3ABLE

Bovine heart cytochrome c oxidase at the fully oxidized state (15-s x-ray exposure dataset)
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
104
structure length
104
Chain Sequence
ETDEEFDARWVTYFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Cytochrome c oxidase subunit 1
publication title A peroxide bridge between Fe and Cu ions in the O2 reduction site of fully oxidized cytochrome c oxidase could suppress the proton pump
pubmed doi rcsb
total genus 40
structure length 104
sequence length 104
chains with identical sequence R
ec nomenclature
pdb deposition date 2009-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF02284 COX5A Cytochrome c oxidase subunit Va
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.40 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Cytochrome c oxidase, subunit Va/VI 3ablE00
2DYRE 3ABLE 2Y69E 2ZXWE 3AG3E 3WG7E 2OCCE 5B1BE 3X2QE 1OCRE 5B3SE 1V54E 2EIKE 3ABKE 3AG4E 2EIJE 1OCCE 3AG2E 3ASOE 3ASNE 2EILE 2EIME 3AG1E 1OCZE 2DYSE 5IY5E 1V55E 3ABME 1OCOE 5B1AE 2EINE
chains in the Genus database with same CATH superfamily
1K8KG 4J0UA 1WY6A 4DPRA 2I1KA 4OYSA 3E4BA 3B95A 4H7XA 4UWHA 3ASFA 3Q49B 3PRZA 3PZ4A 5IY5E 1A5EA 4DUIA 3CHPA 2AW6A 3OXFA 5BPPA 4GMRA 4FC8A 2WXMA 1OWPA 1YA0A 3JXIA 4DX6D 5FQ8A 2KCVA 3PUKA 4IYPA 4V3IA 2Y0BG 3FHEA 3VTYA 3ZHEB 3KS2A 4GU5A 4UI9C 3I3NA 5FIOA 4ANXA 4KVOA 3UMVA 5ITZF 1MX2A 4HBDA 3J5PA 2JEKA 5LCWJ 1EYHA 4XKCA 4LRZA 2FI7A 2XEEA 1S70B 2EILE 3PE4A 1N4QA 4AP2A 1FCHA 4J8YA 2X6FA 2MYOA 2MOWA 4M7CA 2KATA 1H19A 3FTXA 3UX4A 3AG3E 3ZIMA 3FEYA 3ZXPA 3UTMA 3LY8A 2I9CA 3PDNA 3SGHA 3RK6A 4K5AB 3BG0B 1LTXA 4BESA 3TG4A 3FU5A 4GAAA 4FLBA 3ZYQA 4HOQA 4F7AA 2FF4A 3UT8A 1OWNA 3TGOA 2X3MA 3UT7A 4TV3A 3ESLA 5HRYA 3QB2A 4RSYA 4JD2G 1WM5A 5FZQA 3GW4A 3NOCD 2ETCA 4TXPA 4U63A 3CKBA 4BEPA 5FQ7A 3LKUA 4GMJA 2F37A 2YHEA 3BQOA 3PZ3A 1SA5A 2WMOA 2EIKE 1MX4A 3FP3A 2P9NG 2H6IA 1FPPA 5KNHD 1OUVA 4ATGA 1JCSA 1K1AA 3NBNB 2R59A 3T8KA 1IXVA 5D0OD 2ZIRA 1AWCB 4YVQC 4JA7A 4U95D 1TR4A 3Q75A 2R5SA 3RRUA 1SVXA 5G2NA 3FULA 4GTOA 5KCMA 3ASNE 3FTWA 2VGEA 1BD8A 1N4SA 1TNUA 5CERB 3DSVA 4A55A 4C48B 2OEVA 2J49A 3GZ1A 3UPVA 2R05A 2J8SD 5BNWA 3RAUA 4K5BA 4HLLA 1ELKA 3HXCA 2DIWA 2WB2A 3MEKA 1LD8A 3CK9A 5CMYA 3DPYA 4BTAA 4JXTA 3DSTA 3Q15A 2B0OE 3ENEA 2NXPA 2F0YA 4U0UA 4CT4A 3SBTB 4Q69A 4WUYA 5JHBA 3B13A 3S7FA 3ABKE 4JHKA 3ZYMA 2X6HA 3LDZA 3FU0A 3LS8A 4HOUA 4YDWA 3FUHA 1H6KA 4F53A 3QK0A 3GZ2A 2LAIA 3AS8A 2VGYA 4UUCA 3T8MA 3ZVVA 3K9IA 2YNQA 3ZKJA 4DRXE 1Z3YA 4WWOA 1HX8A 4GCNA 5EKQD 3ML8A 2YHCA 1ZBPA 5DBKA 4J8SA 4L2YA 5EILA 1Q2ZA 1TN8A 3ONLA 2P9UG 3WXXA 4N3CA 4CGWA 2GRPB 5BXOA 4FP7A 4DLOA 3LVQE 3ZN3A 2AWIA 4U04A 4AVXA 3S7DA 3BG1B 4UI9J 1TNZA 4B94A 4KXKB 2WM9A 4LCTA 2WVIA 2Y4UA 2V0PA 3E32A 4CDNA 2FO1E 5ARFA 4RG6A 3ASHA 3R9AB 4GTVA 4A1SA 1JWGA 3QAQA 3FTVA 1MX6A 3FUJA 4HI8A 3DEOA 3LVRE 3O48A 4HI9A 3S7BA 2WQHA 4DLQA 2RFMA 2IFUA 2QZAA 2KZTA 2UWJG 3ZXSA 3AU5A 4JVSA 3D9NA 2AXUA 3PZDA 1XNFA 3E33A 3JUEA 3SZ7A 3FUEA 2KZTB 1ZU2A 3PS6A 3R7QA 5J90A 4I6GA 1NZNA 2J4DA 3GYZA 2AJAA 3EIQC 2I1JA 4G26A 1FT1A 3ZNGA 1YCSB 1Y8MA 2CFZA 3P2BA 1IQUA 4FLHA 4FJYA 4TRQA 4AXHA 4GTPA 4O1PA 3L17A 2OV8A 1A17A 1H2VC 2C2LA 4H7YA 2OVFA 5EDSA 3B7SA 5B1BE 4G23A 2ILRA 3BEEA 4HQDA 4BWRA 3FFLA 2WMNA 3ZGQA 2ZGDA 5D66A 1OCZE 1D8DA 1BU9A 4J8FA 3Q4AB 5AJLA 1E8YA 2WXKA 3FUIA 2X6JA 3G2UA 2PNNA 3AAAC 4GTMA 5AAOA 2PZIA 3SF4A 3S7JA 4CDRA 2CHWA 3QC1A 4RLYA 3AJIA 2RD0A 1KT1A 2P9PG 4JEUA 4EBAA 3AG1E 1ELRA 2L6BA 4HOSA 4A1GA 3ZPJA 3ULQA 4GZCA 3SNXA 3VLEA 4KZ0A 3FUNA 4TXRA 4E6HA 3NZSA 4GMLA 3ZU7B 1TYQG 3MJWA 5FINA 2XENA 2MRIA 1DVPA 3JUIA 2OOEA 5CBNA 2ZISA 2HO1A 3DPDA 4BFRA 4GYWA 4G25A 3OAWA 1DCEA 5A23A 3LY7A 2OEWA 2WQ7A 2WXFA 2PL2A 4FADA 5EX0A 4G11A 4DJAA 2VTBA 4WWPA 2OVBA 3PEVB 2NSZA 3W9GA 3UM3A 4NQ0A 3TWQA 4LNGA 3QWPA 1IHGA 4G8KA 4I6JA 5ANLA 3GZSA 2WPVA 4ILGA 2VTBB 1SW6A 5D0QD 3DXKG 4N5QA 4PH4B 3ML9A 3JQ0A 5J08A 1OCRE 2KM4A 5CMWA 5LOZA 3ZYKA 3CSTA 2BKGA 5KWDA 2A4ZA 2GRNB 1W3BA 1E8XA 5HI7A 2A5EA 3ABME 4AV7A 1O1RA 4HFGA 3TL5A 2IONA 1IYGA 2QYUA 4A63B 2DYRE 2GRRB 4U7EB 2V5QC 2WXJA 3RRMB 4EQFA 3NF1A 3CV0A 4O60A 5A7DB 3TWRA 1ZB1A 3PE3A 4GZDA 1KT0A 4BX9A 2CG2A 4ACLA 1HO8A 4CEMA 4OAUC 3L16A 3V79K 1EF1C 1QBQA 3P1UA 2DBAA 1IQRA 3FY4A 3X2QE 3KAEA 4PS3A 5G05C 3UKUG 1QNFA 3UT4A 3LCAA 4UWKA 3HXFA 1JUQA 4PDXA 1PAQA 2XS8A 4F1PA 4GB9A 4B8AA 2GROB 2AXZA 3RSEG 5AQ9A 3HXBA 3Q7FA 4EZLA 2WXOA 5AQAA 4GPKA 4AEZC 4I2ZA 4CGVA 4NIKA 3MV3B 1U3DA 1H6OA 4ABNA 4EHMA 4L23A 4I1OB 4G24A 2WXNA 3CKCA 2XGSA 2DYSE 3QJZA 5AENA 2ZU6B 4CZ2D 5EIBE 3NB2A 4LSZE 2NYJA 1UN8A 4U0ZA 4F1SA 2LXMA 3ZRHA 2ETAA 2JLBA 3PH0C 1TJFA 3B7UX 3FU3A 2YINA 1KZOA 5BV0A 1E8ZA 5CRUA 4C9BB 4GZ6A 4HOTA 2V5FA 4DI4A 2XS1A 2IEJA 4I43A 5AQ7A 1X5BA 2FEZA 3DXMG 5KJKA 4MKTA 4HVBA 3SD5A 5A6CA 1OWMA 2VJ8A 3EUVA 1DC2A 2GGFA 2KBXA 5JJ7A 5G04C 3MV2B 2C0LA 2MHKA 3NZUA 4F6RD 2M63A 3G2WA 3U64A 1Y6IA 4Z68A 3IEGA 2P2CP 4Q96A 4TUMA 2ETBA 3B7BA 3CHOA 3OTNA 1PY1A 3V30A 3UUXA 2X6KA 4N3AA 5LFAA 2CHXA 2IOSA 2WXQA 2Q7FA 3C3RA 4NACA 1VDYA 2J9QA 1EPUA 2Y3AA 4IN3B 4RVBA 5BUZA 2KCKA 4CRWA 4AJWA 5ENQD 2J07A 1TN7A 1N94A 3O4ZA 4HB5A 3PNLB 4IULA 4B8CB 1H0AA 4UWFA 4U8HA 3FUFA 3ASOE 4ACKA 4FJZA 3RO3A 5FJYA 2PQRA 3MKQA 5JHAA 3OXLA 3UM1A 4JEHA 4YDOA 3HYMB 4I6EA 3MA5A 2WXIA 1OY3D 3CEQA 1MQSA 1HF8A 4J6IA 1WDYA 3L13A 4PS7A 4U96D 4I17A 3FTYA 5HS0A 2EINE 3ULEG 5BW8C 4RG9A 3CQGB 4DI3A 3CK8A 3UQ3A 4U07A 4NRHB 1MYOA 4BSZB 5D2MC 3MZLB 1D8EA 3PEUB 2VGXA 4LERA 3NOGD 3KEAA 4FU3A 1HZ4A 3WG7E 5G05J 3E30A 3R7RA 3AG2E 1OT8A 3D9LA 3U3WA 1NA3A 3LJNA 3AS4A 3HDXA 3SBSA 2P9LG 2LUHA 1IKND 4K5CA 2CHZA 2QC9A 3IBEA 2Y69E 3TWWA 4R7LA 2RKKA 4GA2A 5BV1A 3V2OA 4B0ZA 3CHSA 4UI9K 3G2VA 2BUGA 3JCKC 3JYSA 1RW2A 4GZ3A 3EHRA 3VLFA 3TWUA 3HHMA 4WNEA 3KD7A 3SQVA 3EU5A 1OCCE 4M3OA 1WAO1 4JB8P 3MYVA 5KBAA 3FH8A 3RIBA 4WWNA 5AN8A 2LSUA 1N0RA 5EYPF 4P29A 1Z6TA 5CHEE 2RFAA 5ANRA 4ZHBA 2BTDA 1BI8B 3KEZA 3LEWA 4I9EA 3SFZA 2R03A 3IV0A 2HE0A 1OWLA 1UJJA 4MLPA 3FEXA 4GTSA 1TEZA 5CRVA 3T5VA 3AU4A 5HKPA 2I2OA 1O1TA 3APDA 5EX3A 4K03A 2VSOE 1E8WA 3MX3A 2NC9A 5JMND 3SFXA 1QYMA 4DK5A 5FTPA 3PNTB 5FQ6A 5AIJA 1N0QA 1V54E 1N54A 1XGWA 5ENOD 4NURA 3E34A 5LX8A 3CVQA 1JCRA 3UM0A 1IHBA 5ARGA 2J4BA 5BT1A 2DWZA 2XHEA 4CCAA 1E90A 3D9IA 2BKKB 1NFIE 1FVFA 4HORA 3TXMA 3D9KA 4CT0A 2V4HC 4N5CA 2IO2C 4GZ5A 5CCLA 3I4RB 4ILIA 1UJKA 3EHMA 3LJ3A 1U2VG 2FULA 4DX7D 4I2WA 3L82A 3ABLE 4U8VD 3RU0A 4G1TA 2XPYA 4B93B 4Q94A 3Q79A 5ENTD 2WQ6A 3W9FA 3L54A 4I1AA 3TJPA 5FWQA 3CVPA 3T9KA 1UN9A 1S63A 5EN5D 3QKYA 4AY5A 2WXPA 2WXLA 2DVWA 4XIFA 4A3TA 4A3VA 1UW4B 3KSLA 4GA1A 2Y1LE 3HVEA 1WG0A 3CVLA 2X6IA 4TXQA 2VQ2A 4UWGA 3TWSA 2GW1A 2KXPC 3QARA 4MBGA 3F6QA 4X8QA 2XPIA 1H2UA 1U3CA 5ENRD 2OCCE 5CEDB 2F8YA 1NP7A 4WNDA 2A5UA 4GTTA 3HIZA 3ZEFA 1SA4A 2F8XK 1RZ4A 3DBSA 2GRLA 3FUMA 2KC7A 2XQ0A 4PUCA 2KCLA 3ZFWA 4K0RA 1N52A 3EHNA 4HRMB 4YDEA 4ZFHA 3CR3A 3ASGA 3SO8A 4ILHB 2GRMA 3FTUA 2UY1A 4N3BA 3DSUA 2XRZA 3EU9A 3PREA 4GTRA 3SY2A 1BLXB 4BT8A 2J08A 1O5MA 4UWLA 3CHMA 4GPMA 4AOFA 1Z5SC 3UINC 3MGBA 4W9RA 4XE0A 4OVUA 3AG4E 1TJCA 5CBOA 4O6FA 2CFUA 3QWVA 4HRLA 3UIOC 4LNUD 4GCOA 4C0MA 1MJ0A 4J8DA 2X38A 2B6CA 4Y6WA 1LD7A 3RO2A 3J5QB 3V31A 3QWWA 4TUUA 2XPZA 4XI9A 4UQYA 3CHQA 2WXRA 1JPLA 4XKBA 2L9BA 2H6FA 4JHJA 1E96B 2L0IA 3PUJA 4BTBA 3D9JA 3C5RA 3D9MA 4I9CA 5AJDA 3NAWA 3UM2A 1KPSB 2V4LA 3DRAA 3C3QA 3G2SA 4QQIA 3VLDA 5KJNA 3ZHEA 4PS8A 4C0EA 1HG2A 3I5PA 3TG5A 3ZUVB 1BPOA 3CVNA 1B89A 5B1AE 2LXLA 4DX2A 1HFAA 2IO3C 3L6AA 4EBAG 5B3SE 3TXNA 1D9SA 1HG5A 3FU6A 2I6HA 1Z3XA 3D3MA 2PM7A 4EPZA 3CGHA 2QY7A 4FA6A 4B89A 1UG3A 2ZGGA 4URKA 5E76A 4BETA 3IKOB 4ATZD 5EIDA 3FTZA 3TWVA 3TWTA 4WNGA 4L7TA 1HXIA 2P58C 3Q9UC 4GYOA 1DNPA 2XZTG 5FZSA 1DCQA 4KT6B 4IRUA 5DIZA 1MHQA 2YQ8A 3SHFA 2EIJE 3FWVA 3FTSA 2WXHA 2XRYA 3QDNA 4BX8A 5AQBA 4JPSA 4XX5A 3EDTB 5KJMA 5C1DA 2J09A 4APFA 3BUAA 4GA0A 4FHKA 3UI2A 2E0IA 2FO7A 2R2LA 3CIAA 4JZYA 3ZW3A 4HLEA 3RKVA 3Q78A 3CVYA 1HE8A 4L2LA 1TNOA 4YDYA 4DX1A 3NQPA 3APFA 2L6JA 4GYYA 4ANVA 2VSNA 3T5XA 3TWXA 4UQZA 5ENPD 3U9WA 4U8YD 2H6GA 4G8LA 2DZOA 2ZXWE 2XCBA 5HQ8A 3I4GA 1OXJA 3Q9NC 3C72A 3IHVA 4YNDA 3CVWA 4OAVB 4MRUA 4RQIA 2XGOA 3APCA 2Y4TA 3LXUX 1INZA 4BSXA 3CLJA 3HG0D 5ENNA 2R02A 2E2EA 4KVMA 3RRNB 3V2XA 5G55A 4FULA 4WAFA 3JXJA 3HRAA 4HS2A 3CSFA 3HXEA 4LG6A 5LP0A 3DEPA 3ASDA 4BERA 1X81A 3MKQB 2BF0X 2P9KG 4CYMD 3CQCB 2ONDA 5CCMA 1NA0A 1EDUA 3FUKA 3Q5MA 5JJTA 4ANUA 5T3RA 3U4TA 1AP7A 5C2YA 3TAXA 1HU3A 3LYAA 3MKRA 4HXIA 1N4RA 4I1MA 1N9AA 2VGXB 3G2TA 4N39A 1NI1A 3EHQA 3DSWA 1GW6A 4DX5D 2PQNA 4JA9A 2QYJA 1N11A 5CEAA 4OVVA 1OWOA 3FH7A 3C98A 4J8EA 4EZKA 2EQXA 4E85A 3ISMC 4N2QA 3CVUA 3R9MA 5M72A 4EZJA 1E7UA 4KYOB 3CK7A 1NL4A 4AY6A 4FHJA 1S0PA 4J7WA 2P9SG 5JA4D 3LPZA 4JL0A 3URZA 3CHRA 3N71A 3IXEA 4UQXA 2JABA 1SZ9A 4QFVA 2XZDG 3B7RL 3L9TA 3DSXA 3U66A 2VSYA 3EIJA 5KNGA 2IU1A 4KBQA 3UIPC 1S64A 1JWFA 3DSSA 4Y6CA 3ONKA 1N95A 2V8SE 1QQEA 1QZ2A 1G3NB 1K3ZD 1TNBA 4AM9A 2C0MA 4U0SA 3ULYA 1O1SA 4JC8A 4BY6A 5BXUA 1H2TC 3IHYA 3JQ1A 5LCWC 2R17C 4HRNA 5KJLA 2P9IG 3EJNA 5FT9A 3CVXA 4EECA 1E7VA 1H6PA 5FQ4A 2IQCA 5G04J 2AVPA 4XEIG 4O1OA 3E37A 1TN6A 3OXGA 2CG3A 3UXGA 3QNKA 3D9HA 5JJ6A 2VSXE 1PC2A 2IOLA 5AYWD 4G2VA 2XCCA 4LUNU 1TNYA 3Q73A 3PZ2A 1LF8A 4F3VA 3LY9A 4MS6A 1UOHA 2WXGA 1OCOE 2XGMA 4XI0A 3L22A 2VYIA 3ESKA 2QFCA 2HYZA 3KSQA 5H7PA 5FZRA 1HH8A 4LEUA 2L0TB 3BU8A 3C3OA 4APOA 4JW1A 3D9OA 5T8IA 1KLXA 5EYLA 1FT2A 5CECB 3FDHA 2LSVA 3FH5A 3AS5A 5AARA 3B7TA 2HR2A 2RG8A 3PVLA 3QOUA 3HXDA 1P5QA 1ELWA 1SQMA 1YMPA 2DCPA 2BEDA 2XEVA 1MZCA 4KZCA 1K1BA 3UKRG 4HNAD 3S2AA 1FVHA 3HVEB 4L9PA 1L5JA 3DWLG 2IF4A 2DZNA 1BI7B 1YYHA 3MCXA 5E75A 4CDMA 3CVVA 3D9PA 3VTXA 3L08A 2GRQB 4L1BA 4D10C 2PM6A 4JHRA 4KMOA 4XZ4A 1N4PA 2LAHA 4LNBA 3FUDA 2FBNA 3PZ1A 3Q7AA 4AIFA 3SI5A 3ZYLA 2EIME 2LO6A 2IY0C 1JCQA 4ME2A 1V55E 2IJGX 2LNIA 2HM8A 1KZPA 2H6HA 1SZAA 2UY1B 2AXVA 4ANWA 1HS6A 3Q47B 4YVOA 5ENSD 4BT9A 3SFYA 4GTQA 3RJVA 5T4YA 4N2SA 4WNFA 2XEHA
chains in the Genus database with same CATH topology
2DYRE 3ABLE 2Y69E 2ZXWE 3AG3E 3WG7E 2OCCE 5B1BE 3X2QE 1OCRE 5B3SE 1V54E 2EIKE 3ABKE 3AG4E 2EIJE 1OCCE 3AG2E 3ASOE 3ASNE 2EILE 2EIME 3AG1E 1OCZE 2DYSE 5IY5E 1V55E 3ABME 1OCOE 5B1AE 2EINE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DYR E;  3ABL E;  2Y69 E;  2ZXW E;  3AG3 E;  3WG7 E;  2OCC E;  5B1B E;  3X2Q E;  1OCR E;  5B3S E;  1V54 E;  2EIK E;  3ABK E;  3AG4 E;  2EIJ E;  1OCC E;  3AG2 E;  3ASO E;  3ASN E;  2EIL E;  2EIM E;  3AG1 E;  1OCZ E;  2DYS E;  5IY5 E;  1V55 E;  3ABM E;  1OCO E;  5B1A E;  2EIN E; 
#chains in the Genus database with same CATH topology
 1K8K G;  4J0U A;  1WY6 A;  4DPR A;  2I1K A;  4OYS A;  3E4B A;  3B95 A;  4H7X A;  4UWH A;  3ASF A;  3Q49 B;  3PRZ A;  3PZ4 A;  5IY5 E;  1A5E A;  4DUI A;  3CHP A;  2AW6 A;  3OXF A;  5BPP A;  4GMR A;  4FC8 A;  2WXM A;  1OWP A;  1YA0 A;  3JXI A;  4DX6 D;  5FQ8 A;  2KCV A;  3PUK A;  4IYP A;  4V3I A;  2Y0B G;  3FHE A;  3VTY A;  3ZHE B;  3KS2 A;  4GU5 A;  4UI9 C;  3I3N A;  5FIO A;  4ANX A;  4KVO A;  3UMV A;  5ITZ F;  1MX2 A;  4HBD A;  3J5P A;  2JEK A;  5LCW J;  1EYH A;  4XKC A;  4LRZ A;  2FI7 A;  2XEE A;  1S70 B;  2EIL E;  3PE4 A;  1N4Q A;  4AP2 A;  1FCH A;  4J8Y A;  2X6F A;  2MYO A;  2MOW A;  4M7C A;  2KAT A;  1H19 A;  3FTX A;  3UX4 A;  3AG3 E;  3ZIM A;  3FEY A;  3ZXP A;  3UTM A;  3LY8 A;  2I9C A;  3PDN A;  3SGH A;  3RK6 A;  4K5A B;  3BG0 B;  1LTX A;  4BES A;  3TG4 A;  3FU5 A;  4GAA A;  4FLB A;  3ZYQ A;  4HOQ A;  4F7A A;  2FF4 A;  3UT8 A;  1OWN A;  3TGO A;  2X3M A;  3UT7 A;  4TV3 A;  3ESL A;  5HRY A;  3QB2 A;  4RSY A;  4JD2 G;  1WM5 A;  5FZQ A;  3GW4 A;  3NOC D;  2ETC A;  4TXP A;  4U63 A;  3CKB A;  4BEP A;  5FQ7 A;  3LKU A;  4GMJ A;  2F37 A;  2YHE A;  3BQO A;  3PZ3 A;  1SA5 A;  2WMO A;  2EIK E;  1MX4 A;  3FP3 A;  2P9N G;  2H6I A;  1FPP A;  5KNH D;  1OUV A;  4ATG A;  1JCS A;  1K1A A;  3NBN B;  2R59 A;  3T8K A;  1IXV A;  5D0O D;  2ZIR A;  1AWC B;  4YVQ C;  4JA7 A;  4U95 D;  1TR4 A;  3Q75 A;  2R5S A;  3RRU A;  1SVX A;  5G2N A;  3FUL A;  4GTO A;  5KCM A;  3ASN E;  3FTW A;  2VGE A;  1BD8 A;  1N4S A;  1TNU A;  5CER B;  3DSV A;  4A55 A;  4C48 B;  2OEV A;  2J49 A;  3GZ1 A;  3UPV A;  2R05 A;  2J8S D;  5BNW A;  3RAU A;  4K5B A;  4HLL A;  1ELK A;  3HXC A;  2DIW A;  2WB2 A;  3MEK A;  1LD8 A;  3CK9 A;  5CMY A;  3DPY A;  4BTA A;  4JXT A;  3DST A;  3Q15 A;  2B0O E;  3ENE A;  2NXP A;  2F0Y A;  4U0U A;  4CT4 A;  3SBT B;  4Q69 A;  4WUY A;  5JHB A;  3B13 A;  3S7F A;  3ABK E;  4JHK A;  3ZYM A;  2X6H A;  3LDZ A;  3FU0 A;  3LS8 A;  4HOU A;  4YDW A;  3FUH A;  1H6K A;  4F53 A;  3QK0 A;  3GZ2 A;  2LAI A;  3AS8 A;  2VGY A;  4UUC A;  3T8M A;  3ZVV A;  3K9I A;  2YNQ A;  3ZKJ A;  4DRX E;  1Z3Y A;  4WWO A;  1HX8 A;  4GCN A;  5EKQ D;  3ML8 A;  2YHC A;  1ZBP A;  5DBK A;  4J8S A;  4L2Y A;  5EIL A;  1Q2Z A;  1TN8 A;  3ONL A;  2P9U G;  3WXX A;  4N3C A;  4CGW A;  2GRP B;  5BXO A;  4FP7 A;  4DLO A;  3LVQ E;  3ZN3 A;  2AWI A;  4U04 A;  4AVX A;  3S7D A;  3BG1 B;  4UI9 J;  1TNZ A;  4B94 A;  4KXK B;  2WM9 A;  4LCT A;  2WVI A;  2Y4U A;  2V0P A;  3E32 A;  4CDN A;  2FO1 E;  5ARF A;  4RG6 A;  3ASH A;  3R9A B;  4GTV A;  4A1S A;  1JWG A;  3QAQ A;  3FTV A;  1MX6 A;  3FUJ A;  4HI8 A;  3DEO A;  3LVR E;  3O48 A;  4HI9 A;  3S7B A;  2WQH A;  4DLQ A;  2RFM A;  2IFU A;  2QZA A;  2KZT A;  2UWJ G;  3ZXS A;  3AU5 A;  4JVS A;  3D9N A;  2AXU A;  3PZD A;  1XNF A;  3E33 A;  3JUE A;  3SZ7 A;  3FUE A;  2KZT B;  1ZU2 A;  3PS6 A;  3R7Q A;  5J90 A;  4I6G A;  1NZN A;  2J4D A;  3GYZ A;  2AJA A;  3EIQ C;  2I1J A;  4G26 A;  1FT1 A;  3ZNG A;  1YCS B;  1Y8M A;  2CFZ A;  3P2B A;  1IQU A;  4FLH A;  4FJY A;  4TRQ A;  4AXH A;  4GTP A;  4O1P A;  3L17 A;  2OV8 A;  1A17 A;  1H2V C;  2C2L A;  4H7Y A;  2OVF A;  5EDS A;  3B7S A;  5B1B E;  4G23 A;  2ILR A;  3BEE A;  4HQD A;  4BWR A;  3FFL A;  2WMN A;  3ZGQ A;  2ZGD A;  5D66 A;  1OCZ E;  1D8D A;  1BU9 A;  4J8F A;  3Q4A B;  5AJL A;  1E8Y A;  2WXK A;  3FUI A;  2X6J A;  3G2U A;  2PNN A;  3AAA C;  4GTM A;  5AAO A;  2PZI A;  3SF4 A;  3S7J A;  4CDR A;  2CHW A;  3QC1 A;  4RLY A;  3AJI A;  2RD0 A;  1KT1 A;  2P9P G;  4JEU A;  4EBA A;  3AG1 E;  1ELR A;  2L6B A;  4HOS A;  4A1G A;  3ZPJ A;  3ULQ A;  4GZC A;  3SNX A;  3VLE A;  4KZ0 A;  3FUN A;  4TXR A;  4E6H A;  3NZS A;  4GML A;  3ZU7 B;  1TYQ G;  3MJW A;  5FIN A;  2XEN A;  2MRI A;  1DVP A;  3JUI A;  2OOE A;  5CBN A;  2ZIS A;  2HO1 A;  3DPD A;  4BFR A;  4GYW A;  4G25 A;  3OAW A;  1DCE A;  5A23 A;  3LY7 A;  2OEW A;  2WQ7 A;  2WXF A;  2PL2 A;  4FAD A;  5EX0 A;  4G11 A;  4DJA A;  2VTB A;  4WWP A;  2OVB A;  3PEV B;  2NSZ A;  3W9G A;  3UM3 A;  4NQ0 A;  3TWQ A;  4LNG A;  3QWP A;  1IHG A;  4G8K A;  4I6J A;  5ANL A;  3GZS A;  2WPV A;  4ILG A;  2VTB B;  1SW6 A;  5D0Q D;  3DXK G;  4N5Q A;  4PH4 B;  3ML9 A;  3JQ0 A;  5J08 A;  1OCR E;  2KM4 A;  5CMW A;  5LOZ A;  3ZYK A;  3CST A;  2BKG A;  5KWD A;  2A4Z A;  2GRN B;  1W3B A;  1E8X A;  5HI7 A;  2A5E A;  3ABM E;  4AV7 A;  1O1R A;  4HFG A;  3TL5 A;  2ION A;  1IYG A;  2QYU A;  4A63 B;  2DYR E;  2GRR B;  4U7E B;  2V5Q C;  2WXJ A;  3RRM B;  4EQF A;  3NF1 A;  3CV0 A;  4O60 A;  5A7D B;  3TWR A;  1ZB1 A;  3PE3 A;  4GZD A;  1KT0 A;  4BX9 A;  2CG2 A;  4ACL A;  1HO8 A;  4CEM A;  4OAU C;  3L16 A;  3V79 K;  1EF1 C;  1QBQ A;  3P1U A;  2DBA A;  1IQR A;  3FY4 A;  3X2Q E;  3KAE A;  4PS3 A;  5G05 C;  3UKU G;  1QNF A;  3UT4 A;  3LCA A;  4UWK A;  3HXF A;  1JUQ A;  4PDX A;  1PAQ A;  2XS8 A;  4F1P A;  4GB9 A;  4B8A A;  2GRO B;  2AXZ A;  3RSE G;  5AQ9 A;  3HXB A;  3Q7F A;  4EZL A;  2WXO A;  5AQA A;  4GPK A;  4AEZ C;  4I2Z A;  4CGV A;  4NIK A;  3MV3 B;  1U3D A;  1H6O A;  4ABN A;  4EHM A;  4L23 A;  4I1O B;  4G24 A;  2WXN A;  3CKC A;  2XGS A;  2DYS E;  3QJZ A;  5AEN A;  2ZU6 B;  4CZ2 D;  5EIB E;  3NB2 A;  4LSZ E;  2NYJ A;  1UN8 A;  4U0Z A;  4F1S A;  2LXM A;  3ZRH A;  2ETA A;  2JLB A;  3PH0 C;  1TJF A;  3B7U X;  3FU3 A;  2YIN A;  1KZO A;  5BV0 A;  1E8Z A;  5CRU A;  4C9B B;  4GZ6 A;  4HOT A;  2V5F A;  4DI4 A;  2XS1 A;  2IEJ A;  4I43 A;  5AQ7 A;  1X5B A;  2FEZ A;  3DXM G;  5KJK A;  4MKT A;  4HVB A;  3SD5 A;  5A6C A;  1OWM A;  2VJ8 A;  3EUV A;  1DC2 A;  2GGF A;  2KBX A;  5JJ7 A;  5G04 C;  3MV2 B;  2C0L A;  2MHK A;  3NZU A;  4F6R D;  2M63 A;  3G2W A;  3U64 A;  1Y6I A;  4Z68 A;  3IEG A;  2P2C P;  4Q96 A;  4TUM A;  2ETB A;  3B7B A;  3CHO A;  3OTN A;  1PY1 A;  3V30 A;  3UUX A;  2X6K A;  4N3A A;  5LFA A;  2CHX A;  2IOS A;  2WXQ A;  2Q7F A;  3C3R A;  4NAC A;  1VDY A;  2J9Q A;  1EPU A;  2Y3A A;  4IN3 B;  4RVB A;  5BUZ A;  2KCK A;  4CRW A;  4AJW A;  5ENQ D;  2J07 A;  1TN7 A;  1N94 A;  3O4Z A;  4HB5 A;  3PNL B;  4IUL A;  4B8C B;  1H0A A;  4UWF A;  4U8H A;  3FUF A;  3ASO E;  4ACK A;  4FJZ A;  3RO3 A;  5FJY A;  2PQR A;  3MKQ A;  5JHA A;  3OXL A;  3UM1 A;  4JEH A;  4YDO A;  3HYM B;  4I6E A;  3MA5 A;  2WXI A;  1OY3 D;  3CEQ A;  1MQS A;  1HF8 A;  4J6I A;  1WDY A;  3L13 A;  4PS7 A;  4U96 D;  4I17 A;  3FTY A;  5HS0 A;  2EIN E;  3ULE G;  5BW8 C;  4RG9 A;  3CQG B;  4DI3 A;  3CK8 A;  3UQ3 A;  4U07 A;  4NRH B;  1MYO A;  4BSZ B;  5D2M C;  3MZL B;  1D8E A;  3PEU B;  2VGX A;  4LER A;  3NOG D;  3KEA A;  4FU3 A;  1HZ4 A;  3WG7 E;  5G05 J;  3E30 A;  3R7R A;  3AG2 E;  1OT8 A;  3D9L A;  3U3W A;  1NA3 A;  3LJN A;  3AS4 A;  3HDX A;  3SBS A;  2P9L G;  2LUH A;  1IKN D;  4K5C A;  2CHZ A;  2QC9 A;  3IBE A;  2Y69 E;  3TWW A;  4R7L A;  2RKK A;  4GA2 A;  5BV1 A;  3V2O A;  4B0Z A;  3CHS A;  4UI9 K;  3G2V A;  2BUG A;  3JCK C;  3JYS A;  1RW2 A;  4GZ3 A;  3EHR A;  3VLF A;  3TWU A;  3HHM A;  4WNE A;  3KD7 A;  3SQV A;  3EU5 A;  1OCC E;  4M3O A;  1WAO 1;  4JB8 P;  3MYV A;  5KBA A;  3FH8 A;  3RIB A;  4WWN A;  5AN8 A;  2LSU A;  1N0R A;  5EYP F;  4P29 A;  1Z6T A;  5CHE E;  2RFA A;  5ANR A;  4ZHB A;  2BTD A;  1BI8 B;  3KEZ A;  3LEW A;  4I9E A;  3SFZ A;  2R03 A;  3IV0 A;  2HE0 A;  1OWL A;  1UJJ A;  4MLP A;  3FEX A;  4GTS A;  1TEZ A;  5CRV A;  3T5V A;  3AU4 A;  5HKP A;  2I2O A;  1O1T A;  3APD A;  5EX3 A;  4K03 A;  2VSO E;  1E8W A;  3MX3 A;  2NC9 A;  5JMN D;  3SFX A;  1QYM A;  4DK5 A;  5FTP A;  3PNT B;  5FQ6 A;  5AIJ A;  1N0Q A;  1V54 E;  1N54 A;  1XGW A;  5ENO D;  4NUR A;  3E34 A;  5LX8 A;  3CVQ A;  1JCR A;  3UM0 A;  1IHB A;  5ARG A;  2J4B A;  5BT1 A;  2DWZ A;  2XHE A;  4CCA A;  1E90 A;  3D9I A;  2BKK B;  1NFI E;  1FVF A;  4HOR A;  3TXM A;  3D9K A;  4CT0 A;  2V4H C;  4N5C A;  2IO2 C;  4GZ5 A;  5CCL A;  3I4R B;  4ILI A;  1UJK A;  3EHM A;  3LJ3 A;  1U2V G;  2FUL A;  4DX7 D;  4I2W A;  3L82 A;  3ABL E;  4U8V D;  3RU0 A;  4G1T A;  2XPY A;  4B93 B;  4Q94 A;  3Q79 A;  5ENT D;  2WQ6 A;  3W9F A;  3L54 A;  4I1A A;  3TJP A;  5FWQ A;  3CVP A;  3T9K A;  1UN9 A;  1S63 A;  5EN5 D;  3QKY A;  4AY5 A;  2WXP A;  2WXL A;  2DVW A;  4XIF A;  4A3T A;  4A3V A;  1UW4 B;  3KSL A;  4GA1 A;  2Y1L E;  3HVE A;  1WG0 A;  3CVL A;  2X6I A;  4TXQ A;  2VQ2 A;  4UWG A;  3TWS A;  2GW1 A;  2KXP C;  3QAR A;  4MBG A;  3F6Q A;  4X8Q A;  2XPI A;  1H2U A;  1U3C A;  5ENR D;  2OCC E;  5CED B;  2F8Y A;  1NP7 A;  4WND A;  2A5U A;  4GTT A;  3HIZ A;  3ZEF A;  1SA4 A;  2F8X K;  1RZ4 A;  3DBS A;  2GRL A;  3FUM A;  2KC7 A;  2XQ0 A;  4PUC A;  2KCL A;  3ZFW A;  4K0R A;  1N52 A;  3EHN A;  4HRM B;  4YDE A;  4ZFH A;  3CR3 A;  3ASG A;  3SO8 A;  4ILH B;  2GRM A;  3FTU A;  2UY1 A;  4N3B A;  3DSU A;  2XRZ A;  3EU9 A;  3PRE A;  4GTR A;  3SY2 A;  1BLX B;  4BT8 A;  2J08 A;  1O5M A;  4UWL A;  3CHM A;  4GPM A;  4AOF A;  1Z5S C;  3UIN C;  3MGB A;  4W9R A;  4XE0 A;  4OVU A;  3AG4 E;  1TJC A;  5CBO A;  4O6F A;  2CFU A;  3QWV A;  4HRL A;  3UIO C;  4LNU D;  4GCO A;  4C0M A;  1MJ0 A;  4J8D A;  2X38 A;  2B6C A;  4Y6W A;  1LD7 A;  3RO2 A;  3J5Q B;  3V31 A;  3QWW A;  4TUU A;  2XPZ A;  4XI9 A;  4UQY A;  3CHQ A;  2WXR A;  1JPL A;  4XKB A;  2L9B A;  2H6F A;  4JHJ A;  1E96 B;  2L0I A;  3PUJ A;  4BTB A;  3D9J A;  3C5R A;  3D9M A;  4I9C A;  5AJD A;  3NAW A;  3UM2 A;  1KPS B;  2V4L A;  3DRA A;  3C3Q A;  3G2S A;  4QQI A;  3VLD A;  5KJN A;  3ZHE A;  4PS8 A;  4C0E A;  1HG2 A;  3I5P A;  3TG5 A;  3ZUV B;  1BPO A;  3CVN A;  1B89 A;  5B1A E;  2LXL A;  4DX2 A;  1HFA A;  2IO3 C;  3L6A A;  4EBA G;  5B3S E;  3TXN A;  1D9S A;  1HG5 A;  3FU6 A;  2I6H A;  1Z3X A;  3D3M A;  2PM7 A;  4EPZ A;  3CGH A;  2QY7 A;  4FA6 A;  4B89 A;  1UG3 A;  2ZGG A;  4URK A;  5E76 A;  4BET A;  3IKO B;  4ATZ D;  5EID A;  3FTZ A;  3TWV A;  3TWT A;  4WNG A;  4L7T A;  1HXI A;  2P58 C;  3Q9U C;  4GYO A;  1DNP A;  2XZT G;  5FZS A;  1DCQ A;  4KT6 B;  4IRU A;  5DIZ A;  1MHQ A;  2YQ8 A;  3SHF A;  2EIJ E;  3FWV A;  3FTS A;  2WXH A;  2XRY A;  3QDN A;  4BX8 A;  5AQB A;  4JPS A;  4XX5 A;  3EDT B;  5KJM A;  5C1D A;  2J09 A;  4APF A;  3BUA A;  4GA0 A;  4FHK A;  3UI2 A;  2E0I A;  2FO7 A;  2R2L A;  3CIA A;  4JZY A;  3ZW3 A;  4HLE A;  3RKV A;  3Q78 A;  3CVY A;  1HE8 A;  4L2L A;  1TNO A;  4YDY A;  4DX1 A;  3NQP A;  3APF A;  2L6J A;  4GYY A;  4ANV A;  2VSN A;  3T5X A;  3TWX A;  4UQZ A;  5ENP D;  3U9W A;  4U8Y D;  2H6G A;  4G8L A;  2DZO A;  2ZXW E;  2XCB A;  5HQ8 A;  3I4G A;  1OXJ A;  3Q9N C;  3C72 A;  3IHV A;  4YND A;  3CVW A;  4OAV B;  4MRU A;  4RQI A;  2XGO A;  3APC A;  2Y4T A;  3LXU X;  1INZ A;  4BSX A;  3CLJ A;  3HG0 D;  5ENN A;  2R02 A;  2E2E A;  4KVM A;  3RRN B;  3V2X A;  5G55 A;  4FUL A;  4WAF A;  3JXJ A;  3HRA A;  4HS2 A;  3CSF A;  3HXE A;  4LG6 A;  5LP0 A;  3DEP A;  3ASD A;  4BER A;  1X81 A;  3MKQ B;  2BF0 X;  2P9K G;  4CYM D;  3CQC B;  2OND A;  5CCM A;  1NA0 A;  1EDU A;  3FUK A;  3Q5M A;  5JJT A;  4ANU A;  5T3R A;  3U4T A;  1AP7 A;  5C2Y A;  3TAX A;  1HU3 A;  3LYA A;  3MKR A;  4HXI A;  1N4R A;  4I1M A;  1N9A A;  2VGX B;  3G2T A;  4N39 A;  1NI1 A;  3EHQ A;  3DSW A;  1GW6 A;  4DX5 D;  2PQN A;  4JA9 A;  2QYJ A;  1N11 A;  5CEA A;  4OVV A;  1OWO A;  3FH7 A;  3C98 A;  4J8E A;  4EZK A;  2EQX A;  4E85 A;  3ISM C;  4N2Q A;  3CVU A;  3R9M A;  5M72 A;  4EZJ A;  1E7U A;  4KYO B;  3CK7 A;  1NL4 A;  4AY6 A;  4FHJ A;  1S0P A;  4J7W A;  2P9S G;  5JA4 D;  3LPZ A;  4JL0 A;  3URZ A;  3CHR A;  3N71 A;  3IXE A;  4UQX A;  2JAB A;  1SZ9 A;  4QFV A;  2XZD G;  3B7R L;  3L9T A;  3DSX A;  3U66 A;  2VSY A;  3EIJ A;  5KNG A;  2IU1 A;  4KBQ A;  3UIP C;  1S64 A;  1JWF A;  3DSS A;  4Y6C A;  3ONK A;  1N95 A;  2V8S E;  1QQE A;  1QZ2 A;  1G3N B;  1K3Z D;  1TNB A;  4AM9 A;  2C0M A;  4U0S A;  3ULY A;  1O1S A;  4JC8 A;  4BY6 A;  5BXU A;  1H2T C;  3IHY A;  3JQ1 A;  5LCW C;  2R17 C;  4HRN A;  5KJL A;  2P9I G;  3EJN A;  5FT9 A;  3CVX A;  4EEC A;  1E7V A;  1H6P A;  5FQ4 A;  2IQC A;  5G04 J;  2AVP A;  4XEI G;  4O1O A;  3E37 A;  1TN6 A;  3OXG A;  2CG3 A;  3UXG A;  3QNK A;  3D9H A;  5JJ6 A;  2VSX E;  1PC2 A;  2IOL A;  5AYW D;  4G2V A;  2XCC A;  4LUN U;  1TNY A;  3Q73 A;  3PZ2 A;  1LF8 A;  4F3V A;  3LY9 A;  4MS6 A;  1UOH A;  2WXG A;  1OCO E;  2XGM A;  4XI0 A;  3L22 A;  2VYI A;  3ESK A;  2QFC A;  2HYZ A;  3KSQ A;  5H7P A;  5FZR A;  1HH8 A;  4LEU A;  2L0T B;  3BU8 A;  3C3O A;  4APO A;  4JW1 A;  3D9O A;  5T8I A;  1KLX A;  5EYL A;  1FT2 A;  5CEC B;  3FDH A;  2LSV A;  3FH5 A;  3AS5 A;  5AAR A;  3B7T A;  2HR2 A;  2RG8 A;  3PVL A;  3QOU A;  3HXD A;  1P5Q A;  1ELW A;  1SQM A;  1YMP A;  2DCP A;  2BED A;  2XEV A;  1MZC A;  4KZC A;  1K1B A;  3UKR G;  4HNA D;  3S2A A;  1FVH A;  3HVE B;  4L9P A;  1L5J A;  3DWL G;  2IF4 A;  2DZN A;  1BI7 B;  1YYH A;  3MCX A;  5E75 A;  4CDM A;  3CVV A;  3D9P A;  3VTX A;  3L08 A;  2GRQ B;  4L1B A;  4D10 C;  2PM6 A;  4JHR A;  4KMO A;  4XZ4 A;  1N4P A;  2LAH A;  4LNB A;  3FUD A;  2FBN A;  3PZ1 A;  3Q7A A;  4AIF A;  3SI5 A;  3ZYL A;  2EIM E;  2LO6 A;  2IY0 C;  1JCQ A;  4ME2 A;  1V55 E;  2IJG X;  2LNI A;  2HM8 A;  1KZP A;  2H6H A;  1SZA A;  2UY1 B;  2AXV A;  4ANW A;  1HS6 A;  3Q47 B;  4YVO A;  5ENS D;  4BT9 A;  3SFY A;  4GTQ A;  3RJV A;  5T4Y A;  4N2S A;  4WNF A;  2XEH A; 
#chains in the Genus database with same CATH homology
 2DYR E;  3ABL E;  2Y69 E;  2ZXW E;  3AG3 E;  3WG7 E;  2OCC E;  5B1B E;  3X2Q E;  1OCR E;  5B3S E;  1V54 E;  2EIK E;  3ABK E;  3AG4 E;  2EIJ E;  1OCC E;  3AG2 E;  3ASO E;  3ASN E;  2EIL E;  2EIM E;  3AG1 E;  1OCZ E;  2DYS E;  5IY5 E;  1V55 E;  3ABM E;  1OCO E;  5B1A E;  2EIN E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...