3ABLE

Bovine heart cytochrome c oxidase at the fully oxidized state (15-s x-ray exposure dataset)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
104
structure length
104
Chain Sequence
b'ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 40
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ablE00
1OCRE 2EIKE 2EINE 3AG1E 5B1AE 3WG7E 3AG3E 1OCZE 3AG2E 3X2QE 2EIME 3ASNE 1V55E 2DYSE 3ABME 1OCOE 1OCCE 2EIJE 5B1BE 3ABLE 2ZXWE 1V54E 2DYRE 2OCCE 5B3SE 5IY5E 3ABKE 2Y69E 3ASOE 2EILE 3AG4E
chains in the Genus database with same CATH superfamily
2I2OA 4WAFA 3ASDA 1FT2A 1LD7A 5AN8A 3TG5A 3UPVA 2WXPA 5EYPF 3FDHA 3BG0B 1A5EA 3RRMB 4EBAG 2LAHA 4XI9A 5G55A 4CEMA 3B7UX 4GZ3A 3AJIA 4JA9A 2WXGA 3W9FA 5AQAA 3UUXA 3HRAA 4B0ZA 2VTBA 3FUFA 4L1BA 1TNBA 5A7DB 3C98A 3CVYA 2QC9A 4NACA 3HXBA 4FLBA 3CGHA 4GCNA 3AG4E 4KXKB 3BQOA 3DXMG 4I1OB 5D66A 5D2MC 2X38A 5JMND 2HYZA 2V8SE 4I43A 1ZU2A 4OAVB 2DYRE 2WXIA 4E6HA 3D9MA 4WNEA 3FEXA 1MYOA 3ASFA 4TV3A 1JCRA 1QNFA 2DZOA 4DI4A 1OY3D 2LAIA 3JYSA 3HVEA 2WQ7A 3SI5A 4BT9A 4JC8A 4JHJA 4LG6A 4EZLA 3U3WA 4XIFA 2EIKE 5JHBA 3BG1B 3L08A 1H6OA 3DSSA 5C1DA 2LO6A 3FTXA 1QBQA 1U3CA 2GROB 3PNTB 1NA0A 3MZLB 1UN8A 3DSTA 3BEEA 4YDOA 1RW2A 4CCAA 3R7RA 5JHAA 5ITZF 2VGYA 3TJPA 3C5RA 4U0UA 2P58C 2J4DA 4F3VA 1GW6A 4HI9A 3DXKG 1D8DA 4LNUD 4AVXA 3SHFA 3PUJA 4KYOB 4FADA 3FU3A 1TEZA 2GGFA 4IN3B 3Q9UC 5AJDA 5KJLA 2CHXA 4EECA 2J07A 3CQCB 2BUGA 3NQPA 4BETA 3ESKA 4WNGA 3HXCA 1ELWA 3ASNE 1BI8B 4J8SA 2M63A 4WWOA 2XGMA 3VLEA 4Y6WA 1TNOA 3AS8A 3QDNA 5H7PA 1SVXA 2FEZA 3C3QA 2IO3C 5CECB 2GRRB 1N4QA 3UI2A 3E33A 2FI7A 3AU4A 4FHKA 3LCAA 4U04A 5B1BE 5EIBE 2GRQB 3KAEA 5EDSA 4M3OA 2F8YA 3D9KA 3Q78A 4LNBA 3KS2A 4U7EB 4B8CB 4WNFA 2VGXA 5G05C 4G23A 2E0IA 3UM3A 2IJGX 1OWLA 3CR3A 4AIFA 3FH7A 3QNKA 3D9IA 3PREA 3APDA 4I9EA 1ELKA 4FP7A 3QK0A 3VTYA 3GW4A 3SF4A 1K3ZD 4C48B 2EINE 3FTVA 3PRZA 4N3CA 4X8QA 3EHRA 2PM6A 4K5BA 3V79K 4O1PA 4JEUA 5G04C 4CZ2D 3Q9NC 3B7TA 2X6JA 4EPZA 2GW1A 1IYGA 5HRYA 4IRUA 3CQGB 3APFA 4XX5A 2MHKA 3PZ3A 1X81A 4F1SA 5FZQA 4BX9A 4I6JA 4MLPA 5FQ7A 5B1AE 3IHYA 3OXFA 1JPLA 2GRMA 2PQNA 2WXRA 4BEPA 4G8KA 3IV0A 1JUQA 3QAQA 3UM1A 4L7TA 3HXEA 3ABLE 4GZ6A 3S7FA 3OXGA 3I4RB 4CDNA 1UJKA 1HU3A 3FY4A 1S70B 1TJCA 5JA4D 4JVSA 3RSEG 4ILGA 5CRUA 2FO1E 2X3MA 3T9KA 4GTOA 2R17C 1N11A 4YNDA 3Q75A 3VLDA 5JJTA 2YQ8A 3HG0D 3L54A 2F37A 4JZYA 4A1GA 2XPZA 4CGVA 1E8WA 4HOQA 2WXJA 4OVVA 4N2SA 5G04J 3DEOA 4TUMA 4DK5A 2AXVA 4JB8P 5IY5E 4KMOA 4A63B 3I4GA 4AY6A 1FPPA 4DX1A 4WWNA 2Y0BG 2XEEA 3EJNA 5CRVA 5BT1A 2BKKB 3LJNA 1OCCE 2X6HA 1RZ4A 2V0PA 5KBAA 3G2TA 4XZ4A 3ZYKA 3JQ0A 2EILE 3NB2A 3DEPA 3CIAA 2FULA 2WB2A 1JCSA 3EHNA 4HVBA 3DPYA 1QYMA 4GZCA 1KZOA 3B7RL 5EX0A 4L9PA 3FU0A 4JHKA 4J8FA 3ZRHA 4Z68A 2B0OE 2NXPA 3UT7A 1EF1C 2VSOE 3CVLA 5EN5D 4DPRA 3FTUA 4HBDA 1SZ9A 4E85A 3RK6A 3AG2E 2WQ6A 1YCSB 1Z5SC 1E96B 4BT8A 4N2QA 1PC2A 3CHPA 4O60A 4EZJA 4CT4A 1Y6IA 2WMNA 2UWJG 3FUKA 5T4YA 2KBXA 3QWVA 2P9NG 5HI7A 3WG7E 5CHEE 3FTSA 1K1BA 3TWWA 3WXXA 5BV1A 1NFIE 5LCWC 3L9TA 4PS8A 4ACKA 2MOWA 3IKOB 5FJYA 3FUHA 3TWVA 2VJ8A 3MKQA 2NSZA 1DC2A 2V5QC 3B7BA 4Q94A 4R7LA 1YA0A 3G2WA 3TWSA 4EQFA 4FULA 3G2VA 5CERB 3L13A 4I2ZA 2UY1B 2B6CA 3FUNA 3EIJA 4U0ZA 3RU0A 2MYOA 5ARFA 5JJ7A 4I1MA 2YHEA 1UN9A 3OAWA 4HOTA 3ZUVB 3PEUB 4ANWA 4GMRA 4JL0A 2P2CP 4WWPA 2ZISA 4LCTA 2I9CA 3FULA 5BNWA 5FQ8A 3ZFWA 3SZ7A 4N3AA 4FJZA 1IQUA 2WQHA 4ANUA 4CT0A 2GRPB 2WXKA 1UJJA 5AARA 2FO7A 2PM7A 3UTMA 4URKA 3K9IA 4HOUA 2JLBA 3Q79A 3UKRG 1H19A 3LPZA 3CVUA 3TG4A 5LCWJ 5HS0A 2PZIA 3AS5A 2YHCA 3I5PA 3NOGD 2NC9A 2HE0A 4U0SA 2OVBA 4UWLA 3ZHEB 3RO3A 3HXFA 3LEWA 3GYZA 2Y4UA 3RKVA 4J8DA 4CDRA 3ASOE 3ZXPA 1KT0A 3B7SA 3CLJA 4OYSA 1N94A 5LX8A 2DYSE 4PDXA 2WM9A 1NI1A 4AXHA 1SQMA 3UIOC 1H2UA 2P9SG 3APCA 3OTNA 5FZSA 4U63A 3S2AA 4GMLA 2V5FA 3AG3E 4GB9A 3W9GA 4L2LA 2IONA 4TUUA 1TNUA 4G25A 5ENSD 4UQZA 1TN8A 2VSYA 1BPOA 5HKPA 1Z3YA 1AP7A 3CVWA 2LXMA 3L82A 4XEIG 3DSXA 2AW6A 5C2YA 2XENA 4BY6A 3L17A 3OXLA 4BX8A 2JABA 1EDUA 1JWFA 2XPYA 3KSLA 1NL4A 4Q69A 3ASGA 1A17A 3B13A 1OUVA 4C0EA 3CKBA 4G24A 2RFMA 5KWDA 5EYLA 2WPVA 3UXGA 5KJMA 1IXVA 3DSWA 2LSVA 3ZGQA 3V30A 2VGEA 3ZYQA 3PZ4A 3MYVA 4HLLA 5FWQA 3ONLA 2VTBB 3F6QA 4RSYA 2L0IA 2I1KA 1MQSA 1DCQA 5CBOA 5CMWA 3ZKJA 3SNXA 2XEHA 3D9LA 2RG8A 2P9LG 3PZ2A 4A1SA 3BUAA 1PY1A 3EU9A 5AAOA 3EDTB 3CHOA 3ZEFA 2QYUA 3MKRA 2KCKA 3ABKE 4FLHA 4LUNU 1Z6TA 3AG1E 4DX7D 1L5JA 5FT9A 3UMVA 1JWGA 1S0PA 3NZUA 4GTVA 3IEGA 1O5MA 5AENA 4D10C 4J6IA 3TL5A 4FJYA 4F1PA 4BSXA 4YVOA 3EHMA 4K03A 4H7YA 5E75A 2XCBA 3ASHA 1OWPA 2KCVA 4FC8A 3AU5A 4NURA 1NZNA 4HRNA 3FU6A 4A3VA 2Y69E 4LEUA 1LTXA 5ARGA 4B8AA 4P29A 3FUEA 1SW6A 3N71A 4XKBA 5KNGA 3FUJA 3T8MA 3KEZA 3Q47B 3CEQA 1U2VG 3E37A 2IFUA 3FEYA 4JPSA 3D9PA 4RG6A 3CK9A 3JQ1A 2ZU6B 2OEVA 3LS8A 1DVPA 3CHRA 3SY2A 3FWVA 4GTSA 1OCOE 4HRLA 5DBKA 2ZGGA 4CRWA 4GU5A 3FFLA 4APFA 5LP0A 1OWOA 4JEHA 5JJ6A 1HX8A 4HB5A 3D3MA 2HO1A 4G2VA 5B3SE 3FUMA 1N54A 4HFGA 4HOSA 2R5SA 4A3TA 4DI3A 2WVIA 3DSUA 3ZIMA 5T8IA 2P9IG 3TXMA 3QKYA 2ZXWE 4UUCA 2VGXB 5FQ4A 4FA6A 3KEAA 3EUVA 3MV2B 1Q2ZA 2PL2A 3DSVA 3MCXA 3V31A 4C0MA 1MHQA 3SBTB 2P9UG 5ANRA 2C0LA 2R2LA 3HYMB 3ULYA 1NP7A 2IQCA 4GTTA 4DLQA 2C2LA 4PS3A 4AEZC 4BSZB 1WDYA 2FBNA 4TXRA 3RO2A 3IXEA 4J8EA 5KCMA 5G05J 2BEDA 2XS8A 1WAO1 3LY9A 3MJWA 2VSXE 3ZN3A 3D9NA 1U3DA 2H6IA 5ENPD 3CK7A 2QY7A 2R02A 2A5EA 4BFRA 5AIJA 5E76A 2ETBA 3LY7A 4F53A 4GTRA 4TXQA 3C3RA 1IHGA 3PUKA 5EILA 4JD2G 4JHRA 3TWXA 4U07A 4GA1A 1FT1A 2KZTB 1INZA 4GYYA 2WXNA 4ILHB 4UWHA 2XRYA 1SA4A 4AOFA 4NRHB 3TXNA 1N4RA 4KVOA 1W3BA 4YDEA 4I9CA 4NQ0A 1TN7A 4WNDA 1K8KG 2CFZA 3IHVA 3NAWA 1BLXB 4LNGA 4AP2A 2BTDA 1O1SA 2P9PG 3HXDA 4ATGA 4AV7A 4GMJA 3PE4A 5ENTD 1H2VC 2DVWA 2NYJA 5BPPA 1OCRE 2KATA 4ME2A 2CHZA 3KD7A 4C9BB 2IEJA 3SGHA 2IY0C 2H6GA 3QB2A 4O1OA 2WMOA 4GA2A 3ULEG 4AY5A 3GZ1A 4HS2A 1PAQA 4RG9A 3QARA 5KJKA 2GRLA 3T5XA 3UX4A 2WXMA 2F0YA 3ML8A 5T3RA 3CVXA 3R9AB 3LJ3A 2HM8A 2I6HA 3U9WA 2AVPA 4QQIA 3U64A 1H0AA 3JXJA 1BU9A 3MA5A 2UY1A 4K5CA 4GYWA 3Q7FA 4MBGA 4HQDA 5D0OD 1V55E 4ACLA 3S7BA 2PQRA 2AJAA 3TWRA 2HR2A 1UG3A 3C3OA 3PS6A 2P9KG 4ATZD 2WXLA 2PNNA 3ZYLA 4LSZE 4OAUC 3DRAA 5FQ6A 5A23A 1KPSB 4EHMA 1N0QA 4A55A 3V2XA 4N3BA 4PH4B 3J5PA 2H6FA 4JXTA 1OT8A 3LY8A 4UWGA 2J4BA 4CDMA 2Q7FA 1HZ4A 3FUDA 5LFAA 2BF0X 4GPMA 3RAUA 3PVLA 4UWKA 4U8HA 1UOHA 3QOUA 3Q49B 4J0UA 3C72A 2WXOA 1IHBA 3UKUG 3DBSA 3R9MA 3UM0A 4GYOA 4APOA 1WM5A 4B93B 2BKGA 4KT6B 2A5UA 3NZSA 2CFUA 1N52A 4AJWA 3D9JA 3PNLB 1IQRA 3CVQA 5ENQD 1MX2A 3FP3A 3PDNA 3V2OA 3TGOA 1Y8MA 3PZ1A 4XI0A 1XGWA 1YYHA 4LRZA 2XEVA 4HRMB 1KLXA 3Q7AA 3TWUA 2VYIA 1HO8A 1EPUA 2J49A 4YDYA 1H6KA 4XKCA 3SFYA 4RQIA 4WUYA 3SFXA 4DUIA 4DRXE 5CCMA 2L0TB 5A6CA 4I17A 5ENOD 1LD8A 3ENEA 3KSQA 4BERA 5KJNA 3DWLG 3Q15A 4F7AA 3UINC 3QJZA 4IULA 3VTXA 3R7QA 5AQ7A 4CGWA 3LDZA 4YVQC 4U8VD 5FTPA 3ZPJA 4GAAA 3DPDA 2XCCA 2XS1A 3MGBA 2XGSA 3TAXA 1OXJA 4GPKA 2DZNA 1X5BA 1HH8A 5AJLA 3FH5A 3P2BA 2IOLA 2R03A 4ILIA 3O4ZA 5CCLA 4J7WA 1S64A 3NOCD 1HS6A 3I3NA 3L16A 2ETCA 3FU5A 3EIQC 5AQ9A 1E7UA 2RKKA 4I6GA 3LVQE 3URZA 3PE3A 4MS6A 1WG0A 4K0RA 5D0QD 3FH8A 2VQ2A 3L22A 4Q96A 4TRQA 4JW1A 2QZAA 4V3IA 3LVRE 3X2QE 2KCLA 3CSFA 1FCHA 2MRIA 2OV8A 3GZ2A 3HVEB 1QZ2A 2LXLA 1E8XA 1E8ZA 4JA7A 5CEAA 3U4TA 3UT4A 2QYJA 2X6FA 4BTAA 4I2WA 5ANLA 4KBQA 4U96D 2QFCA 3QC1A 3HHMA 3UM2A 3PEVB 3TWQA 3CSTA 4U8YD 3G2SA 3ML9A 3CHSA 3BU8A 2Y3AA 4TXPA 4UWFA 4KVMA 2R05A 1UW4B 1K1AA 3HDXA 3FHEA 3E32A 5DIZA 4MRUA 4BWRA 2XZDG 4I6EA 4DX2A 3JXIA 4GCOA 3Q4AB 1P5QA 5ENNA 1DNPA 2ETAA 4J8YA 3Q73A 3FTZA 2F8XK 3CVNA 1N9AA 2CHWA 3SD5A 2RD0A 3MEKA 4N39A 2ZGDA 2VSNA 1H2TC 3L6AA 3EHQA 4L23A 2J08A 1EYHA 3SQVA 1N0RA 5CMYA 4ABNA 3CHMA 5FINA 2DBAA 3EU5A 4ANVA 1BD8A 5KNHD 4UQXA 2V4LA 2C0MA 3UIPC 2OVFA 2KXPC 4N5CA 2XRZA 4PUCA 3CV0A 5EX3A 4G11A 5G2NA 2Y1LE 2J09A 3JCKC 4LERA 4I1AA 5HQ8A 2OOEA 3LKUA 1DCEA 4M7CA 4DX5D 2ONDA 3D9OA 1IKND 2J9QA 4ZHBA 5CBNA 3CHQA 1TN6A 2AXUA 4GZ5A 3NBNB 3ZU7B 3RRNB 2LUHA 3LXUX 1TYQG 1Z3XA 5BXOA 2YINA 4B89A 3JUEA 2AWIA 3MX3A 3E34A 4MKTA 5AQBA 1TNYA 3QWWA 2XHEA 4PS7A 2LSUA 3SO8A 1SZAA 4GTMA 3GZSA 2DWZA 3SFZA 1KT1A 5BV0A 2L6JA 4NIKA 1HE8A 1VDYA 3T5VA 2DIWA 2KZTA 4EBAA 5AYWD 5M72A 2XPIA 1ZBPA 1HF8A 2R59A 2E2EA 1E8YA 3FUIA 2ILRA 4O6FA 3MV3B 2IO2C 3ZXSA 4ZFHA 4GTQA 2WXQA 1HFAA 5BXUA 2L9BA 2CG2A 4FHJA 1D8EA 3G2UA 3JUIA 3AAAC 3ONKA 4KZ0A 3U66A 1E7VA 2EIJE 5EIDA 4DX6D 1TNZA 1LF8A 4KZCA 2DCPA 3ZYMA 3FTWA 1B89A 1H6PA 4RVBA 3D9HA 2EQXA 4OVUA 4G1TA 3QWPA 3ZW3A 4L2YA 3HIZA 4YDWA 3ULQA 3RRUA 1AWCB 3SBSA 4F6RD 1N95A 5CEDB 1NA3A 4RLYA 3RJVA 1N4SA 5ENRD 1WY6A 2J8SD 1MJ0A 4DLOA 2A4ZA 1V54E 5BUZA 3B95A 1MX4A 3UT8A 3Q5MA 1E90A 1HXIA 3AS4A 2IF4A 2ZIRA 3UQ3A 4HXIA 1YMPA 3TWTA 3ESLA 4UI9C 3NF1A 4W9RA 1JCQA 4EZKA 1BI7B 2FF4A 3PH0C 2OCCE 1TJFA 1KZPA 1O1TA 3O48A 5EKQD 3S7DA 4DJAA 3P1UA 4G8LA 3CKCA 1OWNA 3ZNGA 4ANXA 2Y4TA 1FVFA 2WXHA 1MX6A 2XQ0A 4BESA 4K5AB 1MZCA 4IYPA 2YNQA 3ZVVA 3VLFA 2X6KA 1XNFA 4U95D 5LOZA 2WXFA 4FU3A 4UQYA 3ABME 4Y6CA 2H6HA 1OWMA 2JEKA 3CVVA 3E4BA 3PZDA 4N5QA 3T8KA 3MKQB 3ISMC 2V4HC 1D9SA 4BTBA 2AXZA 2OEWA 4CYMD 3J5QB 4G26A 4HLEA 1HG5A 4QFVA 4B94A 3CVPA 3RIBA 3S7JA 3ZHEA 2IU1A 4GTPA 4UI9J 1ZB1A 3IBEA 2RFAA 4XE0A 1QQEA 2XZTG 3E30A 5FIOA 1O1RA 1SA5A 2EIME 2IOSA 4H7XA 4HORA 2XGOA 2LNIA 1FVHA 4AM9A 2KM4A 1G3NB 3CK8A 4GA0A 5J90A 2I1JA 2X6IA 2GRNB 1TR4A 4UI9K 4GZDA 1S63A 1OCZE 1N4PA 2L6BA 4HNAD 5FZRA 5J08A 5BW8C 1HG2A 2KC7A 2CG3A 1ELRA 3LYAA 4HI8A 3FTYA
chains in the Genus database with same CATH topology
1OCRE 2EIKE 2EINE 3AG1E 5B1AE 3WG7E 3AG3E 1OCZE 3AG2E 3X2QE 2EIME 3ASNE 1V55E 2DYSE 3ABME 1OCOE 1OCCE 2EIJE 5B1BE 3ABLE 2ZXWE 1V54E 2DYRE 2OCCE 5B3SE 5IY5E 3ABKE 2Y69E 3ASOE 2EILE 3AG4E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OCR E;  2EIK E;  2EIN E;  3AG1 E;  5B1A E;  3WG7 E;  3AG3 E;  1OCZ E;  3AG2 E;  3X2Q E;  2EIM E;  3ASN E;  1V55 E;  2DYS E;  3ABM E;  1OCO E;  1OCC E;  2EIJ E;  5B1B E;  3ABL E;  2ZXW E;  1V54 E;  2DYR E;  2OCC E;  5B3S E;  5IY5 E;  3ABK E;  2Y69 E;  3ASO E;  2EIL E;  3AG4 E; 
#chains in the Genus database with same CATH topology
 2I2O A;  4WAF A;  3ASD A;  1FT2 A;  1LD7 A;  5AN8 A;  3TG5 A;  3UPV A;  2WXP A;  5EYP F;  3FDH A;  3BG0 B;  1A5E A;  3RRM B;  4EBA G;  2LAH A;  4XI9 A;  5G55 A;  4CEM A;  3B7U X;  4GZ3 A;  3AJI A;  4JA9 A;  2WXG A;  3W9F A;  5AQA A;  3UUX A;  3HRA A;  4B0Z A;  2VTB A;  3FUF A;  4L1B A;  1TNB A;  5A7D B;  3C98 A;  3CVY A;  2QC9 A;  4NAC A;  3HXB A;  4FLB A;  3CGH A;  4GCN A;  3AG4 E;  4KXK B;  3BQO A;  3DXM G;  4I1O B;  5D66 A;  5D2M C;  2X38 A;  5JMN D;  2HYZ A;  2V8S E;  4I43 A;  1ZU2 A;  4OAV B;  2DYR E;  2WXI A;  4E6H A;  3D9M A;  4WNE A;  3FEX A;  1MYO A;  3ASF A;  4TV3 A;  1JCR A;  1QNF A;  2DZO A;  4DI4 A;  1OY3 D;  2LAI A;  3JYS A;  3HVE A;  2WQ7 A;  3SI5 A;  4BT9 A;  4JC8 A;  4JHJ A;  4LG6 A;  4EZL A;  3U3W A;  4XIF A;  2EIK E;  5JHB A;  3BG1 B;  3L08 A;  1H6O A;  3DSS A;  5C1D A;  2LO6 A;  3FTX A;  1QBQ A;  1U3C A;  2GRO B;  3PNT B;  1NA0 A;  3MZL B;  1UN8 A;  3DST A;  3BEE A;  4YDO A;  1RW2 A;  4CCA A;  3R7R A;  5JHA A;  5ITZ F;  2VGY A;  3TJP A;  3C5R A;  4U0U A;  2P58 C;  2J4D A;  4F3V A;  1GW6 A;  4HI9 A;  3DXK G;  1D8D A;  4LNU D;  4AVX A;  3SHF A;  3PUJ A;  4KYO B;  4FAD A;  3FU3 A;  1TEZ A;  2GGF A;  4IN3 B;  3Q9U C;  5AJD A;  5KJL A;  2CHX A;  4EEC A;  2J07 A;  3CQC B;  2BUG A;  3NQP A;  4BET A;  3ESK A;  4WNG A;  3HXC A;  1ELW A;  3ASN E;  1BI8 B;  4J8S A;  2M63 A;  4WWO A;  2XGM A;  3VLE A;  4Y6W A;  1TNO A;  3AS8 A;  3QDN A;  5H7P A;  1SVX A;  2FEZ A;  3C3Q A;  2IO3 C;  5CEC B;  2GRR B;  1N4Q A;  3UI2 A;  3E33 A;  2FI7 A;  3AU4 A;  4FHK A;  3LCA A;  4U04 A;  5B1B E;  5EIB E;  2GRQ B;  3KAE A;  5EDS A;  4M3O A;  2F8Y A;  3D9K A;  3Q78 A;  4LNB A;  3KS2 A;  4U7E B;  4B8C B;  4WNF A;  2VGX A;  5G05 C;  4G23 A;  2E0I A;  3UM3 A;  2IJG X;  1OWL A;  3CR3 A;  4AIF A;  3FH7 A;  3QNK A;  3D9I A;  3PRE A;  3APD A;  4I9E A;  1ELK A;  4FP7 A;  3QK0 A;  3VTY A;  3GW4 A;  3SF4 A;  1K3Z D;  4C48 B;  2EIN E;  3FTV A;  3PRZ A;  4N3C A;  4X8Q A;  3EHR A;  2PM6 A;  4K5B A;  3V79 K;  4O1P A;  4JEU A;  5G04 C;  4CZ2 D;  3Q9N C;  3B7T A;  2X6J A;  4EPZ A;  2GW1 A;  1IYG A;  5HRY A;  4IRU A;  3CQG B;  3APF A;  4XX5 A;  2MHK A;  3PZ3 A;  1X81 A;  4F1S A;  5FZQ A;  4BX9 A;  4I6J A;  4MLP A;  5FQ7 A;  5B1A E;  3IHY A;  3OXF A;  1JPL A;  2GRM A;  2PQN A;  2WXR A;  4BEP A;  4G8K A;  3IV0 A;  1JUQ A;  3QAQ A;  3UM1 A;  4L7T A;  3HXE A;  3ABL E;  4GZ6 A;  3S7F A;  3OXG A;  3I4R B;  4CDN A;  1UJK A;  1HU3 A;  3FY4 A;  1S70 B;  1TJC A;  5JA4 D;  4JVS A;  3RSE G;  4ILG A;  5CRU A;  2FO1 E;  2X3M A;  3T9K A;  4GTO A;  2R17 C;  1N11 A;  4YND A;  3Q75 A;  3VLD A;  5JJT A;  2YQ8 A;  3HG0 D;  3L54 A;  2F37 A;  4JZY A;  4A1G A;  2XPZ A;  4CGV A;  1E8W A;  4HOQ A;  2WXJ A;  4OVV A;  4N2S A;  5G04 J;  3DEO A;  4TUM A;  4DK5 A;  2AXV A;  4JB8 P;  5IY5 E;  4KMO A;  4A63 B;  3I4G A;  4AY6 A;  1FPP A;  4DX1 A;  4WWN A;  2Y0B G;  2XEE A;  3EJN A;  5CRV A;  5BT1 A;  2BKK B;  3LJN A;  1OCC E;  2X6H A;  1RZ4 A;  2V0P A;  5KBA A;  3G2T A;  4XZ4 A;  3ZYK A;  3JQ0 A;  2EIL E;  3NB2 A;  3DEP A;  3CIA A;  2FUL A;  2WB2 A;  1JCS A;  3EHN A;  4HVB A;  3DPY A;  1QYM A;  4GZC A;  1KZO A;  3B7R L;  5EX0 A;  4L9P A;  3FU0 A;  4JHK A;  4J8F A;  3ZRH A;  4Z68 A;  2B0O E;  2NXP A;  3UT7 A;  1EF1 C;  2VSO E;  3CVL A;  5EN5 D;  4DPR A;  3FTU A;  4HBD A;  1SZ9 A;  4E85 A;  3RK6 A;  3AG2 E;  2WQ6 A;  1YCS B;  1Z5S C;  1E96 B;  4BT8 A;  4N2Q A;  1PC2 A;  3CHP A;  4O60 A;  4EZJ A;  4CT4 A;  1Y6I A;  2WMN A;  2UWJ G;  3FUK A;  5T4Y A;  2KBX A;  3QWV A;  2P9N G;  5HI7 A;  3WG7 E;  5CHE E;  3FTS A;  1K1B A;  3TWW A;  3WXX A;  5BV1 A;  1NFI E;  5LCW C;  3L9T A;  4PS8 A;  4ACK A;  2MOW A;  3IKO B;  5FJY A;  3FUH A;  3TWV A;  2VJ8 A;  3MKQ A;  2NSZ A;  1DC2 A;  2V5Q C;  3B7B A;  4Q94 A;  4R7L A;  1YA0 A;  3G2W A;  3TWS A;  4EQF A;  4FUL A;  3G2V A;  5CER B;  3L13 A;  4I2Z A;  2UY1 B;  2B6C A;  3FUN A;  3EIJ A;  4U0Z A;  3RU0 A;  2MYO A;  5ARF A;  5JJ7 A;  4I1M A;  2YHE A;  1UN9 A;  3OAW A;  4HOT A;  3ZUV B;  3PEU B;  4ANW A;  4GMR A;  4JL0 A;  2P2C P;  4WWP A;  2ZIS A;  4LCT A;  2I9C A;  3FUL A;  5BNW A;  5FQ8 A;  3ZFW A;  3SZ7 A;  4N3A A;  4FJZ A;  1IQU A;  2WQH A;  4ANU A;  4CT0 A;  2GRP B;  2WXK A;  1UJJ A;  5AAR A;  2FO7 A;  2PM7 A;  3UTM A;  4URK A;  3K9I A;  4HOU A;  2JLB A;  3Q79 A;  3UKR G;  1H19 A;  3LPZ A;  3CVU A;  3TG4 A;  5LCW J;  5HS0 A;  2PZI A;  3AS5 A;  2YHC A;  3I5P A;  3NOG D;  2NC9 A;  2HE0 A;  4U0S A;  2OVB A;  4UWL A;  3ZHE B;  3RO3 A;  3HXF A;  3LEW A;  3GYZ A;  2Y4U A;  3RKV A;  4J8D A;  4CDR A;  3ASO E;  3ZXP A;  1KT0 A;  3B7S A;  3CLJ A;  4OYS A;  1N94 A;  5LX8 A;  2DYS E;  4PDX A;  2WM9 A;  1NI1 A;  4AXH A;  1SQM A;  3UIO C;  1H2U A;  2P9S G;  3APC A;  3OTN A;  5FZS A;  4U63 A;  3S2A A;  4GML A;  2V5F A;  3AG3 E;  4GB9 A;  3W9G A;  4L2L A;  2ION A;  4TUU A;  1TNU A;  4G25 A;  5ENS D;  4UQZ A;  1TN8 A;  2VSY A;  1BPO A;  5HKP A;  1Z3Y A;  1AP7 A;  3CVW A;  2LXM A;  3L82 A;  4XEI G;  3DSX A;  2AW6 A;  5C2Y A;  2XEN A;  4BY6 A;  3L17 A;  3OXL A;  4BX8 A;  2JAB A;  1EDU A;  1JWF A;  2XPY A;  3KSL A;  1NL4 A;  4Q69 A;  3ASG A;  1A17 A;  3B13 A;  1OUV A;  4C0E A;  3CKB A;  4G24 A;  2RFM A;  5KWD A;  5EYL A;  2WPV A;  3UXG A;  5KJM A;  1IXV A;  3DSW A;  2LSV A;  3ZGQ A;  3V30 A;  2VGE A;  3ZYQ A;  3PZ4 A;  3MYV A;  4HLL A;  5FWQ A;  3ONL A;  2VTB B;  3F6Q A;  4RSY A;  2L0I A;  2I1K A;  1MQS A;  1DCQ A;  5CBO A;  5CMW A;  3ZKJ A;  3SNX A;  2XEH A;  3D9L A;  2RG8 A;  2P9L G;  3PZ2 A;  4A1S A;  3BUA A;  1PY1 A;  3EU9 A;  5AAO A;  3EDT B;  3CHO A;  3ZEF A;  2QYU A;  3MKR A;  2KCK A;  3ABK E;  4FLH A;  4LUN U;  1Z6T A;  3AG1 E;  4DX7 D;  1L5J A;  5FT9 A;  3UMV A;  1JWG A;  1S0P A;  3NZU A;  4GTV A;  3IEG A;  1O5M A;  5AEN A;  4D10 C;  4J6I A;  3TL5 A;  4FJY A;  4F1P A;  4BSX A;  4YVO A;  3EHM A;  4K03 A;  4H7Y A;  5E75 A;  2XCB A;  3ASH A;  1OWP A;  2KCV A;  4FC8 A;  3AU5 A;  4NUR A;  1NZN A;  4HRN A;  3FU6 A;  4A3V A;  2Y69 E;  4LEU A;  1LTX A;  5ARG A;  4B8A A;  4P29 A;  3FUE A;  1SW6 A;  3N71 A;  4XKB A;  5KNG A;  3FUJ A;  3T8M A;  3KEZ A;  3Q47 B;  3CEQ A;  1U2V G;  3E37 A;  2IFU A;  3FEY A;  4JPS A;  3D9P A;  4RG6 A;  3CK9 A;  3JQ1 A;  2ZU6 B;  2OEV A;  3LS8 A;  1DVP A;  3CHR A;  3SY2 A;  3FWV A;  4GTS A;  1OCO E;  4HRL A;  5DBK A;  2ZGG A;  4CRW A;  4GU5 A;  3FFL A;  4APF A;  5LP0 A;  1OWO A;  4JEH A;  5JJ6 A;  1HX8 A;  4HB5 A;  3D3M A;  2HO1 A;  4G2V A;  5B3S E;  3FUM A;  1N54 A;  4HFG A;  4HOS A;  2R5S A;  4A3T A;  4DI3 A;  2WVI A;  3DSU A;  3ZIM A;  5T8I A;  2P9I G;  3TXM A;  3QKY A;  2ZXW E;  4UUC A;  2VGX B;  5FQ4 A;  4FA6 A;  3KEA A;  3EUV A;  3MV2 B;  1Q2Z A;  2PL2 A;  3DSV A;  3MCX A;  3V31 A;  4C0M A;  1MHQ A;  3SBT B;  2P9U G;  5ANR A;  2C0L A;  2R2L A;  3HYM B;  3ULY A;  1NP7 A;  2IQC A;  4GTT A;  4DLQ A;  2C2L A;  4PS3 A;  4AEZ C;  4BSZ B;  1WDY A;  2FBN A;  4TXR A;  3RO2 A;  3IXE A;  4J8E A;  5KCM A;  5G05 J;  2BED A;  2XS8 A;  1WAO 1;  3LY9 A;  3MJW A;  2VSX E;  3ZN3 A;  3D9N A;  1U3D A;  2H6I A;  5ENP D;  3CK7 A;  2QY7 A;  2R02 A;  2A5E A;  4BFR A;  5AIJ A;  5E76 A;  2ETB A;  3LY7 A;  4F53 A;  4GTR A;  4TXQ A;  3C3R A;  1IHG A;  3PUK A;  5EIL A;  4JD2 G;  4JHR A;  3TWX A;  4U07 A;  4GA1 A;  1FT1 A;  2KZT B;  1INZ A;  4GYY A;  2WXN A;  4ILH B;  4UWH A;  2XRY A;  1SA4 A;  4AOF A;  4NRH B;  3TXN A;  1N4R A;  4KVO A;  1W3B A;  4YDE A;  4I9C A;  4NQ0 A;  1TN7 A;  4WND A;  1K8K G;  2CFZ A;  3IHV A;  3NAW A;  1BLX B;  4LNG A;  4AP2 A;  2BTD A;  1O1S A;  2P9P G;  3HXD A;  4ATG A;  4AV7 A;  4GMJ A;  3PE4 A;  5ENT D;  1H2V C;  2DVW A;  2NYJ A;  5BPP A;  1OCR E;  2KAT A;  4ME2 A;  2CHZ A;  3KD7 A;  4C9B B;  2IEJ A;  3SGH A;  2IY0 C;  2H6G A;  3QB2 A;  4O1O A;  2WMO A;  4GA2 A;  3ULE G;  4AY5 A;  3GZ1 A;  4HS2 A;  1PAQ A;  4RG9 A;  3QAR A;  5KJK A;  2GRL A;  3T5X A;  3UX4 A;  2WXM A;  2F0Y A;  3ML8 A;  5T3R A;  3CVX A;  3R9A B;  3LJ3 A;  2HM8 A;  2I6H A;  3U9W A;  2AVP A;  4QQI A;  3U64 A;  1H0A A;  3JXJ A;  1BU9 A;  3MA5 A;  2UY1 A;  4K5C A;  4GYW A;  3Q7F A;  4MBG A;  4HQD A;  5D0O D;  1V55 E;  4ACL A;  3S7B A;  2PQR A;  2AJA A;  3TWR A;  2HR2 A;  1UG3 A;  3C3O A;  3PS6 A;  2P9K G;  4ATZ D;  2WXL A;  2PNN A;  3ZYL A;  4LSZ E;  4OAU C;  3DRA A;  5FQ6 A;  5A23 A;  1KPS B;  4EHM A;  1N0Q A;  4A55 A;  3V2X A;  4N3B A;  4PH4 B;  3J5P A;  2H6F A;  4JXT A;  1OT8 A;  3LY8 A;  4UWG A;  2J4B A;  4CDM A;  2Q7F A;  1HZ4 A;  3FUD A;  5LFA A;  2BF0 X;  4GPM A;  3RAU A;  3PVL A;  4UWK A;  4U8H A;  1UOH A;  3QOU A;  3Q49 B;  4J0U A;  3C72 A;  2WXO A;  1IHB A;  3UKU G;  3DBS A;  3R9M A;  3UM0 A;  4GYO A;  4APO A;  1WM5 A;  4B93 B;  2BKG A;  4KT6 B;  2A5U A;  3NZS A;  2CFU A;  1N52 A;  4AJW A;  3D9J A;  3PNL B;  1IQR A;  3CVQ A;  5ENQ D;  1MX2 A;  3FP3 A;  3PDN A;  3V2O A;  3TGO A;  1Y8M A;  3PZ1 A;  4XI0 A;  1XGW A;  1YYH A;  4LRZ A;  2XEV A;  4HRM B;  1KLX A;  3Q7A A;  3TWU A;  2VYI A;  1HO8 A;  1EPU A;  2J49 A;  4YDY A;  1H6K A;  4XKC A;  3SFY A;  4RQI A;  4WUY A;  3SFX A;  4DUI A;  4DRX E;  5CCM A;  2L0T B;  5A6C A;  4I17 A;  5ENO D;  1LD8 A;  3ENE A;  3KSQ A;  4BER A;  5KJN A;  3DWL G;  3Q15 A;  4F7A A;  3UIN C;  3QJZ A;  4IUL A;  3VTX A;  3R7Q A;  5AQ7 A;  4CGW A;  3LDZ A;  4YVQ C;  4U8V D;  5FTP A;  3ZPJ A;  4GAA A;  3DPD A;  2XCC A;  2XS1 A;  3MGB A;  2XGS A;  3TAX A;  1OXJ A;  4GPK A;  2DZN A;  1X5B A;  1HH8 A;  5AJL A;  3FH5 A;  3P2B A;  2IOL A;  2R03 A;  4ILI A;  3O4Z A;  5CCL A;  4J7W A;  1S64 A;  3NOC D;  1HS6 A;  3I3N A;  3L16 A;  2ETC A;  3FU5 A;  3EIQ C;  5AQ9 A;  1E7U A;  2RKK A;  4I6G A;  3LVQ E;  3URZ A;  3PE3 A;  4MS6 A;  1WG0 A;  4K0R A;  5D0Q D;  3FH8 A;  2VQ2 A;  3L22 A;  4Q96 A;  4TRQ A;  4JW1 A;  2QZA A;  4V3I A;  3LVR E;  3X2Q E;  2KCL A;  3CSF A;  1FCH A;  2MRI A;  2OV8 A;  3GZ2 A;  3HVE B;  1QZ2 A;  2LXL A;  1E8X A;  1E8Z A;  4JA7 A;  5CEA A;  3U4T A;  3UT4 A;  2QYJ A;  2X6F A;  4BTA A;  4I2W A;  5ANL A;  4KBQ A;  4U96 D;  2QFC A;  3QC1 A;  3HHM A;  3UM2 A;  3PEV B;  3TWQ A;  3CST A;  4U8Y D;  3G2S A;  3ML9 A;  3CHS A;  3BU8 A;  2Y3A A;  4TXP A;  4UWF A;  4KVM A;  2R05 A;  1UW4 B;  1K1A A;  3HDX A;  3FHE A;  3E32 A;  5DIZ A;  4MRU A;  4BWR A;  2XZD G;  4I6E A;  4DX2 A;  3JXI A;  4GCO A;  3Q4A B;  1P5Q A;  5ENN A;  1DNP A;  2ETA A;  4J8Y A;  3Q73 A;  3FTZ A;  2F8X K;  3CVN A;  1N9A A;  2CHW A;  3SD5 A;  2RD0 A;  3MEK A;  4N39 A;  2ZGD A;  2VSN A;  1H2T C;  3L6A A;  3EHQ A;  4L23 A;  2J08 A;  1EYH A;  3SQV A;  1N0R A;  5CMY A;  4ABN A;  3CHM A;  5FIN A;  2DBA A;  3EU5 A;  4ANV A;  1BD8 A;  5KNH D;  4UQX A;  2V4L A;  2C0M A;  3UIP C;  2OVF A;  2KXP C;  4N5C A;  2XRZ A;  4PUC A;  3CV0 A;  5EX3 A;  4G11 A;  5G2N A;  2Y1L E;  2J09 A;  3JCK C;  4LER A;  4I1A A;  5HQ8 A;  2OOE A;  3LKU A;  1DCE A;  4M7C A;  4DX5 D;  2OND A;  3D9O A;  1IKN D;  2J9Q A;  4ZHB A;  5CBN A;  3CHQ A;  1TN6 A;  2AXU A;  4GZ5 A;  3NBN B;  3ZU7 B;  3RRN B;  2LUH A;  3LXU X;  1TYQ G;  1Z3X A;  5BXO A;  2YIN A;  4B89 A;  3JUE A;  2AWI A;  3MX3 A;  3E34 A;  4MKT A;  5AQB A;  1TNY A;  3QWW A;  2XHE A;  4PS7 A;  2LSU A;  3SO8 A;  1SZA A;  4GTM A;  3GZS A;  2DWZ A;  3SFZ A;  1KT1 A;  5BV0 A;  2L6J A;  4NIK A;  1HE8 A;  1VDY A;  3T5V A;  2DIW A;  2KZT A;  4EBA A;  5AYW D;  5M72 A;  2XPI A;  1ZBP A;  1HF8 A;  2R59 A;  2E2E A;  1E8Y A;  3FUI A;  2ILR A;  4O6F A;  3MV3 B;  2IO2 C;  3ZXS A;  4ZFH A;  4GTQ A;  2WXQ A;  1HFA A;  5BXU A;  2L9B A;  2CG2 A;  4FHJ A;  1D8E A;  3G2U A;  3JUI A;  3AAA C;  3ONK A;  4KZ0 A;  3U66 A;  1E7V A;  2EIJ E;  5EID A;  4DX6 D;  1TNZ A;  1LF8 A;  4KZC A;  2DCP A;  3ZYM A;  3FTW A;  1B89 A;  1H6P A;  4RVB A;  3D9H A;  2EQX A;  4OVU A;  4G1T A;  3QWP A;  3ZW3 A;  4L2Y A;  3HIZ A;  4YDW A;  3ULQ A;  3RRU A;  1AWC B;  3SBS A;  4F6R D;  1N95 A;  5CED B;  1NA3 A;  4RLY A;  3RJV A;  1N4S A;  5ENR D;  1WY6 A;  2J8S D;  1MJ0 A;  4DLO A;  2A4Z A;  1V54 E;  5BUZ A;  3B95 A;  1MX4 A;  3UT8 A;  3Q5M A;  1E90 A;  1HXI A;  3AS4 A;  2IF4 A;  2ZIR A;  3UQ3 A;  4HXI A;  1YMP A;  3TWT A;  3ESL A;  4UI9 C;  3NF1 A;  4W9R A;  1JCQ A;  4EZK A;  1BI7 B;  2FF4 A;  3PH0 C;  2OCC E;  1TJF A;  1KZP A;  1O1T A;  3O48 A;  5EKQ D;  3S7D A;  4DJA A;  3P1U A;  4G8L A;  3CKC A;  1OWN A;  3ZNG A;  4ANX A;  2Y4T A;  1FVF A;  2WXH A;  1MX6 A;  2XQ0 A;  4BES A;  4K5A B;  1MZC A;  4IYP A;  2YNQ A;  3ZVV A;  3VLF A;  2X6K A;  1XNF A;  4U95 D;  5LOZ A;  2WXF A;  4FU3 A;  4UQY A;  3ABM E;  4Y6C A;  2H6H A;  1OWM A;  2JEK A;  3CVV A;  3E4B A;  3PZD A;  4N5Q A;  3T8K A;  3MKQ B;  3ISM C;  2V4H C;  1D9S A;  4BTB A;  2AXZ A;  2OEW A;  4CYM D;  3J5Q B;  4G26 A;  4HLE A;  1HG5 A;  4QFV A;  4B94 A;  3CVP A;  3RIB A;  3S7J A;  3ZHE A;  2IU1 A;  4GTP A;  4UI9 J;  1ZB1 A;  3IBE A;  2RFA A;  4XE0 A;  1QQE A;  2XZT G;  3E30 A;  5FIO A;  1O1R A;  1SA5 A;  2EIM E;  2IOS A;  4H7X A;  4HOR A;  2XGO A;  2LNI A;  1FVH A;  4AM9 A;  2KM4 A;  1G3N B;  3CK8 A;  4GA0 A;  5J90 A;  2I1J A;  2X6I A;  2GRN B;  1TR4 A;  4UI9 K;  4GZD A;  1S63 A;  1OCZ E;  1N4P A;  2L6B A;  4HNA D;  5FZR A;  5J08 A;  5BW8 C;  1HG2 A;  2KC7 A;  2CG3 A;  1ELR A;  3LYA A;  4HI8 A;  3FTY A; 
#chains in the Genus database with same CATH homology
 1OCR E;  2EIK E;  2EIN E;  3AG1 E;  5B1A E;  3WG7 E;  3AG3 E;  1OCZ E;  3AG2 E;  3X2Q E;  2EIM E;  3ASN E;  1V55 E;  2DYS E;  3ABM E;  1OCO E;  1OCC E;  2EIJ E;  5B1B E;  3ABL E;  2ZXW E;  1V54 E;  2DYR E;  2OCC E;  5B3S E;  5IY5 E;  3ABK E;  2Y69 E;  3ASO E;  2EIL E;  3AG4 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...