2V5FA

Crystal structure of wild type peptide-binding domain of human type i collagen prolyl 4-hydroxylase.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
97
structure length
97
Chain Sequence
FLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGDLDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKEKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROLYL 4-HYDROXYLASE SUBUNIT ALPHA-1
publication title Crystal Structure of Wild Type Peptide-Binding Domain of Human Type I Collagen Prolyl 4- Hydroxylase.
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 37
structure length 97
sequence length 97
ec nomenclature ec 1.14.11.2: Procollagen-proline 4-dioxygenase.
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2v5fA00
5G05J 4J8DA 4N3CA 5FT9A 1TJCA 2C2LA 5FZSA 2HO1A 3CVNA 1XNFA 3RKVA 3ZFWA 2WPVA 4HORA 4ME2A 2XGMA 3K9IA 5KJLA 5LCWC 3RJVA 4EQFA 1HZ4A 2FEZA 2AVPA 2DBAA 3CKBA 2LSUA 1P5QA 5FZRA 1HXIA 3KS2A 4H7YA 4GYWA 1WM5A 2XCBA 5HI7A 3TAXA 3ZGQA 4N2QA 4UI9J 5BNWA 4HOSA 1NA3A 5D0OD 4G26A 2YQ8A 3KD7A 2VGXB 5A6CA 1ELRA 3U4TA 4N5CA 2OOEA 3NF1A 3IEGA 4WUYA 2C0LA 5C1DA 1YA0A 4KBQA 3PE3A 4IN3B 3ZHEA 4O6FA 3KAEA 3QDNA 4U0UA 3PDNA 3MEKA 2XCCA 3Q15A 4U07A 3MV3B 3VTXA 3ZHEB 3MV2B 4BTAA 4GA0A 2XGOA 2VSYA 3Q47B 3OXGA 3LCAA 3LY8A 2FBNA 4GYYA 1PC2A 4WNFA 4GA1A 2UWJG 2PL2A 4XI9A 3Q5MA 3TGOA 1IHGA 4BT9A 3CEQA 3RO3A 2VGYA 5KJKA 2P58C 2I6HA 2JLBA 2MHKA 3N71A 1WAO1 2IFUA 1W3BA 4NRHB 4APOA 3S7JA 3FP3A 4G24A 2ONDA 3E4BA 2LSVA 3QWPA 3LPZA 5EX0A 4GZ3A 4JL0A 3RO2A 4I9EA 4BT8A 4Y6CA 3ASGA 3QKYA 2Q7FA 4WNGA 1QZ2A 1FCHA 4I9CA 5JJ6A 5G05C 1KT1A 4UQXA 3GZ1A 2VYIA 4KXKB 3QOUA 4U0SA 1A17A 5A7DB 3SF4A 2WQHA 5ARGA 5JJTA 3VTYA 4Y6WA 5FTPA 4G25A 4WNDA 3LY7A 4GYOA 4A1SA 3ESKA 3CVQA 5FZQA 3URZA 3UQ3A 4JA7A 3CKCA 4UQZA 4H7XA 2VSNA 4WNEA 4G23A 1ELWA 1ZBPA 3CVLA 4GA2A 2KC7A 4AIFA 4BTBA 3TG4A 4BWRA 2IF4A 3QWVA 1NZNA 2XEVA 4U04A 3GW4A 4NQ0A 3UPVA 5EKQD 4UI9C 5G04C 2FI7A 1HH8A 5HQ8A 4CDRA 3WXXA 1OUVA 2KCVA 1KLXA 1IYGA 2V5FA 4J8EA 5KJMA 2QFCA 4B94A 4GPKA 3Q49B 2HYZA 3CK9A 2KCLA 2E2EA 2PQRA 1E96B 4CGVA 5JJ7A 5EX3A 1NA0A 2J9QA 3BEEA 3Q4AB 5FJYA 2KATA 3R9AB 4HOQA 4AY6A 4N2SA 3CK8A 2BUGA 3U3WA 4GCNA 2NC9A 5BW8C 3AS8A 4HOTA 2GW1A 3S7DA 4J8FA 4N3BA 4RG6A 4CGWA 4GCOA 4LEUA 3ULQA 3ZN3A 2LNIA 5DIZA 4XIFA 5LCWJ 2FO7A 4RG9A 3RIBA 3GYZA 4W9RA 3AS5A 3CK7A 2Y4TA 3ASFA 3AS4A 3QWWA 2PZIA 3GZ2A 4I1AA 2FF4A 5CCLA 2L6JA 3FWVA 3ASHA 3UUXA 4UQYA 2R5SA 4HOUA 3FFLA 4JA9A 4G1TA 5M72A 2C0MA 3S7BA 2XGSA 4ABNA 2PQNA 4I2WA 3LYAA 4KYOB 4AM9A 2UY1A 4J0UA 4F3VA 3ASDA 3MKRA 4I17A 5CHEE 2VGXA 2UY1B 4AY5A 2HR2A 3O48A 2Y4UA 3EDTB 3TG5A 3SZ7A 5G04J 3MA5A 3S7FA 3HYMB 1ZU2A 1B89A 2KCKA 1KT0A 3RU0A 4JHRA 3PE4A 5DBKA 4G2VA 4YNDA 3ZPJA 4YVQC 2VQ2A 5D0QD 3CV0A 4U0ZA 2XPIA 4N3AA 5AYWD 1Y8MA 5ARFA 2YHCA 4N39A 1QQEA 4YVOA 3OXLA 3OXFA 4I2ZA 4XI0A 4UI9K 4GZ5A 5CCMA 3LKUA 3LY9A 3CVPA 5BT1A 3JYSA 4GZ6A 5KJNA
chains in the Genus database with same CATH superfamily
5G05J 2ETAA 2IOLA 3KSLA 1DC2A 5KCMA 2HO1A 3I5PA 3QB2A 1YCSB 1UJKA 3QC1A 3JQ1A 2PNNA 4QQIA 4Q69A 4DUIA 4A63B 4CEMA 4B8AA 3K9IA 1O1SA 3LXUX 3RJVA 4EQFA 2AVPA 2JEKA 3CHSA 4XE0A 1O1RA 3T9KA 4HI8A 4FJZA 3MX3A 2WXQA 4H7YA 1MQSA 4GYWA 4U8HA 2EIKE 5B1BE 3FULA 4GTSA 3B7SA 2FULA 5KBAA 3EJNA 5EIDA 3SQVA 1H6KA 4G26A 4J8YA 4FC8A 3KD7A 2DZOA 4ANVA 1N94A 1OWMA 3Q9UC 4GTMA 3E37A 2MRIA 4KVOA 2QC9A 5KNGA 3TWTA 5ANRA 4XZ4A 3ZHEA 3TWUA 1Z3YA 3C3QA 3AJIA 1TR4A 2XCCA 3Q15A 4K5CA 3VTXA 3CQCB 3ZHEB 3MV2B 1MX2A 3FDHA 2VSOE 2VSYA 4U8VD 3Q47B 4BESA 3NAWA 1OT8A 3OXGA 4JPSA 4EECA 3LCAA 5ENQD 4WNFA 1FVFA 2PL2A 4LERA 4XI9A 3X2QE 2V5QC 1OWLA 3V2XA 5KJKA 1INZA 5JA4D 3ZXPA 1WAO1 3SBSA 3E4BA 4U96D 1UN9A 2DVWA 5EX0A 4JL0A 3UM1A 4I9EA 1OXJA 1TNZA 3PRZA 4AEZC 5EDSA 4PS8A 3V31A 4APFA 1JCSA 3NB2A 1FCHA 3APCA 1KZPA 3ZXSA 1KT1A 2VYIA 1SQMA 5BXUA 5A23A 1IKND 4KXKB 3QOUA 1A17A 3HXFA 3ULEG 4OAVB 2CG3A 3ZKJA 3ZVVA 1RW2A 4GTVA 3G2SA 2VJ8A 3CVQA 3L13A 3C72A 2R02A 5FWQA 2YHEA 4JA7A 2EIJE 5T4YA 4FLHA 4UQZA 4BX9A 3MCXA 4EZJA 2GRLA 2OEVA 3SY2A 4OVVA 4FU3A 3PUJA 4IYPA 3ISMC 1NZNA 5BV0A 3SFZA 4HFGA 5EKQD 4UI9C 2OCCE 1ZB1A 4O1PA 1N95A 1HFAA 3QARA 3HXEA 4E6HA 5KWDA 3WXXA 2I9CA 1SVXA 4XEIG 2KCVA 1KLXA 3FTSA 1IYGA 2KM4A 3UKUG 4L2YA 4EPZA 4J8EA 5KJMA 3HDXA 3DXKG 1S0PA 3AG2E 1OWPA 2KCLA 1TN8A 4CGVA 1VDYA 2J4DA 4U95D 2J9QA 5AQ7A 4DX5D 2BF0X 4K5BA 3ENEA 2I1JA 3U3WA 4GCNA 4DPRA 2NC9A 1AWCB 2V4HC 2OVBA 2WXIA 3AS8A 5CMWA 4J8FA 3D9MA 4RG6A 3CVVA 2CG2A 3DEOA 2GROB 5DIZA 4XIFA 3CVUA 2YNQA 2E0IA 2FO7A 4RG9A 5LP0A 4LNUD 2GRQB 3HHMA 3PZ4A 2RFMA 3G2TA 3AS4A 4I1AA 4R7LA 2L6JA 2J07A 5AARA 3P1UA 3PNLB 1SA4A 1K1BA 3NQPA 3ZYMA 3FTVA 5ENNA 3DSTA 3FU3A 3ASHA 4WWNA 1EYHA 4BSZB 3UTMA 3DBSA 4JA9A 4GTRA 4KVMA 4JD2G 3DEPA 4ABNA 1DCQA 4EHMA 2WXRA 1LD7A 5AQ9A 2VGXA 4U8YD 2Y4UA 4GAAA 4GTTA 3SZ7A 4F1PA 4U63A 3UXGA 2XZDG 5KNHD 1B89A 1SZAA 1DNPA 1TNYA 4TUUA 2NXPA 3FTZA 3FTYA 2V4LA 3UM2A 4JHRA 3PE4A 1PY1A 2XPZA 1NP7A 3ULYA 1IHBA 1OCRE 2VQ2A 4DX2A 3CSFA 2V8SE 1IQUA 4L23A 5AYWD 4N3AA 3DSSA 3T8MA 3R7QA 3CVYA 2CHZA 4B89A 1H2TC 4HBDA 5AN8A 3UT8A 2BKKB 3U9WA 3PVLA 3LY9A 3HRAA 4XKCA 1AP7A 3JYSA 1LF8A 3FUDA 5KJNA 2B0OE 1N9AA 3PREA 2C2LA 2IU1A 1H6PA 3FUNA 2NSZA 1SW6A 4BY6A 4WAFA 3TWSA 1XNFA 5G2NA 4ME2A 1HE8A 4J8SA 2XS1A 4JXTA 2ZU6B 4TXRA 4HRMB 2DBAA 3CKBA 1UOHA 2VTBB 4JHJA 4D10C 4JHKA 1N0RA 4GTQA 2XEHA 5HI7A 2BKGA 1LTXA 4UWLA 3TAXA 4DI4A 4N2QA 5ITZF 2RD0A 5D0OD 2YQ8A 5T3RA 4L9PA 1Y6IA 5A6CA 5CERB 4KMOA 1E8WA 4N5CA 5C1DA 3PE3A 4IN3B 3E32A 4O6FA 3KAEA 5ENRD 3BG0B 3ZYKA 3IKOB 4BX8A 3UX4A 3MEKA 4Z68A 1WY6A 2XGOA 1FT1A 3FEYA 4MKTA 2P2CP 4MS6A 4PH4B 4QFVA 4AOFA 3LY8A 1PC2A 2OEWA 3C3OA 4BT9A 3CEQA 3RO3A 4I43A 4X8QA 2AJAA 1N4SA 2P58C 4G8LA 2I6HA 3PZ3A 3N71A 3FUFA 3CHQA 2IFUA 4NRHB 4APOA 1DCEA 5FQ4A 2ONDA 3VLDA 3FH5A 3B95A 4GZDA 1JWGA 3LPZA 2AW6A 5B1AE 4HS2A 1H2VC 2R03A 1OWOA 3ASGA 5AJLA 5B3SE 1QZ2A 4HVBA 4C0MA 4GB9A 3SNXA 2L0TB 5G05C 3EU9A 1PAQA 1HF8A 3B7RL 3ML9A 2Y1LE 5LFAA 1WG0A 3BG1B 4U0SA 2VGEA 3L9TA 3HG0D 4GMJA 3F6QA 3VTYA 4Y6WA 4G25A 2XS8A 4WNDA 4A1SA 4ATGA 5BUZA 5FZQA 1JPLA 3B7BA 1O1TA 4GZCA 1BI8B 3OTNA 4GMLA 3T8KA 4RVBA 2H6HA 1UG3A 3ZW3A 5CEDB 2VSNA 3ML8A 2ZXWE 3JUEA 4I1MA 3DXMG 2P9UG 1ZBPA 3UKRG 4PDXA 2HE0A 2LAIA 2R17C 1IQRA 2XRYA 3HVEA 3UIPC 2IF4A 3QWVA 3DSXA 1H2UA 4CZ2D 2XEVA 4U04A 3GW4A 3HVEB 4CDMA 1K3ZD 2EINE 3FY4A 5G04C 3RRUA 2F37A 4CDRA 2DIWA 3S2AA 3TWXA 1FVHA 4DX7D 4UWKA 2WQ7A 1MX4A 2V5FA 4L2LA 4NURA 3JQ0A 3QJZA 4B94A 5FINA 4FHJA 5AENA 3AU4A 3PNTB 2J09A 5J08A 3L82A 2PQRA 1E96B 4HLEA 1QYMA 2DYRE 3SFXA 5EX3A 5JJ7A 2R2LA 3Q4AB 3IHYA 3E30A 3TJPA 1OCZE 3PZ2A 3V30A 4AY6A 3RAUA 2XHEA 4HNAD 4LCTA 5AIJA 3L08A 3D9PA 3HXBA 1O5MA 4N3BA 4CGWA 4GCOA 5H7PA 1D8DA 2LNIA 1JCQA 3FH7A 3D9HA 5LCWJ 2GGFA 5FQ8A 3RIBA 3GYZA 4GPMA 2Y4TA 1HS6A 3CQGB 3ZYQA 3RRMB 3GZ2A 2FF4A 2QYUA 4LNGA 2OVFA 4FLBA 4JVSA 4O1OA 3HXCA 3FH8A 1GW6A 4UUCA 2KXPC 2ZIRA 2HM8A 2CFUA 2GRRB 5D66A 4I2WA 3LYAA 4KT6B 3KEAA 3NZSA 3ASDA 1S63A 3ASNE 3CHMA 3OAWA 4I17A 5CHEE 5FQ7A 1S70B 2DYSE 4AY5A 3SO8A 3ABLE 3O48A 1YMPA 2H6IA 3MA5A 4NACA 1E90A 2NYJA 3LJ3A 3SFYA 2KCKA 4ILGA 2DWZA 4XKBA 3AU5A 3IV0A 1ELKA 3FTXA 2MOWA 3ZPJA 2AXZA 4YVQC 5CECB 2ZISA 5D0QD 1S64A 2IJGX 2WXFA 2X6HA 5EIBE 3AAAC 1Y8MA 1L5JA 4HI9A 4GU5A 5ARFA 3SHFA 4N39A 3TL5A 1QQEA 3OXLA 3I4RB 1D9SA 4XI0A 4UI9K 1OCCE 3HIZA 2GRNB 4GZ5A 2H6FA 3LKUA 4TUMA 1MYOA 4G11A 4ANWA 4ACKA 4J8DA 4N3CA 5FT9A 1TJCA 3FUJA 5FZSA 4ZFHA 3CVNA 1Z3XA 2XRZA 3RKVA 2WPVA 2LXMA 5EYLA 3PEUB 2XENA 2XGMA 4B93B 4URKA 2IO3C 1HZ4A 3FHEA 5HS0A 2QY7A 3AG1E 1P5QA 5FZRA 2X6JA 4B8CB 1WM5A 3DRAA 4KZ0A 4UWFA 1H0AA 3Q9NC 2AXUA 3UI2A 3D9IA 3PZDA 3TWRA 3ZGQA 5BNWA 3JXJA 4HOSA 4BERA 2PM6A 4MRUA 1G3NB 2VGXB 3APDA 3O4ZA 5JMND 3U4TA 4M7CA 4JEHA 3V2OA 3NF1A 3IEGA 2C0LA 3LVQE 4KBQA 5AAOA 3U66A 2DCPA 4F7AA 4JZYA 3QDNA 4U0UA 3PDNA 3UINC 2BEDA 1U2VG 3W9FA 4GA0A 2KZTA 4DX6D 2QYJA 4GYYA 4GA1A 2UWJG 2KZTB 3EHQA 3Q5MA 4CRWA 2IONA 3ABME 1QBQA 1UW4B 2F0YA 3ZIMA 4B0ZA 1W3BA 1TJFA 3S7JA 3AG3E 4GZ3A 3RO2A 2IY0C 4ZHBA 4TXQA 3CHOA 2WXKA 5CMYA 3QKYA 3ZEFA 2Q7FA 4WNGA 2ETBA 4K03A 3QAQA 1WDYA 1RZ4A 3KSQA 3NZUA 5JJ6A 2M63A 4WWPA 4C0EA 3DSVA 4UQXA 3UIOC 1E7UA 3NOCD 4FULA 2V0PA 2X6IA 2X6FA 3NOGD 3SF4A 1BI7B 3Q79A 3LEWA 5FTPA 5E75A 1QNFA 4OYSA 3TWQA 4K5AB 1TNUA 3EIQC 3L16A 5CBOA 3B7UX 3CKCA 4HB5A 3P2BA 2WQ6A 4H7XA 3GZSA 1MJ0A 3LS8A 4G23A 3CVWA 4CYMD 2AXVA 2XPYA 5EILA 4J6IA 3CVLA 5ENPD 4GA2A 2KC7A 4AIFA 4XX5A 1BU9A 3HXDA 3TG4A 3PEVB 1SZ9A 4BETA 4NQ0A 4LNBA 3UPVA 5LOZA 3D9LA 3KEZA 3B7TA 4EBAA 2L9BA 2FI7A 4ILIA 5HQ8A 1HX8A 5EN5D 4PS3A 1TNOA 1OUVA 4BEPA 1TN7A 5AJDA 2QFCA 2BTDA 2P9NG 2OV8A 2WXHA 4GPKA 2WVIA 3UM3A 4K0RA 2HYZA 2Y3AA 5G55A 2E2EA 2KBXA 3ZYLA 4ANXA 3DSUA 4A3VA 3Q7AA 3BEEA 2KATA 4V3IA 1JUQA 4HOQA 1X81A 3JUIA 3CK8A 3SI5A 2BUGA 4E85A 5HKPA 2JABA 4I6JA 4Q96A 4HOTA 2GW1A 3S7DA 2GRPB 2L0IA 3ULQA 3SGHA 3ZN3A 3FEXA 1E8YA 3J5PA 1UJJA 3W9GA 4W9RA 3AS5A 2I1KA 3ASFA 1EDUA 4WWOA 5CCLA 3FWVA 1H6OA 1HU3A 5EYPF 3CIAA 3FFLA 1NL4A 4TXPA 4BSXA 4EZLA 2C0MA 3LJNA 5ENOD 3UM0A 2XGSA 2PQNA 3R7RA 1MHQA 2UY1A 1KPSB 3RK6A 4Q94A 3MKRA 3EHRA 4LUNU 4AJWA 2A5UA 2UY1B 2HR2A 3FUKA 3FU6A 4DJAA 4MBGA 3ABKE 4OAUC 1V55E 3EDTB 3LVRE 3TG5A 3MKQA 5G04J 5CRUA 1U3CA 3HYMB 3PUKA 1ZU2A 4HQDA 4UWHA 2IQCA 1KT0A 3RU0A 2WM9A 3TXMA 3MKQB 4FHKA 5DBKA 4G2VA 1JWFA 2FO1E 3FUHA 4YNDA 4EZKA 2B6CA 3G2WA 1N11A 4P29A 4F53A 2X3MA 2P9PG 2RFAA 3RRNB 3TXNA 3CV0A 2WB2A 2XPIA 3MYVA 2P9IG 3Q7FA 4RQIA 1TNBA 2ZGGA 4DLOA 3DWLG 3ASOE 1NFIE 4YVOA 4AXHA 3C3RA 3L6AA 3BQOA 1BLXB 4ANUA 3DPDA 4MLPA 1BPOA 2LXLA 3FUEA 4FADA 4C48B 1DVPA 4G8KA 3CVPA 3ZNGA 4GZ6A 1E7VA 3PS6A 2WXMA 4YDEA 2I2OA 3DSWA 1EF1C 3Q78A 1TN6A 4JEUA 1Z6TA 3NBNB 4CT4A 3G2VA 4HORA 3ZFWA 1X5BA 2AWIA 1HO8A 1LD8A 3G2UA 3WG7E 5KJLA 5LCWC 3T5XA 4TRQA 5CRVA 4C9BB 4BFRA 2FEZA 4A1GA 3FUMA 2LSUA 5BXOA 3FUIA 4HXIA 3D9JA 1HXIA 3UT7A 2WMNA 5AQAA 1V54E 4HLLA 2A5EA 3KS2A 3ONLA 5BV1A 2XCBA 5J90A 4F6RD 1U3DA 2QZAA 3R9MA 2Y69E 3I4GA 5AQBA 2XQ0A 3ONKA 4UI9J 2ETCA 4LG6A 1NA3A 4L7TA 3C98A 1ELRA 2F8YA 5C2YA 3SBTB 4U7EB 3UMVA 1OCOE 4O60A 3CR3A 4PS7A 2OOEA 4N5QA 4OVUA 4WUYA 1YA0A 2WXJA 4ACLA 2H6GA 3ZU7B 4U07A 4FP7A 3MV3B 1YYHA 5T8IA 4BTAA 3TWWA 3VLEA 2FBNA 3VLFA 1NI1A 4A3TA 3EHMA 4LSZE 2ILRA 3UT4A 2WXLA 3QK0A 3TGOA 1IHGA 4NIKA 2VGYA 4AVXA 2JLBA 2MHKA 4AP2A 4I1OB 3FP3A 4G24A 3CHRA 5HRYA 1N54A 2LSVA 3QWPA 1XGWA 2LO6A 5FQ6A 3PH0C 4BT8A 1OWNA 1H19A 4Y6CA 4JC8A 1KZOA 1EPUA 3U64A 3EHNA 2L6BA 1N4QA 3Q73A 3D9OA 4I9CA 4AV7A 3GZ1A 3PZ1A 2XZTG 2RG8A 4A55A 5A7DB 1Q2ZA 4M3OA 1K1AA 2WQHA 3CLJA 1JCRA 5ARGA 3QNKA 5JJTA 4DX1A 3LY7A 4GYOA 1IXVA 3ESKA 5JHBA 3URZA 5JHAA 3RSEG 3UQ3A 4DI3A 5E76A 3CGHA 4WNEA 1ELWA 1BD8A 2YINA 3D9NA 5ENTD 3FTUA 4GTOA 2R59A 3E33A 4BTBA 4GTPA 4BWRA 3LDZA 2LUHA 2J08A 3CSTA 3E34A 1E8ZA 5IY5E 2EILE 1K8KG 4HRLA 4CT0A 2J8SD 3ZRHA 2XEEA 4PUCA 1HH8A 2X38A 4I6GA 2IOSA 2ZGDA 1OY3D 3C5RA 2X6KA 1UN8A 4TV3A 3FU5A 1HG2A 3I3NA 4F1SA 5ANLA 4DLQA 4L1BA 4J7WA 3DPYA 3Q49B 3CK9A 1NA0A 2LAHA 2IEJA 2PM7A 4DK5A 5FJYA 1D8EA 3R9AB 4RLYA 3T5VA 4KZCA 4N2SA 1FT2A 3JCKC 2J49A 4ILHB 5BW8C 2WXPA 4FJYA 4GMRA 4CCAA 1Z5SC 2WMOA 4FA6A 4YDYA 4LEUA 3IXEA 3TWVA 3ZUVB 3B13A 5LX8A 3L54A 2CHXA 1TYQG 5D2MC 2P9KG 3D3MA 3CK7A 4YDOA 5FIOA 3V79K 1FPPA 2P9SG 3IBEA 2EQXA 2F8XK 3MZLB 3QWWA 2PZIA 4UWGA 4JW1A 1A5EA 2R05A 4IRUA 2VTBA 3AG4E 2GRMA 4DRXE 4EBAG 3UUXA 4UQYA 2R5SA 4HOUA 4I6EA 4G1TA 5M72A 3S7BA 3J5QB 3JXIA 4KYOB 3BUAA 4AM9A 4HRNA 4J0UA 4F3VA 3ESLA 2WXNA 4JB8P 2CHWA 2DZNA 5CBNA 3IHVA 2A4ZA 1HG5A 2VSXE 4IULA 3S7FA 3L17A 1MX6A 5ENSD 2MYOA 2EIME 3L22A 3Q75A 1N4PA 2Y0BG 1TEZA 2WXGA 1N52A 1MZCA 5CEAA 2WXOA 2RKKA 4U0ZA 1N4RA 1E8XA 3MGBA 3FTWA 4LRZA 2YHCA 2IO2C 3FU0A 2J4BA 3OXFA 4I2ZA 3MJWA 5BPPA 3CVXA 3EU5A 3BU8A 4ATZD 3APFA 3D9KA 1SA5A 1N0QA 4RSYA 2CFZA 3EUVA 5CCMA 4CDNA 4YDWA 2P9LG 5BT1A 3EIJA 3SD5A 3CHPA
chains in the Genus database with same CATH topology
5G05J 4ACKA 4J8DA 2IOLA 2WXMA 4N3CA 3PREA 2I2OA 5FT9A 1TJCA 2C2LA 2IU1A 3FUJA 5FZSA 5KCMA 1EF1C 2HO1A 3FUDA 3FUNA 4JEUA 5KJNA 2NSZA 1Z6TA 3I5PA 3QB2A 4BY6A 1UJKA 3QC1A 4CT4A 3CVNA 3G2VA 4WAFA 1Z3XA 2XRZA 1XNFA 3JQ1A 3RKVA 2WPVA 5G2NA 4ME2A 3ZFWA 1HE8A 4J8SA 4HORA 1X5BA 4Q69A 2AWIA 1HO8A 3G2UA 2XGMA 3PEUB 4CEMA 4B8AA 3K9IA 4JXTA 4URKA 5KJLA 5LCWC 2ZU6B 3T5XA 3LXUX 3RJVA 4TRQA 4EQFA 4C9BB 1HZ4A 4BFRA 2FEZA 2AVPA 2DBAA 2JEKA 3CKBA 3FHEA 4A1GA 3CHSA 3FUMA 4XE0A 2LSUA 2VTBB 2QY7A 4JHJA 4D10C 4FJZA 3FUIA 4HXIA 3D9JA 1P5QA 5FZRA 1HXIA 4JHKA 3UT7A 3MX3A 2WMNA 2X6JA 4B8CB 2WXQA 3KS2A 4H7YA 1MQSA 4GYWA 3ONLA 1WM5A 4KZ0A 2XCBA 5BV1A 5J90A 4UWFA 1H0AA 1U3DA 5HI7A 4U8HA 3FULA 2AXUA 3D9IA 3I4GA 4UWLA 3PZDA 3B7SA 3TAXA 2FULA 4DI4A 3ZGQA 2XQ0A 3ONKA 4UI9J 4N2QA 5BNWA 3EJNA 4HOSA 2PM6A 1H6KA 2RD0A 4MRUA 1NA3A 5D0OD 4G26A 2YQ8A 4FC8A 5T3RA 3KD7A 4L7TA 2VGXB 3APDA 4ANVA 3C98A 1Y6IA 3O4ZA 5A6CA 1ELRA 5C2YA 1OWMA 3SBTB 3UMVA 4KMOA 1E8WA 4N5CA 2MRIA 3CR3A 3U4TA 4PS7A 2OOEA 4JEHA 4OVUA 3NF1A 4KVOA 3IEGA 4WUYA 2C0LA 5C1DA 1YA0A 3LVQE 5ANRA 4KBQA 3PE3A 2WXJA 4IN3B 4ACLA 4XZ4A 3ZHEA 3U66A 2DCPA 4F7AA 4JZYA 4O6FA 1Z3YA 3KAEA 3BG0B 3ZYKA 3QDNA 4U0UA 3IKOB 4BX8A 3UX4A 3PDNA 3MEKA 2XCCA 3Q15A 4FP7A 3MV3B 4U07A 3VTXA 3CQCB 5T8IA 3ZHEB 3MV2B 4BTAA 4GA0A 1WY6A 2XGOA 2KZTA 3FDHA 2VSOE 3FEYA 2VSYA 4MKTA 3VLEA 3Q47B 3OXGA 4MS6A 4JPSA 4PH4B 3LCAA 4QFVA 4AOFA 3LY8A 2FBNA 4GYYA 4EECA 1PC2A 4WNFA 1FVFA 4GA1A 2UWJG 2PL2A 3VLFA 4LERA 2KZTB 4A3TA 4XI9A 3EHMA 3Q5MA 4CRWA 2ILRA 2IONA 3UT4A 2WXLA 3QK0A 1OWLA 3TGOA 1IHGA 4BT9A 3CEQA 3RO3A 4I43A 2VGYA 5KJKA 1INZA 1UW4B 2P58C 2I6HA 4AVXA 2JLBA 2MHKA 3ZIMA 3N71A 1WAO1 3FUFA 4B0ZA 3CHQA 3SBSA 2IFUA 1W3BA 1TJFA 4NRHB 3S7JA 4AP2A 4APOA 4I1OB 3FP3A 4G24A 5FQ4A 3CHRA 2ONDA 3E4BA 3VLDA 3FH5A 1UN9A 1N54A 4GZDA 1JWGA 2LSVA 1XGWA 3LPZA 3QWPA 5EX0A 2LO6A 2AW6A 5FQ6A 4GZ3A 4JL0A 3RO2A 4I9EA 4HS2A 3PH0C 1H2VC 4BT8A 1OWNA 1H19A 4Y6CA 4JC8A 1OWOA 1EPUA 3U64A 3CHOA 2WXKA 5CMYA 3ASGA 3QKYA 5AJLA 3ZEFA 2Q7FA 3PRZA 4WNGA 4AEZC 4K03A 5EDSA 3QAQA 1QZ2A 4PS8A 3EHNA 4APFA 4HVBA 4C0MA 3D9OA 1FCHA 3APCA 4I9CA 4AV7A 4GB9A 3SNXA 3NZUA 5JJ6A 2L0TB 5G05C 2M63A 1PAQA 3ZXSA 4WWPA 1HF8A 4C0EA 1KT1A 3B7RL 3GZ1A 4UQXA 1E7UA 2VYIA 1SQMA 4FULA 3ML9A 5LFAA 2V0PA 2X6IA 2X6FA 5A23A 4KXKB 2RG8A 3BG1B 3QOUA 4A55A 4U0SA 1A17A 5A7DB 4M3OA 3SF4A 2WQHA 2CG3A 3CLJA 5ARGA 4GMJA 3QNKA 3ZVVA 5JJTA 3VTYA 4Y6WA 3LEWA 5FTPA 4G25A 3G2SA 4WNDA 3LY7A 4GYOA 4A1SA 5E75A 4ATGA 2VJ8A 3ESKA 5BUZA 1QNFA 5JHBA 3CVQA 3L13A 5FZQA 1JPLA 4OYSA 4GZCA 5FWQA 3URZA 3EIQC 3OTNA 5JHAA 4GMLA 2YHEA 3L16A 3UQ3A 4RVBA 4JA7A 3B7UX 3CKCA 5T4YA 3P2BA 4FLHA 4UQZA 2WQ6A 4H7XA 1UG3A 3GZSA 4BX9A 3LS8A 3MCXA 3ZW3A 4DI3A 2VSNA 3ML8A 5E76A 3CGHA 4I1MA 4WNEA 4G23A 4EZJA 3CVWA 1ELWA 2AXVA 1ZBPA 2XPYA 4J6IA 3CVLA 4PDXA 2LAIA 2YINA 3D9NA 4GA2A 2R17C 2KC7A 4AIFA 1IQRA 4XX5A 2GRLA 3FTUA 2XRYA 3HVEA 2R59A 4BTBA 4OVVA 3TG4A 4FU3A 2IF4A 4BWRA 3PUJA 3PEVB 4IYPA 3QWVA 1NZNA 1SZ9A 3LDZA 1H2UA 2XEVA 2J08A 4U04A 5BV0A 3GW4A 4NQ0A 3SFZA 4HFGA 3HVEB 3UPVA 3CSTA 5EKQD 4UI9C 1E8ZA 5LOZA 4CDMA 3D9LA 4CT0A 3KEZA 3ZRHA 4PUCA 1HFAA 3QARA 3B7TA 3FY4A 2L9BA 5G04C 4E6HA 2FI7A 4ILIA 4EBAA 3RRUA 1HH8A 5HQ8A 1HX8A 4CDRA 3WXXA 2DIWA 2I9CA 2X38A 4I6GA 4PS3A 2IOSA 1OUVA 3S2AA 2KCVA 1KLXA 3FTSA 1IYGA 2KM4A 1FVHA 4UWKA 2WQ7A 4L2YA 2X6KA 2V5FA 4EPZA 1UN8A 4J8EA 4TV3A 3FU5A 5KJMA 5AJDA 4L2LA 2QFCA 1HG2A 3I3NA 4NURA 2BTDA 3JQ0A 5ANLA 4DLQA 4F1SA 3HDXA 4L1BA 3QJZA 2OV8A 1S0PA 4B94A 2WXHA 4GPKA 2WVIA 4FHJA 5AENA 4K0RA 1OWPA 3AU4A 3PNTB 2J09A 5J08A 3Q49B 2HYZA 2Y3AA 3CK9A 2KCLA 5G55A 2E2EA 2PQRA 3ZYLA 1E96B 4ANXA 4HLEA 4CGVA 5JJ7A 5EX3A 1NA0A 1VDYA 2J4DA 4A3VA 2LAHA 2J9QA 2PM7A 4DK5A 3BEEA 3Q4AB 5FJYA 3IHYA 2KATA 4V3IA 3R9AB 3TJPA 1JUQA 4HOQA 1LF8A 4AY6A 2BF0X 3T5VA 3JUIA 4KZCA 4N2SA 2XHEA 3CK8A 3SI5A 3JCKC 2BUGA 4E85A 2J49A 3ENEA 4ILHB 2I1JA 3U3WA 4GCNA 4DPRA 2NC9A 4LCTA 5BW8C 5AIJA 2OVBA 2WXPA 2WXIA 3AS8A 4I6JA 4FJYA 4Q96A 4HOTA 4CCAA 5CMWA 2GW1A 3S7DA 4J8FA 3L08A 3D9PA 3D9MA 4N3BA 4RG6A 4CGWA 2WMOA 4FA6A 3CVVA 4GCOA 4LEUA 2L0IA 3ULQA 3SGHA 2CG2A 3ZN3A 3FEXA 2LNIA 5DIZA 1E8YA 4XIFA 3CVUA 1UJJA 3FH7A 2YNQA 3B13A 5LCWJ 2GGFA 5LX8A 2E0IA 2FO7A 4RG9A 3L54A 2CHXA 5FQ8A 3RIBA 5LP0A 3GYZA 4W9RA 3D3MA 3AS5A 3CK7A 2Y4TA 1HS6A 3CQGB 2I1KA 3HHMA 3IBEA 2EQXA 3ASFA 3G2TA 3MZLB 3AS4A 3QWWA 1EDUA 2PZIA 4WWOA 4UWGA 4JW1A 3ZYQA 3RRMB 3GZ2A 4I1AA 2FF4A 5CCLA 4R7LA 2L6JA 2J07A 4IRUA 3P1UA 3PNLB 3FWVA 1HU3A 2VTBA 3NQPA 3ZYMA 3FTVA 5ENNA 2GRMA 3FU3A 2OVFA 3ASHA 4FLBA 4WWNA 4EBAG 1EYHA 4JVSA 3UUXA 4UQYA 2R5SA 4HOUA 3DBSA 3CIAA 3FH8A 3FFLA 4I6EA 4BSXA 1GW6A 4G1TA 4JA9A 4EZLA 4KVMA 2C0MA 5M72A 3S7BA 2HM8A 2CFUA 2XGSA 4ABNA 2PQNA 3R7RA 4I2WA 1MHQA 3LYAA 4KYOB 2WXRA 4AM9A 4KT6B 2UY1A 4J0UA 4F3VA 3NZSA 3RK6A 4Q94A 3ASDA 3MKRA 3ESLA 2WXNA 3CHMA 3OAWA 4I17A 4LUNU 5CHEE 5FQ7A 2VGXA 4AJWA 2A5UA 2UY1B 2CHWA 4AY5A 2HR2A 3FUKA 3FU6A 4DJAA 3IHVA 2A4ZA 3O48A 1HG5A 2Y4UA 3EDTB 4GAAA 3LVRE 3TG5A 3SZ7A 2VSXE 3MKQA 5G04J 3MA5A 1U3CA 4IULA 3HYMB 3PUKA 4U63A 1ZU2A 3S7FA 3L17A 4NACA 1E90A 3LJ3A 1B89A 1SZAA 4UWHA 2IQCA 1DNPA 2KCKA 4TUUA 3L22A 1KT0A 2NXPA 4ILGA 3RU0A 2WM9A 3FTZA 3FTYA 3MKQB 3TXMA 2V4LA 4FHKA 4JHRA 3PE4A 5DBKA 4G2VA 1JWFA 4XKBA 1TEZA 1PY1A 2WXGA 3AU5A 3FUHA 4YNDA 3IV0A 1N52A 4EZKA 1ELKA 3G2WA 2XPZA 2WXOA 1NP7A 4P29A 3FTXA 2MOWA 3ZPJA 2AXZA 4YVQC 2VQ2A 4F53A 3CSFA 2X3MA 5D0QD 3RRNB 2V8SE 3TXNA 3CV0A 2IJGX 2WXFA 2WB2A 2X6HA 1IQUA 4L23A 4U0ZA 2XPIA 4N3AA 3MYVA 1E8XA 5AYWD 3R7QA 3MGBA 3T8MA 1Y8MA 1L5JA 3CVYA 4DLOA 4GU5A 5ARFA 2CHZA 3SHFA 3FTWA 4B89A 4LRZA 2YHCA 4N39A 3TL5A 1QQEA 4YVOA 3FU0A 2J4BA 3I4RB 1H2TC 3OXLA 3OXFA 4I2ZA 3MJWA 4AXHA 5BPPA 3CVXA 3L6AA 3APFA 4XI0A 4UI9K 3D9KA 4ANUA 4RSYA 3DPDA 3HIZA 2CFZA 4GZ5A 4MLPA 3UT8A 1BPOA 5CCMA 3FUEA 4FADA 3LKUA 1DVPA 3U9WA 4CDNA 3PVLA 3LY9A 3CVPA 4G11A 4XKCA 4ANWA 5BT1A 3EIJA 3JYSA 4GZ6A 3SD5A 1E7VA 3CHPA 3PS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5G05 J;  4J8D A;  4N3C A;  5FT9 A;  1TJC A;  2C2L A;  5FZS A;  2HO1 A;  3CVN A;  1XNF A;  3RKV A;  3ZFW A;  2WPV A;  4HOR A;  4ME2 A;  2XGM A;  3K9I A;  5KJL A;  5LCW C;  3RJV A;  4EQF A;  1HZ4 A;  2FEZ A;  2AVP A;  2DBA A;  3CKB A;  2LSU A;  1P5Q A;  5FZR A;  1HXI A;  3KS2 A;  4H7Y A;  4GYW A;  1WM5 A;  2XCB A;  5HI7 A;  3TAX A;  3ZGQ A;  4N2Q A;  4UI9 J;  5BNW A;  4HOS A;  1NA3 A;  5D0O D;  4G26 A;  2YQ8 A;  3KD7 A;  2VGX B;  5A6C A;  1ELR A;  3U4T A;  4N5C A;  2OOE A;  3NF1 A;  3IEG A;  4WUY A;  2C0L A;  5C1D A;  1YA0 A;  4KBQ A;  3PE3 A;  4IN3 B;  3ZHE A;  4O6F A;  3KAE A;  3QDN A;  4U0U A;  3PDN A;  3MEK A;  2XCC A;  3Q15 A;  4U07 A;  3MV3 B;  3VTX A;  3ZHE B;  3MV2 B;  4BTA A;  4GA0 A;  2XGO A;  2VSY A;  3Q47 B;  3OXG A;  3LCA A;  3LY8 A;  2FBN A;  4GYY A;  1PC2 A;  4WNF A;  4GA1 A;  2UWJ G;  2PL2 A;  4XI9 A;  3Q5M A;  3TGO A;  1IHG A;  4BT9 A;  3CEQ A;  3RO3 A;  2VGY A;  5KJK A;  2P58 C;  2I6H A;  2JLB A;  2MHK A;  3N71 A;  1WAO 1;  2IFU A;  1W3B A;  4NRH B;  4APO A;  3S7J A;  3FP3 A;  4G24 A;  2OND A;  3E4B A;  2LSV A;  3QWP A;  3LPZ A;  5EX0 A;  4GZ3 A;  4JL0 A;  3RO2 A;  4I9E A;  4BT8 A;  4Y6C A;  3ASG A;  3QKY A;  2Q7F A;  4WNG A;  1QZ2 A;  1FCH A;  4I9C A;  5JJ6 A;  5G05 C;  1KT1 A;  4UQX A;  3GZ1 A;  2VYI A;  4KXK B;  3QOU A;  4U0S A;  1A17 A;  5A7D B;  3SF4 A;  2WQH A;  5ARG A;  5JJT A;  3VTY A;  4Y6W A;  5FTP A;  4G25 A;  4WND A;  3LY7 A;  4GYO A;  4A1S A;  3ESK A;  3CVQ A;  5FZQ A;  3URZ A;  3UQ3 A;  4JA7 A;  3CKC A;  4UQZ A;  4H7X A;  2VSN A;  4WNE A;  4G23 A;  1ELW A;  1ZBP A;  3CVL A;  4GA2 A;  2KC7 A;  4AIF A;  4BTB A;  3TG4 A;  4BWR A;  2IF4 A;  3QWV A;  1NZN A;  2XEV A;  4U04 A;  3GW4 A;  4NQ0 A;  3UPV A;  5EKQ D;  4UI9 C;  5G04 C;  2FI7 A;  1HH8 A;  5HQ8 A;  4CDR A;  3WXX A;  1OUV A;  2KCV A;  1KLX A;  1IYG A;  2V5F A;  4J8E A;  5KJM A;  2QFC A;  4B94 A;  4GPK A;  3Q49 B;  2HYZ A;  3CK9 A;  2KCL A;  2E2E A;  2PQR A;  1E96 B;  4CGV A;  5JJ7 A;  5EX3 A;  1NA0 A;  2J9Q A;  3BEE A;  3Q4A B;  5FJY A;  2KAT A;  3R9A B;  4HOQ A;  4AY6 A;  4N2S A;  3CK8 A;  2BUG A;  3U3W A;  4GCN A;  2NC9 A;  5BW8 C;  3AS8 A;  4HOT A;  2GW1 A;  3S7D A;  4J8F A;  4N3B A;  4RG6 A;  4CGW A;  4GCO A;  4LEU A;  3ULQ A;  3ZN3 A;  2LNI A;  5DIZ A;  4XIF A;  5LCW J;  2FO7 A;  4RG9 A;  3RIB A;  3GYZ A;  4W9R A;  3AS5 A;  3CK7 A;  2Y4T A;  3ASF A;  3AS4 A;  3QWW A;  2PZI A;  3GZ2 A;  4I1A A;  2FF4 A;  5CCL A;  2L6J A;  3FWV A;  3ASH A;  3UUX A;  4UQY A;  2R5S A;  4HOU A;  3FFL A;  4JA9 A;  4G1T A;  5M72 A;  2C0M A;  3S7B A;  2XGS A;  4ABN A;  2PQN A;  4I2W A;  3LYA A;  4KYO B;  4AM9 A;  2UY1 A;  4J0U A;  4F3V A;  3ASD A;  3MKR A;  4I17 A;  5CHE E;  2VGX A;  2UY1 B;  4AY5 A;  2HR2 A;  3O48 A;  2Y4U A;  3EDT B;  3TG5 A;  3SZ7 A;  5G04 J;  3MA5 A;  3S7F A;  3HYM B;  1ZU2 A;  1B89 A;  2KCK A;  1KT0 A;  3RU0 A;  4JHR A;  3PE4 A;  5DBK A;  4G2V A;  4YND A;  3ZPJ A;  4YVQ C;  2VQ2 A;  5D0Q D;  3CV0 A;  4U0Z A;  2XPI A;  4N3A A;  5AYW D;  1Y8M A;  5ARF A;  2YHC A;  4N39 A;  1QQE A;  4YVO A;  3OXL A;  3OXF A;  4I2Z A;  4XI0 A;  4UI9 K;  4GZ5 A;  5CCM A;  3LKU A;  3LY9 A;  3CVP A;  5BT1 A;  3JYS A;  4GZ6 A;  5KJN A; 
#chains in the Genus database with same CATH topology
 5G05 J;  2ETA A;  2IOL A;  3KSL A;  1DC2 A;  5KCM A;  2HO1 A;  3I5P A;  3QB2 A;  1YCS B;  1UJK A;  3QC1 A;  3JQ1 A;  2PNN A;  4QQI A;  4Q69 A;  4DUI A;  4A63 B;  4CEM A;  4B8A A;  3K9I A;  1O1S A;  3LXU X;  3RJV A;  4EQF A;  2AVP A;  2JEK A;  3CHS A;  4XE0 A;  1O1R A;  3T9K A;  4HI8 A;  4FJZ A;  3MX3 A;  2WXQ A;  4H7Y A;  1MQS A;  4GYW A;  4U8H A;  2EIK E;  5B1B E;  3FUL A;  4GTS A;  3B7S A;  2FUL A;  5KBA A;  3EJN A;  5EID A;  3SQV A;  1H6K A;  4G26 A;  4J8Y A;  4FC8 A;  3KD7 A;  2DZO A;  4ANV A;  1N94 A;  1OWM A;  3Q9U C;  4GTM A;  3E37 A;  2MRI A;  4KVO A;  2QC9 A;  5KNG A;  3TWT A;  5ANR A;  4XZ4 A;  3ZHE A;  3TWU A;  1Z3Y A;  3C3Q A;  3AJI A;  1TR4 A;  2XCC A;  3Q15 A;  4K5C A;  3VTX A;  3CQC B;  3ZHE B;  3MV2 B;  1MX2 A;  3FDH A;  2VSO E;  2VSY A;  4U8V D;  3Q47 B;  4BES A;  3NAW A;  1OT8 A;  3OXG A;  4JPS A;  4EEC A;  3LCA A;  5ENQ D;  4WNF A;  1FVF A;  2PL2 A;  4LER A;  4XI9 A;  3X2Q E;  2V5Q C;  1OWL A;  3V2X A;  5KJK A;  1INZ A;  5JA4 D;  3ZXP A;  1WAO 1;  3SBS A;  3E4B A;  4U96 D;  1UN9 A;  2DVW A;  5EX0 A;  4JL0 A;  3UM1 A;  4I9E A;  1OXJ A;  1TNZ A;  3PRZ A;  4AEZ C;  5EDS A;  4PS8 A;  3V31 A;  4APF A;  1JCS A;  3NB2 A;  1FCH A;  3APC A;  1KZP A;  3ZXS A;  1KT1 A;  2VYI A;  1SQM A;  5BXU A;  5A23 A;  1IKN D;  4KXK B;  3QOU A;  1A17 A;  3HXF A;  3ULE G;  4OAV B;  2CG3 A;  3ZKJ A;  3ZVV A;  1RW2 A;  4GTV A;  3G2S A;  2VJ8 A;  3CVQ A;  3L13 A;  3C72 A;  2R02 A;  5FWQ A;  2YHE A;  4JA7 A;  2EIJ E;  5T4Y A;  4FLH A;  4UQZ A;  4BX9 A;  3MCX A;  4EZJ A;  2GRL A;  2OEV A;  3SY2 A;  4OVV A;  4FU3 A;  3PUJ A;  4IYP A;  3ISM C;  1NZN A;  5BV0 A;  3SFZ A;  4HFG A;  5EKQ D;  4UI9 C;  2OCC E;  1ZB1 A;  4O1P A;  1N95 A;  1HFA A;  3QAR A;  3HXE A;  4E6H A;  5KWD A;  3WXX A;  2I9C A;  1SVX A;  4XEI G;  2KCV A;  1KLX A;  3FTS A;  1IYG A;  2KM4 A;  3UKU G;  4L2Y A;  4EPZ A;  4J8E A;  5KJM A;  3HDX A;  3DXK G;  1S0P A;  3AG2 E;  1OWP A;  2KCL A;  1TN8 A;  4CGV A;  1VDY A;  2J4D A;  4U95 D;  2J9Q A;  5AQ7 A;  4DX5 D;  2BF0 X;  4K5B A;  3ENE A;  2I1J A;  3U3W A;  4GCN A;  4DPR A;  2NC9 A;  1AWC B;  2V4H C;  2OVB A;  2WXI A;  3AS8 A;  5CMW A;  4J8F A;  3D9M A;  4RG6 A;  3CVV A;  2CG2 A;  3DEO A;  2GRO B;  5DIZ A;  4XIF A;  3CVU A;  2YNQ A;  2E0I A;  2FO7 A;  4RG9 A;  5LP0 A;  4LNU D;  2GRQ B;  3HHM A;  3PZ4 A;  2RFM A;  3G2T A;  3AS4 A;  4I1A A;  4R7L A;  2L6J A;  2J07 A;  5AAR A;  3P1U A;  3PNL B;  1SA4 A;  1K1B A;  3NQP A;  3ZYM A;  3FTV A;  5ENN A;  3DST A;  3FU3 A;  3ASH A;  4WWN A;  1EYH A;  4BSZ B;  3UTM A;  3DBS A;  4JA9 A;  4GTR A;  4KVM A;  4JD2 G;  3DEP A;  4ABN A;  1DCQ A;  4EHM A;  2WXR A;  1LD7 A;  5AQ9 A;  2VGX A;  4U8Y D;  2Y4U A;  4GAA A;  4GTT A;  3SZ7 A;  4F1P A;  4U63 A;  3UXG A;  2XZD G;  5KNH D;  1B89 A;  1SZA A;  1DNP A;  1TNY A;  4TUU A;  2NXP A;  3FTZ A;  3FTY A;  2V4L A;  3UM2 A;  4JHR A;  3PE4 A;  1PY1 A;  2XPZ A;  1NP7 A;  3ULY A;  1IHB A;  1OCR E;  2VQ2 A;  4DX2 A;  3CSF A;  2V8S E;  1IQU A;  4L23 A;  5AYW D;  4N3A A;  3DSS A;  3T8M A;  3R7Q A;  3CVY A;  2CHZ A;  4B89 A;  1H2T C;  4HBD A;  5AN8 A;  3UT8 A;  2BKK B;  3U9W A;  3PVL A;  3LY9 A;  3HRA A;  4XKC A;  1AP7 A;  3JYS A;  1LF8 A;  3FUD A;  5KJN A;  2B0O E;  1N9A A;  3PRE A;  2C2L A;  2IU1 A;  1H6P A;  3FUN A;  2NSZ A;  1SW6 A;  4BY6 A;  4WAF A;  3TWS A;  1XNF A;  5G2N A;  4ME2 A;  1HE8 A;  4J8S A;  2XS1 A;  4JXT A;  2ZU6 B;  4TXR A;  4HRM B;  2DBA A;  3CKB A;  1UOH A;  2VTB B;  4JHJ A;  4D10 C;  4JHK A;  1N0R A;  4GTQ A;  2XEH A;  5HI7 A;  2BKG A;  1LTX A;  4UWL A;  3TAX A;  4DI4 A;  4N2Q A;  5ITZ F;  2RD0 A;  5D0O D;  2YQ8 A;  5T3R A;  4L9P A;  1Y6I A;  5A6C A;  5CER B;  4KMO A;  1E8W A;  4N5C A;  5C1D A;  3PE3 A;  4IN3 B;  3E32 A;  4O6F A;  3KAE A;  5ENR D;  3BG0 B;  3ZYK A;  3IKO B;  4BX8 A;  3UX4 A;  3MEK A;  4Z68 A;  1WY6 A;  2XGO A;  1FT1 A;  3FEY A;  4MKT A;  2P2C P;  4MS6 A;  4PH4 B;  4QFV A;  4AOF A;  3LY8 A;  1PC2 A;  2OEW A;  3C3O A;  4BT9 A;  3CEQ A;  3RO3 A;  4I43 A;  4X8Q A;  2AJA A;  1N4S A;  2P58 C;  4G8L A;  2I6H A;  3PZ3 A;  3N71 A;  3FUF A;  3CHQ A;  2IFU A;  4NRH B;  4APO A;  1DCE A;  5FQ4 A;  2OND A;  3VLD A;  3FH5 A;  3B95 A;  4GZD A;  1JWG A;  3LPZ A;  2AW6 A;  5B1A E;  4HS2 A;  1H2V C;  2R03 A;  1OWO A;  3ASG A;  5AJL A;  5B3S E;  1QZ2 A;  4HVB A;  4C0M A;  4GB9 A;  3SNX A;  2L0T B;  5G05 C;  3EU9 A;  1PAQ A;  1HF8 A;  3B7R L;  3ML9 A;  2Y1L E;  5LFA A;  1WG0 A;  3BG1 B;  4U0S A;  2VGE A;  3L9T A;  3HG0 D;  4GMJ A;  3F6Q A;  3VTY A;  4Y6W A;  4G25 A;  2XS8 A;  4WND A;  4A1S A;  4ATG A;  5BUZ A;  5FZQ A;  1JPL A;  3B7B A;  1O1T A;  4GZC A;  1BI8 B;  3OTN A;  4GML A;  3T8K A;  4RVB A;  2H6H A;  1UG3 A;  3ZW3 A;  5CED B;  2VSN A;  3ML8 A;  2ZXW E;  3JUE A;  4I1M A;  3DXM G;  2P9U G;  1ZBP A;  3UKR G;  4PDX A;  2HE0 A;  2LAI A;  2R17 C;  1IQR A;  2XRY A;  3HVE A;  3UIP C;  2IF4 A;  3QWV A;  3DSX A;  1H2U A;  4CZ2 D;  2XEV A;  4U04 A;  3GW4 A;  3HVE B;  4CDM A;  1K3Z D;  2EIN E;  3FY4 A;  5G04 C;  3RRU A;  2F37 A;  4CDR A;  2DIW A;  3S2A A;  3TWX A;  1FVH A;  4DX7 D;  4UWK A;  2WQ7 A;  1MX4 A;  2V5F A;  4L2L A;  4NUR A;  3JQ0 A;  3QJZ A;  4B94 A;  5FIN A;  4FHJ A;  5AEN A;  3AU4 A;  3PNT B;  2J09 A;  5J08 A;  3L82 A;  2PQR A;  1E96 B;  4HLE A;  1QYM A;  2DYR E;  3SFX A;  5EX3 A;  5JJ7 A;  2R2L A;  3Q4A B;  3IHY A;  3E30 A;  3TJP A;  1OCZ E;  3PZ2 A;  3V30 A;  4AY6 A;  3RAU A;  2XHE A;  4HNA D;  4LCT A;  5AIJ A;  3L08 A;  3D9P A;  3HXB A;  1O5M A;  4N3B A;  4CGW A;  4GCO A;  5H7P A;  1D8D A;  2LNI A;  1JCQ A;  3FH7 A;  3D9H A;  5LCW J;  2GGF A;  5FQ8 A;  3RIB A;  3GYZ A;  4GPM A;  2Y4T A;  1HS6 A;  3CQG B;  3ZYQ A;  3RRM B;  3GZ2 A;  2FF4 A;  2QYU A;  4LNG A;  2OVF A;  4FLB A;  4JVS A;  4O1O A;  3HXC A;  3FH8 A;  1GW6 A;  4UUC A;  2KXP C;  2ZIR A;  2HM8 A;  2CFU A;  2GRR B;  5D66 A;  4I2W A;  3LYA A;  4KT6 B;  3KEA A;  3NZS A;  3ASD A;  1S63 A;  3ASN E;  3CHM A;  3OAW A;  4I17 A;  5CHE E;  5FQ7 A;  1S70 B;  2DYS E;  4AY5 A;  3SO8 A;  3ABL E;  3O48 A;  1YMP A;  2H6I A;  3MA5 A;  4NAC A;  1E90 A;  2NYJ A;  3LJ3 A;  3SFY A;  2KCK A;  4ILG A;  2DWZ A;  4XKB A;  3AU5 A;  3IV0 A;  1ELK A;  3FTX A;  2MOW A;  3ZPJ A;  2AXZ A;  4YVQ C;  5CEC B;  2ZIS A;  5D0Q D;  1S64 A;  2IJG X;  2WXF A;  2X6H A;  5EIB E;  3AAA C;  1Y8M A;  1L5J A;  4HI9 A;  4GU5 A;  5ARF A;  3SHF A;  4N39 A;  3TL5 A;  1QQE A;  3OXL A;  3I4R B;  1D9S A;  4XI0 A;  4UI9 K;  1OCC E;  3HIZ A;  2GRN B;  4GZ5 A;  2H6F A;  3LKU A;  4TUM A;  1MYO A;  4G11 A;  4ANW A;  4ACK A;  4J8D A;  4N3C A;  5FT9 A;  1TJC A;  3FUJ A;  5FZS A;  4ZFH A;  3CVN A;  1Z3X A;  2XRZ A;  3RKV A;  2WPV A;  2LXM A;  5EYL A;  3PEU B;  2XEN A;  2XGM A;  4B93 B;  4URK A;  2IO3 C;  1HZ4 A;  3FHE A;  5HS0 A;  2QY7 A;  3AG1 E;  1P5Q A;  5FZR A;  2X6J A;  4B8C B;  1WM5 A;  3DRA A;  4KZ0 A;  4UWF A;  1H0A A;  3Q9N C;  2AXU A;  3UI2 A;  3D9I A;  3PZD A;  3TWR A;  3ZGQ A;  5BNW A;  3JXJ A;  4HOS A;  4BER A;  2PM6 A;  4MRU A;  1G3N B;  2VGX B;  3APD A;  3O4Z A;  5JMN D;  3U4T A;  4M7C A;  4JEH A;  3V2O A;  3NF1 A;  3IEG A;  2C0L A;  3LVQ E;  4KBQ A;  5AAO A;  3U66 A;  2DCP A;  4F7A A;  4JZY A;  3QDN A;  4U0U A;  3PDN A;  3UIN C;  2BED A;  1U2V G;  3W9F A;  4GA0 A;  2KZT A;  4DX6 D;  2QYJ A;  4GYY A;  4GA1 A;  2UWJ G;  2KZT B;  3EHQ A;  3Q5M A;  4CRW A;  2ION A;  3ABM E;  1QBQ A;  1UW4 B;  2F0Y A;  3ZIM A;  4B0Z A;  1W3B A;  1TJF A;  3S7J A;  3AG3 E;  4GZ3 A;  3RO2 A;  2IY0 C;  4ZHB A;  4TXQ A;  3CHO A;  2WXK A;  5CMY A;  3QKY A;  3ZEF A;  2Q7F A;  4WNG A;  2ETB A;  4K03 A;  3QAQ A;  1WDY A;  1RZ4 A;  3KSQ A;  3NZU A;  5JJ6 A;  2M63 A;  4WWP A;  4C0E A;  3DSV A;  4UQX A;  3UIO C;  1E7U A;  3NOC D;  4FUL A;  2V0P A;  2X6I A;  2X6F A;  3NOG D;  3SF4 A;  1BI7 B;  3Q79 A;  3LEW A;  5FTP A;  5E75 A;  1QNF A;  4OYS A;  3TWQ A;  4K5A B;  1TNU A;  3EIQ C;  3L16 A;  5CBO A;  3B7U X;  3CKC A;  4HB5 A;  3P2B A;  2WQ6 A;  4H7X A;  3GZS A;  1MJ0 A;  3LS8 A;  4G23 A;  3CVW A;  4CYM D;  2AXV A;  2XPY A;  5EIL A;  4J6I A;  3CVL A;  5ENP D;  4GA2 A;  2KC7 A;  4AIF A;  4XX5 A;  1BU9 A;  3HXD A;  3TG4 A;  3PEV B;  1SZ9 A;  4BET A;  4NQ0 A;  4LNB A;  3UPV A;  5LOZ A;  3D9L A;  3KEZ A;  3B7T A;  4EBA A;  2L9B A;  2FI7 A;  4ILI A;  5HQ8 A;  1HX8 A;  5EN5 D;  4PS3 A;  1TNO A;  1OUV A;  4BEP A;  1TN7 A;  5AJD A;  2QFC A;  2BTD A;  2P9N G;  2OV8 A;  2WXH A;  4GPK A;  2WVI A;  3UM3 A;  4K0R A;  2HYZ A;  2Y3A A;  5G55 A;  2E2E A;  2KBX A;  3ZYL A;  4ANX A;  3DSU A;  4A3V A;  3Q7A A;  3BEE A;  2KAT A;  4V3I A;  1JUQ A;  4HOQ A;  1X81 A;  3JUI A;  3CK8 A;  3SI5 A;  2BUG A;  4E85 A;  5HKP A;  2JAB A;  4I6J A;  4Q96 A;  4HOT A;  2GW1 A;  3S7D A;  2GRP B;  2L0I A;  3ULQ A;  3SGH A;  3ZN3 A;  3FEX A;  1E8Y A;  3J5P A;  1UJJ A;  3W9G A;  4W9R A;  3AS5 A;  2I1K A;  3ASF A;  1EDU A;  4WWO A;  5CCL A;  3FWV A;  1H6O A;  1HU3 A;  5EYP F;  3CIA A;  3FFL A;  1NL4 A;  4TXP A;  4BSX A;  4EZL A;  2C0M A;  3LJN A;  5ENO D;  3UM0 A;  2XGS A;  2PQN A;  3R7R A;  1MHQ A;  2UY1 A;  1KPS B;  3RK6 A;  4Q94 A;  3MKR A;  3EHR A;  4LUN U;  4AJW A;  2A5U A;  2UY1 B;  2HR2 A;  3FUK A;  3FU6 A;  4DJA A;  4MBG A;  3ABK E;  4OAU C;  1V55 E;  3EDT B;  3LVR E;  3TG5 A;  3MKQ A;  5G04 J;  5CRU A;  1U3C A;  3HYM B;  3PUK A;  1ZU2 A;  4HQD A;  4UWH A;  2IQC A;  1KT0 A;  3RU0 A;  2WM9 A;  3TXM A;  3MKQ B;  4FHK A;  5DBK A;  4G2V A;  1JWF A;  2FO1 E;  3FUH A;  4YND A;  4EZK A;  2B6C A;  3G2W A;  1N11 A;  4P29 A;  4F53 A;  2X3M A;  2P9P G;  2RFA A;  3RRN B;  3TXN A;  3CV0 A;  2WB2 A;  2XPI A;  3MYV A;  2P9I G;  3Q7F A;  4RQI A;  1TNB A;  2ZGG A;  4DLO A;  3DWL G;  3ASO E;  1NFI E;  4YVO A;  4AXH A;  3C3R A;  3L6A A;  3BQO A;  1BLX B;  4ANU A;  3DPD A;  4MLP A;  1BPO A;  2LXL A;  3FUE A;  4FAD A;  4C48 B;  1DVP A;  4G8K A;  3CVP A;  3ZNG A;  4GZ6 A;  1E7V A;  3PS6 A;  2WXM A;  4YDE A;  2I2O A;  3DSW A;  1EF1 C;  3Q78 A;  1TN6 A;  4JEU A;  1Z6T A;  3NBN B;  4CT4 A;  3G2V A;  4HOR A;  3ZFW A;  1X5B A;  2AWI A;  1HO8 A;  1LD8 A;  3G2U A;  3WG7 E;  5KJL A;  5LCW C;  3T5X A;  4TRQ A;  5CRV A;  4C9B B;  4BFR A;  2FEZ A;  4A1G A;  3FUM A;  2LSU A;  5BXO A;  3FUI A;  4HXI A;  3D9J A;  1HXI A;  3UT7 A;  2WMN A;  5AQA A;  1V54 E;  4HLL A;  2A5E A;  3KS2 A;  3ONL A;  5BV1 A;  2XCB A;  5J90 A;  4F6R D;  1U3D A;  2QZA A;  3R9M A;  2Y69 E;  3I4G A;  5AQB A;  2XQ0 A;  3ONK A;  4UI9 J;  2ETC A;  4LG6 A;  1NA3 A;  4L7T A;  3C98 A;  1ELR A;  2F8Y A;  5C2Y A;  3SBT B;  4U7E B;  3UMV A;  1OCO E;  4O60 A;  3CR3 A;  4PS7 A;  2OOE A;  4N5Q A;  4OVU A;  4WUY A;  1YA0 A;  2WXJ A;  4ACL A;  2H6G A;  3ZU7 B;  4U07 A;  4FP7 A;  3MV3 B;  1YYH A;  5T8I A;  4BTA A;  3TWW A;  3VLE A;  2FBN A;  3VLF A;  1NI1 A;  4A3T A;  3EHM A;  4LSZ E;  2ILR A;  3UT4 A;  2WXL A;  3QK0 A;  3TGO A;  1IHG A;  4NIK A;  2VGY A;  4AVX A;  2JLB A;  2MHK A;  4AP2 A;  4I1O B;  3FP3 A;  4G24 A;  3CHR A;  5HRY A;  1N54 A;  2LSV A;  3QWP A;  1XGW A;  2LO6 A;  5FQ6 A;  3PH0 C;  4BT8 A;  1OWN A;  1H19 A;  4Y6C A;  4JC8 A;  1KZO A;  1EPU A;  3U64 A;  3EHN A;  2L6B A;  1N4Q A;  3Q73 A;  3D9O A;  4I9C A;  4AV7 A;  3GZ1 A;  3PZ1 A;  2XZT G;  2RG8 A;  4A55 A;  5A7D B;  1Q2Z A;  4M3O A;  1K1A A;  2WQH A;  3CLJ A;  1JCR A;  5ARG A;  3QNK A;  5JJT A;  4DX1 A;  3LY7 A;  4GYO A;  1IXV A;  3ESK A;  5JHB A;  3URZ A;  5JHA A;  3RSE G;  3UQ3 A;  4DI3 A;  5E76 A;  3CGH A;  4WNE A;  1ELW A;  1BD8 A;  2YIN A;  3D9N A;  5ENT D;  3FTU A;  4GTO A;  2R59 A;  3E33 A;  4BTB A;  4GTP A;  4BWR A;  3LDZ A;  2LUH A;  2J08 A;  3CST A;  3E34 A;  1E8Z A;  5IY5 E;  2EIL E;  1K8K G;  4HRL A;  4CT0 A;  2J8S D;  3ZRH A;  2XEE A;  4PUC A;  1HH8 A;  2X38 A;  4I6G A;  2IOS A;  2ZGD A;  1OY3 D;  3C5R A;  2X6K A;  1UN8 A;  4TV3 A;  3FU5 A;  1HG2 A;  3I3N A;  4F1S A;  5ANL A;  4DLQ A;  4L1B A;  4J7W A;  3DPY A;  3Q49 B;  3CK9 A;  1NA0 A;  2LAH A;  2IEJ A;  2PM7 A;  4DK5 A;  5FJY A;  1D8E A;  3R9A B;  4RLY A;  3T5V A;  4KZC A;  4N2S A;  1FT2 A;  3JCK C;  2J49 A;  4ILH B;  5BW8 C;  2WXP A;  4FJY A;  4GMR A;  4CCA A;  1Z5S C;  2WMO A;  4FA6 A;  4YDY A;  4LEU A;  3IXE A;  3TWV A;  3ZUV B;  3B13 A;  5LX8 A;  3L54 A;  2CHX A;  1TYQ G;  5D2M C;  2P9K G;  3D3M A;  3CK7 A;  4YDO A;  5FIO A;  3V79 K;  1FPP A;  2P9S G;  3IBE A;  2EQX A;  2F8X K;  3MZL B;  3QWW A;  2PZI A;  4UWG A;  4JW1 A;  1A5E A;  2R05 A;  4IRU A;  2VTB A;  3AG4 E;  2GRM A;  4DRX E;  4EBA G;  3UUX A;  4UQY A;  2R5S A;  4HOU A;  4I6E A;  4G1T A;  5M72 A;  3S7B A;  3J5Q B;  3JXI A;  4KYO B;  3BUA A;  4AM9 A;  4HRN A;  4J0U A;  4F3V A;  3ESL A;  2WXN A;  4JB8 P;  2CHW A;  2DZN A;  5CBN A;  3IHV A;  2A4Z A;  1HG5 A;  2VSX E;  4IUL A;  3S7F A;  3L17 A;  1MX6 A;  5ENS D;  2MYO A;  2EIM E;  3L22 A;  3Q75 A;  1N4P A;  2Y0B G;  1TEZ A;  2WXG A;  1N52 A;  1MZC A;  5CEA A;  2WXO A;  2RKK A;  4U0Z A;  1N4R A;  1E8X A;  3MGB A;  3FTW A;  4LRZ A;  2YHC A;  2IO2 C;  3FU0 A;  2J4B A;  3OXF A;  4I2Z A;  3MJW A;  5BPP A;  3CVX A;  3EU5 A;  3BU8 A;  4ATZ D;  3APF A;  3D9K A;  1SA5 A;  1N0Q A;  4RSY A;  2CFZ A;  3EUV A;  5CCM A;  4CDN A;  4YDW A;  2P9L G;  5BT1 A;  3EIJ A;  3SD5 A;  3CHP A; 
#chains in the Genus database with same CATH homology
 5G05 J;  4ACK A;  4J8D A;  2IOL A;  2WXM A;  4N3C A;  3PRE A;  2I2O A;  5FT9 A;  1TJC A;  2C2L A;  2IU1 A;  3FUJ A;  5FZS A;  5KCM A;  1EF1 C;  2HO1 A;  3FUD A;  3FUN A;  4JEU A;  5KJN A;  2NSZ A;  1Z6T A;  3I5P A;  3QB2 A;  4BY6 A;  1UJK A;  3QC1 A;  4CT4 A;  3CVN A;  3G2V A;  4WAF A;  1Z3X A;  2XRZ A;  1XNF A;  3JQ1 A;  3RKV A;  2WPV A;  5G2N A;  4ME2 A;  3ZFW A;  1HE8 A;  4J8S A;  4HOR A;  1X5B A;  4Q69 A;  2AWI A;  1HO8 A;  3G2U A;  2XGM A;  3PEU B;  4CEM A;  4B8A A;  3K9I A;  4JXT A;  4URK A;  5KJL A;  5LCW C;  2ZU6 B;  3T5X A;  3LXU X;  3RJV A;  4TRQ A;  4EQF A;  4C9B B;  1HZ4 A;  4BFR A;  2FEZ A;  2AVP A;  2DBA A;  2JEK A;  3CKB A;  3FHE A;  4A1G A;  3CHS A;  3FUM A;  4XE0 A;  2LSU A;  2VTB B;  2QY7 A;  4JHJ A;  4D10 C;  4FJZ A;  3FUI A;  4HXI A;  3D9J A;  1P5Q A;  5FZR A;  1HXI A;  4JHK A;  3UT7 A;  3MX3 A;  2WMN A;  2X6J A;  4B8C B;  2WXQ A;  3KS2 A;  4H7Y A;  1MQS A;  4GYW A;  3ONL A;  1WM5 A;  4KZ0 A;  2XCB A;  5BV1 A;  5J90 A;  4UWF A;  1H0A A;  1U3D A;  5HI7 A;  4U8H A;  3FUL A;  2AXU A;  3D9I A;  3I4G A;  4UWL A;  3PZD A;  3B7S A;  3TAX A;  2FUL A;  4DI4 A;  3ZGQ A;  2XQ0 A;  3ONK A;  4UI9 J;  4N2Q A;  5BNW A;  3EJN A;  4HOS A;  2PM6 A;  1H6K A;  2RD0 A;  4MRU A;  1NA3 A;  5D0O D;  4G26 A;  2YQ8 A;  4FC8 A;  5T3R A;  3KD7 A;  4L7T A;  2VGX B;  3APD A;  4ANV A;  3C98 A;  1Y6I A;  3O4Z A;  5A6C A;  1ELR A;  5C2Y A;  1OWM A;  3SBT B;  3UMV A;  4KMO A;  1E8W A;  4N5C A;  2MRI A;  3CR3 A;  3U4T A;  4PS7 A;  2OOE A;  4JEH A;  4OVU A;  3NF1 A;  4KVO A;  3IEG A;  4WUY A;  2C0L A;  5C1D A;  1YA0 A;  3LVQ E;  5ANR A;  4KBQ A;  3PE3 A;  2WXJ A;  4IN3 B;  4ACL A;  4XZ4 A;  3ZHE A;  3U66 A;  2DCP A;  4F7A A;  4JZY A;  4O6F A;  1Z3Y A;  3KAE A;  3BG0 B;  3ZYK A;  3QDN A;  4U0U A;  3IKO B;  4BX8 A;  3UX4 A;  3PDN A;  3MEK A;  2XCC A;  3Q15 A;  4FP7 A;  3MV3 B;  4U07 A;  3VTX A;  3CQC B;  5T8I A;  3ZHE B;  3MV2 B;  4BTA A;  4GA0 A;  1WY6 A;  2XGO A;  2KZT A;  3FDH A;  2VSO E;  3FEY A;  2VSY A;  4MKT A;  3VLE A;  3Q47 B;  3OXG A;  4MS6 A;  4JPS A;  4PH4 B;  3LCA A;  4QFV A;  4AOF A;  3LY8 A;  2FBN A;  4GYY A;  4EEC A;  1PC2 A;  4WNF A;  1FVF A;  4GA1 A;  2UWJ G;  2PL2 A;  3VLF A;  4LER A;  2KZT B;  4A3T A;  4XI9 A;  3EHM A;  3Q5M A;  4CRW A;  2ILR A;  2ION A;  3UT4 A;  2WXL A;  3QK0 A;  1OWL A;  3TGO A;  1IHG A;  4BT9 A;  3CEQ A;  3RO3 A;  4I43 A;  2VGY A;  5KJK A;  1INZ A;  1UW4 B;  2P58 C;  2I6H A;  4AVX A;  2JLB A;  2MHK A;  3ZIM A;  3N71 A;  1WAO 1;  3FUF A;  4B0Z A;  3CHQ A;  3SBS A;  2IFU A;  1W3B A;  1TJF A;  4NRH B;  3S7J A;  4AP2 A;  4APO A;  4I1O B;  3FP3 A;  4G24 A;  5FQ4 A;  3CHR A;  2OND A;  3E4B A;  3VLD A;  3FH5 A;  1UN9 A;  1N54 A;  4GZD A;  1JWG A;  2LSV A;  1XGW A;  3LPZ A;  3QWP A;  5EX0 A;  2LO6 A;  2AW6 A;  5FQ6 A;  4GZ3 A;  4JL0 A;  3RO2 A;  4I9E A;  4HS2 A;  3PH0 C;  1H2V C;  4BT8 A;  1OWN A;  1H19 A;  4Y6C A;  4JC8 A;  1OWO A;  1EPU A;  3U64 A;  3CHO A;  2WXK A;  5CMY A;  3ASG A;  3QKY A;  5AJL A;  3ZEF A;  2Q7F A;  3PRZ A;  4WNG A;  4AEZ C;  4K03 A;  5EDS A;  3QAQ A;  1QZ2 A;  4PS8 A;  3EHN A;  4APF A;  4HVB A;  4C0M A;  3D9O A;  1FCH A;  3APC A;  4I9C A;  4AV7 A;  4GB9 A;  3SNX A;  3NZU A;  5JJ6 A;  2L0T B;  5G05 C;  2M63 A;  1PAQ A;  3ZXS A;  4WWP A;  1HF8 A;  4C0E A;  1KT1 A;  3B7R L;  3GZ1 A;  4UQX A;  1E7U A;  2VYI A;  1SQM A;  4FUL A;  3ML9 A;  5LFA A;  2V0P A;  2X6I A;  2X6F A;  5A23 A;  4KXK B;  2RG8 A;  3BG1 B;  3QOU A;  4A55 A;  4U0S A;  1A17 A;  5A7D B;  4M3O A;  3SF4 A;  2WQH A;  2CG3 A;  3CLJ A;  5ARG A;  4GMJ A;  3QNK A;  3ZVV A;  5JJT A;  3VTY A;  4Y6W A;  3LEW A;  5FTP A;  4G25 A;  3G2S A;  4WND A;  3LY7 A;  4GYO A;  4A1S A;  5E75 A;  4ATG A;  2VJ8 A;  3ESK A;  5BUZ A;  1QNF A;  5JHB A;  3CVQ A;  3L13 A;  5FZQ A;  1JPL A;  4OYS A;  4GZC A;  5FWQ A;  3URZ A;  3EIQ C;  3OTN A;  5JHA A;  4GML A;  2YHE A;  3L16 A;  3UQ3 A;  4RVB A;  4JA7 A;  3B7U X;  3CKC A;  5T4Y A;  3P2B A;  4FLH A;  4UQZ A;  2WQ6 A;  4H7X A;  1UG3 A;  3GZS A;  4BX9 A;  3LS8 A;  3MCX A;  3ZW3 A;  4DI3 A;  2VSN A;  3ML8 A;  5E76 A;  3CGH A;  4I1M A;  4WNE A;  4G23 A;  4EZJ A;  3CVW A;  1ELW A;  2AXV A;  1ZBP A;  2XPY A;  4J6I A;  3CVL A;  4PDX A;  2LAI A;  2YIN A;  3D9N A;  4GA2 A;  2R17 C;  2KC7 A;  4AIF A;  1IQR A;  4XX5 A;  2GRL A;  3FTU A;  2XRY A;  3HVE A;  2R59 A;  4BTB A;  4OVV A;  3TG4 A;  4FU3 A;  2IF4 A;  4BWR A;  3PUJ A;  3PEV B;  4IYP A;  3QWV A;  1NZN A;  1SZ9 A;  3LDZ A;  1H2U A;  2XEV A;  2J08 A;  4U04 A;  5BV0 A;  3GW4 A;  4NQ0 A;  3SFZ A;  4HFG A;  3HVE B;  3UPV A;  3CST A;  5EKQ D;  4UI9 C;  1E8Z A;  5LOZ A;  4CDM A;  3D9L A;  4CT0 A;  3KEZ A;  3ZRH A;  4PUC A;  1HFA A;  3QAR A;  3B7T A;  3FY4 A;  2L9B A;  5G04 C;  4E6H A;  2FI7 A;  4ILI A;  4EBA A;  3RRU A;  1HH8 A;  5HQ8 A;  1HX8 A;  4CDR A;  3WXX A;  2DIW A;  2I9C A;  2X38 A;  4I6G A;  4PS3 A;  2IOS A;  1OUV A;  3S2A A;  2KCV A;  1KLX A;  3FTS A;  1IYG A;  2KM4 A;  1FVH A;  4UWK A;  2WQ7 A;  4L2Y A;  2X6K A;  2V5F A;  4EPZ A;  1UN8 A;  4J8E A;  4TV3 A;  3FU5 A;  5KJM A;  5AJD A;  4L2L A;  2QFC A;  1HG2 A;  3I3N A;  4NUR A;  2BTD A;  3JQ0 A;  5ANL A;  4DLQ A;  4F1S A;  3HDX A;  4L1B A;  3QJZ A;  2OV8 A;  1S0P A;  4B94 A;  2WXH A;  4GPK A;  2WVI A;  4FHJ A;  5AEN A;  4K0R A;  1OWP A;  3AU4 A;  3PNT B;  2J09 A;  5J08 A;  3Q49 B;  2HYZ A;  2Y3A A;  3CK9 A;  2KCL A;  5G55 A;  2E2E A;  2PQR A;  3ZYL A;  1E96 B;  4ANX A;  4HLE A;  4CGV A;  5JJ7 A;  5EX3 A;  1NA0 A;  1VDY A;  2J4D A;  4A3V A;  2LAH A;  2J9Q A;  2PM7 A;  4DK5 A;  3BEE A;  3Q4A B;  5FJY A;  3IHY A;  2KAT A;  4V3I A;  3R9A B;  3TJP A;  1JUQ A;  4HOQ A;  1LF8 A;  4AY6 A;  2BF0 X;  3T5V A;  3JUI A;  4KZC A;  4N2S A;  2XHE A;  3CK8 A;  3SI5 A;  3JCK C;  2BUG A;  4E85 A;  2J49 A;  3ENE A;  4ILH B;  2I1J A;  3U3W A;  4GCN A;  4DPR A;  2NC9 A;  4LCT A;  5BW8 C;  5AIJ A;  2OVB A;  2WXP A;  2WXI A;  3AS8 A;  4I6J A;  4FJY A;  4Q96 A;  4HOT A;  4CCA A;  5CMW A;  2GW1 A;  3S7D A;  4J8F A;  3L08 A;  3D9P A;  3D9M A;  4N3B A;  4RG6 A;  4CGW A;  2WMO A;  4FA6 A;  3CVV A;  4GCO A;  4LEU A;  2L0I A;  3ULQ A;  3SGH A;  2CG2 A;  3ZN3 A;  3FEX A;  2LNI A;  5DIZ A;  1E8Y A;  4XIF A;  3CVU A;  1UJJ A;  3FH7 A;  2YNQ A;  3B13 A;  5LCW J;  2GGF A;  5LX8 A;  2E0I A;  2FO7 A;  4RG9 A;  3L54 A;  2CHX A;  5FQ8 A;  3RIB A;  5LP0 A;  3GYZ A;  4W9R A;  3D3M A;  3AS5 A;  3CK7 A;  2Y4T A;  1HS6 A;  3CQG B;  2I1K A;  3HHM A;  3IBE A;  2EQX A;  3ASF A;  3G2T A;  3MZL B;  3AS4 A;  3QWW A;  1EDU A;  2PZI A;  4WWO A;  4UWG A;  4JW1 A;  3ZYQ A;  3RRM B;  3GZ2 A;  4I1A A;  2FF4 A;  5CCL A;  4R7L A;  2L6J A;  2J07 A;  4IRU A;  3P1U A;  3PNL B;  3FWV A;  1HU3 A;  2VTB A;  3NQP A;  3ZYM A;  3FTV A;  5ENN A;  2GRM A;  3FU3 A;  2OVF A;  3ASH A;  4FLB A;  4WWN A;  4EBA G;  1EYH A;  4JVS A;  3UUX A;  4UQY A;  2R5S A;  4HOU A;  3DBS A;  3CIA A;  3FH8 A;  3FFL A;  4I6E A;  4BSX A;  1GW6 A;  4G1T A;  4JA9 A;  4EZL A;  4KVM A;  2C0M A;  5M72 A;  3S7B A;  2HM8 A;  2CFU A;  2XGS A;  4ABN A;  2PQN A;  3R7R A;  4I2W A;  1MHQ A;  3LYA A;  4KYO B;  2WXR A;  4AM9 A;  4KT6 B;  2UY1 A;  4J0U A;  4F3V A;  3NZS A;  3RK6 A;  4Q94 A;  3ASD A;  3MKR A;  3ESL A;  2WXN A;  3CHM A;  3OAW A;  4I17 A;  4LUN U;  5CHE E;  5FQ7 A;  2VGX A;  4AJW A;  2A5U A;  2UY1 B;  2CHW A;  4AY5 A;  2HR2 A;  3FUK A;  3FU6 A;  4DJA A;  3IHV A;  2A4Z A;  3O48 A;  1HG5 A;  2Y4U A;  3EDT B;  4GAA A;  3LVR E;  3TG5 A;  3SZ7 A;  2VSX E;  3MKQ A;  5G04 J;  3MA5 A;  1U3C A;  4IUL A;  3HYM B;  3PUK A;  4U63 A;  1ZU2 A;  3S7F A;  3L17 A;  4NAC A;  1E90 A;  3LJ3 A;  1B89 A;  1SZA A;  4UWH A;  2IQC A;  1DNP A;  2KCK A;  4TUU A;  3L22 A;  1KT0 A;  2NXP A;  4ILG A;  3RU0 A;  2WM9 A;  3FTZ A;  3FTY A;  3MKQ B;  3TXM A;  2V4L A;  4FHK A;  4JHR A;  3PE4 A;  5DBK A;  4G2V A;  1JWF A;  4XKB A;  1TEZ A;  1PY1 A;  2WXG A;  3AU5 A;  3FUH A;  4YND A;  3IV0 A;  1N52 A;  4EZK A;  1ELK A;  3G2W A;  2XPZ A;  2WXO A;  1NP7 A;  4P29 A;  3FTX A;  2MOW A;  3ZPJ A;  2AXZ A;  4YVQ C;  2VQ2 A;  4F53 A;  3CSF A;  2X3M A;  5D0Q D;  3RRN B;  2V8S E;  3TXN A;  3CV0 A;  2IJG X;  2WXF A;  2WB2 A;  2X6H A;  1IQU A;  4L23 A;  4U0Z A;  2XPI A;  4N3A A;  3MYV A;  1E8X A;  5AYW D;  3R7Q A;  3MGB A;  3T8M A;  1Y8M A;  1L5J A;  3CVY A;  4DLO A;  4GU5 A;  5ARF A;  2CHZ A;  3SHF A;  3FTW A;  4B89 A;  4LRZ A;  2YHC A;  4N39 A;  3TL5 A;  1QQE A;  4YVO A;  3FU0 A;  2J4B A;  3I4R B;  1H2T C;  3OXL A;  3OXF A;  4I2Z A;  3MJW A;  4AXH A;  5BPP A;  3CVX A;  3L6A A;  3APF A;  4XI0 A;  4UI9 K;  3D9K A;  4ANU A;  4RSY A;  3DPD A;  3HIZ A;  2CFZ A;  4GZ5 A;  4MLP A;  3UT8 A;  1BPO A;  5CCM A;  3FUE A;  4FAD A;  3LKU A;  1DVP A;  3U9W A;  4CDN A;  3PVL A;  3LY9 A;  3CVP A;  4G11 A;  4XKC A;  4ANW A;  5BT1 A;  3EIJ A;  3JYS A;  4GZ6 A;  3SD5 A;  1E7V A;  3CHP A;  3PS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...