2V5FA

Crystal structure of wild type peptide-binding domain of human type i collagen prolyl 4-hydroxylase.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
97
structure length
97
Chain Sequence
b'FLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Crystal Structure of Wild Type Peptide-Binding Domain of Human Type I Collagen Prolyl 4- Hydroxylase.
rcsb
total genus 37
structure length 97
sequence length 97
ec nomenclature ec 1.14.11.2: Procollagen-proline 4-dioxygenase.
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2v5fA00
3QKYA 4GCOA 3FFLA 2VGYA 4N3BA 1PC2A 2PL2A 4BT9A 4UQZA 5KJMA 4N2SA 2DBAA 3GW4A 3LY9A 3Q15A 4GYWA 2KCVA 4RG6A 4CGWA 3MV3B 4N5CA 4UI9J 4U07A 3HYMB 5FT9A 3ZFWA 4CDRA 2IFUA 4CGVA 4HOUA 3MKRA 1HXIA 2KCKA 2XGMA 1QQEA 3WXXA 3KS2A 5CCMA 1HH8A 3K9IA 5FZQA 4N2QA 3LKUA 4JA7A 4I9CA 5KJLA 3FWVA 3S7FA 3QOUA 2XPIA 4N39A 3KAEA 1E96B 1NZNA 2I6HA 3AS5A 2AVPA 3MA5A 3MV2B 4H7YA 4AIFA 4GPKA 3ASFA 3QWPA 4I17A 4I9EA 3UUXA 2P58C 4KBQA 2UY1A 3PE4A 4GA1A 5D0QD 3SF4A 4Y6CA 2IF4A 1YA0A 2NC9A 5BW8C 1KLXA 3MEKA 2Y4UA 4W9RA 3CKBA 5EKQD 5FZSA 4ABNA 2E2EA 3KD7A 4NQ0A 4Y6WA 3ASHA 3PDNA 3TGOA 5KJNA 5C1DA 4KXKB 1ZU2A 4HOTA 4JA9A 3LCAA 1OUVA 2HYZA 3CK8A 4G2VA 4I2ZA 3RJVA 3ZPJA 2YQ8A 2LSVA 3AS8A 3CV0A 5BNWA 3FP3A 3TG5A 4HORA 1B89A 3CVLA 1ELRA 2FEZA 5CHEE 5A6CA 4G24A 3ULQA 1FCHA 2R5SA 3RO3A 1Y8MA 5HQ8A 2C0LA 3GZ1A 2XCBA 3Q47B 5M72A 2C2LA 2HR2A 3GYZA 3S7JA 3U3WA 4GZ6A 4XI9A 4WNFA 5DBKA 1IHGA 1TJCA 2V5FA 4N3AA 5EX3A 4I2WA 3CEQA 3N71A 3OXGA 4GYYA 2FI7A 2JLBA 4LEUA 4U04A 5G05C 3S7DA 5JJ7A 5FTPA 3CVQA 4GZ5A 1W3BA 4JL0A 3VTYA 1IYGA 3GZ2A 3O48A 3QWVA 3Q4AB 3TG4A 2GW1A 2Q7FA 4YVOA 2QFCA 3ZN3A 3CKCA 4IN3B 5ARGA 5G04C 4G26A 4APOA 1P5QA 2PZIA 1WAO1 2WQHA 2PQNA 5FJYA 5AYWD 2L6JA 2YHCA 3ASGA 2KCLA 3S7BA 5CCLA 4HOQA 4UI9C 2VGXA 3LY7A 3ZHEB 1KT1A 2FO7A 4J8FA 3QWWA 4GZ3A 3OXLA 5A7DB 3UQ3A 1A17A 4B94A 5KJKA 4AY6A 2HO1A 2OOEA 3PE3A 2XGOA 2KC7A 5D0OD 2XGSA 2LSUA 3E4BA 5EX0A 2MHKA 1ELWA 3NF1A 4WNGA 2Y4TA 2LNIA 5G04J 3ESKA 4U0SA 4J8EA 3IEGA 3OXFA 4WUYA 2C0MA 1QZ2A 4U0UA 2VSYA 4U0ZA 3QDNA 4EQFA 2KATA 1WM5A 1XNFA 2VGXB 4UQYA 3ASDA 3CK7A 2VYIA 4UI9K 3Q49B 3LY8A 5G05J 3JYSA 3R9AB 3CK9A 4AM9A 2BUGA 4NRHB 4YVQC 4I1AA 3ZGQA 4F3VA 3Q5MA 4J8DA 4N3CA 5BT1A 2XCCA 1NA3A 4O6FA 5JJ6A 4BTAA 4G1TA 4GA0A 1HZ4A 4A1SA 2J9QA 2PQRA 5ARFA 2FF4A 4WNEA 4YNDA 4UQXA 4BTBA 3LPZA 3RO2A 2UY1B 4G25A 4XI0A 5LCWC 3CVNA 4GA2A 4BWRA 5JJTA 4HOSA 3RIBA 4J0UA 2FBNA 4AY5A 3EDTB 4KYOB 3RU0A 1NA0A 4WNDA 4GYOA 2VQ2A 3TAXA 3CVPA 2XEVA 2VSNA 4G23A 4JHRA 3URZA 4BT8A 3UPVA 3U4TA 1ZBPA 3VTXA 3AS4A 3RKVA 1KT0A 4RG9A 4H7XA 2ONDA 2UWJG 4ME2A 4XIFA 3BEEA 3LYAA 5HI7A 3ZHEA 5LCWJ 2WPVA 4GCNA 5FZRA 3SZ7A 5DIZA
chains in the Genus database with same CATH superfamily
4ATZD 4E6HA 3G2TA 1HH8A 3K9IA 3RK6A 3SGHA 3CVWA 4C48B 3E33A 1NZNA 3MKQA 4GTMA 5CBNA 2XRYA 3Q7AA 1YCSB 4HRLA 4G8LA 2QYUA 4BX9A 3Q78A 1UN9A 4KXKB 4JA9A 3CK8A 4HRNA 2LSVA 1RZ4A 2LO6A 3DRAA 5HQ8A 4A3VA 2CFZA 1TNBA 5KJKA 4WNFA 4IULA 1OWOA 4U04A 5JJ7A 3GZ2A 2ZXWE 4F1PA 3BQOA 3LJNA 3CLJA 2DWZA 4HFGA 2WQHA 2ZIRA 1TR4A 2XS1A 4HOQA 4J8FA 3UINC 1TJFA 3ULYA 1INZA 2YHEA 3FTXA 3UT7A 5KBAA 2KC7A 2BKGA 5FQ7A 3C3RA 4D10C 4LNGA 2RFAA 4YVQC 4TV3A 3EU5A 3ZYQA 1H6OA 4PS8A 3PZ3A 4GU5A 1N52A 4BWRA 3RIBA 4ILIA 4EPZA 1PAQA 4N5QA 3P2BA 2I2OA 5HI7A 3ZNGA 3FY4A 2QY7A 4BT9A 1IQUA 3C72A 2ETAA 2A4ZA 3CSFA 3HYMB 2P9IG 3T8MA 4GPMA 4WWPA 3VLEA 4GTVA 2L0IA 4DX7D 3ML8A 3MCXA 3SFYA 5EIDA 1JWFA 1WDYA 4C9BB 4AOFA 2Y4UA 4TXQA 5EKQD 3D9LA 4L23A 4J8YA 1SVXA 1O1TA 2WXJA 1AWCB 2AW6A 4HS2A 2X38A 3UT8A 5D66A 4U7EB 4UWFA 3AG3E 5E75A 3RO3A 2DYSE 3W9GA 4K03A 5FWQA 3HDXA 3IKOB 4XI9A 1TNYA 2X3MA 4KZCA 5G05C 4CCAA 1JWGA 3Q9NC 3VTYA 3PNTB 3C98A 3IHVA 3FUNA 3TG4A 4JXTA 5KNGA 2J4DA 2L6JA 1N4PA 2LXMA 4GZ3A 3OXLA 3TXNA 2Y3AA 3CSTA 2XHEA 1WG0A 3FTUA 2C0MA 4NURA 3PH0C 3ZVVA 3CK9A 4BY6A 1VDYA 1NI1A 2CG2A 1SA5A 5B3SE 2WM9A 5JJ6A 3HXEA 3U9WA 1HO8A 1SQMA 3HRAA 4UWLA 4KZ0A 3URZA 2OEVA 3TWXA 3CGHA 4H7XA 2UWJG 2KXPC 3FTWA 3ZHEA 3ZW3A 3DEPA 1JPLA 3FFLA 3OAWA 4B8CB 4UI9J 3PZ1A 3ZFWA 2XGMA 1E7VA 2CHWA 5ENNA 3WG7E 3KAEA 3KEAA 3L08A 4NACA 1D8DA 4GA1A 5B1AE 5BW8C 5BV0A 4RSYA 4CDMA 3QC1A 4EECA 5AQAA 2WMNA 2LUHA 4GB9A 2YQ8A 3FEYA 5AQBA 2J09A 5T3RA 1N4QA 4GTSA 2XCBA 2KZTB 4TUMA 3CVVA 4JW1A 2V5FA 1N9AA 5LFAA 3BUAA 5AQ9A 2V4LA 1MZCA 2GRNB 2PNNA 4JL0A 4KVMA 2P9PG 4CYMD 3S7BA 3L82A 1EF1C 2OOEA 2XGSA 2LSUA 2MHKA 4EZKA 3JQ0A 3OXFA 4EQFA 4RLYA 3QDNA 1WM5A 4F53A 1HU3A 3U66A 2BUGA 4F3VA 5BT1A 4U95D 3UM1A 3RO2A 2XEVA 4OVUA 4K5BA 5J08A 3ULEG 4A55A 4GAAA 3CVUA 4GCOA 1N4RA 4DPRA 4DK5A 4ZHBA 4RVBA 3DSWA 3B13A 2KCKA 5CCMA 4JA7A 5KJLA 1A5EA 1JCQA 4H7YA 4MRUA 5C2YA 2RKKA 3FTSA 2IF4A 2NC9A 4X8QA 2E2EA 3FUEA 2GGFA 3HVEB 1TN7A 5C1DA 4HOTA 4AP2A 1TEZA 5BNWA 4HORA 1Y8MA 2BTDA 3EIQC 4M3OA 3V2OA 4NIKA 3GYZA 3OTNA 1Z3XA 4EZLA 3DPDA 4I2WA 3N71A 5CEAA 5AAOA 1OCCE 4ANVA 2XEEA 3O48A 3ZN3A 4JD2G 1Z3YA 2PQNA 4L2YA 4FLHA 5AYWD 3U3WA 2VGXA 3PEVB 2CFUA 3DBSA 3UIPC 4AJWA 2Y4TA 5H7PA 1DCQA 4R7LA 3FU3A 4MS6A 3MGBA 3ENEA 5CRUA 3AAAC 2L9BA 1FVHA 3UMVA 4O6FA 1N0RA 4GA0A 3LPZA 3ZYKA 2UY1B 4HRMB 4V3IA 3HXDA 4G23A 1K8KG 4EZJA 1K3ZD 4FU3A 2WXFA 4N2SA 3L9TA 3UM0A 4CDRA 4CGVA 3FUHA 3Q73A 2PM6A 4K5AB 1QYMA 2YNQA 3TWTA 3BG0B 3MV2B 4QQIA 4I17A 3TWSA 4AXHA 1FT2A 5CRVA 4W9RA 1MX2A 2Y1LE 3HVEA 3FH7A 4CEMA 3TWUA 3FP3A 1B89A 3ZYMA 3B7BA 1HG2A 4GTTA 1HS6A 2DYRE 1PY1A 2WXGA 3RAUA 2R17C 1IHGA 5BPPA 3OXGA 4GYYA 2JABA 3D9NA 4G8KA 1DC2A 2WQ6A 3SQVA 5ENPD 4APOA 3NQPA 1TN6A 1FT1A 3DPYA 3QWWA 1A17A 4U8HA 1E8WA 3EHMA 3ESKA 3UKRG 3IEGA 3JYSA 5T8IA 1DCEA 4U8VD 3ZXSA 2J08A 2XRZA 1BD8A 3LXUX 2EIME 1OXJA 3SHFA 4FC8A 3SNXA 4AV7A 1TYQG 4CT4A 4B89A 4XIFA 4EHMA 4JHJA 1OY3D 1BI8B 3FUFA 4PS7A 1H2TC 4RG6A 2KCVA 4J8SA 3IHYA 2EINE 1SA4A 4APFA 3LKUA 4HLLA 2BEDA 3APCA 2X6KA 5D0QD 1YA0A 1MYOA 4F1SA 4GTRA 4I1OB 4BERA 1ZU2A 5G55A 1D9SA 3ZPJA 4I2ZA 4JEHA 3CV0A 1O5MA 1ELRA 4XX5A 2GROB 4HB5A 1TJCA 3C3QA 3CEQA 3SFXA 4HVBA 2R2LA 2J8SD 1UW4B 4IN3B 3G2WA 3AG1E 3PNLB 3LY7A 3QARA 2NXPA 2WXLA 5HS0A 5FIOA 2XGOA 5D0OD 4K5CA 3S2AA 3APFA 3IV0A 2LAHA 3LEWA 3PZ2A 3LY8A 3T8KA 4I1AA 3FULA 4J8DA 3D9HA 5HRYA 2P9LG 4WAFA 3FH8A 1Z6TA 2FBNA 3EDTB 1NA0A 4WNDA 1BLXB 3RKVA 3SZ7A 2LXLA 2VGYA 4HI8A 2WXQA 3FTYA 5J90A 1S63A 4N5CA 2MYOA 3L13A 3D9OA 3DSTA 3WXXA 1WY6A 3ISMC 2WB2A 4I9CA 2XPIA 4ILHB 4AIFA 3T5XA 1MJ0A 1KLXA 4DLQA 1HF8A 1BU9A 3C5RA 4OVVA 2GRRB 1E8XA 4O1OA 2KBXA 2C2LA 4KT6B 4LG6A 5EX3A 3CHSA 1H2VC 3PVLA 2VTBA 3B7UX 3D9JA 5EDSA 5BXUA 1QBQA 4RQIA 4UI9C 1HE8A 4DI4A 2QZAA 5KWDA 5EX0A 4U0ZA 4I6JA 1GW6A 2VGXB 2MRIA 2PM7A 1FVFA 4UI9K 3Q49B 4I6GA 1OCZE 4AM9A 4HLEA 3NZUA 1K1AA 3FUMA 2IONA 4EBAG 2WQ7A 2B6CA 2OEWA 2H6IA 3ONLA 4UQXA 3FUKA 1NP7A 2VQ2A 1HFAA 4HQDA 4CZ2D 3AG4E 5FINA 1S70B 3F6QA 1UJKA 2WPVA 5T4YA 5HKPA 1H0AA 1MQSA 2CHXA 4JHKA 1HXIA 3DWLG 4N2QA 1S0PA 4LUNU 2WXRA 1E8ZA 5CMYA 3CQCB 1UN8A 2WVIA 3ASHA 3QB2A 2GRQB 3RJVA 1ZB1A 5G2NA 3ZRHA 3CHPA 4DX1A 4J7WA 1OT8A 1YMPA 4N3AA 3AU4A 4TXPA 4YDEA 3EHRA 2Q7FA 5ARGA 4G26A 5CCLA 3E32A 2V5QC 3LJ3A 1KT1A 4WWNA 2F8XK 1E90A 3L17A 2ILRA 2LNIA 4CGWA 1Z5SC 3FUDA 5CBOA 1UG3A 3CK7A 3AG2E 4DRXE 4K0RA 4BTAA 4G1TA 1HZ4A 3VLDA 1EPUA 5ARFA 4WNEA 3D9PA 2HM8A 2X6JA 4I6EA 3HG0D 4Q69A 3CVPA 2ZU6B 3TWRA 3RSEG 4ME2A 3G2VA 1E8YA 5DIZA 1BPOA 5FQ4A 3APDA 1PC2A 2PL2A 3PZDA 3PUJA 3PZ4A 5FQ8A 4ACKA 1N4SA 1V54E 1IHBA 3KS2A 1U3DA 1OCOE 3QOUA 1UOHA 2EIJE 2ETCA 3DSUA 3I4GA 4PH4B 2E0IA 3UUXA 4KBQA 4BETA 3E34A 5AJLA 4ABNA 2QYJA 3LCAA 4DX5D 2IY0C 1N94A 5AENA 3NBNB 4F7AA 5CHEE 2XS8A 3I3NA 3FH5A 3FUJA 4I43A 2VSXE 5DBKA 3ML9A 3RRNB 5FTPA 4CDNA 4BSZB 2P9SG 3CHQA 3Q4AB 5ENOD 1BI7B 4BX8A 5G04C 2VTBB 4JVSA 4GZDA 5JHAA 2F0YA 2HO1A 3PE3A 1L5JA 4YDWA 1EDUA 3DEOA 1O1RA 1XNFA 1OWPA 2BKKB 3VLFA 3D9IA 3HXCA 2A5EA 5LX8A 4Q96A 2VGEA 2J49A 5JHBA 4BT8A 1OWMA 3AS4A 3QAQA 4RG9A 4PUCA 3FU0A 1SZAA 2ONDA 3LYAA 4GCNA 3MZLB 4XE0A 5FZRA 4ANXA 2DBAA 3LY9A 2IFUA 4LSZE 4E85A 2MOWA 2I6HA 2L0TB 3QK0A 4MLPA 4G11A 3MEKA 5FZSA 3EJNA 3JXJA 4NQ0A 3SFZA 3PDNA 2CHZA 4G2VA 4LRZA 2VJ8A 4FJYA 3HIZA 3BU8A 2FEZA 5EIBE 3D3MA 3TWVA 1RW2A 2I1JA 2H6GA 4GTQA 3TWWA 3D9MA 1W3BA 3UIOC 2IJGX 3EIJA 1NFIE 3CKCA 5ANRA 3QNKA 3UTMA 5B1BE 2PZIA 4IYPA 4DUIA 2FO1E 4U63A 2WXHA 2XENA 5JA4D 1KZOA 3Q9UC 3L54A 2KM4A 1N95A 5AARA 4N3CA 3ZEFA 1NA3A 4HI9A 1V55E 3B95A 4BTBA 4YDOA 5AJDA 2QC9A 4AY5A 2DIWA 4JPSA 4GYOA 3UPVA 2I9CA 1N11A 3VTXA 3T5VA 1KT0A 2ZGGA 3JUEA 2OVBA 3DXKG 4XKBA 2OCCE 3J5QB 4FLBA 3GW4A 4JB8P 3EHQA 5CMWA 2P9KG 4U07A 2L6BA 5FT9A 3JXIA 3FU6A 5CEDB 3ASOE 2NYJA 1E96B 2NSZA 5IY5E 3KSLA 3SF4A 1TNOA 2DZOA 3KD7A 4AEZC 4GMRA 2GRMA 3NOCD 2DZNA 3B7TA 3HXFA 2I1KA 3HHMA 4IRUA 1JCSA 2WMOA 5D2MC 2FI7A 3B7RL 4GTOA 4BFRA 1Y6IA 3CVQA 4UWHA 3ABME 1KZPA 3O4ZA 2F37A 2GW1A 3C3OA 3FEXA 3T9KA 2KCLA 3CHOA 3JQ1A 4AY6A 3ESLA 3FU5A 4A63B 2EIKE 3KEZA 3R9MA 4NRHB 3GZSA 3CR3A 2FF4A 2IU1A 5AIJA 5BV1A 1OCRE 2ETBA 2WXPA 4FHJA 2H6FA 4C0EA 3U4TA 3BEEA 4KMOA 1IQRA 4L1BA 4URKA 1U2VG 3QKYA 4UQZA 1Q2ZA 3FHEA 5CECB 1QQEA 2RD0A 2GRLA 3MA5A 2P58C 2UY1A 3V30A 3CHMA 1OUVA 1D8EA 3X2QE 1MX4A 4LNBA 3PEUB 5CERB 4G24A 3ULQA 4O60A 3GZ1A 3Q47B 3U64A 2ZISA 1EYHA 2DCPA 4HNAD 3UT4A 1G3NB 3UM3A 1DNPA 2IO2C 3QWVA 3KSQA 1S64A 2YHCA 3ASGA 3FDHA 3LS8A 3ZKJA 3UQ3A 2RG8A 3ZXPA 3J5PA 2GRPB 3LDZA 4C0MA 5LOZA 4DX2A 2R03A 3CHRA 1NL4A 4LCTA 1SW6A 3ASDA 4MBGA 3MJWA 4OAUC 5AN8A 3ZGQA 5KNHD 4LNUD 2OV8A 2PQRA 3ASNE 3Q79A 3DSXA 2XPYA 4GA2A 3PS6A 4B8AA 5EYLA 2VSNA 3PUKA 5E76A 1X81A 4JC8A 2J4BA 4TUUA 5LP0A 4XZ4A 4Z68A 1MX6A 4HOUA 2V4HC 3TWQA 2JEKA 3S7FA 4HBDA 4N39A 2AXUA 3AS5A 4CRWA 4I9EA 4O1PA 4Y6CA 3CKBA 4QFVA 3V79K 5AQ7A 3SO8A 4FADA 2LAIA 1LD8A 2HYZA 3NZSA 3TG5A 2KZTA 3LVRE 2C0LA 3MYVA 3SY2A 3SBTB 3Q7FA 4GZ6A 3S7DA 4LEUA 4JEUA 2IQCA 5KCMA 3R7QA 2AJAA 1N0QA 5FJYA 3ZIMA 4GTPA 3CIAA 2WXNA 1IXVA 5A7DB 1IKND 3NF1A 2R59A 4WUYA 4TXRA 4UQYA 3IXEA 3LVQE 2VYIA 2WXOA 3ONKA 2WXIA 3TL5A 4P29A 2XZDG 4FJZA 1QNFA 4G25A 4UWKA 5LCWC 3CVNA 3FTVA 3V31A 4UWGA 5EN5D 1ZBPA 1TNUA 1X5BA 2P9UG 5LCWJ 1XGWA 3I4RB 3HXBA 3RU0A 3PRZA 4N3BA 1TNZA 3Q15A 3MV3B 2V0PA 1KPSB 4M7CA 2J07A 3UXGA 1HG5A 3MKRA 1SZ9A 1UJJA 2X6FA 5FZQA 3FWVA 4F6RD 2VSOE 3UX4A 1E7UA 1H2UA 4L9PA 5ENRD 3RRMB 3UM2A 3E37A 3B7SA 5BUZA 4U8YD 4J6IA 4B93B 3AS8A 4OAVB 4FA6A 2M63A 2R5SA 2B0OE 3FUIA 3AU5A 5KJMA 4MKTA 4FHKA 2A5UA 3RRUA 1IYGA 4CT0A 4YVOA 2QFCA 3D9KA 3DSSA 2F8YA 1H6KA 1P5QA 1WAO1 2OVFA 4GPKA 1H19A 3ZHEB 4WWOA 3E4BA 4A3TA 5G04J 1JCRA 1QZ2A 2VSYA 4YDYA 3SBSA 3SD5A 3TJPA 5G05J 3Q5MA 4U96D 4BEPA 2X6IA 4A1SA 1ELKA 4XI0A 4DJAA 1AP7A 2X6HA 1OWLA 5BXOA 3TAXA 4I1MA 4JHRA 4PDXA 5EILA 4L7TA 5ENQD 3FTZA 4KVOA 3R7RA 2IOLA 2WXMA 4BSXA 3ABLE 4GZCA 3DXMG 1K1BA 4FULA 2H6HA 2AVPA 3QWPA 1LTXA 3JUIA 2AXVA 3P1UA 5ENTD 3PE4A 3DSVA 4ILGA 2EILE 3TXMA 2RFMA 4TRQA 3EUVA 4XEIG 5KJNA 4UUCA 5JMND 2Y69E 2ZGDA 2XQ0A 3NAWA 4A1GA 2Y0BG 4AVXA 5M72A 4Q94A 2AXZA 1YYHA 2CG3A 5EYPF 2JLBA 3JCKC 1MHQA 4GZ5A 4GMJA 4B0ZA 2AWIA 2BF0X 3E30A 5ITZF 2FULA 2IEJA 4GMLA 3CVYA 2FO7A 2XEHA 3MKQB 2EQXA 1TN8A 4ANUA 5FQ6A 4U0UA 5ENSD 3SI5A 3AJIA 3ZYLA 2HE0A 3R9AB 1JUQA 4BESA 4LERA 2YINA 2J9QA 4OYSA 2WXKA 1O1SA 5JJTA 4J0UA 2XPZA 4KYOB 3BG1B 3L22A 1LD7A 3Q75A 3CQGB 4GYWA 3L16A 4DX6D 4EBAA 3UKUG 4ZFHA 4ANWA 3ASFA 4Y6WA 3TGOA 4ACLA 2P9NG 3CVLA 5A6CA 3IBEA 1FCHA 2HR2A 3S7JA 3CVXA 1OWNA 4XKCA 4DI3A 4DLOA 2IOSA 4HXIA 3V2XA 5ANLA 4L2LA 2R02A 3NOGD 1LF8A 4FP7A 4B94A 3ABKE 5A23A 3UI2A 1N54A 1ELWA 3MX3A 4WNGA 2DVWA 4U0SA 1U3CA 4J8EA 4HOSA 2KATA 3W9FA 3ZU7B 3EHNA 4ATGA 3G2UA 1HX8A 2XCCA 2P2CP 3PREA 4YNDA 3L6AA 4JZYA 3I5PA 1DVPA 1FPPA 2V8SE 3EU9A 3NB2A 2IO3C 3ZUVB 4PS3A 2R05A 3G2SA 1H6PA 3QJZA 2XZTG
chains in the Genus database with same CATH topology
5FQ4A 3APDA 4TUUA 1PC2A 2PL2A 3PZDA 5LP0A 3PUJA 4N2SA 5FQ8A 4ACKA 4XZ4A 4CDRA 4CGVA 3FUHA 4HOUA 4E6HA 2PM6A 3KS2A 3G2TA 1HH8A 3K9IA 3RK6A 1U3DA 3SGHA 4C0MA 2YNQA 3CVWA 2JEKA 3QOUA 3S7FA 4N39A 3MKQA 1NZNA 2AXUA 3AS5A 3BG0B 3MV2B 4CRWA 3I4GA 4PH4B 2E0IA 4I17A 4I9EA 3UUXA 4KBQA 2XRYA 4AXHA 4Y6CA 4W9RA 5AJLA 3CKBA 4QFVA 4ABNA 4BX9A 1UN9A 4FADA 4KXKB 3HVEA 3FH7A 2LAIA 3LCAA 2HYZA 3CK8A 4JA9A 4CEMA 3NZSA 2LSVA 2LO6A 5AENA 3FP3A 3TG5A 1B89A 3ZYMA 2KZTA 4F7AA 5CHEE 1HG2A 1HS6A 3I3NA 1PY1A 3LVRE 2C0LA 3FH5A 3FUJA 5HQ8A 4I43A 4A3VA 3MYVA 2CFZA 2VSXE 2WXGA 3SBTB 4GZ6A 5KJKA 2R17C 4WNFA 1IHGA 4IULA 5DBKA 1OWOA 3ML9A 5BPPA 3OXGA 4GYYA 4LEUA 3S7DA 4JEUA 4U04A 3RRNB 5JJ7A 5FTPA 4CDNA 3D9NA 2IQCA 5KCMA 3GZ2A 3CHQA 3Q4AB 3R7QA 4BX8A 2WQ6A 3CLJA 4HFGA 5G04C 4APOA 3NQPA 2WQHA 5FJYA 2VTBB 4HOQA 4JVSA 3ZIMA 3CIAA 2WXNA 4GZDA 4J8FA 1TJFA 3QWWA 5A7DB 5JHAA 1A17A 1INZA 2YHEA 4U8HA 1E8WA 2HO1A 3FTXA 3PE3A 3UT7A 2KC7A 1L5JA 3NF1A 1EDUA 5FQ7A 3EHMA 2R59A 3ESKA 3IEGA 4WUYA 4UQYA 1XNFA 3LVQE 2VYIA 1OWPA 2WXOA 3JYSA 3ONKA 4D10C 5T8IA 4YVQC 3VLFA 3D9IA 3ZXSA 4TV3A 2J08A 3ZYQA 2XRZA 5LX8A 2WXIA 4PS8A 3TL5A 4P29A 4Q96A 4FJZA 4GU5A 1QNFA 1N52A 4G25A 4UWKA 3LXUX 5LCWC 3CVNA 4BWRA 3RIBA 3SHFA 3FTVA 2J49A 4FC8A 5JHBA 3SNXA 4AV7A 4ILIA 4BT8A 4UWGA 1OWMA 4CT4A 4EPZA 1PAQA 1ZBPA 3AS4A 3QAQA 1X5BA 3P2BA 4RG9A 4PUCA 2I2OA 3FU0A 1SZAA 2ONDA 4XIFA 4B89A 1XGWA 3LYAA 5HI7A 5LCWJ 4GCNA 3MZLB 3I4RB 4XE0A 4JHJA 5FZRA 3PRZA 3FY4A 2QY7A 3RU0A 4N3BA 3FUFA 4PS7A 4BT9A 1IQUA 2DBAA 1H2TC 3LY9A 3Q15A 2KCVA 4RG6A 2A4ZA 3CSFA 3MV3B 2V0PA 4J8SA 3HYMB 2J07A 2IFUA 3T8MA 3IHYA 1HG5A 3MKRA 1SZ9A 1UJJA 2X6FA 4WWPA 3VLEA 4APFA 5FZQA 3LKUA 4E85A 2L0IA 2MOWA 3FWVA 3ML8A 2VSOE 2I6HA 2L0TB 1E7UA 3MCXA 3QK0A 4MLPA 3UX4A 4G11A 1H2UA 3APCA 2X6KA 1JWFA 4C9BB 5D0QD 4AOFA 4ANXA 1YA0A 3MEKA 2Y4UA 3RRMB 5EKQD 5FZSA 4F1SA 3D9LA 3EJNA 4NQ0A 3SFZA 4I1OB 4L23A 3PDNA 1ZU2A 5G55A 2CHZA 3B7SA 2WXJA 4G2VA 3ZPJA 4I2ZA 4LRZA 5BUZA 2VJ8A 4JEHA 4J6IA 3AS8A 4FJYA 3HIZA 3CV0A 2AW6A 4HS2A 2X38A 3UT8A 1ELRA 2FEZA 4FA6A 4XX5A 2M63A 4UWFA 2R5SA 5E75A 3RO3A 3FUIA 3D3MA 4K03A 3AU5A 5FWQA 2I1JA 3HDXA 3IKOB 5KJMA 4XI9A 1TJCA 2X3MA 3CEQA 4KZCA 4MKTA 3D9MA 2A5UA 4FHKA 5G05C 4CCAA 3RRUA 1JWGA 1W3BA 3VTYA 4HVBA 3PNTB 1IYGA 3C98A 3IHVA 3FUNA 3TG4A 4CT0A 2IJGX 3EIJA 2QFCA 3D9KA 3CKCA 1UW4B 3QNKA 4IN3B 3G2WA 4JXTA 4YVOA 5ANRA 1H6KA 1P5QA 1WAO1 2J4DA 2OVFA 2PZIA 4IYPA 2L6JA 4GPKA 3PNLB 1H19A 3ZHEB 3LY7A 3QARA 2NXPA 4U63A 4GZ3A 2WXLA 3OXLA 2WXHA 3TXNA 4WWOA 2XGOA 2Y3AA 5D0OD 3CSTA 3E4BA 4A3TA 5G04J 2XHEA 3FTUA 3S2AA 2C0MA 1QZ2A 4NURA 2VSYA 3APFA 3IV0A 2LAHA 3SBSA 3SD5A 3TJPA 3PH0C 3ZVVA 3LEWA 3LY8A 5G05J 3L54A 3CK9A 4BY6A 2KM4A 1VDYA 4I1AA 2CG2A 3Q5MA 3FULA 4J8DA 4N3CA 3ZEFA 1NA3A 2WM9A 5JJ6A 2X6IA 3U9WA 4A1SA 1HO8A 4WAFA 4BTBA 1ELKA 4XI0A 3FH8A 1SQMA 4DJAA 5AJDA 1Z6TA 2X6HA 2FBNA 4UWLA 4AY5A 2DIWA 3EDTB 1NA0A 4JPSA 1OWLA 4GYOA 4KZ0A 4WNDA 3TAXA 4I1MA 4JHRA 4PDXA 2I9CA 3URZA 3UPVA 3VTXA 3T5VA 4L7TA 3RKVA 1KT0A 3CGHA 4H7XA 2UWJG 2OVBA 3FTWA 3ZHEA 3ZW3A 3FTZA 4KVOA 3SZ7A 4XKBA 1JPLA 3FFLA 2VGYA 3OAWA 3R7RA 4FLBA 3GW4A 2WXQA 2IOLA 3FTYA 4B8CB 5J90A 2WXMA 4N5CA 5CMWA 4UI9J 4U07A 5FT9A 3ZFWA 3L13A 3D9OA 3FU6A 2XGMA 1E7VA 2CHWA 3WXXA 4BSXA 1WY6A 4GZCA 5ENNA 2WB2A 4I9CA 4FULA 2XPIA 3KAEA 1E96B 2AVPA 2NSZA 4ILHB 4AIFA 3T5XA 3L08A 3QWPA 3JUIA 4NACA 2AXVA 3P1UA 3PE4A 4ILGA 4GA1A 3TXMA 3SF4A 5BW8C 5BV0A 4RSYA 1KLXA 4TRQA 4DLQA 3KD7A 1HF8A 4AEZC 4CDMA 3QC1A 2GRMA 5KJNA 4EECA 4OVVA 2WMNA 4GB9A 2YQ8A 3FEYA 3B7TA 2J09A 5T3RA 1E8XA 2I1KA 3HHMA 2XQ0A 4A1GA 4IRUA 4AVXA 2XCBA 5M72A 2C2LA 4KT6B 2WMOA 2KZTB 5EX3A 4Q94A 3CVVA 4JW1A 2V5FA 2AXZA 3CHSA 2CG3A 2FI7A 2JLBA 3B7RL 1MHQA 3JCKC 1Y6IA 4BFRA 1H2VC 3CVQA 5LFAA 2V4LA 3PVLA 4UWHA 4GZ5A 2VTBA 4JL0A 3B7UX 4GMJA 3O4ZA 4B0ZA 2GW1A 3FEXA 2AWIA 2BF0X 3D9JA 4KVMA 5EDSA 2FULA 3S7BA 2KCLA 4GMLA 4UI9C 3CVYA 1HE8A 2FO7A 3CHOA 3JQ1A 4DI4A 1EF1C 3MKQB 4AY6A 2EQXA 2OOEA 2XGSA 2LSUA 3ESLA 5EX0A 2MHKA 4ANUA 5FQ6A 4EZKA 3JQ0A 3OXFA 4U0UA 3FU5A 4U0ZA 3QDNA 1GW6A 4I6JA 1WM5A 2VGXB 2MRIA 3SI5A 2PM7A 1FVFA 3ZYLA 4UI9K 3Q49B 4F53A 3KEZA 4I6GA 1JUQA 1HU3A 3R9AB 4AM9A 4HLEA 3U66A 2BUGA 4NRHB 4F3VA 5BT1A 4LERA 3NZUA 3FUMA 2IONA 4EBAG 2WQ7A 3GZSA 2YINA 2J9QA 3CR3A 2FF4A 4OYSA 2IU1A 3ONLA 2WXKA 4UQXA 3RO2A 5AIJA 5BV1A 3FUKA 5JJTA 1NP7A 4J0UA 2XPZA 4KYOB 2VQ2A 2WXPA 1HFAA 3BG1B 4FHJA 2XEVA 4C0EA 3U4TA 3L22A 4OVUA 5J08A 4A55A 3BEEA 4KMOA 1UJKA 4GAAA 4EQFA 1IQRA 2WPVA 4L1BA 4URKA 5T4YA 3CVUA 3QKYA 4GCOA 1H0AA 4UQZA 3CQGB 1MQSA 4GYWA 4DPRA 4DK5A 2CHXA 3FHEA 4JHKA 4RVBA 3L16A 1HXIA 3B13A 2KCKA 1QQEA 4EBAA 5CCMA 2RD0A 4N2QA 1S0PA 2GRLA 4JA7A 5KJLA 4LUNU 4ANWA 2WXRA 4H7YA 3MA5A 4MRUA 1E8ZA 3ASFA 2P58C 5C2YA 2UY1A 3FTSA 1BPOA 2IF4A 2NC9A 5CMYA 5DIZA 3CQCB 2E2EA 3FUEA 1UN8A 2WVIA 2GGFA 3ASHA 3HVEB 3QB2A 4Y6WA 3TGOA 5C1DA 3CHMA 4ACLA 4HOTA 3RJVA 1OUVA 4AP2A 5G2NA 1TEZA 3ZRHA 5BNWA 4HORA 3CVLA 3PEUB 3IBEA 5A6CA 4G24A 3ULQA 1FCHA 3CHPA 1Y8MA 2BTDA 3EIQC 3GZ1A 4M3OA 3Q47B 2HR2A 3GYZA 3S7JA 3OTNA 3CVXA 1OWNA 1Z3XA 4XKCA 3DPDA 4N3AA 3U64A 4I2WA 3AU4A 3N71A 4DI3A 4EZLA 4DLOA 1EYHA 2DCPA 2IOSA 4ANVA 3UT4A 4HXIA 1DNPA 3O48A 3QWVA 2Q7FA 3ZN3A 5ANLA 5ARGA 4L2LA 4G26A 1Z3YA 2PQNA 1LF8A 4FLHA 2YHCA 4L2YA 3ASGA 4FP7A 5AYWD 5CCLA 3U3WA 2VGXA 3PEVB 2CFUA 1KT1A 3LJ3A 3FDHA 3LS8A 4WWNA 3UQ3A 2RG8A 1E90A 3DBSA 4B94A 3L17A 2ILRA 4AJWA 5A23A 3LDZA 1N54A 1ELWA 3MX3A 4WNGA 2Y4TA 2LNIA 3FUDA 5LOZA 4U0SA 1U3CA 4J8EA 4CGWA 3CHRA 4HOSA 4R7LA 2KATA 3FU3A 4LCTA 1UG3A 3ASDA 3CK7A 3MGBA 4MS6A 3ENEA 3MJWA 3EHNA 4ATGA 2L9BA 1FVHA 3ZGQA 3UMVA 3G2UA 1HX8A 2XCCA 4K0RA 4O6FA 4BTAA 4G1TA 2OV8A 1HZ4A 4GA0A 3VLDA 1EPUA 2PQRA 5ARFA 4WNEA 3PREA 4YNDA 3LPZA 3D9PA 2UY1B 3L6AA 3ZYKA 2HM8A 2XPYA 4GA2A 2X6JA 4I6EA 4JZYA 4V3IA 3PS6A 4B8AA 3I5PA 4Q69A 3CVPA 1DVPA 2VSNA 4G23A 2ZU6B 3PUKA 2V8SE 4EZJA 5E76A 4ME2A 4PS3A 3G2VA 3G2SA 3QJZA 4FU3A 2WXFA 1E8YA 4JC8A 2J4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QKY A;  4GCO A;  3FFL A;  2VGY A;  4N3B A;  1PC2 A;  2PL2 A;  4BT9 A;  4UQZ A;  5KJM A;  4N2S A;  2DBA A;  3GW4 A;  3LY9 A;  3Q15 A;  4GYW A;  2KCV A;  4RG6 A;  4CGW A;  3MV3 B;  4N5C A;  4UI9 J;  4U07 A;  3HYM B;  5FT9 A;  3ZFW A;  4CDR A;  2IFU A;  4CGV A;  4HOU A;  3MKR A;  1HXI A;  2KCK A;  2XGM A;  1QQE A;  3WXX A;  3KS2 A;  5CCM A;  1HH8 A;  3K9I A;  5FZQ A;  4N2Q A;  3LKU A;  4JA7 A;  4I9C A;  5KJL A;  3FWV A;  3S7F A;  3QOU A;  2XPI A;  4N39 A;  3KAE A;  1E96 B;  1NZN A;  2I6H A;  3AS5 A;  2AVP A;  3MA5 A;  3MV2 B;  4H7Y A;  4AIF A;  4GPK A;  3ASF A;  3QWP A;  4I17 A;  4I9E A;  3UUX A;  2P58 C;  4KBQ A;  2UY1 A;  3PE4 A;  4GA1 A;  5D0Q D;  3SF4 A;  4Y6C A;  2IF4 A;  1YA0 A;  2NC9 A;  5BW8 C;  1KLX A;  3MEK A;  2Y4U A;  4W9R A;  3CKB A;  5EKQ D;  5FZS A;  4ABN A;  2E2E A;  3KD7 A;  4NQ0 A;  4Y6W A;  3ASH A;  3PDN A;  3TGO A;  5KJN A;  5C1D A;  4KXK B;  1ZU2 A;  4HOT A;  4JA9 A;  3LCA A;  1OUV A;  2HYZ A;  3CK8 A;  4G2V A;  4I2Z A;  3RJV A;  3ZPJ A;  2YQ8 A;  2LSV A;  3AS8 A;  3CV0 A;  5BNW A;  3FP3 A;  3TG5 A;  4HOR A;  1B89 A;  3CVL A;  1ELR A;  2FEZ A;  5CHE E;  5A6C A;  4G24 A;  3ULQ A;  1FCH A;  2R5S A;  3RO3 A;  1Y8M A;  5HQ8 A;  2C0L A;  3GZ1 A;  2XCB A;  3Q47 B;  5M72 A;  2C2L A;  2HR2 A;  3GYZ A;  3S7J A;  3U3W A;  4GZ6 A;  4XI9 A;  4WNF A;  5DBK A;  1IHG A;  1TJC A;  2V5F A;  4N3A A;  5EX3 A;  4I2W A;  3CEQ A;  3N71 A;  3OXG A;  4GYY A;  2FI7 A;  2JLB A;  4LEU A;  4U04 A;  5G05 C;  3S7D A;  5JJ7 A;  5FTP A;  3CVQ A;  4GZ5 A;  1W3B A;  4JL0 A;  3VTY A;  1IYG A;  3GZ2 A;  3O48 A;  3QWV A;  3Q4A B;  3TG4 A;  2GW1 A;  2Q7F A;  4YVO A;  2QFC A;  3ZN3 A;  3CKC A;  4IN3 B;  5ARG A;  5G04 C;  4G26 A;  4APO A;  1P5Q A;  2PZI A;  1WAO 1;  2WQH A;  2PQN A;  5FJY A;  5AYW D;  2L6J A;  2YHC A;  3ASG A;  2KCL A;  3S7B A;  5CCL A;  4HOQ A;  4UI9 C;  2VGX A;  3LY7 A;  3ZHE B;  1KT1 A;  2FO7 A;  4J8F A;  3QWW A;  4GZ3 A;  3OXL A;  5A7D B;  3UQ3 A;  1A17 A;  4B94 A;  5KJK A;  4AY6 A;  2HO1 A;  2OOE A;  3PE3 A;  2XGO A;  2KC7 A;  5D0O D;  2XGS A;  2LSU A;  3E4B A;  5EX0 A;  2MHK A;  1ELW A;  3NF1 A;  4WNG A;  2Y4T A;  2LNI A;  5G04 J;  3ESK A;  4U0S A;  4J8E A;  3IEG A;  3OXF A;  4WUY A;  2C0M A;  1QZ2 A;  4U0U A;  2VSY A;  4U0Z A;  3QDN A;  4EQF A;  2KAT A;  1WM5 A;  1XNF A;  2VGX B;  4UQY A;  3ASD A;  3CK7 A;  2VYI A;  4UI9 K;  3Q49 B;  3LY8 A;  5G05 J;  3JYS A;  3R9A B;  3CK9 A;  4AM9 A;  2BUG A;  4NRH B;  4YVQ C;  4I1A A;  3ZGQ A;  4F3V A;  3Q5M A;  4J8D A;  4N3C A;  5BT1 A;  2XCC A;  1NA3 A;  4O6F A;  5JJ6 A;  4BTA A;  4G1T A;  4GA0 A;  1HZ4 A;  4A1S A;  2J9Q A;  2PQR A;  5ARF A;  2FF4 A;  4WNE A;  4YND A;  4UQX A;  4BTB A;  3LPZ A;  3RO2 A;  2UY1 B;  4G25 A;  4XI0 A;  5LCW C;  3CVN A;  4GA2 A;  4BWR A;  5JJT A;  4HOS A;  3RIB A;  4J0U A;  2FBN A;  4AY5 A;  3EDT B;  4KYO B;  3RU0 A;  1NA0 A;  4WND A;  4GYO A;  2VQ2 A;  3TAX A;  3CVP A;  2XEV A;  2VSN A;  4G23 A;  4JHR A;  3URZ A;  4BT8 A;  3UPV A;  3U4T A;  1ZBP A;  3VTX A;  3AS4 A;  3RKV A;  1KT0 A;  4RG9 A;  4H7X A;  2OND A;  2UWJ G;  4ME2 A;  4XIF A;  3BEE A;  3LYA A;  5HI7 A;  3ZHE A;  5LCW J;  2WPV A;  4GCN A;  5FZR A;  3SZ7 A;  5DIZ A; 
#chains in the Genus database with same CATH topology
 4ATZ D;  4E6H A;  3G2T A;  1HH8 A;  3K9I A;  3RK6 A;  3SGH A;  3CVW A;  4C48 B;  3E33 A;  1NZN A;  3MKQ A;  4GTM A;  5CBN A;  2XRY A;  3Q7A A;  1YCS B;  4HRL A;  4G8L A;  2QYU A;  4BX9 A;  3Q78 A;  1UN9 A;  4KXK B;  4JA9 A;  3CK8 A;  4HRN A;  2LSV A;  1RZ4 A;  2LO6 A;  3DRA A;  5HQ8 A;  4A3V A;  2CFZ A;  1TNB A;  5KJK A;  4WNF A;  4IUL A;  1OWO A;  4U04 A;  5JJ7 A;  3GZ2 A;  2ZXW E;  4F1P A;  3BQO A;  3LJN A;  3CLJ A;  2DWZ A;  4HFG A;  2WQH A;  2ZIR A;  1TR4 A;  2XS1 A;  4HOQ A;  4J8F A;  3UIN C;  1TJF A;  3ULY A;  1INZ A;  2YHE A;  3FTX A;  3UT7 A;  5KBA A;  2KC7 A;  2BKG A;  5FQ7 A;  3C3R A;  4D10 C;  4LNG A;  2RFA A;  4YVQ C;  4TV3 A;  3EU5 A;  3ZYQ A;  1H6O A;  4PS8 A;  3PZ3 A;  4GU5 A;  1N52 A;  4BWR A;  3RIB A;  4ILI A;  4EPZ A;  1PAQ A;  4N5Q A;  3P2B A;  2I2O A;  5HI7 A;  3ZNG A;  3FY4 A;  2QY7 A;  4BT9 A;  1IQU A;  3C72 A;  2ETA A;  2A4Z A;  3CSF A;  3HYM B;  2P9I G;  3T8M A;  4GPM A;  4WWP A;  3VLE A;  4GTV A;  2L0I A;  4DX7 D;  3ML8 A;  3MCX A;  3SFY A;  5EID A;  1JWF A;  1WDY A;  4C9B B;  4AOF A;  2Y4U A;  4TXQ A;  5EKQ D;  3D9L A;  4L23 A;  4J8Y A;  1SVX A;  1O1T A;  2WXJ A;  1AWC B;  2AW6 A;  4HS2 A;  2X38 A;  3UT8 A;  5D66 A;  4U7E B;  4UWF A;  3AG3 E;  5E75 A;  3RO3 A;  2DYS E;  3W9G A;  4K03 A;  5FWQ A;  3HDX A;  3IKO B;  4XI9 A;  1TNY A;  2X3M A;  4KZC A;  5G05 C;  4CCA A;  1JWG A;  3Q9N C;  3VTY A;  3PNT B;  3C98 A;  3IHV A;  3FUN A;  3TG4 A;  4JXT A;  5KNG A;  2J4D A;  2L6J A;  1N4P A;  2LXM A;  4GZ3 A;  3OXL A;  3TXN A;  2Y3A A;  3CST A;  2XHE A;  1WG0 A;  3FTU A;  2C0M A;  4NUR A;  3PH0 C;  3ZVV A;  3CK9 A;  4BY6 A;  1VDY A;  1NI1 A;  2CG2 A;  1SA5 A;  5B3S E;  2WM9 A;  5JJ6 A;  3HXE A;  3U9W A;  1HO8 A;  1SQM A;  3HRA A;  4UWL A;  4KZ0 A;  3URZ A;  2OEV A;  3TWX A;  3CGH A;  4H7X A;  2UWJ G;  2KXP C;  3FTW A;  3ZHE A;  3ZW3 A;  3DEP A;  1JPL A;  3FFL A;  3OAW A;  4B8C B;  4UI9 J;  3PZ1 A;  3ZFW A;  2XGM A;  1E7V A;  2CHW A;  5ENN A;  3WG7 E;  3KAE A;  3KEA A;  3L08 A;  4NAC A;  1D8D A;  4GA1 A;  5B1A E;  5BW8 C;  5BV0 A;  4RSY A;  4CDM A;  3QC1 A;  4EEC A;  5AQA A;  2WMN A;  2LUH A;  4GB9 A;  2YQ8 A;  3FEY A;  5AQB A;  2J09 A;  5T3R A;  1N4Q A;  4GTS A;  2XCB A;  2KZT B;  4TUM A;  3CVV A;  4JW1 A;  2V5F A;  1N9A A;  5LFA A;  3BUA A;  5AQ9 A;  2V4L A;  1MZC A;  2GRN B;  2PNN A;  4JL0 A;  4KVM A;  2P9P G;  4CYM D;  3S7B A;  3L82 A;  1EF1 C;  2OOE A;  2XGS A;  2LSU A;  2MHK A;  4EZK A;  3JQ0 A;  3OXF A;  4EQF A;  4RLY A;  3QDN A;  1WM5 A;  4F53 A;  1HU3 A;  3U66 A;  2BUG A;  4F3V A;  5BT1 A;  4U95 D;  3UM1 A;  3RO2 A;  2XEV A;  4OVU A;  4K5B A;  5J08 A;  3ULE G;  4A55 A;  4GAA A;  3CVU A;  4GCO A;  1N4R A;  4DPR A;  4DK5 A;  4ZHB A;  4RVB A;  3DSW A;  3B13 A;  2KCK A;  5CCM A;  4JA7 A;  5KJL A;  1A5E A;  1JCQ A;  4H7Y A;  4MRU A;  5C2Y A;  2RKK A;  3FTS A;  2IF4 A;  2NC9 A;  4X8Q A;  2E2E A;  3FUE A;  2GGF A;  3HVE B;  1TN7 A;  5C1D A;  4HOT A;  4AP2 A;  1TEZ A;  5BNW A;  4HOR A;  1Y8M A;  2BTD A;  3EIQ C;  4M3O A;  3V2O A;  4NIK A;  3GYZ A;  3OTN A;  1Z3X A;  4EZL A;  3DPD A;  4I2W A;  3N71 A;  5CEA A;  5AAO A;  1OCC E;  4ANV A;  2XEE A;  3O48 A;  3ZN3 A;  4JD2 G;  1Z3Y A;  2PQN A;  4L2Y A;  4FLH A;  5AYW D;  3U3W A;  2VGX A;  3PEV B;  2CFU A;  3DBS A;  3UIP C;  4AJW A;  2Y4T A;  5H7P A;  1DCQ A;  4R7L A;  3FU3 A;  4MS6 A;  3MGB A;  3ENE A;  5CRU A;  3AAA C;  2L9B A;  1FVH A;  3UMV A;  4O6F A;  1N0R A;  4GA0 A;  3LPZ A;  3ZYK A;  2UY1 B;  4HRM B;  4V3I A;  3HXD A;  4G23 A;  1K8K G;  4EZJ A;  1K3Z D;  4FU3 A;  2WXF A;  4N2S A;  3L9T A;  3UM0 A;  4CDR A;  4CGV A;  3FUH A;  3Q73 A;  2PM6 A;  4K5A B;  1QYM A;  2YNQ A;  3TWT A;  3BG0 B;  3MV2 B;  4QQI A;  4I17 A;  3TWS A;  4AXH A;  1FT2 A;  5CRV A;  4W9R A;  1MX2 A;  2Y1L E;  3HVE A;  3FH7 A;  4CEM A;  3TWU A;  3FP3 A;  1B89 A;  3ZYM A;  3B7B A;  1HG2 A;  4GTT A;  1HS6 A;  2DYR E;  1PY1 A;  2WXG A;  3RAU A;  2R17 C;  1IHG A;  5BPP A;  3OXG A;  4GYY A;  2JAB A;  3D9N A;  4G8K A;  1DC2 A;  2WQ6 A;  3SQV A;  5ENP D;  4APO A;  3NQP A;  1TN6 A;  1FT1 A;  3DPY A;  3QWW A;  1A17 A;  4U8H A;  1E8W A;  3EHM A;  3ESK A;  3UKR G;  3IEG A;  3JYS A;  5T8I A;  1DCE A;  4U8V D;  3ZXS A;  2J08 A;  2XRZ A;  1BD8 A;  3LXU X;  2EIM E;  1OXJ A;  3SHF A;  4FC8 A;  3SNX A;  4AV7 A;  1TYQ G;  4CT4 A;  4B89 A;  4XIF A;  4EHM A;  4JHJ A;  1OY3 D;  1BI8 B;  3FUF A;  4PS7 A;  1H2T C;  4RG6 A;  2KCV A;  4J8S A;  3IHY A;  2EIN E;  1SA4 A;  4APF A;  3LKU A;  4HLL A;  2BED A;  3APC A;  2X6K A;  5D0Q D;  1YA0 A;  1MYO A;  4F1S A;  4GTR A;  4I1O B;  4BER A;  1ZU2 A;  5G55 A;  1D9S A;  3ZPJ A;  4I2Z A;  4JEH A;  3CV0 A;  1O5M A;  1ELR A;  4XX5 A;  2GRO B;  4HB5 A;  1TJC A;  3C3Q A;  3CEQ A;  3SFX A;  4HVB A;  2R2L A;  2J8S D;  1UW4 B;  4IN3 B;  3G2W A;  3AG1 E;  3PNL B;  3LY7 A;  3QAR A;  2NXP A;  2WXL A;  5HS0 A;  5FIO A;  2XGO A;  5D0O D;  4K5C A;  3S2A A;  3APF A;  3IV0 A;  2LAH A;  3LEW A;  3PZ2 A;  3LY8 A;  3T8K A;  4I1A A;  3FUL A;  4J8D A;  3D9H A;  5HRY A;  2P9L G;  4WAF A;  3FH8 A;  1Z6T A;  2FBN A;  3EDT B;  1NA0 A;  4WND A;  1BLX B;  3RKV A;  3SZ7 A;  2LXL A;  2VGY A;  4HI8 A;  2WXQ A;  3FTY A;  5J90 A;  1S63 A;  4N5C A;  2MYO A;  3L13 A;  3D9O A;  3DST A;  3WXX A;  1WY6 A;  3ISM C;  2WB2 A;  4I9C A;  2XPI A;  4ILH B;  4AIF A;  3T5X A;  1MJ0 A;  1KLX A;  4DLQ A;  1HF8 A;  1BU9 A;  3C5R A;  4OVV A;  2GRR B;  1E8X A;  4O1O A;  2KBX A;  2C2L A;  4KT6 B;  4LG6 A;  5EX3 A;  3CHS A;  1H2V C;  3PVL A;  2VTB A;  3B7U X;  3D9J A;  5EDS A;  5BXU A;  1QBQ A;  4RQI A;  4UI9 C;  1HE8 A;  4DI4 A;  2QZA A;  5KWD A;  5EX0 A;  4U0Z A;  4I6J A;  1GW6 A;  2VGX B;  2MRI A;  2PM7 A;  1FVF A;  4UI9 K;  3Q49 B;  4I6G A;  1OCZ E;  4AM9 A;  4HLE A;  3NZU A;  1K1A A;  3FUM A;  2ION A;  4EBA G;  2WQ7 A;  2B6C A;  2OEW A;  2H6I A;  3ONL A;  4UQX A;  3FUK A;  1NP7 A;  2VQ2 A;  1HFA A;  4HQD A;  4CZ2 D;  3AG4 E;  5FIN A;  1S70 B;  3F6Q A;  1UJK A;  2WPV A;  5T4Y A;  5HKP A;  1H0A A;  1MQS A;  2CHX A;  4JHK A;  1HXI A;  3DWL G;  4N2Q A;  1S0P A;  4LUN U;  2WXR A;  1E8Z A;  5CMY A;  3CQC B;  1UN8 A;  2WVI A;  3ASH A;  3QB2 A;  2GRQ B;  3RJV A;  1ZB1 A;  5G2N A;  3ZRH A;  3CHP A;  4DX1 A;  4J7W A;  1OT8 A;  1YMP A;  4N3A A;  3AU4 A;  4TXP A;  4YDE A;  3EHR A;  2Q7F A;  5ARG A;  4G26 A;  5CCL A;  3E32 A;  2V5Q C;  3LJ3 A;  1KT1 A;  4WWN A;  2F8X K;  1E90 A;  3L17 A;  2ILR A;  2LNI A;  4CGW A;  1Z5S C;  3FUD A;  5CBO A;  1UG3 A;  3CK7 A;  3AG2 E;  4DRX E;  4K0R A;  4BTA A;  4G1T A;  1HZ4 A;  3VLD A;  1EPU A;  5ARF A;  4WNE A;  3D9P A;  2HM8 A;  2X6J A;  4I6E A;  3HG0 D;  4Q69 A;  3CVP A;  2ZU6 B;  3TWR A;  3RSE G;  4ME2 A;  3G2V A;  1E8Y A;  5DIZ A;  1BPO A;  5FQ4 A;  3APD A;  1PC2 A;  2PL2 A;  3PZD A;  3PUJ A;  3PZ4 A;  5FQ8 A;  4ACK A;  1N4S A;  1V54 E;  1IHB A;  3KS2 A;  1U3D A;  1OCO E;  3QOU A;  1UOH A;  2EIJ E;  2ETC A;  3DSU A;  3I4G A;  4PH4 B;  2E0I A;  3UUX A;  4KBQ A;  4BET A;  3E34 A;  5AJL A;  4ABN A;  2QYJ A;  3LCA A;  4DX5 D;  2IY0 C;  1N94 A;  5AEN A;  3NBN B;  4F7A A;  5CHE E;  2XS8 A;  3I3N A;  3FH5 A;  3FUJ A;  4I43 A;  2VSX E;  5DBK A;  3ML9 A;  3RRN B;  5FTP A;  4CDN A;  4BSZ B;  2P9S G;  3CHQ A;  3Q4A B;  5ENO D;  1BI7 B;  4BX8 A;  5G04 C;  2VTB B;  4JVS A;  4GZD A;  5JHA A;  2F0Y A;  2HO1 A;  3PE3 A;  1L5J A;  4YDW A;  1EDU A;  3DEO A;  1O1R A;  1XNF A;  1OWP A;  2BKK B;  3VLF A;  3D9I A;  3HXC A;  2A5E A;  5LX8 A;  4Q96 A;  2VGE A;  2J49 A;  5JHB A;  4BT8 A;  1OWM A;  3AS4 A;  3QAQ A;  4RG9 A;  4PUC A;  3FU0 A;  1SZA A;  2OND A;  3LYA A;  4GCN A;  3MZL B;  4XE0 A;  5FZR A;  4ANX A;  2DBA A;  3LY9 A;  2IFU A;  4LSZ E;  4E85 A;  2MOW A;  2I6H A;  2L0T B;  3QK0 A;  4MLP A;  4G11 A;  3MEK A;  5FZS A;  3EJN A;  3JXJ A;  4NQ0 A;  3SFZ A;  3PDN A;  2CHZ A;  4G2V A;  4LRZ A;  2VJ8 A;  4FJY A;  3HIZ A;  3BU8 A;  2FEZ A;  5EIB E;  3D3M A;  3TWV A;  1RW2 A;  2I1J A;  2H6G A;  4GTQ A;  3TWW A;  3D9M A;  1W3B A;  3UIO C;  2IJG X;  3EIJ A;  1NFI E;  3CKC A;  5ANR A;  3QNK A;  3UTM A;  5B1B E;  2PZI A;  4IYP A;  4DUI A;  2FO1 E;  4U63 A;  2WXH A;  2XEN A;  5JA4 D;  1KZO A;  3Q9U C;  3L54 A;  2KM4 A;  1N95 A;  5AAR A;  4N3C A;  3ZEF A;  1NA3 A;  4HI9 A;  1V55 E;  3B95 A;  4BTB A;  4YDO A;  5AJD A;  2QC9 A;  4AY5 A;  2DIW A;  4JPS A;  4GYO A;  3UPV A;  2I9C A;  1N11 A;  3VTX A;  3T5V A;  1KT0 A;  2ZGG A;  3JUE A;  2OVB A;  3DXK G;  4XKB A;  2OCC E;  3J5Q B;  4FLB A;  3GW4 A;  4JB8 P;  3EHQ A;  5CMW A;  2P9K G;  4U07 A;  2L6B A;  5FT9 A;  3JXI A;  3FU6 A;  5CED B;  3ASO E;  2NYJ A;  1E96 B;  2NSZ A;  5IY5 E;  3KSL A;  3SF4 A;  1TNO A;  2DZO A;  3KD7 A;  4AEZ C;  4GMR A;  2GRM A;  3NOC D;  2DZN A;  3B7T A;  3HXF A;  2I1K A;  3HHM A;  4IRU A;  1JCS A;  2WMO A;  5D2M C;  2FI7 A;  3B7R L;  4GTO A;  4BFR A;  1Y6I A;  3CVQ A;  4UWH A;  3ABM E;  1KZP A;  3O4Z A;  2F37 A;  2GW1 A;  3C3O A;  3FEX A;  3T9K A;  2KCL A;  3CHO A;  3JQ1 A;  4AY6 A;  3ESL A;  3FU5 A;  4A63 B;  2EIK E;  3KEZ A;  3R9M A;  4NRH B;  3GZS A;  3CR3 A;  2FF4 A;  2IU1 A;  5AIJ A;  5BV1 A;  1OCR E;  2ETB A;  2WXP A;  4FHJ A;  2H6F A;  4C0E A;  3U4T A;  3BEE A;  4KMO A;  1IQR A;  4L1B A;  4URK A;  1U2V G;  3QKY A;  4UQZ A;  1Q2Z A;  3FHE A;  5CEC B;  1QQE A;  2RD0 A;  2GRL A;  3MA5 A;  2P58 C;  2UY1 A;  3V30 A;  3CHM A;  1OUV A;  1D8E A;  3X2Q E;  1MX4 A;  4LNB A;  3PEU B;  5CER B;  4G24 A;  3ULQ A;  4O60 A;  3GZ1 A;  3Q47 B;  3U64 A;  2ZIS A;  1EYH A;  2DCP A;  4HNA D;  3UT4 A;  1G3N B;  3UM3 A;  1DNP A;  2IO2 C;  3QWV A;  3KSQ A;  1S64 A;  2YHC A;  3ASG A;  3FDH A;  3LS8 A;  3ZKJ A;  3UQ3 A;  2RG8 A;  3ZXP A;  3J5P A;  2GRP B;  3LDZ A;  4C0M A;  5LOZ A;  4DX2 A;  2R03 A;  3CHR A;  1NL4 A;  4LCT A;  1SW6 A;  3ASD A;  4MBG A;  3MJW A;  4OAU C;  5AN8 A;  3ZGQ A;  5KNH D;  4LNU D;  2OV8 A;  2PQR A;  3ASN E;  3Q79 A;  3DSX A;  2XPY A;  4GA2 A;  3PS6 A;  4B8A A;  5EYL A;  2VSN A;  3PUK A;  5E76 A;  1X81 A;  4JC8 A;  2J4B A;  4TUU A;  5LP0 A;  4XZ4 A;  4Z68 A;  1MX6 A;  4HOU A;  2V4H C;  3TWQ A;  2JEK A;  3S7F A;  4HBD A;  4N39 A;  2AXU A;  3AS5 A;  4CRW A;  4I9E A;  4O1P A;  4Y6C A;  3CKB A;  4QFV A;  3V79 K;  5AQ7 A;  3SO8 A;  4FAD A;  2LAI A;  1LD8 A;  2HYZ A;  3NZS A;  3TG5 A;  2KZT A;  3LVR E;  2C0L A;  3MYV A;  3SY2 A;  3SBT B;  3Q7F A;  4GZ6 A;  3S7D A;  4LEU A;  4JEU A;  2IQC A;  5KCM A;  3R7Q A;  2AJA A;  1N0Q A;  5FJY A;  3ZIM A;  4GTP A;  3CIA A;  2WXN A;  1IXV A;  5A7D B;  1IKN D;  3NF1 A;  2R59 A;  4WUY A;  4TXR A;  4UQY A;  3IXE A;  3LVQ E;  2VYI A;  2WXO A;  3ONK A;  2WXI A;  3TL5 A;  4P29 A;  2XZD G;  4FJZ A;  1QNF A;  4G25 A;  4UWK A;  5LCW C;  3CVN A;  3FTV A;  3V31 A;  4UWG A;  5EN5 D;  1ZBP A;  1TNU A;  1X5B A;  2P9U G;  5LCW J;  1XGW A;  3I4R B;  3HXB A;  3RU0 A;  3PRZ A;  4N3B A;  1TNZ A;  3Q15 A;  3MV3 B;  2V0P A;  1KPS B;  4M7C A;  2J07 A;  3UXG A;  1HG5 A;  3MKR A;  1SZ9 A;  1UJJ A;  2X6F A;  5FZQ A;  3FWV A;  4F6R D;  2VSO E;  3UX4 A;  1E7U A;  1H2U A;  4L9P A;  5ENR D;  3RRM B;  3UM2 A;  3E37 A;  3B7S A;  5BUZ A;  4U8Y D;  4J6I A;  4B93 B;  3AS8 A;  4OAV B;  4FA6 A;  2M63 A;  2R5S A;  2B0O E;  3FUI A;  3AU5 A;  5KJM A;  4MKT A;  4FHK A;  2A5U A;  3RRU A;  1IYG A;  4CT0 A;  4YVO A;  2QFC A;  3D9K A;  3DSS A;  2F8Y A;  1H6K A;  1P5Q A;  1WAO 1;  2OVF A;  4GPK A;  1H19 A;  3ZHE B;  4WWO A;  3E4B A;  4A3T A;  5G04 J;  1JCR A;  1QZ2 A;  2VSY A;  4YDY A;  3SBS A;  3SD5 A;  3TJP A;  5G05 J;  3Q5M A;  4U96 D;  4BEP A;  2X6I A;  4A1S A;  1ELK A;  4XI0 A;  4DJA A;  1AP7 A;  2X6H A;  1OWL A;  5BXO A;  3TAX A;  4I1M A;  4JHR A;  4PDX A;  5EIL A;  4L7T A;  5ENQ D;  3FTZ A;  4KVO A;  3R7R A;  2IOL A;  2WXM A;  4BSX A;  3ABL E;  4GZC A;  3DXM G;  1K1B A;  4FUL A;  2H6H A;  2AVP A;  3QWP A;  1LTX A;  3JUI A;  2AXV A;  3P1U A;  5ENT D;  3PE4 A;  3DSV A;  4ILG A;  2EIL E;  3TXM A;  2RFM A;  4TRQ A;  3EUV A;  4XEI G;  5KJN A;  4UUC A;  5JMN D;  2Y69 E;  2ZGD A;  2XQ0 A;  3NAW A;  4A1G A;  2Y0B G;  4AVX A;  5M72 A;  4Q94 A;  2AXZ A;  1YYH A;  2CG3 A;  5EYP F;  2JLB A;  3JCK C;  1MHQ A;  4GZ5 A;  4GMJ A;  4B0Z A;  2AWI A;  2BF0 X;  3E30 A;  5ITZ F;  2FUL A;  2IEJ A;  4GML A;  3CVY A;  2FO7 A;  2XEH A;  3MKQ B;  2EQX A;  1TN8 A;  4ANU A;  5FQ6 A;  4U0U A;  5ENS D;  3SI5 A;  3AJI A;  3ZYL A;  2HE0 A;  3R9A B;  1JUQ A;  4BES A;  4LER A;  2YIN A;  2J9Q A;  4OYS A;  2WXK A;  1O1S A;  5JJT A;  4J0U A;  2XPZ A;  4KYO B;  3BG1 B;  3L22 A;  1LD7 A;  3Q75 A;  3CQG B;  4GYW A;  3L16 A;  4DX6 D;  4EBA A;  3UKU G;  4ZFH A;  4ANW A;  3ASF A;  4Y6W A;  3TGO A;  4ACL A;  2P9N G;  3CVL A;  5A6C A;  3IBE A;  1FCH A;  2HR2 A;  3S7J A;  3CVX A;  1OWN A;  4XKC A;  4DI3 A;  4DLO A;  2IOS A;  4HXI A;  3V2X A;  5ANL A;  4L2L A;  2R02 A;  3NOG D;  1LF8 A;  4FP7 A;  4B94 A;  3ABK E;  5A23 A;  3UI2 A;  1N54 A;  1ELW A;  3MX3 A;  4WNG A;  2DVW A;  4U0S A;  1U3C A;  4J8E A;  4HOS A;  2KAT A;  3W9F A;  3ZU7 B;  3EHN A;  4ATG A;  3G2U A;  1HX8 A;  2XCC A;  2P2C P;  3PRE A;  4YND A;  3L6A A;  4JZY A;  3I5P A;  1DVP A;  1FPP A;  2V8S E;  3EU9 A;  3NB2 A;  2IO3 C;  3ZUV B;  4PS3 A;  2R05 A;  3G2S A;  1H6P A;  3QJZ A;  2XZT G; 
#chains in the Genus database with same CATH homology
 5FQ4 A;  3APD A;  4TUU A;  1PC2 A;  2PL2 A;  3PZD A;  5LP0 A;  3PUJ A;  4N2S A;  5FQ8 A;  4ACK A;  4XZ4 A;  4CDR A;  4CGV A;  3FUH A;  4HOU A;  4E6H A;  2PM6 A;  3KS2 A;  3G2T A;  1HH8 A;  3K9I A;  3RK6 A;  1U3D A;  3SGH A;  4C0M A;  2YNQ A;  3CVW A;  2JEK A;  3QOU A;  3S7F A;  4N39 A;  3MKQ A;  1NZN A;  2AXU A;  3AS5 A;  3BG0 B;  3MV2 B;  4CRW A;  3I4G A;  4PH4 B;  2E0I A;  4I17 A;  4I9E A;  3UUX A;  4KBQ A;  2XRY A;  4AXH A;  4Y6C A;  4W9R A;  5AJL A;  3CKB A;  4QFV A;  4ABN A;  4BX9 A;  1UN9 A;  4FAD A;  4KXK B;  3HVE A;  3FH7 A;  2LAI A;  3LCA A;  2HYZ A;  3CK8 A;  4JA9 A;  4CEM A;  3NZS A;  2LSV A;  2LO6 A;  5AEN A;  3FP3 A;  3TG5 A;  1B89 A;  3ZYM A;  2KZT A;  4F7A A;  5CHE E;  1HG2 A;  1HS6 A;  3I3N A;  1PY1 A;  3LVR E;  2C0L A;  3FH5 A;  3FUJ A;  5HQ8 A;  4I43 A;  4A3V A;  3MYV A;  2CFZ A;  2VSX E;  2WXG A;  3SBT B;  4GZ6 A;  5KJK A;  2R17 C;  4WNF A;  1IHG A;  4IUL A;  5DBK A;  1OWO A;  3ML9 A;  5BPP A;  3OXG A;  4GYY A;  4LEU A;  3S7D A;  4JEU A;  4U04 A;  3RRN B;  5JJ7 A;  5FTP A;  4CDN A;  3D9N A;  2IQC A;  5KCM A;  3GZ2 A;  3CHQ A;  3Q4A B;  3R7Q A;  4BX8 A;  2WQ6 A;  3CLJ A;  4HFG A;  5G04 C;  4APO A;  3NQP A;  2WQH A;  5FJY A;  2VTB B;  4HOQ A;  4JVS A;  3ZIM A;  3CIA A;  2WXN A;  4GZD A;  4J8F A;  1TJF A;  3QWW A;  5A7D B;  5JHA A;  1A17 A;  1INZ A;  2YHE A;  4U8H A;  1E8W A;  2HO1 A;  3FTX A;  3PE3 A;  3UT7 A;  2KC7 A;  1L5J A;  3NF1 A;  1EDU A;  5FQ7 A;  3EHM A;  2R59 A;  3ESK A;  3IEG A;  4WUY A;  4UQY A;  1XNF A;  3LVQ E;  2VYI A;  1OWP A;  2WXO A;  3JYS A;  3ONK A;  4D10 C;  5T8I A;  4YVQ C;  3VLF A;  3D9I A;  3ZXS A;  4TV3 A;  2J08 A;  3ZYQ A;  2XRZ A;  5LX8 A;  2WXI A;  4PS8 A;  3TL5 A;  4P29 A;  4Q96 A;  4FJZ A;  4GU5 A;  1QNF A;  1N52 A;  4G25 A;  4UWK A;  3LXU X;  5LCW C;  3CVN A;  4BWR A;  3RIB A;  3SHF A;  3FTV A;  2J49 A;  4FC8 A;  5JHB A;  3SNX A;  4AV7 A;  4ILI A;  4BT8 A;  4UWG A;  1OWM A;  4CT4 A;  4EPZ A;  1PAQ A;  1ZBP A;  3AS4 A;  3QAQ A;  1X5B A;  3P2B A;  4RG9 A;  4PUC A;  2I2O A;  3FU0 A;  1SZA A;  2OND A;  4XIF A;  4B89 A;  1XGW A;  3LYA A;  5HI7 A;  5LCW J;  4GCN A;  3MZL B;  3I4R B;  4XE0 A;  4JHJ A;  5FZR A;  3PRZ A;  3FY4 A;  2QY7 A;  3RU0 A;  4N3B A;  3FUF A;  4PS7 A;  4BT9 A;  1IQU A;  2DBA A;  1H2T C;  3LY9 A;  3Q15 A;  2KCV A;  4RG6 A;  2A4Z A;  3CSF A;  3MV3 B;  2V0P A;  4J8S A;  3HYM B;  2J07 A;  2IFU A;  3T8M A;  3IHY A;  1HG5 A;  3MKR A;  1SZ9 A;  1UJJ A;  2X6F A;  4WWP A;  3VLE A;  4APF A;  5FZQ A;  3LKU A;  4E85 A;  2L0I A;  2MOW A;  3FWV A;  3ML8 A;  2VSO E;  2I6H A;  2L0T B;  1E7U A;  3MCX A;  3QK0 A;  4MLP A;  3UX4 A;  4G11 A;  1H2U A;  3APC A;  2X6K A;  1JWF A;  4C9B B;  5D0Q D;  4AOF A;  4ANX A;  1YA0 A;  3MEK A;  2Y4U A;  3RRM B;  5EKQ D;  5FZS A;  4F1S A;  3D9L A;  3EJN A;  4NQ0 A;  3SFZ A;  4I1O B;  4L23 A;  3PDN A;  1ZU2 A;  5G55 A;  2CHZ A;  3B7S A;  2WXJ A;  4G2V A;  3ZPJ A;  4I2Z A;  4LRZ A;  5BUZ A;  2VJ8 A;  4JEH A;  4J6I A;  3AS8 A;  4FJY A;  3HIZ A;  3CV0 A;  2AW6 A;  4HS2 A;  2X38 A;  3UT8 A;  1ELR A;  2FEZ A;  4FA6 A;  4XX5 A;  2M63 A;  4UWF A;  2R5S A;  5E75 A;  3RO3 A;  3FUI A;  3D3M A;  4K03 A;  3AU5 A;  5FWQ A;  2I1J A;  3HDX A;  3IKO B;  5KJM A;  4XI9 A;  1TJC A;  2X3M A;  3CEQ A;  4KZC A;  4MKT A;  3D9M A;  2A5U A;  4FHK A;  5G05 C;  4CCA A;  3RRU A;  1JWG A;  1W3B A;  3VTY A;  4HVB A;  3PNT B;  1IYG A;  3C98 A;  3IHV A;  3FUN A;  3TG4 A;  4CT0 A;  2IJG X;  3EIJ A;  2QFC A;  3D9K A;  3CKC A;  1UW4 B;  3QNK A;  4IN3 B;  3G2W A;  4JXT A;  4YVO A;  5ANR A;  1H6K A;  1P5Q A;  1WAO 1;  2J4D A;  2OVF A;  2PZI A;  4IYP A;  2L6J A;  4GPK A;  3PNL B;  1H19 A;  3ZHE B;  3LY7 A;  3QAR A;  2NXP A;  4U63 A;  4GZ3 A;  2WXL A;  3OXL A;  2WXH A;  3TXN A;  4WWO A;  2XGO A;  2Y3A A;  5D0O D;  3CST A;  3E4B A;  4A3T A;  5G04 J;  2XHE A;  3FTU A;  3S2A A;  2C0M A;  1QZ2 A;  4NUR A;  2VSY A;  3APF A;  3IV0 A;  2LAH A;  3SBS A;  3SD5 A;  3TJP A;  3PH0 C;  3ZVV A;  3LEW A;  3LY8 A;  5G05 J;  3L54 A;  3CK9 A;  4BY6 A;  2KM4 A;  1VDY A;  4I1A A;  2CG2 A;  3Q5M A;  3FUL A;  4J8D A;  4N3C A;  3ZEF A;  1NA3 A;  2WM9 A;  5JJ6 A;  2X6I A;  3U9W A;  4A1S A;  1HO8 A;  4WAF A;  4BTB A;  1ELK A;  4XI0 A;  3FH8 A;  1SQM A;  4DJA A;  5AJD A;  1Z6T A;  2X6H A;  2FBN A;  4UWL A;  4AY5 A;  2DIW A;  3EDT B;  1NA0 A;  4JPS A;  1OWL A;  4GYO A;  4KZ0 A;  4WND A;  3TAX A;  4I1M A;  4JHR A;  4PDX A;  2I9C A;  3URZ A;  3UPV A;  3VTX A;  3T5V A;  4L7T A;  3RKV A;  1KT0 A;  3CGH A;  4H7X A;  2UWJ G;  2OVB A;  3FTW A;  3ZHE A;  3ZW3 A;  3FTZ A;  4KVO A;  3SZ7 A;  4XKB A;  1JPL A;  3FFL A;  2VGY A;  3OAW A;  3R7R A;  4FLB A;  3GW4 A;  2WXQ A;  2IOL A;  3FTY A;  4B8C B;  5J90 A;  2WXM A;  4N5C A;  5CMW A;  4UI9 J;  4U07 A;  5FT9 A;  3ZFW A;  3L13 A;  3D9O A;  3FU6 A;  2XGM A;  1E7V A;  2CHW A;  3WXX A;  4BSX A;  1WY6 A;  4GZC A;  5ENN A;  2WB2 A;  4I9C A;  4FUL A;  2XPI A;  3KAE A;  1E96 B;  2AVP A;  2NSZ A;  4ILH B;  4AIF A;  3T5X A;  3L08 A;  3QWP A;  3JUI A;  4NAC A;  2AXV A;  3P1U A;  3PE4 A;  4ILG A;  4GA1 A;  3TXM A;  3SF4 A;  5BW8 C;  5BV0 A;  4RSY A;  1KLX A;  4TRQ A;  4DLQ A;  3KD7 A;  1HF8 A;  4AEZ C;  4CDM A;  3QC1 A;  2GRM A;  5KJN A;  4EEC A;  4OVV A;  2WMN A;  4GB9 A;  2YQ8 A;  3FEY A;  3B7T A;  2J09 A;  5T3R A;  1E8X A;  2I1K A;  3HHM A;  2XQ0 A;  4A1G A;  4IRU A;  4AVX A;  2XCB A;  5M72 A;  2C2L A;  4KT6 B;  2WMO A;  2KZT B;  5EX3 A;  4Q94 A;  3CVV A;  4JW1 A;  2V5F A;  2AXZ A;  3CHS A;  2CG3 A;  2FI7 A;  2JLB A;  3B7R L;  1MHQ A;  3JCK C;  1Y6I A;  4BFR A;  1H2V C;  3CVQ A;  5LFA A;  2V4L A;  3PVL A;  4UWH A;  4GZ5 A;  2VTB A;  4JL0 A;  3B7U X;  4GMJ A;  3O4Z A;  4B0Z A;  2GW1 A;  3FEX A;  2AWI A;  2BF0 X;  3D9J A;  4KVM A;  5EDS A;  2FUL A;  3S7B A;  2KCL A;  4GML A;  4UI9 C;  3CVY A;  1HE8 A;  2FO7 A;  3CHO A;  3JQ1 A;  4DI4 A;  1EF1 C;  3MKQ B;  4AY6 A;  2EQX A;  2OOE A;  2XGS A;  2LSU A;  3ESL A;  5EX0 A;  2MHK A;  4ANU A;  5FQ6 A;  4EZK A;  3JQ0 A;  3OXF A;  4U0U A;  3FU5 A;  4U0Z A;  3QDN A;  1GW6 A;  4I6J A;  1WM5 A;  2VGX B;  2MRI A;  3SI5 A;  2PM7 A;  1FVF A;  3ZYL A;  4UI9 K;  3Q49 B;  4F53 A;  3KEZ A;  4I6G A;  1JUQ A;  1HU3 A;  3R9A B;  4AM9 A;  4HLE A;  3U66 A;  2BUG A;  4NRH B;  4F3V A;  5BT1 A;  4LER A;  3NZU A;  3FUM A;  2ION A;  4EBA G;  2WQ7 A;  3GZS A;  2YIN A;  2J9Q A;  3CR3 A;  2FF4 A;  4OYS A;  2IU1 A;  3ONL A;  2WXK A;  4UQX A;  3RO2 A;  5AIJ A;  5BV1 A;  3FUK A;  5JJT A;  1NP7 A;  4J0U A;  2XPZ A;  4KYO B;  2VQ2 A;  2WXP A;  1HFA A;  3BG1 B;  4FHJ A;  2XEV A;  4C0E A;  3U4T A;  3L22 A;  4OVU A;  5J08 A;  4A55 A;  3BEE A;  4KMO A;  1UJK A;  4GAA A;  4EQF A;  1IQR A;  2WPV A;  4L1B A;  4URK A;  5T4Y A;  3CVU A;  3QKY A;  4GCO A;  1H0A A;  4UQZ A;  3CQG B;  1MQS A;  4GYW A;  4DPR A;  4DK5 A;  2CHX A;  3FHE A;  4JHK A;  4RVB A;  3L16 A;  1HXI A;  3B13 A;  2KCK A;  1QQE A;  4EBA A;  5CCM A;  2RD0 A;  4N2Q A;  1S0P A;  2GRL A;  4JA7 A;  5KJL A;  4LUN U;  4ANW A;  2WXR A;  4H7Y A;  3MA5 A;  4MRU A;  1E8Z A;  3ASF A;  2P58 C;  5C2Y A;  2UY1 A;  3FTS A;  1BPO A;  2IF4 A;  2NC9 A;  5CMY A;  5DIZ A;  3CQC B;  2E2E A;  3FUE A;  1UN8 A;  2WVI A;  2GGF A;  3ASH A;  3HVE B;  3QB2 A;  4Y6W A;  3TGO A;  5C1D A;  3CHM A;  4ACL A;  4HOT A;  3RJV A;  1OUV A;  4AP2 A;  5G2N A;  1TEZ A;  3ZRH A;  5BNW A;  4HOR A;  3CVL A;  3PEU B;  3IBE A;  5A6C A;  4G24 A;  3ULQ A;  1FCH A;  3CHP A;  1Y8M A;  2BTD A;  3EIQ C;  3GZ1 A;  4M3O A;  3Q47 B;  2HR2 A;  3GYZ A;  3S7J A;  3OTN A;  3CVX A;  1OWN A;  1Z3X A;  4XKC A;  3DPD A;  4N3A A;  3U64 A;  4I2W A;  3AU4 A;  3N71 A;  4DI3 A;  4EZL A;  4DLO A;  1EYH A;  2DCP A;  2IOS A;  4ANV A;  3UT4 A;  4HXI A;  1DNP A;  3O48 A;  3QWV A;  2Q7F A;  3ZN3 A;  5ANL A;  5ARG A;  4L2L A;  4G26 A;  1Z3Y A;  2PQN A;  1LF8 A;  4FLH A;  2YHC A;  4L2Y A;  3ASG A;  4FP7 A;  5AYW D;  5CCL A;  3U3W A;  2VGX A;  3PEV B;  2CFU A;  1KT1 A;  3LJ3 A;  3FDH A;  3LS8 A;  4WWN A;  3UQ3 A;  2RG8 A;  1E90 A;  3DBS A;  4B94 A;  3L17 A;  2ILR A;  4AJW A;  5A23 A;  3LDZ A;  1N54 A;  1ELW A;  3MX3 A;  4WNG A;  2Y4T A;  2LNI A;  3FUD A;  5LOZ A;  4U0S A;  1U3C A;  4J8E A;  4CGW A;  3CHR A;  4HOS A;  4R7L A;  2KAT A;  3FU3 A;  4LCT A;  1UG3 A;  3ASD A;  3CK7 A;  3MGB A;  4MS6 A;  3ENE A;  3MJW A;  3EHN A;  4ATG A;  2L9B A;  1FVH A;  3ZGQ A;  3UMV A;  3G2U A;  1HX8 A;  2XCC A;  4K0R A;  4O6F A;  4BTA A;  4G1T A;  2OV8 A;  1HZ4 A;  4GA0 A;  3VLD A;  1EPU A;  2PQR A;  5ARF A;  4WNE A;  3PRE A;  4YND A;  3LPZ A;  3D9P A;  2UY1 B;  3L6A A;  3ZYK A;  2HM8 A;  2XPY A;  4GA2 A;  2X6J A;  4I6E A;  4JZY A;  4V3I A;  3PS6 A;  4B8A A;  3I5P A;  4Q69 A;  3CVP A;  1DVP A;  2VSN A;  4G23 A;  2ZU6 B;  3PUK A;  2V8S E;  4EZJ A;  5E76 A;  4ME2 A;  4PS3 A;  3G2V A;  3G2S A;  3QJZ A;  4FU3 A;  2WXF A;  1E8Y A;  4JC8 A;  2J4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...