTSA 3Q49B 3R7QA 2KZTB 3CHOA 2AXVA 4E85A 4I6EA 4NURA 2BF0X 2OOEA 2P58C 2HM8A 3ESLA 4FA6A 5JJTA 3FDHA 4FHJA 3ZFWA 1JWGA 3HDXA 4UQYA 4CCAA 4AXHA 4E6HA 3MA5A 3BG1B 3CQCB 5AJDA 5FTPA 3CVVA 1ZU2A 4L2YA 3GW4A 4I6GA 4Q94A 4CEMA 3FU5A 3CHRA 4JL0A 3IKOB 5BV1A 4ATGA 3G2VA 4HOTA 4Q96A 5D0OD 4I2ZA 4ANWA 3KD7A 4GCNA 4G26A 2HR2A 3D9MA 3FH8A 3CK8A 3EHNA 5LP0A 4OVVA 5CHEE 3U9WA 3PEUB 1PY1A 4PS7A 3ZIMA 3VLEA 1TJFA 1ELRA 4BY6A 4IRUA 5D0QD 4PS8A 4WWPA 3G2UA 3MJWA 3OXGA 1HFAA 2RG8A 2VGYA 2HO1A 3BG0B 1H2UA 4U0ZA 4UWGA 3FUKA 3I3NA 2ZU6B 3TG5A 1E8YA 3ASFA 3CQGB 3JUIA 4GB9A 4UI9K 5G55A 5BT1A 3UT8A 3MKQA 5KJKA 1X5BA 4AY6A 4AIFA 4KXKB 4FP7A 2MHKA 3APDA 3CHMA 4JEUA 2WQ7A 3FTWA 3MX3A 4R7LA 4BX8A 5ARFA 1QQEA 2J49A 3L16A 3TXMA 4F7AA 2Y4UA 1Z6TA 1E90A 4H7YA 4TV3A 3R9AB 3QDNA 3QWWA 4U0UA 1IHGA 3MGBA 4N2SA 1HZ4A 1IQUA 2WQHA 3EJNA 3EIJA 4JA9A 1HH8A 1YA0A 1S0PA 2XRYA 5AJLA 4UWHA 2I9CA 1W3BA 3S7FA 3VTXA 4Q69A 4EBAA 2J07A 3MKQB 5JJ7A 4YNDA 5FZQA 4CRWA 4HOSA 4BT8A 4PH4B 4M3OA 4DPRA 5BV0A 3CVPA 3SBTB 2WXOA 3FTUA 2GGFA 2XQ0A 3FUNA 3PE4A 3D9NA 1OWOA 4GMJA 3AU4A 3GZSA 3K9IA 4GCOA 5EKQD 2IJGX 1TJCA 3UQ3A 3AU5A 3PZDA 3ZPJA 4HVBA 2R5SA 2HYZA 3DBSA 2WXQA 3FH7A 3O48A 4BFRA 3Q15A 1H2TC 3B7RL 3FEYA 3L17A 4KMOA 2A5UA 1XGWA 2LAIA 1E7VA 2FI7A 3D9JA 3OTNA 2AXZA 3LJ3A 3ML9A 3D9OA 4CT4A 5KJLA 3RRNB 4FJYA 1OWMA 2YHCA 1OWLA 3ASHA 3IHYA 1UJJA 1IQRA 3ZYKA 5BPPA 5EDSA 1MHQA 1IYGA 3ENEA 4Y6CA 4FLBA 4N5CA 4LEUA 2V0PA 3CKCA 3PDNA 4I43A 5E75A 3TAXA 4AV7A 2X6HA 3JYSA 4XE0A 2UWJG 3RRUA 4ACLA 5JJ6A 1N52A 3D9IA 2NXPA 4I1OB 1A17A 4G23A 5G04C 4KVOA 5J90A 2JLBA 2I2OA 2JEKA 3G2WA 1WM5A 4J0UA 4TRQA 4N2QA 3MKRA 4ACKA 3FU6A 1ELWA 1BPOA 5JHAA 3UX4A 2PM6A 3T5XA 3MCXA 3HVEA 4EZLA 1FVFA 3BEEA 3ZVVA 4XZ4A 2WXKA 4G25A 3TL5A 5KJMA 1SZ9A 4Y6WA 2IU1A 2IF4A 2CHZA 1SZAA 2L0TB 1E8WA 2WQ6A 1VDYA 3ONKA 3CHSA 4J8EA 2X38A 4EBAG 2VSNA 3U3WA 4F1SA 3CV0A 3L22A 4QFVA 3LEWA 3MYVA 4YVQC 5ANLA 3ZRHA 1E96B 4J8SA 4CT0A 3Q4AB 4UWKA 4NQ0A 3VLDA 5DIZA 4BTAA 3NZUA 4ILIA 3MEKA 5CMYA 1HF8A 2FULA 4ABNA 4A55A 3PNTB 5KJNA 1U3DA 3B13A 2VJ8A 3CHPA 4GZ5A 3ZYMA 2XEVA 2CHXA 4AVXA 4WNFA 4OYSA 2QY7A 5ARGA 2PZIA 3PUJA 4FLHA 4HS2A 2PL2A 3UUXA 3FUMA 5T8IA 4C9BB 2L0IA 4GZCA 2CFZA 3HVEB 3OXFA 4MRUA 5CCLA 5LFAA 3QB2A 3UT7A 4BTBA 3LS8A 4GA1A 3LYAA 2X3MA 4WWOA 4PUCA 4HOQA 4W9RA 2KCKA 2YNQA 3EHMA 4D10C 1NA3A 4DLOA 1DNPA 4FULA 3LKUA 3D3MA 4A1GA 2PQRA 2V5FA 3LY8A 4EZJA 4JHKA 3RU0A 4NACA 5ANRA 3P2BA 1E7UA 2VSYA 3RIBA 1U3CA 2LSUA 1L5JA 2PM7A 2I1KA 3ASGA 2XPZA 3T8MA 2DCPA 3QC1A 3HHMA 4HOUA 2XGOA 4EECA 3APFA 3FULA 4I17A 3FEXA 2CG2A 4I9EA 4CGWA 3EIQC 4HLEA 4DK5A 4HFGA 4UWFA 2AVPA 5E76A 5T3RA 1QNFA 4DI3A 1UJKA 2WXLA 1UW4B 3G2TA 3QWVA 3ESKA 1PAQA 3RKVA 3ZGQA 4N3CA 4J8DA 1HG5A 2XGSA 3FFLA 3LXUX 3PNLB 3FUIA 4GZ6A 3GYZA 4XX5A 1LF8A 1WY6A 2VYIA 4KVMA 3SNXA 4J8FA 3EDTB 4FHKA 4LUNU 4GYWA 1H6KA 1OWPA 3G2SA 4GAAA 5ENNA 2XRZA 4XKBA 1HX8A 4MLPA 2L6JA 5G05C 1ELKA 1H0AA 5M72A 3TJPA 3B7SA 4GMLA 4A3VA 3UPVA 2L9BA 2WXNA 2WMOA 1JPLA 3CEQA 3RJVA 5AIJA 3B7TA 5J08A 3S2AA 2IOLA 3HIZA 3CK9A 4MS6A 4GZDA 4TUUA 2XPYA 4ME2A 4KZCA 1Z3XA 2GW1A 3DPDA 3UT4A 4WNDA 4NRHB 3TXNA 4RSYA 1KLXA 2RD0A 4OVUA 3FUJA 1JWFA 4G11A 1KT1A 4MKTA 4B8AA 3CR3A 3SF4A 4U07A 4JHJA 3FHEA 3T5VA 2KCVA 3FTVA 4A3TA 1EYHA 1UN9A 3ULQA 1HXIA 3PEVB 2VGXA 4G24A 3SD5A 1Y6IA 4AEZC 4BT9A 2Y3AA 4U04A 3CLJA 4J6IA 3SI5A 2DIWA 4XKCA 3LVRE 2LNIA 5G04J 4JXTA 2A4ZA 2LAHA 2J4BA 1Z3YA 2J4DA 3VLFA 3S7BA 2WXIA 3P1UA 3QK0A 4XI9A 2WM9A 5C2YA 3APCA 4HXIA 3B7UX 1H2VC 4F53A 1NP7A 4HORA 4IYPA 2GRLA 4UQXA 3JQ1A 4WWNA 2KCLA 4GPKA 3GZ2A 3FP3A 1GW6A 4WNGA 2OVFA 3KEZA 3CGHA 2VGXB 2WPVA 3N71A 2C0LA 2YHEA 3CKBA 3LY9A 4GA2A 4BX9A 4KZ0A 4UI9C 3ZHEA 2Q7FA 3HYMB 2FEZA 3JQ0A 2J9QA 3PREA 4GYYA 4ILHB 3RK6A 3QNKA 5FJYA 4APFA 2FO7A 2ONDA 5KCMA 2KC7A 4EZKA 3Q5MA 3VTYA 3ZYLA 5A23A 3FUDA 5FQ6A 3L08A 2YQ8A 2E0IA 2VQ2A 3D9LA 1HO8A 2C2LA 1PC2A 4H7XA 1INZA 4A1SA 1NA0A 3CSTA 3OAWA 3URZA 1HG2A 4YVOA 3RO2A 3R7RA 3CVNA 4FU3A 2LSVA 5EX0A 2CFUA 3LDZA 3ZXSA 3FTXA 3FUHA 2VSOE 3Q47B 4XI0A 3ZHEB 4AJWA 3TGOA 2IOSA 1E8ZA 1ZBPA 4K03A 2R59A 1Y8MA 4N3BA 3C98A 3O4ZA 3SFZA 4KBQA 2CG3A 3S7JA 2YINA 4KYOB 3SBSA 3I5PA 5CMWA 3KS2A 5FQ8A 3SGHA 5T4YA 5JHBA 3CSFA 3AS5A 2IFUA 4PS3A 2UY1A 2CHWA 3D9KA 4JW1A 2NC9A 5HQ8A 2WXJA 4WAFA 3L54A 5CCMA 3AS4A 3JCKC 3MV2B 2VSXE 3WXXA 4RVBA 3CVXA 2MRIA 2X6JA 3IV0A 3L6AA 4C0MA 1DVPA 3KAEA 4CDRA 3PUKA 4I1MA 4IN3B 4P29A 3QARA 2PQNA 1MQSA 2WXHA 2QFCA 4ANVA 4B89A 4JVSA 2WXRA 3FH5A 2EQXA 2WXFA 4FADA 4AY5A 4L7TA 3U4TA 4PDXA 2XGMA 3D9PA 2LO6A 3QOUA 3I4GA 4RG9A 4B94A 4APOA 1HS6A 5DBKA 3E4BA 4IULA 4JA7A 4ANUA 3ZEFA 3CVQA 3SZ7A 4LRZA 2UY1B 4FJZA 2WB2A 1EF1C 1OWNA 2WXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G2V A;  1UJJ A;  4FU3 A;  4Q96 A;  3ZYK A;  1ELK A;  1H0A A;  1MHQ A;  1JUQ A;  3ONL A;  1SZ9 A;  3LDZ A;  4FLB A;  3D9M A;  2KM4 A;  1EDU A;  1SZA A;  4HFG A;  2L0T B;  3CLJ A;  1JPL A;  5LP0 A;  1VDY A;  1UJK A;  1DVP A;  2DIW A;  3D9N A;  1PY1 A;  3ONK A;  3RRU A;  5J08 A;  3G2T A;  3D9I A;  4GZD A;  2V8S E;  4JXT A;  2L0I A;  2BF0 X;  1HG5 A;  2MOW A;  3G2U A;  3G2W A;  1HF8 A;  4NAC A;  5CMY A;  1HFA A;  1JWG A;  2LO6 A;  3D9P A;  5LOZ A;  3ZYL A;  5CMW A;  1XGW A;  1LF8 A;  1JWF A;  3D9J A;  3ZYM A;  4AVX A;  3D9L A;  3ZYQ A;  2QY7 A;  2DCP A;  3D9K A;  3D9O A;  4Q94 A;  1INZ A;  1EYH A;  3G2S A;  1X5B A;  4GZC A;  1HG2 A;  1HX8 A; 
#chains in the Genus database with same CATH topology
 3SHF A;  4DJA A;  5G05 J;  2AW6 A;  1EDU A;  3RRM B;  2RFA A;  2J08 A;  4BSX A;  3LJN A;  2MOW A;  4U63 A;  2I1J A;  2XCB A;  3ZYQ A;  2WXP A;  4O6F A;  4ANX A;  4B8C B;  5HI7 A;  3C3O A;  4JEH A;  4CDN A;  2A5E A;  4UQZ A;  4EQF A;  5AYW D;  5EID A;  4V3I A;  2E2E A;  5EX3 A;  4RG6 A;  3LVQ E;  3PZ1 A;  4JHR A;  2IQC A;  1N0Q A;  1N4R A;  4I9C A;  5FQ4 A;  1N54 A;  3PH0 C;  4TXR A;  3LCA A;  2KM4 A;  5AEN A;  3CVU A;  5LCW J;  4UI9 J;  5FZS A;  2ZGG A;  2KZT A;  5FWQ A;  3LPZ A;  2FBN A;  2BUG A;  3QAQ A;  5FQ7 A;  2X6F A;  4URK A;  2XZT G;  4GTP A;  3IBE A;  4I1A A;  2H6H A;  2C0M A;  5LX8 A;  4DUI A;  3CVL A;  2OV8 A;  1QBQ A;  2KZT B;  4LSZ E;  4FA6 A;  2P58 C;  2HM8 A;  4GTV A;  5JJT A;  3FDH A;  1JWG A;  1IHB A;  4AXH A;  5AJD A;  3BG1 B;  3CVV A;  3DEP A;  3E34 A;  3TWW A;  5BV1 A;  1OCC E;  1K3Z D;  1OT8 A;  3FH8 A;  3V31 A;  2EIN E;  5CHE E;  3U9W A;  2LXM A;  1PY1 A;  4PS7 A;  3ZIM A;  3Q78 A;  4BY6 A;  3IXE A;  3TWX A;  5D0Q D;  4PS8 A;  2VGY A;  3I3N A;  4GB9 A;  5BT1 A;  3UI2 A;  1RW2 A;  3UT8 A;  4JEU A;  3NAW A;  5HRY A;  3AG3 E;  4BX8 A;  2BKK B;  2H6G A;  4TXP A;  3QDN A;  1IQU A;  3EIJ A;  3TWS A;  4Q69 A;  2I9C A;  3VTX A;  3EHQ A;  3Q73 A;  5JJ7 A;  4HOS A;  4DPR A;  3SBT B;  2WXO A;  1N11 A;  1OWO A;  2F8X K;  4BSZ B;  2V4H C;  3DBS A;  4BFR A;  3FEY A;  2A5U A;  1O1T A;  2LAI A;  3ML9 A;  3E30 A;  5KJL A;  4FJY A;  2YHC A;  4BEP A;  3AAA C;  3TWQ A;  3ZYK A;  1IYG A;  3UM0 A;  4LEU A;  2ETB A;  2UWJ G;  3RRU A;  5H7P A;  3D9I A;  2NXP A;  4G23 A;  5G04 C;  4KVO A;  1NI1 A;  4YDY A;  2JEK A;  3G2W A;  1WG0 A;  3FU6 A;  3SFX A;  5ENQ D;  1FVF A;  3AG2 E;  3BEE A;  2WXK A;  4DRX E;  1VDY A;  3ONK A;  3CHS A;  3L22 A;  4YVQ C;  3MYV A;  4J8S A;  1G3N B;  4UWK A;  4BTA A;  1HF8 A;  3E33 A;  5KJN A;  2VJ8 A;  3CHP A;  3ZYM A;  2ETA A;  1JCR A;  4GZC A;  3DSU A;  1FPP A;  3EHR A;  4GA1 A;  4HOQ A;  2YNQ A;  3LKU A;  1DC2 A;  2V5F A;  4EZJ A;  2EIL E;  3RU0 A;  1E7U A;  2VSY A;  2I1K A;  3T8M A;  2DCP A;  4DK5 A;  4HFG A;  5E76 A;  4U8V D;  5T3R A;  2P9U G;  3QWV A;  1PAQ A;  3RKV A;  3ZGQ A;  5AQ9 A;  3FUI A;  3GYZ A;  1LF8 A;  4J8F A;  3EDT B;  4FHK A;  5ENN A;  3G2S A;  2XRZ A;  5ITZ F;  1HX8 A;  1TN7 A;  4LNU D;  3B7S A;  3R9M A;  4DX6 D;  4GTS A;  3RJV A;  3B7T A;  3CK9 A;  4MS6 A;  4KZC A;  3AG4 E;  2GW1 A;  1DCQ A;  4NRH B;  1JWF A;  4G11 A;  4NIK A;  3PZ3 A;  2KCV A;  3DXK G;  4G24 A;  4U04 A;  1TNB A;  3DRA A;  2LAH A;  1D9S A;  2P9K G;  2WXI A;  3QK0 A;  2QC9 A;  1NP7 A;  3J5Q B;  2GRL A;  3JQ1 A;  3GZ2 A;  1GW6 A;  3CGH A;  3TWR A;  1QYM A;  2C0L A;  1A5E A;  2Y69 E;  4KZ0 A;  3DWL G;  3HYM B;  3PRE A;  3QNK A;  2FO7 A;  3EU9 A;  3VTY A;  2DYR E;  4YDO A;  3D9L A;  1HO8 A;  3ASO E;  4YVO A;  3R7R A;  3CVN A;  2LSV A;  3FUH A;  1D8E A;  2R59 A;  3O4Z A;  4KBQ A;  3S7J A;  2YIN A;  3I5P A;  3KS2 A;  3HXB A;  3AS5 A;  3D9K A;  5HQ8 A;  4OAU C;  3AS4 A;  4A63 B;  3MV2 B;  2VSX E;  2X6J A;  1DVP A;  4CDR A;  5KBA A;  3PUK A;  4JVS A;  4N5Q A;  1YCS B;  4PDX A;  2XGM A;  3QOU A;  1UOH A;  4B94 A;  4RG9 A;  2DYS E;  4JA7 A;  4LRZ A;  2WB2 A;  5B1B E;  5BXU A;  3AS8 A;  4U0S A;  1V54 E;  4AM9 A;  4I2W A;  4TXQ A;  3ASD A;  3NF1 A;  4EPZ A;  1YYH A;  4N3A A;  4I6J A;  3RO3 A;  3NQP A;  3Q9U C;  2ION A;  2XZD G;  3FTY A;  2X6K A;  2WVI A;  3CK7 A;  4F1P A;  3U66 A;  3QWP A;  2R17 C;  3ML8 A;  4K0R A;  3NOC D;  3V79 K;  5BUZ A;  1U2V G;  3QKY A;  5BNW A;  2WMN A;  4N39 A;  4JB8 P;  2GRN B;  1BU9 A;  1HU3 A;  3FUF A;  2M63 A;  1E8X A;  1V55 E;  2IEJ A;  4L2L A;  4LCT A;  3DPY A;  5FT9 A;  1MX4 A;  4RQI A;  1WAO 1;  4GU5 A;  5CEC B;  5FZR A;  4AP2 A;  1FVH A;  3Q49 B;  1JCQ A;  5EYP F;  3R7Q A;  3CHO A;  5KWD A;  4I6E A;  1K8K G;  3ESL A;  5HKP A;  4B93 B;  3HDX A;  1SW6 A;  3MA5 A;  4CEM A;  4I6G A;  4JL0 A;  4Q96 A;  5D0O D;  1OXJ A;  5CBN A;  5LP0 A;  4OVV A;  3PEU B;  4YDE A;  3ZU7 B;  3ZXP A;  1H2U A;  3WG7 E;  2ZU6 B;  3ASF A;  4UI9 K;  3JUI A;  4AY6 A;  2MHK A;  3APD A;  3CHM A;  1TNO A;  3MX3 A;  2EIK E;  5ARF A;  4F7A A;  1N94 A;  1Z6T A;  4TV3 A;  3R9A B;  4U0U A;  4RLY A;  4HBD A;  4JA9 A;  1YA0 A;  1W3B A;  3S7F A;  1LD8 A;  4ZHB A;  5BV0 A;  3FTU A;  3PE4 A;  5ENR D;  4GMJ A;  2DWZ A;  3K9I A;  2IJG X;  1MX6 A;  3AU5 A;  3PZD A;  3ZPJ A;  1LD7 A;  3JUE A;  2HYZ A;  2ZXW E;  2GRQ B;  1H2T C;  3B7R L;  3L17 A;  4KMO A;  2FI7 A;  2R05 A;  3OTN A;  3LJ3 A;  3D9O A;  4CT4 A;  3D9H A;  2P9N G;  1OWM A;  3ASH A;  1MHQ A;  3ENE A;  4FLB A;  1D8D A;  3CKC A;  3HXE A;  2X6H A;  3JYS A;  4XE0 A;  3HXD A;  4I1O B;  2JLB A;  5CER B;  1WM5 A;  4J0U A;  4TRQ A;  3MKR A;  1ELW A;  4EZL A;  3ZVV A;  4XZ4 A;  4G25 A;  5KJM A;  1SZ9 A;  5KNG A;  1SZA A;  2L0T B;  4EBA G;  2X38 A;  4F1S A;  3LEW A;  3ZRH A;  5ANL A;  1E96 B;  3Q4A B;  3VLD A;  5DIZ A;  1WDY A;  3NZU A;  3MEK A;  4A55 A;  1SA4 A;  2LXL A;  3PNT B;  3ULY A;  1U3D A;  3B13 A;  4O60 A;  4OAV B;  4WNF A;  5ARG A;  3PUJ A;  4L9P A;  4HS2 A;  2PL2 A;  4C9B B;  2CFZ A;  5LFA A;  4GTT A;  1S64 A;  2X3M A;  3PZ2 A;  4WWO A;  4BES A;  2KCK A;  4DLO A;  4A1G A;  3LY8 A;  4NAC A;  1L5J A;  3HHM A;  4QQI A;  4HOU A;  4EEC A;  3FEX A;  2CG2 A;  4I9E A;  4HNA D;  5JA4 D;  1UW4 B;  3G2T A;  2Y1L E;  3LXU X;  4HQD A;  1WY6 A;  4KVM A;  1FT1 A;  1H6K A;  4XKB A;  1MZC A;  5G05 C;  1ELK A;  3UPV A;  3CEQ A;  5AIJ A;  4LG6 A;  4GZD A;  4TUU A;  2XPY A;  4ME2 A;  1N4S A;  4B8A A;  4U07 A;  3ULQ A;  1HXI A;  3PEV B;  5ENT D;  3NB2 A;  1Y6I A;  4AEZ C;  2QZA A;  4J6I A;  4XKC A;  2LNI A;  5HS0 A;  2J4D A;  3P1U A;  2WM9 A;  3Q7F A;  3B7U X;  5EN5 D;  4WWN A;  4UQX A;  4GPK A;  3T8K A;  3DSV A;  3ASN E;  3KEZ A;  3UXG A;  2YHE A;  3CKB A;  4BX9 A;  4UI9 C;  2Q7F A;  2J9Q A;  3Q5M A;  2GRR B;  2R02 A;  5A23 A;  5FQ6 A;  2YQ8 A;  5FIO A;  2C2L A;  1PC2 A;  4H7X A;  1INZ A;  3OAW A;  3ULE G;  1TNU A;  4FU3 A;  2CFU A;  3LDZ A;  3HXF A;  2VSO E;  4N3B A;  1E8Z A;  3C98 A;  4KYO B;  3SBS A;  1SVX A;  3SGH A;  5T4Y A;  3CSF A;  4PS3 A;  2CHW A;  2DZO A;  3C3R A;  2F37 A;  4JW1 A;  2WXJ A;  5CCM A;  4U95 D;  4RVB A;  3UKU G;  3IV0 A;  3CVX A;  4DX5 D;  4P29 A;  3QAR A;  3SY2 A;  2IY0 C;  2V5Q C;  4FAD A;  2XEE A;  5BXO A;  4L7T A;  2LO6 A;  3I4G A;  2IO2 C;  3PZ4 A;  5DBK A;  1KZP A;  3SZ7 A;  3F6Q A;  2XS1 A;  4FJZ A;  2P9S G;  2WXM A;  3OXL A;  1UN8 A;  2AWI A;  4GTR A;  2R03 A;  3FWV A;  3U64 A;  3ZW3 A;  4C0E A;  4G2V A;  2GRO B;  1NZN A;  2J09 A;  2AXU A;  2ZGD A;  1HE8 A;  3FY4 A;  2QYU A;  2XHE A;  1S70 B;  3MV3 B;  5ENO D;  4HRN A;  1YMP A;  5G2N A;  5AQ7 A;  2ZIR A;  3UMV A;  3V2O A;  3CIA A;  4DI4 A;  2VTB A;  3I4R B;  4KT6 B;  5A7D B;  3PS6 A;  5A6C A;  2V4L A;  1H19 A;  4WUY A;  1N4P A;  4BWR A;  5C1D A;  2WXG A;  4ILG A;  4FC8 A;  3S7D A;  4XIF A;  4G1T A;  3IHV A;  3TG4 A;  5LOZ A;  2I6H A;  4LNG A;  2VTB B;  3FU3 A;  5EIB E;  2P2C P;  1B89 A;  3CVW A;  3PRZ A;  4WNE A;  1RZ4 A;  2XCC A;  1BI7 B;  4AOF A;  1BI8 B;  3FTS A;  4NUR A;  2BF0 X;  4FHJ A;  4UQY A;  1LTX A;  3NOG D;  3GW4 A;  4Q94 A;  3IKO B;  4ATG A;  4HOT A;  3ZUV B;  2ETC A;  4GCN A;  4G26 A;  2HR2 A;  3D9M A;  5ENP D;  3VLE A;  2BED A;  1TJF A;  2F8Y A;  1NFI E;  1N9A A;  3MJW A;  2P9I G;  2RG8 A;  2HO1 A;  3BG0 B;  3FUK A;  2NYJ A;  1E8Y A;  5G55 A;  3MKQ A;  5KJK A;  1X5B A;  4FP7 A;  3FTW A;  2XS8 A;  1OCO E;  2J49 A;  3L16 A;  3TXM A;  1E90 A;  4EHM A;  3QWW A;  1IHG A;  2WQH A;  5AJL A;  4EBA A;  2J07 A;  3MKQ B;  4YND A;  4CRW A;  1ZB1 A;  3CVP A;  3D9N A;  5AAO A;  3GZS A;  1TJC A;  3UQ3 A;  4HVB A;  3FH7 A;  3O48 A;  2WXQ A;  3C72 A;  3Q15 A;  1XGW A;  5IY5 E;  1E7V A;  3D9J A;  2AXZ A;  1H6O A;  1OWL A;  4MBG A;  3IHY A;  1UJJ A;  5BPP A;  4Y6C A;  5E75 A;  1AWC B;  4ACL A;  5JJ6 A;  1KPS B;  4DX1 A;  2L6B A;  5J90 A;  2I2O A;  3ABK E;  3DSW A;  1N4Q A;  3UIO C;  4N2Q A;  3UX4 A;  3HVE A;  3TL5 A;  4HRL A;  4Y6W A;  2IF4 A;  3C5R A;  5AQA A;  1E8W A;  4U7E B;  5CED B;  3CV0 A;  4QFV A;  4ILI A;  5CMY A;  4ABN A;  5JMN D;  3B95 A;  4GZ5 A;  2PZI A;  3UUX A;  2MYO A;  3FUM A;  5T8I A;  5CCL A;  4HI9 A;  3HVE B;  3OXF A;  4MRU A;  3C3Q A;  3DXM G;  3UTM A;  3LYA A;  3UKR G;  4PUC A;  2ZIS A;  3UIP C;  3EHM A;  4D10 C;  1NA3 A;  3D3M A;  2PQR A;  3UIN C;  3P2B A;  3RIB A;  2LSU A;  2PM7 A;  2XPZ A;  3ASG A;  2XGO A;  3ZKJ A;  3APF A;  4I17 A;  3EIQ C;  4HLE A;  4UWF A;  2AVP A;  3L82 A;  1UJK A;  3ESK A;  1HG5 A;  2XGS A;  3Q79 A;  4XX5 A;  2VYI A;  3SNX A;  4LUN U;  4GYW A;  4GAA A;  2JAB A;  2RFM A;  3ABL E;  1H0A A;  1SA5 A;  4GML A;  4A3V A;  5CBO A;  5J08 A;  3S2A A;  2IOL A;  3HIZ A;  2PNN A;  4WND A;  3TXN A;  2KBX A;  4RSY A;  2RD0 A;  3BQO A;  1KT1 A;  4GMR A;  4MKT A;  3SF4 A;  1NL4 A;  4JHJ A;  3FHE A;  3T5V A;  1EYH A;  4F6R D;  2VGX A;  4BT9 A;  2Y3A A;  3CLJ A;  3SI5 A;  2DIW A;  1K1B A;  3LVR E;  1TNY A;  5G04 J;  4JXT A;  2A4Z A;  2J4B A;  1Z3Y A;  3HXC A;  3VLF A;  5B3S E;  5C2Y A;  4XI9 A;  3APC A;  4F53 A;  4TUM A;  2KCL A;  2VGX B;  4GA2 A;  3LY9 A;  2VGE A;  3JQ0 A;  4J8Y A;  4GYY A;  3RK6 A;  4APF A;  2OND A;  4EZK A;  4K5B A;  3ZYL A;  3KSQ A;  2OCC E;  4UUC A;  2VQ2 A;  5AN8 A;  3CST A;  1HG2 A;  4GPM A;  5CEA A;  3ZXS A;  1KZO A;  4XI0 A;  4AJW A;  3TGO A;  4K03 A;  1ZBP A;  3BU8 A;  1IKN D;  2CG3 A;  3ZNG A;  5FIN A;  2UY1 A;  2NC9 A;  4WAF A;  2P9L G;  3RAU A;  1MX2 A;  3DST A;  3JCK C;  3DSS A;  4C0M A;  4IN3 B;  2WXH A;  1MQS A;  4ANV A;  4B89 A;  2KXP C;  3FH5 A;  2EQX A;  3U4T A;  3D9P A;  4APO A;  1HS6 A;  4IUL A;  1N95 A;  3ZEF A;  4GTM A;  3CVQ A;  2UY1 B;  3FTZ A;  3GZ1 A;  2KAT A;  1JUQ A;  4J7W A;  1FCH A;  3ZN3 A;  1UG3 A;  3W9F A;  3QJZ A;  1O1S A;  4UWL A;  2V8S E;  1H6P A;  3Q75 A;  4X8Q A;  2NSZ A;  4F3V A;  1EPU A;  4U8H A;  4CGV A;  3KSL A;  3FUE A;  4DX2 A;  1P5Q A;  4ATZ D;  1QZ2 A;  3IEG A;  1O5M A;  2GRM A;  4CDM A;  4JZY A;  4Z68 A;  3SFY A;  2DZN A;  2XPI A;  3MZL B;  4GYO A;  3L13 A;  3CVY A;  2B0O E;  3PE3 A;  2FF4 A;  3NZS A;  3FU0 A;  4JPS A;  5D66 A;  4BET A;  3SQV A;  1SQM A;  3AG1 E;  4JC8 A;  1OUV A;  2BTD A;  3JXI A;  3PVL A;  4DLQ A;  3CHQ A;  2LUH A;  3ONL A;  4L23 A;  2F0Y A;  2EIM E;  1TEZ A;  4LER A;  5LCW C;  2XEN A;  4GA0 A;  4GZ3 A;  1XNF A;  5EIL A;  4O1O A;  2DBA A;  3DSX A;  3TWV A;  2Y4T A;  4GTQ A;  1AP7 A;  1BLX B;  4LNB A;  2X6I A;  2DVW A;  2ILR A;  4L1B A;  3LY7 A;  2OVB A;  4B0Z A;  1IXV A;  5BW8 C;  1KT0 A;  2AXV A;  3KEA A;  4E85 A;  2OOE A;  3ZFW A;  4CCA A;  4E6H A;  3CQC B;  5FTP A;  1ZU2 A;  4L2Y A;  3FU5 A;  3CHR A;  3G2V A;  4HRM B;  4I2Z A;  4ANW A;  3KD7 A;  2Y0B G;  3CK8 A;  4G8K A;  3EHN A;  1ELR A;  4G8L A;  4IRU A;  2H6F A;  3AJI A;  4WWP A;  3G2U A;  3OXG A;  3NBN B;  1HFA A;  4U0Z A;  4UWG A;  5EYL A;  3TG5 A;  1Z5S C;  3CQG B;  3DEO A;  4AIF A;  4KXK B;  2WQ7 A;  4R7L A;  1QQE A;  2OEW A;  2Y4U A;  4H7Y A;  1Q2Z A;  4N2S A;  3MGB A;  1HZ4 A;  3ISM C;  3EJN A;  2B6C A;  1HH8 A;  1S0P A;  2XRY A;  4UWH A;  3Q7A A;  5FZQ A;  3RSE G;  4BT8 A;  4PH4 B;  4M3O A;  3HRA A;  2GGF A;  2XQ0 A;  3FUN A;  3L9T A;  1TN8 A;  3AU4 A;  4GCO A;  5EKQ D;  1OCZ E;  4O1P A;  2R5S A;  2AJA A;  3RRN B;  3X2Q E;  1N0R A;  1IQR A;  5EDS A;  3J5P A;  1OY3 D;  3SO8 A;  4N5C A;  4AV7 A;  2V0P A;  4I43 A;  3PDN A;  3TAX A;  3ABM E;  1K1A A;  1N52 A;  1MJ0 A;  1A17 A;  5CRV A;  4DX7 D;  4YDW A;  4ACK A;  1BPO A;  5JHA A;  2PM6 A;  3T5X A;  3MCX A;  3E37 A;  2R2L A;  2IU1 A;  2CHZ A;  2WQ6 A;  4J8E A;  3U3W A;  2VSN A;  4CT0 A;  4NQ0 A;  2FUL A;  2BKG A;  2XEV A;  2CHX A;  4AVX A;  4OYS A;  2QY7 A;  4FLH A;  4HI8 A;  2L0I A;  3TWU A;  3QB2 A;  2RKK A;  3UT7 A;  4BTB A;  3LS8 A;  1O1R A;  4W9R A;  4GTO A;  1DNP A;  1FT2 A;  4FUL A;  4JHK A;  3V30 A;  1TNZ A;  5ANR A;  1U3C A;  5ENS D;  3QC1 A;  3JXJ A;  3FUL A;  3T9K A;  4CGW A;  2J8S D;  4HLL A;  5AAR A;  1QNF A;  4DI3 A;  2WXL A;  4U8Y D;  4N3C A;  4J8D A;  3FFL A;  5CRU A;  4K5A B;  3PNL B;  3V2X A;  4GZ6 A;  3TWT A;  5B1A E;  4HB5 A;  4ZFH A;  1OWP A;  2OEV A;  4MLP A;  2L6J A;  4U96 D;  5M72 A;  3TJP A;  2L9B A;  2P9P G;  2WXN A;  2WMO A;  1JPL A;  5AQB A;  3W9G A;  1Z3X A;  3DPD A;  3UT4 A;  4K5C A;  4M7C A;  1KLX A;  4OVU A;  3FUJ A;  2EIJ E;  1X81 A;  3CR3 A;  4CZ2 D;  3E32 A;  3FTV A;  4A3T A;  1UN9 A;  3HG0 D;  1TN6 A;  3SD5 A;  2FO1 E;  3S7B A;  2GRP B;  4HXI A;  1H2V C;  4HOR A;  4IYP A;  3FP3 A;  4WNG A;  5KNH D;  2OVF A;  1BD8 A;  2WPV A;  3N71 A;  3UM3 A;  2QYJ A;  4C48 B;  3ZHE A;  2FEZ A;  4ILH B;  5FJY A;  5KCM A;  2KC7 A;  4XEI G;  1JCS A;  1MYO A;  3EU5 A;  3FUD A;  3L08 A;  2E0I A;  1S63 A;  4A1S A;  1NA0 A;  3URZ A;  3RO2 A;  5EX0 A;  3FTX A;  2HE0 A;  2IO3 C;  3Q47 B;  3ZHE B;  4CYM D;  2IOS A;  1Y8M A;  4BER A;  1DCE A;  3SFZ A;  1TYQ G;  5D2M C;  5CMW A;  5FQ8 A;  5JHB A;  2IFU A;  3L54 A;  3WXX A;  2MRI A;  3B7B A;  3L6A A;  1OCR E;  3KAE A;  4I1M A;  2PQN A;  2QFC A;  4JD2 G;  2WXR A;  2WXF A;  4AY5 A;  3Q9N C;  2XEH A;  3EUV A;  3E4B A;  2H6I A;  4ANU A;  3UM1 A;  1TR4 A;  3BUA A;  1EF1 C;  1OWN A;  3UM2 A; 
#chains in the Genus database with same CATH homology
 3SHF A;  3FTZ A;  3OXL A;  5G05 J;  3GZ1 A;  4DJA A;  2KAT A;  1UN8 A;  1JUQ A;  3AS8 A;  2AW6 A;  4U0S A;  2AWI A;  4AM9 A;  1EDU A;  3RRM B;  1FCH A;  3FWV A;  3U64 A;  3ZN3 A;  3ZW3 A;  1UG3 A;  2J08 A;  4I2W A;  3QJZ A;  4C0E A;  3ASD A;  4UWL A;  2V8S E;  3NF1 A;  4BSX A;  4G2V A;  4F3V A;  2NSZ A;  2MOW A;  1NZN A;  1EPU A;  4U63 A;  2I1J A;  2XCB A;  4U8H A;  4CGV A;  2J09 A;  4EPZ A;  3FUE A;  2AXU A;  1P5Q A;  2WXP A;  3ZYQ A;  1HE8 A;  3FY4 A;  1QZ2 A;  3IEG A;  4O6F A;  2GRM A;  4ANX A;  2XHE A;  4N3A A;  4B8C B;  4I6J A;  5HI7 A;  3RO3 A;  4CDM A;  4JZY A;  3NQP A;  4JEH A;  3MV3 B;  4CDN A;  4UQZ A;  2ION A;  4EQF A;  3FTY A;  5AYW D;  2XPI A;  3MZL B;  5G2N A;  4GYO A;  3L13 A;  4V3I A;  3CVY A;  2E2E A;  3PE3 A;  2X6K A;  5EX3 A;  2WVI A;  3CK7 A;  3UMV A;  3U66 A;  2FF4 A;  3NZS A;  4RG6 A;  3FU0 A;  4JPS A;  3LVQ E;  3QWP A;  4JHR A;  2IQC A;  2R17 C;  1SQM A;  3CIA A;  4DI4 A;  4JC8 A;  2VTB A;  1OUV A;  2BTD A;  3ML8 A;  4K0R A;  3PVL A;  5BUZ A;  3I4R B;  4DLQ A;  4KT6 B;  4I9C A;  3QKY A;  5FQ4 A;  1N54 A;  3PS6 A;  3PH0 C;  3CHQ A;  5A7D B;  5BNW A;  5A6C A;  2WMN A;  4N39 A;  2V4L A;  3LCA A;  3ONL A;  1H19 A;  4L23 A;  2KM4 A;  4WUY A;  5AEN A;  3CVU A;  5LCW J;  4UI9 J;  5FZS A;  1TEZ A;  4LER A;  4BWR A;  5C1D A;  5LCW C;  2WXG A;  4GA0 A;  2KZT A;  1HU3 A;  4GZ3 A;  5FWQ A;  3FUF A;  4ILG A;  1XNF A;  4FC8 A;  3S7D A;  2M63 A;  4XIF A;  3LPZ A;  1E8X A;  3IHV A;  4G1T A;  2FBN A;  2DBA A;  3TG4 A;  5LOZ A;  2BUG A;  3QAQ A;  4L2L A;  4LCT A;  5FQ7 A;  2X6F A;  2I6H A;  5FT9 A;  4URK A;  2Y4T A;  2VTB B;  3FU3 A;  3IBE A;  4I1A A;  1WAO 1;  2C0M A;  5LX8 A;  4GU5 A;  1B89 A;  2X6I A;  3CVW A;  3PRZ A;  2ILR A;  4WNE A;  3CVL A;  4L1B A;  3LY7 A;  2OV8 A;  2OVB A;  2XCC A;  4B0Z A;  5FZR A;  4AP2 A;  1FVH A;  5BW8 C;  4AOF A;  1KT0 A;  3FTS A;  3Q49 B;  3R7Q A;  2KZT B;  3CHO A;  2AXV A;  4E85 A;  4I6E A;  4NUR A;  2BF0 X;  2OOE A;  2P58 C;  2HM8 A;  3ESL A;  4FA6 A;  5JJT A;  3FDH A;  4FHJ A;  3ZFW A;  1JWG A;  3HDX A;  4UQY A;  4CCA A;  4AXH A;  4E6H A;  3MA5 A;  3BG1 B;  3CQC B;  5AJD A;  5FTP A;  3CVV A;  1ZU2 A;  4L2Y A;  3GW4 A;  4I6G A;  4Q94 A;  4CEM A;  3FU5 A;  3CHR A;  4JL0 A;  3IKO B;  5BV1 A;  4ATG A;  3G2V A;  4HOT A;  4Q96 A;  5D0O D;  4I2Z A;  4ANW A;  3KD7 A;  4GCN A;  4G26 A;  2HR2 A;  3D9M A;  3FH8 A;  3CK8 A;  3EHN A;  5LP0 A;  4OVV A;  5CHE E;  3U9W A;  3PEU B;  1PY1 A;  4PS7 A;  3ZIM A;  3VLE A;  1TJF A;  1ELR A;  4BY6 A;  4IRU A;  5D0Q D;  4PS8 A;  4WWP A;  3G2U A;  3MJW A;  3OXG A;  1HFA A;  2RG8 A;  2VGY A;  2HO1 A;  3BG0 B;  1H2U A;  4U0Z A;  4UWG A;  3FUK A;  3I3N A;  2ZU6 B;  3TG5 A;  1E8Y A;  3ASF A;  3CQG B;  3JUI A;  4GB9 A;  4UI9 K;  5G55 A;  5BT1 A;  3UT8 A;  3MKQ A;  5KJK A;  1X5B A;  4AY6 A;  4AIF A;  4KXK B;  4FP7 A;  2MHK A;  3APD A;  3CHM A;  4JEU A;  2WQ7 A;  3FTW A;  3MX3 A;  4R7L A;  4BX8 A;  5ARF A;  1QQE A;  2J49 A;  3L16 A;  3TXM A;  4F7A A;  2Y4U A;  1Z6T A;  1E90 A;  4H7Y A;  4TV3 A;  3R9A B;  3QDN A;  3QWW A;  4U0U A;  1IHG A;  3MGB A;  4N2S A;  1HZ4 A;  1IQU A;  2WQH A;  3EJN A;  3EIJ A;  4JA9 A;  1HH8 A;  1YA0 A;  1S0P A;  2XRY A;  5AJL A;  4UWH A;  2I9C A;  1W3B A;  3S7F A;  3VTX A;  4Q69 A;  4EBA A;  2J07 A;  3MKQ B;  5JJ7 A;  4YND A;  5FZQ A;  4CRW A;  4HOS A;  4BT8 A;  4PH4 B;  4M3O A;  4DPR A;  5BV0 A;  3CVP A;  3SBT B;  2WXO A;  3FTU A;  2GGF A;  2XQ0 A;  3FUN A;  3PE4 A;  3D9N A;  1OWO A;  4GMJ A;  3AU4 A;  3GZS A;  3K9I A;  4GCO A;  5EKQ D;  2IJG X;  1TJC A;  3UQ3 A;  3AU5 A;  3PZD A;  3ZPJ A;  4HVB A;  2R5S A;  2HYZ A;  3DBS A;  2WXQ A;  3FH7 A;  3O48 A;  4BFR A;  3Q15 A;  1H2T C;  3B7R L;  3FEY A;  3L17 A;  4KMO A;  2A5U A;  1XGW A;  2LAI A;  1E7V A;  2FI7 A;  3D9J A;  3OTN A;  2AXZ A;  3LJ3 A;  3ML9 A;  3D9O A;  4CT4 A;  5KJL A;  3RRN B;  4FJY A;  1OWM A;  2YHC A;  1OWL A;  3ASH A;  3IHY A;  1UJJ A;  1IQR A;  3ZYK A;  5BPP A;  5EDS A;  1MHQ A;  1IYG A;  3ENE A;  4Y6C A;  4FLB A;  4N5C A;  4LEU A;  2V0P A;  3CKC A;  3PDN A;  4I43 A;  5E75 A;  3TAX A;  4AV7 A;  2X6H A;  3JYS A;  4XE0 A;  2UWJ G;  3RRU A;  4ACL A;  5JJ6 A;  1N52 A;  3D9I A;  2NXP A;  4I1O B;  1A17 A;  4G23 A;  5G04 C;  4KVO A;  5J90 A;  2JLB A;  2I2O A;  2JEK A;  3G2W A;  1WM5 A;  4J0U A;  4TRQ A;  4N2Q A;  3MKR A;  4ACK A;  3FU6 A;  1ELW A;  1BPO A;  5JHA A;  3UX4 A;  2PM6 A;  3T5X A;  3MCX A;  3HVE A;  4EZL A;  1FVF A;  3BEE A;  3ZVV A;  4XZ4 A;  2WXK A;  4G25 A;  3TL5 A;  5KJM A;  1SZ9 A;  4Y6W A;  2IU1 A;  2IF4 A;  2CHZ A;  1SZA A;  2L0T B;  1E8W A;  2WQ6 A;  1VDY A;  3ONK A;  3CHS A;  4J8E A;  2X38 A;  4EBA G;  2VSN A;  3U3W A;  4F1S A;  3CV0 A;  3L22 A;  4QFV A;  3LEW A;  3MYV A;  4YVQ C;  5ANL A;  3ZRH A;  1E96 B;  4J8S A;  4CT0 A;  3Q4A B;  4UWK A;  4NQ0 A;  3VLD A;  5DIZ A;  4BTA A;  3NZU A;  4ILI A;  3MEK A;  5CMY A;  1HF8 A;  2FUL A;  4ABN A;  4A55 A;  3PNT B;  5KJN A;  1U3D A;  3B13 A;  2VJ8 A;  3CHP A;  4GZ5 A;  3ZYM A;  2XEV A;  2CHX A;  4AVX A;  4WNF A;  4OYS A;  2QY7 A;  5ARG A;  2PZI A;  3PUJ A;  4FLH A;  4HS2 A;  2PL2 A;  3UUX A;  3FUM A;  5T8I A;  4C9B B;  2L0I A;  4GZC A;  2CFZ A;  3HVE B;  3OXF A;  4MRU A;  5CCL A;  5LFA A;  3QB2 A;  3UT7 A;  4BTB A;  3LS8 A;  4GA1 A;  3LYA A;  2X3M A;  4WWO A;  4PUC A;  4HOQ A;  4W9R A;  2KCK A;  2YNQ A;  3EHM A;  4D10 C;  1NA3 A;  4DLO A;  1DNP A;  4FUL A;  3LKU A;  3D3M A;  4A1G A;  2PQR A;  2V5F A;  3LY8 A;  4EZJ A;  4JHK A;  3RU0 A;  4NAC A;  5ANR A;  3P2B A;  1E7U A;  2VSY A;  3RIB A;  1U3C A;  2LSU A;  1L5J A;  2PM7 A;  2I1K A;  3ASG A;  2XPZ A;  3T8M A;  2DCP A;  3QC1 A;  3HHM A;  4HOU A;  2XGO A;  4EEC A;  3APF A;  3FUL A;  4I17 A;  3FEX A;  2CG2 A;  4I9E A;  4CGW A;  3EIQ C;  4HLE A;  4DK5 A;  4HFG A;  4UWF A;  2AVP A;  5E76 A;  5T3R A;  1QNF A;  4DI3 A;  1UJK A;  2WXL A;  1UW4 B;  3G2T A;  3QWV A;  3ESK A;  1PAQ A;  3RKV A;  3ZGQ A;  4N3C A;  4J8D A;  1HG5 A;  2XGS A;  3FFL A;  3LXU X;  3PNL B;  3FUI A;  4GZ6 A;  3GYZ A;  4XX5 A;  1LF8 A;  1WY6 A;  2VYI A;  4KVM A;  3SNX A;  4J8F A;  3EDT B;  4FHK A;  4LUN U;  4GYW A;  1H6K A;  1OWP A;  3G2S A;  4GAA A;  5ENN A;  2XRZ A;  4XKB A;  1HX8 A;  4MLP A;  2L6J A;  5G05 C;  1ELK A;  1H0A A;  5M72 A;  3TJP A;  3B7S A;  4GML A;  4A3V A;  3UPV A;  2L9B A;  2WXN A;  2WMO A;  1JPL A;  3CEQ A;  3RJV A;  5AIJ A;  3B7T A;  5J08 A;  3S2A A;  2IOL A;  3HIZ A;  3CK9 A;  4MS6 A;  4GZD A;  4TUU A;  2XPY A;  4ME2 A;  4KZC A;  1Z3X A;  2GW1 A;  3DPD A;  3UT4 A;  4WND A;  4NRH B;  3TXN A;  4RSY A;  1KLX A;  2RD0 A;  4OVU A;  3FUJ A;  1JWF A;  4G11 A;  1KT1 A;  4MKT A;  4B8A A;  3CR3 A;  3SF4 A;  4U07 A;  4JHJ A;  3FHE A;  3T5V A;  2KCV A;  3FTV A;  4A3T A;  1EYH A;  1UN9 A;  3ULQ A;  1HXI A;  3PEV B;  2VGX A;  4G24 A;  3SD5 A;  1Y6I A;  4AEZ C;  4BT9 A;  2Y3A A;  4U04 A;  3CLJ A;  4J6I A;  3SI5 A;  2DIW A;  4XKC A;  3LVR E;  2LNI A;  5G04 J;  4JXT A;  2A4Z A;  2LAH A;  2J4B A;  1Z3Y A;  2J4D A;  3VLF A;  3S7B A;  2WXI A;  3P1U A;  3QK0 A;  4XI9 A;  2WM9 A;  5C2Y A;  3APC A;  4HXI A;  3B7U X;  1H2V C;  4F53 A;  1NP7 A;  4HOR A;  4IYP A;  2GRL A;  4UQX A;  3JQ1 A;  4WWN A;  2KCL A;  4GPK A;  3GZ2 A;  3FP3 A;  1GW6 A;  4WNG A;  2OVF A;  3KEZ A;  3CGH A;  2VGX B;  2WPV A;  3N71 A;  2C0L A;  2YHE A;  3CKB A;  3LY9 A;  4GA2 A;  4BX9 A;  4KZ0 A;  4UI9 C;  3ZHE A;  2Q7F A;  3HYM B;  2FEZ A;  3JQ0 A;  2J9Q A;  3PRE A;  4GYY A;  4ILH B;  3RK6 A;  3QNK A;  5FJY A;  4APF A;  2FO7 A;  2OND A;  5KCM A;  2KC7 A;  4EZK A;  3Q5M A;  3VTY A;  3ZYL A;  5A23 A;  3FUD A;  5FQ6 A;  3L08 A;  2YQ8 A;  2E0I A;  2VQ2 A;  3D9L A;  1HO8 A;  2C2L A;  1PC2 A;  4H7X A;  1INZ A;  4A1S A;  1NA0 A;  3CST A;  3OAW A;  3URZ A;  1HG2 A;  4YVO A;  3RO2 A;  3R7R A;  3CVN A;  4FU3 A;  2LSV A;  5EX0 A;  2CFU A;  3LDZ A;  3ZXS A;  3FTX A;  3FUH A;  2VSO E;  3Q47 B;  4XI0 A;  3ZHE B;  4AJW A;  3TGO A;  2IOS A;  1E8Z A;  1ZBP A;  4K03 A;  2R59 A;  1Y8M A;  4N3B A;  3C98 A;  3O4Z A;  3SFZ A;  4KBQ A;  2CG3 A;  3S7J A;  2YIN A;  4KYO B;  3SBS A;  3I5P A;  5CMW A;  3KS2 A;  5FQ8 A;  3SGH A;  5T4Y A;  5JHB A;  3CSF A;  3AS5 A;  2IFU A;  4PS3 A;  2UY1 A;  2CHW A;  3D9K A;  4JW1 A;  2NC9 A;  5HQ8 A;  2WXJ A;  4WAF A;  3L54 A;  5CCM A;  3AS4 A;  3JCK C;  3MV2 B;  2VSX E;  3WXX A;  4RVB A;  3CVX A;  2MRI A;  2X6J A;  3IV0 A;  3L6A A;  4C0M A;  1DVP A;  3KAE A;  4CDR A;  3PUK A;  4I1M A;  4IN3 B;  4P29 A;  3QAR A;  2PQN A;  1MQS A;  2WXH A;  2QFC A;  4ANV A;  4B89 A;  4JVS A;  2WXR A;  3FH5 A;  2EQX A;  2WXF A;  4FAD A;  4AY5 A;  4L7T A;  3U4T A;  4PDX A;  2XGM A;  3D9P A;  2LO6 A;  3QOU A;  3I4G A;  4RG9 A;  4B94 A;  4APO A;  1HS6 A;  5DBK A;  3E4B A;  4IUL A;  4JA7 A;  4ANU A;  3ZEF A;  3CVQ A;  3SZ7 A;  4LRZ A;  2UY1 B;  4FJZ A;  2WB2 A;  1EF1 C;  1OWN A;  2WXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...