3ABLE

Bovine heart cytochrome c oxidase at the fully oxidized state (15-s x-ray exposure dataset)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
104
structure length
104
Chain Sequence
ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ablE00
5B1AE 3ABLE 3X2QE 2EIKE 1OCCE 5B3SE 2Y69E 5B1BE 3WG7E 2DYRE 3AG2E 3AG4E 2EIJE 3ABKE 1OCRE 3AG3E 3AG1E 2EILE 1V54E 2EIME 1V55E 1OCZE 3ABME 3ASOE 2EINE 5IY5E 2OCCE 2ZXWE 2DYSE 1OCOE 3ASNE
chains in the Genus database with same CATH superfamily
3B7RL 2WXPA 2PM7A 4FADA 4AM9A 2VTBA 5FQ4A 2AW6A 5EILA 2ETAA 3HXDA 2WXQA 5C2YA 3PVLA 4IRUA 1NFIE 5IY5E 1BI8B 1HH8A 2A5EA 3ASDA 3BEEA 4FC8A 4ME2A 1N4RA 4OVVA 4M3OA 5KBAA 1EYHA 1INZA 2YNQA 4MS6A 1N4PA 2GRLA 5JHBA 1DC2A 1X81A 3J5QB 5EX3A 5FQ6A 5CRVA 1BI7B 3DEPA 4CEMA 1H6OA 4FLBA 3HXBA 2EIJE 4BERA 2J9QA 4AIFA 3ML9A 4K5BA 3SBSA 2F8YA 1E8ZA 2MHKA 3MKRA 1JCQA 4TUMA 2BEDA 3QWPA 1E7UA 3E34A 4UI9J 3LCAA 4RQIA 5JMND 4LEUA 1HG2A 5HI7A 3LY7A 1KT0A 2BF0X 5ENSD 3S7FA 3L22A 3LJNA 3CSFA 2PL2A 1MJ0A 4AEZC 5EIDA 3MEKA 5G2NA 3LVRE 2IONA 1QZ2A 2R5SA 2M63A 3L82A 3NQPA 1DCQA 1HF8A 2ZIRA 2FF4A 4HBDA 3FUJA 2KM4A 1G3NB 4GMLA 5KWDA 4EZJA 3C5RA 2BUGA 1SW6A 3HXFA 4EPZA 5BXOA 1N94A 5FWQA 4MKTA 3E4BA 3QWWA 3DPYA 3UM1A 1N0QA 3BU8A 2YINA 2WB2A 3EU9A 4CGWA 2J8SD 4UWHA 4YDEA 2RD0A 2PM6A 3E37A 3FH8A 4Q94A 5ARGA 2OVBA 5LCWJ 1HO8A 1OXJA 4TRQA 4BT8A 4J8DA 4B89A 2WQ7A 4GMRA 1V54E 1MYOA 2WXHA 1OCZE 2L0TB 5ENPD 2X6HA 2P9IG 3JUEA 3CHRA 3NOGD 4G8LA 4DPRA 2IY0C 4MLPA 4G26A 2QZAA 5EDSA 5CCLA 1KZPA 2KZTA 3PZ3A 2XRYA 4ILIA 3DXMG 4CDMA 1DNPA 2WPVA 3FTZA 4JEUA 1IXVA 1UN9A 3JQ0A 1P5QA 1JUQA 3PEUB 1VDYA 2XENA 1HZ4A 2PNNA 4WNGA 2EIME 3U4TA 4HOTA 1ELKA 2LO6A 3R9AB 3HVEB 1XNFA 3PDNA 3V2OA 2WMNA 2B0OE 5CBOA 1K3ZD 1H2TC 3FH7A 3HDXA 2VTBB 3RU0A 3CSTA 3CVWA 3EHQA 1TEZA 5HRYA 1E7VA 4UQXA 4BSXA 4PS3A 4DX5D 4F6RD 2QYUA 4P29A 5LOZA 2CHZA 2XPZA 4C0MA 4ILHB 4LNUD 3O48A 4H7YA 3L08A 3RIBA 2X3MA 2WVIA 3MGBA 3L9TA 3LKUA 3TL5A 4PS8A 4JZYA 5DBKA 5G04J 2ZGGA 3TGOA 3B13A 2OEWA 5AQAA 4XEIG 3CEQA 4U8VD 2I2OA 3RO2A 3Q5MA 4G8KA 1H6KA 1A17A 2ONDA 5ANRA 4HI9A 2WMOA 3ZN3A 1Q2ZA 4BFRA 3Q49B 5FJYA 3CVQA 2HYZA 2FO1E 4WWNA 2A5UA 5ITZF 3L6AA 4CDNA 4AP2A 2ETCA 4I9EA 3FY4A 3FUIA 5BPPA 5LX8A 1S63A 3TG4A 1WM5A 3LEWA 3CLJA 3QK0A 3TJPA 1OCOE 2LSVA 3FUNA 5FINA 2WQHA 4O1OA 3FFLA 3SFZA 4HS2A 2BTDA 1MZCA 1TNZA 2H6GA 2YHEA 2P9KG 3FU6A 3LYAA 4KZCA 4GAAA 4UWKA 4MRUA 2AWIA 4ANXA 3AG4E 3S7DA 5ENRD 3U3WA 3FUDA 4M7CA 3OAWA 3AS4A 2ILRA 4OVUA 2MOWA 2GRQB 2LXLA 3VLDA 4YNDA 1O1TA 3DWLG 1TJFA 4ZHBA 4C48B 1TNYA 1B89A 4FU3A 3ULQA 2NYJA 2YHCA 2GGFA 3CKCA 3CKBA 4A55A 3RKVA 4ACKA 2VSOE 5JHAA 3E33A 4WNFA 2PQRA 4O6FA 4Q96A 3EIJA 2IF4A 4JHJA 1MX4A 4LERA 5BV1A 1FT1A 4GZCA 3BG0B 4I2WA 3TWXA 2GW1A 4IYPA 4IULA 2LAIA 3IBEA 4ILGA 2KZTB 3X2QE 3PRZA 3ENEA 3I4GA 4GCOA 4XI0A 3IXEA 3B7TA 3O4ZA 3D9OA 4GTRA 1TNBA 4G24A 4AY6A 4TV3A 3KD7A 3APDA 4HB5A 3FULA 4BTBA 1N0RA 3DSVA 1K1AA 1U3DA 3CGHA 2ZISA 4XKBA 4AY5A 5BV0A 4BESA 5AQ9A 4U0SA 4G1TA 4DX2A 4LUNU 4Q69A 1S0PA 3ISMC 3OXLA 3FDHA 3RRUA 2R17C 2DYSE 3FUFA 2WXMA 5FQ7A 3ASHA 3C3QA 4FJZA 3T5VA 4A1GA 3PE4A 3IHYA 1JCSA 2JEKA 3UT4A 2XEVA 4HOSA 2IJGX 3V30A 3EIQC 3MV2B 1QYMA 2ZXWE 2Y3AA 1PAQA 4HRLA 1H2VC 4QFVA 3QKYA 4WWPA 4JXTA 4DX6D 3FHEA 3UQ3A 4E85A 4DI3A 2C2LA 3Q7AA 2AVPA 3SGHA 2JLBA 3LJ3A 2ZU6B 4JW1A 4JB8P 4G2VA 3CK9A 5EIBE 3ABLE 3ZXPA 4JD2G 4K0RA 1A5EA 3HXEA 4N39A 4GZDA 2IOLA 3CVLA 2L0IA 2WXLA 4N2QA 1E8YA 4KYOB 2BKKB 2X6JA 5DIZA 3EHMA 4DRXE 3DSWA 5CMYA 4B93B 3D9KA 2WXNA 3ZEFA 2EIKE 2H6IA 2VSYA 3UM0A 2DZNA 4APFA 1ELRA 1TYQG 2HO1A 1H0AA 2DZOA 5BUZA 1SA5A 2CG3A 2LUHA 3ZHEA 1S64A 1MX2A 1UG3A 3NF1A 4KVMA 3IV0A 5EN5D 4AOFA 3LPZA 4DX7D 3PEVB 2XGOA 3EJNA 2PQNA 2FBNA 3KAEA 3HYMB 4EQFA 5CEDB 1IQUA 2AXZA 4BX8A 3ASOE 3KSQA 4KVOA 3QARA 2H6FA 1EDUA 4IN3B 1HFAA 2KCKA 1QQEA 3GZSA 4RVBA 1BPOA 3DPDA 4J7WA 1U2VG 4Z68A 2R59A 2V4HC 2J4BA 4UWLA 3SO8A 4A3TA 2XZDG 5BT1A 1TNOA 2J49A 3VTYA 3ZUVB 5G55A 5CBNA 3AJIA 2I1KA 4GA0A 1E8XA 5ENNA 3FTSA 3R9MA 4AV7A 3LS8A 4TXQA 3KEZA 4UWFA 3G2TA 5KNGA 4ATZD 4ANWA 4HRMB 4EBAA 1WG0A 2OEVA 3EDTB 4XIFA 2XCBA 3JYSA 2IQCA 3Q79A 5ENQD 3SNXA 2J4DA 2HE0A 4U63A 1FVFA 4WAFA 3KEAA 3G2SA 1MHQA 3PUKA 3UTMA 1XGWA 2XHEA 4GA2A 3UMVA 4JEHA 1OCCE 4OYSA 3BUAA 1D9SA 3R7RA 2XQ0A 3FH5A 3Q73A 3FU0A 4APOA 2IU1A 3F6QA 5B1AE 2RFMA 3CVYA 3N71A 4LNGA 1E96B 2XZTG 5E75A 1UN8A 1BU9A 3AG2E 4DI4A 1OWMA 2I1JA 2OV8A 2OOEA 4N5CA 1EF1C 2DVWA 4NIKA 3LDZA 2KCVA 4UI9C 2P9NG 1NL4A 2P9PG 4ATGA 2BKGA 4CRWA 2XS1A 5AQ7A 2KC7A 3CV0A 3I3NA 2MYOA 3FTXA 5G05C 4F3VA 4FHJA 1E8WA 3RAUA 1RZ4A 4UQYA 2R03A 3D3MA 5LFAA 3C98A 4BSZB 3ZIMA 5HS0A 5ENTD 3FEYA 3PZ2A 3ESLA 4KZ0A 3LY9A 3W9GA 4F1SA 4GTMA 1K8KG 4XKCA 2XEEA 5JA4D 1EPUA 5KCMA 3UIPC 1KZOA 4GZ3A 3JXIA 4N3CA 4GTQA 2VGXA 2UY1A 3JQ1A 2PZIA 1WAO1 3U9WA 3FWVA 1OWLA 1PY1A 2CHWA 5AQBA 2R02A 4JL0A 3Q47B 3ULEG 4UQZA 5CERB 2KATA 4DX1A 3DSUA 4N5QA 2UWJG 1O1RA 2H6HA 5ENOD 3FUKA 1RW2A 2WXKA 3ZHEB 5AYWD 5KNHD 5M72A 5ARFA 2WXFA 4GTSA 3D9JA 4J8FA 2CG2A 2CHXA 1K1BA 5JJTA 4HI8A 2IFUA 4EBAG 4B8AA 1TNUA 1LTXA 5H7PA 2J07A 4G11A 4CCAA 2F0YA 3AG1E 2VSXE 1SQMA 4RSYA 2CFUA 1ZB1A 3FTUA 2WXRA 3G2VA 3MX3A 4AXHA 5EKQD 4AVXA 2Y69E 3U66A 3Q9UC 4HVBA 3T5XA 5KJMA 5AAOA 5KJLA 4GCNA 1FCHA 3DBSA 1H2UA 5J08A 2AXUA 3QAQA 3EUVA 4WWOA 4XE0A 3QB2A 4UUCA 4H7XA 1Z3XA 4L1BA 3TWTA 3APFA 4I17A 1KPSB 3CHSA 4E6HA 5B1BE 1ZU2A 2QYJA 4F7AA 4BX9A 5CRUA 3ONKA 3AS5A 5EYPF 1JCRA 3CVPA 4NQ0A 3UKUG 2WXIA 4DLQA 3QJZA 3TWQA 3RSEG 4ABNA 4HNAD 1NZNA 4NURA 5T8IA 1SA4A 2NXPA 4NRHB 2KCLA 3CVUA 3S7BA 3SY2A 2R2LA 5A7DB 3G2UA 4URKA 4FJYA 5EYLA 1TN8A 1FPPA 1Z3YA 5A6CA 3ZU7B 2KBXA 2YQ8A 1PC2A 2R05A 3JCKC 3C72A 2FEZA 5JJ7A 4BEPA 4G23A 2Q7FA 3FU5A 3CHOA 4KMOA 3S2AA 3FU3A 3BG1B 2C0MA 2LSUA 3T9KA 5CCMA 3ABKE 3SF4A 4HLLA 4PDXA 3SD5A 1MX6A 3BQOA 1MQSA 4CT4A 3GZ2A 2J09A 3QNKA 2QY7A 1NA0A 1HU3A 4YVQC 3UX4A 3L17A 2QFCA 5J90A 3UIOC 3PUJA 3D9HA 1N4QA 4BY6A 4I2ZA 4UWGA 4GPKA 2RKKA 2LXMA 2HR2A 4GPMA 2VJ8A 4PS7A 5AN8A 4WNDA 3PZDA 4A63B 3ZW3A 5AENA 3IKOB 4TUUA 2VGXB 2UY1B 3ESKA 3B7UX 4J6IA 4GTVA 3UXGA 4ANVA 3DXKG 4I43A 4JA9A 3SHFA 2WXOA 2VQ2A 2XCCA 3ASFA 3GYZA 4NACA 3B7SA 5FT9A 3FUEA 3JUIA 3K9IA 3NAWA 4K5AB 3AU5A 3AG3E 4FULA 3PNTB 3WXXA 2AXVA 5KJKA 3PREA 2GRMA 3MKQA 1HS6A 4GZ5A 2VGEA 3RK6A 4A3VA 4G25A 1AWCB 3GW4A 2IO2C 3TWUA 2GRPB 2V5QC 4JA7A 4DK5A 4GA1A 4CDRA 1D8EA 1KLXA 2NSZA 4BT9A 3E32A 5EX0A 2DCPA 3TWWA 2JABA 1IKND 4ANUA 4I1MA 3FTYA 5HQ8A 4Y6WA 2L6JA 3MZLB 3OXFA 4GTTA 2RFAA 3CIAA 3QWVA 4HXIA 4CT0A 3FEXA 3AAAC 3CK7A 3RJVA 2WM9A 2XGMA 1OT8A 2NC9A 2B6CA 5D66A 4BETA 5JJ6A 4LRZA 2WQ6A 3Q9NC 4FHKA 2KXPC 4GTPA 3FTVA 4OAUC 4N3BA 2FO7A 4EZKA 1UJKA 3EHRA 4WUYA 1SZ9A 5BW8C 2VYIA 2V5FA 4I1OB 4J8YA 4KXKB 1IYGA 2QC9A 3RRNB 5FZRA 4GYWA 4EHMA 5FIOA 3ZPJA 1ZBPA 2EILE 1N11A 2J08A 3DRAA 1YCSB 4R7LA 4L7TA 4U95D 4F53A 1QNFA 3HG0D 1N54A 4V3IA 3FP3A 3ZYLA 3MA5A 5CECB 4L9PA 4K03A 4CZ2D 2X6IA 4B0ZA 1OWPA 3ZXSA 3P2BA 3MJWA 3QOUA 5AIJA 4FLHA 2X38A 2LAHA 1OUVA 5G05J 2XEHA 1E90A 2RG8A 1HG5A 1YYHA 1UW4B 5LP0A 3CVXA 3HIZA 1S70B 1N95A 4I1AA 1Z6TA 4GB9A 1JWFA 2V0PA 3S7JA 4JVSA 2P58C 3TG5A 5C1DA 1OY3D 1V55E 1IHGA 3FUMA 3L13A 4U96D 4TXRA 3NB2A 3OTNA 2V4LA 3G2WA 4PUCA 2VSNA 4U8HA 3TWRA 4U8YD 2Y4TA 5FQ8A 4JHKA 3ONLA 3W9FA 4X8QA 4UI9K 3CK8A 3HRAA 4FA6A 2E2EA 2Y0BG 4U0ZA 4KBQA 4CYMD 1FVHA 4XZ4A 2P9SG 2A4ZA 3D9PA 3TWVA 2E0IA 4LNBA 2Y4UA 4HFGA 5T4YA 3UM3A 4HRNA 4C9BB 1O5MA 2FI7A 4QQIA 3WG7E 2HM8A 5FTPA 2ZGDA 3NZSA 2EINE 3URZA 1D8DA 1JPLA 1ELWA 2XRZA 3GZ1A 3IHVA 2V8SE 1IQRA 3UKRG 3UPVA 3B7BA 3TWSA 3Q15A 3CQGB 3Q4AB 3ZYKA 5BXUA 3UT7A 3B95A 2XPIA 3ABME 4GTOA 3EU5A 4D10C 2C0LA 2DBAA 1X5BA 3QC1A 2XS8A 3APCA 3CVNA 4A1SA 3NBNB 5T3RA 3CHQA 3ZGQA 4OAVB 3T8MA 4LCTA 3MKQB 3V31A 4FP7A 4BWRA 3OXGA 3ML8A 3FTWA 4GYOA 4B8CB 2DIWA 4AJWA 1OWOA 2OCCE 2ETBA 4HOQA 4K5CA 3J5PA 2LNIA 1TR4A 3DSTA 3LVQE 1KT1A 4RLYA 1UJJA 3C3OA 4L2YA 5LCWC 5BNWA 3CQCB 3UINC 4I6JA 1Y8MA 5FZSA 1YA0A 3NOCD 4HQDA 3UUXA 3ZNGA 2I9CA 3PE3A 1HE8A 3TXMA 3EHNA 1FT2A 3RO3A 5B3SE 3SBTB 4B94A 3UM2A 3V79K 3SFYA 3AS8A 4HOUA 3CHPA 2IOSA 3PH0C 3RRMB 3Q75A 1N4SA 2L6BA 3ZFWA 3I5PA 3CHMA 5CHEE 1L5JA 5AARA 4HLEA 1TJCA 4GZ6A 3ZRHA 5AJDA 2XGSA 4KT6B 2P2CP 3JXJA 4O60A 1H6PA 4U07A 4O1PA 4RG6A 1HX8A 4EZLA 3DEOA 3ULYA 3SZ7A 3D9LA 4N2SA 4U0UA 1N52A 3ZYMA 1LF8A 1O1SA 1OCRE 4JHRA 3CVVA 3T8KA 1TN6A 3HXCA 2Y1LE 3UI2A 4ACLA 2VGYA 2CFZA 3I4RB 3MYVA 3ZVVA 1UOHA 2F37A 3CR3A 1AP7A 4N3AA 2XPYA 5CEAA 3HHMA 1LD8A 2AJAA 1JWGA 1LD7A 3FUHA 3IEGA 1TN7A 4Y6CA 3Q7FA 5D0OD 3SI5A 1GW6A 3VLEA 2IEJA 3LY8A 4MBGA 1HXIA 3R7QA 1WY6A 1NI1A 3ZYQA 4DJAA 2L9BA 1BD8A 2DWZA 4GU5A 4I6GA 5ANLA 3V2XA 5KJNA 4I9CA 4I6EA 3ASGA 4XI9A 4YDOA 3D9IA 5G04C 4GMJA 1NP7A 2WXJA 4XX5A 2F8XK 3P1UA 1YMPA 3PS6A 1OWNA 1DCEA 4YDWA 2P9LG 3D9MA 3PZ1A 1BLXB 3PNLB 2X6KA 1SZAA 3UT8A 4J8EA 4W9RA 3SFXA 3AU4A 3TXNA 3U64A 4C0EA 4ZFHA 4LG6A 3DSSA 4GYYA 2MRIA 3L54A 4WNEA 1W3BA 4PH4B 4EECA 1U3CA 3VLFA 1Z5SC 3TAXA 3VTXA 5A23A 4RG9A 5HKPA 4HORA 4JPSA 4L2LA 2GRNB 3PZ4A 3D9NA 4U04A 1SVXA 2P9UG 4JC8A 3ZKJA 1QBQA 4J0UA 4YVOA 5FZQA 1H19A 2EQXA 2OVFA 3Q78A 4YDYA 1WDYA 1N9AA 2DYRE 2IO3C 3C3RA 1IHBA 2FULA 2I6HA 3QDNA 2WXGA 4TXPA 3SQVA 4CGVA 4BTAA 4F1PA 5E76A 5AJLA 4DLOA 2GROB 2GRRB 1Y6IA 3L16A 4J8SA 4DUIA 4LSZE 1NA3A 3LXUX 3ASNE 1DVPA 3NZUA 3HVEA 4U7EB 3MV3B 3KS2A 4L23A 5D2MC 5CMWA 3MCXA 3E30A 3DSXA 5D0QD 2X6FA 3KSLA
chains in the Genus database with same CATH topology
5B1AE 3ABLE 3X2QE 2EIKE 1OCCE 5B3SE 2Y69E 5B1BE 3WG7E 2DYRE 3AG2E 3AG4E 2EIJE 3ABKE 1OCRE 3AG3E 3AG1E 2EILE 1V54E 2EIME 1V55E 1OCZE 3ABME 3ASOE 2EINE 5IY5E 2OCCE 2ZXWE 2DYSE 1OCOE 3ASNE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B1A E;  3ABL E;  3X2Q E;  2EIK E;  1OCC E;  5B3S E;  2Y69 E;  5B1B E;  3WG7 E;  2DYR E;  3AG2 E;  3AG4 E;  2EIJ E;  3ABK E;  1OCR E;  3AG3 E;  3AG1 E;  2EIL E;  1V54 E;  2EIM E;  1V55 E;  1OCZ E;  3ABM E;  3ASO E;  2EIN E;  5IY5 E;  2OCC E;  2ZXW E;  2DYS E;  1OCO E;  3ASN E; 
#chains in the Genus database with same CATH topology
 3B7R L;  2WXP A;  2PM7 A;  4FAD A;  4AM9 A;  2VTB A;  5FQ4 A;  2AW6 A;  5EIL A;  2ETA A;  3HXD A;  2WXQ A;  5C2Y A;  3PVL A;  4IRU A;  1NFI E;  5IY5 E;  1BI8 B;  1HH8 A;  2A5E A;  3ASD A;  3BEE A;  4FC8 A;  4ME2 A;  1N4R A;  4OVV A;  4M3O A;  5KBA A;  1EYH A;  1INZ A;  2YNQ A;  4MS6 A;  1N4P A;  2GRL A;  5JHB A;  1DC2 A;  1X81 A;  3J5Q B;  5EX3 A;  5FQ6 A;  5CRV A;  1BI7 B;  3DEP A;  4CEM A;  1H6O A;  4FLB A;  3HXB A;  2EIJ E;  4BER A;  2J9Q A;  4AIF A;  3ML9 A;  4K5B A;  3SBS A;  2F8Y A;  1E8Z A;  2MHK A;  3MKR A;  1JCQ A;  4TUM A;  2BED A;  3QWP A;  1E7U A;  3E34 A;  4UI9 J;  3LCA A;  4RQI A;  5JMN D;  4LEU A;  1HG2 A;  5HI7 A;  3LY7 A;  1KT0 A;  2BF0 X;  5ENS D;  3S7F A;  3L22 A;  3LJN A;  3CSF A;  2PL2 A;  1MJ0 A;  4AEZ C;  5EID A;  3MEK A;  5G2N A;  3LVR E;  2ION A;  1QZ2 A;  2R5S A;  2M63 A;  3L82 A;  3NQP A;  1DCQ A;  1HF8 A;  2ZIR A;  2FF4 A;  4HBD A;  3FUJ A;  2KM4 A;  1G3N B;  4GML A;  5KWD A;  4EZJ A;  3C5R A;  2BUG A;  1SW6 A;  3HXF A;  4EPZ A;  5BXO A;  1N94 A;  5FWQ A;  4MKT A;  3E4B A;  3QWW A;  3DPY A;  3UM1 A;  1N0Q A;  3BU8 A;  2YIN A;  2WB2 A;  3EU9 A;  4CGW A;  2J8S D;  4UWH A;  4YDE A;  2RD0 A;  2PM6 A;  3E37 A;  3FH8 A;  4Q94 A;  5ARG A;  2OVB A;  5LCW J;  1HO8 A;  1OXJ A;  4TRQ A;  4BT8 A;  4J8D A;  4B89 A;  2WQ7 A;  4GMR A;  1V54 E;  1MYO A;  2WXH A;  1OCZ E;  2L0T B;  5ENP D;  2X6H A;  2P9I G;  3JUE A;  3CHR A;  3NOG D;  4G8L A;  4DPR A;  2IY0 C;  4MLP A;  4G26 A;  2QZA A;  5EDS A;  5CCL A;  1KZP A;  2KZT A;  3PZ3 A;  2XRY A;  4ILI A;  3DXM G;  4CDM A;  1DNP A;  2WPV A;  3FTZ A;  4JEU A;  1IXV A;  1UN9 A;  3JQ0 A;  1P5Q A;  1JUQ A;  3PEU B;  1VDY A;  2XEN A;  1HZ4 A;  2PNN A;  4WNG A;  2EIM E;  3U4T A;  4HOT A;  1ELK A;  2LO6 A;  3R9A B;  3HVE B;  1XNF A;  3PDN A;  3V2O A;  2WMN A;  2B0O E;  5CBO A;  1K3Z D;  1H2T C;  3FH7 A;  3HDX A;  2VTB B;  3RU0 A;  3CST A;  3CVW A;  3EHQ A;  1TEZ A;  5HRY A;  1E7V A;  4UQX A;  4BSX A;  4PS3 A;  4DX5 D;  4F6R D;  2QYU A;  4P29 A;  5LOZ A;  2CHZ A;  2XPZ A;  4C0M A;  4ILH B;  4LNU D;  3O48 A;  4H7Y A;  3L08 A;  3RIB A;  2X3M A;  2WVI A;  3MGB A;  3L9T A;  3LKU A;  3TL5 A;  4PS8 A;  4JZY A;  5DBK A;  5G04 J;  2ZGG A;  3TGO A;  3B13 A;  2OEW A;  5AQA A;  4XEI G;  3CEQ A;  4U8V D;  2I2O A;  3RO2 A;  3Q5M A;  4G8K A;  1H6K A;  1A17 A;  2OND A;  5ANR A;  4HI9 A;  2WMO A;  3ZN3 A;  1Q2Z A;  4BFR A;  3Q49 B;  5FJY A;  3CVQ A;  2HYZ A;  2FO1 E;  4WWN A;  2A5U A;  5ITZ F;  3L6A A;  4CDN A;  4AP2 A;  2ETC A;  4I9E A;  3FY4 A;  3FUI A;  5BPP A;  5LX8 A;  1S63 A;  3TG4 A;  1WM5 A;  3LEW A;  3CLJ A;  3QK0 A;  3TJP A;  1OCO E;  2LSV A;  3FUN A;  5FIN A;  2WQH A;  4O1O A;  3FFL A;  3SFZ A;  4HS2 A;  2BTD A;  1MZC A;  1TNZ A;  2H6G A;  2YHE A;  2P9K G;  3FU6 A;  3LYA A;  4KZC A;  4GAA A;  4UWK A;  4MRU A;  2AWI A;  4ANX A;  3AG4 E;  3S7D A;  5ENR D;  3U3W A;  3FUD A;  4M7C A;  3OAW A;  3AS4 A;  2ILR A;  4OVU A;  2MOW A;  2GRQ B;  2LXL A;  3VLD A;  4YND A;  1O1T A;  3DWL G;  1TJF A;  4ZHB A;  4C48 B;  1TNY A;  1B89 A;  4FU3 A;  3ULQ A;  2NYJ A;  2YHC A;  2GGF A;  3CKC A;  3CKB A;  4A55 A;  3RKV A;  4ACK A;  2VSO E;  5JHA A;  3E33 A;  4WNF A;  2PQR A;  4O6F A;  4Q96 A;  3EIJ A;  2IF4 A;  4JHJ A;  1MX4 A;  4LER A;  5BV1 A;  1FT1 A;  4GZC A;  3BG0 B;  4I2W A;  3TWX A;  2GW1 A;  4IYP A;  4IUL A;  2LAI A;  3IBE A;  4ILG A;  2KZT B;  3X2Q E;  3PRZ A;  3ENE A;  3I4G A;  4GCO A;  4XI0 A;  3IXE A;  3B7T A;  3O4Z A;  3D9O A;  4GTR A;  1TNB A;  4G24 A;  4AY6 A;  4TV3 A;  3KD7 A;  3APD A;  4HB5 A;  3FUL A;  4BTB A;  1N0R A;  3DSV A;  1K1A A;  1U3D A;  3CGH A;  2ZIS A;  4XKB A;  4AY5 A;  5BV0 A;  4BES A;  5AQ9 A;  4U0S A;  4G1T A;  4DX2 A;  4LUN U;  4Q69 A;  1S0P A;  3ISM C;  3OXL A;  3FDH A;  3RRU A;  2R17 C;  2DYS E;  3FUF A;  2WXM A;  5FQ7 A;  3ASH A;  3C3Q A;  4FJZ A;  3T5V A;  4A1G A;  3PE4 A;  3IHY A;  1JCS A;  2JEK A;  3UT4 A;  2XEV A;  4HOS A;  2IJG X;  3V30 A;  3EIQ C;  3MV2 B;  1QYM A;  2ZXW E;  2Y3A A;  1PAQ A;  4HRL A;  1H2V C;  4QFV A;  3QKY A;  4WWP A;  4JXT A;  4DX6 D;  3FHE A;  3UQ3 A;  4E85 A;  4DI3 A;  2C2L A;  3Q7A A;  2AVP A;  3SGH A;  2JLB A;  3LJ3 A;  2ZU6 B;  4JW1 A;  4JB8 P;  4G2V A;  3CK9 A;  5EIB E;  3ABL E;  3ZXP A;  4JD2 G;  4K0R A;  1A5E A;  3HXE A;  4N39 A;  4GZD A;  2IOL A;  3CVL A;  2L0I A;  2WXL A;  4N2Q A;  1E8Y A;  4KYO B;  2BKK B;  2X6J A;  5DIZ A;  3EHM A;  4DRX E;  3DSW A;  5CMY A;  4B93 B;  3D9K A;  2WXN A;  3ZEF A;  2EIK E;  2H6I A;  2VSY A;  3UM0 A;  2DZN A;  4APF A;  1ELR A;  1TYQ G;  2HO1 A;  1H0A A;  2DZO A;  5BUZ A;  1SA5 A;  2CG3 A;  2LUH A;  3ZHE A;  1S64 A;  1MX2 A;  1UG3 A;  3NF1 A;  4KVM A;  3IV0 A;  5EN5 D;  4AOF A;  3LPZ A;  4DX7 D;  3PEV B;  2XGO A;  3EJN A;  2PQN A;  2FBN A;  3KAE A;  3HYM B;  4EQF A;  5CED B;  1IQU A;  2AXZ A;  4BX8 A;  3ASO E;  3KSQ A;  4KVO A;  3QAR A;  2H6F A;  1EDU A;  4IN3 B;  1HFA A;  2KCK A;  1QQE A;  3GZS A;  4RVB A;  1BPO A;  3DPD A;  4J7W A;  1U2V G;  4Z68 A;  2R59 A;  2V4H C;  2J4B A;  4UWL A;  3SO8 A;  4A3T A;  2XZD G;  5BT1 A;  1TNO A;  2J49 A;  3VTY A;  3ZUV B;  5G55 A;  5CBN A;  3AJI A;  2I1K A;  4GA0 A;  1E8X A;  5ENN A;  3FTS A;  3R9M A;  4AV7 A;  3LS8 A;  4TXQ A;  3KEZ A;  4UWF A;  3G2T A;  5KNG A;  4ATZ D;  4ANW A;  4HRM B;  4EBA A;  1WG0 A;  2OEV A;  3EDT B;  4XIF A;  2XCB A;  3JYS A;  2IQC A;  3Q79 A;  5ENQ D;  3SNX A;  2J4D A;  2HE0 A;  4U63 A;  1FVF A;  4WAF A;  3KEA A;  3G2S A;  1MHQ A;  3PUK A;  3UTM A;  1XGW A;  2XHE A;  4GA2 A;  3UMV A;  4JEH A;  1OCC E;  4OYS A;  3BUA A;  1D9S A;  3R7R A;  2XQ0 A;  3FH5 A;  3Q73 A;  3FU0 A;  4APO A;  2IU1 A;  3F6Q A;  5B1A E;  2RFM A;  3CVY A;  3N71 A;  4LNG A;  1E96 B;  2XZT G;  5E75 A;  1UN8 A;  1BU9 A;  3AG2 E;  4DI4 A;  1OWM A;  2I1J A;  2OV8 A;  2OOE A;  4N5C A;  1EF1 C;  2DVW A;  4NIK A;  3LDZ A;  2KCV A;  4UI9 C;  2P9N G;  1NL4 A;  2P9P G;  4ATG A;  2BKG A;  4CRW A;  2XS1 A;  5AQ7 A;  2KC7 A;  3CV0 A;  3I3N A;  2MYO A;  3FTX A;  5G05 C;  4F3V A;  4FHJ A;  1E8W A;  3RAU A;  1RZ4 A;  4UQY A;  2R03 A;  3D3M A;  5LFA A;  3C98 A;  4BSZ B;  3ZIM A;  5HS0 A;  5ENT D;  3FEY A;  3PZ2 A;  3ESL A;  4KZ0 A;  3LY9 A;  3W9G A;  4F1S A;  4GTM A;  1K8K G;  4XKC A;  2XEE A;  5JA4 D;  1EPU A;  5KCM A;  3UIP C;  1KZO A;  4GZ3 A;  3JXI A;  4N3C A;  4GTQ A;  2VGX A;  2UY1 A;  3JQ1 A;  2PZI A;  1WAO 1;  3U9W A;  3FWV A;  1OWL A;  1PY1 A;  2CHW A;  5AQB A;  2R02 A;  4JL0 A;  3Q47 B;  3ULE G;  4UQZ A;  5CER B;  2KAT A;  4DX1 A;  3DSU A;  4N5Q A;  2UWJ G;  1O1R A;  2H6H A;  5ENO D;  3FUK A;  1RW2 A;  2WXK A;  3ZHE B;  5AYW D;  5KNH D;  5M72 A;  5ARF A;  2WXF A;  4GTS A;  3D9J A;  4J8F A;  2CG2 A;  2CHX A;  1K1B A;  5JJT A;  4HI8 A;  2IFU A;  4EBA G;  4B8A A;  1TNU A;  1LTX A;  5H7P A;  2J07 A;  4G11 A;  4CCA A;  2F0Y A;  3AG1 E;  2VSX E;  1SQM A;  4RSY A;  2CFU A;  1ZB1 A;  3FTU A;  2WXR A;  3G2V A;  3MX3 A;  4AXH A;  5EKQ D;  4AVX A;  2Y69 E;  3U66 A;  3Q9U C;  4HVB A;  3T5X A;  5KJM A;  5AAO A;  5KJL A;  4GCN A;  1FCH A;  3DBS A;  1H2U A;  5J08 A;  2AXU A;  3QAQ A;  3EUV A;  4WWO A;  4XE0 A;  3QB2 A;  4UUC A;  4H7X A;  1Z3X A;  4L1B A;  3TWT A;  3APF A;  4I17 A;  1KPS B;  3CHS A;  4E6H A;  5B1B E;  1ZU2 A;  2QYJ A;  4F7A A;  4BX9 A;  5CRU A;  3ONK A;  3AS5 A;  5EYP F;  1JCR A;  3CVP A;  4NQ0 A;  3UKU G;  2WXI A;  4DLQ A;  3QJZ A;  3TWQ A;  3RSE G;  4ABN A;  4HNA D;  1NZN A;  4NUR A;  5T8I A;  1SA4 A;  2NXP A;  4NRH B;  2KCL A;  3CVU A;  3S7B A;  3SY2 A;  2R2L A;  5A7D B;  3G2U A;  4URK A;  4FJY A;  5EYL A;  1TN8 A;  1FPP A;  1Z3Y A;  5A6C A;  3ZU7 B;  2KBX A;  2YQ8 A;  1PC2 A;  2R05 A;  3JCK C;  3C72 A;  2FEZ A;  5JJ7 A;  4BEP A;  4G23 A;  2Q7F A;  3FU5 A;  3CHO A;  4KMO A;  3S2A A;  3FU3 A;  3BG1 B;  2C0M A;  2LSU A;  3T9K A;  5CCM A;  3ABK E;  3SF4 A;  4HLL A;  4PDX A;  3SD5 A;  1MX6 A;  3BQO A;  1MQS A;  4CT4 A;  3GZ2 A;  2J09 A;  3QNK A;  2QY7 A;  1NA0 A;  1HU3 A;  4YVQ C;  3UX4 A;  3L17 A;  2QFC A;  5J90 A;  3UIO C;  3PUJ A;  3D9H A;  1N4Q A;  4BY6 A;  4I2Z A;  4UWG A;  4GPK A;  2RKK A;  2LXM A;  2HR2 A;  4GPM A;  2VJ8 A;  4PS7 A;  5AN8 A;  4WND A;  3PZD A;  4A63 B;  3ZW3 A;  5AEN A;  3IKO B;  4TUU A;  2VGX B;  2UY1 B;  3ESK A;  3B7U X;  4J6I A;  4GTV A;  3UXG A;  4ANV A;  3DXK G;  4I43 A;  4JA9 A;  3SHF A;  2WXO A;  2VQ2 A;  2XCC A;  3ASF A;  3GYZ A;  4NAC A;  3B7S A;  5FT9 A;  3FUE A;  3JUI A;  3K9I A;  3NAW A;  4K5A B;  3AU5 A;  3AG3 E;  4FUL A;  3PNT B;  3WXX A;  2AXV A;  5KJK A;  3PRE A;  2GRM A;  3MKQ A;  1HS6 A;  4GZ5 A;  2VGE A;  3RK6 A;  4A3V A;  4G25 A;  1AWC B;  3GW4 A;  2IO2 C;  3TWU A;  2GRP B;  2V5Q C;  4JA7 A;  4DK5 A;  4GA1 A;  4CDR A;  1D8E A;  1KLX A;  2NSZ A;  4BT9 A;  3E32 A;  5EX0 A;  2DCP A;  3TWW A;  2JAB A;  1IKN D;  4ANU A;  4I1M A;  3FTY A;  5HQ8 A;  4Y6W A;  2L6J A;  3MZL B;  3OXF A;  4GTT A;  2RFA A;  3CIA A;  3QWV A;  4HXI A;  4CT0 A;  3FEX A;  3AAA C;  3CK7 A;  3RJV A;  2WM9 A;  2XGM A;  1OT8 A;  2NC9 A;  2B6C A;  5D66 A;  4BET A;  5JJ6 A;  4LRZ A;  2WQ6 A;  3Q9N C;  4FHK A;  2KXP C;  4GTP A;  3FTV A;  4OAU C;  4N3B A;  2FO7 A;  4EZK A;  1UJK A;  3EHR A;  4WUY A;  1SZ9 A;  5BW8 C;  2VYI A;  2V5F A;  4I1O B;  4J8Y A;  4KXK B;  1IYG A;  2QC9 A;  3RRN B;  5FZR A;  4GYW A;  4EHM A;  5FIO A;  3ZPJ A;  1ZBP A;  2EIL E;  1N11 A;  2J08 A;  3DRA A;  1YCS B;  4R7L A;  4L7T A;  4U95 D;  4F53 A;  1QNF A;  3HG0 D;  1N54 A;  4V3I A;  3FP3 A;  3ZYL A;  3MA5 A;  5CEC B;  4L9P A;  4K03 A;  4CZ2 D;  2X6I A;  4B0Z A;  1OWP A;  3ZXS A;  3P2B A;  3MJW A;  3QOU A;  5AIJ A;  4FLH A;  2X38 A;  2LAH A;  1OUV A;  5G05 J;  2XEH A;  1E90 A;  2RG8 A;  1HG5 A;  1YYH A;  1UW4 B;  5LP0 A;  3CVX A;  3HIZ A;  1S70 B;  1N95 A;  4I1A A;  1Z6T A;  4GB9 A;  1JWF A;  2V0P A;  3S7J A;  4JVS A;  2P58 C;  3TG5 A;  5C1D A;  1OY3 D;  1V55 E;  1IHG A;  3FUM A;  3L13 A;  4U96 D;  4TXR A;  3NB2 A;  3OTN A;  2V4L A;  3G2W A;  4PUC A;  2VSN A;  4U8H A;  3TWR A;  4U8Y D;  2Y4T A;  5FQ8 A;  4JHK A;  3ONL A;  3W9F A;  4X8Q A;  4UI9 K;  3CK8 A;  3HRA A;  4FA6 A;  2E2E A;  2Y0B G;  4U0Z A;  4KBQ A;  4CYM D;  1FVH A;  4XZ4 A;  2P9S G;  2A4Z A;  3D9P A;  3TWV A;  2E0I A;  4LNB A;  2Y4U A;  4HFG A;  5T4Y A;  3UM3 A;  4HRN A;  4C9B B;  1O5M A;  2FI7 A;  4QQI A;  3WG7 E;  2HM8 A;  5FTP A;  2ZGD A;  3NZS A;  2EIN E;  3URZ A;  1D8D A;  1JPL A;  1ELW A;  2XRZ A;  3GZ1 A;  3IHV A;  2V8S E;  1IQR A;  3UKR G;  3UPV A;  3B7B A;  3TWS A;  3Q15 A;  3CQG B;  3Q4A B;  3ZYK A;  5BXU A;  3UT7 A;  3B95 A;  2XPI A;  3ABM E;  4GTO A;  3EU5 A;  4D10 C;  2C0L A;  2DBA A;  1X5B A;  3QC1 A;  2XS8 A;  3APC A;  3CVN A;  4A1S A;  3NBN B;  5T3R A;  3CHQ A;  3ZGQ A;  4OAV B;  3T8M A;  4LCT A;  3MKQ B;  3V31 A;  4FP7 A;  4BWR A;  3OXG A;  3ML8 A;  3FTW A;  4GYO A;  4B8C B;  2DIW A;  4AJW A;  1OWO A;  2OCC E;  2ETB A;  4HOQ A;  4K5C A;  3J5P A;  2LNI A;  1TR4 A;  3DST A;  3LVQ E;  1KT1 A;  4RLY A;  1UJJ A;  3C3O A;  4L2Y A;  5LCW C;  5BNW A;  3CQC B;  3UIN C;  4I6J A;  1Y8M A;  5FZS A;  1YA0 A;  3NOC D;  4HQD A;  3UUX A;  3ZNG A;  2I9C A;  3PE3 A;  1HE8 A;  3TXM A;  3EHN A;  1FT2 A;  3RO3 A;  5B3S E;  3SBT B;  4B94 A;  3UM2 A;  3V79 K;  3SFY A;  3AS8 A;  4HOU A;  3CHP A;  2IOS A;  3PH0 C;  3RRM B;  3Q75 A;  1N4S A;  2L6B A;  3ZFW A;  3I5P A;  3CHM A;  5CHE E;  1L5J A;  5AAR A;  4HLE A;  1TJC A;  4GZ6 A;  3ZRH A;  5AJD A;  2XGS A;  4KT6 B;  2P2C P;  3JXJ A;  4O60 A;  1H6P A;  4U07 A;  4O1P A;  4RG6 A;  1HX8 A;  4EZL A;  3DEO A;  3ULY A;  3SZ7 A;  3D9L A;  4N2S A;  4U0U A;  1N52 A;  3ZYM A;  1LF8 A;  1O1S A;  1OCR E;  4JHR A;  3CVV A;  3T8K A;  1TN6 A;  3HXC A;  2Y1L E;  3UI2 A;  4ACL A;  2VGY A;  2CFZ A;  3I4R B;  3MYV A;  3ZVV A;  1UOH A;  2F37 A;  3CR3 A;  1AP7 A;  4N3A A;  2XPY A;  5CEA A;  3HHM A;  1LD8 A;  2AJA A;  1JWG A;  1LD7 A;  3FUH A;  3IEG A;  1TN7 A;  4Y6C A;  3Q7F A;  5D0O D;  3SI5 A;  1GW6 A;  3VLE A;  2IEJ A;  3LY8 A;  4MBG A;  1HXI A;  3R7Q A;  1WY6 A;  1NI1 A;  3ZYQ A;  4DJA A;  2L9B A;  1BD8 A;  2DWZ A;  4GU5 A;  4I6G A;  5ANL A;  3V2X A;  5KJN A;  4I9C A;  4I6E A;  3ASG A;  4XI9 A;  4YDO A;  3D9I A;  5G04 C;  4GMJ A;  1NP7 A;  2WXJ A;  4XX5 A;  2F8X K;  3P1U A;  1YMP A;  3PS6 A;  1OWN A;  1DCE A;  4YDW A;  2P9L G;  3D9M A;  3PZ1 A;  1BLX B;  3PNL B;  2X6K A;  1SZA A;  3UT8 A;  4J8E A;  4W9R A;  3SFX A;  3AU4 A;  3TXN A;  3U64 A;  4C0E A;  4ZFH A;  4LG6 A;  3DSS A;  4GYY A;  2MRI A;  3L54 A;  4WNE A;  1W3B A;  4PH4 B;  4EEC A;  1U3C A;  3VLF A;  1Z5S C;  3TAX A;  3VTX A;  5A23 A;  4RG9 A;  5HKP A;  4HOR A;  4JPS A;  4L2L A;  2GRN B;  3PZ4 A;  3D9N A;  4U04 A;  1SVX A;  2P9U G;  4JC8 A;  3ZKJ A;  1QBQ A;  4J0U A;  4YVO A;  5FZQ A;  1H19 A;  2EQX A;  2OVF A;  3Q78 A;  4YDY A;  1WDY A;  1N9A A;  2DYR E;  2IO3 C;  3C3R A;  1IHB A;  2FUL A;  2I6H A;  3QDN A;  2WXG A;  4TXP A;  3SQV A;  4CGV A;  4BTA A;  4F1P A;  5E76 A;  5AJL A;  4DLO A;  2GRO B;  2GRR B;  1Y6I A;  3L16 A;  4J8S A;  4DUI A;  4LSZ E;  1NA3 A;  3LXU X;  3ASN E;  1DVP A;  3NZU A;  3HVE A;  4U7E B;  3MV3 B;  3KS2 A;  4L23 A;  5D2M C;  5CMW A;  3MCX A;  3E30 A;  3DSX A;  5D0Q D;  2X6F A;  3KSL A; 
#chains in the Genus database with same CATH homology
 5B1A E;  3ABL E;  3X2Q E;  2EIK E;  1OCC E;  5B3S E;  2Y69 E;  5B1B E;  3WG7 E;  2DYR E;  3AG2 E;  3AG4 E;  2EIJ E;  3ABK E;  1OCR E;  3AG3 E;  3AG1 E;  2EIL E;  1V54 E;  2EIM E;  1V55 E;  1OCZ E;  3ABM E;  3ASO E;  2EIN E;  5IY5 E;  2OCC E;  2ZXW E;  2DYS E;  1OCO E;  3ASN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...