2V5FA

Crystal structure of wild type peptide-binding domain of human type i collagen prolyl 4-hydroxylase.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
97
structure length
97
Chain Sequence
FLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1
publication title Crystal Structure of Wild Type Peptide-Binding Domain of Human Type I Collagen Prolyl 4- Hydroxylase.
rcsb
source organism Homo sapiens
total genus 37
structure length 97
sequence length 97
ec nomenclature ec 1.14.11.2: Procollagen-proline 4-dioxygenase.
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2v5fA00
2V5FA 4BT8A 1HH8A 1FCHA 3LY9A 3E4BA 4HOSA 4XIFA 3ZGQA 3K9IA 3S7FA 2FEZA 5HI7A 2IFUA 5A6CA 2BUGA 2LSVA 3CKBA 3FWVA 4AM9A 3CK8A 3NF1A 3GYZA 4UI9J 4LEUA 4RG6A 2OOEA 5FJYA 4GYWA 3PE4A 4GZ6A 3MEKA 4N2SA 4I2WA 4J0UA 2Y4UA 3PDNA 3IEGA 4U0ZA 2P58C 4UQZA 4BTBA 4AIFA 4UQYA 2I6HA 1Y8MA 2Y4TA 4WNFA 4GA1A 5DBKA 2ONDA 4YVOA 4XI0A 3UPVA 3LYAA 1NA3A 2E2EA 4AY5A 2LNIA 4GZ3A 3OXLA 1NZNA 2XCCA 3ZFWA 5LCWC 2XPIA 3GW4A 4J8EA 4G1TA 3QWVA 1P5QA 3CVPA 1WM5A 4J8FA 3S7JA 4GYOA 3LY7A 3ZHEA 4YVQC 4I9CA 4CDRA 4GA0A 4GPKA 2YHCA 1E96B 3R9AB 2XGMA 1XNFA 4I1AA 3TAXA 3AS5A 1A17A 3ZN3A 5M72A 2VGXB 3OXGA 5DIZA 3BEEA 3U3WA 2L6JA 4RG9A 5C1DA 3EDTB 4U04A 5G04C 5EX0A 4G26A 4G23A 2PZIA 4AY6A 2KC7A 1OUVA 1HZ4A 3QOUA 1KLXA 4HORA 4GA2A 3AS8A 2AVPA 2XCBA 3CVQA 3CVNA 1QZ2A 4B94A 2VSNA 4I17A 4N5CA 4Y6CA 4BTAA 3S7BA 5G05C 3ASFA 1YA0A 1KT0A 2YQ8A 1PC2A 2NC9A 3MV3B 5BNWA 4N3CA 3QWWA 3PE3A 4UQXA 3KS2A 3O48A 4N39A 2KCVA 2VYIA 2XEVA 4XI9A 3FFLA 5D0OD 1ZBPA 4GCNA 5A7DB 3TGOA 3GZ2A 2PQRA 2C0MA 2UWJG 4HOQA 5JJ6A 2J9QA 4BWRA 5JJ7A 3AS4A 5KJNA 1ELWA 4WNGA 1NA0A 3Q15A 2MHKA 4KXKB 3CKCA 2FO7A 2WPVA 5EX3A 5G04J 1B89A 4W9RA 2C0LA 4JA7A 4ABNA 2FF4A 4NQ0A 1ELRA 4GZ5A 4G25A 2JLBA 4G2VA 3ULQA 1W3BA 3ZHEB 4Y6WA 4NRHB 3ASDA 2QFCA 2KATA 3CEQA 4EQFA 5CCLA 3RJVA 2UY1A 2XGOA 3SZ7A 4CGWA 5G05J 2HO1A 4APOA 4HOTA 3SF4A 3KAEA 2VQ2A 3QDNA 3KD7A 5BW8C 2PL2A 4JL0A 3Q5MA 3VTYA 3Q4AB 1HXIA 4CGVA 3RO3A 3N71A 3OXFA 4GYYA 2VSYA 1QQEA 5FZQA 3VTXA 3UQ3A 2XGSA 3HYMB 3WXXA 2Q7FA 4WNDA 4F3VA 4U0SA 4JA9A 3CK9A 1WAO1 1IHGA 2PQNA 3TG5A 5JJTA 3MV2B 3LPZA 5FZSA 3LY8A 5CCMA 4GCOA 4KBQA 3GZ1A 5LCWJ 2DBAA 4H7XA 5D0QD 3S7DA 3ASHA 4UI9K 4BT9A 5ARFA 2C2LA 3RKVA 3CK7A 3U4TA 4ME2A 3QKYA 4O6FA 1IYGA 4IN3B 5FT9A 3Q47B 3LKUA 3RIBA 5FZRA 3UUXA 5BT1A 3LCAA 5EKQD 2HR2A 2LSUA 5KJKA 2HYZA 3Q49B 2WQHA 3MA5A 5ARGA 1TJCA 3CV0A 2VGYA 3ZPJA 3RU0A 4U0UA 4UI9C 2GW1A 4I9EA 4J8DA 4JHRA 3URZA 4I2ZA 4YNDA 4A1SA 2KCKA 5KJMA 5KJLA 4H7YA 3JYSA 2R5SA 5CHEE 5FTPA 4KYOB 2IF4A 4WNEA 3FP3A 4HOUA 4G24A 2UY1B 2VGXA 5HQ8A 4N2QA 3RO2A 5AYWD 3MKRA 3ASGA 2FBNA 3QWPA 1ZU2A 2FI7A 2KCLA 4WUYA 3CVLA 4U07A 3ESKA 4N3AA 4N3BA 1KT1A 3TG4A
chains in the Genus database with same CATH superfamily
4BT8A 1JCRA 5G2NA 3ONLA 3L6AA 3AU5A 4HBDA 2FEZA 2IEJA 4HB5A 4G11A 5A6CA 2BUGA 3CKBA 3HVEA 5CBOA 4OVVA 3CK8A 4AJWA 3ZU7B 4PDXA 5ENOD 3LEWA 4LG6A 3PH0C 2OOEA 5FJYA 3PVLA 4CDMA 5LP0A 2MYOA 2FO1E 1JWGA 3R7QA 3IEGA 5B3SE 4BTBA 4UQZA 3MYVA 2KM4A 4AIFA 1TNOA 2OVFA 2Y4TA 4WNFA 3JQ0A 3B7RL 4Q69A 3APCA 5CERB 3AJIA 3HDXA 4GZ3A 2KZTB 2XCCA 5AENA 2CFZA 2XS1A 4XEIG 4UWHA 2QC9A 3CSFA 3MZLB 3D9NA 2BEDA 3RRUA 5LCWC 5ANRA 1MX6A 1NL4A 4J8EA 2J07A 3QWVA 3UXGA 4B0ZA 1P5QA 3CVPA 3W9GA 1TNZA 4LNGA 3UKUG 3S7JA 3CVXA 3ZHEA 4I9CA 3QK0A 1E96B 2X3MA 2YINA 1XNFA 3FDHA 5FINA 3AS5A 2WXOA 3ZN3A 2VGXB 2XS8A 2L6JA 5C1DA 4U04A 4G26A 4G23A 4BETA 1D9SA 3APDA 3QOUA 1OCOE 1OXJA 4PH4B 3AS8A 2AVPA 1S63A 1MQSA 2V0PA 1H0AA 3I5PA 4OVUA 4CT4A 3NBNB 3L9TA 3HVEB 3L13A 4N5CA 1NFIE 4BTAA 2B6CA 3S7BA 5G05C 4F1PA 2V4HC 4GZDA 4LSZE 3DPYA 2XRYA 1S64A 3RRMB 3RRNB 2R03A 2IONA 4IRUA 2EIKE 5BNWA 4URKA 4UQXA 1LF8A 3KS2A 3DXMG 3UX4A 3E34A 4DI3A 2XEVA 3EIQC 4XI9A 5CMYA 3PZ1A 3FUFA 1ZB1A 4KZCA 4GTPA 2LUHA 3NQPA 1SVXA 4HOQA 4NACA 2QYJA 5JJ6A 4P29A 2XEHA 4AOFA 4ATZD 4YDEA 4L2YA 1OT8A 4YDWA 3ZXPA 2MHKA 5D2MC 1H2TC 5BV1A 2XPYA 4KXKB 3CKCA 4PS3A 2WVIA 5EX3A 5G04J 2C0LA 4A1GA 2FF4A 1HO8A 4HQDA 1EPUA 3FH8A 3CQGB 4GTTA 5HRYA 3Q9NC 5CECB 3UINC 1DCEA 3FEYA 3ZHEB 3MJWA 3HXBA 3I4GA 4MRUA 2IQCA 4EQFA 3WG7E 2HO1A 5CRVA 4HOTA 1E7UA 4U8YD 4JZYA 4FU3A 1TNUA 4JL0A 3Q5MA 3PNTB 2F8XK 4CGVA 5EIBE 5EIDA 3UQ3A 4GZCA 3WXXA 3T9KA 4F3VA 4D10C 4A3TA 3TWVA 2ZGDA 2GRPB 3CK9A 1HFAA 4U7EB 3RK6A 4HNAD 1TYQG 3LPZA 2WXIA 2R59A 4GCOA 4KBQA 3GZ1A 3G2UA 2DBAA 4H7XA 3FTSA 5AJDA 4UI9K 3B7SA 4BESA 4OAVB 5ARFA 5JHAA 1O5MA 2C2LA 3SY2A 5FQ8A 1O1TA 2X38A 3SGHA 3V31A 3KSQA 2OVBA 4ME2A 4KZ0A 4U8HA 3Q79A 5FZRA 1H2UA 3LCAA 1OWPA 3UT7A 2LSUA 4K03A 4TXRA 3FH5A 4HS2A 3Q49B 3CHOA 1LTXA 4GMRA 3FUDA 5ARGA 2IOLA 4JEHA 1TJCA 4J8YA 1HX8A 2QY7A 2VGYA 5H7PA 5T4YA 3RU0A 3DEOA 2V4LA 3QNKA 4C0MA 1H19A 4GTQA 2NYJA 4ZFHA 2NXPA 3TJPA 2BKGA 1H6KA 1FT1A 3DXKG 3FU6A 2H6HA 4LCTA 5T8IA 3PREA 2P9IG 5FTPA 5CMWA 3E32A 3JXJA 1IKND 2DYSE 2J08A 2IF4A 3T5XA 3TWUA 4WWOA 4DJAA 4HOUA 1SZ9A 3HG0D 2EILE 1K1AA 3NAWA 3RO2A 5AYWD 1OWOA 4A55A 4Q96A 3PRZA 1OCCE 2FI7A 2KCLA 4WUYA 2RKKA 4U07A 3ESKA 3DSXA 5JHBA 1KT1A 4EHMA 2V5FA 3MCXA 3ZXSA 3ML9A 3LY9A 3E4BA 3IHYA 3GZSA 4K0RA 4HOSA 3OAWA 3ZGQA 1RW2A 3FU0A 3FUIA 3HHMA 4OYSA 2WM9A 3ULYA 2X6JA 3NF1A 3SFYA 1KZOA 2L0TB 3B7UX 4UI9J 4DX7D 3ZVVA 2FULA 3CHPA 1N4PA 4KMOA 4TRQA 3PE4A 4GZ6A 3MEKA 3SFXA 2AWIA 2IO3C 3X2QE 2Y4UA 1N54A 3NOCD 5KCMA 4PUCA 2VTBB 3SHFA 3IV0A 4FP7A 2WXLA 2OV8A 2ONDA 4YVOA 1K1BA 2KZTA 4JB8P 1SQMA 4UWKA 3OXLA 4O60A 3ZUVB 1NZNA 4HLEA 4JHJA 4AEZC 3S2AA 2L6BA 3ESLA 1UJKA 3VLDA 3CVWA 3ENEA 1JWFA 3FTYA 5E76A 3DSTA 3E30A 1NP7A 1BPOA 2IU1A 4E6HA 5KNHD 3LY7A 4J6IA 2WXJA 4GPKA 2X6HA 1DNPA 2BKKB 5A23A 4FADA 3CHMA 4FULA 1A17A 4I1MA 4B8CB 3ML8A 3UKRG 4PS8A 1BI7B 3U3WA 4MLPA 1TN6A 3CHRA 3FUEA 3SO8A 5FQ6A 5LX8A 5EX0A 3ZRHA 2PZIA 2P9KG 1OUVA 1HZ4A 2J4DA 4DUIA 1V54E 5EYPF 4GA2A 3C3RA 1D8DA 3HRAA 1IHBA 4IULA 1EF1C 4RLYA 4GPMA 2WXPA 2YQ8A 3EU5A 3NZSA 1PC2A 3FTUA 1LD8A 3QWWA 2XZDG 2I1JA 3CGHA 3PE3A 1H6PA 2Y69E 2H6FA 1O1SA 1OCRE 1QBQA 2DVWA 3CVUA 3PUJA 1HS6A 5D0OD 3FU5A 4XKBA 2NSZA 2M63A 4GCNA 2C0MA 2WXNA 2OEVA 4MBGA 5AJLA 3J5QB 4GMJA 3VLFA 2P9NG 4JC8A 1KPSB 1INZA 4A63B 3AG3E 2FO7A 2WPVA 1UJJA 4W9RA 4JA7A 4FC8A 3SQVA 2F0YA 1Z3XA 4U63A 1MYOA 1IQRA 1YYHA 4NRHB 1SA5A 1VDYA 3DSSA 1TN8A 4GTRA 3CEQA 3RJVA 1N4QA 3DRAA 4CGWA 5G05J 2X6FA 2DWZA 3B13A 3P2BA 3KAEA 4EZLA 3V30A 2WMNA 3ZW3A 3OTNA 4JVSA 1AWCB 3N71A 2P9PG 3EU9A 4HLLA 2VSYA 1QQEA 4YDOA 2J8SD 4O1OA 2H6IA 5EILA 3FU3A 2KXPC 3U64A 4J7WA 2XGSA 3HYMB 3C98A 2PM6A 2Q7FA 4DX2A 4WNDA 4U0SA 2WB2A 4ANXA 2IY0C 3PUKA 4JA9A 5J90A 1OWMA 2RFAA 1L5JA 2R2LA 2PQNA 2PM7A 3UTMA 3L16A 5AAOA 3DEPA 1N9AA 1E8XA 4KT6B 3JCKC 3PZDA 4DLOA 5KWDA 2ETBA 2ZGGA 4GU5A 3G2WA 3L17A 3UMVA 3KSLA 3ZYKA 3U66A 3PZ3A 3ZKJA 1Z3YA 3CK7A 4U95D 4O6FA 1IYGA 3CQCB 4EPZA 4IN3B 4G8KA 4BERA 5JMND 1RZ4A 5BT1A 4DPRA 5EKQD 4CDNA 2AXZA 5KJKA 4R7LA 5EN5D 2WQHA 2V5QC 3T8KA 4DX6D 3CV0A 3ZPJA 1MZCA 1TNYA 3EHQA 4AXHA 4XKCA 4U0UA 4F7AA 4M3OA 2E0IA 2WXQA 3Q78A 4FHKA 4A1SA 3B95A 2AXUA 4O1PA 3FUMA 3JYSA 2R5SA 1SW6A 5CHEE 4KYOB 5AARA 4NURA 4LERA 1E8ZA 3TWQA 4WNEA 4HRLA 3G2TA 2GRMA 2OEWA 5HQ8A 4U8VD 1S70B 3MKRA 3AG4E 2FBNA 3PZ2A 3AAAC 4JXTA 3Q7FA 3FULA 1H6OA 4N3BA 2DYRE 3ULEG 1X5BA 1TEZA 1WDYA 1HH8A 1FCHA 1Q2ZA 2WXRA 3SI5A 3AG2E 4ACLA 4XIFA 3K9IA 3E37A 3S7FA 4F1SA 5HKPA 4ILIA 3QAQA 2LSVA 1UW4B 3FWVA 2CG3A 2P9UG 4AM9A 4LRZA 3HXCA 3FTXA 3GYZA 2A5EA 5AQ7A 3Q9UC 4TUUA 3UIOC 4UWFA 4LEUA 4RG6A 3EJNA 4EZKA 4GYWA 4LNUD 3UI2A 3JXIA 4I43A 4XX5A 3R9MA 5AQAA 4N2SA 2P9LG 3UM0A 4J0UA 4B93B 2VTBA 3PDNA 1DVPA 3L54A 4U0ZA 2B0OE 1JUQA 3ONKA 3IBEA 3JUEA 5KBAA 4LUNU 3O4ZA 1TJFA 3MX3A 4XI0A 2Y3AA 3UPVA 5AQBA 2E2EA 3FH7A 5JA4D 4AY5A 2LNIA 4ILHB 3FUNA 4N5QA 4TV3A 1BD8A 1UG3A 3NOGD 5BPPA 1MJ0A 2DIWA 3D9IA 3KEAA 4TXPA 3KEZA 2WQ7A 2ILRA 5EYLA 1XGWA 3ZYMA 1WM5A 2VGEA 3FY4A 5ENSD 2WQ6A 3FUJA 3QJZA 4Q94A 4YVQC 1OY3D 3C5RA 1WY6A 4CDRA 4GA0A 2KBXA 3R9AB 3BU8A 3I3NA 3CVYA 3V2OA 3MKQA 5DIZA 4C48B 1JCQA 3D9MA 1Y6IA 1H2VC 2R02A 5KNGA 4JPSA 3TWWA 3SFZA 2ZXWE 1JCSA 2XCBA 4ANUA 3CVQA 3CVNA 5AN8A 4B94A 2RFMA 4I17A 4QFVA 4JD2G 1N0QA 3MGBA 1YA0A 1KT0A 4OAUC 4L9PA 4V3IA 3BUAA 4EBAG 2NC9A 2EIJE 3MV3B 4AP2A 4N3CA 3ZYLA 3EHNA 3I4RB 3EIJA 5FQ4A 2RD0A 3CVVA 2AJAA 1FT2A 1U2VG 3QB2A 1MHQA 4CEMA 1TR4A 1X81A 1FVFA 3D3MA 4ANWA 5A7DB 3TGOA 3PEVB 4KVMA 1A5EA 2PQRA 1GW6A 2UWJG 4MKTA 2J9QA 5JJ7A 3AS4A 3C3QA 2A4ZA 4CCAA 4EZJA 1NA0A 2EIME 3D9OA 2GROB 1DCQA 1B89A 3HXDA 2XENA 5BXOA 3SBSA 4NQ0A 4ACKA 1ELRA 4M7CA 1UN9A 2BTDA 2LO6A 2OCCE 2JLBA 5AQ9A 3CLJA 4AVXA 3TWXA 2XHEA 1W3BA 2X6IA 4Y6WA 3ASDA 3PEUB 4BX9A 2QFCA 3HIZA 5CCLA 1QNFA 2XGOA 3SZ7A 3NB2A 3UM1A 3ISMC 3MKQB 3SF4A 2IO2C 4DLQA 2VQ2A 3QDNA 3KD7A 5BW8C 4AV7A 2PL2A 3VTYA 1OWNA 2QZAA 1HXIA 3D9PA 1N52A 3RO3A 3OXFA 4GYYA 5BXUA 1Z5SC 2WXHA 4L23A 3D9JA 3NZUA 5ENTD 3LJNA 4RQIA 2J09A 3B7TA 3SNXA 4I6JA 4JHKA 3TWRA 2CG2A 4JEUA 4C9BB 1HF8A 3LDZA 3W9FA 2GGFA 5FZSA 4APFA 2L9BA 3TXNA 3APFA 4QQIA 5LCWJ 3LJ3A 1FVHA 2ZISA 5D0QD 4Z68A 2HE0A 3HXEA 3RKVA 5CBNA 4ZHBA 3TWSA 5HS0A 1D8EA 3U4TA 3QKYA 4BX8A 1BI8B 4HFGA 5FT9A 2J49A 3LKUA 3UUXA 2A5UA 1E8YA 2HR2A 3UT8A 4CT0A 3J5PA 3IKOB 4BEPA 3FEXA 3AG1E 2GRRB 3U9WA 2LXMA 3FUKA 1AP7A 3P1UA 2YHEA 5T3RA 4IYPA 4DRXE 4X8QA 3ZEFA 2GW1A 2AXVA 1MX2A 1SA4A 3HXFA 4JHRA 3URZA 3DSWA 3FTWA 2IJGX 4YNDA 1BU9A 3TWTA 4EECA 2VSOE 2VSXE 5ENQD 2MOWA 5KJMA 3Q75A 4ATGA 4H7YA 5D66A 2ETAA 2ETCA 1N94A 1LD7A 1EDUA 3SBTB 1SZAA 2F37A 1KZPA 1K3ZD 5G55A 1WG0A 4DX1A 4K5CA 4FLHA 4B8AA 4BFRA 3QWPA 5ITZF 1ZU2A 4NIKA 3L08A 1OWLA 4GAAA 5AIJA 4N3AA 1TNBA 4FHJA 3E33A 2WMOA 4HI9A 1K8KG 4B89A 2I2OA 5FWQA 2P9SG 4G8LA 2J4BA 3IHVA 5HI7A 2IFUA 5BV0A 3BG1B 2JABA 1PY1A 4K5AB 3ZNGA 2CHXA 1JPLA 1ELKA 1UN8A 2I9CA 1O1RA 3TL5A 2Y1LE 3D9LA 4RSYA 2GRLA 2LAHA 3V79K 3AU4A 2QYUA 3DBSA 4I2WA 3BQOA 4WWPA 3CIAA 2P58C 4UQYA 2I6HA 1Y8MA 1IQUA 2DZOA 4GA1A 5DBKA 2DZNA 3ABKE 3D9HA 3LYAA 1NA3A 3ASNE 1E90A 2XZTG 4L1BA 1HG2A 4JW1A 3D9KA 3ZFWA 2L0IA 2MRIA 1U3CA 2XPIA 1N95A 3GW4A 4G1TA 4HXIA 4J8FA 4I1OB 4GYOA 2PNNA 3CHQA 3LVQE 2YHCA 4GB9A 1S0PA 2JEKA 1MX4A 3UM3A 4UWGA 2XGMA 4I1AA 4MS6A 3TAXA 4ANVA 1HU3A 4WWNA 5M72A 2WXKA 1N0RA 3OXGA 3C3OA 3BEEA 2LXLA 3L22A 3FUHA 4RG9A 3DSVA 3EDTB 4BSXA 5G04C 4FA6A 4AY6A 2KC7A 1E7VA 4YDYA 1KLXA 4L7TA 3EUVA 2ZIRA 4HORA 1QZ2A 3LVRE 1V55E 2VSNA 3Q73A 4KVOA 5LOZA 4Y6CA 3QARA 2AW6A 3DSUA 2R17C 3RSEG 3ASFA 3EHRA 3ABME 2X6KA 4F6RD 3LXUX 1G3NB 1BLXB 5C2YA 4F53A 3O48A 4N39A 2KCVA 2WXGA 2VYIA 3CSTA 2GRNB 4PS7A 2I1KA 3LS8A 3FFLA 5EDSA 1ZBPA 3QC1A 2V8SE 3GZ2A 3FTZA 2EQXA 1FPPA 4BWRA 5KJNA 2LAIA 3CHSA 5ENPD 4U96D 1ELWA 1EYHA 4WNGA 3PS6A 3Q15A 4EBAA 4FJZA 3FHEA 3PZ4A 5B1BE 4A3VA 1U3DA 4ABNA 2BF0X 4HI8A 1PAQA 4GZ5A 4ILGA 4CRWA 4G25A 4UWLA 2DCPA 4G2VA 4HRNA 5B1AE 3ULQA 5FQ7A 5ANLA 5BUZA 3EHMA 2KATA 3TXMA 2UY1A 2WXFA 3SD5A 4APOA 3BG0B 4K5BA 2Y0BG 3DPDA 3Q4AB 2XRZA 3VLEA 4BY6A 5IY5E 3ZIMA 5FZQA 3VTXA 3UM2A 4XE0A 2XEEA 5CEDB 1HE8A 2VJ8A 4CZ2D 2F8YA 1YMPA 3UIPC 2GRQB 5E75A 1WAO1 1IHGA 3PNLB 2XPZA 3R7RA 2P2CP 3TG5A 5JJTA 3MV2B 3G2VA 4J8SA 4XZ4A 3LY8A 2RG8A 5CCMA 5CEAA 5FIOA 3S7DA 3ASHA 4I6GA 4BT9A 2HM8A 4HRMB 4DK5A 4TUMA 3G2SA 4GMLA 3B7BA 5ENNA 2H6GA 3Q47B 5J08A 3RIBA 1Z6TA 3T5VA 1N11A 2HYZA 4L2LA 3MA5A 4UUCA 2CHZA 2XQ0A 2CFUA 2IOSA 2YNQA 4UI9C 1N4SA 4I9EA 4J8DA 4C0EA 4GTMA 4DI4A 3JQ1A 4LNBA 3L82A 1UOHA 1DC2A 3Q7AA 2WXMA 4I2ZA 1HG5A 3RAUA 2KCKA 3UT4A 3ASOE 5KJLA 4RVBA 1OCZE 4TXQA 4CYMD 5ENRD 4BSZB 3V2XA 3ZYQA 1IXVA 2EINE 4FLBA 3FTVA 4DX5D 1N4RA 1E8WA 3CR3A 3FP3A 3JUIA 4GTSA 3C72A 1YCSB 4G24A 4FJYA 2UY1B 3T8MA 2VGXA 5LFAA 3ABLE 4N2QA 4GTVA 5CRUA 2CHWA 3ASGA 3IXEA 3DWLG 4HVBA 2ZU6B 1QYMA 1TN7A 4GTOA 3CVLA 4I6EA 1NI1A 2R05A 4WAFA 3TG4A 3F6QA 4E85A
chains in the Genus database with same CATH topology
2V5FA 4BT8A 3MCXA 1TEZA 1HH8A 1FCHA 2WXRA 3ZXSA 3ML9A 5G2NA 3LY9A 3SI5A 4B89A 3E4BA 2I2OA 3IHYA 3GZSA 4K0RA 3ONLA 4ACLA 4HOSA 3L6AA 3OAWA 4XIFA 5FWQA 3ZGQA 3AU5A 3K9IA 3S7FA 2J4BA 4F1SA 3IHVA 2FEZA 4ILIA 5HI7A 2IFUA 5BV0A 3FU0A 4G11A 3BG1B 5A6CA 2BUGA 3QAQA 2LSVA 1UW4B 3FUIA 3CKBA 3FWVA 3HHMA 3HVEA 1PY1A 2CG3A 4OYSA 4AM9A 4OVVA 2WM9A 3CK8A 4LRZA 4AJWA 2X6JA 2CHXA 3NF1A 1JPLA 1ELKA 4PDXA 1UN8A 3FTXA 3GYZA 2I9CA 2L0TB 3B7UX 4TUUA 4UI9J 3TL5A 3LEWA 3ZVVA 2FULA 3D9LA 3CHPA 2GRLA 4LEUA 4RG6A 2LAHA 4RSYA 4UWFA 3PH0C 3EJNA 2OOEA 3AU4A 4KMOA 5FJYA 4EZKA 3PVLA 4CDMA 4GYWA 4TRQA 3PE4A 5LP0A 4I43A 4XX5A 3DBSA 4GZ6A 3MEKA 4N2SA 4I2WA 4J0UA 1JWGA 2AWIA 3R7QA 2Y4UA 3PDNA 1DVPA 4WWPA 2VTBA 3IEGA 1N54A 3L54A 3CIAA 4U0ZA 2P58C 4UQZA 4BTBA 3MYVA 2KM4A 5KCMA 4AIFA 1JUQA 4UQYA 4PUCA 2I6HA 3ONKA 2VTBB 3IBEA 1Y8MA 2OVFA 2Y4TA 4WNFA 1IQUA 3JQ0A 4GA1A 3SHFA 3IV0A 5DBKA 4FP7A 4LUNU 2WXLA 2OV8A 2ONDA 3O4ZA 4YVOA 1TJFA 2KZTA 3MX3A 3B7RL 4XI0A 2Y3AA 4Q69A 3APCA 3UPVA 3LYAA 1NA3A 2E2EA 3FH7A 4AY5A 2LNIA 1E90A 4ILHB 1SQMA 3FUNA 4TV3A 4GZ3A 3HDXA 3OXLA 2KZTB 4UWKA 1NZNA 1UG3A 2XCCA 4HLEA 5BPPA 4L1BA 4JHJA 5AENA 2CFZA 1HG2A 4UWHA 4JW1A 3S2AA 4AEZC 2DIWA 3D9KA 3ESLA 3ZFWA 3D9IA 3CSFA 3MZLB 3D9NA 2L0IA 2MRIA 1UJKA 3RRUA 3VLDA 5LCWC 5ANRA 3CVWA 3ENEA 3KEZA 2WQ7A 2ILRA 1JWFA 1U3CA 2XPIA 3GW4A 3FTYA 4J8EA 1XGWA 5E76A 2J07A 3QWVA 4G1TA 3ZYMA 1NP7A 4B0ZA 4HXIA 1BPOA 1P5QA 3CVPA 1WM5A 2IU1A 4J8FA 4E6HA 3FY4A 4I1OB 3S7JA 2WQ6A 3CVXA 3FUJA 3LY7A 3QJZA 4GYOA 4J6IA 3ZHEA 2WXJA 3CHQA 4Q94A 4YVQC 1WY6A 4I9CA 4CDRA 3LVQE 4GA0A 4GPKA 2YHCA 4GB9A 3QK0A 2X6HA 1E96B 1S0PA 2X3MA 2JEKA 1DNPA 3R9AB 5A23A 2YINA 4FADA 3CHMA 4UWGA 2XGMA 1XNFA 3FDHA 4FULA 4I1AA 4MS6A 3TAXA 3AS5A 1A17A 1HU3A 4I1MA 4WWNA 4ANVA 2WXOA 3I3NA 4B8CB 3CVYA 3ZN3A 5M72A 2VGXB 3MKQA 2WXKA 3ML8A 4PS8A 3OXGA 5DIZA 3BEEA 3U3WA 4MLPA 3L22A 2L6JA 3CHRA 3FUHA 3D9MA 4RG9A 1Y6IA 1H2VC 3FUEA 5C1DA 3EDTB 4U04A 5FQ6A 4BSXA 5G04C 5LX8A 5EX0A 3ZRHA 4JPSA 4G26A 4G23A 3SFZA 4FA6A 2PZIA 4AY6A 2KC7A 1E7VA 1OUVA 3APDA 1HZ4A 3QOUA 1KLXA 4L7TA 2J4DA 4HORA 4PH4B 4GA2A 3AS8A 2AVPA 1MQSA 2XCBA 4ANUA 2V0PA 3CVQA 1H0AA 3CVNA 3I5PA 1QZ2A 3LVRE 4B94A 4OVUA 2VSNA 4CT4A 3HVEB 3L13A 4I17A 4KVOA 4QFVA 4N5CA 5LOZA 4Y6CA 4BTAA 3QARA 2AW6A 4IULA 3S7BA 2R17C 5G05C 3MGBA 3ASFA 1EF1C 1YA0A 1KT0A 4GZDA 2X6KA 2XRYA 2WXPA 2YQ8A 3NZSA 4V3IA 3LXUX 4EBAG 3RRMB 3RRNB 1PC2A 2IONA 2NC9A 4IRUA 3FTUA 3MV3B 5BNWA 4AP2A 4URKA 5C2YA 4N3CA 3QWWA 3ZYLA 3EHNA 3I4RB 2I1JA 3CGHA 3PE3A 3EIJA 5FQ4A 4F53A 4UQXA 1LF8A 3KS2A 3O48A 4N39A 2RD0A 3CVVA 3UX4A 2KCVA 2WXGA 3QB2A 1MHQA 2VYIA 3CSTA 3CVUA 4DI3A 4CEMA 3PUJA 2XEVA 2I1KA 3EIQC 4PS7A 4XI9A 5CMYA 3LS8A 1HS6A 3FFLA 1FVFA 5D0OD 3FU5A 4XKBA 2NSZA 3D3MA 5EDSA 1ZBPA 2M63A 4GCNA 3FUFA 4KZCA 4ANWA 5A7DB 3TGOA 3QC1A 2V8SE 3PEVB 3GZ2A 4KVMA 2PQRA 1GW6A 2C0MA 3FTZA 3NQPA 2UWJG 2WXNA 4HOQA 2EQXA 4NACA 4MKTA 5JJ6A 2J9QA 4BWRA 5JJ7A 3AS4A 5KJNA 5AJLA 4P29A 2LAIA 3CHSA 2A4ZA 4AOFA 4CCAA 1ELWA 1EYHA 4EZJA 4WNGA 3PS6A 4GMJA 1NA0A 4L2YA 3Q15A 3VLFA 2MHKA 4JC8A 4EBAA 1H2TC 4FJZA 1INZA 3FHEA 2XPYA 5BV1A 3D9OA 4KXKB 3CKCA 2FO7A 4PS3A 2WVIA 2WPVA 5EX3A 5G04J 4A3VA 1U3DA 1UJJA 1B89A 4W9RA 2C0LA 4A1GA 4JA7A 4FC8A 4ABNA 2FF4A 2BF0X 3SBSA 4NQ0A 1HO8A 1ELRA 4ACKA 1PAQA 1EPUA 4GZ5A 4ILGA 3FH8A 1UN9A 1Z3XA 3CQGB 4CRWA 2BTDA 2LO6A 4U63A 4G25A 4UWLA 2JLBA 2DCPA 4G2VA 3CLJA 4AVXA 1IQRA 3ULQA 2XHEA 3FEYA 1W3BA 2X6IA 3ZHEB 5FQ7A 4Y6WA 4NRHB 3ASDA 1VDYA 3PEUB 4BX9A 5ANLA 5BUZA 3MJWA 3EHMA 2QFCA 2KATA 3CEQA 3I4GA 4MRUA 2IQCA 4EQFA 3HIZA 5CCLA 3RJVA 3TXMA 2UY1A 1QNFA 2WXFA 2XGOA 3SD5A 3SZ7A 4CGWA 5G05J 2HO1A 2X6FA 3B13A 3MKQB 4APOA 4HOTA 1E7UA 3BG0B 3P2BA 3SF4A 3KAEA 4EZLA 4DLQA 2VQ2A 3QDNA 4JZYA 3KD7A 5BW8C 4FU3A 4AV7A 2PL2A 4JL0A 2WMNA 3Q5MA 3ZW3A 3VTYA 1OWNA 3DPDA 3OTNA 3Q4AB 3PNTB 1HXIA 3D9PA 4JVSA 1N52A 4CGVA 3RO3A 2XRZA 3N71A 3VLEA 3OXFA 4BY6A 4GYYA 3ZIMA 2VSYA 1QQEA 5FZQA 3VTXA 2WXHA 4L23A 4XE0A 3FU3A 3UQ3A 3D9JA 3NZUA 3U64A 4GZCA 2XGSA 3HYMB 3WXXA 1HE8A 2PM6A 2Q7FA 2VJ8A 3C98A 4WNDA 4F3VA 4U0SA 4D10C 4A3TA 4ANXA 3PUKA 4JA9A 2WB2A 2J09A 5J90A 1OWMA 3B7TA 3SNXA 4I6JA 1L5JA 3CK9A 5E75A 4JHKA 1WAO1 1IHGA 1HFAA 3PNLB 2PQNA 2CG2A 2PM7A 4JEUA 2XPZA 3R7RA 3L16A 3RK6A 3TG5A 3MV2B 4C9BB 1HF8A 3G2VA 5JJTA 3LPZA 2WXIA 3LDZA 4J8SA 4XZ4A 2GGFA 5FZSA 3LY8A 2RG8A 2R59A 4APFA 5CCMA 2L9BA 3TXNA 3APFA 4GCOA 4KBQA 1E8XA 3GZ1A 3G2UA 4KT6B 3JCKC 3PZDA 4DLOA 5LCWJ 2DBAA 1FVHA 3LJ3A 4H7XA 5D0QD 3FTSA 3S7DA 3ASHA 5AJDA 4I6GA 4UI9K 4BT9A 3B7SA 4GU5A 3G2WA 5ARFA 3L17A 5JHAA 3UMVA 2HM8A 3ZYKA 3U66A 2C2LA 5FQ8A 4DK5A 2X38A 3RKVA 3SGHA 3G2SA 1Z3YA 3CK7A 3U4TA 2OVBA 3QKYA 4GMLA 4KZ0A 4ME2A 3CQCB 4O6FA 4U8HA 5ENNA 4BX8A 4EPZA 1IYGA 4HFGA 4IN3B 5FT9A 2J49A 3Q47B 3LKUA 5J08A 3RIBA 5FZRA 3UUXA 5BT1A 1H2UA 2A5UA 4DPRA 3LCAA 1Z6TA 5EKQD 1E8YA 2HR2A 3UT8A 1OWPA 3UT7A 4CDNA 4CT0A 3T5VA 2AXZA 2LSUA 4K03A 3IKOB 3FH5A 4HS2A 5KJKA 2HYZA 3Q49B 3CHOA 3FEXA 4L2LA 4R7LA 2WQHA 3FUDA 3MA5A 3U9WA 5ARGA 2IOLA 3FUKA 4JEHA 1TJCA 3CV0A 1HX8A 2QY7A 2VGYA 3ZPJA 5T4YA 4XKCA 3P1UA 3RU0A 4AXHA 2CHZA 2XQ0A 2YHEA 4IYPA 4U0UA 2CFUA 5T3RA 4F7AA 2IOSA 3ZEFA 2YNQA 4M3OA 4UI9C 2GW1A 2E0IA 4I9EA 4J8DA 2V4LA 4C0EA 2AXVA 3QNKA 3JQ1A 4DI4A 4JHRA 4C0MA 3URZA 3FTWA 4E85A 1H19A 2WXMA 2IJGX 2WXQA 4I2ZA 4YNDA 4FHKA 2NXPA 4A1SA 1HG5A 3TJPA 2VSOE 4EECA 2VSXE 2AXUA 1H6KA 2KCKA 2MOWA 5KJMA 3UT4A 4ATGA 3FU6A 5KJLA 3FUMA 4LCTA 4RVBA 4H7YA 3JYSA 5T8IA 2R5SA 3PREA 5CHEE 5FTPA 5CMWA 4KYOB 4LERA 4NURA 3ZYQA 1E8ZA 4FLBA 1EDUA 2J08A 2IF4A 3FTVA 4WNEA 3G2TA 3T5XA 1E8WA 3CR3A 2GRMA 3FP3A 3JUIA 4WWOA 3SBTB 4HOUA 4G24A 4DJAA 4FJYA 1SZ9A 2UY1B 1SZAA 3T8MA 2VGXA 5LFAA 5HQ8A 4N2QA 3RO2A 5AYWD 5G55A 3MKRA 1OWOA 2CHWA 3ASGA 4HVBA 2FBNA 4A55A 4FLHA 2ZU6B 4Q96A 4B8AA 4BFRA 3PRZA 3QWPA 1ZU2A 4JXTA 2FI7A 2KCLA 4WUYA 3L08A 1OWLA 3CVLA 4I6EA 4GAAA 4U07A 5AIJA 3ESKA 4N3AA 3FULA 4WAFA 4FHJA 5JHBA 4N3BA 1KT1A 2WMOA 3TG4A 1X5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V5F A;  4BT8 A;  1HH8 A;  1FCH A;  3LY9 A;  3E4B A;  4HOS A;  4XIF A;  3ZGQ A;  3K9I A;  3S7F A;  2FEZ A;  5HI7 A;  2IFU A;  5A6C A;  2BUG A;  2LSV A;  3CKB A;  3FWV A;  4AM9 A;  3CK8 A;  3NF1 A;  3GYZ A;  4UI9 J;  4LEU A;  4RG6 A;  2OOE A;  5FJY A;  4GYW A;  3PE4 A;  4GZ6 A;  3MEK A;  4N2S A;  4I2W A;  4J0U A;  2Y4U A;  3PDN A;  3IEG A;  4U0Z A;  2P58 C;  4UQZ A;  4BTB A;  4AIF A;  4UQY A;  2I6H A;  1Y8M A;  2Y4T A;  4WNF A;  4GA1 A;  5DBK A;  2OND A;  4YVO A;  4XI0 A;  3UPV A;  3LYA A;  1NA3 A;  2E2E A;  4AY5 A;  2LNI A;  4GZ3 A;  3OXL A;  1NZN A;  2XCC A;  3ZFW A;  5LCW C;  2XPI A;  3GW4 A;  4J8E A;  4G1T A;  3QWV A;  1P5Q A;  3CVP A;  1WM5 A;  4J8F A;  3S7J A;  4GYO A;  3LY7 A;  3ZHE A;  4YVQ C;  4I9C A;  4CDR A;  4GA0 A;  4GPK A;  2YHC A;  1E96 B;  3R9A B;  2XGM A;  1XNF A;  4I1A A;  3TAX A;  3AS5 A;  1A17 A;  3ZN3 A;  5M72 A;  2VGX B;  3OXG A;  5DIZ A;  3BEE A;  3U3W A;  2L6J A;  4RG9 A;  5C1D A;  3EDT B;  4U04 A;  5G04 C;  5EX0 A;  4G26 A;  4G23 A;  2PZI A;  4AY6 A;  2KC7 A;  1OUV A;  1HZ4 A;  3QOU A;  1KLX A;  4HOR A;  4GA2 A;  3AS8 A;  2AVP A;  2XCB A;  3CVQ A;  3CVN A;  1QZ2 A;  4B94 A;  2VSN A;  4I17 A;  4N5C A;  4Y6C A;  4BTA A;  3S7B A;  5G05 C;  3ASF A;  1YA0 A;  1KT0 A;  2YQ8 A;  1PC2 A;  2NC9 A;  3MV3 B;  5BNW A;  4N3C A;  3QWW A;  3PE3 A;  4UQX A;  3KS2 A;  3O48 A;  4N39 A;  2KCV A;  2VYI A;  2XEV A;  4XI9 A;  3FFL A;  5D0O D;  1ZBP A;  4GCN A;  5A7D B;  3TGO A;  3GZ2 A;  2PQR A;  2C0M A;  2UWJ G;  4HOQ A;  5JJ6 A;  2J9Q A;  4BWR A;  5JJ7 A;  3AS4 A;  5KJN A;  1ELW A;  4WNG A;  1NA0 A;  3Q15 A;  2MHK A;  4KXK B;  3CKC A;  2FO7 A;  2WPV A;  5EX3 A;  5G04 J;  1B89 A;  4W9R A;  2C0L A;  4JA7 A;  4ABN A;  2FF4 A;  4NQ0 A;  1ELR A;  4GZ5 A;  4G25 A;  2JLB A;  4G2V A;  3ULQ A;  1W3B A;  3ZHE B;  4Y6W A;  4NRH B;  3ASD A;  2QFC A;  2KAT A;  3CEQ A;  4EQF A;  5CCL A;  3RJV A;  2UY1 A;  2XGO A;  3SZ7 A;  4CGW A;  5G05 J;  2HO1 A;  4APO A;  4HOT A;  3SF4 A;  3KAE A;  2VQ2 A;  3QDN A;  3KD7 A;  5BW8 C;  2PL2 A;  4JL0 A;  3Q5M A;  3VTY A;  3Q4A B;  1HXI A;  4CGV A;  3RO3 A;  3N71 A;  3OXF A;  4GYY A;  2VSY A;  1QQE A;  5FZQ A;  3VTX A;  3UQ3 A;  2XGS A;  3HYM B;  3WXX A;  2Q7F A;  4WND A;  4F3V A;  4U0S A;  4JA9 A;  3CK9 A;  1WAO 1;  1IHG A;  2PQN A;  3TG5 A;  5JJT A;  3MV2 B;  3LPZ A;  5FZS A;  3LY8 A;  5CCM A;  4GCO A;  4KBQ A;  3GZ1 A;  5LCW J;  2DBA A;  4H7X A;  5D0Q D;  3S7D A;  3ASH A;  4UI9 K;  4BT9 A;  5ARF A;  2C2L A;  3RKV A;  3CK7 A;  3U4T A;  4ME2 A;  3QKY A;  4O6F A;  1IYG A;  4IN3 B;  5FT9 A;  3Q47 B;  3LKU A;  3RIB A;  5FZR A;  3UUX A;  5BT1 A;  3LCA A;  5EKQ D;  2HR2 A;  2LSU A;  5KJK A;  2HYZ A;  3Q49 B;  2WQH A;  3MA5 A;  5ARG A;  1TJC A;  3CV0 A;  2VGY A;  3ZPJ A;  3RU0 A;  4U0U A;  4UI9 C;  2GW1 A;  4I9E A;  4J8D A;  4JHR A;  3URZ A;  4I2Z A;  4YND A;  4A1S A;  2KCK A;  5KJM A;  5KJL A;  4H7Y A;  3JYS A;  2R5S A;  5CHE E;  5FTP A;  4KYO B;  2IF4 A;  4WNE A;  3FP3 A;  4HOU A;  4G24 A;  2UY1 B;  2VGX A;  5HQ8 A;  4N2Q A;  3RO2 A;  5AYW D;  3MKR A;  3ASG A;  2FBN A;  3QWP A;  1ZU2 A;  2FI7 A;  2KCL A;  4WUY A;  3CVL A;  4U07 A;  3ESK A;  4N3A A;  4N3B A;  1KT1 A;  3TG4 A; 
#chains in the Genus database with same CATH topology
 4BT8 A;  1JCR A;  5G2N A;  3ONL A;  3L6A A;  3AU5 A;  4HBD A;  2FEZ A;  2IEJ A;  4HB5 A;  4G11 A;  5A6C A;  2BUG A;  3CKB A;  3HVE A;  5CBO A;  4OVV A;  3CK8 A;  4AJW A;  3ZU7 B;  4PDX A;  5ENO D;  3LEW A;  4LG6 A;  3PH0 C;  2OOE A;  5FJY A;  3PVL A;  4CDM A;  5LP0 A;  2MYO A;  2FO1 E;  1JWG A;  3R7Q A;  3IEG A;  5B3S E;  4BTB A;  4UQZ A;  3MYV A;  2KM4 A;  4AIF A;  1TNO A;  2OVF A;  2Y4T A;  4WNF A;  3JQ0 A;  3B7R L;  4Q69 A;  3APC A;  5CER B;  3AJI A;  3HDX A;  4GZ3 A;  2KZT B;  2XCC A;  5AEN A;  2CFZ A;  2XS1 A;  4XEI G;  4UWH A;  2QC9 A;  3CSF A;  3MZL B;  3D9N A;  2BED A;  3RRU A;  5LCW C;  5ANR A;  1MX6 A;  1NL4 A;  4J8E A;  2J07 A;  3QWV A;  3UXG A;  4B0Z A;  1P5Q A;  3CVP A;  3W9G A;  1TNZ A;  4LNG A;  3UKU G;  3S7J A;  3CVX A;  3ZHE A;  4I9C A;  3QK0 A;  1E96 B;  2X3M A;  2YIN A;  1XNF A;  3FDH A;  5FIN A;  3AS5 A;  2WXO A;  3ZN3 A;  2VGX B;  2XS8 A;  2L6J A;  5C1D A;  4U04 A;  4G26 A;  4G23 A;  4BET A;  1D9S A;  3APD A;  3QOU A;  1OCO E;  1OXJ A;  4PH4 B;  3AS8 A;  2AVP A;  1S63 A;  1MQS A;  2V0P A;  1H0A A;  3I5P A;  4OVU A;  4CT4 A;  3NBN B;  3L9T A;  3HVE B;  3L13 A;  4N5C A;  1NFI E;  4BTA A;  2B6C A;  3S7B A;  5G05 C;  4F1P A;  2V4H C;  4GZD A;  4LSZ E;  3DPY A;  2XRY A;  1S64 A;  3RRM B;  3RRN B;  2R03 A;  2ION A;  4IRU A;  2EIK E;  5BNW A;  4URK A;  4UQX A;  1LF8 A;  3KS2 A;  3DXM G;  3UX4 A;  3E34 A;  4DI3 A;  2XEV A;  3EIQ C;  4XI9 A;  5CMY A;  3PZ1 A;  3FUF A;  1ZB1 A;  4KZC A;  4GTP A;  2LUH A;  3NQP A;  1SVX A;  4HOQ A;  4NAC A;  2QYJ A;  5JJ6 A;  4P29 A;  2XEH A;  4AOF A;  4ATZ D;  4YDE A;  4L2Y A;  1OT8 A;  4YDW A;  3ZXP A;  2MHK A;  5D2M C;  1H2T C;  5BV1 A;  2XPY A;  4KXK B;  3CKC A;  4PS3 A;  2WVI A;  5EX3 A;  5G04 J;  2C0L A;  4A1G A;  2FF4 A;  1HO8 A;  4HQD A;  1EPU A;  3FH8 A;  3CQG B;  4GTT A;  5HRY A;  3Q9N C;  5CEC B;  3UIN C;  1DCE A;  3FEY A;  3ZHE B;  3MJW A;  3HXB A;  3I4G A;  4MRU A;  2IQC A;  4EQF A;  3WG7 E;  2HO1 A;  5CRV A;  4HOT A;  1E7U A;  4U8Y D;  4JZY A;  4FU3 A;  1TNU A;  4JL0 A;  3Q5M A;  3PNT B;  2F8X K;  4CGV A;  5EIB E;  5EID A;  3UQ3 A;  4GZC A;  3WXX A;  3T9K A;  4F3V A;  4D10 C;  4A3T A;  3TWV A;  2ZGD A;  2GRP B;  3CK9 A;  1HFA A;  4U7E B;  3RK6 A;  4HNA D;  1TYQ G;  3LPZ A;  2WXI A;  2R59 A;  4GCO A;  4KBQ A;  3GZ1 A;  3G2U A;  2DBA A;  4H7X A;  3FTS A;  5AJD A;  4UI9 K;  3B7S A;  4BES A;  4OAV B;  5ARF A;  5JHA A;  1O5M A;  2C2L A;  3SY2 A;  5FQ8 A;  1O1T A;  2X38 A;  3SGH A;  3V31 A;  3KSQ A;  2OVB A;  4ME2 A;  4KZ0 A;  4U8H A;  3Q79 A;  5FZR A;  1H2U A;  3LCA A;  1OWP A;  3UT7 A;  2LSU A;  4K03 A;  4TXR A;  3FH5 A;  4HS2 A;  3Q49 B;  3CHO A;  1LTX A;  4GMR A;  3FUD A;  5ARG A;  2IOL A;  4JEH A;  1TJC A;  4J8Y A;  1HX8 A;  2QY7 A;  2VGY A;  5H7P A;  5T4Y A;  3RU0 A;  3DEO A;  2V4L A;  3QNK A;  4C0M A;  1H19 A;  4GTQ A;  2NYJ A;  4ZFH A;  2NXP A;  3TJP A;  2BKG A;  1H6K A;  1FT1 A;  3DXK G;  3FU6 A;  2H6H A;  4LCT A;  5T8I A;  3PRE A;  2P9I G;  5FTP A;  5CMW A;  3E32 A;  3JXJ A;  1IKN D;  2DYS E;  2J08 A;  2IF4 A;  3T5X A;  3TWU A;  4WWO A;  4DJA A;  4HOU A;  1SZ9 A;  3HG0 D;  2EIL E;  1K1A A;  3NAW A;  3RO2 A;  5AYW D;  1OWO A;  4A55 A;  4Q96 A;  3PRZ A;  1OCC E;  2FI7 A;  2KCL A;  4WUY A;  2RKK A;  4U07 A;  3ESK A;  3DSX A;  5JHB A;  1KT1 A;  4EHM A;  2V5F A;  3MCX A;  3ZXS A;  3ML9 A;  3LY9 A;  3E4B A;  3IHY A;  3GZS A;  4K0R A;  4HOS A;  3OAW A;  3ZGQ A;  1RW2 A;  3FU0 A;  3FUI A;  3HHM A;  4OYS A;  2WM9 A;  3ULY A;  2X6J A;  3NF1 A;  3SFY A;  1KZO A;  2L0T B;  3B7U X;  4UI9 J;  4DX7 D;  3ZVV A;  2FUL A;  3CHP A;  1N4P A;  4KMO A;  4TRQ A;  3PE4 A;  4GZ6 A;  3MEK A;  3SFX A;  2AWI A;  2IO3 C;  3X2Q E;  2Y4U A;  1N54 A;  3NOC D;  5KCM A;  4PUC A;  2VTB B;  3SHF A;  3IV0 A;  4FP7 A;  2WXL A;  2OV8 A;  2OND A;  4YVO A;  1K1B A;  2KZT A;  4JB8 P;  1SQM A;  4UWK A;  3OXL A;  4O60 A;  3ZUV B;  1NZN A;  4HLE A;  4JHJ A;  4AEZ C;  3S2A A;  2L6B A;  3ESL A;  1UJK A;  3VLD A;  3CVW A;  3ENE A;  1JWF A;  3FTY A;  5E76 A;  3DST A;  3E30 A;  1NP7 A;  1BPO A;  2IU1 A;  4E6H A;  5KNH D;  3LY7 A;  4J6I A;  2WXJ A;  4GPK A;  2X6H A;  1DNP A;  2BKK B;  5A23 A;  4FAD A;  3CHM A;  4FUL A;  1A17 A;  4I1M A;  4B8C B;  3ML8 A;  3UKR G;  4PS8 A;  1BI7 B;  3U3W A;  4MLP A;  1TN6 A;  3CHR A;  3FUE A;  3SO8 A;  5FQ6 A;  5LX8 A;  5EX0 A;  3ZRH A;  2PZI A;  2P9K G;  1OUV A;  1HZ4 A;  2J4D A;  4DUI A;  1V54 E;  5EYP F;  4GA2 A;  3C3R A;  1D8D A;  3HRA A;  1IHB A;  4IUL A;  1EF1 C;  4RLY A;  4GPM A;  2WXP A;  2YQ8 A;  3EU5 A;  3NZS A;  1PC2 A;  3FTU A;  1LD8 A;  3QWW A;  2XZD G;  2I1J A;  3CGH A;  3PE3 A;  1H6P A;  2Y69 E;  2H6F A;  1O1S A;  1OCR E;  1QBQ A;  2DVW A;  3CVU A;  3PUJ A;  1HS6 A;  5D0O D;  3FU5 A;  4XKB A;  2NSZ A;  2M63 A;  4GCN A;  2C0M A;  2WXN A;  2OEV A;  4MBG A;  5AJL A;  3J5Q B;  4GMJ A;  3VLF A;  2P9N G;  4JC8 A;  1KPS B;  1INZ A;  4A63 B;  3AG3 E;  2FO7 A;  2WPV A;  1UJJ A;  4W9R A;  4JA7 A;  4FC8 A;  3SQV A;  2F0Y A;  1Z3X A;  4U63 A;  1MYO A;  1IQR A;  1YYH A;  4NRH B;  1SA5 A;  1VDY A;  3DSS A;  1TN8 A;  4GTR A;  3CEQ A;  3RJV A;  1N4Q A;  3DRA A;  4CGW A;  5G05 J;  2X6F A;  2DWZ A;  3B13 A;  3P2B A;  3KAE A;  4EZL A;  3V30 A;  2WMN A;  3ZW3 A;  3OTN A;  4JVS A;  1AWC B;  3N71 A;  2P9P G;  3EU9 A;  4HLL A;  2VSY A;  1QQE A;  4YDO A;  2J8S D;  4O1O A;  2H6I A;  5EIL A;  3FU3 A;  2KXP C;  3U64 A;  4J7W A;  2XGS A;  3HYM B;  3C98 A;  2PM6 A;  2Q7F A;  4DX2 A;  4WND A;  4U0S A;  2WB2 A;  4ANX A;  2IY0 C;  3PUK A;  4JA9 A;  5J90 A;  1OWM A;  2RFA A;  1L5J A;  2R2L A;  2PQN A;  2PM7 A;  3UTM A;  3L16 A;  5AAO A;  3DEP A;  1N9A A;  1E8X A;  4KT6 B;  3JCK C;  3PZD A;  4DLO A;  5KWD A;  2ETB A;  2ZGG A;  4GU5 A;  3G2W A;  3L17 A;  3UMV A;  3KSL A;  3ZYK A;  3U66 A;  3PZ3 A;  3ZKJ A;  1Z3Y A;  3CK7 A;  4U95 D;  4O6F A;  1IYG A;  3CQC B;  4EPZ A;  4IN3 B;  4G8K A;  4BER A;  5JMN D;  1RZ4 A;  5BT1 A;  4DPR A;  5EKQ D;  4CDN A;  2AXZ A;  5KJK A;  4R7L A;  5EN5 D;  2WQH A;  2V5Q C;  3T8K A;  4DX6 D;  3CV0 A;  3ZPJ A;  1MZC A;  1TNY A;  3EHQ A;  4AXH A;  4XKC A;  4U0U A;  4F7A A;  4M3O A;  2E0I A;  2WXQ A;  3Q78 A;  4FHK A;  4A1S A;  3B95 A;  2AXU A;  4O1P A;  3FUM A;  3JYS A;  2R5S A;  1SW6 A;  5CHE E;  4KYO B;  5AAR A;  4NUR A;  4LER A;  1E8Z A;  3TWQ A;  4WNE A;  4HRL A;  3G2T A;  2GRM A;  2OEW A;  5HQ8 A;  4U8V D;  1S70 B;  3MKR A;  3AG4 E;  2FBN A;  3PZ2 A;  3AAA C;  4JXT A;  3Q7F A;  3FUL A;  1H6O A;  4N3B A;  2DYR E;  3ULE G;  1X5B A;  1TEZ A;  1WDY A;  1HH8 A;  1FCH A;  1Q2Z A;  2WXR A;  3SI5 A;  3AG2 E;  4ACL A;  4XIF A;  3K9I A;  3E37 A;  3S7F A;  4F1S A;  5HKP A;  4ILI A;  3QAQ A;  2LSV A;  1UW4 B;  3FWV A;  2CG3 A;  2P9U G;  4AM9 A;  4LRZ A;  3HXC A;  3FTX A;  3GYZ A;  2A5E A;  5AQ7 A;  3Q9U C;  4TUU A;  3UIO C;  4UWF A;  4LEU A;  4RG6 A;  3EJN A;  4EZK A;  4GYW A;  4LNU D;  3UI2 A;  3JXI A;  4I43 A;  4XX5 A;  3R9M A;  5AQA A;  4N2S A;  2P9L G;  3UM0 A;  4J0U A;  4B93 B;  2VTB A;  3PDN A;  1DVP A;  3L54 A;  4U0Z A;  2B0O E;  1JUQ A;  3ONK A;  3IBE A;  3JUE A;  5KBA A;  4LUN U;  3O4Z A;  1TJF A;  3MX3 A;  4XI0 A;  2Y3A A;  3UPV A;  5AQB A;  2E2E A;  3FH7 A;  5JA4 D;  4AY5 A;  2LNI A;  4ILH B;  3FUN A;  4N5Q A;  4TV3 A;  1BD8 A;  1UG3 A;  3NOG D;  5BPP A;  1MJ0 A;  2DIW A;  3D9I A;  3KEA A;  4TXP A;  3KEZ A;  2WQ7 A;  2ILR A;  5EYL A;  1XGW A;  3ZYM A;  1WM5 A;  2VGE A;  3FY4 A;  5ENS D;  2WQ6 A;  3FUJ A;  3QJZ A;  4Q94 A;  4YVQ C;  1OY3 D;  3C5R A;  1WY6 A;  4CDR A;  4GA0 A;  2KBX A;  3R9A B;  3BU8 A;  3I3N A;  3CVY A;  3V2O A;  3MKQ A;  5DIZ A;  4C48 B;  1JCQ A;  3D9M A;  1Y6I A;  1H2V C;  2R02 A;  5KNG A;  4JPS A;  3TWW A;  3SFZ A;  2ZXW E;  1JCS A;  2XCB A;  4ANU A;  3CVQ A;  3CVN A;  5AN8 A;  4B94 A;  2RFM A;  4I17 A;  4QFV A;  4JD2 G;  1N0Q A;  3MGB A;  1YA0 A;  1KT0 A;  4OAU C;  4L9P A;  4V3I A;  3BUA A;  4EBA G;  2NC9 A;  2EIJ E;  3MV3 B;  4AP2 A;  4N3C A;  3ZYL A;  3EHN A;  3I4R B;  3EIJ A;  5FQ4 A;  2RD0 A;  3CVV A;  2AJA A;  1FT2 A;  1U2V G;  3QB2 A;  1MHQ A;  4CEM A;  1TR4 A;  1X81 A;  1FVF A;  3D3M A;  4ANW A;  5A7D B;  3TGO A;  3PEV B;  4KVM A;  1A5E A;  2PQR A;  1GW6 A;  2UWJ G;  4MKT A;  2J9Q A;  5JJ7 A;  3AS4 A;  3C3Q A;  2A4Z A;  4CCA A;  4EZJ A;  1NA0 A;  2EIM E;  3D9O A;  2GRO B;  1DCQ A;  1B89 A;  3HXD A;  2XEN A;  5BXO A;  3SBS A;  4NQ0 A;  4ACK A;  1ELR A;  4M7C A;  1UN9 A;  2BTD A;  2LO6 A;  2OCC E;  2JLB A;  5AQ9 A;  3CLJ A;  4AVX A;  3TWX A;  2XHE A;  1W3B A;  2X6I A;  4Y6W A;  3ASD A;  3PEU B;  4BX9 A;  2QFC A;  3HIZ A;  5CCL A;  1QNF A;  2XGO A;  3SZ7 A;  3NB2 A;  3UM1 A;  3ISM C;  3MKQ B;  3SF4 A;  2IO2 C;  4DLQ A;  2VQ2 A;  3QDN A;  3KD7 A;  5BW8 C;  4AV7 A;  2PL2 A;  3VTY A;  1OWN A;  2QZA A;  1HXI A;  3D9P A;  1N52 A;  3RO3 A;  3OXF A;  4GYY A;  5BXU A;  1Z5S C;  2WXH A;  4L23 A;  3D9J A;  3NZU A;  5ENT D;  3LJN A;  4RQI A;  2J09 A;  3B7T A;  3SNX A;  4I6J A;  4JHK A;  3TWR A;  2CG2 A;  4JEU A;  4C9B B;  1HF8 A;  3LDZ A;  3W9F A;  2GGF A;  5FZS A;  4APF A;  2L9B A;  3TXN A;  3APF A;  4QQI A;  5LCW J;  3LJ3 A;  1FVH A;  2ZIS A;  5D0Q D;  4Z68 A;  2HE0 A;  3HXE A;  3RKV A;  5CBN A;  4ZHB A;  3TWS A;  5HS0 A;  1D8E A;  3U4T A;  3QKY A;  4BX8 A;  1BI8 B;  4HFG A;  5FT9 A;  2J49 A;  3LKU A;  3UUX A;  2A5U A;  1E8Y A;  2HR2 A;  3UT8 A;  4CT0 A;  3J5P A;  3IKO B;  4BEP A;  3FEX A;  3AG1 E;  2GRR B;  3U9W A;  2LXM A;  3FUK A;  1AP7 A;  3P1U A;  2YHE A;  5T3R A;  4IYP A;  4DRX E;  4X8Q A;  3ZEF A;  2GW1 A;  2AXV A;  1MX2 A;  1SA4 A;  3HXF A;  4JHR A;  3URZ A;  3DSW A;  3FTW A;  2IJG X;  4YND A;  1BU9 A;  3TWT A;  4EEC A;  2VSO E;  2VSX E;  5ENQ D;  2MOW A;  5KJM A;  3Q75 A;  4ATG A;  4H7Y A;  5D66 A;  2ETA A;  2ETC A;  1N94 A;  1LD7 A;  1EDU A;  3SBT B;  1SZA A;  2F37 A;  1KZP A;  1K3Z D;  5G55 A;  1WG0 A;  4DX1 A;  4K5C A;  4FLH A;  4B8A A;  4BFR A;  3QWP A;  5ITZ F;  1ZU2 A;  4NIK A;  3L08 A;  1OWL A;  4GAA A;  5AIJ A;  4N3A A;  1TNB A;  4FHJ A;  3E33 A;  2WMO A;  4HI9 A;  1K8K G;  4B89 A;  2I2O A;  5FWQ A;  2P9S G;  4G8L A;  2J4B A;  3IHV A;  5HI7 A;  2IFU A;  5BV0 A;  3BG1 B;  2JAB A;  1PY1 A;  4K5A B;  3ZNG A;  2CHX A;  1JPL A;  1ELK A;  1UN8 A;  2I9C A;  1O1R A;  3TL5 A;  2Y1L E;  3D9L A;  4RSY A;  2GRL A;  2LAH A;  3V79 K;  3AU4 A;  2QYU A;  3DBS A;  4I2W A;  3BQO A;  4WWP A;  3CIA A;  2P58 C;  4UQY A;  2I6H A;  1Y8M A;  1IQU A;  2DZO A;  4GA1 A;  5DBK A;  2DZN A;  3ABK E;  3D9H A;  3LYA A;  1NA3 A;  3ASN E;  1E90 A;  2XZT G;  4L1B A;  1HG2 A;  4JW1 A;  3D9K A;  3ZFW A;  2L0I A;  2MRI A;  1U3C A;  2XPI A;  1N95 A;  3GW4 A;  4G1T A;  4HXI A;  4J8F A;  4I1O B;  4GYO A;  2PNN A;  3CHQ A;  3LVQ E;  2YHC A;  4GB9 A;  1S0P A;  2JEK A;  1MX4 A;  3UM3 A;  4UWG A;  2XGM A;  4I1A A;  4MS6 A;  3TAX A;  4ANV A;  1HU3 A;  4WWN A;  5M72 A;  2WXK A;  1N0R A;  3OXG A;  3C3O A;  3BEE A;  2LXL A;  3L22 A;  3FUH A;  4RG9 A;  3DSV A;  3EDT B;  4BSX A;  5G04 C;  4FA6 A;  4AY6 A;  2KC7 A;  1E7V A;  4YDY A;  1KLX A;  4L7T A;  3EUV A;  2ZIR A;  4HOR A;  1QZ2 A;  3LVR E;  1V55 E;  2VSN A;  3Q73 A;  4KVO A;  5LOZ A;  4Y6C A;  3QAR A;  2AW6 A;  3DSU A;  2R17 C;  3RSE G;  3ASF A;  3EHR A;  3ABM E;  2X6K A;  4F6R D;  3LXU X;  1G3N B;  1BLX B;  5C2Y A;  4F53 A;  3O48 A;  4N39 A;  2KCV A;  2WXG A;  2VYI A;  3CST A;  2GRN B;  4PS7 A;  2I1K A;  3LS8 A;  3FFL A;  5EDS A;  1ZBP A;  3QC1 A;  2V8S E;  3GZ2 A;  3FTZ A;  2EQX A;  1FPP A;  4BWR A;  5KJN A;  2LAI A;  3CHS A;  5ENP D;  4U96 D;  1ELW A;  1EYH A;  4WNG A;  3PS6 A;  3Q15 A;  4EBA A;  4FJZ A;  3FHE A;  3PZ4 A;  5B1B E;  4A3V A;  1U3D A;  4ABN A;  2BF0 X;  4HI8 A;  1PAQ A;  4GZ5 A;  4ILG A;  4CRW A;  4G25 A;  4UWL A;  2DCP A;  4G2V A;  4HRN A;  5B1A E;  3ULQ A;  5FQ7 A;  5ANL A;  5BUZ A;  3EHM A;  2KAT A;  3TXM A;  2UY1 A;  2WXF A;  3SD5 A;  4APO A;  3BG0 B;  4K5B A;  2Y0B G;  3DPD A;  3Q4A B;  2XRZ A;  3VLE A;  4BY6 A;  5IY5 E;  3ZIM A;  5FZQ A;  3VTX A;  3UM2 A;  4XE0 A;  2XEE A;  5CED B;  1HE8 A;  2VJ8 A;  4CZ2 D;  2F8Y A;  1YMP A;  3UIP C;  2GRQ B;  5E75 A;  1WAO 1;  1IHG A;  3PNL B;  2XPZ A;  3R7R A;  2P2C P;  3TG5 A;  5JJT A;  3MV2 B;  3G2V A;  4J8S A;  4XZ4 A;  3LY8 A;  2RG8 A;  5CCM A;  5CEA A;  5FIO A;  3S7D A;  3ASH A;  4I6G A;  4BT9 A;  2HM8 A;  4HRM B;  4DK5 A;  4TUM A;  3G2S A;  4GML A;  3B7B A;  5ENN A;  2H6G A;  3Q47 B;  5J08 A;  3RIB A;  1Z6T A;  3T5V A;  1N11 A;  2HYZ A;  4L2L A;  3MA5 A;  4UUC A;  2CHZ A;  2XQ0 A;  2CFU A;  2IOS A;  2YNQ A;  4UI9 C;  1N4S A;  4I9E A;  4J8D A;  4C0E A;  4GTM A;  4DI4 A;  3JQ1 A;  4LNB A;  3L82 A;  1UOH A;  1DC2 A;  3Q7A A;  2WXM A;  4I2Z A;  1HG5 A;  3RAU A;  2KCK A;  3UT4 A;  3ASO E;  5KJL A;  4RVB A;  1OCZ E;  4TXQ A;  4CYM D;  5ENR D;  4BSZ B;  3V2X A;  3ZYQ A;  1IXV A;  2EIN E;  4FLB A;  3FTV A;  4DX5 D;  1N4R A;  1E8W A;  3CR3 A;  3FP3 A;  3JUI A;  4GTS A;  3C72 A;  1YCS B;  4G24 A;  4FJY A;  2UY1 B;  3T8M A;  2VGX A;  5LFA A;  3ABL E;  4N2Q A;  4GTV A;  5CRU A;  2CHW A;  3ASG A;  3IXE A;  3DWL G;  4HVB A;  2ZU6 B;  1QYM A;  1TN7 A;  4GTO A;  3CVL A;  4I6E A;  1NI1 A;  2R05 A;  4WAF A;  3TG4 A;  3F6Q A;  4E85 A; 
#chains in the Genus database with same CATH homology
 2V5F A;  4BT8 A;  3MCX A;  1TEZ A;  1HH8 A;  1FCH A;  2WXR A;  3ZXS A;  3ML9 A;  5G2N A;  3LY9 A;  3SI5 A;  4B89 A;  3E4B A;  2I2O A;  3IHY A;  3GZS A;  4K0R A;  3ONL A;  4ACL A;  4HOS A;  3L6A A;  3OAW A;  4XIF A;  5FWQ A;  3ZGQ A;  3AU5 A;  3K9I A;  3S7F A;  2J4B A;  4F1S A;  3IHV A;  2FEZ A;  4ILI A;  5HI7 A;  2IFU A;  5BV0 A;  3FU0 A;  4G11 A;  3BG1 B;  5A6C A;  2BUG A;  3QAQ A;  2LSV A;  1UW4 B;  3FUI A;  3CKB A;  3FWV A;  3HHM A;  3HVE A;  1PY1 A;  2CG3 A;  4OYS A;  4AM9 A;  4OVV A;  2WM9 A;  3CK8 A;  4LRZ A;  4AJW A;  2X6J A;  2CHX A;  3NF1 A;  1JPL A;  1ELK A;  4PDX A;  1UN8 A;  3FTX A;  3GYZ A;  2I9C A;  2L0T B;  3B7U X;  4TUU A;  4UI9 J;  3TL5 A;  3LEW A;  3ZVV A;  2FUL A;  3D9L A;  3CHP A;  2GRL A;  4LEU A;  4RG6 A;  2LAH A;  4RSY A;  4UWF A;  3PH0 C;  3EJN A;  2OOE A;  3AU4 A;  4KMO A;  5FJY A;  4EZK A;  3PVL A;  4CDM A;  4GYW A;  4TRQ A;  3PE4 A;  5LP0 A;  4I43 A;  4XX5 A;  3DBS A;  4GZ6 A;  3MEK A;  4N2S A;  4I2W A;  4J0U A;  1JWG A;  2AWI A;  3R7Q A;  2Y4U A;  3PDN A;  1DVP A;  4WWP A;  2VTB A;  3IEG A;  1N54 A;  3L54 A;  3CIA A;  4U0Z A;  2P58 C;  4UQZ A;  4BTB A;  3MYV A;  2KM4 A;  5KCM A;  4AIF A;  1JUQ A;  4UQY A;  4PUC A;  2I6H A;  3ONK A;  2VTB B;  3IBE A;  1Y8M A;  2OVF A;  2Y4T A;  4WNF A;  1IQU A;  3JQ0 A;  4GA1 A;  3SHF A;  3IV0 A;  5DBK A;  4FP7 A;  4LUN U;  2WXL A;  2OV8 A;  2OND A;  3O4Z A;  4YVO A;  1TJF A;  2KZT A;  3MX3 A;  3B7R L;  4XI0 A;  2Y3A A;  4Q69 A;  3APC A;  3UPV A;  3LYA A;  1NA3 A;  2E2E A;  3FH7 A;  4AY5 A;  2LNI A;  1E90 A;  4ILH B;  1SQM A;  3FUN A;  4TV3 A;  4GZ3 A;  3HDX A;  3OXL A;  2KZT B;  4UWK A;  1NZN A;  1UG3 A;  2XCC A;  4HLE A;  5BPP A;  4L1B A;  4JHJ A;  5AEN A;  2CFZ A;  1HG2 A;  4UWH A;  4JW1 A;  3S2A A;  4AEZ C;  2DIW A;  3D9K A;  3ESL A;  3ZFW A;  3D9I A;  3CSF A;  3MZL B;  3D9N A;  2L0I A;  2MRI A;  1UJK A;  3RRU A;  3VLD A;  5LCW C;  5ANR A;  3CVW A;  3ENE A;  3KEZ A;  2WQ7 A;  2ILR A;  1JWF A;  1U3C A;  2XPI A;  3GW4 A;  3FTY A;  4J8E A;  1XGW A;  5E76 A;  2J07 A;  3QWV A;  4G1T A;  3ZYM A;  1NP7 A;  4B0Z A;  4HXI A;  1BPO A;  1P5Q A;  3CVP A;  1WM5 A;  2IU1 A;  4J8F A;  4E6H A;  3FY4 A;  4I1O B;  3S7J A;  2WQ6 A;  3CVX A;  3FUJ A;  3LY7 A;  3QJZ A;  4GYO A;  4J6I A;  3ZHE A;  2WXJ A;  3CHQ A;  4Q94 A;  4YVQ C;  1WY6 A;  4I9C A;  4CDR A;  3LVQ E;  4GA0 A;  4GPK A;  2YHC A;  4GB9 A;  3QK0 A;  2X6H A;  1E96 B;  1S0P A;  2X3M A;  2JEK A;  1DNP A;  3R9A B;  5A23 A;  2YIN A;  4FAD A;  3CHM A;  4UWG A;  2XGM A;  1XNF A;  3FDH A;  4FUL A;  4I1A A;  4MS6 A;  3TAX A;  3AS5 A;  1A17 A;  1HU3 A;  4I1M A;  4WWN A;  4ANV A;  2WXO A;  3I3N A;  4B8C B;  3CVY A;  3ZN3 A;  5M72 A;  2VGX B;  3MKQ A;  2WXK A;  3ML8 A;  4PS8 A;  3OXG A;  5DIZ A;  3BEE A;  3U3W A;  4MLP A;  3L22 A;  2L6J A;  3CHR A;  3FUH A;  3D9M A;  4RG9 A;  1Y6I A;  1H2V C;  3FUE A;  5C1D A;  3EDT B;  4U04 A;  5FQ6 A;  4BSX A;  5G04 C;  5LX8 A;  5EX0 A;  3ZRH A;  4JPS A;  4G26 A;  4G23 A;  3SFZ A;  4FA6 A;  2PZI A;  4AY6 A;  2KC7 A;  1E7V A;  1OUV A;  3APD A;  1HZ4 A;  3QOU A;  1KLX A;  4L7T A;  2J4D A;  4HOR A;  4PH4 B;  4GA2 A;  3AS8 A;  2AVP A;  1MQS A;  2XCB A;  4ANU A;  2V0P A;  3CVQ A;  1H0A A;  3CVN A;  3I5P A;  1QZ2 A;  3LVR E;  4B94 A;  4OVU A;  2VSN A;  4CT4 A;  3HVE B;  3L13 A;  4I17 A;  4KVO A;  4QFV A;  4N5C A;  5LOZ A;  4Y6C A;  4BTA A;  3QAR A;  2AW6 A;  4IUL A;  3S7B A;  2R17 C;  5G05 C;  3MGB A;  3ASF A;  1EF1 C;  1YA0 A;  1KT0 A;  4GZD A;  2X6K A;  2XRY A;  2WXP A;  2YQ8 A;  3NZS A;  4V3I A;  3LXU X;  4EBA G;  3RRM B;  3RRN B;  1PC2 A;  2ION A;  2NC9 A;  4IRU A;  3FTU A;  3MV3 B;  5BNW A;  4AP2 A;  4URK A;  5C2Y A;  4N3C A;  3QWW A;  3ZYL A;  3EHN A;  3I4R B;  2I1J A;  3CGH A;  3PE3 A;  3EIJ A;  5FQ4 A;  4F53 A;  4UQX A;  1LF8 A;  3KS2 A;  3O48 A;  4N39 A;  2RD0 A;  3CVV A;  3UX4 A;  2KCV A;  2WXG A;  3QB2 A;  1MHQ A;  2VYI A;  3CST A;  3CVU A;  4DI3 A;  4CEM A;  3PUJ A;  2XEV A;  2I1K A;  3EIQ C;  4PS7 A;  4XI9 A;  5CMY A;  3LS8 A;  1HS6 A;  3FFL A;  1FVF A;  5D0O D;  3FU5 A;  4XKB A;  2NSZ A;  3D3M A;  5EDS A;  1ZBP A;  2M63 A;  4GCN A;  3FUF A;  4KZC A;  4ANW A;  5A7D B;  3TGO A;  3QC1 A;  2V8S E;  3PEV B;  3GZ2 A;  4KVM A;  2PQR A;  1GW6 A;  2C0M A;  3FTZ A;  3NQP A;  2UWJ G;  2WXN A;  4HOQ A;  2EQX A;  4NAC A;  4MKT A;  5JJ6 A;  2J9Q A;  4BWR A;  5JJ7 A;  3AS4 A;  5KJN A;  5AJL A;  4P29 A;  2LAI A;  3CHS A;  2A4Z A;  4AOF A;  4CCA A;  1ELW A;  1EYH A;  4EZJ A;  4WNG A;  3PS6 A;  4GMJ A;  1NA0 A;  4L2Y A;  3Q15 A;  3VLF A;  2MHK A;  4JC8 A;  4EBA A;  1H2T C;  4FJZ A;  1INZ A;  3FHE A;  2XPY A;  5BV1 A;  3D9O A;  4KXK B;  3CKC A;  2FO7 A;  4PS3 A;  2WVI A;  2WPV A;  5EX3 A;  5G04 J;  4A3V A;  1U3D A;  1UJJ A;  1B89 A;  4W9R A;  2C0L A;  4A1G A;  4JA7 A;  4FC8 A;  4ABN A;  2FF4 A;  2BF0 X;  3SBS A;  4NQ0 A;  1HO8 A;  1ELR A;  4ACK A;  1PAQ A;  1EPU A;  4GZ5 A;  4ILG A;  3FH8 A;  1UN9 A;  1Z3X A;  3CQG B;  4CRW A;  2BTD A;  2LO6 A;  4U63 A;  4G25 A;  4UWL A;  2JLB A;  2DCP A;  4G2V A;  3CLJ A;  4AVX A;  1IQR A;  3ULQ A;  2XHE A;  3FEY A;  1W3B A;  2X6I A;  3ZHE B;  5FQ7 A;  4Y6W A;  4NRH B;  3ASD A;  1VDY A;  3PEU B;  4BX9 A;  5ANL A;  5BUZ A;  3MJW A;  3EHM A;  2QFC A;  2KAT A;  3CEQ A;  3I4G A;  4MRU A;  2IQC A;  4EQF A;  3HIZ A;  5CCL A;  3RJV A;  3TXM A;  2UY1 A;  1QNF A;  2WXF A;  2XGO A;  3SD5 A;  3SZ7 A;  4CGW A;  5G05 J;  2HO1 A;  2X6F A;  3B13 A;  3MKQ B;  4APO A;  4HOT A;  1E7U A;  3BG0 B;  3P2B A;  3SF4 A;  3KAE A;  4EZL A;  4DLQ A;  2VQ2 A;  3QDN A;  4JZY A;  3KD7 A;  5BW8 C;  4FU3 A;  4AV7 A;  2PL2 A;  4JL0 A;  2WMN A;  3Q5M A;  3ZW3 A;  3VTY A;  1OWN A;  3DPD A;  3OTN A;  3Q4A B;  3PNT B;  1HXI A;  3D9P A;  4JVS A;  1N52 A;  4CGV A;  3RO3 A;  2XRZ A;  3N71 A;  3VLE A;  3OXF A;  4BY6 A;  4GYY A;  3ZIM A;  2VSY A;  1QQE A;  5FZQ A;  3VTX A;  2WXH A;  4L23 A;  4XE0 A;  3FU3 A;  3UQ3 A;  3D9J A;  3NZU A;  3U64 A;  4GZC A;  2XGS A;  3HYM B;  3WXX A;  1HE8 A;  2PM6 A;  2Q7F A;  2VJ8 A;  3C98 A;  4WND A;  4F3V A;  4U0S A;  4D10 C;  4A3T A;  4ANX A;  3PUK A;  4JA9 A;  2WB2 A;  2J09 A;  5J90 A;  1OWM A;  3B7T A;  3SNX A;  4I6J A;  1L5J A;  3CK9 A;  5E75 A;  4JHK A;  1WAO 1;  1IHG A;  1HFA A;  3PNL B;  2PQN A;  2CG2 A;  2PM7 A;  4JEU A;  2XPZ A;  3R7R A;  3L16 A;  3RK6 A;  3TG5 A;  3MV2 B;  4C9B B;  1HF8 A;  3G2V A;  5JJT A;  3LPZ A;  2WXI A;  3LDZ A;  4J8S A;  4XZ4 A;  2GGF A;  5FZS A;  3LY8 A;  2RG8 A;  2R59 A;  4APF A;  5CCM A;  2L9B A;  3TXN A;  3APF A;  4GCO A;  4KBQ A;  1E8X A;  3GZ1 A;  3G2U A;  4KT6 B;  3JCK C;  3PZD A;  4DLO A;  5LCW J;  2DBA A;  1FVH A;  3LJ3 A;  4H7X A;  5D0Q D;  3FTS A;  3S7D A;  3ASH A;  5AJD A;  4I6G A;  4UI9 K;  4BT9 A;  3B7S A;  4GU5 A;  3G2W A;  5ARF A;  3L17 A;  5JHA A;  3UMV A;  2HM8 A;  3ZYK A;  3U66 A;  2C2L A;  5FQ8 A;  4DK5 A;  2X38 A;  3RKV A;  3SGH A;  3G2S A;  1Z3Y A;  3CK7 A;  3U4T A;  2OVB A;  3QKY A;  4GML A;  4KZ0 A;  4ME2 A;  3CQC B;  4O6F A;  4U8H A;  5ENN A;  4BX8 A;  4EPZ A;  1IYG A;  4HFG A;  4IN3 B;  5FT9 A;  2J49 A;  3Q47 B;  3LKU A;  5J08 A;  3RIB A;  5FZR A;  3UUX A;  5BT1 A;  1H2U A;  2A5U A;  4DPR A;  3LCA A;  1Z6T A;  5EKQ D;  1E8Y A;  2HR2 A;  3UT8 A;  1OWP A;  3UT7 A;  4CDN A;  4CT0 A;  3T5V A;  2AXZ A;  2LSU A;  4K03 A;  3IKO B;  3FH5 A;  4HS2 A;  5KJK A;  2HYZ A;  3Q49 B;  3CHO A;  3FEX A;  4L2L A;  4R7L A;  2WQH A;  3FUD A;  3MA5 A;  3U9W A;  5ARG A;  2IOL A;  3FUK A;  4JEH A;  1TJC A;  3CV0 A;  1HX8 A;  2QY7 A;  2VGY A;  3ZPJ A;  5T4Y A;  4XKC A;  3P1U A;  3RU0 A;  4AXH A;  2CHZ A;  2XQ0 A;  2YHE A;  4IYP A;  4U0U A;  2CFU A;  5T3R A;  4F7A A;  2IOS A;  3ZEF A;  2YNQ A;  4M3O A;  4UI9 C;  2GW1 A;  2E0I A;  4I9E A;  4J8D A;  2V4L A;  4C0E A;  2AXV A;  3QNK A;  3JQ1 A;  4DI4 A;  4JHR A;  4C0M A;  3URZ A;  3FTW A;  4E85 A;  1H19 A;  2WXM A;  2IJG X;  2WXQ A;  4I2Z A;  4YND A;  4FHK A;  2NXP A;  4A1S A;  1HG5 A;  3TJP A;  2VSO E;  4EEC A;  2VSX E;  2AXU A;  1H6K A;  2KCK A;  2MOW A;  5KJM A;  3UT4 A;  4ATG A;  3FU6 A;  5KJL A;  3FUM A;  4LCT A;  4RVB A;  4H7Y A;  3JYS A;  5T8I A;  2R5S A;  3PRE A;  5CHE E;  5FTP A;  5CMW A;  4KYO B;  4LER A;  4NUR A;  3ZYQ A;  1E8Z A;  4FLB A;  1EDU A;  2J08 A;  2IF4 A;  3FTV A;  4WNE A;  3G2T A;  3T5X A;  1E8W A;  3CR3 A;  2GRM A;  3FP3 A;  3JUI A;  4WWO A;  3SBT B;  4HOU A;  4G24 A;  4DJA A;  4FJY A;  1SZ9 A;  2UY1 B;  1SZA A;  3T8M A;  2VGX A;  5LFA A;  5HQ8 A;  4N2Q A;  3RO2 A;  5AYW D;  5G55 A;  3MKR A;  1OWO A;  2CHW A;  3ASG A;  4HVB A;  2FBN A;  4A55 A;  4FLH A;  2ZU6 B;  4Q96 A;  4B8A A;  4BFR A;  3PRZ A;  3QWP A;  1ZU2 A;  4JXT A;  2FI7 A;  2KCL A;  4WUY A;  3L08 A;  1OWL A;  3CVL A;  4I6E A;  4GAA A;  4U07 A;  5AIJ A;  3ESK A;  4N3A A;  3FUL A;  4WAF A;  4FHJ A;  5JHB A;  4N3B A;  1KT1 A;  2WMO A;  3TG4 A;  1X5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...