2V5FA

Crystal structure of wild type peptide-binding domain of human type i collagen prolyl 4-hydroxylase.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
97
structure length
97
Chain Sequence
FLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1
publication title Crystal Structure of Wild Type Peptide-Binding Domain of Human Type I Collagen Prolyl 4- Hydroxylase.
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 97
sequence length 97
ec nomenclature ec 1.14.11.2: Procollagen-proline 4-dioxygenase.
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2v5fA00
4KBQA 5ARGA 4G2VA 3RJVA 4H7YA 2FBNA 4KXKB 4IN3B 5JJ6A 5CHEE 4AM9A 1Y8MA 3FP3A 2VGYA 1ZU2A 2XGSA 1IHGA 3KS2A 5ARFA 3UQ3A 2C2LA 2UY1A 3MV3B 5CCLA 3RIBA 4AY6A 1A17A 3CK9A 5M72A 4BWRA 1P5QA 4JHRA 4F3VA 4N3AA 3UUXA 2KATA 1W3BA 4O6FA 5C1DA 2XGMA 4G25A 2XGOA 4U0ZA 3ZPJA 3WXXA 2WPVA 5FT9A 3TG4A 3LY8A 3SF4A 4UI9C 5FZQA 1ELWA 1ZBPA 3IEGA 2P58C 2VQ2A 4GPKA 3AS5A 3LKUA 3UPVA 2XCCA 4CGVA 3MV2B 4I9CA 2FI7A 4G1TA 4I2WA 2BUGA 3Q47B 4XI0A 3QOUA 2UWJG 4KYOB 3AS4A 3ULQA 3TGOA 2FO7A 5HQ8A 2R5SA 3CVPA 4GCOA 4APOA 3ASHA 4JL0A 4J0UA 3KD7A 5KJKA 3HYMB 3RO3A 4H7XA 2C0MA 5EX3A 4NRHB 3U3WA 5FZRA 2XPIA 5KJNA 3LY7A 1E96B 4HOTA 3GYZA 2Y4TA 5AYWD 4UI9K 4YVQC 2PL2A 5G05J 4U04A 4JA7A 3CKBA 4NQ0A 4WNEA 2HR2A 4YVOA 4I2ZA 3ZFWA 4HORA 3EDTB 3RKVA 4J8DA 4U0UA 4A1SA 3PE3A 3MA5A 2FEZA 4AY5A 3RO2A 4EQFA 2FF4A 4WNFA 2VYIA 4ABNA 4GZ6A 3S7FA 5EX0A 1TJCA 3R9AB 1OUVA 2KCKA 2VGXB 5CCMA 2IF4A 3Q4AB 4BT9A 2YQ8A 4WNGA 3VTYA 3AS8A 3ZHEB 3CV0A 4GCNA 4UI9J 3CVQA 3Q49B 5A7DB 2LNIA 1HH8A 2VGXA 3URZA 2WQHA 1KT1A 1YA0A 5KJMA 1FCHA 5G04C 2NC9A 3K9IA 1IYGA 4U0SA 4XIFA 3U4TA 4J8FA 4Y6CA 2VSNA 2LSUA 4N5CA 2PQNA 5D0QD 3VTXA 2Q7FA 3JYSA 2E2EA 2AVPA 2QFCA 3E4BA 4G23A 1NA3A 2DBAA 3TAXA 4I1AA 4UQZA 3CEQA 3N71A 5BNWA 2JLBA 2HO1A 3S7BA 3LY9A 4GYWA 5D0OD 4N2QA 4I9EA 5FJYA 4I17A 2XCBA 5BW8C 5LCWC 2PQRA 5FZSA 2IFUA 4RG6A 2KCLA 4B94A 4Y6WA 1HXIA 3PE4A 4N39A 3S7DA 1NZNA 3CK7A 3NF1A 4G24A 5HI7A 2GW1A 3ASDA 4BT8A 3LYAA 4HOUA 4BTBA 3CK8A 5JJ7A 4ME2A 2C0LA 2L6JA 3OXLA 3FFLA 3TG5A 3ZN3A 1PC2A 2KC7A 1B89A 5DBKA 4BTAA 4N3BA 5BT1A 3GW4A 2UY1B 4LEUA 3MKRA 2VSYA 1HZ4A 3ASFA 3O48A 4GA1A 4GZ5A 3CKCA 1KLXA 4AIFA 5FTPA 2LSVA 4RG9A 2Y4UA 4HOSA 2ONDA 3ESKA 1NA0A 2PZIA 3GZ1A 3LPZA 3Q5MA 3SZ7A 1WAO1 5G04J 2YHCA 3Q15A 3QWWA 3OXGA 4JA9A 4GZ3A 3PDNA 4W9RA 3ZHEA 4XI9A 2XEVA 2HYZA 2KCVA 4GA2A 2V5FA 1WM5A 3FWVA 5EKQD 2OOEA 3ZGQA 4GYOA 4GA0A 4G26A 4WNDA 5A6CA 4CGWA 4UQYA 3CVNA 5DIZA 2J9QA 3ASGA 4N2SA 3QWVA 4J8EA 3QKYA 3KAEA 3S7JA 5LCWJ 4UQXA 1KT0A 1ELRA 5JJTA 3QWPA 2MHKA 4YNDA 3LCAA 4CDRA 3BEEA 3CVLA 2I6HA 4HOQA 5KJLA 3QDNA 4U07A 1QQEA 4WUYA 3RU0A 3MEKA 1QZ2A 3OXFA 4GYYA 1XNFA 4N3CA 5G05C 3GZ2A
chains in the Genus database with same CATH superfamily
4G2VA 5BV0A 2RD0A 2CHWA 4JEHA 4H7YA 2VSXE 4DLOA 5LOZA 4AM9A 1Y8MA 3FP3A 1ZU2A 2YINA 3R7QA 5ARFA 4F1SA 1N0QA 1A17A 1D8DA 1GW6A 3CVYA 4C0EA 3ESLA 5M72A 4BWRA 1S63A 4FJZA 3AG2E 1V55E 5ITZF 4F3VA 4AP2A 1OWMA 3Q7AA 4MKTA 3SFYA 3J5QB 4CT0A 1QBQA 3TG4A 3L16A 3UM2A 4HQDA 3CHQA 3CQGB 3TXMA 3L08A 3C72A 1O5MA 5HRYA 3IHYA 2H6FA 3DPDA 3MV2B 4O1PA 4MBGA 3NOGD 3NBNB 2L0TB 2BUGA 4XI0A 3QOUA 3EIQC 3FDHA 3AS4A 3ULQA 1S64A 1K3ZD 2WVIA 3FTVA 2FO7A 2XPYA 4PUCA 5LX8A 3ASHA 5KWDA 3AU4A 2I1JA 3E34A 4DX6D 3PZ1A 4O60A 5EX3A 4NACA 1AP7A 1E96B 3GYZA 5AYWD 2WXRA 4AVXA 3CVXA 5FQ7A 2MYOA 1OY3D 2XRYA 3ZVVA 2CFUA 4JA7A 3QAQA 1DVPA 1IQUA 2XEEA 1NL4A 3EDTB 4J8DA 2XQ0A 3WG7E 3IKOB 3ZKJA 5CBNA 4R7LA 4GTQA 4AOFA 4WWOA 3I5PA 4WNFA 4GTTA 2R17C 5EIDA 1OT8A 4ABNA 1N4QA 3TWRA 1TJCA 4ATZD 5BXUA 3MYVA 3HXBA 3L22A 2I9CA 3FU0A 1OUVA 5CCMA 3PUJA 1JCQA 4ANUA 4YDWA 1MX2A 3CV0A 3NQPA 2EILE 5ANLA 4I6GA 2X6HA 3I4RB 3CVQA 1K1AA 5A7DB 3FH7A 3PZDA 4DUIA 1OWOA 4UWLA 1JWFA 3B7RL 1KZOA 4GZDA 3Q9NC 2P9UG 1H2UA 4A3TA 5HKPA 3ZEFA 4HXIA 3FU5A 3PRZA 2VSNA 3IXEA 2LSUA 4JD2G 4BEPA 2E2EA 1MZCA 2X6KA 1HF8A 2AVPA 2DZOA 2XEHA 2DBAA 3TAXA 3CEQA 4UWFA 2NXPA 2PM6A 3R7RA 4GYWA 5D0OD 5EN5D 1TNYA 4I9EA 5FJYA 5ENSD 2XCBA 3JQ0A 2Y1LE 3UTMA 3CR3A 4DK5A 1Y6IA 4ATGA 4U96D 2I1KA 4HLEA 5ENRD 4RLYA 3Q75A 3S7DA 1N9AA 1NZNA 3CK7A 3NF1A 4WAFA 3TWQA 2F8XK 4V3IA 2R02A 5ENOD 4BT8A 3CSTA 2OEVA 3TG5A 3FFLA 2WXGA 4ZFHA 2P9PG 1B89A 4DX1A 4OYSA 3FUJA 2XZDG 5J08A 3F6QA 2AXZA 3T8MA 4BTAA 4DLQA 1BI7B 3UI2A 5B1BE 2DYSE 4LEUA 2VGEA 4URKA 3EHMA 2VSYA 3UM3A 2LXMA 3UT7A 3TWXA 2RFMA 1HG2A 3VLFA 4I6JA 4FLHA 3DEOA 4ACLA 4C0MA 3SNXA 2RFAA 3LPZA 4L2LA 1HS6A 4Q94A 2ETCA 1WAO1 3Q7FA 5G04J 2DCPA 2YHCA 3C3OA 3QWWA 4ANVA 4C48B 5CBOA 5G55A 3QC1A 4JA9A 1JCRA 1SZ9A 4GZ3A 4FU3A 4XI9A 5AQAA 3KEAA 3FH5A 4XE0A 4CEMA 2KCVA 3C3RA 3PEVB 4KMOA 5D66A 3ZGQA 4GYOA 4GA0A 2DIWA 2VSOE 4G26A 4WNDA 4FADA 5DIZA 1Z3YA 4N2SA 3B7UX 3B7TA 4J8EA 3QKYA 3V31A 5B3SE 1N52A 4ILHB 3JXIA 3MJWA 2XHEA 4B93B 3L82A 4HB5A 5BUZA 3SBTB 1SA4A 2CHXA 3PEUB 5KJLA 4WWNA 4EECA 4OAUC 1HX8A 4NIKA 4PH4B 1SVXA 3SGHA 1MHQA 4U8VD 1QNFA 2WQ7A 4LNUD 1QZ2A 3OXFA 4N3CA 2YNQA 3FU6A 5H7PA 4WWPA 2V4LA 5G05C 4XX5A 3RRMB 2IOSA 3ZYLA 2KBXA 2KXPC 1EPUA 4GTPA 4CRWA 2RG8A 2VGYA 3CQCB 4JPSA 3UINC 4CT4A 2WXOA 3DSTA 5EDSA 4LG6A 2WXMA 2NYJA 2WXKA 3HDXA 2C2LA 3QJZA 3MV3B 5CCLA 4FP7A 4J6IA 4DX2A 3RIBA 3LEWA 3ONLA 2AXUA 3CK9A 1OCOE 1U2VG 5EYLA 5T8IA 3RSEG 4N3AA 2KATA 3AG3E 3FTYA 3RRUA 4U0ZA 3WXXA 2WPVA 2CHZA 1JWGA 3S2AA 4K0RA 4JHJA 3SHFA 4FA6A 4APFA 4TXQA 5FZQA 1IKND 1H6PA 1S0PA 4F7AA 3P1UA 4GPKA 4PDXA 3AS5A 2F37A 3LKUA 3UPVA 2KM4A 3OAWA 4CGVA 1TN7A 5FIOA 4I9CA 2FI7A 3HVEA 3DXKG 3Q47B 4I1OB 3FTZA 3L54A 3LVQE 5CRVA 5AAOA 1X81A 1LF8A 3UT4A 1Z3XA 5HQ8A 4RQIA 5AN8A 4APOA 3B7BA 4ANXA 2R03A 2EIJE 1FVFA 4CZ2D 1MQSA 4GTRA 5FZRA 3LY7A 1HO8A 3ML8A 5CRUA 4LSZE 4YVQC 3IV0A 4C9BB 2OV8A 4U04A 4UUCA 2LUHA 5JA4D 4NQ0A 4WNEA 4K5AB 2J49A 4I2ZA 3ZFWA 1TYQG 4GAAA 1OCZE 3ZUVB 2GRPB 2IY0C 5ENQD 3FUFA 1VDYA 3GZSA 2VJ8A 1JUQA 2FEZA 4AY5A 1TNBA 4BERA 1KPSB 3RO2A 2BKKB 2F0YA 2WXPA 3CGHA 1PY1A 4GZ6A 3S7FA 4KZCA 3U66A 2EINE 3R9AB 4BX8A 1O1SA 2VGXB 3PREA 2DWZA 4JEUA 3MCXA 3ML9A 4WNGA 5FQ8A 1TN8A 3I4GA 4GCNA 4UI9J 4EZKA 3AG1E 4MS6A 3NB2A 2LNIA 1DNPA 2VGXA 2B0OE 2HE0A 3MKQB 2ILRA 1A5EA 5KJMA 1FCHA 3D9KA 5D2MC 3DSVA 3K9IA 1RW2A 1IYGA 4FC8A 3DRAA 4XZ4A 4A3VA 3FUMA 3ASOE 3U4TA 5KCMA 2F8YA 3QK0A 3FTSA 2PQNA 3VTXA 1TNUA 5CECB 4FHJA 4TRQA 1N94A 3BG0B 3E4BA 2CFZA 2IQCA 2WB2A 2JLBA 3APCA 3CHSA 3S7BA 1UN8A 4TV3A 1SA5A 5BW8C 5LCWC 1MJ0A 4Z68A 4RG6A 1D9SA 4TUUA 4Y6WA 4TXRA 3PE4A 2EQXA 1HE8A 3TL5A 3HRAA 3FUKA 3KSLA 3LYAA 4HOUA 4BTBA 3CK8A 4CYMD 2I2OA 4ME2A 3O4ZA 4L9PA 5KBAA 2C0LA 4FLBA 2JABA 3LJNA 3T5XA 2VTBB 5DBKA 3NOCD 2Y69E 3L9TA 3UXGA 3GW4A 2UY1B 4ZHBA 1EYHA 3ZU7B 1HZ4A 3ASFA 5G2NA 4GA1A 3CKCA 3FTXA 1HU3A 4U8HA 5EIBE 1KLXA 4AIFA 1E8ZA 3RAUA 2WXJA 3B95A 4HOSA 3KEZA 5EILA 1DCEA 2PZIA 3GZ1A 4MRUA 3DSSA 4EZJA 1UJKA 2ZGDA 2BKGA 3EU9A 3FTUA 2X6IA 4A55A 3ISMC 1FT2A 3L17A 2P9SG 1S70B 2H6GA 4LUNU 5KNHD 3CIAA 2WQ6A 4W9RA 2XEVA 3ZYKA 2HYZA 2IJGX 2YHEA 1WM5A 3ULEG 1ELKA 4XEIG 4QQIA 3ABME 4BESA 5A6CA 2GRMA 3CVNA 3DEPA 4RVBA 3EHQA 1E90A 3EU5A 1TR4A 3QWVA 1MX4A 2BF0X 2X3MA 3P2BA 2FO1E 1V54E 4UQXA 3EJNA 3OTNA 5JMND 3NZSA 4JHKA 4ILGA 5JJTA 2MHKA 2OEWA 4BFRA 3CVLA 4LNGA 2I6HA 3EIJA 3DSUA 1YMPA 4U07A 4YDEA 5FQ4A 2J4DA 2WXIA 3D9MA 3PNLB 3MEKA 3UIOC 1XNFA 1MX6A 3CVWA 1QYMA 3UIPC 5ARGA 3C3QA 2BTDA 3DSXA 3RJVA 5JHAA 3BUAA 2CG3A 3FUIA 4FHKA 4HBDA 2GGFA 1N95A 4IN3B 5CHEE 1L5JA 4N5QA 2ZISA 4EBAG 4JW1A 4DRXE 3CSFA 4GTOA 2QC9A 1IHGA 3KS2A 3UQ3A 5IY5E 3FEYA 1SW6A 4JVSA 1BPOA 4K5BA 2H6HA 3AG4E 4JHRA 3V2XA 1U3DA 2ETBA 4G11A 2QYUA 1E7VA 4O6FA 3UMVA 3ZPJA 3X2QE 4K03A 2E0IA 4GB9A 4DX5D 5FT9A 2IEJA 3V2OA 3LY8A 2MRIA 4YDOA 3SF4A 3G2WA 4ACKA 1SZAA 5J90A 2P58C 2VQ2A 1N11A 2PM7A 5FINA 4MLPA 1Q2ZA 2XENA 4E6HA 3U64A 4B0ZA 3ABKE 3QARA 4KVOA 3TGOA 1E8WA 2WXNA 3W9FA 1H2TC 4DI3A 1LD7A 2R5SA 3UM1A 4GCOA 1IQRA 1X5BA 3JCKC 3V30A 4Q69A 3G2UA 1IHBA 1OWNA 3RO3A 2C0MA 4CCAA 4TUMA 3U3WA 3ULYA 5KJNA 3HXEA 2J4BA 2EIKE 4HOTA 2Y4TA 4UI9K 1LD8A 3NZUA 3FUDA 2PL2A 2V8SE 1INZA 4GMJA 3FULA 4GMLA 3CKBA 2XRZA 2HR2A 4YVOA 1TN6A 3HHMA 2GRRB 3RKVA 3ZIMA 4L1BA 1H0AA 3MA5A 4L23A 3T9KA 3G2TA 3DSWA 3D9LA 2IO2C 1OCRE 1EF1C 3ZYQA 4GPMA 2P9KG 3QNKA 2OCCE 3JQ1A 2J07A 2QYJA 3D9OA 4QFVA 2KCKA 3B13A 2IF4A 3Q4AB 4BT9A 2YQ8A 1JPLA 4DI4A 4NURA 3TWTA 3PUKA 3ZHEB 2NSZA 2WXQA 3DBSA 3UM0A 4GZCA 3URZA 3E37A 1LTXA 1KT1A 5B1AE 3ZW3A 5G04C 2NC9A 1BI8B 4J7WA 4OAVB 2R59A 3KSQA 4U0SA 2IO3C 2QY7A 4UWHA 2KZTB 4N5CA 1N54A 2V5QC 3JYSA 3CVUA 4U95D 2QFCA 4G23A 1AWCB 1NA3A 3BQOA 3DPYA 2HM8A 3ZXSA 1SQMA 2XS8A 4I1AA 4UQZA 2LAIA 2HO1A 3PZ4A 4N2QA 2LAHA 2ZGGA 2A5UA 3JUIA 5FQ6A 1D8EA 2PQRA 2IFUA 3UT8A 3TWUA 4L2YA 3EHRA 3HIZA 1HXIA 3Q9UC 4JXTA 4K5CA 4N39A 2AWIA 3PVLA 4G24A 1DCQA 1H19A 1RZ4A 4AJWA 3R9MA 3T8KA 2WXHA 3AU5A 5HS0A 2AXVA 1EDUA 2OVFA 3NAWA 3FY4A 3OXLA 3ZN3A 2KC7A 1TEZA 3FTWA 1K1BA 2WXFA 4OVUA 3MX3A 3E30A 1UG3A 1JCSA 5BT1A 3J5PA 1HFAA 5C2YA 3IBEA 3MKRA 1WDYA 4A1GA 4GZ5A 1IXVA 2XPZA 5FTPA 2LSVA 4RG9A 3EUVA 2ONDA 3ESKA 1NA0A 3UKRG 2PNNA 3HXDA 5LFAA 5CMWA 3Q5MA 3PZ3A 3Q15A 3RK6A 3FU3A 4F6RD 1N0RA 3T5VA 3FUHA 4I1MA 3OXGA 3D9JA 4DPRA 5AARA 2QZAA 4F1PA 3FH8A 3IHVA 2M63A 4GA2A 5ENNA 3FWVA 2H6IA 4HNAD 2J08A 2OOEA 2WMNA 1NP7A 3L13A 4B89A 5AQ9A 3I3NA 3BG1B 3MKQA 2MOWA 4M7CA 4CGWA 4RSYA 3C5RA 5CMYA 3ONKA 2J9QA 1FT1A 4D10C 1N4SA 1G3NB 5CEAA 3KAEA 5CERB 3SI5A 1O1TA 3G2SA 5ANRA 3LCAA 2XS1A 2V0PA 3BEEA 3HXFA 4HLLA 1BD8A 3Q73A 2P9NG 4XKCA 3QDNA 4L7TA 1TNZA 2GRQB 1QQEA 4LRZA 3SBSA 5A23A 3Q79A 2L9BA 3JXJA 3D3MA 4F53A 1H2VC 2LO6A 4IULA 3RRNB 3ZNGA 4P29A 2V4HC 4KBQA 2AJAA 1KZPA 5BXOA 1OWPA 2FBNA 4KXKB 1PAQA 5JJ6A 5AQBA 3PH0C 2VTBA 2XGSA 1NFIE 3VLEA 3HXCA 5AJLA 5AJDA 2J09A 2ETAA 4CDMA 2UY1A 3ZXPA 2OVBA 2X38A 4AY6A 2ZXWE 1DC2A 2P9IG 1P5QA 4GU5A 2L6BA 4LNBA 2BEDA 3UUXA 1W3BA 5C1DA 2XGMA 4G25A 1H6OA 2R05A 2XGOA 2P9LG 3VLDA 1OWLA 3Q78A 3LS8A 4JB8P 1UW4B 5BV1A 1TNOA 1ZB1A 3LDZA 2DZNA 4UI9C 4JC8A 1ELWA 4UWGA 5ENTD 3TXNA 1ZBPA 2EIME 3IEGA 3SD5A 1WY6A 2XCCA 2B6CA 2GRNB 3TWWA 4ANWA 4G1TA 4I2WA 4BSZB 3CHRA 2UWJG 4KYOB 4BX9A 3CHOA 2L0IA 4HRMB 2CG2A 5ENPD 3LXUX 3QB2A 3CVPA 4KT6B 1WG0A 4BETA 4JL0A 4I6EA 3SQVA 4J0UA 2R2LA 3KD7A 3SO8A 4HRNA 3TJPA 3G2VA 5KJKA 3HYMB 4H7XA 3AAAC 4NRHB 2XPIA 1O1RA 4FJYA 1E8YA 1E7UA 3CLJA 3E33A 1YYHA 2RKKA 3MZLB 5G05J 2X6FA 5E76A 4GMRA 3BU8A 4HORA 4B8AA 4U0UA 4A1SA 2X6JA 3PS6A 3PE3A 4J8YA 1HG5A 1UJJA 4DX7D 3ASNE 4EQFA 5BPPA 3CHPA 4AXHA 2FF4A 3PNTB 2VYIA 4ILIA 2DYRE 1UOHA 4I43A 5EX0A 4KVMA 4GTMA 4HI8A 4GTVA 5T3RA 1OXJA 3ZRHA 3C98A 3VTYA 3AS8A 3TWVA 2Y0BG 3UX4A 4LERA 5EYPF 3MGBA 3Q49B 4Q96A 1HH8A 2WQHA 4IRUA 1YA0A 3SFXA 4G8LA 2A5EA 2JEKA 4XIFA 4M3OA 5AENA 4J8FA 4Y6CA 5D0QD 2IOLA 2Q7FA 2IU1A 3SY2A 4PS3A 4EZLA 3E32A 1OCCE 3ENEA 5AQ7A 4CDNA 3W9GA 3N71A 3JUEA 5BNWA 3LY9A 3U9WA 4GTSA 4I17A 3D9IA 3APDA 2GRLA 4O1OA 3UKUG 2WXLA 3HG0D 1Z6TA 5FZSA 1Z5SC 1E8XA 2KCLA 3CHMA 4EPZA 4B94A 4HVBA 3D9PA 1H6KA 3FUNA 5HI7A 2XZTG 1U3CA 2GW1A 3ASDA 4IYPA 4AEZC 5LP0A 5JJ7A 4HFGA 4OVVA 3V79K 2L6JA 1BLXB 5E75A 1PC2A 4HRLA 4DJAA 3B7SA 1MYOA 2A4ZA 4N3BA 3TWSA 2DVWA 1XGWA 1K8KG 3LVRE 1YCSB 3O48A 2WMOA 1FVHA 4J8SA 5JHBA 3ZYMA 2Y4UA 3PZ2A 4UWKA 3DWLG 5FWQA 4KZ0A 3FEXA 3AJIA 2ZU6B 3APFA 3DXMG 3SZ7A 3D9HA 3FHEA 5KNGA 4HS2A 4U8YD 2J8SD 4JZYA 2WM9A 4XKBA 2AW6A 3ABLE 4AV7A 4HI9A 4U63A 3L6AA 2P2CP 4X8QA 5CEDB 4YDYA 3PDNA 3ZHEA 3FUEA 2V5FA 3HVEB 3EHNA 5EKQD 4G8KA 4EBAA 2GROB 3LJ3A 2LXLA 3D9NA 1N4RA 4FULA 4A63B 4UQYA 2IONA 4E85A 3ASGA 4B8CB 3S7JA 5LCWJ 1TJFA 2KZTA 2Y3AA 1KT0A 1ELRA 2ZIRA 3CVVA 3QWPA 4PS7A 4YNDA 5T4YA 4CDRA 1NI1A 4PS8A 4BY6A 4HOQA 1N4PA 5AIJA 4WUYA 2FULA 4LCTA 4TXPA 3RU0A 1FPPA 4GYYA 1BU9A 3SFZA 4BSXA 4EHMA 1UN9A 3GZ2A 4U7EB
chains in the Genus database with same CATH topology
4KBQA 5ARGA 2BTDA 4G2VA 3RJVA 5BV0A 2RD0A 5JHAA 2CHWA 4JEHA 2IOSA 2CG3A 3FUIA 4FHKA 4H7YA 1OWPA 3ZYLA 2VSXE 2FBNA 2GGFA 1PAQA 4KXKB 1EPUA 4IN3B 5JJ6A 5LOZA 5CHEE 4DLOA 4AM9A 4CRWA 1Y8MA 2RG8A 3FP3A 1L5JA 2VGYA 3CQCB 4JPSA 4EBAG 3PH0C 1ZU2A 4JW1A 2XGSA 2WXOA 2YINA 4CT4A 2VTBA 5EDSA 3CSFA 2WXMA 3VLEA 5AJLA 5AJDA 2J09A 1IHGA 3KS2A 5ARFA 3R7QA 3UQ3A 4CDMA 2WXKA 3HDXA 2C2LA 3QJZA 2UY1A 3MV3B 5CCLA 3FEYA 4FP7A 4J6IA 4JVSA 2OVBA 3RIBA 4F1SA 2X38A 3LEWA 4AY6A 1A17A 3ONLA 2AXUA 1BPOA 1GW6A 3CVYA 3CK9A 4C0EA 3ESLA 5M72A 4BWRA 1P5QA 4FJZA 4JHRA 4F3VA 1U3DA 4GU5A 5T8IA 4G11A 4N3AA 3UUXA 1OWMA 1E7VA 4MKTA 2KATA 4AP2A 1W3BA 4O6FA 5C1DA 3FTYA 2XGMA 3UMVA 4G25A 3RRUA 2XGOA 4U0ZA 3ZPJA 4CT0A 3VLDA 4K03A 3WXXA 2E0IA 2WPVA 1OWLA 4GB9A 2CHZA 3LS8A 1UW4B 5FT9A 1JWGA 3TG4A 5BV1A 3L16A 3S2AA 4K0RA 3CHQA 4JHJA 3CQGB 3LDZA 3SHFA 3TXMA 3LY8A 3L08A 4FA6A 2MRIA 3SF4A 4APFA 4UI9C 4JC8A 5FZQA 1ELWA 1S0PA 3G2WA 4F7AA 4UWGA 4ACKA 1SZAA 3P1UA 5J90A 3TXNA 1ZBPA 3IEGA 2P58C 2VQ2A 3SD5A 4PDXA 4GPKA 3AS5A 3LKUA 3UPVA 1WY6A 2PM7A 2XCCA 2KM4A 3DPDA 3IHYA 3OAWA 3MV2B 4CGVA 4MLPA 2L0TB 4I9CA 4ANWA 2FI7A 4G1TA 4I2WA 2BUGA 3CHRA 3HVEA 3U64A 4E6HA 3Q47B 4XI0A 3QOUA 4B0ZA 3EIQC 2UWJG 4KYOB 4BX9A 3CHOA 3FDHA 4I1OB 3AS4A 2L0IA 3ULQA 3FTZA 3QARA 2CG2A 3L54A 3LVQE 3LXUX 3QB2A 4KVOA 3TGOA 1E8WA 2WVIA 3FTVA 1LF8A 2FO7A 2WXNA 3UT4A 1H2TC 1Z3XA 4DI3A 5HQ8A 2R5SA 3CVPA 4GCOA 1IQRA 2XPYA 4KT6B 1X5BA 4PUCA 4APOA 3ASHA 5LX8A 3AU4A 4JL0A 4ANXA 3JCKC 4I6EA 4J0UA 2I1JA 4Q69A 3KD7A 1FVFA 3G2UA 3TJPA 5KJKA 3G2VA 3HYMB 1OWNA 3RO3A 4H7XA 2C0MA 4CCAA 1MQSA 5EX3A 4NRHB 4NACA 3U3WA 5FZRA 2XPIA 5KJNA 3LY7A 1HO8A 1E8YA 2J4BA 1E96B 3ML8A 4FJYA 4HOTA 3GYZA 2Y4TA 5AYWD 2WXRA 4UI9K 4AVXA 3CVXA 1E7UA 3CLJA 3NZUA 4YVQC 3FUDA 2PL2A 3IV0A 4C9BB 5FQ7A 2V8SE 2OV8A 3MZLB 4GMJA 3FULA 5G05J 1INZA 4U04A 2XRYA 2X6FA 3ZVVA 2CFUA 4GMLA 4JA7A 3CKBA 3QAQA 4NQ0A 2XRZA 4WNEA 5E76A 2HR2A 4YVOA 2J49A 4I2ZA 3ZFWA 4HORA 4GAAA 1DVPA 1IQUA 3HHMA 3EDTB 3RKVA 4B8AA 4J8DA 2XQ0A 3FUFA 3ZIMA 4U0UA 3IKOB 4A1SA 2X6JA 3PS6A 3PE3A 4L1BA 1H0AA 1VDYA 3GZSA 3MA5A 2VJ8A 4R7LA 4L23A 1JUQA 2FEZA 1HG5A 3G2TA 4AY5A 3D9LA 1UJJA 1EF1C 3RO2A 4AOFA 3ZYQA 4WWOA 4EQFA 3I5PA 5BPPA 3CHPA 4AXHA 2WXPA 2FF4A 4WNFA 3PNTB 2R17C 3CGHA 2VYIA 3QNKA 4ILIA 1PY1A 4I43A 4ABNA 4GZ6A 3S7FA 5EX0A 1TJCA 4KZCA 3JQ1A 3U66A 4KVMA 2J07A 3MYVA 3R9AB 3L22A 2I9CA 4BX8A 3FU0A 5T3RA 1OUVA 3D9OA 2KCKA 2VGXB 3PREA 4QFVA 3B13A 2IF4A 3PUJA 5CCMA 4JEUA 3MCXA 3Q4AB 3ZRHA 4BT9A 2YQ8A 3ML9A 4ANUA 4WNGA 5FQ8A 3C98A 1JPLA 3VTYA 4DI4A 3AS8A 4NURA 3PUKA 3ZHEB 3CV0A 3NQPA 3I4GA 4GCNA 5ANLA 4I6GA 2NSZA 2X6HA 4UI9J 4EZKA 3I4RB 2WXQA 3DBSA 3CVQA 3UX4A 4LERA 4MS6A 3MGBA 3Q49B 4Q96A 5A7DB 2LNIA 3FH7A 1DNPA 4GZCA 1HH8A 2VGXA 3URZA 3PZDA 2WQHA 4IRUA 1KT1A 1YA0A 3MKQB 1OWOA 2ILRA 5KJMA 1FCHA 3ZW3A 4UWLA 5G04C 2NC9A 3D9KA 1JWFA 3B7RL 3K9IA 2R59A 4GZDA 1IYGA 2JEKA 4FC8A 4U0SA 4XZ4A 4XIFA 1H2UA 3FUMA 4M3OA 4A3VA 4A3TA 2QY7A 3ZEFA 4HXIA 4UWHA 5AENA 2KZTB 3U4TA 5KCMA 4J8FA 4Y6CA 3FU5A 3PRZA 2VSNA 2LSUA 4N5CA 3QK0A 3FTSA 2PQNA 1N54A 2IOLA 5D0QD 3VTXA 2Q7FA 2IU1A 3JYSA 2E2EA 3CVUA 2X6KA 4FHJA 4TRQA 1HF8A 2AVPA 4PS3A 4EZLA 3BG0B 2QFCA 3E4BA 4G23A 1NA3A 3ENEA 2HM8A 2DBAA 1SQMA 4I1AA 4UQZA 3CEQA 3TAXA 3ZXSA 4CDNA 2CFZA 4UWFA 3N71A 2IQCA 2WB2A 2NXPA 5BNWA 2JLBA 2LAIA 2PM6A 2HO1A 3R7RA 3APCA 3CHSA 3LY9A 1UN8A 3S7BA 4GYWA 5D0OD 4N2QA 3U9WA 2LAHA 4I9EA 5FJYA 4I17A 3D9IA 2A5UA 3APDA 4TV3A 2XCBA 3JUIA 2GRLA 3JQ0A 5FQ6A 2WXLA 3CR3A 5BW8C 4DK5A 5LCWC 1Z6TA 2PQRA 5FZSA 2IFUA 1Y6IA 3UT8A 4ATGA 1E8XA 4L2YA 4RG6A 2I1KA 2KCLA 3CHMA 4EPZA 4HLEA 4B94A 4TUUA 4Y6WA 3HIZA 1HXIA 4HVBA 4JXTA 3PE4A 2EQXA 3D9PA 2AWIA 4N39A 3S7DA 1HE8A 1NZNA 3CK7A 3NF1A 1H6KA 3FUNA 3PVLA 4G24A 4WAFA 5HI7A 4V3IA 1H19A 3TL5A 1U3CA 2GW1A 3ASDA 4AJWA 3FUKA 4BT8A 3LYAA 4IYPA 4HOUA 4BTBA 2WXHA 3CK8A 3AU5A 4AEZC 5LP0A 2I2OA 2AXVA 5JJ7A 4ME2A 3O4ZA 3CSTA 2C0LA 4HFGA 1EDUA 4FLBA 4OVVA 2L6JA 2OVFA 3FY4A 3OXLA 3FFLA 5E75A 2WXGA 3TG5A 3ZN3A 1PC2A 3T5XA 2KC7A 1TEZA 2VTBB 1B89A 4OYSA 3FUJA 3FTWA 5J08A 4DJAA 5DBKA 2AXZA 3B7SA 3T8MA 2A4ZA 2WXFA 4OVUA 4BTAA 4DLQA 4N3BA 3MX3A 1UG3A 5BT1A 3GW4A 1HFAA 2UY1B 4LEUA 1XGWA 5C2YA 3IBEA 1EYHA 3LVRE 3MKRA 4URKA 3EHMA 4A1GA 2VSYA 1HZ4A 3ASFA 3O48A 2WMOA 5G2NA 4GA1A 4GZ5A 1FVHA 3CKCA 3FTXA 1HU3A 2XPZA 4J8SA 4U8HA 5JHBA 3UT7A 1KLXA 4AIFA 5FTPA 2LSVA 1E8ZA 4RG9A 3ZYMA 1HG2A 2Y4UA 2WXJA 3VLFA 4HOSA 2ONDA 4UWKA 3KEZA 4I6JA 3ESKA 5FWQA 4KZ0A 3FEXA 1NA0A 4FLHA 2PZIA 3GZ1A 4ACLA 4C0MA 2ZU6B 3APFA 4MRUA 3SNXA 3LPZA 5LFAA 5CMWA 4L2LA 3Q5MA 1HS6A 4Q94A 4EZJA 1UJKA 3SZ7A 1WAO1 5G04J 3FHEA 2DCPA 2YHCA 3FTUA 3Q15A 4HS2A 3RK6A 4JZYA 2X6IA 3FU3A 2WM9A 4A55A 3L17A 3QWWA 2AW6A 4XKBA 4ANVA 3T5VA 4AV7A 3FUHA 4I1MA 4U63A 3OXGA 5G55A 3D9JA 3QC1A 3L6AA 4JA9A 1SZ9A 4LUNU 4DPRA 3CIAA 2WQ6A 4GZ3A 3PDNA 4W9RA 4FU3A 3ZHEA 4XI9A 2XEVA 3FH8A 3ZYKA 3IHVA 3FH5A 4XE0A 2M63A 4CEMA 2HYZA 3FUEA 2KCVA 4GA2A 2IJGX 5ENNA 2V5FA 1WM5A 2YHEA 3FWVA 3HVEB 3EHNA 5EKQD 2J08A 3PEVB 4KMOA 4EBAA 1ELKA 2OOEA 3ZGQA 4GYOA 2WMNA 4GA0A 2DIWA 1NP7A 2VSOE 3L13A 4B89A 3LJ3A 4G26A 4WNDA 3I3NA 3BG1B 3MKQA 3D9NA 5A6CA 2MOWA 4CGWA 4FULA 2GRMA 4RSYA 4UQYA 4FADA 3CVNA 5DIZA 2IONA 4RVBA 5CMYA 1Z3YA 4E85A 1E90A 3ONKA 2J9QA 3ASGA 4N2SA 3QWVA 3B7UX 4D10C 2BF0X 2X3MA 3P2BA 3B7TA 4J8EA 4B8CB 3QKYA 3KAEA 3S7JA 5LCWJ 3SI5A 4UQXA 1TJFA 3EJNA 2KZTA 3OTNA 2Y3AA 3G2SA 1KT0A 3NZSA 4JHKA 1ELRA 1N52A 4ILGA 3CVVA 4ILHB 3MJWA 5JJTA 2XHEA 3QWPA 4PS7A 2MHKA 4YNDA 5ANRA 5BUZA 3LCAA 5T4YA 4CDRA 3SBTB 4BFRA 2V0PA 3BEEA 3CVLA 4PS8A 2I6HA 3EIJA 4BY6A 2CHXA 4HOQA 3PEUB 5KJLA 4WWNA 4EECA 4XKCA 1HX8A 3QDNA 4L7TA 4U07A 4PH4B 3SGHA 5FQ4A 5AIJA 4LRZA 1QQEA 3SBSA 4WUYA 2J4DA 5A23A 2FULA 2WXIA 1MHQA 3D9MA 1QNFA 2L9BA 3PNLB 3MEKA 4LCTA 3RU0A 2WQ7A 3D3MA 1QZ2A 3OXFA 4F53A 1H2VC 4GYYA 1XNFA 2LO6A 4IULA 2YNQA 4N3CA 3FU6A 3SFZA 4BSXA 4WWPA 1UN9A 2V4LA 5G05C 3CVWA 4XX5A 3RRNB 3GZ2A 4P29A 3RRMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KBQ A;  5ARG A;  4G2V A;  3RJV A;  4H7Y A;  2FBN A;  4KXK B;  4IN3 B;  5JJ6 A;  5CHE E;  4AM9 A;  1Y8M A;  3FP3 A;  2VGY A;  1ZU2 A;  2XGS A;  1IHG A;  3KS2 A;  5ARF A;  3UQ3 A;  2C2L A;  2UY1 A;  3MV3 B;  5CCL A;  3RIB A;  4AY6 A;  1A17 A;  3CK9 A;  5M72 A;  4BWR A;  1P5Q A;  4JHR A;  4F3V A;  4N3A A;  3UUX A;  2KAT A;  1W3B A;  4O6F A;  5C1D A;  2XGM A;  4G25 A;  2XGO A;  4U0Z A;  3ZPJ A;  3WXX A;  2WPV A;  5FT9 A;  3TG4 A;  3LY8 A;  3SF4 A;  4UI9 C;  5FZQ A;  1ELW A;  1ZBP A;  3IEG A;  2P58 C;  2VQ2 A;  4GPK A;  3AS5 A;  3LKU A;  3UPV A;  2XCC A;  4CGV A;  3MV2 B;  4I9C A;  2FI7 A;  4G1T A;  4I2W A;  2BUG A;  3Q47 B;  4XI0 A;  3QOU A;  2UWJ G;  4KYO B;  3AS4 A;  3ULQ A;  3TGO A;  2FO7 A;  5HQ8 A;  2R5S A;  3CVP A;  4GCO A;  4APO A;  3ASH A;  4JL0 A;  4J0U A;  3KD7 A;  5KJK A;  3HYM B;  3RO3 A;  4H7X A;  2C0M A;  5EX3 A;  4NRH B;  3U3W A;  5FZR A;  2XPI A;  5KJN A;  3LY7 A;  1E96 B;  4HOT A;  3GYZ A;  2Y4T A;  5AYW D;  4UI9 K;  4YVQ C;  2PL2 A;  5G05 J;  4U04 A;  4JA7 A;  3CKB A;  4NQ0 A;  4WNE A;  2HR2 A;  4YVO A;  4I2Z A;  3ZFW A;  4HOR A;  3EDT B;  3RKV A;  4J8D A;  4U0U A;  4A1S A;  3PE3 A;  3MA5 A;  2FEZ A;  4AY5 A;  3RO2 A;  4EQF A;  2FF4 A;  4WNF A;  2VYI A;  4ABN A;  4GZ6 A;  3S7F A;  5EX0 A;  1TJC A;  3R9A B;  1OUV A;  2KCK A;  2VGX B;  5CCM A;  2IF4 A;  3Q4A B;  4BT9 A;  2YQ8 A;  4WNG A;  3VTY A;  3AS8 A;  3ZHE B;  3CV0 A;  4GCN A;  4UI9 J;  3CVQ A;  3Q49 B;  5A7D B;  2LNI A;  1HH8 A;  2VGX A;  3URZ A;  2WQH A;  1KT1 A;  1YA0 A;  5KJM A;  1FCH A;  5G04 C;  2NC9 A;  3K9I A;  1IYG A;  4U0S A;  4XIF A;  3U4T A;  4J8F A;  4Y6C A;  2VSN A;  2LSU A;  4N5C A;  2PQN A;  5D0Q D;  3VTX A;  2Q7F A;  3JYS A;  2E2E A;  2AVP A;  2QFC A;  3E4B A;  4G23 A;  1NA3 A;  2DBA A;  3TAX A;  4I1A A;  4UQZ A;  3CEQ A;  3N71 A;  5BNW A;  2JLB A;  2HO1 A;  3S7B A;  3LY9 A;  4GYW A;  5D0O D;  4N2Q A;  4I9E A;  5FJY A;  4I17 A;  2XCB A;  5BW8 C;  5LCW C;  2PQR A;  5FZS A;  2IFU A;  4RG6 A;  2KCL A;  4B94 A;  4Y6W A;  1HXI A;  3PE4 A;  4N39 A;  3S7D A;  1NZN A;  3CK7 A;  3NF1 A;  4G24 A;  5HI7 A;  2GW1 A;  3ASD A;  4BT8 A;  3LYA A;  4HOU A;  4BTB A;  3CK8 A;  5JJ7 A;  4ME2 A;  2C0L A;  2L6J A;  3OXL A;  3FFL A;  3TG5 A;  3ZN3 A;  1PC2 A;  2KC7 A;  1B89 A;  5DBK A;  4BTA A;  4N3B A;  5BT1 A;  3GW4 A;  2UY1 B;  4LEU A;  3MKR A;  2VSY A;  1HZ4 A;  3ASF A;  3O48 A;  4GA1 A;  4GZ5 A;  3CKC A;  1KLX A;  4AIF A;  5FTP A;  2LSV A;  4RG9 A;  2Y4U A;  4HOS A;  2OND A;  3ESK A;  1NA0 A;  2PZI A;  3GZ1 A;  3LPZ A;  3Q5M A;  3SZ7 A;  1WAO 1;  5G04 J;  2YHC A;  3Q15 A;  3QWW A;  3OXG A;  4JA9 A;  4GZ3 A;  3PDN A;  4W9R A;  3ZHE A;  4XI9 A;  2XEV A;  2HYZ A;  2KCV A;  4GA2 A;  2V5F A;  1WM5 A;  3FWV A;  5EKQ D;  2OOE A;  3ZGQ A;  4GYO A;  4GA0 A;  4G26 A;  4WND A;  5A6C A;  4CGW A;  4UQY A;  3CVN A;  5DIZ A;  2J9Q A;  3ASG A;  4N2S A;  3QWV A;  4J8E A;  3QKY A;  3KAE A;  3S7J A;  5LCW J;  4UQX A;  1KT0 A;  1ELR A;  5JJT A;  3QWP A;  2MHK A;  4YND A;  3LCA A;  4CDR A;  3BEE A;  3CVL A;  2I6H A;  4HOQ A;  5KJL A;  3QDN A;  4U07 A;  1QQE A;  4WUY A;  3RU0 A;  3MEK A;  1QZ2 A;  3OXF A;  4GYY A;  1XNF A;  4N3C A;  5G05 C;  3GZ2 A; 
#chains in the Genus database with same CATH topology
 4G2V A;  5BV0 A;  2RD0 A;  2CHW A;  4JEH A;  4H7Y A;  2VSX E;  4DLO A;  5LOZ A;  4AM9 A;  1Y8M A;  3FP3 A;  1ZU2 A;  2YIN A;  3R7Q A;  5ARF A;  4F1S A;  1N0Q A;  1A17 A;  1D8D A;  1GW6 A;  3CVY A;  4C0E A;  3ESL A;  5M72 A;  4BWR A;  1S63 A;  4FJZ A;  3AG2 E;  1V55 E;  5ITZ F;  4F3V A;  4AP2 A;  1OWM A;  3Q7A A;  4MKT A;  3SFY A;  3J5Q B;  4CT0 A;  1QBQ A;  3TG4 A;  3L16 A;  3UM2 A;  4HQD A;  3CHQ A;  3CQG B;  3TXM A;  3L08 A;  3C72 A;  1O5M A;  5HRY A;  3IHY A;  2H6F A;  3DPD A;  3MV2 B;  4O1P A;  4MBG A;  3NOG D;  3NBN B;  2L0T B;  2BUG A;  4XI0 A;  3QOU A;  3EIQ C;  3FDH A;  3AS4 A;  3ULQ A;  1S64 A;  1K3Z D;  2WVI A;  3FTV A;  2FO7 A;  2XPY A;  4PUC A;  5LX8 A;  3ASH A;  5KWD A;  3AU4 A;  2I1J A;  3E34 A;  4DX6 D;  3PZ1 A;  4O60 A;  5EX3 A;  4NAC A;  1AP7 A;  1E96 B;  3GYZ A;  5AYW D;  2WXR A;  4AVX A;  3CVX A;  5FQ7 A;  2MYO A;  1OY3 D;  2XRY A;  3ZVV A;  2CFU A;  4JA7 A;  3QAQ A;  1DVP A;  1IQU A;  2XEE A;  1NL4 A;  3EDT B;  4J8D A;  2XQ0 A;  3WG7 E;  3IKO B;  3ZKJ A;  5CBN A;  4R7L A;  4GTQ A;  4AOF A;  4WWO A;  3I5P A;  4WNF A;  4GTT A;  2R17 C;  5EID A;  1OT8 A;  4ABN A;  1N4Q A;  3TWR A;  1TJC A;  4ATZ D;  5BXU A;  3MYV A;  3HXB A;  3L22 A;  2I9C A;  3FU0 A;  1OUV A;  5CCM A;  3PUJ A;  1JCQ A;  4ANU A;  4YDW A;  1MX2 A;  3CV0 A;  3NQP A;  2EIL E;  5ANL A;  4I6G A;  2X6H A;  3I4R B;  3CVQ A;  1K1A A;  5A7D B;  3FH7 A;  3PZD A;  4DUI A;  1OWO A;  4UWL A;  1JWF A;  3B7R L;  1KZO A;  4GZD A;  3Q9N C;  2P9U G;  1H2U A;  4A3T A;  5HKP A;  3ZEF A;  4HXI A;  3FU5 A;  3PRZ A;  2VSN A;  3IXE A;  2LSU A;  4JD2 G;  4BEP A;  2E2E A;  1MZC A;  2X6K A;  1HF8 A;  2AVP A;  2DZO A;  2XEH A;  2DBA A;  3TAX A;  3CEQ A;  4UWF A;  2NXP A;  2PM6 A;  3R7R A;  4GYW A;  5D0O D;  5EN5 D;  1TNY A;  4I9E A;  5FJY A;  5ENS D;  2XCB A;  3JQ0 A;  2Y1L E;  3UTM A;  3CR3 A;  4DK5 A;  1Y6I A;  4ATG A;  4U96 D;  2I1K A;  4HLE A;  5ENR D;  4RLY A;  3Q75 A;  3S7D A;  1N9A A;  1NZN A;  3CK7 A;  3NF1 A;  4WAF A;  3TWQ A;  2F8X K;  4V3I A;  2R02 A;  5ENO D;  4BT8 A;  3CST A;  2OEV A;  3TG5 A;  3FFL A;  2WXG A;  4ZFH A;  2P9P G;  1B89 A;  4DX1 A;  4OYS A;  3FUJ A;  2XZD G;  5J08 A;  3F6Q A;  2AXZ A;  3T8M A;  4BTA A;  4DLQ A;  1BI7 B;  3UI2 A;  5B1B E;  2DYS E;  4LEU A;  2VGE A;  4URK A;  3EHM A;  2VSY A;  3UM3 A;  2LXM A;  3UT7 A;  3TWX A;  2RFM A;  1HG2 A;  3VLF A;  4I6J A;  4FLH A;  3DEO A;  4ACL A;  4C0M A;  3SNX A;  2RFA A;  3LPZ A;  4L2L A;  1HS6 A;  4Q94 A;  2ETC A;  1WAO 1;  3Q7F A;  5G04 J;  2DCP A;  2YHC A;  3C3O A;  3QWW A;  4ANV A;  4C48 B;  5CBO A;  5G55 A;  3QC1 A;  4JA9 A;  1JCR A;  1SZ9 A;  4GZ3 A;  4FU3 A;  4XI9 A;  5AQA A;  3KEA A;  3FH5 A;  4XE0 A;  4CEM A;  2KCV A;  3C3R A;  3PEV B;  4KMO A;  5D66 A;  3ZGQ A;  4GYO A;  4GA0 A;  2DIW A;  2VSO E;  4G26 A;  4WND A;  4FAD A;  5DIZ A;  1Z3Y A;  4N2S A;  3B7U X;  3B7T A;  4J8E A;  3QKY A;  3V31 A;  5B3S E;  1N52 A;  4ILH B;  3JXI A;  3MJW A;  2XHE A;  4B93 B;  3L82 A;  4HB5 A;  5BUZ A;  3SBT B;  1SA4 A;  2CHX A;  3PEU B;  5KJL A;  4WWN A;  4EEC A;  4OAU C;  1HX8 A;  4NIK A;  4PH4 B;  1SVX A;  3SGH A;  1MHQ A;  4U8V D;  1QNF A;  2WQ7 A;  4LNU D;  1QZ2 A;  3OXF A;  4N3C A;  2YNQ A;  3FU6 A;  5H7P A;  4WWP A;  2V4L A;  5G05 C;  4XX5 A;  3RRM B;  2IOS A;  3ZYL A;  2KBX A;  2KXP C;  1EPU A;  4GTP A;  4CRW A;  2RG8 A;  2VGY A;  3CQC B;  4JPS A;  3UIN C;  4CT4 A;  2WXO A;  3DST A;  5EDS A;  4LG6 A;  2WXM A;  2NYJ A;  2WXK A;  3HDX A;  2C2L A;  3QJZ A;  3MV3 B;  5CCL A;  4FP7 A;  4J6I A;  4DX2 A;  3RIB A;  3LEW A;  3ONL A;  2AXU A;  3CK9 A;  1OCO E;  1U2V G;  5EYL A;  5T8I A;  3RSE G;  4N3A A;  2KAT A;  3AG3 E;  3FTY A;  3RRU A;  4U0Z A;  3WXX A;  2WPV A;  2CHZ A;  1JWG A;  3S2A A;  4K0R A;  4JHJ A;  3SHF A;  4FA6 A;  4APF A;  4TXQ A;  5FZQ A;  1IKN D;  1H6P A;  1S0P A;  4F7A A;  3P1U A;  4GPK A;  4PDX A;  3AS5 A;  2F37 A;  3LKU A;  3UPV A;  2KM4 A;  3OAW A;  4CGV A;  1TN7 A;  5FIO A;  4I9C A;  2FI7 A;  3HVE A;  3DXK G;  3Q47 B;  4I1O B;  3FTZ A;  3L54 A;  3LVQ E;  5CRV A;  5AAO A;  1X81 A;  1LF8 A;  3UT4 A;  1Z3X A;  5HQ8 A;  4RQI A;  5AN8 A;  4APO A;  3B7B A;  4ANX A;  2R03 A;  2EIJ E;  1FVF A;  4CZ2 D;  1MQS A;  4GTR A;  5FZR A;  3LY7 A;  1HO8 A;  3ML8 A;  5CRU A;  4LSZ E;  4YVQ C;  3IV0 A;  4C9B B;  2OV8 A;  4U04 A;  4UUC A;  2LUH A;  5JA4 D;  4NQ0 A;  4WNE A;  4K5A B;  2J49 A;  4I2Z A;  3ZFW A;  1TYQ G;  4GAA A;  1OCZ E;  3ZUV B;  2GRP B;  2IY0 C;  5ENQ D;  3FUF A;  1VDY A;  3GZS A;  2VJ8 A;  1JUQ A;  2FEZ A;  4AY5 A;  1TNB A;  4BER A;  1KPS B;  3RO2 A;  2BKK B;  2F0Y A;  2WXP A;  3CGH A;  1PY1 A;  4GZ6 A;  3S7F A;  4KZC A;  3U66 A;  2EIN E;  3R9A B;  4BX8 A;  1O1S A;  2VGX B;  3PRE A;  2DWZ A;  4JEU A;  3MCX A;  3ML9 A;  4WNG A;  5FQ8 A;  1TN8 A;  3I4G A;  4GCN A;  4UI9 J;  4EZK A;  3AG1 E;  4MS6 A;  3NB2 A;  2LNI A;  1DNP A;  2VGX A;  2B0O E;  2HE0 A;  3MKQ B;  2ILR A;  1A5E A;  5KJM A;  1FCH A;  3D9K A;  5D2M C;  3DSV A;  3K9I A;  1RW2 A;  1IYG A;  4FC8 A;  3DRA A;  4XZ4 A;  4A3V A;  3FUM A;  3ASO E;  3U4T A;  5KCM A;  2F8Y A;  3QK0 A;  3FTS A;  2PQN A;  3VTX A;  1TNU A;  5CEC B;  4FHJ A;  4TRQ A;  1N94 A;  3BG0 B;  3E4B A;  2CFZ A;  2IQC A;  2WB2 A;  2JLB A;  3APC A;  3CHS A;  3S7B A;  1UN8 A;  4TV3 A;  1SA5 A;  5BW8 C;  5LCW C;  1MJ0 A;  4Z68 A;  4RG6 A;  1D9S A;  4TUU A;  4Y6W A;  4TXR A;  3PE4 A;  2EQX A;  1HE8 A;  3TL5 A;  3HRA A;  3FUK A;  3KSL A;  3LYA A;  4HOU A;  4BTB A;  3CK8 A;  4CYM D;  2I2O A;  4ME2 A;  3O4Z A;  4L9P A;  5KBA A;  2C0L A;  4FLB A;  2JAB A;  3LJN A;  3T5X A;  2VTB B;  5DBK A;  3NOC D;  2Y69 E;  3L9T A;  3UXG A;  3GW4 A;  2UY1 B;  4ZHB A;  1EYH A;  3ZU7 B;  1HZ4 A;  3ASF A;  5G2N A;  4GA1 A;  3CKC A;  3FTX A;  1HU3 A;  4U8H A;  5EIB E;  1KLX A;  4AIF A;  1E8Z A;  3RAU A;  2WXJ A;  3B95 A;  4HOS A;  3KEZ A;  5EIL A;  1DCE A;  2PZI A;  3GZ1 A;  4MRU A;  3DSS A;  4EZJ A;  1UJK A;  2ZGD A;  2BKG A;  3EU9 A;  3FTU A;  2X6I A;  4A55 A;  3ISM C;  1FT2 A;  3L17 A;  2P9S G;  1S70 B;  2H6G A;  4LUN U;  5KNH D;  3CIA A;  2WQ6 A;  4W9R A;  2XEV A;  3ZYK A;  2HYZ A;  2IJG X;  2YHE A;  1WM5 A;  3ULE G;  1ELK A;  4XEI G;  4QQI A;  3ABM E;  4BES A;  5A6C A;  2GRM A;  3CVN A;  3DEP A;  4RVB A;  3EHQ A;  1E90 A;  3EU5 A;  1TR4 A;  3QWV A;  1MX4 A;  2BF0 X;  2X3M A;  3P2B A;  2FO1 E;  1V54 E;  4UQX A;  3EJN A;  3OTN A;  5JMN D;  3NZS A;  4JHK A;  4ILG A;  5JJT A;  2MHK A;  2OEW A;  4BFR A;  3CVL A;  4LNG A;  2I6H A;  3EIJ A;  3DSU A;  1YMP A;  4U07 A;  4YDE A;  5FQ4 A;  2J4D A;  2WXI A;  3D9M A;  3PNL B;  3MEK A;  3UIO C;  1XNF A;  1MX6 A;  3CVW A;  1QYM A;  3UIP C;  5ARG A;  3C3Q A;  2BTD A;  3DSX A;  3RJV A;  5JHA A;  3BUA A;  2CG3 A;  3FUI A;  4FHK A;  4HBD A;  2GGF A;  1N95 A;  4IN3 B;  5CHE E;  1L5J A;  4N5Q A;  2ZIS A;  4EBA G;  4JW1 A;  4DRX E;  3CSF A;  4GTO A;  2QC9 A;  1IHG A;  3KS2 A;  3UQ3 A;  5IY5 E;  3FEY A;  1SW6 A;  4JVS A;  1BPO A;  4K5B A;  2H6H A;  3AG4 E;  4JHR A;  3V2X A;  1U3D A;  2ETB A;  4G11 A;  2QYU A;  1E7V A;  4O6F A;  3UMV A;  3ZPJ A;  3X2Q E;  4K03 A;  2E0I A;  4GB9 A;  4DX5 D;  5FT9 A;  2IEJ A;  3V2O A;  3LY8 A;  2MRI A;  4YDO A;  3SF4 A;  3G2W A;  4ACK A;  1SZA A;  5J90 A;  2P58 C;  2VQ2 A;  1N11 A;  2PM7 A;  5FIN A;  4MLP A;  1Q2Z A;  2XEN A;  4E6H A;  3U64 A;  4B0Z A;  3ABK E;  3QAR A;  4KVO A;  3TGO A;  1E8W A;  2WXN A;  3W9F A;  1H2T C;  4DI3 A;  1LD7 A;  2R5S A;  3UM1 A;  4GCO A;  1IQR A;  1X5B A;  3JCK C;  3V30 A;  4Q69 A;  3G2U A;  1IHB A;  1OWN A;  3RO3 A;  2C0M A;  4CCA A;  4TUM A;  3U3W A;  3ULY A;  5KJN A;  3HXE A;  2J4B A;  2EIK E;  4HOT A;  2Y4T A;  4UI9 K;  1LD8 A;  3NZU A;  3FUD A;  2PL2 A;  2V8S E;  1INZ A;  4GMJ A;  3FUL A;  4GML A;  3CKB A;  2XRZ A;  2HR2 A;  4YVO A;  1TN6 A;  3HHM A;  2GRR B;  3RKV A;  3ZIM A;  4L1B A;  1H0A A;  3MA5 A;  4L23 A;  3T9K A;  3G2T A;  3DSW A;  3D9L A;  2IO2 C;  1OCR E;  1EF1 C;  3ZYQ A;  4GPM A;  2P9K G;  3QNK A;  2OCC E;  3JQ1 A;  2J07 A;  2QYJ A;  3D9O A;  4QFV A;  2KCK A;  3B13 A;  2IF4 A;  3Q4A B;  4BT9 A;  2YQ8 A;  1JPL A;  4DI4 A;  4NUR A;  3TWT A;  3PUK A;  3ZHE B;  2NSZ A;  2WXQ A;  3DBS A;  3UM0 A;  4GZC A;  3URZ A;  3E37 A;  1LTX A;  1KT1 A;  5B1A E;  3ZW3 A;  5G04 C;  2NC9 A;  1BI8 B;  4J7W A;  4OAV B;  2R59 A;  3KSQ A;  4U0S A;  2IO3 C;  2QY7 A;  4UWH A;  2KZT B;  4N5C A;  1N54 A;  2V5Q C;  3JYS A;  3CVU A;  4U95 D;  2QFC A;  4G23 A;  1AWC B;  1NA3 A;  3BQO A;  3DPY A;  2HM8 A;  3ZXS A;  1SQM A;  2XS8 A;  4I1A A;  4UQZ A;  2LAI A;  2HO1 A;  3PZ4 A;  4N2Q A;  2LAH A;  2ZGG A;  2A5U A;  3JUI A;  5FQ6 A;  1D8E A;  2PQR A;  2IFU A;  3UT8 A;  3TWU A;  4L2Y A;  3EHR A;  3HIZ A;  1HXI A;  3Q9U C;  4JXT A;  4K5C A;  4N39 A;  2AWI A;  3PVL A;  4G24 A;  1DCQ A;  1H19 A;  1RZ4 A;  4AJW A;  3R9M A;  3T8K A;  2WXH A;  3AU5 A;  5HS0 A;  2AXV A;  1EDU A;  2OVF A;  3NAW A;  3FY4 A;  3OXL A;  3ZN3 A;  2KC7 A;  1TEZ A;  3FTW A;  1K1B A;  2WXF A;  4OVU A;  3MX3 A;  3E30 A;  1UG3 A;  1JCS A;  5BT1 A;  3J5P A;  1HFA A;  5C2Y A;  3IBE A;  3MKR A;  1WDY A;  4A1G A;  4GZ5 A;  1IXV A;  2XPZ A;  5FTP A;  2LSV A;  4RG9 A;  3EUV A;  2OND A;  3ESK A;  1NA0 A;  3UKR G;  2PNN A;  3HXD A;  5LFA A;  5CMW A;  3Q5M A;  3PZ3 A;  3Q15 A;  3RK6 A;  3FU3 A;  4F6R D;  1N0R A;  3T5V A;  3FUH A;  4I1M A;  3OXG A;  3D9J A;  4DPR A;  5AAR A;  2QZA A;  4F1P A;  3FH8 A;  3IHV A;  2M63 A;  4GA2 A;  5ENN A;  3FWV A;  2H6I A;  4HNA D;  2J08 A;  2OOE A;  2WMN A;  1NP7 A;  3L13 A;  4B89 A;  5AQ9 A;  3I3N A;  3BG1 B;  3MKQ A;  2MOW A;  4M7C A;  4CGW A;  4RSY A;  3C5R A;  5CMY A;  3ONK A;  2J9Q A;  1FT1 A;  4D10 C;  1N4S A;  1G3N B;  5CEA A;  3KAE A;  5CER B;  3SI5 A;  1O1T A;  3G2S A;  5ANR A;  3LCA A;  2XS1 A;  2V0P A;  3BEE A;  3HXF A;  4HLL A;  1BD8 A;  3Q73 A;  2P9N G;  4XKC A;  3QDN A;  4L7T A;  1TNZ A;  2GRQ B;  1QQE A;  4LRZ A;  3SBS A;  5A23 A;  3Q79 A;  2L9B A;  3JXJ A;  3D3M A;  4F53 A;  1H2V C;  2LO6 A;  4IUL A;  3RRN B;  3ZNG A;  4P29 A;  2V4H C;  4KBQ A;  2AJA A;  1KZP A;  5BXO A;  1OWP A;  2FBN A;  4KXK B;  1PAQ A;  5JJ6 A;  5AQB A;  3PH0 C;  2VTB A;  2XGS A;  1NFI E;  3VLE A;  3HXC A;  5AJL A;  5AJD A;  2J09 A;  2ETA A;  4CDM A;  2UY1 A;  3ZXP A;  2OVB A;  2X38 A;  4AY6 A;  2ZXW E;  1DC2 A;  2P9I G;  1P5Q A;  4GU5 A;  2L6B A;  4LNB A;  2BED A;  3UUX A;  1W3B A;  5C1D A;  2XGM A;  4G25 A;  1H6O A;  2R05 A;  2XGO A;  2P9L G;  3VLD A;  1OWL A;  3Q78 A;  3LS8 A;  4JB8 P;  1UW4 B;  5BV1 A;  1TNO A;  1ZB1 A;  3LDZ A;  2DZN A;  4UI9 C;  4JC8 A;  1ELW A;  4UWG A;  5ENT D;  3TXN A;  1ZBP A;  2EIM E;  3IEG A;  3SD5 A;  1WY6 A;  2XCC A;  2B6C A;  2GRN B;  3TWW A;  4ANW A;  4G1T A;  4I2W A;  4BSZ B;  3CHR A;  2UWJ G;  4KYO B;  4BX9 A;  3CHO A;  2L0I A;  4HRM B;  2CG2 A;  5ENP D;  3LXU X;  3QB2 A;  3CVP A;  4KT6 B;  1WG0 A;  4BET A;  4JL0 A;  4I6E A;  3SQV A;  4J0U A;  2R2L A;  3KD7 A;  3SO8 A;  4HRN A;  3TJP A;  3G2V A;  5KJK A;  3HYM B;  4H7X A;  3AAA C;  4NRH B;  2XPI A;  1O1R A;  4FJY A;  1E8Y A;  1E7U A;  3CLJ A;  3E33 A;  1YYH A;  2RKK A;  3MZL B;  5G05 J;  2X6F A;  5E76 A;  4GMR A;  3BU8 A;  4HOR A;  4B8A A;  4U0U A;  4A1S A;  2X6J A;  3PS6 A;  3PE3 A;  4J8Y A;  1HG5 A;  1UJJ A;  4DX7 D;  3ASN E;  4EQF A;  5BPP A;  3CHP A;  4AXH A;  2FF4 A;  3PNT B;  2VYI A;  4ILI A;  2DYR E;  1UOH A;  4I43 A;  5EX0 A;  4KVM A;  4GTM A;  4HI8 A;  4GTV A;  5T3R A;  1OXJ A;  3ZRH A;  3C98 A;  3VTY A;  3AS8 A;  3TWV A;  2Y0B G;  3UX4 A;  4LER A;  5EYP F;  3MGB A;  3Q49 B;  4Q96 A;  1HH8 A;  2WQH A;  4IRU A;  1YA0 A;  3SFX A;  4G8L A;  2A5E A;  2JEK A;  4XIF A;  4M3O A;  5AEN A;  4J8F A;  4Y6C A;  5D0Q D;  2IOL A;  2Q7F A;  2IU1 A;  3SY2 A;  4PS3 A;  4EZL A;  3E32 A;  1OCC E;  3ENE A;  5AQ7 A;  4CDN A;  3W9G A;  3N71 A;  3JUE A;  5BNW A;  3LY9 A;  3U9W A;  4GTS A;  4I17 A;  3D9I A;  3APD A;  2GRL A;  4O1O A;  3UKU G;  2WXL A;  3HG0 D;  1Z6T A;  5FZS A;  1Z5S C;  1E8X A;  2KCL A;  3CHM A;  4EPZ A;  4B94 A;  4HVB A;  3D9P A;  1H6K A;  3FUN A;  5HI7 A;  2XZT G;  1U3C A;  2GW1 A;  3ASD A;  4IYP A;  4AEZ C;  5LP0 A;  5JJ7 A;  4HFG A;  4OVV A;  3V79 K;  2L6J A;  1BLX B;  5E75 A;  1PC2 A;  4HRL A;  4DJA A;  3B7S A;  1MYO A;  2A4Z A;  4N3B A;  3TWS A;  2DVW A;  1XGW A;  1K8K G;  3LVR E;  1YCS B;  3O48 A;  2WMO A;  1FVH A;  4J8S A;  5JHB A;  3ZYM A;  2Y4U A;  3PZ2 A;  4UWK A;  3DWL G;  5FWQ A;  4KZ0 A;  3FEX A;  3AJI A;  2ZU6 B;  3APF A;  3DXM G;  3SZ7 A;  3D9H A;  3FHE A;  5KNG A;  4HS2 A;  4U8Y D;  2J8S D;  4JZY A;  2WM9 A;  4XKB A;  2AW6 A;  3ABL E;  4AV7 A;  4HI9 A;  4U63 A;  3L6A A;  2P2C P;  4X8Q A;  5CED B;  4YDY A;  3PDN A;  3ZHE A;  3FUE A;  2V5F A;  3HVE B;  3EHN A;  5EKQ D;  4G8K A;  4EBA A;  2GRO B;  3LJ3 A;  2LXL A;  3D9N A;  1N4R A;  4FUL A;  4A63 B;  4UQY A;  2ION A;  4E85 A;  3ASG A;  4B8C B;  3S7J A;  5LCW J;  1TJF A;  2KZT A;  2Y3A A;  1KT0 A;  1ELR A;  2ZIR A;  3CVV A;  3QWP A;  4PS7 A;  4YND A;  5T4Y A;  4CDR A;  1NI1 A;  4PS8 A;  4BY6 A;  4HOQ A;  1N4P A;  5AIJ A;  4WUY A;  2FUL A;  4LCT A;  4TXP A;  3RU0 A;  1FPP A;  4GYY A;  1BU9 A;  3SFZ A;  4BSX A;  4EHM A;  1UN9 A;  3GZ2 A;  4U7E B; 
#chains in the Genus database with same CATH homology
 4KBQ A;  5ARG A;  2BTD A;  4G2V A;  3RJV A;  5BV0 A;  2RD0 A;  5JHA A;  2CHW A;  4JEH A;  2IOS A;  2CG3 A;  3FUI A;  4FHK A;  4H7Y A;  1OWP A;  3ZYL A;  2VSX E;  2FBN A;  2GGF A;  1PAQ A;  4KXK B;  1EPU A;  4IN3 B;  5JJ6 A;  5LOZ A;  5CHE E;  4DLO A;  4AM9 A;  4CRW A;  1Y8M A;  2RG8 A;  3FP3 A;  1L5J A;  2VGY A;  3CQC B;  4JPS A;  4EBA G;  3PH0 C;  1ZU2 A;  4JW1 A;  2XGS A;  2WXO A;  2YIN A;  4CT4 A;  2VTB A;  5EDS A;  3CSF A;  2WXM A;  3VLE A;  5AJL A;  5AJD A;  2J09 A;  1IHG A;  3KS2 A;  5ARF A;  3R7Q A;  3UQ3 A;  4CDM A;  2WXK A;  3HDX A;  2C2L A;  3QJZ A;  2UY1 A;  3MV3 B;  5CCL A;  3FEY A;  4FP7 A;  4J6I A;  4JVS A;  2OVB A;  3RIB A;  4F1S A;  2X38 A;  3LEW A;  4AY6 A;  1A17 A;  3ONL A;  2AXU A;  1BPO A;  1GW6 A;  3CVY A;  3CK9 A;  4C0E A;  3ESL A;  5M72 A;  4BWR A;  1P5Q A;  4FJZ A;  4JHR A;  4F3V A;  1U3D A;  4GU5 A;  5T8I A;  4G11 A;  4N3A A;  3UUX A;  1OWM A;  1E7V A;  4MKT A;  2KAT A;  4AP2 A;  1W3B A;  4O6F A;  5C1D A;  3FTY A;  2XGM A;  3UMV A;  4G25 A;  3RRU A;  2XGO A;  4U0Z A;  3ZPJ A;  4CT0 A;  3VLD A;  4K03 A;  3WXX A;  2E0I A;  2WPV A;  1OWL A;  4GB9 A;  2CHZ A;  3LS8 A;  1UW4 B;  5FT9 A;  1JWG A;  3TG4 A;  5BV1 A;  3L16 A;  3S2A A;  4K0R A;  3CHQ A;  4JHJ A;  3CQG B;  3LDZ A;  3SHF A;  3TXM A;  3LY8 A;  3L08 A;  4FA6 A;  2MRI A;  3SF4 A;  4APF A;  4UI9 C;  4JC8 A;  5FZQ A;  1ELW A;  1S0P A;  3G2W A;  4F7A A;  4UWG A;  4ACK A;  1SZA A;  3P1U A;  5J90 A;  3TXN A;  1ZBP A;  3IEG A;  2P58 C;  2VQ2 A;  3SD5 A;  4PDX A;  4GPK A;  3AS5 A;  3LKU A;  3UPV A;  1WY6 A;  2PM7 A;  2XCC A;  2KM4 A;  3DPD A;  3IHY A;  3OAW A;  3MV2 B;  4CGV A;  4MLP A;  2L0T B;  4I9C A;  4ANW A;  2FI7 A;  4G1T A;  4I2W A;  2BUG A;  3CHR A;  3HVE A;  3U64 A;  4E6H A;  3Q47 B;  4XI0 A;  3QOU A;  4B0Z A;  3EIQ C;  2UWJ G;  4KYO B;  4BX9 A;  3CHO A;  3FDH A;  4I1O B;  3AS4 A;  2L0I A;  3ULQ A;  3FTZ A;  3QAR A;  2CG2 A;  3L54 A;  3LVQ E;  3LXU X;  3QB2 A;  4KVO A;  3TGO A;  1E8W A;  2WVI A;  3FTV A;  1LF8 A;  2FO7 A;  2WXN A;  3UT4 A;  1H2T C;  1Z3X A;  4DI3 A;  5HQ8 A;  2R5S A;  3CVP A;  4GCO A;  1IQR A;  2XPY A;  4KT6 B;  1X5B A;  4PUC A;  4APO A;  3ASH A;  5LX8 A;  3AU4 A;  4JL0 A;  4ANX A;  3JCK C;  4I6E A;  4J0U A;  2I1J A;  4Q69 A;  3KD7 A;  1FVF A;  3G2U A;  3TJP A;  5KJK A;  3G2V A;  3HYM B;  1OWN A;  3RO3 A;  4H7X A;  2C0M A;  4CCA A;  1MQS A;  5EX3 A;  4NRH B;  4NAC A;  3U3W A;  5FZR A;  2XPI A;  5KJN A;  3LY7 A;  1HO8 A;  1E8Y A;  2J4B A;  1E96 B;  3ML8 A;  4FJY A;  4HOT A;  3GYZ A;  2Y4T A;  5AYW D;  2WXR A;  4UI9 K;  4AVX A;  3CVX A;  1E7U A;  3CLJ A;  3NZU A;  4YVQ C;  3FUD A;  2PL2 A;  3IV0 A;  4C9B B;  5FQ7 A;  2V8S E;  2OV8 A;  3MZL B;  4GMJ A;  3FUL A;  5G05 J;  1INZ A;  4U04 A;  2XRY A;  2X6F A;  3ZVV A;  2CFU A;  4GML A;  4JA7 A;  3CKB A;  3QAQ A;  4NQ0 A;  2XRZ A;  4WNE A;  5E76 A;  2HR2 A;  4YVO A;  2J49 A;  4I2Z A;  3ZFW A;  4HOR A;  4GAA A;  1DVP A;  1IQU A;  3HHM A;  3EDT B;  3RKV A;  4B8A A;  4J8D A;  2XQ0 A;  3FUF A;  3ZIM A;  4U0U A;  3IKO B;  4A1S A;  2X6J A;  3PS6 A;  3PE3 A;  4L1B A;  1H0A A;  1VDY A;  3GZS A;  3MA5 A;  2VJ8 A;  4R7L A;  4L23 A;  1JUQ A;  2FEZ A;  1HG5 A;  3G2T A;  4AY5 A;  3D9L A;  1UJJ A;  1EF1 C;  3RO2 A;  4AOF A;  3ZYQ A;  4WWO A;  4EQF A;  3I5P A;  5BPP A;  3CHP A;  4AXH A;  2WXP A;  2FF4 A;  4WNF A;  3PNT B;  2R17 C;  3CGH A;  2VYI A;  3QNK A;  4ILI A;  1PY1 A;  4I43 A;  4ABN A;  4GZ6 A;  3S7F A;  5EX0 A;  1TJC A;  4KZC A;  3JQ1 A;  3U66 A;  4KVM A;  2J07 A;  3MYV A;  3R9A B;  3L22 A;  2I9C A;  4BX8 A;  3FU0 A;  5T3R A;  1OUV A;  3D9O A;  2KCK A;  2VGX B;  3PRE A;  4QFV A;  3B13 A;  2IF4 A;  3PUJ A;  5CCM A;  4JEU A;  3MCX A;  3Q4A B;  3ZRH A;  4BT9 A;  2YQ8 A;  3ML9 A;  4ANU A;  4WNG A;  5FQ8 A;  3C98 A;  1JPL A;  3VTY A;  4DI4 A;  3AS8 A;  4NUR A;  3PUK A;  3ZHE B;  3CV0 A;  3NQP A;  3I4G A;  4GCN A;  5ANL A;  4I6G A;  2NSZ A;  2X6H A;  4UI9 J;  4EZK A;  3I4R B;  2WXQ A;  3DBS A;  3CVQ A;  3UX4 A;  4LER A;  4MS6 A;  3MGB A;  3Q49 B;  4Q96 A;  5A7D B;  2LNI A;  3FH7 A;  1DNP A;  4GZC A;  1HH8 A;  2VGX A;  3URZ A;  3PZD A;  2WQH A;  4IRU A;  1KT1 A;  1YA0 A;  3MKQ B;  1OWO A;  2ILR A;  5KJM A;  1FCH A;  3ZW3 A;  4UWL A;  5G04 C;  2NC9 A;  3D9K A;  1JWF A;  3B7R L;  3K9I A;  2R59 A;  4GZD A;  1IYG A;  2JEK A;  4FC8 A;  4U0S A;  4XZ4 A;  4XIF A;  1H2U A;  3FUM A;  4M3O A;  4A3V A;  4A3T A;  2QY7 A;  3ZEF A;  4HXI A;  4UWH A;  5AEN A;  2KZT B;  3U4T A;  5KCM A;  4J8F A;  4Y6C A;  3FU5 A;  3PRZ A;  2VSN A;  2LSU A;  4N5C A;  3QK0 A;  3FTS A;  2PQN A;  1N54 A;  2IOL A;  5D0Q D;  3VTX A;  2Q7F A;  2IU1 A;  3JYS A;  2E2E A;  3CVU A;  2X6K A;  4FHJ A;  4TRQ A;  1HF8 A;  2AVP A;  4PS3 A;  4EZL A;  3BG0 B;  2QFC A;  3E4B A;  4G23 A;  1NA3 A;  3ENE A;  2HM8 A;  2DBA A;  1SQM A;  4I1A A;  4UQZ A;  3CEQ A;  3TAX A;  3ZXS A;  4CDN A;  2CFZ A;  4UWF A;  3N71 A;  2IQC A;  2WB2 A;  2NXP A;  5BNW A;  2JLB A;  2LAI A;  2PM6 A;  2HO1 A;  3R7R A;  3APC A;  3CHS A;  3LY9 A;  1UN8 A;  3S7B A;  4GYW A;  5D0O D;  4N2Q A;  3U9W A;  2LAH A;  4I9E A;  5FJY A;  4I17 A;  3D9I A;  2A5U A;  3APD A;  4TV3 A;  2XCB A;  3JUI A;  2GRL A;  3JQ0 A;  5FQ6 A;  2WXL A;  3CR3 A;  5BW8 C;  4DK5 A;  5LCW C;  1Z6T A;  2PQR A;  5FZS A;  2IFU A;  1Y6I A;  3UT8 A;  4ATG A;  1E8X A;  4L2Y A;  4RG6 A;  2I1K A;  2KCL A;  3CHM A;  4EPZ A;  4HLE A;  4B94 A;  4TUU A;  4Y6W A;  3HIZ A;  1HXI A;  4HVB A;  4JXT A;  3PE4 A;  2EQX A;  3D9P A;  2AWI A;  4N39 A;  3S7D A;  1HE8 A;  1NZN A;  3CK7 A;  3NF1 A;  1H6K A;  3FUN A;  3PVL A;  4G24 A;  4WAF A;  5HI7 A;  4V3I A;  1H19 A;  3TL5 A;  1U3C A;  2GW1 A;  3ASD A;  4AJW A;  3FUK A;  4BT8 A;  3LYA A;  4IYP A;  4HOU A;  4BTB A;  2WXH A;  3CK8 A;  3AU5 A;  4AEZ C;  5LP0 A;  2I2O A;  2AXV A;  5JJ7 A;  4ME2 A;  3O4Z A;  3CST A;  2C0L A;  4HFG A;  1EDU A;  4FLB A;  4OVV A;  2L6J A;  2OVF A;  3FY4 A;  3OXL A;  3FFL A;  5E75 A;  2WXG A;  3TG5 A;  3ZN3 A;  1PC2 A;  3T5X A;  2KC7 A;  1TEZ A;  2VTB B;  1B89 A;  4OYS A;  3FUJ A;  3FTW A;  5J08 A;  4DJA A;  5DBK A;  2AXZ A;  3B7S A;  3T8M A;  2A4Z A;  2WXF A;  4OVU A;  4BTA A;  4DLQ A;  4N3B A;  3MX3 A;  1UG3 A;  5BT1 A;  3GW4 A;  1HFA A;  2UY1 B;  4LEU A;  1XGW A;  5C2Y A;  3IBE A;  1EYH A;  3LVR E;  3MKR A;  4URK A;  3EHM A;  4A1G A;  2VSY A;  1HZ4 A;  3ASF A;  3O48 A;  2WMO A;  5G2N A;  4GA1 A;  4GZ5 A;  1FVH A;  3CKC A;  3FTX A;  1HU3 A;  2XPZ A;  4J8S A;  4U8H A;  5JHB A;  3UT7 A;  1KLX A;  4AIF A;  5FTP A;  2LSV A;  1E8Z A;  4RG9 A;  3ZYM A;  1HG2 A;  2Y4U A;  2WXJ A;  3VLF A;  4HOS A;  2OND A;  4UWK A;  3KEZ A;  4I6J A;  3ESK A;  5FWQ A;  4KZ0 A;  3FEX A;  1NA0 A;  4FLH A;  2PZI A;  3GZ1 A;  4ACL A;  4C0M A;  2ZU6 B;  3APF A;  4MRU A;  3SNX A;  3LPZ A;  5LFA A;  5CMW A;  4L2L A;  3Q5M A;  1HS6 A;  4Q94 A;  4EZJ A;  1UJK A;  3SZ7 A;  1WAO 1;  5G04 J;  3FHE A;  2DCP A;  2YHC A;  3FTU A;  3Q15 A;  4HS2 A;  3RK6 A;  4JZY A;  2X6I A;  3FU3 A;  2WM9 A;  4A55 A;  3L17 A;  3QWW A;  2AW6 A;  4XKB A;  4ANV A;  3T5V A;  4AV7 A;  3FUH A;  4I1M A;  4U63 A;  3OXG A;  5G55 A;  3D9J A;  3QC1 A;  3L6A A;  4JA9 A;  1SZ9 A;  4LUN U;  4DPR A;  3CIA A;  2WQ6 A;  4GZ3 A;  3PDN A;  4W9R A;  4FU3 A;  3ZHE A;  4XI9 A;  2XEV A;  3FH8 A;  3ZYK A;  3IHV A;  3FH5 A;  4XE0 A;  2M63 A;  4CEM A;  2HYZ A;  3FUE A;  2KCV A;  4GA2 A;  2IJG X;  5ENN A;  2V5F A;  1WM5 A;  2YHE A;  3FWV A;  3HVE B;  3EHN A;  5EKQ D;  2J08 A;  3PEV B;  4KMO A;  4EBA A;  1ELK A;  2OOE A;  3ZGQ A;  4GYO A;  2WMN A;  4GA0 A;  2DIW A;  1NP7 A;  2VSO E;  3L13 A;  4B89 A;  3LJ3 A;  4G26 A;  4WND A;  3I3N A;  3BG1 B;  3MKQ A;  3D9N A;  5A6C A;  2MOW A;  4CGW A;  4FUL A;  2GRM A;  4RSY A;  4UQY A;  4FAD A;  3CVN A;  5DIZ A;  2ION A;  4RVB A;  5CMY A;  1Z3Y A;  4E85 A;  1E90 A;  3ONK A;  2J9Q A;  3ASG A;  4N2S A;  3QWV A;  3B7U X;  4D10 C;  2BF0 X;  2X3M A;  3P2B A;  3B7T A;  4J8E A;  4B8C B;  3QKY A;  3KAE A;  3S7J A;  5LCW J;  3SI5 A;  4UQX A;  1TJF A;  3EJN A;  2KZT A;  3OTN A;  2Y3A A;  3G2S A;  1KT0 A;  3NZS A;  4JHK A;  1ELR A;  1N52 A;  4ILG A;  3CVV A;  4ILH B;  3MJW A;  5JJT A;  2XHE A;  3QWP A;  4PS7 A;  2MHK A;  4YND A;  5ANR A;  5BUZ A;  3LCA A;  5T4Y A;  4CDR A;  3SBT B;  4BFR A;  2V0P A;  3BEE A;  3CVL A;  4PS8 A;  2I6H A;  3EIJ A;  4BY6 A;  2CHX A;  4HOQ A;  3PEU B;  5KJL A;  4WWN A;  4EEC A;  4XKC A;  1HX8 A;  3QDN A;  4L7T A;  4U07 A;  4PH4 B;  3SGH A;  5FQ4 A;  5AIJ A;  4LRZ A;  1QQE A;  3SBS A;  4WUY A;  2J4D A;  5A23 A;  2FUL A;  2WXI A;  1MHQ A;  3D9M A;  1QNF A;  2L9B A;  3PNL B;  3MEK A;  4LCT A;  3RU0 A;  2WQ7 A;  3D3M A;  1QZ2 A;  3OXF A;  4F53 A;  1H2V C;  4GYY A;  1XNF A;  2LO6 A;  4IUL A;  2YNQ A;  4N3C A;  3FU6 A;  3SFZ A;  4BSX A;  4WWP A;  1UN9 A;  2V4L A;  5G05 C;  3CVW A;  4XX5 A;  3RRN B;  3GZ2 A;  4P29 A;  3RRM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...