4K5BA

Co-crystallization with conformation-specific designed ankyrin repeat proteins explains the conformational flexibility of bcl-w
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
156
structure length
156
Chain Sequence
DLGKKLLEAARAGQDDEVRILMANGADVNAKDRFGWTPLHLAAMEGHLEIVEVLLKTGADVNAWADLGTTPLHLAAMKGHLEIVEVLLKAGADVNAEAIVGYTPLHLAAWEGHLEIVEVLLKHGADVNAQDKFGKTPFDLAIDNGNEDIAEVLQKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Apoptosis regulator BCL-W
publication title Co-Crystallization with Conformation-Specific Designed Ankyrin Repeat Proteins Explains the Conformational Flexibility of BCL-W
pubmed doi rcsb
source organism Escherichia coli
total genus 51
structure length 156
sequence length 156
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-04-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.20 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Ankyrin repeat-containing domain 4k5bA00
1TR4A 5EN5D 2RFMA 5ENQD 4HLLA 4J8YA 3V31A 4HQDA 5ITZF 2BKKB 2DZOA 4HI9A 5FIOA 3ZNGA 5AQAA 2XZDG 2BKGA 4G8LA 3Q9NC 1N0QA 4ZFHA 1NFIE 4DX2A 4DX1A 1BI8B 2V5QC 2Y0BG 3LJNA 5KWDA 4ZHBA 3ZUVB 4U96D 4GMRA 4U8VD 2NYJA 2RFAA 5CBNA 4O60A 3KEAA 3TWQA 5ENRD 1D9SA 5CEAA 4HRLA 1MX6A 3TWXA 4BEPA 1OT8A 4HI8A 4LG6A 3TWTA 3JXJA 4LSZE 2J8SD 4OAUC 2F8XK 3J5QB 4U95D 3V30A 1QYMA 3TWWA 1WDYA 3SO8A 5JMND 1DCQA 1MX2A 4U8YD 3TWVA 2B0OE 4HNAD 1BLXB 1IHBA 1MYOA 5EYPF 1K1AA 4J7WA 4QQIA 3F6QA 3T8KA 2ZGDA 5KBAA 2A5EA 5EYLA 4F6RD 4Z68A 4TUMA 2L6BA 1BD8A 4ATZD 3EU9A 3C5RA 2KXPC 4GPMA 4BETA 2F37A 3EHRA 2ETAA 4O1OA 2FO1E 2JABA 5EIBE 1MX4A 2XENA 2XEHA 3B95A 5HS0A 1OY3D 2F8YA 3UXGA 5HKPA 5CECB 1N0RA 4UUCA 3TWSA 5AQ9A 2PNNA 4CZ2D 1SVXA 4O1PA 2XZTG 5AQBA 5BXUA 2Y1LE 5ENOD 1BI7B 3EHQA 2QC9A 2XEEA 3D9HA 4QFVA 4K5CA 5FINA 5AARA 3ZU7B 4HBDA 4F1PA 5ENPD 4BSZB 4YDYA 1IKND 3IXEA 5KNGA 5JA4D 1IXVA 3TWRA 3DEPA 5HRYA 2KBXA 3HG0D 1AP7A 3Q9UC 4HRMB 4G8KA 4A63B 3V2OA 4JB8P 2ZGGA 5BXOA 3JXIA 4LNUD 3NBNB 1K1BA 4YDWA 5EIDA 3W9GA 2HE0A 1WG0A 2QYJA 4C48B 4DX6D 4DX5D 1N11A 2ETBA 4HRNA 3V2XA 1SW6A 4N5QA 5KNHD 1A5EA 2P2CP 4DRXE 1S70B 3DEOA 1YMPA 4K5AB 1UOHA 4BESA 5ENSD 3J5PA 4CYMD 2V4HC 2AJAA 4DX7D 5AQ7A 1DC2A 3B7BA 1AWCB 5ENTD 2VGEA 4K5BA 4RLYA 3UTMA 5D66A 5AN8A 3T9KA 3AJIA 3HRAA 1K3ZD 3TWUA 4NIKA 1G3NB 2ETCA 4B93B 4BERA 4DUIA 3V79K 1BU9A 2MYOA 3W9FA 1YYHA 5AAOA 5CEDB 4HB5A 1YCSB 3JUEA 3NOCD 3UI2A 4OAVB 1MJ0A 3AAAC 2DZNA 3ZKJA 5CERB 3NOGD 2DVWA 5CBOA 2DWZA 5EILA
chains in the Genus database with same CATH superfamily
2XRYA 3FUHA 5FIOA 2L0IA 4I1OB 2R03A 2VSNA 4F7AA 1QZ2A 2WXQA 4N5CA 3ZUVB 2NYJA 1E8ZA 3S7JA 3FUIA 4I17A 1DCEA 2LNIA 2KCKA 4N2SA 3D9LA 4J0UA 3NAWA 2Y3AA 5JMND 4PS3A 3IEGA 3PRZA 3CVLA 3JQ0A 4TUMA 3ASGA 1V55E 4BFRA 2IO3C 3MV3B 5BV0A 3DWLG 3DSVA 5CCMA 5BXUA 5EX0A 5ENOD 4KT6B 3CIAA 3G2SA 3MGBA 5AIJA 1UW4B 2V4LA 3IXEA 4NQ0A 4CDMA 4BWRA 4EHMA 3G2VA 3O48A 1HU3A 3FUDA 3JXIA 3RIBA 2RD0A 3GZSA 4C48B 2XS1A 3RU0A 3DRAA 3L08A 3MA5A 3S2AA 3QARA 2WVIA 4GTOA 3RO3A 3DEOA 2X3MA 3ASOE 3GZ2A 5JHAA 4Y6WA 5A6CA 3TWUA 4JL0A 3PUKA 3MKQA 3ULYA 1OWPA 3UM3A 4JHJA 1FT2A 1N4QA 5ENQD 4HQDA 2WXGA 3CSFA 3BUAA 4G8LA 2F0YA 2WXOA 3CKCA 3JUIA 1N4PA 4FADA 3KD7A 4JA7A 3UUXA 3RSEG 3FTXA 5ENRD 3OXLA 4HI8A 3LXUX 1XNFA 2KCVA 4L7TA 4EBAG 4UWLA 2CFUA 4TXRA 1TNBA 3AG3E 2AWIA 2IEJA 2HM8A 4QQIA 1TN7A 2J4DA 3D9IA 1QBQA 3G2UA 3O4ZA 1HXIA 3Q79A 3SD5A 2DYRE 1PY1A 2J49A 5LP0A 2WXMA 4GA1A 1W3BA 2PNNA 3QWWA 1N94A 2PQNA 4FA6A 1HX8A 2DBAA 3FUJA 1IXVA 5E75A 3FUMA 3Q4AB 3DEPA 2I6HA 4HOQA 4GZ5A 4KXKB 4YDWA 2V0PA 4ATGA 3QC1A 1EPUA 3ZYMA 4GAAA 4GZ6A 4H7YA 1YMPA 1Z3XA 2AJAA 4IULA 1OWMA 4GYYA 3NOCD 3FUEA 2BUGA 3AAAC 1E96B 5EILA 2V8SE 1OWNA 2H6IA 3CGHA 4GMLA 1KLXA 2V5QC 3ZVVA 4ZHBA 4GTRA 5AJLA 1LTXA 2C0LA 4LERA 3KAEA 3PH0C 3UM0A 1WDYA 1DCQA 3CK8A 3LPZA 4YDEA 1IHBA 3SBSA 3IV0A 3KS2A 4TUUA 2OVBA 1FCHA 4MLPA 5E76A 5KCMA 4J6IA 1ZBPA 4BETA 2ETAA 4GTPA 4G1TA 2AXUA 3HXCA 4FHJA 3UT4A 2BEDA 1N9AA 2WXFA 4MRUA 4GCNA 4RQIA 5JA4D 3MKQB 4JVSA 3BU8A 2I9CA 4K03A 4V3IA 2IU1A 3W9GA 3LVRE 2QYJA 4EBAA 1VDYA 2GRQB 3NF1A 2ETBA 4AIFA 2DCPA 3ZYLA 2KZTB 3LY8A 3AU4A 3B7BA 4C0EA 3QOUA 3FTVA 1G3NB 4DUIA 1TEZA 2JEKA 1L5JA 5CCLA 2KC7A 4DLQA 2LSVA 3RK6A 5DBKA 3ZYKA 3C3RA 4EPZA 3UMVA 3SFYA 5FT9A 3ZNGA 3PZ1A 2VGXB 1ZU2A 4U96D 2OOEA 4GMRA 4I43A 2RFAA 1DNPA 3APDA 5CBNA 3PE3A 2QFCA 2GRNB 4FLHA 3ZW3A 3I3NA 3E34A 2F8XK 5FZQA 3ONKA 3UX4A 3DSTA 3QNKA 5EYPF 4ANXA 5BNWA 4AM9A 5KBAA 4F6RD 2CFZA 4XIFA 4ATZD 2M63A 5BUZA 2VTBA 2WPVA 3PEVB 3LYAA 3UT8A 3B95A 4TV3A 3HXBA 4WUYA 2R02A 4WNEA 3CHMA 5EX3A 2XRZA 5AQBA 2J4BA 5AARA 4CDRA 4U0ZA 3ZHEA 1OXJA 4N3BA 3C3OA 3U64A 3T5XA 5KNGA 4HORA 3Q78A 3HG0D 1AP7A 2H6FA 1TJCA 2LO6A 4I1AA 5EIDA 4ILIA 4YVOA 1A5EA 1S70B 2I2OA 1LD7A 1OCZE 4B8CB 5AQ7A 1DC2A 4KVOA 4O6FA 1S63A 1JWGA 3EDTB 4HB5A 2IOSA 4ANWA 2VSOE 3CVXA 2V5FA 2NSZA 2B6CA 3CQCB 4U8VD 4UI9K 3LKUA 3I4RB 3QKYA 4UQXA 2FF4A 4BSXA 3SO8A 2WMNA 3TWVA 2B0OE 2FEZA 3FTZA 3DXMG 3HIZA 1WM5A 3T8KA 1TNUA 3DPYA 3X2QE 4JZYA 2A4ZA 4AY6A 1U3CA 2KCLA 5G04C 4D10C 3TXMA 2XGMA 3APFA 5ANLA 3DXKG 4PS7A 2ZXWE 4RG9A 5AYWD 4F1PA 4BT9A 2X6KA 1U3DA 1RW2A 4HOTA 3NQPA 3GZ1A 2XPIA 2KBXA 4G24A 4UWGA 3EIJA 2VSXE 5CHEE 4G25A 1SQMA 4DX6D 1HZ4A 3B7SA 3HHMA 3PZ4A 4F53A 1KT0A 2VGEA 3T8MA 3UTMA 2VJ8A 5KJNA 3AS8A 3L13A 3HXFA 4GTSA 3W9FA 2P9PG 4CDNA 4OAVB 3LJ3A 5LFAA 3CK9A 3FEYA 4ME2A 3C3QA 4HOSA 3CKBA 2BKKB 3MYVA 3B7RL 2IOLA 2MHKA 1OT8A 3D3MA 1FVHA 3ESKA 3EU5A 4I9EA 4GZ3A 3ABLE 3ZHEB 2R5SA 4HS2A 2J08A 2ZISA 3ONLA 3FWVA 3ZPJA 2CHZA 3NZSA 1UJJA 4X8QA 3OXFA 3CVYA 2KXPC 2WXLA 2F37A 1HFAA 4OVUA 5KJKA 3T5VA 1KT1A 3UXGA 4UUCA 5AQ9A 2HYZA 3C72A 4RVBA 3Q7AA 2WM9A 1JCRA 4BY6A 4LCTA 3EHNA 1Z3YA 4JB8P 4CRWA 3L16A 2FO7A 3IHVA 3LS8A 4RSYA 3V2XA 3JCKC 3QK0A 4IYPA 1UOHA 2P9LG 5J08A 5BV1A 2HO1A 4G26A 2EQXA 2IFUA 3QDNA 2ETCA 3ZXSA 4BERA 2KM4A 3DSSA 1MHQA 4G23A 1Y8MA 1E90A 2DWZA 5CBOA 2R17C 2WQ6A 2XPYA 2X6HA 3Q9NC 2EIME 3RO2A 4AJWA 1QNFA 1TNYA 4U63A 2WXPA 3Q49B 4B8AA 3APCA 3FU0A 4U8YD 1ELRA 4B89A 4NRHB 3URZA 2XEVA 4K0RA 4JPSA 5G05C 4P29A 3MKRA 3MZLB 4GPMA 2KZTA 3ASHA 4O1OA 3PUJA 3CEQA 1JPLA 3QWVA 2I1KA 2XEHA 2LXMA 5LOZA 3S7DA 3U9WA 1BI7B 3D9KA 4XKCA 2DYSE 1IHGA 1IKND 2HR2A 1V54E 2NXPA 3BEEA 4I9CA 2VGXA 2WXHA 3D9OA 2YNQA 3E30A 4A63B 3V2OA 4MKTA 3D9JA 2XCBA 2XGOA 4KBQA 3SGHA 1MZCA 2WXJA 1NI1A 4YDOA 5KJMA 3FU5A 4BTBA 5DIZA 2H6HA 2GRPB 3DSUA 4RLYA 5D66A 5AN8A 4LNBA 1K3ZD 3ZGQA 3UKRG 3FULA 3LVQE 4KZCA 3LDZA 3SHFA 2IF4A 1N95A 4F1SA 2BKGA 5ARGA 3FY4A 1UN8A 1B89A 3MV2B 1IQUA 2J9QA 4A1SA 1MX6A 4DK5A 3VTXA 3J5QB 4TXPA 3TWWA 5FZRA 1D8EA 3ENEA 3QAQA 1K1AA 2CHWA 2GRRB 2ZGDA 2A5EA 4ILGA 4APOA 2KATA 1OWLA 1EDUA 3D9MA 5EIBE 3GYZA 2OV8A 5B1AE 3CQGB 5FZSA 5A23A 1OWOA 5EDSA 5CRVA 4HBDA 3Q7FA 3SNXA 4LNGA 3TAXA 2ONDA 3FP3A 4GTQA 2IONA 3PZDA 4BT8A 2YHCA 2PM6A 2AVPA 2RG8A 1N11A 4IRUA 1SW6A 4ANUA 5KNHD 2J09A 3J5PA 5ENTD 3ESLA 3ZIMA 4UQYA 4B93B 2MYOA 2GRMA 3ZXPA 1SZAA 1YA0A 5LCWC 4N39A 2CG3A 3V31A 5ITZF 5FJYA 2XZDG 3R7RA 2MRIA 2X38A 3LY7A 3TG4A 2IY0C 5FWQA 4PH4B 2GGFA 1D9SA 2L6JA 4AVXA 4TXQA 3Q5MA 5JHBA 3CV0A 1KZPA 2OVFA 3TXNA 1E7UA 4KMOA 4XEIG 4C9BB 2LAHA 1ELKA 4UI9C 3UT7A 3EU9A 4I2WA 4JHRA 2JABA 1MX4A 3SFXA 3CLJA 5HS0A 3ZN3A 2WXKA 2VGYA 2F8YA 2XZTG 3N71A 3ZU7B 2RKKA 2P9NG 5ENPD 4CCAA 4YNDA 5G05J 1XGWA 1OUVA 1LF8A 4E6HA 1K1BA 3EUVA 4TRQA 1O1SA 1E8WA 3CHOA 3VLFA 4HRNA 4N5QA 4FP7A 4WWPA 4DRXE 1S0PA 4I6GA 2V4HC 2E2EA 2EINE 3HXDA 3FH8A 3UM2A 4G2VA 1YCSB 4GCOA 1RZ4A 3EIQC 3L82A 1A17A 1HH8A 5B1BE 3L9TA 2P9IG 4GTVA 5ENNA 3OAWA 5CEAA 3BQOA 4AV7A 4CGWA 3TL5A 1SA4A 3PEUB 1TN6A 3RRMB 4URKA 4ACKA 5D2MC 5KJLA 3F6QA 3QWPA 3SY2A 4JW1A 1DVPA 5BW8C 4MBGA 1H6KA 3SI5A 3ML8A 2P9KG 3RKVA 1HF8A 2R05A 3TWSA 2XS8A 2NC9A 3U66A 3SQVA 4JEHA 3CVNA 2IO2C 2E0IA 4HRMB 3Q75A 3ASFA 2PZIA 3AG2E 4J8FA 4GU5A 5JJTA 3PDNA 3FEXA 4JC8A 3FH7A 3L22A 3R7QA 4DJAA 4L2YA 3IKOB 4K5AB 3TJPA 4GYOA 3UM1A 1AWCB 2PL2A 4OYSA 3V79K 3E33A 1WY6A 1N4SA 3FTSA 4MS6A 4Q69A 4FJYA 1MJ0A 3RRNB 3PZ3A 2C2LA 4HI9A 2OCCE 2WXIA 1NFIE 4ANVA 4KYOB 5IY5E 4ABNA 2LSUA 3TWQA 4HRLA 5CMYA 1QQEA 4LSZE 3PS6A 4OAUC 1X81A 3V30A 5LCWJ 2XCCA 5CMWA 1LD8A 2P9UG 4N2QA 4CEMA 1O1RA 3HVEA 5H7PA 4HVBA 3OXGA 2ILRA 4FC8A 3KSQA 3CHQA 2L6BA 4WAFA 3CR3A 3EHRA 3JYSA 4EZJA 1OCRE 1E8XA 5T8IA 2WQ7A 2ZU6B 4A1GA 1INZA 3D9PA 1Q2ZA 3ZRHA 4M7CA 4UWFA 3P1UA 3CHSA 4FU3A 3TWRA 5HRYA 5FTPA 3ULQA 4G8KA 4DPRA 2ZGGA 3NB2A 2Y4TA 3ZEFA 3DBSA 3UIOC 1O1TA 1E8YA 2BF0X 2DIWA 5FQ7A 2LAIA 3CSTA 3HDXA 2LUHA 2P2CP 4WNFA 4XI0A 4PDXA 2CHXA 3Q15A 3D9NA 4DX7D 3I4GA 3MX3A 2L9BA 3ML9A 2WB2A 3QJZA 3DSXA 2QZAA 3TGOA 4IN3B 3UINC 4EZLA 3JUEA 3UI2A 3EHMA 2DZNA 3QB2A 1Y6IA 5EN5D 1N52A 1HE8A 4J8DA 2BTDA 2MOWA 1BI8B 2Y0BG 3UIPC 4H7XA 2AW6A 2X6JA 4ACLA 1E7VA 4GYWA 3L54A 1QYMA 1TNZA 3FTWA 1BLXB 3MCXA 3VLEA 3C5RA 4U7EB 4EZKA 3ISMC 3CK7A 3E32A 1GW6A 1JCSA 5G55A 3AS5A 1H2VC 1TN8A 5CECB 1N0RA 3VTYA 4XKBA 3VLDA 4U0UA 3I5PA 4BSZB 4YDYA 5AJDA 4C0MA 1PAQA 5AENA 4G11A 3SBTB 4LNUD 1HO8A 3NBNB 2CG2A 5A7DB 2YINA 3ZFWA 4L2LA 4BESA 2WQHA 1H0AA 4E85A 5BT1A 3CVVA 3AS4A 2YHEA 3RJVA 2AXVA 3HRAA 4NIKA 1ZB1A 1BU9A 5ARFA 3HVEB 5G04J 5CERB 4AY5A 4L1BA 4AP2A 2RFMA 3PVLA 4J8YA 2DZOA 4B94A 5D0QD 4UWHA 1H2TC 2AXZA 4R7LA 3UPVA 2H6GA 5CRUA 1UJKA 2FULA 3B7TA 4DI4A 3B7UX 3DSWA 1TYQG 4LG6A 3TWTA 2C0MA 1MX2A 2J07A 4HNAD 3CHPA 3LEWA 4J7WA 3PZ2A 2R2LA 1EYHA 2VYIA 1SA5A 2FI7A 3SF4A 4A3TA 3CVUA 2GW1A 4CT4A 1JCQA 3FDHA 1X5BA 3FTUA 2UWJG 4Y6CA 4J8EA 1EF1C 4O1PA 3FFLA 5FINA 4HLEA 1TNOA 1WAO1 4GA0A 3Q9UC 4PUCA 4ILHB 5FQ8A 1H19A 4A3VA 4GTMA 2WMOA 2LXLA 4KZ0A 3AU5A 3BG0B 4AEZC 1NA0A 3PREA 4W9RA 3CVPA 4GB9A 4DX2A 4L9PA 4CYMD 5ENSD 4EQFA 5T3RA 1HS6A 2JLBA 2X6IA 4NURA 4KVMA 3BG1B 4LUNU 1JWFA 1FT1A 1NA3A 2L0TB 4RG6A 3NOGD 5J90A 3E37A 1TR4A 3Q47B 4N3AA 4BTAA 5LX8A 4Q94A 3ASNE 2R59A 3G2TA 4WNGA 4LRZA 2X6FA 1MQSA 2FBNA 3KSLA 2EIKE 2EIJE 1FPPA 1O5MA 2WXRA 3PNLB 4M3OA 2ZIRA 2J8SD 1JUQA 1H2UA 4U95D 1N4RA 3GW4A 2XQ0A 1Z5SC 4BX8A 3U4TA 4GPKA 4HFGA 2QYUA 2XGSA 4FLBA 3R9AB 3FU6A 1TJFA 4GZDA 4UQZA 4BX9A 2VSYA 3FHEA 1IYGA 4XZ4A 3HXEA 4CZ2D 3UQ3A 3G2WA 1P5QA 4QFVA 4K5CA 3CHRA 1H6OA 4L23A 1HG5A 3FU3A 1KPSB 4J8SA 5BPPA 3CVWA 3L17A 5BXOA 3AG1E 2UY1A 1PC2A 1NP7A 4JD2G 4OVVA 2P58C 4N3CA 2HE0A 1N54A 3LY9A 2OEVA 4U04A 5B3SE 4K5BA 2Y69E 4GA2A 3T9KA 1ELWA 3SFZA 4JEUA 3PNTB 4GTTA 3JQ1A 2XHEA 3IBEA 1U2VG 5AQAA 3ASDA 3AG4E 4ZFHA 3EJNA 4JA9A 4DLOA 4O60A 3TWXA 4BEPA 3SZ7A 5M72A 3FUNA 3JXJA 3U3WA 1OCCE 4GZCA 3P2BA 1UN9A 2OEWA 1MYOA 4WNDA 1OCOE 3ABKE 4DI3A 5D0OD 5EYLA 4Z68A 1BD8A 3FH5A 1S64A 2FO1E 3ULEG 4I6EA 2XENA 3L6AA 5HKPA 4A55A 2Y1LE 3EHQA 2QC9A 2XEEA 3D9HA 4CT0A 4FJZA 2GROB 2IQCA 3ABME 5C2YA 2YQ8A 5HI7A 4Q96A 4I1MA 4B0ZA 4APFA 5JJ7A 2Y4UA 1WG0A 3NZUA 4DX5D 2VQ2A 4YVQC 4EECA 4I6JA 5EKQD 2IJGX 4XE0A 5FQ4A 4CGVA 3OTNA 4NACA 3RRUA 4LEUA 4U07A 5CEDB 3PE4A 2Q7FA 4U0SA 2PQRA 5T4YA 4HLLA 4GMJA 1UG3A 1N0QA 2GRLA 3HYMB 3LJNA 4DX1A 5KWDA 3DPDA 3TG5A 4FHKA 3KEAA 4WWOA 2P9SG 3K9IA 3E4BA 4XI9A 1KZOA 4I2ZA 2A5UA 3FTYA 4WWNA 2XPZA 1SZ9A 4U8HA 5FQ6A 3IHYA 2UY1B 1BPOA 3WXXA 2PM7A 1NL4A 2WXNA 3C98A 1FVFA 4AXHA 3R9MA 1IQRA 4UWKA 3Q73A 1Z6TA 1OY3D 2I1JA 4XX5A 4HOUA 1SVXA 1HG2A 3S7FA 4F3VA 3CVQA 3FUKA 3S7BA 2QY7A 4PS8A 5C1DA 1H6PA 5HQ8A 1D8DA 3MEKA 4HXIA 3UKUG 3B13A 3ZYQA 1K8KG 4JXTA 3LCAA 2EILE 3MJWA 1NZNA 3WG7E 5ANRA 2VTBB 4AOFA 5JJ6A 4UI9J 3AJIA 3KEZA 3RAUA 4JHKA 4FULA 1YYHA 5AAOA 3ZKJA 5G2NA 2DVWA 3FUFA
chains in the Genus database with same CATH topology
1TR4A 5EN5D 2RFMA 5ENQD 4HLLA 4J8YA 3V31A 4HQDA 5ITZF 2BKKB 2DZOA 4HI9A 5FIOA 3ZNGA 5AQAA 2XZDG 2BKGA 4G8LA 3Q9NC 1N0QA 4ZFHA 1NFIE 4DX2A 4DX1A 1BI8B 2V5QC 2Y0BG 3LJNA 5KWDA 4ZHBA 3ZUVB 4U96D 4GMRA 4U8VD 2NYJA 2RFAA 5CBNA 4O60A 3KEAA 3TWQA 5ENRD 1D9SA 5CEAA 4HRLA 1MX6A 3TWXA 4BEPA 1OT8A 4HI8A 4LG6A 3TWTA 3JXJA 4LSZE 2J8SD 4OAUC 2F8XK 3J5QB 4U95D 3V30A 1QYMA 3TWWA 1WDYA 3SO8A 5JMND 1DCQA 1MX2A 4U8YD 3TWVA 2B0OE 4HNAD 1BLXB 1IHBA 1MYOA 5EYPF 1K1AA 4J7WA 4QQIA 3F6QA 3T8KA 2ZGDA 5KBAA 2A5EA 5EYLA 4F6RD 4Z68A 4TUMA 2L6BA 1BD8A 4ATZD 3EU9A 3C5RA 2KXPC 4GPMA 4BETA 2F37A 3EHRA 2ETAA 4O1OA 2FO1E 2JABA 5EIBE 1MX4A 2XENA 2XEHA 3B95A 5HS0A 1OY3D 2F8YA 3UXGA 5HKPA 5CECB 1N0RA 4UUCA 3TWSA 5AQ9A 2PNNA 4CZ2D 1SVXA 4O1PA 2XZTG 5AQBA 5BXUA 2Y1LE 5ENOD 1BI7B 3EHQA 2QC9A 2XEEA 3D9HA 4QFVA 4K5CA 5FINA 5AARA 3ZU7B 4HBDA 4F1PA 5ENPD 4BSZB 4YDYA 1IKND 3IXEA 5KNGA 5JA4D 1IXVA 3TWRA 3DEPA 5HRYA 2KBXA 3HG0D 1AP7A 3Q9UC 4HRMB 4G8KA 4A63B 3V2OA 4JB8P 2ZGGA 5BXOA 3JXIA 4LNUD 3NBNB 1K1BA 4YDWA 5EIDA 3W9GA 2HE0A 1WG0A 2QYJA 4C48B 4DX6D 4DX5D 1N11A 2ETBA 4HRNA 3V2XA 1SW6A 4N5QA 5KNHD 1A5EA 2P2CP 4DRXE 1S70B 3DEOA 1YMPA 4K5AB 1UOHA 4BESA 5ENSD 3J5PA 4CYMD 2V4HC 2AJAA 4DX7D 5AQ7A 1DC2A 3B7BA 1AWCB 5ENTD 2VGEA 4K5BA 4RLYA 3UTMA 5D66A 5AN8A 3T9KA 3AJIA 3HRAA 1K3ZD 3TWUA 4NIKA 1G3NB 2ETCA 4B93B 4BERA 4DUIA 3V79K 1BU9A 2MYOA 3W9FA 1YYHA 5AAOA 5CEDB 4HB5A 1YCSB 3JUEA 3NOCD 3UI2A 4OAVB 1MJ0A 3AAAC 2DZNA 3ZKJA 5CERB 3NOGD 2DVWA 5CBOA 2DWZA 5EILA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TR4 A;  5EN5 D;  2RFM A;  5ENQ D;  4HLL A;  4J8Y A;  3V31 A;  4HQD A;  5ITZ F;  2BKK B;  2DZO A;  4HI9 A;  5FIO A;  3ZNG A;  5AQA A;  2XZD G;  2BKG A;  4G8L A;  3Q9N C;  1N0Q A;  4ZFH A;  1NFI E;  4DX2 A;  4DX1 A;  1BI8 B;  2V5Q C;  2Y0B G;  3LJN A;  5KWD A;  4ZHB A;  3ZUV B;  4U96 D;  4GMR A;  4U8V D;  2NYJ A;  2RFA A;  5CBN A;  4O60 A;  3KEA A;  3TWQ A;  5ENR D;  1D9S A;  5CEA A;  4HRL A;  1MX6 A;  3TWX A;  4BEP A;  1OT8 A;  4HI8 A;  4LG6 A;  3TWT A;  3JXJ A;  4LSZ E;  2J8S D;  4OAU C;  2F8X K;  3J5Q B;  4U95 D;  3V30 A;  1QYM A;  3TWW A;  1WDY A;  3SO8 A;  5JMN D;  1DCQ A;  1MX2 A;  4U8Y D;  3TWV A;  2B0O E;  4HNA D;  1BLX B;  1IHB A;  1MYO A;  5EYP F;  1K1A A;  4J7W A;  4QQI A;  3F6Q A;  3T8K A;  2ZGD A;  5KBA A;  2A5E A;  5EYL A;  4F6R D;  4Z68 A;  4TUM A;  2L6B A;  1BD8 A;  4ATZ D;  3EU9 A;  3C5R A;  2KXP C;  4GPM A;  4BET A;  2F37 A;  3EHR A;  2ETA A;  4O1O A;  2FO1 E;  2JAB A;  5EIB E;  1MX4 A;  2XEN A;  2XEH A;  3B95 A;  5HS0 A;  1OY3 D;  2F8Y A;  3UXG A;  5HKP A;  5CEC B;  1N0R A;  4UUC A;  3TWS A;  5AQ9 A;  2PNN A;  4CZ2 D;  1SVX A;  4O1P A;  2XZT G;  5AQB A;  5BXU A;  2Y1L E;  5ENO D;  1BI7 B;  3EHQ A;  2QC9 A;  2XEE A;  3D9H A;  4QFV A;  4K5C A;  5FIN A;  5AAR A;  3ZU7 B;  4HBD A;  4F1P A;  5ENP D;  4BSZ B;  4YDY A;  1IKN D;  3IXE A;  5KNG A;  5JA4 D;  1IXV A;  3TWR A;  3DEP A;  5HRY A;  2KBX A;  3HG0 D;  1AP7 A;  3Q9U C;  4HRM B;  4G8K A;  4A63 B;  3V2O A;  4JB8 P;  2ZGG A;  5BXO A;  3JXI A;  4LNU D;  3NBN B;  1K1B A;  4YDW A;  5EID A;  3W9G A;  2HE0 A;  1WG0 A;  2QYJ A;  4C48 B;  4DX6 D;  4DX5 D;  1N11 A;  2ETB A;  4HRN A;  3V2X A;  1SW6 A;  4N5Q A;  5KNH D;  1A5E A;  2P2C P;  4DRX E;  1S70 B;  3DEO A;  1YMP A;  4K5A B;  1UOH A;  4BES A;  5ENS D;  3J5P A;  4CYM D;  2V4H C;  2AJA A;  4DX7 D;  5AQ7 A;  1DC2 A;  3B7B A;  1AWC B;  5ENT D;  2VGE A;  4K5B A;  4RLY A;  3UTM A;  5D66 A;  5AN8 A;  3T9K A;  3AJI A;  3HRA A;  1K3Z D;  3TWU A;  4NIK A;  1G3N B;  2ETC A;  4B93 B;  4BER A;  4DUI A;  3V79 K;  1BU9 A;  2MYO A;  3W9F A;  1YYH A;  5AAO A;  5CED B;  4HB5 A;  1YCS B;  3JUE A;  3NOC D;  3UI2 A;  4OAV B;  1MJ0 A;  3AAA C;  2DZN A;  3ZKJ A;  5CER B;  3NOG D;  2DVW A;  5CBO A;  2DWZ A;  5EIL A; 
#chains in the Genus database with same CATH topology
 2XRY A;  3FUH A;  5FIO A;  2L0I A;  4I1O B;  2R03 A;  2VSN A;  4F7A A;  1QZ2 A;  2WXQ A;  4N5C A;  3ZUV B;  2NYJ A;  1E8Z A;  3S7J A;  3FUI A;  4I17 A;  1DCE A;  2LNI A;  2KCK A;  4N2S A;  3D9L A;  4J0U A;  3NAW A;  2Y3A A;  5JMN D;  4PS3 A;  3IEG A;  3PRZ A;  3CVL A;  3JQ0 A;  4TUM A;  3ASG A;  1V55 E;  4BFR A;  2IO3 C;  3MV3 B;  5BV0 A;  3DWL G;  3DSV A;  5CCM A;  5BXU A;  5EX0 A;  5ENO D;  4KT6 B;  3CIA A;  3G2S A;  3MGB A;  5AIJ A;  1UW4 B;  2V4L A;  3IXE A;  4NQ0 A;  4CDM A;  4BWR A;  4EHM A;  3G2V A;  3O48 A;  1HU3 A;  3FUD A;  3JXI A;  3RIB A;  2RD0 A;  3GZS A;  4C48 B;  2XS1 A;  3RU0 A;  3DRA A;  3L08 A;  3MA5 A;  3S2A A;  3QAR A;  2WVI A;  4GTO A;  3RO3 A;  3DEO A;  2X3M A;  3ASO E;  3GZ2 A;  5JHA A;  4Y6W A;  5A6C A;  3TWU A;  4JL0 A;  3PUK A;  3MKQ A;  3ULY A;  1OWP A;  3UM3 A;  4JHJ A;  1FT2 A;  1N4Q A;  5ENQ D;  4HQD A;  2WXG A;  3CSF A;  3BUA A;  4G8L A;  2F0Y A;  2WXO A;  3CKC A;  3JUI A;  1N4P A;  4FAD A;  3KD7 A;  4JA7 A;  3UUX A;  3RSE G;  3FTX A;  5ENR D;  3OXL A;  4HI8 A;  3LXU X;  1XNF A;  2KCV A;  4L7T A;  4EBA G;  4UWL A;  2CFU A;  4TXR A;  1TNB A;  3AG3 E;  2AWI A;  2IEJ A;  2HM8 A;  4QQI A;  1TN7 A;  2J4D A;  3D9I A;  1QBQ A;  3G2U A;  3O4Z A;  1HXI A;  3Q79 A;  3SD5 A;  2DYR E;  1PY1 A;  2J49 A;  5LP0 A;  2WXM A;  4GA1 A;  1W3B A;  2PNN A;  3QWW A;  1N94 A;  2PQN A;  4FA6 A;  1HX8 A;  2DBA A;  3FUJ A;  1IXV A;  5E75 A;  3FUM A;  3Q4A B;  3DEP A;  2I6H A;  4HOQ A;  4GZ5 A;  4KXK B;  4YDW A;  2V0P A;  4ATG A;  3QC1 A;  1EPU A;  3ZYM A;  4GAA A;  4GZ6 A;  4H7Y A;  1YMP A;  1Z3X A;  2AJA A;  4IUL A;  1OWM A;  4GYY A;  3NOC D;  3FUE A;  2BUG A;  3AAA C;  1E96 B;  5EIL A;  2V8S E;  1OWN A;  2H6I A;  3CGH A;  4GML A;  1KLX A;  2V5Q C;  3ZVV A;  4ZHB A;  4GTR A;  5AJL A;  1LTX A;  2C0L A;  4LER A;  3KAE A;  3PH0 C;  3UM0 A;  1WDY A;  1DCQ A;  3CK8 A;  3LPZ A;  4YDE A;  1IHB A;  3SBS A;  3IV0 A;  3KS2 A;  4TUU A;  2OVB A;  1FCH A;  4MLP A;  5E76 A;  5KCM A;  4J6I A;  1ZBP A;  4BET A;  2ETA A;  4GTP A;  4G1T A;  2AXU A;  3HXC A;  4FHJ A;  3UT4 A;  2BED A;  1N9A A;  2WXF A;  4MRU A;  4GCN A;  4RQI A;  5JA4 D;  3MKQ B;  4JVS A;  3BU8 A;  2I9C A;  4K03 A;  4V3I A;  2IU1 A;  3W9G A;  3LVR E;  2QYJ A;  4EBA A;  1VDY A;  2GRQ B;  3NF1 A;  2ETB A;  4AIF A;  2DCP A;  3ZYL A;  2KZT B;  3LY8 A;  3AU4 A;  3B7B A;  4C0E A;  3QOU A;  3FTV A;  1G3N B;  4DUI A;  1TEZ A;  2JEK A;  1L5J A;  5CCL A;  2KC7 A;  4DLQ A;  2LSV A;  3RK6 A;  5DBK A;  3ZYK A;  3C3R A;  4EPZ A;  3UMV A;  3SFY A;  5FT9 A;  3ZNG A;  3PZ1 A;  2VGX B;  1ZU2 A;  4U96 D;  2OOE A;  4GMR A;  4I43 A;  2RFA A;  1DNP A;  3APD A;  5CBN A;  3PE3 A;  2QFC A;  2GRN B;  4FLH A;  3ZW3 A;  3I3N A;  3E34 A;  2F8X K;  5FZQ A;  3ONK A;  3UX4 A;  3DST A;  3QNK A;  5EYP F;  4ANX A;  5BNW A;  4AM9 A;  5KBA A;  4F6R D;  2CFZ A;  4XIF A;  4ATZ D;  2M63 A;  5BUZ A;  2VTB A;  2WPV A;  3PEV B;  3LYA A;  3UT8 A;  3B95 A;  4TV3 A;  3HXB A;  4WUY A;  2R02 A;  4WNE A;  3CHM A;  5EX3 A;  2XRZ A;  5AQB A;  2J4B A;  5AAR A;  4CDR A;  4U0Z A;  3ZHE A;  1OXJ A;  4N3B A;  3C3O A;  3U64 A;  3T5X A;  5KNG A;  4HOR A;  3Q78 A;  3HG0 D;  1AP7 A;  2H6F A;  1TJC A;  2LO6 A;  4I1A A;  5EID A;  4ILI A;  4YVO A;  1A5E A;  1S70 B;  2I2O A;  1LD7 A;  1OCZ E;  4B8C B;  5AQ7 A;  1DC2 A;  4KVO A;  4O6F A;  1S63 A;  1JWG A;  3EDT B;  4HB5 A;  2IOS A;  4ANW A;  2VSO E;  3CVX A;  2V5F A;  2NSZ A;  2B6C A;  3CQC B;  4U8V D;  4UI9 K;  3LKU A;  3I4R B;  3QKY A;  4UQX A;  2FF4 A;  4BSX A;  3SO8 A;  2WMN A;  3TWV A;  2B0O E;  2FEZ A;  3FTZ A;  3DXM G;  3HIZ A;  1WM5 A;  3T8K A;  1TNU A;  3DPY A;  3X2Q E;  4JZY A;  2A4Z A;  4AY6 A;  1U3C A;  2KCL A;  5G04 C;  4D10 C;  3TXM A;  2XGM A;  3APF A;  5ANL A;  3DXK G;  4PS7 A;  2ZXW E;  4RG9 A;  5AYW D;  4F1P A;  4BT9 A;  2X6K A;  1U3D A;  1RW2 A;  4HOT A;  3NQP A;  3GZ1 A;  2XPI A;  2KBX A;  4G24 A;  4UWG A;  3EIJ A;  2VSX E;  5CHE E;  4G25 A;  1SQM A;  4DX6 D;  1HZ4 A;  3B7S A;  3HHM A;  3PZ4 A;  4F53 A;  1KT0 A;  2VGE A;  3T8M A;  3UTM A;  2VJ8 A;  5KJN A;  3AS8 A;  3L13 A;  3HXF A;  4GTS A;  3W9F A;  2P9P G;  4CDN A;  4OAV B;  3LJ3 A;  5LFA A;  3CK9 A;  3FEY A;  4ME2 A;  3C3Q A;  4HOS A;  3CKB A;  2BKK B;  3MYV A;  3B7R L;  2IOL A;  2MHK A;  1OT8 A;  3D3M A;  1FVH A;  3ESK A;  3EU5 A;  4I9E A;  4GZ3 A;  3ABL E;  3ZHE B;  2R5S A;  4HS2 A;  2J08 A;  2ZIS A;  3ONL A;  3FWV A;  3ZPJ A;  2CHZ A;  3NZS A;  1UJJ A;  4X8Q A;  3OXF A;  3CVY A;  2KXP C;  2WXL A;  2F37 A;  1HFA A;  4OVU A;  5KJK A;  3T5V A;  1KT1 A;  3UXG A;  4UUC A;  5AQ9 A;  2HYZ A;  3C72 A;  4RVB A;  3Q7A A;  2WM9 A;  1JCR A;  4BY6 A;  4LCT A;  3EHN A;  1Z3Y A;  4JB8 P;  4CRW A;  3L16 A;  2FO7 A;  3IHV A;  3LS8 A;  4RSY A;  3V2X A;  3JCK C;  3QK0 A;  4IYP A;  1UOH A;  2P9L G;  5J08 A;  5BV1 A;  2HO1 A;  4G26 A;  2EQX A;  2IFU A;  3QDN A;  2ETC A;  3ZXS A;  4BER A;  2KM4 A;  3DSS A;  1MHQ A;  4G23 A;  1Y8M A;  1E90 A;  2DWZ A;  5CBO A;  2R17 C;  2WQ6 A;  2XPY A;  2X6H A;  3Q9N C;  2EIM E;  3RO2 A;  4AJW A;  1QNF A;  1TNY A;  4U63 A;  2WXP A;  3Q49 B;  4B8A A;  3APC A;  3FU0 A;  4U8Y D;  1ELR A;  4B89 A;  4NRH B;  3URZ A;  2XEV A;  4K0R A;  4JPS A;  5G05 C;  4P29 A;  3MKR A;  3MZL B;  4GPM A;  2KZT A;  3ASH A;  4O1O A;  3PUJ A;  3CEQ A;  1JPL A;  3QWV A;  2I1K A;  2XEH A;  2LXM A;  5LOZ A;  3S7D A;  3U9W A;  1BI7 B;  3D9K A;  4XKC A;  2DYS E;  1IHG A;  1IKN D;  2HR2 A;  1V54 E;  2NXP A;  3BEE A;  4I9C A;  2VGX A;  2WXH A;  3D9O A;  2YNQ A;  3E30 A;  4A63 B;  3V2O A;  4MKT A;  3D9J A;  2XCB A;  2XGO A;  4KBQ A;  3SGH A;  1MZC A;  2WXJ A;  1NI1 A;  4YDO A;  5KJM A;  3FU5 A;  4BTB A;  5DIZ A;  2H6H A;  2GRP B;  3DSU A;  4RLY A;  5D66 A;  5AN8 A;  4LNB A;  1K3Z D;  3ZGQ A;  3UKR G;  3FUL A;  3LVQ E;  4KZC A;  3LDZ A;  3SHF A;  2IF4 A;  1N95 A;  4F1S A;  2BKG A;  5ARG A;  3FY4 A;  1UN8 A;  1B89 A;  3MV2 B;  1IQU A;  2J9Q A;  4A1S A;  1MX6 A;  4DK5 A;  3VTX A;  3J5Q B;  4TXP A;  3TWW A;  5FZR A;  1D8E A;  3ENE A;  3QAQ A;  1K1A A;  2CHW A;  2GRR B;  2ZGD A;  2A5E A;  4ILG A;  4APO A;  2KAT A;  1OWL A;  1EDU A;  3D9M A;  5EIB E;  3GYZ A;  2OV8 A;  5B1A E;  3CQG B;  5FZS A;  5A23 A;  1OWO A;  5EDS A;  5CRV A;  4HBD A;  3Q7F A;  3SNX A;  4LNG A;  3TAX A;  2OND A;  3FP3 A;  4GTQ A;  2ION A;  3PZD A;  4BT8 A;  2YHC A;  2PM6 A;  2AVP A;  2RG8 A;  1N11 A;  4IRU A;  1SW6 A;  4ANU A;  5KNH D;  2J09 A;  3J5P A;  5ENT D;  3ESL A;  3ZIM A;  4UQY A;  4B93 B;  2MYO A;  2GRM A;  3ZXP A;  1SZA A;  1YA0 A;  5LCW C;  4N39 A;  2CG3 A;  3V31 A;  5ITZ F;  5FJY A;  2XZD G;  3R7R A;  2MRI A;  2X38 A;  3LY7 A;  3TG4 A;  2IY0 C;  5FWQ A;  4PH4 B;  2GGF A;  1D9S A;  2L6J A;  4AVX A;  4TXQ A;  3Q5M A;  5JHB A;  3CV0 A;  1KZP A;  2OVF A;  3TXN A;  1E7U A;  4KMO A;  4XEI G;  4C9B B;  2LAH A;  1ELK A;  4UI9 C;  3UT7 A;  3EU9 A;  4I2W A;  4JHR A;  2JAB A;  1MX4 A;  3SFX A;  3CLJ A;  5HS0 A;  3ZN3 A;  2WXK A;  2VGY A;  2F8Y A;  2XZT G;  3N71 A;  3ZU7 B;  2RKK A;  2P9N G;  5ENP D;  4CCA A;  4YND A;  5G05 J;  1XGW A;  1OUV A;  1LF8 A;  4E6H A;  1K1B A;  3EUV A;  4TRQ A;  1O1S A;  1E8W A;  3CHO A;  3VLF A;  4HRN A;  4N5Q A;  4FP7 A;  4WWP A;  4DRX E;  1S0P A;  4I6G A;  2V4H C;  2E2E A;  2EIN E;  3HXD A;  3FH8 A;  3UM2 A;  4G2V A;  1YCS B;  4GCO A;  1RZ4 A;  3EIQ C;  3L82 A;  1A17 A;  1HH8 A;  5B1B E;  3L9T A;  2P9I G;  4GTV A;  5ENN A;  3OAW A;  5CEA A;  3BQO A;  4AV7 A;  4CGW A;  3TL5 A;  1SA4 A;  3PEU B;  1TN6 A;  3RRM B;  4URK A;  4ACK A;  5D2M C;  5KJL A;  3F6Q A;  3QWP A;  3SY2 A;  4JW1 A;  1DVP A;  5BW8 C;  4MBG A;  1H6K A;  3SI5 A;  3ML8 A;  2P9K G;  3RKV A;  1HF8 A;  2R05 A;  3TWS A;  2XS8 A;  2NC9 A;  3U66 A;  3SQV A;  4JEH A;  3CVN A;  2IO2 C;  2E0I A;  4HRM B;  3Q75 A;  3ASF A;  2PZI A;  3AG2 E;  4J8F A;  4GU5 A;  5JJT A;  3PDN A;  3FEX A;  4JC8 A;  3FH7 A;  3L22 A;  3R7Q A;  4DJA A;  4L2Y A;  3IKO B;  4K5A B;  3TJP A;  4GYO A;  3UM1 A;  1AWC B;  2PL2 A;  4OYS A;  3V79 K;  3E33 A;  1WY6 A;  1N4S A;  3FTS A;  4MS6 A;  4Q69 A;  4FJY A;  1MJ0 A;  3RRN B;  3PZ3 A;  2C2L A;  4HI9 A;  2OCC E;  2WXI A;  1NFI E;  4ANV A;  4KYO B;  5IY5 E;  4ABN A;  2LSU A;  3TWQ A;  4HRL A;  5CMY A;  1QQE A;  4LSZ E;  3PS6 A;  4OAU C;  1X81 A;  3V30 A;  5LCW J;  2XCC A;  5CMW A;  1LD8 A;  2P9U G;  4N2Q A;  4CEM A;  1O1R A;  3HVE A;  5H7P A;  4HVB A;  3OXG A;  2ILR A;  4FC8 A;  3KSQ A;  3CHQ A;  2L6B A;  4WAF A;  3CR3 A;  3EHR A;  3JYS A;  4EZJ A;  1OCR E;  1E8X A;  5T8I A;  2WQ7 A;  2ZU6 B;  4A1G A;  1INZ A;  3D9P A;  1Q2Z A;  3ZRH A;  4M7C A;  4UWF A;  3P1U A;  3CHS A;  4FU3 A;  3TWR A;  5HRY A;  5FTP A;  3ULQ A;  4G8K A;  4DPR A;  2ZGG A;  3NB2 A;  2Y4T A;  3ZEF A;  3DBS A;  3UIO C;  1O1T A;  1E8Y A;  2BF0 X;  2DIW A;  5FQ7 A;  2LAI A;  3CST A;  3HDX A;  2LUH A;  2P2C P;  4WNF A;  4XI0 A;  4PDX A;  2CHX A;  3Q15 A;  3D9N A;  4DX7 D;  3I4G A;  3MX3 A;  2L9B A;  3ML9 A;  2WB2 A;  3QJZ A;  3DSX A;  2QZA A;  3TGO A;  4IN3 B;  3UIN C;  4EZL A;  3JUE A;  3UI2 A;  3EHM A;  2DZN A;  3QB2 A;  1Y6I A;  5EN5 D;  1N52 A;  1HE8 A;  4J8D A;  2BTD A;  2MOW A;  1BI8 B;  2Y0B G;  3UIP C;  4H7X A;  2AW6 A;  2X6J A;  4ACL A;  1E7V A;  4GYW A;  3L54 A;  1QYM A;  1TNZ A;  3FTW A;  1BLX B;  3MCX A;  3VLE A;  3C5R A;  4U7E B;  4EZK A;  3ISM C;  3CK7 A;  3E32 A;  1GW6 A;  1JCS A;  5G55 A;  3AS5 A;  1H2V C;  1TN8 A;  5CEC B;  1N0R A;  3VTY A;  4XKB A;  3VLD A;  4U0U A;  3I5P A;  4BSZ B;  4YDY A;  5AJD A;  4C0M A;  1PAQ A;  5AEN A;  4G11 A;  3SBT B;  4LNU D;  1HO8 A;  3NBN B;  2CG2 A;  5A7D B;  2YIN A;  3ZFW A;  4L2L A;  4BES A;  2WQH A;  1H0A A;  4E85 A;  5BT1 A;  3CVV A;  3AS4 A;  2YHE A;  3RJV A;  2AXV A;  3HRA A;  4NIK A;  1ZB1 A;  1BU9 A;  5ARF A;  3HVE B;  5G04 J;  5CER B;  4AY5 A;  4L1B A;  4AP2 A;  2RFM A;  3PVL A;  4J8Y A;  2DZO A;  4B94 A;  5D0Q D;  4UWH A;  1H2T C;  2AXZ A;  4R7L A;  3UPV A;  2H6G A;  5CRU A;  1UJK A;  2FUL A;  3B7T A;  4DI4 A;  3B7U X;  3DSW A;  1TYQ G;  4LG6 A;  3TWT A;  2C0M A;  1MX2 A;  2J07 A;  4HNA D;  3CHP A;  3LEW A;  4J7W A;  3PZ2 A;  2R2L A;  1EYH A;  2VYI A;  1SA5 A;  2FI7 A;  3SF4 A;  4A3T A;  3CVU A;  2GW1 A;  4CT4 A;  1JCQ A;  3FDH A;  1X5B A;  3FTU A;  2UWJ G;  4Y6C A;  4J8E A;  1EF1 C;  4O1P A;  3FFL A;  5FIN A;  4HLE A;  1TNO A;  1WAO 1;  4GA0 A;  3Q9U C;  4PUC A;  4ILH B;  5FQ8 A;  1H19 A;  4A3V A;  4GTM A;  2WMO A;  2LXL A;  4KZ0 A;  3AU5 A;  3BG0 B;  4AEZ C;  1NA0 A;  3PRE A;  4W9R A;  3CVP A;  4GB9 A;  4DX2 A;  4L9P A;  4CYM D;  5ENS D;  4EQF A;  5T3R A;  1HS6 A;  2JLB A;  2X6I A;  4NUR A;  4KVM A;  3BG1 B;  4LUN U;  1JWF A;  1FT1 A;  1NA3 A;  2L0T B;  4RG6 A;  3NOG D;  5J90 A;  3E37 A;  1TR4 A;  3Q47 B;  4N3A A;  4BTA A;  5LX8 A;  4Q94 A;  3ASN E;  2R59 A;  3G2T A;  4WNG A;  4LRZ A;  2X6F A;  1MQS A;  2FBN A;  3KSL A;  2EIK E;  2EIJ E;  1FPP A;  1O5M A;  2WXR A;  3PNL B;  4M3O A;  2ZIR A;  2J8S D;  1JUQ A;  1H2U A;  4U95 D;  1N4R A;  3GW4 A;  2XQ0 A;  1Z5S C;  4BX8 A;  3U4T A;  4GPK A;  4HFG A;  2QYU A;  2XGS A;  4FLB A;  3R9A B;  3FU6 A;  1TJF A;  4GZD A;  4UQZ A;  4BX9 A;  2VSY A;  3FHE A;  1IYG A;  4XZ4 A;  3HXE A;  4CZ2 D;  3UQ3 A;  3G2W A;  1P5Q A;  4QFV A;  4K5C A;  3CHR A;  1H6O A;  4L23 A;  1HG5 A;  3FU3 A;  1KPS B;  4J8S A;  5BPP A;  3CVW A;  3L17 A;  5BXO A;  3AG1 E;  2UY1 A;  1PC2 A;  1NP7 A;  4JD2 G;  4OVV A;  2P58 C;  4N3C A;  2HE0 A;  1N54 A;  3LY9 A;  2OEV A;  4U04 A;  5B3S E;  4K5B A;  2Y69 E;  4GA2 A;  3T9K A;  1ELW A;  3SFZ A;  4JEU A;  3PNT B;  4GTT A;  3JQ1 A;  2XHE A;  3IBE A;  1U2V G;  5AQA A;  3ASD A;  3AG4 E;  4ZFH A;  3EJN A;  4JA9 A;  4DLO A;  4O60 A;  3TWX A;  4BEP A;  3SZ7 A;  5M72 A;  3FUN A;  3JXJ A;  3U3W A;  1OCC E;  4GZC A;  3P2B A;  1UN9 A;  2OEW A;  1MYO A;  4WND A;  1OCO E;  3ABK E;  4DI3 A;  5D0O D;  5EYL A;  4Z68 A;  1BD8 A;  3FH5 A;  1S64 A;  2FO1 E;  3ULE G;  4I6E A;  2XEN A;  3L6A A;  5HKP A;  4A55 A;  2Y1L E;  3EHQ A;  2QC9 A;  2XEE A;  3D9H A;  4CT0 A;  4FJZ A;  2GRO B;  2IQC A;  3ABM E;  5C2Y A;  2YQ8 A;  5HI7 A;  4Q96 A;  4I1M A;  4B0Z A;  4APF A;  5JJ7 A;  2Y4U A;  1WG0 A;  3NZU A;  4DX5 D;  2VQ2 A;  4YVQ C;  4EEC A;  4I6J A;  5EKQ D;  2IJG X;  4XE0 A;  5FQ4 A;  4CGV A;  3OTN A;  4NAC A;  3RRU A;  4LEU A;  4U07 A;  5CED B;  3PE4 A;  2Q7F A;  4U0S A;  2PQR A;  5T4Y A;  4HLL A;  4GMJ A;  1UG3 A;  1N0Q A;  2GRL A;  3HYM B;  3LJN A;  4DX1 A;  5KWD A;  3DPD A;  3TG5 A;  4FHK A;  3KEA A;  4WWO A;  2P9S G;  3K9I A;  3E4B A;  4XI9 A;  1KZO A;  4I2Z A;  2A5U A;  3FTY A;  4WWN A;  2XPZ A;  1SZ9 A;  4U8H A;  5FQ6 A;  3IHY A;  2UY1 B;  1BPO A;  3WXX A;  2PM7 A;  1NL4 A;  2WXN A;  3C98 A;  1FVF A;  4AXH A;  3R9M A;  1IQR A;  4UWK A;  3Q73 A;  1Z6T A;  1OY3 D;  2I1J A;  4XX5 A;  4HOU A;  1SVX A;  1HG2 A;  3S7F A;  4F3V A;  3CVQ A;  3FUK A;  3S7B A;  2QY7 A;  4PS8 A;  5C1D A;  1H6P A;  5HQ8 A;  1D8D A;  3MEK A;  4HXI A;  3UKU G;  3B13 A;  3ZYQ A;  1K8K G;  4JXT A;  3LCA A;  2EIL E;  3MJW A;  1NZN A;  3WG7 E;  5ANR A;  2VTB B;  4AOF A;  5JJ6 A;  4UI9 J;  3AJI A;  3KEZ A;  3RAU A;  4JHK A;  4FUL A;  1YYH A;  5AAO A;  3ZKJ A;  5G2N A;  2DVW A;  3FUF A; 
#chains in the Genus database with same CATH homology
 1TR4 A;  5EN5 D;  2RFM A;  5ENQ D;  4HLL A;  4J8Y A;  3V31 A;  4HQD A;  5ITZ F;  2BKK B;  2DZO A;  4HI9 A;  5FIO A;  3ZNG A;  5AQA A;  2XZD G;  2BKG A;  4G8L A;  3Q9N C;  1N0Q A;  4ZFH A;  1NFI E;  4DX2 A;  4DX1 A;  1BI8 B;  2V5Q C;  2Y0B G;  3LJN A;  5KWD A;  4ZHB A;  3ZUV B;  4U96 D;  4GMR A;  4U8V D;  2NYJ A;  2RFA A;  5CBN A;  4O60 A;  3KEA A;  3TWQ A;  5ENR D;  1D9S A;  5CEA A;  4HRL A;  1MX6 A;  3TWX A;  4BEP A;  1OT8 A;  4HI8 A;  4LG6 A;  3TWT A;  3JXJ A;  4LSZ E;  2J8S D;  4OAU C;  2F8X K;  3J5Q B;  4U95 D;  3V30 A;  1QYM A;  3TWW A;  1WDY A;  3SO8 A;  5JMN D;  1DCQ A;  1MX2 A;  4U8Y D;  3TWV A;  2B0O E;  4HNA D;  1BLX B;  1IHB A;  1MYO A;  5EYP F;  1K1A A;  4J7W A;  4QQI A;  3F6Q A;  3T8K A;  2ZGD A;  5KBA A;  2A5E A;  5EYL A;  4F6R D;  4Z68 A;  4TUM A;  2L6B A;  1BD8 A;  4ATZ D;  3EU9 A;  3C5R A;  2KXP C;  4GPM A;  4BET A;  2F37 A;  3EHR A;  2ETA A;  4O1O A;  2FO1 E;  2JAB A;  5EIB E;  1MX4 A;  2XEN A;  2XEH A;  3B95 A;  5HS0 A;  1OY3 D;  2F8Y A;  3UXG A;  5HKP A;  5CEC B;  1N0R A;  4UUC A;  3TWS A;  5AQ9 A;  2PNN A;  4CZ2 D;  1SVX A;  4O1P A;  2XZT G;  5AQB A;  5BXU A;  2Y1L E;  5ENO D;  1BI7 B;  3EHQ A;  2QC9 A;  2XEE A;  3D9H A;  4QFV A;  4K5C A;  5FIN A;  5AAR A;  3ZU7 B;  4HBD A;  4F1P A;  5ENP D;  4BSZ B;  4YDY A;  1IKN D;  3IXE A;  5KNG A;  5JA4 D;  1IXV A;  3TWR A;  3DEP A;  5HRY A;  2KBX A;  3HG0 D;  1AP7 A;  3Q9U C;  4HRM B;  4G8K A;  4A63 B;  3V2O A;  4JB8 P;  2ZGG A;  5BXO A;  3JXI A;  4LNU D;  3NBN B;  1K1B A;  4YDW A;  5EID A;  3W9G A;  2HE0 A;  1WG0 A;  2QYJ A;  4C48 B;  4DX6 D;  4DX5 D;  1N11 A;  2ETB A;  4HRN A;  3V2X A;  1SW6 A;  4N5Q A;  5KNH D;  1A5E A;  2P2C P;  4DRX E;  1S70 B;  3DEO A;  1YMP A;  4K5A B;  1UOH A;  4BES A;  5ENS D;  3J5P A;  4CYM D;  2V4H C;  2AJA A;  4DX7 D;  5AQ7 A;  1DC2 A;  3B7B A;  1AWC B;  5ENT D;  2VGE A;  4K5B A;  4RLY A;  3UTM A;  5D66 A;  5AN8 A;  3T9K A;  3AJI A;  3HRA A;  1K3Z D;  3TWU A;  4NIK A;  1G3N B;  2ETC A;  4B93 B;  4BER A;  4DUI A;  3V79 K;  1BU9 A;  2MYO A;  3W9F A;  1YYH A;  5AAO A;  5CED B;  4HB5 A;  1YCS B;  3JUE A;  3NOC D;  3UI2 A;  4OAV B;  1MJ0 A;  3AAA C;  2DZN A;  3ZKJ A;  5CER B;  3NOG D;  2DVW A;  5CBO A;  2DWZ A;  5EIL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...