4K5BA

Co-crystallization with conformation-specific designed ankyrin repeat proteins explains the conformational flexibility of bcl-w
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
156
structure length
156
Chain Sequence
b'DLGKKLLEAARAGQDDEVRILMANGADVNAKDRFGWTPLHLAAMEGHLEIVEVLLKTGADVNAWADLGTTPLHLAAMKGHLEIVEVLLKAGADVNAEAIVGYTPLHLAAWEGHLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis regulator BCL-W
publication title Co-Crystallization with Conformation-Specific Designed Ankyrin Repeat Proteins Explains the Conformational Flexibility of BCL-W
pubmed doi rcsb
source organism Escherichia coli
molecule tags Apoptosis
total genus 51
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4k5bA00
2ETCA 4G8LA 5CBNA 2J8SD 3J5QB 4U8VD 5ENOD 5CEAA 2Y1LE 1OY3D 2XZTG 4K5AB 5JA4D 1DC2A 1MJ0A 1MYOA 5EIBE 3F6QA 4BSZB 4A63B 5ENRD 1WDYA 1YMPA 2DZNA 1MX2A 4DRXE 5EYLA 4BEPA 4HRNA 2RFAA 5AQBA 4LG6A 4U96D 4DX2A 4O1PA 5CERB 3T8KA 2F8XK 2VGEA 3HG0D 2V5QC 5CBOA 4DX1A 4ZHBA 1YYHA 4J8YA 2AJAA 1TR4A 2XEEA 1K1AA 5EILA 2FO1E 2XZDG 5KNGA 4GPMA 4DX5D 4DX7D 2BKKB 2DVWA 2L6BA 1S70B 3KEAA 2KBXA 5EYPF 3ZU7B 3DEPA 3JXJA 3EU9A 3LJNA 1AP7A 2B0OE 4BERA 1BD8A 5KWDA 1K1BA 5ENQD 5EIDA 5AARA 1D9SA 3AAAC 1N0RA 1YCSB 4N5QA 2F8YA 4G8KA 3ZKJA 5D66A 2PNNA 4LSZE 4BETA 4YDWA 3V30A 3HRAA 2Y0BG 5FINA 1WG0A 4F6RD 3UI2A 4DX6D 1N0QA 1K3ZD 3EHRA 3TWXA 3NBNB 5AQ7A 3NOGD 4HQDA 2QC9A 4U8YD 1MX4A 2BKGA 3EHQA 1BI7B 2ZGDA 3DEOA 3SO8A 1BI8B 2DZOA 3IXEA 4JB8P 4GMRA 4Z68A 4HI8A 3V31A 1BU9A 4HB5A 1AWCB 4K5CA 5KNHD 1SW6A 3TWVA 3Q9NC 5JMND 4CYMD 5CECB 4BESA 4J7WA 4QFVA 5AN8A 5FIOA 4QQIA 5HRYA 3W9GA 3V2OA 3AJIA 4HBDA 5AQ9A 3D9HA 3J5PA 4OAUC 3V79K 3JUEA 4K5BA 4HLLA 5HS0A 1IKND 4UUCA 3UTMA 2MYOA 3UXGA 3T9KA 5ENPD 1IHBA 1UOHA 3JXIA 2NYJA 5HKPA 4RLYA 1IXVA 4HNAD 2ETAA 5ENTD 3ZUVB 4TUMA 2P2CP 4ZFHA 1SVXA 5AAOA 3W9FA 2KXPC 4O1OA 4B93B 1QYMA 3V2XA 5BXOA 3Q9UC 3TWSA 2HE0A 2V4HC 3C5RA 5ENSD 2QYJA 5BXUA 3TWUA 4YDYA 3TWQA 1BLXB 1NFIE 5AQAA 4CZ2D 4HRLA 3NOCD 4OAVB 1G3NB 2JABA 4LNUD 3TWRA 2ZGGA 4O60A 2F37A 2ETBA 4C48B 1OT8A 3ZNGA 4U95D 5KBAA 4HRMB 2RFMA 5ITZF 1DCQA 1MX6A 1A5EA 3TWTA 2XEHA 3TWWA 1N11A 3B95A 4ATZD 4DUIA 5EN5D 5CEDB 3B7BA 2DWZA 2A5EA 2XENA 4NIKA 4HI9A 4F1PA
chains in the Genus database with same CATH superfamily
4Y6WA 3Q79A 2GRNB 1TJFA 3FUDA 5JA4D 1DNPA 1TEZA 2GRMA 2DBAA 3ZFWA 1WDYA 1YMPA 4I6JA 3SFYA 4HOTA 3UM2A 5G05C 4BTAA 3CHSA 4UI9K 1O1TA 3EIQC 2I1JA 4DX5D 2PL2A 3FU5A 3MKRA 4B8CB 4XIFA 3FULA 2NSZA 3S7BA 1AP7A 4BERA 3LVQE 2P9SG 4A3TA 4CEMA 5FT9A 4BT8A 3ML8A 2DIWA 1Y6IA 4DK5A 3ABLE 2X3MA 4LEUA 3VTYA 4MKTA 3HDXA 1BI7B 4HI8A 1BU9A 4I6EA 4AVXA 4HB5A 4GZ6A 1SW6A 3Q9NC 4JPSA 4EQFA 4QQIA 1E96B 1XNFA 3Q75A 2BTDA 3WXXA 3V79K 4I6GA 4HLEA 4U0ZA 3VLFA 3KSLA 4Q69A 2H6IA 4UUCA 2VTBA 2FO7A 4ILHB 4RLYA 2WXOA 3B13A 2WXPA 3QWPA 1U2VG 5C2YA 3Q5MA 4U63A 3ULEG 4HOQA 5CHEE 5AJLA 4G1TA 1A5EA 4B0ZA 3AG2E 4XEIG 5H7PA 3CEQA 2CG2A 3FUKA 5KJKA 2XENA 2LXMA 3FTSA 1H6OA 2ETCA 4G8LA 3R9MA 3J5QB 5ENOD 4A1SA 4JL0A 4PH4B 5ENRD 1HZ4A 4M7CA 4A1GA 3FEXA 3PEUB 2VGEA 5CBOA 4J8YA 2AJAA 4PS8A 4UQXA 4N2QA 4HFGA 5EYPF 2KBXA 4XI9A 3L6AA 4JHRA 4URKA 3L16A 4GZCA 5M72A 3ZYMA 2KZTB 3CHMA 4R7LA 4G11A 5AQ7A 2QC9A 2BKGA 3ZPJA 2F0YA 4AOFA 2ZGDA 1BI8B 5FQ4A 4CGVA 4JA7A 2XGSA 3U3WA 1UN8A 2VSYA 3TWVA 3MV3B 5EX3A 5G2NA 2ZU6B 3V2OA 5ARFA 5BPPA 2GROB 5HS0A 3AS4A 3UTMA 4HXIA 5HKPA 4HNAD 4XKCA 4XZ4A 3PNTB 3CIAA 4LNGA 4RG6A 1OWLA 4E85A 3TWRA 4O60A 5EKQD 4AP2A 2UY1B 1KT0A 2RFMA 3OXGA 3E33A 4BX9A 2XEHA 5CEDB 2Y3AA 1TN8A 1V54E 1OWNA 3OTNA 4F1PA 3DPYA 3R9AB 4J8FA 2XS8A 4TV3A 1H2TC 1MYOA 3F6QA 4UWGA 3CVWA 3RRNB 3TXNA 3PH0C 4UWKA 4G23A 5CERB 4FULA 2X38A 2XRYA 1OUVA 1BD8A 4N3BA 2P9KG 3NQPA 2MOWA 3URZA 3UM3A 3DXKG 3CKBA 3MCXA 2Y4TA 1DCEA 2HM8A 3LY8A 4DX6D 3OAWA 3MJWA 3D9NA 4XKBA 3FTVA 4C0EA 2WXGA 3HYMB 5KNHD 2YHEA 4GMLA 4L9PA 2MHKA 2FF4A 1ZBPA 4ATGA 4BFRA 4OVUA 2CG3A 5FJYA 2X6HA 3R7QA 3UMVA 3NAWA 2PZIA 3CK7A 1SA4A 3PE3A 2ETAA 1K8KG 3ISMC 1A17A 4CGWA 2R17C 2VSOE 4J8SA 2QYJA 3TWQA 1MZCA 3G2SA 4AM9A 5FZSA 4LNBA 2P9UG 2ETBA 2YINA 4IN3B 3GYZA 2WXHA 4DUIA 4PS7A 3EIJA 2DWZA 4F3VA 5J08A 1IYGA 2NXPA 3ULYA 2P9LG 2J4DA 2P9IG 1FVHA 4EPZA 2H6GA 2AXUA 5G55A 2V4LA 3Q4AB 2XCBA 3CKCA 4FC8A 1SQMA 2WXLA 4JD2G 4O1PA 2F8XK 3FUEA 3HXCA 1TR4A 2PQRA 3C3OA 3CVVA 2OEWA 3D9JA 1YCSB 4N5QA 3AG3E 5FINA 3HVEB 4KMOA 3PUKA 3CHOA 4K0RA 4U0UA 4L2YA 5LOZA 3RO3A 1N4SA 1ELKA 3E4BA 5AN8A 4JEUA 5ANRA 2VGXB 2OVFA 3JUIA 2GW1A 3LY9A 2BF0X 2R05A 1IKND 1H19A 2IO3C 2FULA 4L2LA 2H6FA 1MHQA 5ENPD 1UOHA 3KSQA 2WXMA 1OCRE 3K9IA 4APOA 5CMYA 3LDZA 4GTTA 3ZIMA 3IEGA 1FCHA 1BLXB 1WM5A 3SI5A 4OAVB 1KZPA 3AS5A 4LNUD 4GPKA 2F37A 2R59A 2R02A 3FUHA 3T5VA 4LUNU 1JCRA 4BSZB 4KVMA 4U8VD 1TJCA 2LNIA 1FT1A 2Q7FA 4Q94A 2WXRA 3MZLB 1HG5A 4TXQA 3GZ1A 4TXPA 2QY7A 5KJMA 4F53A 3HG0D 4N5CA 3S7JA 4UQYA 3FH7A 3UM1A 1OCZE 1S0PA 2B0OE 3TG5A 2A4ZA 3CGHA 3ZKJA 4BETA 3AG4E 1NA3A 1N0QA 3NOGD 4J6IA 4L1BA 1TNUA 3DEOA 3ASHA 2ZISA 2R03A 3MEKA 1HF8A 3Q49B 3L08A 1S64A 3ENEA 5FQ6A 4JW1A 2XRZA 4EZLA 3MKQA 2VYIA 3ZYLA 2QYUA 4H7XA 4TRQA 2IFUA 3FEYA 2HE0A 3C5RA 5BXUA 1QNFA 4HRLA 4IRUA 3C3QA 1HG2A 4GYOA 2R2LA 3HXBA 4DPRA 1Z3YA 3Q15A 3IKOB 3FU6A 3PNLB 4GA1A 4HOUA 1PC2A 4ABNA 2A5EA 5FTPA 1FT2A 2HO1A 3Q47B 2XZTG 3AS8A 4K5AB 3QOUA 4GB9A 3FTXA 2GRLA 3FUFA 2GRRB 2DCPA 2XPIA 2L0IA 1LTXA 2P58C 3EU5A 5EILA 2BKKB 1U3DA 3HIZA 4JC8A 3EU9A 4LRZA 2V0PA 3ZN3A 4WNDA 3RAUA 3Q78A 4DI3A 4UWFA 1PAQA 2WMOA 3RSEG 3DSVA 1MX4A 5E76A 4U8HA 4N39A 4I9CA 3LXUX 4Z68A 3P1UA 4MBGA 4GTPA 3ZRHA 4CT0A 1UN9A 4JXTA 2HR2A 3AJIA 4HBDA 3IHVA 1O1SA 4K5BA 3O48A 1EDUA 4GCOA 4B93B 3E34A 1QYMA 3U4TA 2EINE 5D2MC 1NI1A 5FQ7A 5T4YA 3TWWA 1N94A 1HXIA 4NIKA 3ULQA 3UT8A 2EIJE 1N52A 4BX8A 1Z3XA 2YNQA 3SZ7A 4XE0A 2WQ7A 3AU5A 1E8XA 2DZNA 4GCNA 3ABME 3FUJA 1UJKA 4WWPA 2XEVA 2FO1E 2R5SA 1L5JA 2WM9A 5HQ8A 2AWIA 2OCCE 4KVOA 1N54A 4B8AA 3BQOA 2PNNA 4I17A 3C98A 3V30A 1INZA 3EHRA 3UT7A 4HQDA 5B1BE 1ELWA 5CRVA 4KZCA 4I2ZA 4V3IA 2Y4UA 1HO8A 1E8YA 4N2SA 3P2BA 4WNEA 2P9PG 2I6HA 4UWLA 4FA6A 2Y69E 1D8DA 4HLLA 4WUYA 2LSVA 3G2VA 5KJLA 3D9OA 2NYJA 4UI9C 1XGWA 4BSXA 2IEJA 3FH8A 3ZUVB 5LCWJ 2LAIA 1SVXA 5AAOA 2B6CA 1TNBA 2KCKA 4G24A 3JYSA 5T3RA 3PZDA 1E8ZA 5ENSD 3ZVVA 1H6PA 2WQ6A 3ZW3A 3PUJA 4D10C 3UPVA 1UJJA 1OWMA 2J49A 3WG7E 3PRZA 3TWTA 4A3VA 4GTMA 2QZAA 2V8SE 4A55A 5BNWA 1TN6A 3Q73A 1OY3D 2E0IA 2WB2A 3BG0B 3HXEA 3CK8A 1RZ4A 4DX1A 1YYHA 2GGFA 3DPDA 3JXJA 2KATA 2CHWA 2KZTA 2VSNA 3FHEA 1IHGA 5FZQA 3UINC 4YDEA 1EF1C 3MGBA 3ZGQA 1K3ZD 4EHMA 1UW4B 1X81A 4JB8P 4GMRA 2KCVA 1AWCB 3FU0A 5KCMA 1TNZA 3CQCB 5KJNA 4HORA 3J5PA 1E90A 3EDTB 3E32A 2JEKA 3PZ3A 4O6FA 4EBAA 3APDA 3PREA 4GU5A 5A7DB 4IULA 2UY1A 3PZ1A 4GA2A 5BV1A 4J0UA 2OV8A 3KD7A 3I4GA 3JQ0A 1KZOA 5ITZF 2VGYA 5EX0A 3FU3A 1BPOA 5D0QD 3D9LA 2KCLA 4HOSA 3FDHA 3ZHEA 4GZ5A 4JZYA 4YDOA 3UQ3A 1N95A 1JWFA 3RK6A 1Z5SC 4JEHA 3EJNA 2IOLA 2X6IA 2XZDG 4GPMA 2DVWA 1S70B 4P29A 2WXKA 4M3OA 5KWDA 2XS1A 5EDSA 3AAAC 1U3CA 4PUCA 3PS6A 1LD7A 4XX5A 4UWHA 3HRAA 2Y0BG 4GTQA 2VJ8A 5J90A 3G2WA 1NL4A 2V5FA 4G26A 5JHAA 1QZ2A 3IXEA 3HXFA 2WQHA 5G05J 4EZKA 2WXNA 2XGMA 2BUGA 3ZXPA 1LF8A 5JJ6A 2DYRE 1N4QA 5C1DA 3UXGA 4GTRA 3D9MA 3ML9A 1FVFA 4U0SA 2KXPC 3V2XA 4E6HA 4AEZC 3Q9UC 3PZ2A 1NFIE 2IQCA 4ACKA 4KBQA 1ELRA 1G3NB 1DVPA 2JABA 4GAAA 2JLBA 4CRWA 2IF4A 1V55E 3PVLA 3B7UX 4HRMB 1HFAA 1MX6A 3CQGB 4ATZD 1N11A 5AJDA 1ZB1A 2FBNA 5FZRA 4U07A 3QJZA 4MRUA 3CVLA 3B7TA 1FPPA 5B1AE 3B7RL 2MRIA 3GZSA 3ASFA 3Q7FA 2I2OA 2KC7A 5BW8C 5B3SE 3SD5A 3QAQA 3UKRG 5KNGA 1B89A 4PDXA 1HH8A 4FHKA 3BEEA 4NQ0A 3R7RA 4GTOA 3MV2B 1WG0A 3FUIA 5ANLA 1SZAA 4FJYA 3KAEA 4I43A 3TXMA 1N4RA 3EHQA 3MA5A 2NC9A 2VGXA 4CCAA 2M63A 4WWOA 3MYVA 4BESA 3MKQB 2X6FA 2XGOA 3Q7AA 5DBKA 3EUVA 4I1OB 3QARA 5D0OD 1NP7A 1SA5A 4HS2A 2ZGGA 2LO6A 2CFUA 4EECA 2C0MA 2EQXA 3PE4A 4OYSA 4ANWA 5CMWA 2WMNA 3B95A 3DSTA 1O1RA 4NURA 1E8WA 4X8QA 1MJ0A 2I1KA 1X5BA 3APCA 1MX2A 4ANVA 4LG6A 3UT4A 3HHMA 3PZ4A 3X2QE 2L6BA 5AYWD 3TAXA 1K1BA 2IO2C 4L7TA 3ONLA 2BEDA 3TL5A 3U64A 2IJGX 3CHRA 4RVBA 2VQ2A 3TWXA 4DJAA 1JCQA 4LCTA 2VSXE 3CVNA 3D9IA 4ME2A 5IY5E 5FIOA 3UM0A 3W9GA 2X6JA 3EHNA 3L22A 4ILIA 2I9CA 1QBQA 1TN7A 2L6JA 3UKUG 4OVVA 3ABKE 3E37A 3JUEA 4BWRA 3LCAA 5BUZA 4WAFA 1TNYA 3D9KA 1WY6A 3GZ2A 4O1OA 1NA0A 3TJPA 5FQ8A 2VTBB 3NB2A 3LEWA 2RD0A 2XPZA 2YQ8A 1NZNA 4K03A 4C48B 2XHEA 2AXVA 5T8IA 3UX4A 5CBNA 3SGHA 4LERA 1JCSA 2AXZA 2J07A 1DC2A 1HU3A 4EBAG 5BV0A 5LFAA 4A63B 3RIBA 3FUNA 4RG9A 2QFCA 4DRXE 3SQVA 2LSUA 2E2EA 3DSXA 4WNFA 1KLXA 5AENA 3D9PA 2XEEA 2X6KA 2CHXA 1JUQA 3S7DA 4DI4A 3KS2A 4XI0A 3CVYA 1D9SA 3ZYQA 2F8YA 3SHFA 3CVXA 3AU4A 3SFXA 1GW6A 4G25A 3CK9A 2XPYA 3FTUA 1WAO1 2WVIA 3QNKA 3FFLA 4RSYA 3UIPC 2CHZA 4ACLA 2C0LA 3IHYA 4C9BB 5JMND 5HRYA 3ESKA 2GRPB 1PY1A 3T8MA 3OXLA 4AIFA 3L54A 2EIKE 3T9KA 5CCLA 4RQIA 4CDNA 4TUMA 3DXMG 3QKYA 4W9RA 3JQ1A 2PM6A 5AQAA 4JVSA 3QWVA 1Q2ZA 4I1MA 4N3CA 3LY7A 1ZU2A 5DIZA 2J9QA 3B7BA 3ASGA 5ENQD 3OXFA 4N3AA 1TYQG 5G04C 4JHKA 3EHMA 4C0MA 1N4PA 1IQRA 4B89A 3TG4A 4NRHB 3FTYA 4I9EA 4JA9A 4GYWA 5EYLA 4FADA 1HE8A 5E75A 4BT9A 3C72A 3QWWA 2V5QC 2J09A 3RO2A 2WXFA 3ZU7B 3DEPA 3SY2A 1SZ9A 1OXJA 5AARA 2ZIRA 4G8KA 5AIJA 5D66A 4GYYA 2L9BA 4DLQA 3APFA 4F6RD 4B94A 3UI2A 3NBNB 5BT1A 3FTZA 3MX3A 4ANXA 3G2UA 4YVQC 1MQSA 1QQEA 3PDNA 5AQ9A 3D9HA 4OAUC 3VLDA 2XQ0A 2ZXWE 3JXIA 4U04A 1OWPA 5ENTD 3JCKC 3W9FA 1IQUA 3HXDA 2P9NG 5LX8A 4EZJA 3TWUA 4CZ2D 3ZYKA 4GTSA 3ZHEB 3C3RA 3LPZA 2J4BA 3ESLA 3RU0A 5KBAA 2OOEA 4U95D 3CHPA 4MLPA 4AV7A 1KT1A 3BG1B 4CT4A 1TNOA 1D8EA 2LXLA 4FLBA 3CR3A 3N71A 4TXRA 3QDNA 5EIBE 4BEPA 4U96D 2DYSE 3FTWA 4GMJA 1H2UA 1EYHA 2GRQB 4ZHBA 2AVPA 1K1AA 4DX7D 1H0AA 3CVPA 4I1AA 3CVQA 3LJNA 3DWLG 5EIDA 5HI7A 3VTXA 4FJZA 1RW2A 3G2TA 3GW4A 1KPSB 3ASOE 4YVOA 1UG3A 5FWQA 2IONA 3TGOA 3L82A 3CSFA 3IV0A 3V31A 2AW6A 5JJ7A 4CYMD 4AY5A 4J7WA 4L23A 4Q96A 3SF4A 2ILRA 3O4ZA 4PS3A 4AXHA 3CV0A 4TUUA 2XCCA 3L9TA 3L17A 3CVUA 2PQNA 3FH5A 3RKVA 1VDYA 4FU3A 3NZUA 3LVRE 1LD8A 2P2CP 1JPLA 1OWOA 3SBTB 2V4HC 1OCOE 4YDYA 3NF1A 3NOCD 3VLEA 3UUXA 4GTVA 1H2VC 3SBSA 1P5QA 4GZDA 1DCQA 1HS6A 4F7AA 4HI9A 3T5XA 2OEVA 2J8SD 4GZ3A 5CEAA 3IBEA 1OCCE 3S7FA 3U9WA 2RFAA 4AJWA 2UWJG 4AY6A 3T8KA 2CFZA 3DBSA 4FHJA 3BUAA 3KEAA 3LKUA 4DLOA 1Z6TA 3CLJA 3DSUA 2L0TB 3QK0A 1HX8A 1N0RA 3PEVB 5LCWC 4YNDA 4MS6A 4JHJA 2WXJA 2WXIA 4CDMA 5A6CA 4WNGA 4CDRA 4ANUA 4J8DA 3LS8A 4FLHA 1Y8MA 2FI7A 3CSTA 3SO8A 2DZOA 3RJVA 5JJTA 3FY4A 1EPUA 5CECB 2FEZA 3HVEA 4QFVA 3AG1E 3QC1A 1E7VA 3ASNE 3I3NA 5ENNA 2OVBA 1IHBA 2WXQA 4J8EA 1IXVA 2C2LA 5ARGA 3RRMB 2WPVA 1H6KA 4KZ0A 1JWGA 4KYOB 4HVBA 4I2WA 3ZNGA 3RRUA 3D3MA 5EN5D 3B7SA 2A5UA 2HYZA 2IOSA 2Y1LE 4UI9J 2LAHA 5CRUA 3FP3A 4NACA 5G04J 2KM4A 3E30A 4HRNA 5AQBA 4DX2A 4KXKB 4WWNA 2RG8A 4UQZA 3LJ3A 3LYAA 3I5PA 2EIME 1O5MA 3BU8A 3ONKA 2J08A 3ZXSA 5JHBA 4KT6B 4F1SA 3NZSA 4LSZE 4YDWA 2YHCA 4FP7A 4U7EB 3DSSA 2IY0C 4U8YD 5CCMA 3UIOC 1YA0A 3U66A 4K5CA 5A23A 3CHQA 2PM7A 4G2VA 4BY6A 3FUMA 3DRAA 3KEZA 3L13A 2H6HA 3DSWA 1N9AA 3S2AA 3ASDA 2MYOA 4H7YA 4ZFHA 3ZEFA 3SNXA 4GA0A 2EILE 3FWVA 5BXOA 3TWSA 1S63A 2RKKA 1W3BA 4Y6CA 5LP0A 3QB2A 1OT8A 4BTBA 2LUHA 2IU1A 2ONDA 4ILGA 3I4RB 1E7UA 4IYPA 3SFZA 4APFA
chains in the Genus database with same CATH topology
2ETCA 4G8LA 5CBNA 2J8SD 3J5QB 4U8VD 5ENOD 5CEAA 2Y1LE 1OY3D 2XZTG 4K5AB 5JA4D 1DC2A 1MJ0A 1MYOA 5EIBE 3F6QA 4BSZB 4A63B 5ENRD 1WDYA 1YMPA 2DZNA 1MX2A 4DRXE 5EYLA 4BEPA 4HRNA 2RFAA 5AQBA 4LG6A 4U96D 4DX2A 4O1PA 5CERB 3T8KA 2F8XK 2VGEA 3HG0D 2V5QC 5CBOA 4DX1A 4ZHBA 1YYHA 4J8YA 2AJAA 1TR4A 2XEEA 1K1AA 5EILA 2FO1E 2XZDG 5KNGA 4GPMA 4DX5D 4DX7D 2BKKB 2DVWA 2L6BA 1S70B 3KEAA 2KBXA 5EYPF 3ZU7B 3DEPA 3JXJA 3EU9A 3LJNA 1AP7A 2B0OE 4BERA 1BD8A 5KWDA 1K1BA 5ENQD 5EIDA 5AARA 1D9SA 3AAAC 1N0RA 1YCSB 4N5QA 2F8YA 4G8KA 3ZKJA 5D66A 2PNNA 4LSZE 4BETA 4YDWA 3V30A 3HRAA 2Y0BG 5FINA 1WG0A 4F6RD 3UI2A 4DX6D 1N0QA 1K3ZD 3EHRA 3TWXA 3NBNB 5AQ7A 3NOGD 4HQDA 2QC9A 4U8YD 1MX4A 2BKGA 3EHQA 1BI7B 2ZGDA 3DEOA 3SO8A 1BI8B 2DZOA 3IXEA 4JB8P 4GMRA 4Z68A 4HI8A 3V31A 1BU9A 4HB5A 1AWCB 4K5CA 5KNHD 1SW6A 3TWVA 3Q9NC 5JMND 4CYMD 5CECB 4BESA 4J7WA 4QFVA 5AN8A 5FIOA 4QQIA 5HRYA 3W9GA 3V2OA 3AJIA 4HBDA 5AQ9A 3D9HA 3J5PA 4OAUC 3V79K 3JUEA 4K5BA 4HLLA 5HS0A 1IKND 4UUCA 3UTMA 2MYOA 3UXGA 3T9KA 5ENPD 1IHBA 1UOHA 3JXIA 2NYJA 5HKPA 4RLYA 1IXVA 4HNAD 2ETAA 5ENTD 3ZUVB 4TUMA 2P2CP 4ZFHA 1SVXA 5AAOA 3W9FA 2KXPC 4O1OA 4B93B 1QYMA 3V2XA 5BXOA 3Q9UC 3TWSA 2HE0A 2V4HC 3C5RA 5ENSD 2QYJA 5BXUA 3TWUA 4YDYA 3TWQA 1BLXB 1NFIE 5AQAA 4CZ2D 4HRLA 3NOCD 4OAVB 1G3NB 2JABA 4LNUD 3TWRA 2ZGGA 4O60A 2F37A 2ETBA 4C48B 1OT8A 3ZNGA 4U95D 5KBAA 4HRMB 2RFMA 5ITZF 1DCQA 1MX6A 1A5EA 3TWTA 2XEHA 3TWWA 1N11A 3B95A 4ATZD 4DUIA 5EN5D 5CEDB 3B7BA 2DWZA 2A5EA 2XENA 4NIKA 4HI9A 4F1PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ETC A;  4G8L A;  5CBN A;  2J8S D;  3J5Q B;  4U8V D;  5ENO D;  5CEA A;  2Y1L E;  1OY3 D;  2XZT G;  4K5A B;  5JA4 D;  1DC2 A;  1MJ0 A;  1MYO A;  5EIB E;  3F6Q A;  4BSZ B;  4A63 B;  5ENR D;  1WDY A;  1YMP A;  2DZN A;  1MX2 A;  4DRX E;  5EYL A;  4BEP A;  4HRN A;  2RFA A;  5AQB A;  4LG6 A;  4U96 D;  4DX2 A;  4O1P A;  5CER B;  3T8K A;  2F8X K;  2VGE A;  3HG0 D;  2V5Q C;  5CBO A;  4DX1 A;  4ZHB A;  1YYH A;  4J8Y A;  2AJA A;  1TR4 A;  2XEE A;  1K1A A;  5EIL A;  2FO1 E;  2XZD G;  5KNG A;  4GPM A;  4DX5 D;  4DX7 D;  2BKK B;  2DVW A;  2L6B A;  1S70 B;  3KEA A;  2KBX A;  5EYP F;  3ZU7 B;  3DEP A;  3JXJ A;  3EU9 A;  3LJN A;  1AP7 A;  2B0O E;  4BER A;  1BD8 A;  5KWD A;  1K1B A;  5ENQ D;  5EID A;  5AAR A;  1D9S A;  3AAA C;  1N0R A;  1YCS B;  4N5Q A;  2F8Y A;  4G8K A;  3ZKJ A;  5D66 A;  2PNN A;  4LSZ E;  4BET A;  4YDW A;  3V30 A;  3HRA A;  2Y0B G;  5FIN A;  1WG0 A;  4F6R D;  3UI2 A;  4DX6 D;  1N0Q A;  1K3Z D;  3EHR A;  3TWX A;  3NBN B;  5AQ7 A;  3NOG D;  4HQD A;  2QC9 A;  4U8Y D;  1MX4 A;  2BKG A;  3EHQ A;  1BI7 B;  2ZGD A;  3DEO A;  3SO8 A;  1BI8 B;  2DZO A;  3IXE A;  4JB8 P;  4GMR A;  4Z68 A;  4HI8 A;  3V31 A;  1BU9 A;  4HB5 A;  1AWC B;  4K5C A;  5KNH D;  1SW6 A;  3TWV A;  3Q9N C;  5JMN D;  4CYM D;  5CEC B;  4BES A;  4J7W A;  4QFV A;  5AN8 A;  5FIO A;  4QQI A;  5HRY A;  3W9G A;  3V2O A;  3AJI A;  4HBD A;  5AQ9 A;  3D9H A;  3J5P A;  4OAU C;  3V79 K;  3JUE A;  4K5B A;  4HLL A;  5HS0 A;  1IKN D;  4UUC A;  3UTM A;  2MYO A;  3UXG A;  3T9K A;  5ENP D;  1IHB A;  1UOH A;  3JXI A;  2NYJ A;  5HKP A;  4RLY A;  1IXV A;  4HNA D;  2ETA A;  5ENT D;  3ZUV B;  4TUM A;  2P2C P;  4ZFH A;  1SVX A;  5AAO A;  3W9F A;  2KXP C;  4O1O A;  4B93 B;  1QYM A;  3V2X A;  5BXO A;  3Q9U C;  3TWS A;  2HE0 A;  2V4H C;  3C5R A;  5ENS D;  2QYJ A;  5BXU A;  3TWU A;  4YDY A;  3TWQ A;  1BLX B;  1NFI E;  5AQA A;  4CZ2 D;  4HRL A;  3NOC D;  4OAV B;  1G3N B;  2JAB A;  4LNU D;  3TWR A;  2ZGG A;  4O60 A;  2F37 A;  2ETB A;  4C48 B;  1OT8 A;  3ZNG A;  4U95 D;  5KBA A;  4HRM B;  2RFM A;  5ITZ F;  1DCQ A;  1MX6 A;  1A5E A;  3TWT A;  2XEH A;  3TWW A;  1N11 A;  3B95 A;  4ATZ D;  4DUI A;  5EN5 D;  5CED B;  3B7B A;  2DWZ A;  2A5E A;  2XEN A;  4NIK A;  4HI9 A;  4F1P A; 
#chains in the Genus database with same CATH topology
 4Y6W A;  3Q79 A;  2GRN B;  1TJF A;  3FUD A;  5JA4 D;  1DNP A;  1TEZ A;  2GRM A;  2DBA A;  3ZFW A;  1WDY A;  1YMP A;  4I6J A;  3SFY A;  4HOT A;  3UM2 A;  5G05 C;  4BTA A;  3CHS A;  4UI9 K;  1O1T A;  3EIQ C;  2I1J A;  4DX5 D;  2PL2 A;  3FU5 A;  3MKR A;  4B8C B;  4XIF A;  3FUL A;  2NSZ A;  3S7B A;  1AP7 A;  4BER A;  3LVQ E;  2P9S G;  4A3T A;  4CEM A;  5FT9 A;  4BT8 A;  3ML8 A;  2DIW A;  1Y6I A;  4DK5 A;  3ABL E;  2X3M A;  4LEU A;  3VTY A;  4MKT A;  3HDX A;  1BI7 B;  4HI8 A;  1BU9 A;  4I6E A;  4AVX A;  4HB5 A;  4GZ6 A;  1SW6 A;  3Q9N C;  4JPS A;  4EQF A;  4QQI A;  1E96 B;  1XNF A;  3Q75 A;  2BTD A;  3WXX A;  3V79 K;  4I6G A;  4HLE A;  4U0Z A;  3VLF A;  3KSL A;  4Q69 A;  2H6I A;  4UUC A;  2VTB A;  2FO7 A;  4ILH B;  4RLY A;  2WXO A;  3B13 A;  2WXP A;  3QWP A;  1U2V G;  5C2Y A;  3Q5M A;  4U63 A;  3ULE G;  4HOQ A;  5CHE E;  5AJL A;  4G1T A;  1A5E A;  4B0Z A;  3AG2 E;  4XEI G;  5H7P A;  3CEQ A;  2CG2 A;  3FUK A;  5KJK A;  2XEN A;  2LXM A;  3FTS A;  1H6O A;  2ETC A;  4G8L A;  3R9M A;  3J5Q B;  5ENO D;  4A1S A;  4JL0 A;  4PH4 B;  5ENR D;  1HZ4 A;  4M7C A;  4A1G A;  3FEX A;  3PEU B;  2VGE A;  5CBO A;  4J8Y A;  2AJA A;  4PS8 A;  4UQX A;  4N2Q A;  4HFG A;  5EYP F;  2KBX A;  4XI9 A;  3L6A A;  4JHR A;  4URK A;  3L16 A;  4GZC A;  5M72 A;  3ZYM A;  2KZT B;  3CHM A;  4R7L A;  4G11 A;  5AQ7 A;  2QC9 A;  2BKG A;  3ZPJ A;  2F0Y A;  4AOF A;  2ZGD A;  1BI8 B;  5FQ4 A;  4CGV A;  4JA7 A;  2XGS A;  3U3W A;  1UN8 A;  2VSY A;  3TWV A;  3MV3 B;  5EX3 A;  5G2N A;  2ZU6 B;  3V2O A;  5ARF A;  5BPP A;  2GRO B;  5HS0 A;  3AS4 A;  3UTM A;  4HXI A;  5HKP A;  4HNA D;  4XKC A;  4XZ4 A;  3PNT B;  3CIA A;  4LNG A;  4RG6 A;  1OWL A;  4E85 A;  3TWR A;  4O60 A;  5EKQ D;  4AP2 A;  2UY1 B;  1KT0 A;  2RFM A;  3OXG A;  3E33 A;  4BX9 A;  2XEH A;  5CED B;  2Y3A A;  1TN8 A;  1V54 E;  1OWN A;  3OTN A;  4F1P A;  3DPY A;  3R9A B;  4J8F A;  2XS8 A;  4TV3 A;  1H2T C;  1MYO A;  3F6Q A;  4UWG A;  3CVW A;  3RRN B;  3TXN A;  3PH0 C;  4UWK A;  4G23 A;  5CER B;  4FUL A;  2X38 A;  2XRY A;  1OUV A;  1BD8 A;  4N3B A;  2P9K G;  3NQP A;  2MOW A;  3URZ A;  3UM3 A;  3DXK G;  3CKB A;  3MCX A;  2Y4T A;  1DCE A;  2HM8 A;  3LY8 A;  4DX6 D;  3OAW A;  3MJW A;  3D9N A;  4XKB A;  3FTV A;  4C0E A;  2WXG A;  3HYM B;  5KNH D;  2YHE A;  4GML A;  4L9P A;  2MHK A;  2FF4 A;  1ZBP A;  4ATG A;  4BFR A;  4OVU A;  2CG3 A;  5FJY A;  2X6H A;  3R7Q A;  3UMV A;  3NAW A;  2PZI A;  3CK7 A;  1SA4 A;  3PE3 A;  2ETA A;  1K8K G;  3ISM C;  1A17 A;  4CGW A;  2R17 C;  2VSO E;  4J8S A;  2QYJ A;  3TWQ A;  1MZC A;  3G2S A;  4AM9 A;  5FZS A;  4LNB A;  2P9U G;  2ETB A;  2YIN A;  4IN3 B;  3GYZ A;  2WXH A;  4DUI A;  4PS7 A;  3EIJ A;  2DWZ A;  4F3V A;  5J08 A;  1IYG A;  2NXP A;  3ULY A;  2P9L G;  2J4D A;  2P9I G;  1FVH A;  4EPZ A;  2H6G A;  2AXU A;  5G55 A;  2V4L A;  3Q4A B;  2XCB A;  3CKC A;  4FC8 A;  1SQM A;  2WXL A;  4JD2 G;  4O1P A;  2F8X K;  3FUE A;  3HXC A;  1TR4 A;  2PQR A;  3C3O A;  3CVV A;  2OEW A;  3D9J A;  1YCS B;  4N5Q A;  3AG3 E;  5FIN A;  3HVE B;  4KMO A;  3PUK A;  3CHO A;  4K0R A;  4U0U A;  4L2Y A;  5LOZ A;  3RO3 A;  1N4S A;  1ELK A;  3E4B A;  5AN8 A;  4JEU A;  5ANR A;  2VGX B;  2OVF A;  3JUI A;  2GW1 A;  3LY9 A;  2BF0 X;  2R05 A;  1IKN D;  1H19 A;  2IO3 C;  2FUL A;  4L2L A;  2H6F A;  1MHQ A;  5ENP D;  1UOH A;  3KSQ A;  2WXM A;  1OCR E;  3K9I A;  4APO A;  5CMY A;  3LDZ A;  4GTT A;  3ZIM A;  3IEG A;  1FCH A;  1BLX B;  1WM5 A;  3SI5 A;  4OAV B;  1KZP A;  3AS5 A;  4LNU D;  4GPK A;  2F37 A;  2R59 A;  2R02 A;  3FUH A;  3T5V A;  4LUN U;  1JCR A;  4BSZ B;  4KVM A;  4U8V D;  1TJC A;  2LNI A;  1FT1 A;  2Q7F A;  4Q94 A;  2WXR A;  3MZL B;  1HG5 A;  4TXQ A;  3GZ1 A;  4TXP A;  2QY7 A;  5KJM A;  4F53 A;  3HG0 D;  4N5C A;  3S7J A;  4UQY A;  3FH7 A;  3UM1 A;  1OCZ E;  1S0P A;  2B0O E;  3TG5 A;  2A4Z A;  3CGH A;  3ZKJ A;  4BET A;  3AG4 E;  1NA3 A;  1N0Q A;  3NOG D;  4J6I A;  4L1B A;  1TNU A;  3DEO A;  3ASH A;  2ZIS A;  2R03 A;  3MEK A;  1HF8 A;  3Q49 B;  3L08 A;  1S64 A;  3ENE A;  5FQ6 A;  4JW1 A;  2XRZ A;  4EZL A;  3MKQ A;  2VYI A;  3ZYL A;  2QYU A;  4H7X A;  4TRQ A;  2IFU A;  3FEY A;  2HE0 A;  3C5R A;  5BXU A;  1QNF A;  4HRL A;  4IRU A;  3C3Q A;  1HG2 A;  4GYO A;  2R2L A;  3HXB A;  4DPR A;  1Z3Y A;  3Q15 A;  3IKO B;  3FU6 A;  3PNL B;  4GA1 A;  4HOU A;  1PC2 A;  4ABN A;  2A5E A;  5FTP A;  1FT2 A;  2HO1 A;  3Q47 B;  2XZT G;  3AS8 A;  4K5A B;  3QOU A;  4GB9 A;  3FTX A;  2GRL A;  3FUF A;  2GRR B;  2DCP A;  2XPI A;  2L0I A;  1LTX A;  2P58 C;  3EU5 A;  5EIL A;  2BKK B;  1U3D A;  3HIZ A;  4JC8 A;  3EU9 A;  4LRZ A;  2V0P A;  3ZN3 A;  4WND A;  3RAU A;  3Q78 A;  4DI3 A;  4UWF A;  1PAQ A;  2WMO A;  3RSE G;  3DSV A;  1MX4 A;  5E76 A;  4U8H A;  4N39 A;  4I9C A;  3LXU X;  4Z68 A;  3P1U A;  4MBG A;  4GTP A;  3ZRH A;  4CT0 A;  1UN9 A;  4JXT A;  2HR2 A;  3AJI A;  4HBD A;  3IHV A;  1O1S A;  4K5B A;  3O48 A;  1EDU A;  4GCO A;  4B93 B;  3E34 A;  1QYM A;  3U4T A;  2EIN E;  5D2M C;  1NI1 A;  5FQ7 A;  5T4Y A;  3TWW A;  1N94 A;  1HXI A;  4NIK A;  3ULQ A;  3UT8 A;  2EIJ E;  1N52 A;  4BX8 A;  1Z3X A;  2YNQ A;  3SZ7 A;  4XE0 A;  2WQ7 A;  3AU5 A;  1E8X A;  2DZN A;  4GCN A;  3ABM E;  3FUJ A;  1UJK A;  4WWP A;  2XEV A;  2FO1 E;  2R5S A;  1L5J A;  2WM9 A;  5HQ8 A;  2AWI A;  2OCC E;  4KVO A;  1N54 A;  4B8A A;  3BQO A;  2PNN A;  4I17 A;  3C98 A;  3V30 A;  1INZ A;  3EHR A;  3UT7 A;  4HQD A;  5B1B E;  1ELW A;  5CRV A;  4KZC A;  4I2Z A;  4V3I A;  2Y4U A;  1HO8 A;  1E8Y A;  4N2S A;  3P2B A;  4WNE A;  2P9P G;  2I6H A;  4UWL A;  4FA6 A;  2Y69 E;  1D8D A;  4HLL A;  4WUY A;  2LSV A;  3G2V A;  5KJL A;  3D9O A;  2NYJ A;  4UI9 C;  1XGW A;  4BSX A;  2IEJ A;  3FH8 A;  3ZUV B;  5LCW J;  2LAI A;  1SVX A;  5AAO A;  2B6C A;  1TNB A;  2KCK A;  4G24 A;  3JYS A;  5T3R A;  3PZD A;  1E8Z A;  5ENS D;  3ZVV A;  1H6P A;  2WQ6 A;  3ZW3 A;  3PUJ A;  4D10 C;  3UPV A;  1UJJ A;  1OWM A;  2J49 A;  3WG7 E;  3PRZ A;  3TWT A;  4A3V A;  4GTM A;  2QZA A;  2V8S E;  4A55 A;  5BNW A;  1TN6 A;  3Q73 A;  1OY3 D;  2E0I A;  2WB2 A;  3BG0 B;  3HXE A;  3CK8 A;  1RZ4 A;  4DX1 A;  1YYH A;  2GGF A;  3DPD A;  3JXJ A;  2KAT A;  2CHW A;  2KZT A;  2VSN A;  3FHE A;  1IHG A;  5FZQ A;  3UIN C;  4YDE A;  1EF1 C;  3MGB A;  3ZGQ A;  1K3Z D;  4EHM A;  1UW4 B;  1X81 A;  4JB8 P;  4GMR A;  2KCV A;  1AWC B;  3FU0 A;  5KCM A;  1TNZ A;  3CQC B;  5KJN A;  4HOR A;  3J5P A;  1E90 A;  3EDT B;  3E32 A;  2JEK A;  3PZ3 A;  4O6F A;  4EBA A;  3APD A;  3PRE A;  4GU5 A;  5A7D B;  4IUL A;  2UY1 A;  3PZ1 A;  4GA2 A;  5BV1 A;  4J0U A;  2OV8 A;  3KD7 A;  3I4G A;  3JQ0 A;  1KZO A;  5ITZ F;  2VGY A;  5EX0 A;  3FU3 A;  1BPO A;  5D0Q D;  3D9L A;  2KCL A;  4HOS A;  3FDH A;  3ZHE A;  4GZ5 A;  4JZY A;  4YDO A;  3UQ3 A;  1N95 A;  1JWF A;  3RK6 A;  1Z5S C;  4JEH A;  3EJN A;  2IOL A;  2X6I A;  2XZD G;  4GPM A;  2DVW A;  1S70 B;  4P29 A;  2WXK A;  4M3O A;  5KWD A;  2XS1 A;  5EDS A;  3AAA C;  1U3C A;  4PUC A;  3PS6 A;  1LD7 A;  4XX5 A;  4UWH A;  3HRA A;  2Y0B G;  4GTQ A;  2VJ8 A;  5J90 A;  3G2W A;  1NL4 A;  2V5F A;  4G26 A;  5JHA A;  1QZ2 A;  3IXE A;  3HXF A;  2WQH A;  5G05 J;  4EZK A;  2WXN A;  2XGM A;  2BUG A;  3ZXP A;  1LF8 A;  5JJ6 A;  2DYR E;  1N4Q A;  5C1D A;  3UXG A;  4GTR A;  3D9M A;  3ML9 A;  1FVF A;  4U0S A;  2KXP C;  3V2X A;  4E6H A;  4AEZ C;  3Q9U C;  3PZ2 A;  1NFI E;  2IQC A;  4ACK A;  4KBQ A;  1ELR A;  1G3N B;  1DVP A;  2JAB A;  4GAA A;  2JLB A;  4CRW A;  2IF4 A;  1V55 E;  3PVL A;  3B7U X;  4HRM B;  1HFA A;  1MX6 A;  3CQG B;  4ATZ D;  1N11 A;  5AJD A;  1ZB1 A;  2FBN A;  5FZR A;  4U07 A;  3QJZ A;  4MRU A;  3CVL A;  3B7T A;  1FPP A;  5B1A E;  3B7R L;  2MRI A;  3GZS A;  3ASF A;  3Q7F A;  2I2O A;  2KC7 A;  5BW8 C;  5B3S E;  3SD5 A;  3QAQ A;  3UKR G;  5KNG A;  1B89 A;  4PDX A;  1HH8 A;  4FHK A;  3BEE A;  4NQ0 A;  3R7R A;  4GTO A;  3MV2 B;  1WG0 A;  3FUI A;  5ANL A;  1SZA A;  4FJY A;  3KAE A;  4I43 A;  3TXM A;  1N4R A;  3EHQ A;  3MA5 A;  2NC9 A;  2VGX A;  4CCA A;  2M63 A;  4WWO A;  3MYV A;  4BES A;  3MKQ B;  2X6F A;  2XGO A;  3Q7A A;  5DBK A;  3EUV A;  4I1O B;  3QAR A;  5D0O D;  1NP7 A;  1SA5 A;  4HS2 A;  2ZGG A;  2LO6 A;  2CFU A;  4EEC A;  2C0M A;  2EQX A;  3PE4 A;  4OYS A;  4ANW A;  5CMW A;  2WMN A;  3B95 A;  3DST A;  1O1R A;  4NUR A;  1E8W A;  4X8Q A;  1MJ0 A;  2I1K A;  1X5B A;  3APC A;  1MX2 A;  4ANV A;  4LG6 A;  3UT4 A;  3HHM A;  3PZ4 A;  3X2Q E;  2L6B A;  5AYW D;  3TAX A;  1K1B A;  2IO2 C;  4L7T A;  3ONL A;  2BED A;  3TL5 A;  3U64 A;  2IJG X;  3CHR A;  4RVB A;  2VQ2 A;  3TWX A;  4DJA A;  1JCQ A;  4LCT A;  2VSX E;  3CVN A;  3D9I A;  4ME2 A;  5IY5 E;  5FIO A;  3UM0 A;  3W9G A;  2X6J A;  3EHN A;  3L22 A;  4ILI A;  2I9C A;  1QBQ A;  1TN7 A;  2L6J A;  3UKU G;  4OVV A;  3ABK E;  3E37 A;  3JUE A;  4BWR A;  3LCA A;  5BUZ A;  4WAF A;  1TNY A;  3D9K A;  1WY6 A;  3GZ2 A;  4O1O A;  1NA0 A;  3TJP A;  5FQ8 A;  2VTB B;  3NB2 A;  3LEW A;  2RD0 A;  2XPZ A;  2YQ8 A;  1NZN A;  4K03 A;  4C48 B;  2XHE A;  2AXV A;  5T8I A;  3UX4 A;  5CBN A;  3SGH A;  4LER A;  1JCS A;  2AXZ A;  2J07 A;  1DC2 A;  1HU3 A;  4EBA G;  5BV0 A;  5LFA A;  4A63 B;  3RIB A;  3FUN A;  4RG9 A;  2QFC A;  4DRX E;  3SQV A;  2LSU A;  2E2E A;  3DSX A;  4WNF A;  1KLX A;  5AEN A;  3D9P A;  2XEE A;  2X6K A;  2CHX A;  1JUQ A;  3S7D A;  4DI4 A;  3KS2 A;  4XI0 A;  3CVY A;  1D9S A;  3ZYQ A;  2F8Y A;  3SHF A;  3CVX A;  3AU4 A;  3SFX A;  1GW6 A;  4G25 A;  3CK9 A;  2XPY A;  3FTU A;  1WAO 1;  2WVI A;  3QNK A;  3FFL A;  4RSY A;  3UIP C;  2CHZ A;  4ACL A;  2C0L A;  3IHY A;  4C9B B;  5JMN D;  5HRY A;  3ESK A;  2GRP B;  1PY1 A;  3T8M A;  3OXL A;  4AIF A;  3L54 A;  2EIK E;  3T9K A;  5CCL A;  4RQI A;  4CDN A;  4TUM A;  3DXM G;  3QKY A;  4W9R A;  3JQ1 A;  2PM6 A;  5AQA A;  4JVS A;  3QWV A;  1Q2Z A;  4I1M A;  4N3C A;  3LY7 A;  1ZU2 A;  5DIZ A;  2J9Q A;  3B7B A;  3ASG A;  5ENQ D;  3OXF A;  4N3A A;  1TYQ G;  5G04 C;  4JHK A;  3EHM A;  4C0M A;  1N4P A;  1IQR A;  4B89 A;  3TG4 A;  4NRH B;  3FTY A;  4I9E A;  4JA9 A;  4GYW A;  5EYL A;  4FAD A;  1HE8 A;  5E75 A;  4BT9 A;  3C72 A;  3QWW A;  2V5Q C;  2J09 A;  3RO2 A;  2WXF A;  3ZU7 B;  3DEP A;  3SY2 A;  1SZ9 A;  1OXJ A;  5AAR A;  2ZIR A;  4G8K A;  5AIJ A;  5D66 A;  4GYY A;  2L9B A;  4DLQ A;  3APF A;  4F6R D;  4B94 A;  3UI2 A;  3NBN B;  5BT1 A;  3FTZ A;  3MX3 A;  4ANX A;  3G2U A;  4YVQ C;  1MQS A;  1QQE A;  3PDN A;  5AQ9 A;  3D9H A;  4OAU C;  3VLD A;  2XQ0 A;  2ZXW E;  3JXI A;  4U04 A;  1OWP A;  5ENT D;  3JCK C;  3W9F A;  1IQU A;  3HXD A;  2P9N G;  5LX8 A;  4EZJ A;  3TWU A;  4CZ2 D;  3ZYK A;  4GTS A;  3ZHE B;  3C3R A;  3LPZ A;  2J4B A;  3ESL A;  3RU0 A;  5KBA A;  2OOE A;  4U95 D;  3CHP A;  4MLP A;  4AV7 A;  1KT1 A;  3BG1 B;  4CT4 A;  1TNO A;  1D8E A;  2LXL A;  4FLB A;  3CR3 A;  3N71 A;  4TXR A;  3QDN A;  5EIB E;  4BEP A;  4U96 D;  2DYS E;  3FTW A;  4GMJ A;  1H2U A;  1EYH A;  2GRQ B;  4ZHB A;  2AVP A;  1K1A A;  4DX7 D;  1H0A A;  3CVP A;  4I1A A;  3CVQ A;  3LJN A;  3DWL G;  5EID A;  5HI7 A;  3VTX A;  4FJZ A;  1RW2 A;  3G2T A;  3GW4 A;  1KPS B;  3ASO E;  4YVO A;  1UG3 A;  5FWQ A;  2ION A;  3TGO A;  3L82 A;  3CSF A;  3IV0 A;  3V31 A;  2AW6 A;  5JJ7 A;  4CYM D;  4AY5 A;  4J7W A;  4L23 A;  4Q96 A;  3SF4 A;  2ILR A;  3O4Z A;  4PS3 A;  4AXH A;  3CV0 A;  4TUU A;  2XCC A;  3L9T A;  3L17 A;  3CVU A;  2PQN A;  3FH5 A;  3RKV A;  1VDY A;  4FU3 A;  3NZU A;  3LVR E;  1LD8 A;  2P2C P;  1JPL A;  1OWO A;  3SBT B;  2V4H C;  1OCO E;  4YDY A;  3NF1 A;  3NOC D;  3VLE A;  3UUX A;  4GTV A;  1H2V C;  3SBS A;  1P5Q A;  4GZD A;  1DCQ A;  1HS6 A;  4F7A A;  4HI9 A;  3T5X A;  2OEV A;  2J8S D;  4GZ3 A;  5CEA A;  3IBE A;  1OCC E;  3S7F A;  3U9W A;  2RFA A;  4AJW A;  2UWJ G;  4AY6 A;  3T8K A;  2CFZ A;  3DBS A;  4FHJ A;  3BUA A;  3KEA A;  3LKU A;  4DLO A;  1Z6T A;  3CLJ A;  3DSU A;  2L0T B;  3QK0 A;  1HX8 A;  1N0R A;  3PEV B;  5LCW C;  4YND A;  4MS6 A;  4JHJ A;  2WXJ A;  2WXI A;  4CDM A;  5A6C A;  4WNG A;  4CDR A;  4ANU A;  4J8D A;  3LS8 A;  4FLH A;  1Y8M A;  2FI7 A;  3CST A;  3SO8 A;  2DZO A;  3RJV A;  5JJT A;  3FY4 A;  1EPU A;  5CEC B;  2FEZ A;  3HVE A;  4QFV A;  3AG1 E;  3QC1 A;  1E7V A;  3ASN E;  3I3N A;  5ENN A;  2OVB A;  1IHB A;  2WXQ A;  4J8E A;  1IXV A;  2C2L A;  5ARG A;  3RRM B;  2WPV A;  1H6K A;  4KZ0 A;  1JWG A;  4KYO B;  4HVB A;  4I2W A;  3ZNG A;  3RRU A;  3D3M A;  5EN5 D;  3B7S A;  2A5U A;  2HYZ A;  2IOS A;  2Y1L E;  4UI9 J;  2LAH A;  5CRU A;  3FP3 A;  4NAC A;  5G04 J;  2KM4 A;  3E30 A;  4HRN A;  5AQB A;  4DX2 A;  4KXK B;  4WWN A;  2RG8 A;  4UQZ A;  3LJ3 A;  3LYA A;  3I5P A;  2EIM E;  1O5M A;  3BU8 A;  3ONK A;  2J08 A;  3ZXS A;  5JHB A;  4KT6 B;  4F1S A;  3NZS A;  4LSZ E;  4YDW A;  2YHC A;  4FP7 A;  4U7E B;  3DSS A;  2IY0 C;  4U8Y D;  5CCM A;  3UIO C;  1YA0 A;  3U66 A;  4K5C A;  5A23 A;  3CHQ A;  2PM7 A;  4G2V A;  4BY6 A;  3FUM A;  3DRA A;  3KEZ A;  3L13 A;  2H6H A;  3DSW A;  1N9A A;  3S2A A;  3ASD A;  2MYO A;  4H7Y A;  4ZFH A;  3ZEF A;  3SNX A;  4GA0 A;  2EIL E;  3FWV A;  5BXO A;  3TWS A;  1S63 A;  2RKK A;  1W3B A;  4Y6C A;  5LP0 A;  3QB2 A;  1OT8 A;  4BTB A;  2LUH A;  2IU1 A;  2OND A;  4ILG A;  3I4R B;  1E7U A;  4IYP A;  3SFZ A;  4APF A; 
#chains in the Genus database with same CATH homology
 2ETC A;  4G8L A;  5CBN A;  2J8S D;  3J5Q B;  4U8V D;  5ENO D;  5CEA A;  2Y1L E;  1OY3 D;  2XZT G;  4K5A B;  5JA4 D;  1DC2 A;  1MJ0 A;  1MYO A;  5EIB E;  3F6Q A;  4BSZ B;  4A63 B;  5ENR D;  1WDY A;  1YMP A;  2DZN A;  1MX2 A;  4DRX E;  5EYL A;  4BEP A;  4HRN A;  2RFA A;  5AQB A;  4LG6 A;  4U96 D;  4DX2 A;  4O1P A;  5CER B;  3T8K A;  2F8X K;  2VGE A;  3HG0 D;  2V5Q C;  5CBO A;  4DX1 A;  4ZHB A;  1YYH A;  4J8Y A;  2AJA A;  1TR4 A;  2XEE A;  1K1A A;  5EIL A;  2FO1 E;  2XZD G;  5KNG A;  4GPM A;  4DX5 D;  4DX7 D;  2BKK B;  2DVW A;  2L6B A;  1S70 B;  3KEA A;  2KBX A;  5EYP F;  3ZU7 B;  3DEP A;  3JXJ A;  3EU9 A;  3LJN A;  1AP7 A;  2B0O E;  4BER A;  1BD8 A;  5KWD A;  1K1B A;  5ENQ D;  5EID A;  5AAR A;  1D9S A;  3AAA C;  1N0R A;  1YCS B;  4N5Q A;  2F8Y A;  4G8K A;  3ZKJ A;  5D66 A;  2PNN A;  4LSZ E;  4BET A;  4YDW A;  3V30 A;  3HRA A;  2Y0B G;  5FIN A;  1WG0 A;  4F6R D;  3UI2 A;  4DX6 D;  1N0Q A;  1K3Z D;  3EHR A;  3TWX A;  3NBN B;  5AQ7 A;  3NOG D;  4HQD A;  2QC9 A;  4U8Y D;  1MX4 A;  2BKG A;  3EHQ A;  1BI7 B;  2ZGD A;  3DEO A;  3SO8 A;  1BI8 B;  2DZO A;  3IXE A;  4JB8 P;  4GMR A;  4Z68 A;  4HI8 A;  3V31 A;  1BU9 A;  4HB5 A;  1AWC B;  4K5C A;  5KNH D;  1SW6 A;  3TWV A;  3Q9N C;  5JMN D;  4CYM D;  5CEC B;  4BES A;  4J7W A;  4QFV A;  5AN8 A;  5FIO A;  4QQI A;  5HRY A;  3W9G A;  3V2O A;  3AJI A;  4HBD A;  5AQ9 A;  3D9H A;  3J5P A;  4OAU C;  3V79 K;  3JUE A;  4K5B A;  4HLL A;  5HS0 A;  1IKN D;  4UUC A;  3UTM A;  2MYO A;  3UXG A;  3T9K A;  5ENP D;  1IHB A;  1UOH A;  3JXI A;  2NYJ A;  5HKP A;  4RLY A;  1IXV A;  4HNA D;  2ETA A;  5ENT D;  3ZUV B;  4TUM A;  2P2C P;  4ZFH A;  1SVX A;  5AAO A;  3W9F A;  2KXP C;  4O1O A;  4B93 B;  1QYM A;  3V2X A;  5BXO A;  3Q9U C;  3TWS A;  2HE0 A;  2V4H C;  3C5R A;  5ENS D;  2QYJ A;  5BXU A;  3TWU A;  4YDY A;  3TWQ A;  1BLX B;  1NFI E;  5AQA A;  4CZ2 D;  4HRL A;  3NOC D;  4OAV B;  1G3N B;  2JAB A;  4LNU D;  3TWR A;  2ZGG A;  4O60 A;  2F37 A;  2ETB A;  4C48 B;  1OT8 A;  3ZNG A;  4U95 D;  5KBA A;  4HRM B;  2RFM A;  5ITZ F;  1DCQ A;  1MX6 A;  1A5E A;  3TWT A;  2XEH A;  3TWW A;  1N11 A;  3B95 A;  4ATZ D;  4DUI A;  5EN5 D;  5CED B;  3B7B A;  2DWZ A;  2A5E A;  2XEN A;  4NIK A;  4HI9 A;  4F1P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...