4K5BA

Co-crystallization with conformation-specific designed ankyrin repeat proteins explains the conformational flexibility of bcl-w
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
156
structure length
156
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVNAKDRFGWTPLHLAAMEGHLEIVEVLLKTGADVNAWADLGTTPLHLAAMKGHLEIVEVLLKAGADVNAEAIVGYTPLHLAAWEGHLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Apoptosis regulator BCL-W
publication title Co-Crystallization with Conformation-Specific Designed Ankyrin Repeat Proteins Explains the Conformational Flexibility of BCL-W
pubmed doi rcsb
source organism Escherichia coli
molecule tags Apoptosis
total genus 51
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4k5bA00
3SO8A 4G8LA 5HS0A 1YCSB 4HRNA 5EIDA 2V4HC 3Q9UC 3J5QB 4CYMD 1MX4A 2F8XK 2NYJA 2DWZA 3AAAC 4HI9A 2QC9A 3DEOA 5HKPA 3UTMA 3V31A 4HNAD 1MYOA 2KXPC 4O1PA 4YDYA 2ETAA 3HG0D 4YDWA 5CBOA 4G8KA 5BXUA 2HE0A 5KWDA 4HRLA 2B0OE 5EYPF 1WDYA 2J8SD 5AN8A 3Q9NC 3V2OA 5AQ7A 2JABA 1QYMA 3HRAA 5ENTD 3AJIA 3TWVA 3D9HA 1BD8A 1IKND 5ENQD 4B93B 4DX7D 4O1OA 2XZDG 5CEDB 4O60A 1IHBA 2RFAA 2Y1LE 1SVXA 4BSZB 5EIBE 5CEAA 3NOGD 4K5BA 2AJAA 5EILA 4QQIA 5EN5D 3ZUVB 1BLXB 4ZFHA 5AQ9A 5CBNA 4OAUC 3W9GA 5KNGA 4DX1A 1SW6A 1YYHA 2XEHA 4Z68A 3NBNB 5ENOD 3UI2A 4N5QA 3TWUA 3KEAA 2A5EA 2L6BA 3B7BA 1A5EA 4GPMA 2F37A 4F1PA 1MX6A 1G3NB 4K5AB 1MX2A 1NFIE 3TWWA 4CZ2D 2XEEA 3C5RA 3TWSA 3ZU7B 2DVWA 1S70B 2ETBA 5EYLA 3TWXA 4J7WA 2BKGA 2V5QC 4F6RD 2Y0BG 4HI8A 5AQBA 5ENPD 5KNHD 4DX5D 3EU9A 5AAOA 4HBDA 4U8VD 2P2CP 4UUCA 1OT8A 3TWTA 1WG0A 1OY3D 1IXVA 2VGEA 5ENSD 4LNUD 3JXJA 1D9SA 3T8KA 3DEPA 3V2XA 1AWCB 4OAVB 5BXOA 5CERB 2XENA 3UXGA 1K3ZD 1UOHA 4K5CA 1DCQA 2ZGGA 2KBXA 4U96D 2MYOA 3LJNA 5HRYA 3JXIA 3T9KA 4DX2A 5AQAA 3F6QA 3ZNGA 1N0RA 5ENRD 1TR4A 3W9FA 3JUEA 4BETA 4BESA 2RFMA 5FIOA 1DC2A 3EHQA 4C48B 2DZOA 4BEPA 4GMRA 5AARA 5KBAA 1BI7B 4HQDA 3V79K 4ATZD 4RLYA 1K1AA 2PNNA 2ETCA 5D66A 4ZHBA 2ZGDA 4BERA 4QFVA 1MJ0A 1N11A 3EHRA 2XZTG 3J5PA 3TWQA 3V30A 4DRXE 5JA4D 3TWRA 4HLLA 3NOCD 2BKKB 2QYJA 3IXEA 4LG6A 4TUMA 4U8YD 4DX6D 2DZNA 4U95D 5CECB 2FO1E 1AP7A 1K1BA 4J8YA 4LSZE 5ITZF 4A63B 1BI8B 4DUIA 5JMND 4JB8P 4HB5A 3ZKJA 1YMPA 2F8YA 5FINA 3B95A 1BU9A 4NIKA 4HRMB 1N0QA
chains in the Genus database with same CATH superfamily
2PM6A 2F8XK 1B89A 3Q75A 3GW4A 3ASFA 4JHJA 2QC9A 2KXPC 1V54E 1H2UA 4KT6B 3CHMA 4ATGA 2IO3C 2EIJE 5FZSA 3FTYA 2IOSA 4CGWA 2R5SA 3CHQA 5CEDB 4ACLA 4JA9A 3CKBA 3PZ2A 2V0PA 1EPUA 3NBNB 3ABKE 2Y4UA 3RJVA 3L82A 1FVHA 3TWWA 2EQXA 4YVQC 4ANUA 1XNFA 3PRZA 4WNGA 2XQ0A 3FUIA 3UXGA 3CHOA 2WB2A 1D8DA 3ZNGA 4ILIA 3TG5A 3AS5A 1IHGA 4ACKA 4UI9K 3UQ3A 4RLYA 1Z6TA 5FWQA 2KCKA 3J5PA 2LO6A 3V30A 1OWNA 2VQ2A 4G26A 2ZISA 3WG7E 3NB2A 1BI8B 3BG0B 3BG1B 3T8MA 2OCCE 1OUVA 5KJLA 1OWLA 4V3IA 4FJYA 4HOQA 2GRRB 3D9NA 3R9AB 4A3VA 4P29A 5HKPA 5FJYA 3HG0D 4FU3A 2GW1A 3ZN3A 4YDWA 2AXZA 2DIWA 3LVQE 2X6KA 3RIBA 3ZHEB 4UWKA 2IFUA 1HU3A 3D9HA 1BD8A 3FFLA 1VDYA 1OWOA 3I4GA 1NL4A 3NOGD 4W9RA 2AJAA 3T5XA 4QQIA 3L54A 3ML8A 4OAUC 1SW6A 2I1KA 2A5EA 1SZ9A 2L0IA 2Y0BG 4EECA 1OT8A 1S63A 3KSLA 3CVNA 3D9IA 4OAVB 4B8CB 3DPYA 1JCQA 3CK7A 2X38A 3ESLA 1U3CA 4AIFA 2P9PG 3AU5A 3FU0A 4GMRA 4ATZD 5CMWA 1K1AA 3FY4A 5G05J 4GPKA 4L23A 3DSWA 5BNWA 3L13A 3L6AA 1TEZA 4YNDA 3G2TA 2GRLA 3LS8A 2VJ8A 5JMND 3ZHEA 5BPPA 4O6FA 2CG3A 4F3VA 4JW1A 5EX0A 2IJGX 2LXLA 2Y4TA 4RG6A 3E32A 5BUZA 4EBAA 4O1PA 4JXTA 3L16A 5KWDA 4APFA 5B1BE 2B0OE 2VSOE 1UW4B 4HXIA 5AQ7A 4B94A 4H7YA 4IULA 3RAUA 1HG2A 3FH7A 3AJIA 3PDNA 2KATA 2WXJA 1KT1A 5EN5D 1LTXA 4NACA 3W9GA 4DX1A 4GCNA 4Z68A 1HG5A 3LPZA 4GCOA 2BEDA 4MKTA 5LCWC 1Y6IA 3LY8A 2DVWA 2VGYA 2XS8A 3E37A 5KNHD 4BT9A 4WUYA 3FDHA 3I3NA 2GROB 3Q49B 3MEKA 4FJZA 3FUJA 3UM0A 4U04A 2DYSE 3BUAA 1A17A 3LJNA 3E34A 2WXLA 2CFZA 2OEWA 3IEGA 3SD5A 4OVUA 2DZOA 4FLHA 4U0SA 1TNYA 5AARA 3TL5A 2XRYA 3IHYA 2XZTG 4UWFA 2FULA 2RD0A 3CHPA 2AW6A 4LSZE 4DUIA 2IY0C 3CHRA 3UMVA 4WNEA 3X2QE 3CQCB 1WM5A 3B95A 4IYPA 5JJ6A 4GZCA 2X6HA 1SZAA 3FH5A 3APDA 2CFUA 4TV3A 4LERA 1H2TC 5EKQD 3GZ2A 5BXUA 4LEUA 1JUQA 1L5JA 3K9IA 2YINA 3AG3E 2JEKA 1OCOE 3TWVA 2X6JA 2WQHA 4GZ5A 4O60A 2WXQA 1ELKA 3MJWA 2RKKA 2XEVA 2OEVA 3PEUB 3Q15A 4F1PA 2J4BA 1FT1A 4TXPA 5DIZA 3ZU7B 4J7WA 2HM8A 3P2BA 4DX5D 5A6CA 4WNFA 4U8VD 2XHEA 5ENSD 3UM3A 1N94A 3PZ4A 4J6IA 3OTNA 5BXOA 1MZCA 4ILHB 1K8KG 4I9EA 3ZEFA 4I43A 2R17C 5BW8C 3W9FA 3FU5A 4XZ4A 3PUJA 3NF1A 3HYMB 3CHSA 4AOFA 4FHJA 2QFCA 3UPVA 4HLLA 1NP7A 3LDZA 4TUMA 4U8YD 4BY6A 2Q7FA 2F8YA 1TNOA 1BU9A 3Q7FA 1H6OA 4HRNA 2IONA 3Q9UC 2I2OA 1TNZA 3DSTA 2IEJA 2ETAA 1QZ2A 5CBOA 2HE0A 3Q5MA 4EZJA 1WAO1 1H6KA 5AJDA 4A3TA 1QBQA 2YNQA 4EQFA 3ZYQA 2L6JA 3ASDA 1N4RA 1IKND 4GZ6A 5AJLA 4KXKB 4L9PA 1DVPA 4Q96A 3PREA 2X3MA 4KYOB 3ONLA 5CEAA 2PM7A 3EDTB 2I6HA 2OVFA 4GU5A 2E0IA 3OXFA 3UI2A 2FBNA 2F0YA 3URZA 3PS6A 1KPSB 3EHMA 1OCCE 1MX6A 3C3QA 4HI8A 3N71A 2PL2A 1E90A 2MOWA 1AWCB 2GRNB 2ZXWE 2WVIA 2ZGGA 5AQAA 3ASHA 3DSXA 3IHVA 4PS3A 3UIPC 3Q73A 3MA5A 3U3WA 1BI7B 1UG3A 2BTDA 4OVVA 5G04J 4NQ0A 3QAQA 4PH4B 2V8SE 3NOCD 2BKKB 1W3BA 1IYGA 3CV0A 4U95D 4DI4A 3ESKA 4J8YA 4TXQA 5ITZF 2XGSA 3SF4A 4ANVA 3SI5A 2Y3AA 4MS6A 3ZIMA 3S7DA 4A1GA 4CYMD 4F7AA 2BUGA 3UUXA 1GW6A 2UWJG 1TN6A 5B1AE 4ME2A 4YDOA 1WDYA 3UM2A 3HXEA 2MRIA 2ILRA 4DX7D 4O1OA 4FADA 1SVXA 5KJMA 3FTVA 2L0TB 5M72A 2NXPA 3G2WA 1A5EA 1QQEA 1UJKA 2WQ7A 4K5AB 2XPIA 1NFIE 4HVBA 2JLBA 2BKGA 4JVSA 1H0AA 1HFAA 1PC2A 4CDNA 4LNUD 4GZ3A 4KZCA 3SBSA 3DXMG 5CMYA 1NA3A 4K5CA 4NRHB 2HO1A 4DX2A 4BETA 4BESA 2RG8A 4XX5A 5FIOA 4BEPA 2WXRA 1ZU2A 4E6HA 1E8XA 4UQYA 2AWIA 1FVFA 3UM1A 3KSQA 3O48A 1RW2A 2B6CA 4JB8P 3Q4AB 4BTBA 4JEUA 2XPZA 1HXIA 4K0RA 2IU1A 4J0UA 3U9WA 3ABME 1HX8A 1O1RA 2EINE 4GTSA 3S7BA 1E8WA 1BPOA 4G2VA 3V2OA 3QNKA 4XE0A 4I6JA 2KZTB 1NI1A 3QB2A 1JWGA 3PZ3A 2KCLA 4EZKA 2P9IG 3ZUVB 5CCMA 1H6PA 4GTRA 4BTAA 1MQSA 3B7TA 2ETBA 1E7VA 3UIOC 3ZYLA 4XIFA 3GYZA 2P2CP 1Z3XA 2XRZA 3Q47B 1YA0A 3T8KA 3LXUX 2L9BA 5KCMA 3RU0A 5ENNA 5LOZA 4F1SA 4JC8A 3ASNE 1O5MA 1JPLA 1X81A 3UINC 5JJTA 1AP7A 4G25A 2PQNA 5ARGA 4G24A 2QYUA 3RRMB 1KZOA 4I2ZA 3MCXA 2KZTA 3EHNA 4NIKA 3DRAA 2QY7A 2R02A 5BV1A 5J90A 2FF4A 3I4RB 2NC9A 4APOA 3V31A 5E75A 4RG9A 4YDYA 4GTPA 3PUKA 3NZSA 2J8SD 3APFA 3UT8A 2YQ8A 3DPDA 3CSFA 4B89A 2XCCA 2P9SG 3TGOA 4AY5A 4BSZB 5EIBE 3B13A 3UKUG 2DYRE 4GMJA 2IF4A 4A55A 4FC8A 4N5QA 3TWUA 4YVOA 1SA4A 5G04C 5AIJA 2AVPA 3TWXA 1TN7A 3SFXA 3VLDA 4HFGA 5ENPD 3P1UA 4KMOA 3TWTA 5BV0A 2VGEA 3PVLA 3D9OA 4HOTA 1DCEA 3R7QA 5CERB 1V55E 1UOHA 4LRZA 2IOLA 2GGFA 1UN9A 4GTTA 3CLJA 3LY9A 4U0ZA 1KZPA 3NQPA 4UQXA 4K03A 2H6IA 4ZHBA 4IN3B 4GA1A 2J08A 4GYYA 3FUKA 4JL0A 3D9JA 1EYHA 3KS2A 3ULEG 4G23A 4FHKA 3Q78A 2WXMA 4HB5A 4DJAA 3U64A 2LAHA 3FULA 4U0UA 5EIDA 3PNLB 1IQUA 4TXRA 3LVRE 3D9MA 3NAWA 4PUCA 4KBQA 3CSTA 3FTSA 4HRLA 3UT7A 3KEZA 2KM4A 2WXKA 1FPPA 4L7TA 1FT2A 3FHEA 3U66A 3MYVA 3CVWA 3VLFA 1UJJA 2RFAA 3DBSA 5JHBA 2XPYA 5G55A 5ENOD 4AVXA 3QDNA 4FA6A 2C0LA 3RO2A 3PH0C 2J9QA 4AXHA 5AAOA 2A5UA 3OAWA 3SFYA 4MBGA 1KLXA 4GA0A 3JXJA 2CHXA 3DEPA 1U2VG 2OVBA 4I6GA 2WXPA 2RFMA 2I9CA 4LCTA 3D9KA 3MV3B 2IQCA 5B3SE 3HIZA 4CT4A 1N52A 3MX3A 4HS2A 4XEIG 2M63A 3ENEA 3TWRA 2XGOA 3UKRG 1NA0A 3IXEA 2XS1A 1JWFA 2J09A 5ANLA 3FUNA 4GYWA 4G1TA 3D9LA 2P9KG 3R7RA 4WAFA 4CEMA 4G8LA 5C2YA 2MHKA 1MX4A 1UN8A 2DWZA 2KC7A 4Q94A 5FT9A 3JQ1A 2H6FA 3LKUA 4D10C 3CGHA 2GRPB 3LCAA 5BT1A 3TXNA 5H7PA 3CVQA 4BFRA 1HF8A 1BLXB 5AQ9A 4AY6A 4Q69A 5KNGA 1YYHA 4JA7A 3RSEG 3B7BA 4CRWA 4GPMA 4N5CA 1G3NB 1MX2A 1H2VC 3RO3A 4GTVA 3B7SA 3PE4A 2WXHA 3ABLE 3MZLB 3PZDA 2YHCA 2VYIA 5LP0A 3RRNB 2C2LA 3QWVA 3HDXA 2R03A 3S7FA 1N4SA 4LNGA 3PE3A 3QARA 3EIQC 1EF1C 4AV7A 3PZ1A 3BEEA 3DWLG 4U96D 2FI7A 2XCBA 3KD7A 4DLQA 2VSXE 4C9BB 4HQDA 1OWPA 2R59A 2GRMA 3TWQA 4UWHA 4DRXE 4MRUA 1OCRE 2EIKE 3FUFA 3ZFWA 1YMPA 3FUEA 4LNBA 2C0MA 1YCSB 3ZVVA 1OWMA 3CVYA 4WWPA 4J8SA 3UTMA 2R2LA 1RZ4A 4G8KA 4FULA 5EYPF 2VSYA 2JABA 3DSVA 1QYMA 3ZXPA 3ML9A 4RQIA 3QOUA 2P9LG 4U07A 3D9PA 3ZYMA 3C98A 4K5BA 5EILA 2P9UG 2WM9A 3ISMC 1ELWA 3FEXA 2J4DA 3L17A 2L6BA 4UI9J 3ZRHA 2NSZA 1Z3YA 2OOEA 1E8ZA 5LX8A 2EIME 3SNXA 4GA2A 3FUDA 3FUMA 1E7UA 4B0ZA 1D8EA 2ZU6B 4CGVA 3CK8A 1FCHA 1OCZE 3TG4A 3LYAA 4CT0A 3HXFA 1SA5A 4J8FA 4IRUA 4L2LA 3BU8A 5E76A 4AJWA 5AENA 2LSUA 5HRYA 4CDMA 3T9KA 3AS4A 3S2AA 2LSVA 4KVOA 4E85A 3VTYA 1MJ0A 5JA4D 3U4TA 4UQZA 3CIAA 2QYJA 3FU6A 5JJ7A 4BX9A 3LY7A 3FEYA 5JHAA 1LF8A 5FINA 3TAXA 5IY5E 3FTZA 2CG2A 3UT4A 4UWGA 2P58C 3EU5A 4A1SA 2BF0X 3JYSA 3L22A 5AN8A 4JHKA 3I5PA 4GAAA 3TXMA 2J07A 4XKBA 3VTXA 2WXGA 3OXLA 2LNIA 3QJZA 5CBNA 4HORA 4FLBA 4GTOA 2XEHA 4WWNA 2F37A 1HE8A 3VLEA 2WPVA 5AQBA 4HBDA 1E96B 1N54A 3AG2E 3FH8A 4JHRA 4U8HA 5KJKA 4M3OA 3V2XA 2XENA 3L9TA 2KBXA 5AYWD 4FP7A 4DPRA 3PEVB 5ENRD 4EZLA 3E33A 3EHQA 3FWVA 3FTWA 3SHFA 1INZA 3E4BA 2VGXB 1TYQG 1U3DA 4PS7A 2LXMA 4EHMA 3CVLA 2A4ZA 3MGBA 5G2NA 3MKQB 5HS0A 2J49A 3CQGB 4HI9A 2I1JA 4GZDA 5T8IA 3HXCA 1DNPA 5CRUA 3Q9NC 5ENTD 4JD2G 3IBEA 4I2WA 3AU4A 2Y1LE 1S0PA 2VTBB 1XGWA 4URKA 1TN8A 2PQRA 4GTQA 3CVVA 5FTPA 1Q2ZA 3GZSA 3DSUA 2P9NG 5CRVA 3C5RA 4UWLA 5DBKA 4N39A 2V4LA 4U7EB 2EILE 4JPSA 2VGXA 3SFZA 1OY3D 4BT8A 1D9SA 3IKOB 4WNDA 1K3ZD 3SGHA 3SQVA 3EJNA 3ZXSA 1PAQA 3F6QA 3HHMA 5D0QD 4JEHA 4C48B 3MKQA 5FQ4A 3CK9A 3ZYKA 1N4PA 5KBAA 2E2EA 3ZW3A 3GZ1A 2ETCA 4J8DA 1H19A 4QFVA 1N11A 3B7RL 3QKYA 3DXKG 4AP2A 3G2VA 3FU3A 5CHEE 2FO1E 4A63B 2WXNA 4DK5A 3C72A 3JQ0A 4GYOA 5FQ6A 4UI9C 4C0MA 2V4HC 2VTBA 3QWPA 3APCA 2DCPA 4N3CA 2GRQB 3ONKA 1ZBPA 3RRUA 1TJCA 1SQMA 1QNFA 1PY1A 2PZIA 1X5BA 3HRAA 5A23A 5CCLA 2Y69E 4ILGA 1HH8A 4B93B 3MV2B 2XZDG 2IO2C 2X6IA 5EDSA 4ZFHA 5J08A 4PDXA 3CVUA 3D3MA 4TRQA 1TNUA 2X6FA 4ANXA 1O1TA 4RVBA 1S70B 4DLOA 4F6RD 4H7XA 2VSNA 1MHQA 4MLPA 3MKRA 5FQ7A 4PS8A 3FTUA 3ULYA 3UX4A 3EIJA 3CEQA 3FTXA 3RKVA 3RK6A 3JXIA 1N0RA 5D2MC 5FQ8A 2WMNA 4WWOA 5ANRA 1ELRA 4HOSA 4BWRA 4X8QA 2AXUA 2PNNA 4BERA 1NZNA 3EHRA 2CHZA 5CECB 2UY1B 1K1BA 1E8YA 2DBAA 4RSYA 4N2SA 4HRMB 2XGMA 1KT0A 2OV8A 2NYJA 3AAAC 3Q7AA 3QK0A 3SZ7A 5LFAA 1ZB1A 3DEOA 4HNAD 2LUHA 3ULQA 1Y8MA 1TJFA 2QZAA 3AS8A 3TJPA 4GTMA 3QC1A 5FZRA 2H6HA 1LD8A 3FUHA 5ENQD 5FZQA 3DSSA 3LJ3A 1IHBA 3AG1E 2R05A 3FP3A 3BQOA 1OXJA 3Q79A 5EX3A 4BX8A 2ONDA 3PNTB 2H6GA 3WXXA 4GMLA 4KZ0A 2HYZA 4I17A 4CZ2D 2XEEA 3TWSA 3C3OA 5EYLA 1WY6A 2V5QC 4XI9A 1S64A 3IV0A 3CR3A 4LUNU 4I1OB 4TUUA 4UUCA 1N4QA 3JUIA 3QWWA 1IXVA 4DI3A 4EPZA 5ARFA 4R7LA 4XI0A 3HVEB 4BSXA 2UY1A 4F53A 4N3AA 2KCVA 1DCQA 5C1DA 3O4ZA 2MYOA 2FEZA 3HXDA 1LD7A 1JCSA 1TR4A 3JUEA 3G2SA 1DC2A 3R9MA 3V79K 4Y6CA 2ZGDA 2V5FA 3CVPA 4OYSA 3AG4E 3L08A 5A7DB 2WXIA 2AXVA 4C0EA 4HOUA 3G2UA 3JCKC 3ZKJA 1HZ4A 4KVMA 5T4YA 1O1SA 3SO8A 4M7CA 4YDEA 3J5QB 3ZPJA 4JZYA 3ZGQA 3ASGA 1MYOA 1IQRA 5G05C 1HS6A 3HXBA 3SY2A 1Z5SC 3CKCA 2WQ6A 5D0OD 4U63A 2FO7A 4J8EA 3OXGA 3C3RA 3CVXA 2LAIA 2YHEA 4G11A 3HVEA 2ZIRA 4L2YA 3KEAA 4I1AA 4HLEA 3LEWA 4AM9A 4NURA 4XKCA 5HI7A 3EU9A 5HQ8A 2WXFA 5KJNA 2HR2A 1WG0A 2WXOA 3NZUA 4CDRA 4AEZC 3EUVA 3KAEA 4Y6WA 4I9CA 1JCRA 1N95A 4ABNA 2CHWA 5T3RA 4CCAA 1HO8A 1TNBA 4EBAG 4GB9A 5D66A 3S7JA 1P5QA 4N3BA 5LCWJ 4N2QA 3T5VA 4B8AA 4LG6A 2WMOA 4DX6D 2DZNA 4ANWA 3SBTB 4I1MA 3ASOE 1EDUA 4I6EA 3B7UX 1N9AA 3E30A 4L1BA 1N0QA
chains in the Genus database with same CATH topology
3SO8A 4G8LA 5HS0A 1YCSB 4HRNA 5EIDA 2V4HC 3Q9UC 3J5QB 4CYMD 1MX4A 2F8XK 2NYJA 2DWZA 3AAAC 4HI9A 2QC9A 3DEOA 5HKPA 3UTMA 3V31A 4HNAD 1MYOA 2KXPC 4O1PA 4YDYA 2ETAA 3HG0D 4YDWA 5CBOA 4G8KA 5BXUA 2HE0A 5KWDA 4HRLA 2B0OE 5EYPF 1WDYA 2J8SD 5AN8A 3Q9NC 3V2OA 5AQ7A 2JABA 1QYMA 3HRAA 5ENTD 3AJIA 3TWVA 3D9HA 1BD8A 1IKND 5ENQD 4B93B 4DX7D 4O1OA 2XZDG 5CEDB 4O60A 1IHBA 2RFAA 2Y1LE 1SVXA 4BSZB 5EIBE 5CEAA 3NOGD 4K5BA 2AJAA 5EILA 4QQIA 5EN5D 3ZUVB 1BLXB 4ZFHA 5AQ9A 5CBNA 4OAUC 3W9GA 5KNGA 4DX1A 1SW6A 1YYHA 2XEHA 4Z68A 3NBNB 5ENOD 3UI2A 4N5QA 3TWUA 3KEAA 2A5EA 2L6BA 3B7BA 1A5EA 4GPMA 2F37A 4F1PA 1MX6A 1G3NB 4K5AB 1MX2A 1NFIE 3TWWA 4CZ2D 2XEEA 3C5RA 3TWSA 3ZU7B 2DVWA 1S70B 2ETBA 5EYLA 3TWXA 4J7WA 2BKGA 2V5QC 4F6RD 2Y0BG 4HI8A 5AQBA 5ENPD 5KNHD 4DX5D 3EU9A 5AAOA 4HBDA 4U8VD 2P2CP 4UUCA 1OT8A 3TWTA 1WG0A 1OY3D 1IXVA 2VGEA 5ENSD 4LNUD 3JXJA 1D9SA 3T8KA 3DEPA 3V2XA 1AWCB 4OAVB 5BXOA 5CERB 2XENA 3UXGA 1K3ZD 1UOHA 4K5CA 1DCQA 2ZGGA 2KBXA 4U96D 2MYOA 3LJNA 5HRYA 3JXIA 3T9KA 4DX2A 5AQAA 3F6QA 3ZNGA 1N0RA 5ENRD 1TR4A 3W9FA 3JUEA 4BETA 4BESA 2RFMA 5FIOA 1DC2A 3EHQA 4C48B 2DZOA 4BEPA 4GMRA 5AARA 5KBAA 1BI7B 4HQDA 3V79K 4ATZD 4RLYA 1K1AA 2PNNA 2ETCA 5D66A 4ZHBA 2ZGDA 4BERA 4QFVA 1MJ0A 1N11A 3EHRA 2XZTG 3J5PA 3TWQA 3V30A 4DRXE 5JA4D 3TWRA 4HLLA 3NOCD 2BKKB 2QYJA 3IXEA 4LG6A 4TUMA 4U8YD 4DX6D 2DZNA 4U95D 5CECB 2FO1E 1AP7A 1K1BA 4J8YA 4LSZE 5ITZF 4A63B 1BI8B 4DUIA 5JMND 4JB8P 4HB5A 3ZKJA 1YMPA 2F8YA 5FINA 3B95A 1BU9A 4NIKA 4HRMB 1N0QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SO8 A;  4G8L A;  5HS0 A;  1YCS B;  4HRN A;  5EID A;  2V4H C;  3Q9U C;  3J5Q B;  4CYM D;  1MX4 A;  2F8X K;  2NYJ A;  2DWZ A;  3AAA C;  4HI9 A;  2QC9 A;  3DEO A;  5HKP A;  3UTM A;  3V31 A;  4HNA D;  1MYO A;  2KXP C;  4O1P A;  4YDY A;  2ETA A;  3HG0 D;  4YDW A;  5CBO A;  4G8K A;  5BXU A;  2HE0 A;  5KWD A;  4HRL A;  2B0O E;  5EYP F;  1WDY A;  2J8S D;  5AN8 A;  3Q9N C;  3V2O A;  5AQ7 A;  2JAB A;  1QYM A;  3HRA A;  5ENT D;  3AJI A;  3TWV A;  3D9H A;  1BD8 A;  1IKN D;  5ENQ D;  4B93 B;  4DX7 D;  4O1O A;  2XZD G;  5CED B;  4O60 A;  1IHB A;  2RFA A;  2Y1L E;  1SVX A;  4BSZ B;  5EIB E;  5CEA A;  3NOG D;  4K5B A;  2AJA A;  5EIL A;  4QQI A;  5EN5 D;  3ZUV B;  1BLX B;  4ZFH A;  5AQ9 A;  5CBN A;  4OAU C;  3W9G A;  5KNG A;  4DX1 A;  1SW6 A;  1YYH A;  2XEH A;  4Z68 A;  3NBN B;  5ENO D;  3UI2 A;  4N5Q A;  3TWU A;  3KEA A;  2A5E A;  2L6B A;  3B7B A;  1A5E A;  4GPM A;  2F37 A;  4F1P A;  1MX6 A;  1G3N B;  4K5A B;  1MX2 A;  1NFI E;  3TWW A;  4CZ2 D;  2XEE A;  3C5R A;  3TWS A;  3ZU7 B;  2DVW A;  1S70 B;  2ETB A;  5EYL A;  3TWX A;  4J7W A;  2BKG A;  2V5Q C;  4F6R D;  2Y0B G;  4HI8 A;  5AQB A;  5ENP D;  5KNH D;  4DX5 D;  3EU9 A;  5AAO A;  4HBD A;  4U8V D;  2P2C P;  4UUC A;  1OT8 A;  3TWT A;  1WG0 A;  1OY3 D;  1IXV A;  2VGE A;  5ENS D;  4LNU D;  3JXJ A;  1D9S A;  3T8K A;  3DEP A;  3V2X A;  1AWC B;  4OAV B;  5BXO A;  5CER B;  2XEN A;  3UXG A;  1K3Z D;  1UOH A;  4K5C A;  1DCQ A;  2ZGG A;  2KBX A;  4U96 D;  2MYO A;  3LJN A;  5HRY A;  3JXI A;  3T9K A;  4DX2 A;  5AQA A;  3F6Q A;  3ZNG A;  1N0R A;  5ENR D;  1TR4 A;  3W9F A;  3JUE A;  4BET A;  4BES A;  2RFM A;  5FIO A;  1DC2 A;  3EHQ A;  4C48 B;  2DZO A;  4BEP A;  4GMR A;  5AAR A;  5KBA A;  1BI7 B;  4HQD A;  3V79 K;  4ATZ D;  4RLY A;  1K1A A;  2PNN A;  2ETC A;  5D66 A;  4ZHB A;  2ZGD A;  4BER A;  4QFV A;  1MJ0 A;  1N11 A;  3EHR A;  2XZT G;  3J5P A;  3TWQ A;  3V30 A;  4DRX E;  5JA4 D;  3TWR A;  4HLL A;  3NOC D;  2BKK B;  2QYJ A;  3IXE A;  4LG6 A;  4TUM A;  4U8Y D;  4DX6 D;  2DZN A;  4U95 D;  5CEC B;  2FO1 E;  1AP7 A;  1K1B A;  4J8Y A;  4LSZ E;  5ITZ F;  4A63 B;  1BI8 B;  4DUI A;  5JMN D;  4JB8 P;  4HB5 A;  3ZKJ A;  1YMP A;  2F8Y A;  5FIN A;  3B95 A;  1BU9 A;  4NIK A;  4HRM B;  1N0Q A; 
#chains in the Genus database with same CATH topology
 2PM6 A;  2F8X K;  1B89 A;  3Q75 A;  3GW4 A;  3ASF A;  4JHJ A;  2QC9 A;  2KXP C;  1V54 E;  1H2U A;  4KT6 B;  3CHM A;  4ATG A;  2IO3 C;  2EIJ E;  5FZS A;  3FTY A;  2IOS A;  4CGW A;  2R5S A;  3CHQ A;  5CED B;  4ACL A;  4JA9 A;  3CKB A;  3PZ2 A;  2V0P A;  1EPU A;  3NBN B;  3ABK E;  2Y4U A;  3RJV A;  3L82 A;  1FVH A;  3TWW A;  2EQX A;  4YVQ C;  4ANU A;  1XNF A;  3PRZ A;  4WNG A;  2XQ0 A;  3FUI A;  3UXG A;  3CHO A;  2WB2 A;  1D8D A;  3ZNG A;  4ILI A;  3TG5 A;  3AS5 A;  1IHG A;  4ACK A;  4UI9 K;  3UQ3 A;  4RLY A;  1Z6T A;  5FWQ A;  2KCK A;  3J5P A;  2LO6 A;  3V30 A;  1OWN A;  2VQ2 A;  4G26 A;  2ZIS A;  3WG7 E;  3NB2 A;  1BI8 B;  3BG0 B;  3BG1 B;  3T8M A;  2OCC E;  1OUV A;  5KJL A;  1OWL A;  4V3I A;  4FJY A;  4HOQ A;  2GRR B;  3D9N A;  3R9A B;  4A3V A;  4P29 A;  5HKP A;  5FJY A;  3HG0 D;  4FU3 A;  2GW1 A;  3ZN3 A;  4YDW A;  2AXZ A;  2DIW A;  3LVQ E;  2X6K A;  3RIB A;  3ZHE B;  4UWK A;  2IFU A;  1HU3 A;  3D9H A;  1BD8 A;  3FFL A;  1VDY A;  1OWO A;  3I4G A;  1NL4 A;  3NOG D;  4W9R A;  2AJA A;  3T5X A;  4QQI A;  3L54 A;  3ML8 A;  4OAU C;  1SW6 A;  2I1K A;  2A5E A;  1SZ9 A;  2L0I A;  2Y0B G;  4EEC A;  1OT8 A;  1S63 A;  3KSL A;  3CVN A;  3D9I A;  4OAV B;  4B8C B;  3DPY A;  1JCQ A;  3CK7 A;  2X38 A;  3ESL A;  1U3C A;  4AIF A;  2P9P G;  3AU5 A;  3FU0 A;  4GMR A;  4ATZ D;  5CMW A;  1K1A A;  3FY4 A;  5G05 J;  4GPK A;  4L23 A;  3DSW A;  5BNW A;  3L13 A;  3L6A A;  1TEZ A;  4YND A;  3G2T A;  2GRL A;  3LS8 A;  2VJ8 A;  5JMN D;  3ZHE A;  5BPP A;  4O6F A;  2CG3 A;  4F3V A;  4JW1 A;  5EX0 A;  2IJG X;  2LXL A;  2Y4T A;  4RG6 A;  3E32 A;  5BUZ A;  4EBA A;  4O1P A;  4JXT A;  3L16 A;  5KWD A;  4APF A;  5B1B E;  2B0O E;  2VSO E;  1UW4 B;  4HXI A;  5AQ7 A;  4B94 A;  4H7Y A;  4IUL A;  3RAU A;  1HG2 A;  3FH7 A;  3AJI A;  3PDN A;  2KAT A;  2WXJ A;  1KT1 A;  5EN5 D;  1LTX A;  4NAC A;  3W9G A;  4DX1 A;  4GCN A;  4Z68 A;  1HG5 A;  3LPZ A;  4GCO A;  2BED A;  4MKT A;  5LCW C;  1Y6I A;  3LY8 A;  2DVW A;  2VGY A;  2XS8 A;  3E37 A;  5KNH D;  4BT9 A;  4WUY A;  3FDH A;  3I3N A;  2GRO B;  3Q49 B;  3MEK A;  4FJZ A;  3FUJ A;  3UM0 A;  4U04 A;  2DYS E;  3BUA A;  1A17 A;  3LJN A;  3E34 A;  2WXL A;  2CFZ A;  2OEW A;  3IEG A;  3SD5 A;  4OVU A;  2DZO A;  4FLH A;  4U0S A;  1TNY A;  5AAR A;  3TL5 A;  2XRY A;  3IHY A;  2XZT G;  4UWF A;  2FUL A;  2RD0 A;  3CHP A;  2AW6 A;  4LSZ E;  4DUI A;  2IY0 C;  3CHR A;  3UMV A;  4WNE A;  3X2Q E;  3CQC B;  1WM5 A;  3B95 A;  4IYP A;  5JJ6 A;  4GZC A;  2X6H A;  1SZA A;  3FH5 A;  3APD A;  2CFU A;  4TV3 A;  4LER A;  1H2T C;  5EKQ D;  3GZ2 A;  5BXU A;  4LEU A;  1JUQ A;  1L5J A;  3K9I A;  2YIN A;  3AG3 E;  2JEK A;  1OCO E;  3TWV A;  2X6J A;  2WQH A;  4GZ5 A;  4O60 A;  2WXQ A;  1ELK A;  3MJW A;  2RKK A;  2XEV A;  2OEV A;  3PEU B;  3Q15 A;  4F1P A;  2J4B A;  1FT1 A;  4TXP A;  5DIZ A;  3ZU7 B;  4J7W A;  2HM8 A;  3P2B A;  4DX5 D;  5A6C A;  4WNF A;  4U8V D;  2XHE A;  5ENS D;  3UM3 A;  1N94 A;  3PZ4 A;  4J6I A;  3OTN A;  5BXO A;  1MZC A;  4ILH B;  1K8K G;  4I9E A;  3ZEF A;  4I43 A;  2R17 C;  5BW8 C;  3W9F A;  3FU5 A;  4XZ4 A;  3PUJ A;  3NF1 A;  3HYM B;  3CHS A;  4AOF A;  4FHJ A;  2QFC A;  3UPV A;  4HLL A;  1NP7 A;  3LDZ A;  4TUM A;  4U8Y D;  4BY6 A;  2Q7F A;  2F8Y A;  1TNO A;  1BU9 A;  3Q7F A;  1H6O A;  4HRN A;  2ION A;  3Q9U C;  2I2O A;  1TNZ A;  3DST A;  2IEJ A;  2ETA A;  1QZ2 A;  5CBO A;  2HE0 A;  3Q5M A;  4EZJ A;  1WAO 1;  1H6K A;  5AJD A;  4A3T A;  1QBQ A;  2YNQ A;  4EQF A;  3ZYQ A;  2L6J A;  3ASD A;  1N4R A;  1IKN D;  4GZ6 A;  5AJL A;  4KXK B;  4L9P A;  1DVP A;  4Q96 A;  3PRE A;  2X3M A;  4KYO B;  3ONL A;  5CEA A;  2PM7 A;  3EDT B;  2I6H A;  2OVF A;  4GU5 A;  2E0I A;  3OXF A;  3UI2 A;  2FBN A;  2F0Y A;  3URZ A;  3PS6 A;  1KPS B;  3EHM A;  1OCC E;  1MX6 A;  3C3Q A;  4HI8 A;  3N71 A;  2PL2 A;  1E90 A;  2MOW A;  1AWC B;  2GRN B;  2ZXW E;  2WVI A;  2ZGG A;  5AQA A;  3ASH A;  3DSX A;  3IHV A;  4PS3 A;  3UIP C;  3Q73 A;  3MA5 A;  3U3W A;  1BI7 B;  1UG3 A;  2BTD A;  4OVV A;  5G04 J;  4NQ0 A;  3QAQ A;  4PH4 B;  2V8S E;  3NOC D;  2BKK B;  1W3B A;  1IYG A;  3CV0 A;  4U95 D;  4DI4 A;  3ESK A;  4J8Y A;  4TXQ A;  5ITZ F;  2XGS A;  3SF4 A;  4ANV A;  3SI5 A;  2Y3A A;  4MS6 A;  3ZIM A;  3S7D A;  4A1G A;  4CYM D;  4F7A A;  2BUG A;  3UUX A;  1GW6 A;  2UWJ G;  1TN6 A;  5B1A E;  4ME2 A;  4YDO A;  1WDY A;  3UM2 A;  3HXE A;  2MRI A;  2ILR A;  4DX7 D;  4O1O A;  4FAD A;  1SVX A;  5KJM A;  3FTV A;  2L0T B;  5M72 A;  2NXP A;  3G2W A;  1A5E A;  1QQE A;  1UJK A;  2WQ7 A;  4K5A B;  2XPI A;  1NFI E;  4HVB A;  2JLB A;  2BKG A;  4JVS A;  1H0A A;  1HFA A;  1PC2 A;  4CDN A;  4LNU D;  4GZ3 A;  4KZC A;  3SBS A;  3DXM G;  5CMY A;  1NA3 A;  4K5C A;  4NRH B;  2HO1 A;  4DX2 A;  4BET A;  4BES A;  2RG8 A;  4XX5 A;  5FIO A;  4BEP A;  2WXR A;  1ZU2 A;  4E6H A;  1E8X A;  4UQY A;  2AWI A;  1FVF A;  3UM1 A;  3KSQ A;  3O48 A;  1RW2 A;  2B6C A;  4JB8 P;  3Q4A B;  4BTB A;  4JEU A;  2XPZ A;  1HXI A;  4K0R A;  2IU1 A;  4J0U A;  3U9W A;  3ABM E;  1HX8 A;  1O1R A;  2EIN E;  4GTS A;  3S7B A;  1E8W A;  1BPO A;  4G2V A;  3V2O A;  3QNK A;  4XE0 A;  4I6J A;  2KZT B;  1NI1 A;  3QB2 A;  1JWG A;  3PZ3 A;  2KCL A;  4EZK A;  2P9I G;  3ZUV B;  5CCM A;  1H6P A;  4GTR A;  4BTA A;  1MQS A;  3B7T A;  2ETB A;  1E7V A;  3UIO C;  3ZYL A;  4XIF A;  3GYZ A;  2P2C P;  1Z3X A;  2XRZ A;  3Q47 B;  1YA0 A;  3T8K A;  3LXU X;  2L9B A;  5KCM A;  3RU0 A;  5ENN A;  5LOZ A;  4F1S A;  4JC8 A;  3ASN E;  1O5M A;  1JPL A;  1X81 A;  3UIN C;  5JJT A;  1AP7 A;  4G25 A;  2PQN A;  5ARG A;  4G24 A;  2QYU A;  3RRM B;  1KZO A;  4I2Z A;  3MCX A;  2KZT A;  3EHN A;  4NIK A;  3DRA A;  2QY7 A;  2R02 A;  5BV1 A;  5J90 A;  2FF4 A;  3I4R B;  2NC9 A;  4APO A;  3V31 A;  5E75 A;  4RG9 A;  4YDY A;  4GTP A;  3PUK A;  3NZS A;  2J8S D;  3APF A;  3UT8 A;  2YQ8 A;  3DPD A;  3CSF A;  4B89 A;  2XCC A;  2P9S G;  3TGO A;  4AY5 A;  4BSZ B;  5EIB E;  3B13 A;  3UKU G;  2DYR E;  4GMJ A;  2IF4 A;  4A55 A;  4FC8 A;  4N5Q A;  3TWU A;  4YVO A;  1SA4 A;  5G04 C;  5AIJ A;  2AVP A;  3TWX A;  1TN7 A;  3SFX A;  3VLD A;  4HFG A;  5ENP D;  3P1U A;  4KMO A;  3TWT A;  5BV0 A;  2VGE A;  3PVL A;  3D9O A;  4HOT A;  1DCE A;  3R7Q A;  5CER B;  1V55 E;  1UOH A;  4LRZ A;  2IOL A;  2GGF A;  1UN9 A;  4GTT A;  3CLJ A;  3LY9 A;  4U0Z A;  1KZP A;  3NQP A;  4UQX A;  4K03 A;  2H6I A;  4ZHB A;  4IN3 B;  4GA1 A;  2J08 A;  4GYY A;  3FUK A;  4JL0 A;  3D9J A;  1EYH A;  3KS2 A;  3ULE G;  4G23 A;  4FHK A;  3Q78 A;  2WXM A;  4HB5 A;  4DJA A;  3U64 A;  2LAH A;  3FUL A;  4U0U A;  5EID A;  3PNL B;  1IQU A;  4TXR A;  3LVR E;  3D9M A;  3NAW A;  4PUC A;  4KBQ A;  3CST A;  3FTS A;  4HRL A;  3UT7 A;  3KEZ A;  2KM4 A;  2WXK A;  1FPP A;  4L7T A;  1FT2 A;  3FHE A;  3U66 A;  3MYV A;  3CVW A;  3VLF A;  1UJJ A;  2RFA A;  3DBS A;  5JHB A;  2XPY A;  5G55 A;  5ENO D;  4AVX A;  3QDN A;  4FA6 A;  2C0L A;  3RO2 A;  3PH0 C;  2J9Q A;  4AXH A;  5AAO A;  2A5U A;  3OAW A;  3SFY A;  4MBG A;  1KLX A;  4GA0 A;  3JXJ A;  2CHX A;  3DEP A;  1U2V G;  2OVB A;  4I6G A;  2WXP A;  2RFM A;  2I9C A;  4LCT A;  3D9K A;  3MV3 B;  2IQC A;  5B3S E;  3HIZ A;  4CT4 A;  1N52 A;  3MX3 A;  4HS2 A;  4XEI G;  2M63 A;  3ENE A;  3TWR A;  2XGO A;  3UKR G;  1NA0 A;  3IXE A;  2XS1 A;  1JWF A;  2J09 A;  5ANL A;  3FUN A;  4GYW A;  4G1T A;  3D9L A;  2P9K G;  3R7R A;  4WAF A;  4CEM A;  4G8L A;  5C2Y A;  2MHK A;  1MX4 A;  1UN8 A;  2DWZ A;  2KC7 A;  4Q94 A;  5FT9 A;  3JQ1 A;  2H6F A;  3LKU A;  4D10 C;  3CGH A;  2GRP B;  3LCA A;  5BT1 A;  3TXN A;  5H7P A;  3CVQ A;  4BFR A;  1HF8 A;  1BLX B;  5AQ9 A;  4AY6 A;  4Q69 A;  5KNG A;  1YYH A;  4JA7 A;  3RSE G;  3B7B A;  4CRW A;  4GPM A;  4N5C A;  1G3N B;  1MX2 A;  1H2V C;  3RO3 A;  4GTV A;  3B7S A;  3PE4 A;  2WXH A;  3ABL E;  3MZL B;  3PZD A;  2YHC A;  2VYI A;  5LP0 A;  3RRN B;  2C2L A;  3QWV A;  3HDX A;  2R03 A;  3S7F A;  1N4S A;  4LNG A;  3PE3 A;  3QAR A;  3EIQ C;  1EF1 C;  4AV7 A;  3PZ1 A;  3BEE A;  3DWL G;  4U96 D;  2FI7 A;  2XCB A;  3KD7 A;  4DLQ A;  2VSX E;  4C9B B;  4HQD A;  1OWP A;  2R59 A;  2GRM A;  3TWQ A;  4UWH A;  4DRX E;  4MRU A;  1OCR E;  2EIK E;  3FUF A;  3ZFW A;  1YMP A;  3FUE A;  4LNB A;  2C0M A;  1YCS B;  3ZVV A;  1OWM A;  3CVY A;  4WWP A;  4J8S A;  3UTM A;  2R2L A;  1RZ4 A;  4G8K A;  4FUL A;  5EYP F;  2VSY A;  2JAB A;  3DSV A;  1QYM A;  3ZXP A;  3ML9 A;  4RQI A;  3QOU A;  2P9L G;  4U07 A;  3D9P A;  3ZYM A;  3C98 A;  4K5B A;  5EIL A;  2P9U G;  2WM9 A;  3ISM C;  1ELW A;  3FEX A;  2J4D A;  3L17 A;  2L6B A;  4UI9 J;  3ZRH A;  2NSZ A;  1Z3Y A;  2OOE A;  1E8Z A;  5LX8 A;  2EIM E;  3SNX A;  4GA2 A;  3FUD A;  3FUM A;  1E7U A;  4B0Z A;  1D8E A;  2ZU6 B;  4CGV A;  3CK8 A;  1FCH A;  1OCZ E;  3TG4 A;  3LYA A;  4CT0 A;  3HXF A;  1SA5 A;  4J8F A;  4IRU A;  4L2L A;  3BU8 A;  5E76 A;  4AJW A;  5AEN A;  2LSU A;  5HRY A;  4CDM A;  3T9K A;  3AS4 A;  3S2A A;  2LSV A;  4KVO A;  4E85 A;  3VTY A;  1MJ0 A;  5JA4 D;  3U4T A;  4UQZ A;  3CIA A;  2QYJ A;  3FU6 A;  5JJ7 A;  4BX9 A;  3LY7 A;  3FEY A;  5JHA A;  1LF8 A;  5FIN A;  3TAX A;  5IY5 E;  3FTZ A;  2CG2 A;  3UT4 A;  4UWG A;  2P58 C;  3EU5 A;  4A1S A;  2BF0 X;  3JYS A;  3L22 A;  5AN8 A;  4JHK A;  3I5P A;  4GAA A;  3TXM A;  2J07 A;  4XKB A;  3VTX A;  2WXG A;  3OXL A;  2LNI A;  3QJZ A;  5CBN A;  4HOR A;  4FLB A;  4GTO A;  2XEH A;  4WWN A;  2F37 A;  1HE8 A;  3VLE A;  2WPV A;  5AQB A;  4HBD A;  1E96 B;  1N54 A;  3AG2 E;  3FH8 A;  4JHR A;  4U8H A;  5KJK A;  4M3O A;  3V2X A;  2XEN A;  3L9T A;  2KBX A;  5AYW D;  4FP7 A;  4DPR A;  3PEV B;  5ENR D;  4EZL A;  3E33 A;  3EHQ A;  3FWV A;  3FTW A;  3SHF A;  1INZ A;  3E4B A;  2VGX B;  1TYQ G;  1U3D A;  4PS7 A;  2LXM A;  4EHM A;  3CVL A;  2A4Z A;  3MGB A;  5G2N A;  3MKQ B;  5HS0 A;  2J49 A;  3CQG B;  4HI9 A;  2I1J A;  4GZD A;  5T8I A;  3HXC A;  1DNP A;  5CRU A;  3Q9N C;  5ENT D;  4JD2 G;  3IBE A;  4I2W A;  3AU4 A;  2Y1L E;  1S0P A;  2VTB B;  1XGW A;  4URK A;  1TN8 A;  2PQR A;  4GTQ A;  3CVV A;  5FTP A;  1Q2Z A;  3GZS A;  3DSU A;  2P9N G;  5CRV A;  3C5R A;  4UWL A;  5DBK A;  4N39 A;  2V4L A;  4U7E B;  2EIL E;  4JPS A;  2VGX A;  3SFZ A;  1OY3 D;  4BT8 A;  1D9S A;  3IKO B;  4WND A;  1K3Z D;  3SGH A;  3SQV A;  3EJN A;  3ZXS A;  1PAQ A;  3F6Q A;  3HHM A;  5D0Q D;  4JEH A;  4C48 B;  3MKQ A;  5FQ4 A;  3CK9 A;  3ZYK A;  1N4P A;  5KBA A;  2E2E A;  3ZW3 A;  3GZ1 A;  2ETC A;  4J8D A;  1H19 A;  4QFV A;  1N11 A;  3B7R L;  3QKY A;  3DXK G;  4AP2 A;  3G2V A;  3FU3 A;  5CHE E;  2FO1 E;  4A63 B;  2WXN A;  4DK5 A;  3C72 A;  3JQ0 A;  4GYO A;  5FQ6 A;  4UI9 C;  4C0M A;  2V4H C;  2VTB A;  3QWP A;  3APC A;  2DCP A;  4N3C A;  2GRQ B;  3ONK A;  1ZBP A;  3RRU A;  1TJC A;  1SQM A;  1QNF A;  1PY1 A;  2PZI A;  1X5B A;  3HRA A;  5A23 A;  5CCL A;  2Y69 E;  4ILG A;  1HH8 A;  4B93 B;  3MV2 B;  2XZD G;  2IO2 C;  2X6I A;  5EDS A;  4ZFH A;  5J08 A;  4PDX A;  3CVU A;  3D3M A;  4TRQ A;  1TNU A;  2X6F A;  4ANX A;  1O1T A;  4RVB A;  1S70 B;  4DLO A;  4F6R D;  4H7X A;  2VSN A;  1MHQ A;  4MLP A;  3MKR A;  5FQ7 A;  4PS8 A;  3FTU A;  3ULY A;  3UX4 A;  3EIJ A;  3CEQ A;  3FTX A;  3RKV A;  3RK6 A;  3JXI A;  1N0R A;  5D2M C;  5FQ8 A;  2WMN A;  4WWO A;  5ANR A;  1ELR A;  4HOS A;  4BWR A;  4X8Q A;  2AXU A;  2PNN A;  4BER A;  1NZN A;  3EHR A;  2CHZ A;  5CEC B;  2UY1 B;  1K1B A;  1E8Y A;  2DBA A;  4RSY A;  4N2S A;  4HRM B;  2XGM A;  1KT0 A;  2OV8 A;  2NYJ A;  3AAA C;  3Q7A A;  3QK0 A;  3SZ7 A;  5LFA A;  1ZB1 A;  3DEO A;  4HNA D;  2LUH A;  3ULQ A;  1Y8M A;  1TJF A;  2QZA A;  3AS8 A;  3TJP A;  4GTM A;  3QC1 A;  5FZR A;  2H6H A;  1LD8 A;  3FUH A;  5ENQ D;  5FZQ A;  3DSS A;  3LJ3 A;  1IHB A;  3AG1 E;  2R05 A;  3FP3 A;  3BQO A;  1OXJ A;  3Q79 A;  5EX3 A;  4BX8 A;  2OND A;  3PNT B;  2H6G A;  3WXX A;  4GML A;  4KZ0 A;  2HYZ A;  4I17 A;  4CZ2 D;  2XEE A;  3TWS A;  3C3O A;  5EYL A;  1WY6 A;  2V5Q C;  4XI9 A;  1S64 A;  3IV0 A;  3CR3 A;  4LUN U;  4I1O B;  4TUU A;  4UUC A;  1N4Q A;  3JUI A;  3QWW A;  1IXV A;  4DI3 A;  4EPZ A;  5ARF A;  4R7L A;  4XI0 A;  3HVE B;  4BSX A;  2UY1 A;  4F53 A;  4N3A A;  2KCV A;  1DCQ A;  5C1D A;  3O4Z A;  2MYO A;  2FEZ A;  3HXD A;  1LD7 A;  1JCS A;  1TR4 A;  3JUE A;  3G2S A;  1DC2 A;  3R9M A;  3V79 K;  4Y6C A;  2ZGD A;  2V5F A;  3CVP A;  4OYS A;  3AG4 E;  3L08 A;  5A7D B;  2WXI A;  2AXV A;  4C0E A;  4HOU A;  3G2U A;  3JCK C;  3ZKJ A;  1HZ4 A;  4KVM A;  5T4Y A;  1O1S A;  3SO8 A;  4M7C A;  4YDE A;  3J5Q B;  3ZPJ A;  4JZY A;  3ZGQ A;  3ASG A;  1MYO A;  1IQR A;  5G05 C;  1HS6 A;  3HXB A;  3SY2 A;  1Z5S C;  3CKC A;  2WQ6 A;  5D0O D;  4U63 A;  2FO7 A;  4J8E A;  3OXG A;  3C3R A;  3CVX A;  2LAI A;  2YHE A;  4G11 A;  3HVE A;  2ZIR A;  4L2Y A;  3KEA A;  4I1A A;  4HLE A;  3LEW A;  4AM9 A;  4NUR A;  4XKC A;  5HI7 A;  3EU9 A;  5HQ8 A;  2WXF A;  5KJN A;  2HR2 A;  1WG0 A;  2WXO A;  3NZU A;  4CDR A;  4AEZ C;  3EUV A;  3KAE A;  4Y6W A;  4I9C A;  1JCR A;  1N95 A;  4ABN A;  2CHW A;  5T3R A;  4CCA A;  1HO8 A;  1TNB A;  4EBA G;  4GB9 A;  5D66 A;  3S7J A;  1P5Q A;  4N3B A;  5LCW J;  4N2Q A;  3T5V A;  4B8A A;  4LG6 A;  2WMO A;  4DX6 D;  2DZN A;  4ANW A;  3SBT B;  4I1M A;  3ASO E;  1EDU A;  4I6E A;  3B7U X;  1N9A A;  3E30 A;  4L1B A;  1N0Q A; 
#chains in the Genus database with same CATH homology
 3SO8 A;  4G8L A;  5HS0 A;  1YCS B;  4HRN A;  5EID A;  2V4H C;  3Q9U C;  3J5Q B;  4CYM D;  1MX4 A;  2F8X K;  2NYJ A;  2DWZ A;  3AAA C;  4HI9 A;  2QC9 A;  3DEO A;  5HKP A;  3UTM A;  3V31 A;  4HNA D;  1MYO A;  2KXP C;  4O1P A;  4YDY A;  2ETA A;  3HG0 D;  4YDW A;  5CBO A;  4G8K A;  5BXU A;  2HE0 A;  5KWD A;  4HRL A;  2B0O E;  5EYP F;  1WDY A;  2J8S D;  5AN8 A;  3Q9N C;  3V2O A;  5AQ7 A;  2JAB A;  1QYM A;  3HRA A;  5ENT D;  3AJI A;  3TWV A;  3D9H A;  1BD8 A;  1IKN D;  5ENQ D;  4B93 B;  4DX7 D;  4O1O A;  2XZD G;  5CED B;  4O60 A;  1IHB A;  2RFA A;  2Y1L E;  1SVX A;  4BSZ B;  5EIB E;  5CEA A;  3NOG D;  4K5B A;  2AJA A;  5EIL A;  4QQI A;  5EN5 D;  3ZUV B;  1BLX B;  4ZFH A;  5AQ9 A;  5CBN A;  4OAU C;  3W9G A;  5KNG A;  4DX1 A;  1SW6 A;  1YYH A;  2XEH A;  4Z68 A;  3NBN B;  5ENO D;  3UI2 A;  4N5Q A;  3TWU A;  3KEA A;  2A5E A;  2L6B A;  3B7B A;  1A5E A;  4GPM A;  2F37 A;  4F1P A;  1MX6 A;  1G3N B;  4K5A B;  1MX2 A;  1NFI E;  3TWW A;  4CZ2 D;  2XEE A;  3C5R A;  3TWS A;  3ZU7 B;  2DVW A;  1S70 B;  2ETB A;  5EYL A;  3TWX A;  4J7W A;  2BKG A;  2V5Q C;  4F6R D;  2Y0B G;  4HI8 A;  5AQB A;  5ENP D;  5KNH D;  4DX5 D;  3EU9 A;  5AAO A;  4HBD A;  4U8V D;  2P2C P;  4UUC A;  1OT8 A;  3TWT A;  1WG0 A;  1OY3 D;  1IXV A;  2VGE A;  5ENS D;  4LNU D;  3JXJ A;  1D9S A;  3T8K A;  3DEP A;  3V2X A;  1AWC B;  4OAV B;  5BXO A;  5CER B;  2XEN A;  3UXG A;  1K3Z D;  1UOH A;  4K5C A;  1DCQ A;  2ZGG A;  2KBX A;  4U96 D;  2MYO A;  3LJN A;  5HRY A;  3JXI A;  3T9K A;  4DX2 A;  5AQA A;  3F6Q A;  3ZNG A;  1N0R A;  5ENR D;  1TR4 A;  3W9F A;  3JUE A;  4BET A;  4BES A;  2RFM A;  5FIO A;  1DC2 A;  3EHQ A;  4C48 B;  2DZO A;  4BEP A;  4GMR A;  5AAR A;  5KBA A;  1BI7 B;  4HQD A;  3V79 K;  4ATZ D;  4RLY A;  1K1A A;  2PNN A;  2ETC A;  5D66 A;  4ZHB A;  2ZGD A;  4BER A;  4QFV A;  1MJ0 A;  1N11 A;  3EHR A;  2XZT G;  3J5P A;  3TWQ A;  3V30 A;  4DRX E;  5JA4 D;  3TWR A;  4HLL A;  3NOC D;  2BKK B;  2QYJ A;  3IXE A;  4LG6 A;  4TUM A;  4U8Y D;  4DX6 D;  2DZN A;  4U95 D;  5CEC B;  2FO1 E;  1AP7 A;  1K1B A;  4J8Y A;  4LSZ E;  5ITZ F;  4A63 B;  1BI8 B;  4DUI A;  5JMN D;  4JB8 P;  4HB5 A;  3ZKJ A;  1YMP A;  2F8Y A;  5FIN A;  3B95 A;  1BU9 A;  4NIK A;  4HRM B;  1N0Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...