4C9BB

Crystal structure of eif4aiii-cwc22 complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
284
structure length
277
Chain Sequence
DPLLTRTGGAYIPPAKLRMKNSLAYQRMSWEALKKSINGLINKVNISNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILNFRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKECGLKLTQVSPRGINAIFERLRNILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKAIKKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EUKARYOTIC INITIATION FACTOR 4A-III
publication title Crystal Structure of the Human Eif4Aiii-Cwc22 Complex Shows How a Dead-Box Protein is Inhibited by a Mif4G Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
total genus 107
structure length 277
sequence length 284
ec nomenclature
pdb deposition date 2013-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4c9bB00
4JHKA 4GMJA 1UW4B 3FEYA 2IONA 4JHJA 1H2VC 1H2UA 2KZTA 3L6AA 2IOSA 1PAQA 2GGFA 2IOLA 1N54A 2RG8A 3JUIA 3FEXA 3RK6A 4LUNU 4B89A 4C9BB 2VSOE 2VSXE 2KZTB 3D3MA 1H6KA 2ZU6B 4IULA 1UG3A 2HM8A 2NSZA 4CEMA 2I2OA 2IU1A 4CRWA 1H2TC 1N52A 4GMLA 3EIJA 5ANRA 4B8CB 4B8AA 4CT4A 2FULA 1HU3A 3EIQC
chains in the Genus database with same CATH superfamily
2L9BA 3U9WA 2IEJA 3LXUX 3HXEA 5CCLA 3E33A 3ZFWA 2WPVA 2WXFA 3DSUA 1HE8A 3SBSA 2ZIRA 2DIWA 5G04J 5T4YA 2B6CA 3EJNA 5AIJA 4YVOA 3KS2A 4CDRA 1RZ4A 2WQHA 3ZPJA 1PAQA 2JLBA 1TNZA 4APFA 2VSNA 1N4SA 2KXPC 4OVVA 2YHEA 1X5BA 2KCLA 3HXCA 4TUMA 4N3AA 4AJWA 3RKVA 2LSUA 1SW6A 2P9NG 3PREA 4I17A 5FINA 2F0YA 4FHJA 4WWOA 3VLEA 3UTMA 3RRMB 3DRAA 1ZBPA 5JA4D 1HXIA 3ZYMA 2R59A 5BUZA 3JYSA 4UWGA 2DBAA 3T5XA 2X6JA 1OWOA 3QC1A 2R02A 1BD8A 4GAAA 4LUNU 2BUGA 3TG4A 2KZTB 1ELWA 3KEZA 4GTVA 5A6CA 5EYPF 5DBKA 5H7PA 4ANUA 2KZTA 3QKYA 1N54A 4V3IA 2XEHA 3R9MA 2ZGDA 4CDNA 2ETCA 4BTAA 5KJKA 2HM8A 3FU6A 4LNUD 5FIOA 4WNFA 3TG5A 2AXZA 5CEAA 2WXGA 2P9IG 3ASHA 1L5JA 2Y3AA 1OCOE 4YVQC 3HXBA 3VTXA 2WQ6A 2AXVA 5BV0A 2WXIA 4B8AA 4O1OA 2DVWA 2L6BA 1DVPA 2OV8A 3QWWA 5LP0A 2F37A 4DRXE 2QZAA 3FTZA 4Z68A 4WNDA 3AG4E 3ULQA 4J6IA 4I2WA 3T9KA 5BV1A 1WY6A 2WXPA 3WG7E 3CQCB 5AN8A 2FF4A 2XGSA 5AQAA 1E90A 2LAIA 3UT4A 3JXIA 3L17A 1TNUA 2BTDA 4HBDA 1GW6A 2WXKA 3JUEA 4U8VD 4GU5A 5D2MC 4YDEA 3FEXA 2V5QC 3FTUA 2PM7A 1HH8A 3ESLA 5KBAA 4AP2A 4BT9A 3NZUA 4PS3A 3FUNA 3CVUA 3OXFA 3ZYQA 2HR2A 4MBGA 2PQRA 4TV3A 1QQEA 4B0ZA 4LCTA 1Z3YA 3V30A 3ZYKA 2RKKA 3I4RB 2J49A 4O1PA 1TN8A 2LUHA 3B7SA 5BW8C 4GTMA 1BI7B 3FUEA 2FBNA 1Y8MA 3G2WA 1YCSB 3EDTB 4ILGA 4ACKA 3C3OA 2ILRA 3DSWA 3PUJA 4GCOA 4XIFA 3FTWA 1E8WA 4JHJA 3E32A 4U0ZA 3HXFA 5CCMA 4A1SA 3ZKJA 4L1BA 2V8SE 4BERA 3FP3A 4CT0A 1IYGA 2KC7A 2VSXE 2IO3C 2V5FA 3D9IA 4O60A 1KZPA 1JCSA 2HYZA 4EHMA 4LSZE 2LXLA 3UM3A 4E85A 3ONKA 2EIKE 2DWZA 4UI9J 4N2QA 3AU5A 3CGHA 3APDA 5T8IA 3ZHEB 5ENNA 5EX0A 5CMWA 4G25A 4CRWA 3UXGA 1EYHA 4GZCA 1Z5SC 3ZHEA 2P9PG 3L6AA 4JW1A 1TN7A 2IOLA 2I9CA 4BX8A 4RVBA 4C0EA 4K5AB 3S7JA 2ZISA 2KCVA 1JCQA 2ETBA 4A3VA 5JHBA 2L0TB 4FHKA 4TXRA 4KZCA 5HI7A 3MV2B 3VLFA 2CG2A 4J8SA 2EILE 4E6HA 4F7AA 2GRPB 2GRRB 5ARGA 5CHEE 3QARA 1OCRE 2AW6A 2J08A 3MKQB 3CHQA 4DX2A 1H6PA 3TJPA 3AS8A 3EIJA 2GRNB 2GW1A 3JQ0A 3UQ3A 4JEHA 2HO1A 2RFAA 4UWLA 1H2VC 3MKQA 2LXMA 4RG9A 2RG8A 3KD7A 3L08A 1Z6TA 4TRQA 3AS4A 1P5QA 4IN3B 3JXJA 5C2YA 4JEUA 2Y69E 3SQVA 5ENRD 5AARA 2XHEA 2WXOA 1IQUA 2IY0C 3FTSA 4HQDA 2Y1LE 5A23A 1O1TA 3RK6A 4F53A 4I2ZA 4C48B 4FADA 2L6JA 2I2OA 4JB8P 4H7XA 5FJYA 2BKKB 4JA7A 2IJGX 4GA1A 3I3NA 4J8DA 4DX5D 2XRYA 3AU4A 2UWJG 2E0IA 3V2OA 4W9RA 1JWFA 1A5EA 2WQ7A 1KZOA 4GTQA 3O48A 3UMVA 2J8SD 3L13A 1YMPA 3APCA 5CBNA 3RU0A 5FQ7A 3MYVA 1LD7A 5JJTA 5LOZA 3HVEB 2LSVA 3E30A 1MZCA 4N3CA 3UKUG 1NL4A 2WMNA 4GA2A 1N52A 3DSTA 3HVEA 5D0OD 3DSVA 1E8ZA 1NA3A 4I9EA 5FQ4A 1OY3D 3EHMA 3AG1E 2J09A 3L82A 3DEPA 4XX5A 1B89A 4K5CA 2AWIA 1OXJA 1SZ9A 3U64A 3Q78A 5LCWJ 1HZ4A 2YHCA 4G1TA 2A5EA 2MYOA 2VYIA 1SQMA 4U8YD 2OCCE 1S63A 5KCMA 1UN9A 3MEKA 3NZSA 3CEQA 3ULYA 3CVVA 2IQCA 2EIME 2WXHA 3PZ2A 3CHOA 3GZ2A 2GRLA 1NZNA 1BLXB 3R7QA 1YYHA 1H6KA 4L7TA 2QC9A 4AY5A 1UJKA 1DCEA 2QYJA 3ASDA 4KMOA 3FFLA 3LKUA 2FULA 2WXMA 3SBTB 4DX1A 2WVIA 3LEWA 1TNOA 3RO2A 4NRHB 3D9JA 4CZ2D 1S64A 1UOHA 4CEMA 3CVNA 3SFYA 1D8DA 3TXMA 3LVRE 4KVMA 3TWRA 3MCXA 3PRZA 3JCKC 4N5QA 2QYUA 4N5CA 2WM9A 3KSLA 4K0RA 1ELRA 1MYOA 5KWDA 4NQ0A 2NSZA 3PNLB 4B8CB 2DYRE 2XEVA 4ZFHA 5HS0A 4JHRA 2X6IA 3IBEA 1IXVA 2R03A 2WB2A 1HX8A 2A5UA 5CBOA 3OAWA 4IULA 3ENEA 4PS8A 4J0UA 3HHMA 3Q15A 4U0UA 1Q2ZA 5ANRA 4BSXA 3EIQC 4UQYA 3FTYA 2X38A 3CHMA 1KT1A 3FHEA 1TN6A 2XZDG 3E34A 2LAHA 1FVFA 3D9NA 3QK0A 1BPOA 2X6FA 3CVQA 3RJVA 4RSYA 3CVPA 2VQ2A 4F6RD 3D9LA 1UN8A 5G05C 3ZIMA 1JUQA 4GYOA 1IQRA 5T3RA 2XPYA 1OCZE 1AP7A 3W9GA 3NBNB 2KATA 4JZYA 2L0IA 2V4HC 5FTPA 4J8EA 2A4ZA 3CVWA 4UQZA 4LG6A 4U95D 4ANWA 1E8YA 3SZ7A 1IKND 1NFIE 4LRZA 3ZVVA 4AOFA 1TR4A 3OXLA 1KPSB 3FWVA 2C0MA 5B3SE 1K1BA 3LPZA 3TWVA 1XNFA 4HVBA 1N94A 1U2VG 2LNIA 2JABA 3QJZA 3UT8A 3RRNB 4Y6CA 5AYWD 4JA9A 4AEZC 1H0AA 2FO1E 3QNKA 1ELKA 4U8HA 3ZGQA 4TXQA 4XI9A 4KBQA 5JJ6A 4EZKA 4HOSA 4YDYA 3NAWA 1H19A 2XGMA 3IHVA 3SF4A 2XRZA 4I43A 4XI0A 4N2SA 5JHAA 2OEVA 1FT1A 1MX4A 1X81A 2EQXA 3DSXA 5ENOD 3PS6A 2IO2C 3G2SA 3APFA 4GZ6A 4Y6WA 1IHBA 5HRYA 1N0QA 4KXKB 2GRQB 3D9MA 4EBAA 2FI7A 5ITZF 3UIPC 1N0RA 3SY2A 3ABME 2PL2A 4JD2G 2IU1A 1E96B 4KZ0A 3ABKE 3C5RA 2CFUA 3BUAA 4PS7A 3D9HA 3TWQA 1OUVA 4Q94A 2P9LG 2M63A 1EDUA 5E76A 1ZU2A 3RAUA 5BT1A 3TXNA 1IHGA 2OVBA 2XEEA 4I9CA 5CRVA 4I1AA 1NI1A 2XS1A 4NACA 2BEDA 3CR3A 1O1SA 4GMRA 1U3DA 3IKOB 2VTBB 1SVXA 4GA0A 1SA5A 2J4BA 3C3RA 4G24A 3Q73A 4K5BA 3AS5A 2VJ8A 3DBSA 4G8KA 3TGOA 2VTBA 3Q79A 4UWFA 3T8KA 3UX4A 3DXKG 4DPRA 4HRNA 1QZ2A 5EN5D 4NURA 4HOTA 2VSOE 4BETA 4CYMD 5D66A 4UUCA 2FEZA 3CK9A 4ACLA 2PM6A 3ZEFA 2X6KA 1WG0A 3CVXA 3FEYA 3R7RA 4BEPA 4C0MA 5BXUA 4ABNA 3B7BA 2WXLA 1G3NB 4LNBA 1LF8A 3HXDA 3E4BA 1S0PA 3SNXA 3EHNA 3G2UA 4URKA 3FUDA 5EIDA 1OCCE 5D0QD 4HLEA 4EPZA 4GTRA 3BU8A 4JPSA 4YNDA 3DPYA 4CT4A 3ZYLA 4HORA 2AJAA 2HE0A 3AJIA 3NQPA 3UT7A 4M3OA 5ANLA 4C9BB 3HIZA 1U3CA 3NF1A 5KNHD 4DLOA 3ASFA 3QDNA 2CHXA 2PQNA 2VSYA 2C2LA 3L16A 4U96D 5ARFA 4WUYA 1YA0A 1MX2A 3U3WA 3JQ1A 1TJCA 2J4DA 4QFVA 4AM9A 4IRUA 3FDHA 1OWPA 3CVLA 3NOCD 5ENTD 2XCBA 3UIOC 3MGBA 2GRMA 2AXUA 5C1DA 1MJ0A 3B7TA 1AWCB 3ESKA 3IHYA 1WDYA 5CECB 4DI4A 3PVLA 1ZB1A 3BG0B 5AQBA 4HNAD 5AQ9A 2OEWA 2I1JA 5J08A 4GZ5A 1UW4B 3ASNE 3ASGA 4FP7A 1KT0A 4WAFA 4L9PA 1TNBA 3SHFA 4HRMB 4LERA 2OVFA 3LVQE 4WNEA 1N4RA 3CIAA 3UI2A 3HDXA 1FT2A 5FQ6A 4U07A 3CVYA 1H2TC 2XCCA 3VTYA 1K8KG 4GZDA 3PDNA 3SO8A 3MZLB 2P58C 5G04C 4A1GA 5M72A 2P9KG 2R5SA 3Q7FA 4RG6A 5KJNA 2XGOA 4EECA 2EIJE 5J90A 5B1AE 3B7UX 4KT6B 3CKBA 3RO3A 5JMND 3FU5A 1O5MA 2YQ8A 3D9OA 2IFUA 1NA0A 4YDOA 1EF1C 4HI9A 3UM2A 1N95A 3CSTA 5CRUA 2NYJA 3CV0A 3FUHA 4D10C 3PEUB 5B1BE 3FTXA 4FC8A 1DCQA 4YDWA 4G26A 4TXPA 3I4GA 4BY6A 2V0PA 4X8QA 2XPZA 3FUJA 4N3BA 1N9AA 2OOEA 2Y4TA 2CFZA 3SFZA 2H6FA 5A7DB 5BXOA 3RSEG 2I1KA 3FUFA 1TJFA 3GW4A 3LDZA 2AVPA 2CHWA 4JL0A 4I1MA 2MHKA 1TNYA 4GB9A 4B89A 3ZN3A 3Q9NC 2H6GA 4LNGA 2WXQA 2WXRA 1H6OA 3ML9A 3QAQA 5AJLA 3BQOA 3DWLG 2WMOA 3ZW3A 1OWMA 1HG2A 3LY9A 3LJ3A 1OWLA 3B13A 4DUIA 4BSZB 3FY4A 2RFMA 3C3QA 4ANVA 4ANXA 2V4LA 2XPIA 3UM0A 4G11A 3GYZA 3EHRA 1E7UA 5FWQA 2F8YA 2Y4UA 3PE3A 3FUMA 3GZ1A 2PZIA 2CG3A 4XZ4A 3ISMC 4ME2A 2ETAA 4XE0A 4HOUA 3C72A 4B93B 1SA4A 1FPPA 5KNGA 3IXEA 3TAXA 1N11A 1EPUA 2YINA 2KBXA 1HU3A 5FZQA 3TWUA 5HKPA 3PZ4A 3P1UA 4AXHA 1DC2A 3SFXA 4QQIA 3B7RL 5EX3A 3B95A 3LS8A 2C0LA 5FZRA 1V54E 4GCNA 3MKRA 4BT8A 2BF0X 3CHPA 5ENPD 1OWNA 3AG2E 4HS2A 1INZA 3G2TA 3TWTA 4HOQA 2NC9A 1DNPA 2QFCA 3KSQA 1PY1A 1NP7A 2H6HA 3WXXA 3U4TA 2NXPA 1BI8B 4ATGA 3KAEA 4AY6A 3S7DA 3FUKA 1MX6A 1TYQG 2Q7FA 3PNTB 4JC8A 1MHQA 1VDYA 1UG3A 3AAAC 3PEVB 1TEZA 5AAOA 5CMYA 3LY8A 2R2LA 4BTBA 2MRIA 4I6JA 3K9IA 4HXIA 2YNQA 3O4ZA 3D3MA 1UJJA 3ZU7B 3FU3A 4XKCA 3PH0C 1HFAA 1JWGA 2ONDA 4NIKA 4G8LA 3Q5MA 3N71A 3PE4A 3I5PA 2P9UG 5ENQD 4PDXA 2XENA 3W9FA 1N4QA 3DXMG 3CKCA 1LD8A 4U0SA 4CCAA 5FZSA 3X2QE 2X3MA 3ML8A 4B94A 3MV3B 4UI9C 1XGWA 3BEEA 2X6HA 3MX3A 4DJAA 2DYSE 3CSFA 4AV7A 4PUCA 4LEUA 4K03A 3LYAA 3HRAA 1WM5A 1JCRA 3RRUA 4R7LA 4GPMA 3ZRHA 5FT9A 2B0OE 3LCAA 4UWHA 4N39A 3S2AA 2I6HA 5IY5E 3PUKA 3TWSA 3UKRG 4FLHA 3CHSA 3TWXA 4U7EB 4ZHBA 1Y6IA 4GPKA 4G2VA 2PNNA 3FH5A 1BU9A 3FUIA 4APOA 2E2EA 1LTXA 3MJWA 3IV0A 5G05J 4FJZA 4FU3A 3PZ3A 4EBAG 1A17A 3PZ1A 5LFAA 2IF4A 2R05A 3L54A 2QY7A 4ATZD 3SD5A 1HF8A 3QB2A 1D9SA 1K3ZD 4ILIA 4TUUA 4EZLA 3ABLE 5JJ7A 4AIFA 4FA6A 3KEAA 4BFRA 1OT8A 4HRLA 2ZU6B 2WXJA 4MRUA 2CHZA 3ZNGA 4GYYA 4IYPA 4A55A 3CHRA 3UM1A 4OVUA 3CLJA 1D8EA 3QWVA 1WAO1 3VLDA 4BX9A 3IEGA 4A3TA 2KM4A 2J9QA 2GROB 2LO6A 4GTSA 5AENA 3J5QB 3F6QA 3ULEG 5ENSD 4RLYA 4O6FA 2J07A 2ZGGA 3ASOE 1E7VA 3PZDA 2P2CP 3DEOA 4UQXA 5AQ7A 3V2XA 3T5VA 2XZTG 3AG3E 4WWPA 4BWRA 4CGWA 2JEKA 4GTOA 4GTTA 1PC2A 3ZXPA 3P2BA 2VGXB 4JVSA 3UPVA 4I6EA 4H7YA 3CK8A 3T8MA 5FQ8A 3HYMB 1Z3XA 2VGXA 4HB5A 3EUVA 1V55E 3URZA 3UUXA 4L2LA 3GZSA 4RQIA 4F1SA 1QNFA 2ZXWE 4J7WA 5EYLA 3JUIA 4J8YA 4DLQA 3V79K 3Q7AA 3Q9UC 3DPDA 3BG1B 4L2YA 2DZNA 4MKTA 4Q96A 4ILHB 4FULA 3LJNA 4HLLA 3HG0D 2R17C 4OAVB 4BESA 3Q47B 4GMJA 5LCWC 4KVOA 3OTNA 3ZUVB 1HS6A 2XS8A 3RIBA 4I6GA 4PH4B 4M7CA 3EU9A 4XKBA 5KJLA 1KLXA 3ONLA 4P29A 3S7BA 1H2UA 2BKGA 3MA5A 4HI8A 3R9AB 3LY7A 4A63B 4DX6D 4DX7D 2H6IA 3EU5A 3E37A 1QBQA 4DK5A 3FH7A 2FO7A 1MQSA 2KCKA 1E8XA 3SGHA 3L22A 2IOSA 5CEDB 3FU0A 3V31A 4L23A 2VGYA 1K1AA 4MLPA 4FJYA 4OYSA 5DIZA 3TWWA 3QOUA 4WWNA 3J5PA 5HQ8A 4GTPA 4GZ3A 4UWKA 3CK7A 3DSSA 4CGVA 2MOWA 1SZAA 2DZOA 3D9KA 3TL5A 4CDMA 4U04A 2WXNA 1FCHA 5CERB 4HFGA 4EZJA 4JHKA 2IONA 3FTVA 4EQFA 1HO8A 5AJDA 1QYMA 3Q75A 3QWPA 2Y0BG 5EILA 5EDSA 4AVXA 4J8FA 3NOGD 4GYWA 1FVHA 3Q4AB 4JXTA 4I1OB 3G2VA 1JPLA 4F1PA 4XEIG 5G2NA 2F8XK 2VGEA 3NB2A 1W3BA 2XQ0A 3FULA 5EKQD 4U63A 3S7FA 5LX8A 4FLBA 5BPPA 3SI5A 4Q69A 5BNWA 5KJMA 1N4PA 3OXGA 1RW2A 4F3VA 3CQGB 5G55A 2UY1B 2P9SG 2RD0A 4UI9K 1S70B 5E75A 2EINE 1HG5A 3L9TA 4GMLA 5EIBE 3Q49B 3U66A 4MS6A 3C98A 4G23A 2DCPA 2GGFA 2UY1A 3ZXSA 3D9PA 4WNGA 4KYOB 3EHQA 4OAUC 1O1RA 3UINC 3FH8A 4DI3A
chains in the Genus database with same CATH topology
2VTBA 2L9BA 3U9WA 1IQUA 4UWFA 3LXUX 5CMYA 3UX4A 5CCLA 3LY8A 4DPRA 3FTSA 4BTBA 3ZFWA 2MRIA 2WPVA 2WXFA 4I6JA 3K9IA 1QZ2A 4HXIA 5A23A 3RK6A 4F53A 4NURA 4HOTA 2YNQA 4I2ZA 1HE8A 2VSOE 3SBSA 3O4ZA 3D3MA 1UJJA 4FADA 2L6JA 3FU3A 4XKCA 3PH0C 1HFAA 2FEZA 1JWGA 2I2OA 3CK9A 4ACLA 4H7XA 2DIWA 5FJYA 2ONDA 2PM6A 4JA7A 5G04J 3Q5MA 3ZEFA 5T4YA 2IJGX 3N71A 2X6KA 4GA1A 3EJNA 3I3NA 3PE4A 4J8DA 3CVXA 2XRYA 3AU4A 2UWJG 3FEYA 3I5PA 2E0IA 5AIJA 4YVOA 3R7RA 4C0MA 3KS2A 4W9RA 4CDRA 4ABNA 2WQHA 4PDXA 1JWFA 3ZPJA 2WQ7A 1PAQA 2WXLA 2JLBA 3O48A 3CKCA 4CT0A 4APFA 1LF8A 2VSNA 4U0SA 4CCAA 5FZSA 3E4BA 1S0PA 3SNXA 3EHNA 3G2UA 4URKA 3FUDA 2X3MA 3UMVA 4OVVA 3ML8A 5D0QD 4B94A 3MV3B 4HLEA 4UI9C 2YHEA 4EPZA 1XGWA 4JPSA 1X5BA 2KCLA 4YNDA 3BEEA 3L13A 4CT4A 3APCA 2X6HA 3MX3A 3ZYLA 4DJAA 3CSFA 4AV7A 4N3AA 4AJWA 3RKVA 4HORA 4PUCA 4LEUA 3RU0A 5FQ7A 4K03A 3LYAA 3MYVA 2LSUA 1WM5A 3RRUA 5JJTA 5LOZA 3NQPA 3HVEB 3PREA 2LSVA 4I17A 4R7LA 3UT7A 4M3OA 2WXOA 5ANLA 4N3CA 5FT9A 3ZRHA 4C9BB 3HIZA 3LCAA 1U3CA 4FHJA 3NF1A 4N39A 4UWHA 4WWOA 3S2AA 4GA2A 2I6HA 2WMNA 3VLEA 3PUKA 3RRMB 4DLOA 3ASFA 3QDNA 1N52A 1ZBPA 4FLHA 3CHSA 1HXIA 3ZYMA 2CHXA 3HVEA 2R59A 5D0OD 5BUZA 1E8ZA 1NA3A 2PQNA 2C2LA 2VSYA 3JYSA 1Y6IA 2DBAA 3L16A 4I9EA 4G2VA 4UWGA 3FH5A 5ARFA 5FQ4A 4GPKA 4WUYA 3EHMA 3FUIA 3T5XA 1YA0A 4APOA 2E2EA 2X6JA 1OWOA 3MJWA 3IV0A 3QC1A 5G05J 4FJZA 2J09A 4FU3A 1B89A 4XX5A 4EBAG 3U3WA 2AWIA 1A17A 4GAAA 1SZ9A 4LUNU 3JQ1A 3U64A 2BUGA 1TJCA 2J4DA 5LFAA 4QFVA 3TG4A 4AM9A 4IRUA 2IF4A 1HZ4A 2KZTB 1ELWA 2YHCA 3KEZA 4G1TA 5LCWJ 3FDHA 1OWPA 2VYIA 3CVLA 1SQMA 3L54A 2QY7A 3SD5A 1HF8A 2XCBA 3MGBA 3QB2A 5A6CA 5KCMA 1UN9A 2GRMA 2AXUA 3MEKA 5C1DA 5DBKA 4ILIA 4TUUA 3NZSA 2KZTA 3B7TA 3CEQA 4ANUA 3QKYA 4EZLA 3CVVA 2IQCA 3ESKA 1N54A 4V3IA 2WXHA 3IHYA 5JJ7A 3CHOA 3GZ2A 2GRLA 4DI4A 1NZNA 4AIFA 4CDNA 4FA6A 3PVLA 4BTAA 4BFRA 5KJKA 3R7QA 1H6KA 3BG0B 4L7TA 2ZU6B 2WXJA 4AY5A 4MRUA 2CHZA 1UJKA 2HM8A 3FU6A 4GYYA 4IYPA 4WNFA 3TG5A 2AXZA 4A55A 3ASDA 4KMOA 3CHRA 2I1JA 3FFLA 3LKUA 4OVUA 5J08A 2FULA 2WXMA 4GZ5A 2WXGA 3CLJA 3SBTB 1UW4B 3ASHA 1L5JA 3ASGA 2Y3AA 1KT0A 4FP7A 2WVIA 4WAFA 3LEWA 3QWVA 3SHFA 1WAO1 4LERA 3VLDA 4BX9A 3IEGA 4YVQC 2OVFA 3LVQE 4WNEA 4A3TA 2KM4A 3RO2A 2J9QA 3CIAA 1IYGA 2LO6A 3HDXA 3VTXA 4NRHB 5FQ6A 5AENA 2AXVA 3D9JA 4U07A 2WQ6A 3CVYA 4CEMA 3CVNA 1H2TC 4O6FA 2WXIA 5BV0A 2XCCA 3VTYA 2J07A 4B8AA 1E7VA 3PZDA 4GZDA 3LVRE 3TXMA 4KVMA 3PDNA 3MCXA 3PRZA 4UQXA 3JCKC 2P58C 3MZLB 2OV8A 1DVPA 3T5VA 3QWWA 5G04C 5LP0A 4N5CA 4A1GA 2WM9A 4WWPA 5M72A 4K0RA 4BWRA 4CGWA 2JEKA 3FTZA 2R5SA 1ELRA 4WNDA 4RG6A 3ULQA 4J6IA 5KJNA 2XGOA 4EECA 4I2WA 1PC2A 5BV1A 1WY6A 3P2BA 2NSZA 2VGXB 4NQ0A 3B7UX 2WXPA 3PNLB 4KT6B 5J90A 3CKBA 3RO3A 4B8CB 4JVSA 3TGOA 3UPVA 3FU5A 2XEVA 4I6EA 2YQ8A 3CQCB 3D9OA 4H7YA 2IFUA 4JHRA 2FF4A 2X6IA 1NA0A 3IBEA 2XGSA 3CK8A 3T8MA 5FQ8A 3HYMB 1Z3XA 1E90A 2LAIA 2VGXA 3UT4A 1EF1C 2WB2A 3L17A 1HX8A 2BTDA 2A5UA 3OAWA 4IULA 3ENEA 4PS8A 4J0UA 3CSTA 3HHMA 3Q15A 4U0UA 3URZA 3UUXA 3CV0A 1GW6A 2WXKA 4L2LA 5ANRA 3FUHA 4BSXA 4D10C 3PEUB 3EIQC 3GZSA 4F1SA 3FTXA 4UQYA 3FTYA 4FC8A 2X38A 3CHMA 1KT1A 4GU5A 1QNFA 4G26A 3JUIA 3I4GA 4BY6A 3FHEA 3FEXA 4DLQA 2V0PA 2LAHA 1FVFA 3DPDA 3D9NA 2XPZA 1BPOA 2PM7A 3BG1B 1HH8A 3ESLA 2X6FA 3FTUA 3CVQA 3FUJA 4L2YA 4N3BA 2OOEA 4MKTA 4RSYA 3RJVA 4AP2A 2Y4TA 4BT9A 3CVPA 2VQ2A 3D9LA 1UN8A 3NZUA 4PS3A 4Q96A 5G05C 3ZIMA 4ILHB 2CFZA 1JUQA 4FULA 4GYOA 3SFZA 5A7DB 2R17C 3FUNA 1IQRA 5T3RA 3Q47B 3CVUA 2I1KA 2XPYA 3FUFA 1TJFA 3OXFA 3GW4A 4GMJA 4KVOA 2HR2A 3ZYQA 5LCWC 3OTNA 1HS6A 2PQRA 2KATA 3LDZA 3RIBA 4I6GA 3QK0A 2AVPA 2CHWA 4JL0A 4JZYA 4PH4B 2L0IA 2MHKA 1QQEA 4I1MA 4TV3A 4B0ZA 4GB9A 5FTPA 4J8EA 4LCTA 4B89A 3ZN3A 4XKBA 2A4ZA 1Z3YA 3CVWA 4UQZA 3ZYKA 5KJLA 1KLXA 2WXQA 2WXRA 3ML9A 4ANWA 3ONLA 4P29A 3QAQA 5AJLA 3I4RB 2J49A 1E8YA 2WMOA 3S7BA 3SZ7A 3ZW3A 1OWMA 3B7SA 1HG2A 1H2UA 3LY9A 5BW8C 3MA5A 4LRZA 3ZVVA 4AOFA 3FUEA 2FBNA 1Y8MA 1OWLA 3G2WA 3B13A 3LY7A 3LJ3A 3OXLA 3R9AB 3EDTB 3FY4A 3FWVA 4ILGA 2C0MA 4ACKA 2ILRA 4ANVA 3PUJA 4GCOA 4ANXA 4DK5A 3FH7A 3LPZA 4XIFA 3FTWA 2V4LA 2FO7A 1XNFA 1E8WA 4HVBA 1MQSA 2XPIA 4JHJA 2KCKA 1E8XA 2LNIA 3QJZA 4U0ZA 3UT8A 3RRNB 4G11A 5CCMA 3SGHA 4Y6CA 3GYZA 5AYWD 3L22A 4JA9A 2IOSA 3FU0A 1E7UA 5FWQA 4A1SA 4L1BA 2V8SE 4L23A 2VGYA 4AEZC 1H0AA 2Y4UA 3FP3A 3PE3A 3QNKA 3FUMA 3GZ1A 4FJYA 1ELKA 4MLPA 4OYSA 4U8HA 2PZIA 5DIZA 3ZGQA 2KC7A 4XI9A 2VSXE 4KBQA 2CG3A 5JJ6A 4EZKA 4XZ4A 3QOUA 4HOSA 4WWNA 2V5FA 4ME2A 3D9IA 5HQ8A 4GZ3A 1H19A 4UWKA 4XE0A 2HYZA 2XGMA 3IHVA 3CK7A 4HOUA 3SF4A 2XRZA 4I43A 4CGVA 2MOWA 1SZAA 4E85A 3ONKA 3D9KA 4XI0A 4UI9J 3TL5A 4N2QA 4N2SA 5JHAA 3AU5A 3TAXA 4CDMA 3CGHA 3APDA 4U04A 5T8IA 3ZHEB 1EPUA 2WXNA 5ENNA 1FCHA 5EX0A 5CMWA 2EQXA 4G25A 4CRWA 3PS6A 2YINA 3G2SA 1EYHA 3APFA 4GZCA 4GZ6A 4Y6WA 1HU3A 4HFGA 5FZQA 4EZJA 4JHKA 2IONA 3FTVA 3P1UA 3ZHEA 4AXHA 4EQFA 1HO8A 3L6AA 4JW1A 5AJDA 4KXKB 3D9MA 2IOLA 2FI7A 3QWPA 4EBAA 5EDSA 2I9CA 4AVXA 4J8FA 4BX8A 4RVBA 4C0EA 4GYWA 1FVHA 3S7JA 3B7RL 3Q4AB 4JXTA 2KCVA 4I1OB 5EX3A 2PL2A 3G2VA 3LS8A 4A3VA 2C0LA 1JPLA 5FZRA 5G2NA 2IU1A 5JHBA 2L0TB 1E96B 4FHKA 1W3BA 2XQ0A 4KZ0A 4GCNA 3FULA 4KZCA 3MKRA 4BT8A 2BF0X 3CHPA 5HI7A 3MV2B 5EKQD 2CFUA 1OWNA 4U63A 3S7FA 5LX8A 4FLBA 4PS7A 5BPPA 3VLFA 2CG2A 4J8SA 3SI5A 4Q69A 5BNWA 4E6HA 4F7AA 5KJMA 4HS2A 5ARGA 5CHEE 1OUVA 3QARA 4Q94A 2M63A 1INZA 3OXGA 2AW6A 3G2TA 2J08A 1EDUA 4HOQA 4F3VA 2NC9A 3CQGB 5E76A 1ZU2A 1DNPA 2QFCA 3MKQB 5BT1A 3TXNA 3CHQA 1IHGA 5G55A 1PY1A 2OVBA 1NP7A 2UY1B 2RD0A 4I9CA 3TJPA 4UI9K 3AS8A 3EIJA 2GW1A 3JQ0A 3WXXA 5E75A 3UQ3A 1HG5A 4I1AA 4GMLA 4JEHA 2HO1A 2NXPA 3Q49B 3U4TA 4UWLA 4NACA 3KAEA 4ATGA 3U66A 4MS6A 1H2VC 3MKQA 4AY6A 3CR3A 3C98A 4G23A 3S7DA 4RG9A 2DCPA 2GGFA 2RG8A 3FUKA 2UY1A 3KD7A 3L08A 3ZXSA 1U3DA 3D9PA 1Z6TA 2Q7FA 3IKOB 4WNGA 4TRQA 2VTBB 4KYOB 3AS4A 4GA0A 1P5QA 4IN3B 2J4BA 3PNTB 4G24A 4JC8A 5C2YA 1MHQA 3AS5A 4JEUA 1VDYA 3FH8A 1UG3A 2VJ8A 3DBSA 3PEVB 1TEZA 4DI3A 2XHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JHK A;  4GMJ A;  1UW4 B;  3FEY A;  2ION A;  4JHJ A;  1H2V C;  1H2U A;  2KZT A;  3L6A A;  2IOS A;  1PAQ A;  2GGF A;  2IOL A;  1N54 A;  2RG8 A;  3JUI A;  3FEX A;  3RK6 A;  4LUN U;  4B89 A;  4C9B B;  2VSO E;  2VSX E;  2KZT B;  3D3M A;  1H6K A;  2ZU6 B;  4IUL A;  1UG3 A;  2HM8 A;  2NSZ A;  4CEM A;  2I2O A;  2IU1 A;  4CRW A;  1H2T C;  1N52 A;  4GML A;  3EIJ A;  5ANR A;  4B8C B;  4B8A A;  4CT4 A;  2FUL A;  1HU3 A;  3EIQ C; 
#chains in the Genus database with same CATH topology
 2L9B A;  3U9W A;  2IEJ A;  3LXU X;  3HXE A;  5CCL A;  3E33 A;  3ZFW A;  2WPV A;  2WXF A;  3DSU A;  1HE8 A;  3SBS A;  2ZIR A;  2DIW A;  5G04 J;  5T4Y A;  2B6C A;  3EJN A;  5AIJ A;  4YVO A;  3KS2 A;  4CDR A;  1RZ4 A;  2WQH A;  3ZPJ A;  1PAQ A;  2JLB A;  1TNZ A;  4APF A;  2VSN A;  1N4S A;  2KXP C;  4OVV A;  2YHE A;  1X5B A;  2KCL A;  3HXC A;  4TUM A;  4N3A A;  4AJW A;  3RKV A;  2LSU A;  1SW6 A;  2P9N G;  3PRE A;  4I17 A;  5FIN A;  2F0Y A;  4FHJ A;  4WWO A;  3VLE A;  3UTM A;  3RRM B;  3DRA A;  1ZBP A;  5JA4 D;  1HXI A;  3ZYM A;  2R59 A;  5BUZ A;  3JYS A;  4UWG A;  2DBA A;  3T5X A;  2X6J A;  1OWO A;  3QC1 A;  2R02 A;  1BD8 A;  4GAA A;  4LUN U;  2BUG A;  3TG4 A;  2KZT B;  1ELW A;  3KEZ A;  4GTV A;  5A6C A;  5EYP F;  5DBK A;  5H7P A;  4ANU A;  2KZT A;  3QKY A;  1N54 A;  4V3I A;  2XEH A;  3R9M A;  2ZGD A;  4CDN A;  2ETC A;  4BTA A;  5KJK A;  2HM8 A;  3FU6 A;  4LNU D;  5FIO A;  4WNF A;  3TG5 A;  2AXZ A;  5CEA A;  2WXG A;  2P9I G;  3ASH A;  1L5J A;  2Y3A A;  1OCO E;  4YVQ C;  3HXB A;  3VTX A;  2WQ6 A;  2AXV A;  5BV0 A;  2WXI A;  4B8A A;  4O1O A;  2DVW A;  2L6B A;  1DVP A;  2OV8 A;  3QWW A;  5LP0 A;  2F37 A;  4DRX E;  2QZA A;  3FTZ A;  4Z68 A;  4WND A;  3AG4 E;  3ULQ A;  4J6I A;  4I2W A;  3T9K A;  5BV1 A;  1WY6 A;  2WXP A;  3WG7 E;  3CQC B;  5AN8 A;  2FF4 A;  2XGS A;  5AQA A;  1E90 A;  2LAI A;  3UT4 A;  3JXI A;  3L17 A;  1TNU A;  2BTD A;  4HBD A;  1GW6 A;  2WXK A;  3JUE A;  4U8V D;  4GU5 A;  5D2M C;  4YDE A;  3FEX A;  2V5Q C;  3FTU A;  2PM7 A;  1HH8 A;  3ESL A;  5KBA A;  4AP2 A;  4BT9 A;  3NZU A;  4PS3 A;  3FUN A;  3CVU A;  3OXF A;  3ZYQ A;  2HR2 A;  4MBG A;  2PQR A;  4TV3 A;  1QQE A;  4B0Z A;  4LCT A;  1Z3Y A;  3V30 A;  3ZYK A;  2RKK A;  3I4R B;  2J49 A;  4O1P A;  1TN8 A;  2LUH A;  3B7S A;  5BW8 C;  4GTM A;  1BI7 B;  3FUE A;  2FBN A;  1Y8M A;  3G2W A;  1YCS B;  3EDT B;  4ILG A;  4ACK A;  3C3O A;  2ILR A;  3DSW A;  3PUJ A;  4GCO A;  4XIF A;  3FTW A;  1E8W A;  4JHJ A;  3E32 A;  4U0Z A;  3HXF A;  5CCM A;  4A1S A;  3ZKJ A;  4L1B A;  2V8S E;  4BER A;  3FP3 A;  4CT0 A;  1IYG A;  2KC7 A;  2VSX E;  2IO3 C;  2V5F A;  3D9I A;  4O60 A;  1KZP A;  1JCS A;  2HYZ A;  4EHM A;  4LSZ E;  2LXL A;  3UM3 A;  4E85 A;  3ONK A;  2EIK E;  2DWZ A;  4UI9 J;  4N2Q A;  3AU5 A;  3CGH A;  3APD A;  5T8I A;  3ZHE B;  5ENN A;  5EX0 A;  5CMW A;  4G25 A;  4CRW A;  3UXG A;  1EYH A;  4GZC A;  1Z5S C;  3ZHE A;  2P9P G;  3L6A A;  4JW1 A;  1TN7 A;  2IOL A;  2I9C A;  4BX8 A;  4RVB A;  4C0E A;  4K5A B;  3S7J A;  2ZIS A;  2KCV A;  1JCQ A;  2ETB A;  4A3V A;  5JHB A;  2L0T B;  4FHK A;  4TXR A;  4KZC A;  5HI7 A;  3MV2 B;  3VLF A;  2CG2 A;  4J8S A;  2EIL E;  4E6H A;  4F7A A;  2GRP B;  2GRR B;  5ARG A;  5CHE E;  3QAR A;  1OCR E;  2AW6 A;  2J08 A;  3MKQ B;  3CHQ A;  4DX2 A;  1H6P A;  3TJP A;  3AS8 A;  3EIJ A;  2GRN B;  2GW1 A;  3JQ0 A;  3UQ3 A;  4JEH A;  2HO1 A;  2RFA A;  4UWL A;  1H2V C;  3MKQ A;  2LXM A;  4RG9 A;  2RG8 A;  3KD7 A;  3L08 A;  1Z6T A;  4TRQ A;  3AS4 A;  1P5Q A;  4IN3 B;  3JXJ A;  5C2Y A;  4JEU A;  2Y69 E;  3SQV A;  5ENR D;  5AAR A;  2XHE A;  2WXO A;  1IQU A;  2IY0 C;  3FTS A;  4HQD A;  2Y1L E;  5A23 A;  1O1T A;  3RK6 A;  4F53 A;  4I2Z A;  4C48 B;  4FAD A;  2L6J A;  2I2O A;  4JB8 P;  4H7X A;  5FJY A;  2BKK B;  4JA7 A;  2IJG X;  4GA1 A;  3I3N A;  4J8D A;  4DX5 D;  2XRY A;  3AU4 A;  2UWJ G;  2E0I A;  3V2O A;  4W9R A;  1JWF A;  1A5E A;  2WQ7 A;  1KZO A;  4GTQ A;  3O48 A;  3UMV A;  2J8S D;  3L13 A;  1YMP A;  3APC A;  5CBN A;  3RU0 A;  5FQ7 A;  3MYV A;  1LD7 A;  5JJT A;  5LOZ A;  3HVE B;  2LSV A;  3E30 A;  1MZC A;  4N3C A;  3UKU G;  1NL4 A;  2WMN A;  4GA2 A;  1N52 A;  3DST A;  3HVE A;  5D0O D;  3DSV A;  1E8Z A;  1NA3 A;  4I9E A;  5FQ4 A;  1OY3 D;  3EHM A;  3AG1 E;  2J09 A;  3L82 A;  3DEP A;  4XX5 A;  1B89 A;  4K5C A;  2AWI A;  1OXJ A;  1SZ9 A;  3U64 A;  3Q78 A;  5LCW J;  1HZ4 A;  2YHC A;  4G1T A;  2A5E A;  2MYO A;  2VYI A;  1SQM A;  4U8Y D;  2OCC E;  1S63 A;  5KCM A;  1UN9 A;  3MEK A;  3NZS A;  3CEQ A;  3ULY A;  3CVV A;  2IQC A;  2EIM E;  2WXH A;  3PZ2 A;  3CHO A;  3GZ2 A;  2GRL A;  1NZN A;  1BLX B;  3R7Q A;  1YYH A;  1H6K A;  4L7T A;  2QC9 A;  4AY5 A;  1UJK A;  1DCE A;  2QYJ A;  3ASD A;  4KMO A;  3FFL A;  3LKU A;  2FUL A;  2WXM A;  3SBT B;  4DX1 A;  2WVI A;  3LEW A;  1TNO A;  3RO2 A;  4NRH B;  3D9J A;  4CZ2 D;  1S64 A;  1UOH A;  4CEM A;  3CVN A;  3SFY A;  1D8D A;  3TXM A;  3LVR E;  4KVM A;  3TWR A;  3MCX A;  3PRZ A;  3JCK C;  4N5Q A;  2QYU A;  4N5C A;  2WM9 A;  3KSL A;  4K0R A;  1ELR A;  1MYO A;  5KWD A;  4NQ0 A;  2NSZ A;  3PNL B;  4B8C B;  2DYR E;  2XEV A;  4ZFH A;  5HS0 A;  4JHR A;  2X6I A;  3IBE A;  1IXV A;  2R03 A;  2WB2 A;  1HX8 A;  2A5U A;  5CBO A;  3OAW A;  4IUL A;  3ENE A;  4PS8 A;  4J0U A;  3HHM A;  3Q15 A;  4U0U A;  1Q2Z A;  5ANR A;  4BSX A;  3EIQ C;  4UQY A;  3FTY A;  2X38 A;  3CHM A;  1KT1 A;  3FHE A;  1TN6 A;  2XZD G;  3E34 A;  2LAH A;  1FVF A;  3D9N A;  3QK0 A;  1BPO A;  2X6F A;  3CVQ A;  3RJV A;  4RSY A;  3CVP A;  2VQ2 A;  4F6R D;  3D9L A;  1UN8 A;  5G05 C;  3ZIM A;  1JUQ A;  4GYO A;  1IQR A;  5T3R A;  2XPY A;  1OCZ E;  1AP7 A;  3W9G A;  3NBN B;  2KAT A;  4JZY A;  2L0I A;  2V4H C;  5FTP A;  4J8E A;  2A4Z A;  3CVW A;  4UQZ A;  4LG6 A;  4U95 D;  4ANW A;  1E8Y A;  3SZ7 A;  1IKN D;  1NFI E;  4LRZ A;  3ZVV A;  4AOF A;  1TR4 A;  3OXL A;  1KPS B;  3FWV A;  2C0M A;  5B3S E;  1K1B A;  3LPZ A;  3TWV A;  1XNF A;  4HVB A;  1N94 A;  1U2V G;  2LNI A;  2JAB A;  3QJZ A;  3UT8 A;  3RRN B;  4Y6C A;  5AYW D;  4JA9 A;  4AEZ C;  1H0A A;  2FO1 E;  3QNK A;  1ELK A;  4U8H A;  3ZGQ A;  4TXQ A;  4XI9 A;  4KBQ A;  5JJ6 A;  4EZK A;  4HOS A;  4YDY A;  3NAW A;  1H19 A;  2XGM A;  3IHV A;  3SF4 A;  2XRZ A;  4I43 A;  4XI0 A;  4N2S A;  5JHA A;  2OEV A;  1FT1 A;  1MX4 A;  1X81 A;  2EQX A;  3DSX A;  5ENO D;  3PS6 A;  2IO2 C;  3G2S A;  3APF A;  4GZ6 A;  4Y6W A;  1IHB A;  5HRY A;  1N0Q A;  4KXK B;  2GRQ B;  3D9M A;  4EBA A;  2FI7 A;  5ITZ F;  3UIP C;  1N0R A;  3SY2 A;  3ABM E;  2PL2 A;  4JD2 G;  2IU1 A;  1E96 B;  4KZ0 A;  3ABK E;  3C5R A;  2CFU A;  3BUA A;  4PS7 A;  3D9H A;  3TWQ A;  1OUV A;  4Q94 A;  2P9L G;  2M63 A;  1EDU A;  5E76 A;  1ZU2 A;  3RAU A;  5BT1 A;  3TXN A;  1IHG A;  2OVB A;  2XEE A;  4I9C A;  5CRV A;  4I1A A;  1NI1 A;  2XS1 A;  4NAC A;  2BED A;  3CR3 A;  1O1S A;  4GMR A;  1U3D A;  3IKO B;  2VTB B;  1SVX A;  4GA0 A;  1SA5 A;  2J4B A;  3C3R A;  4G24 A;  3Q73 A;  4K5B A;  3AS5 A;  2VJ8 A;  3DBS A;  4G8K A;  3TGO A;  2VTB A;  3Q79 A;  4UWF A;  3T8K A;  3UX4 A;  3DXK G;  4DPR A;  4HRN A;  1QZ2 A;  5EN5 D;  4NUR A;  4HOT A;  2VSO E;  4BET A;  4CYM D;  5D66 A;  4UUC A;  2FEZ A;  3CK9 A;  4ACL A;  2PM6 A;  3ZEF A;  2X6K A;  1WG0 A;  3CVX A;  3FEY A;  3R7R A;  4BEP A;  4C0M A;  5BXU A;  4ABN A;  3B7B A;  2WXL A;  1G3N B;  4LNB A;  1LF8 A;  3HXD A;  3E4B A;  1S0P A;  3SNX A;  3EHN A;  3G2U A;  4URK A;  3FUD A;  5EID A;  1OCC E;  5D0Q D;  4HLE A;  4EPZ A;  4GTR A;  3BU8 A;  4JPS A;  4YND A;  3DPY A;  4CT4 A;  3ZYL A;  4HOR A;  2AJA A;  2HE0 A;  3AJI A;  3NQP A;  3UT7 A;  4M3O A;  5ANL A;  4C9B B;  3HIZ A;  1U3C A;  3NF1 A;  5KNH D;  4DLO A;  3ASF A;  3QDN A;  2CHX A;  2PQN A;  2VSY A;  2C2L A;  3L16 A;  4U96 D;  5ARF A;  4WUY A;  1YA0 A;  1MX2 A;  3U3W A;  3JQ1 A;  1TJC A;  2J4D A;  4QFV A;  4AM9 A;  4IRU A;  3FDH A;  1OWP A;  3CVL A;  3NOC D;  5ENT D;  2XCB A;  3UIO C;  3MGB A;  2GRM A;  2AXU A;  5C1D A;  1MJ0 A;  3B7T A;  1AWC B;  3ESK A;  3IHY A;  1WDY A;  5CEC B;  4DI4 A;  3PVL A;  1ZB1 A;  3BG0 B;  5AQB A;  4HNA D;  5AQ9 A;  2OEW A;  2I1J A;  5J08 A;  4GZ5 A;  1UW4 B;  3ASN E;  3ASG A;  4FP7 A;  1KT0 A;  4WAF A;  4L9P A;  1TNB A;  3SHF A;  4HRM B;  4LER A;  2OVF A;  3LVQ E;  4WNE A;  1N4R A;  3CIA A;  3UI2 A;  3HDX A;  1FT2 A;  5FQ6 A;  4U07 A;  3CVY A;  1H2T C;  2XCC A;  3VTY A;  1K8K G;  4GZD A;  3PDN A;  3SO8 A;  3MZL B;  2P58 C;  5G04 C;  4A1G A;  5M72 A;  2P9K G;  2R5S A;  3Q7F A;  4RG6 A;  5KJN A;  2XGO A;  4EEC A;  2EIJ E;  5J90 A;  5B1A E;  3B7U X;  4KT6 B;  3CKB A;  3RO3 A;  5JMN D;  3FU5 A;  1O5M A;  2YQ8 A;  3D9O A;  2IFU A;  1NA0 A;  4YDO A;  1EF1 C;  4HI9 A;  3UM2 A;  1N95 A;  3CST A;  5CRU A;  2NYJ A;  3CV0 A;  3FUH A;  4D10 C;  3PEU B;  5B1B E;  3FTX A;  4FC8 A;  1DCQ A;  4YDW A;  4G26 A;  4TXP A;  3I4G A;  4BY6 A;  2V0P A;  4X8Q A;  2XPZ A;  3FUJ A;  4N3B A;  1N9A A;  2OOE A;  2Y4T A;  2CFZ A;  3SFZ A;  2H6F A;  5A7D B;  5BXO A;  3RSE G;  2I1K A;  3FUF A;  1TJF A;  3GW4 A;  3LDZ A;  2AVP A;  2CHW A;  4JL0 A;  4I1M A;  2MHK A;  1TNY A;  4GB9 A;  4B89 A;  3ZN3 A;  3Q9N C;  2H6G A;  4LNG A;  2WXQ A;  2WXR A;  1H6O A;  3ML9 A;  3QAQ A;  5AJL A;  3BQO A;  3DWL G;  2WMO A;  3ZW3 A;  1OWM A;  1HG2 A;  3LY9 A;  3LJ3 A;  1OWL A;  3B13 A;  4DUI A;  4BSZ B;  3FY4 A;  2RFM A;  3C3Q A;  4ANV A;  4ANX A;  2V4L A;  2XPI A;  3UM0 A;  4G11 A;  3GYZ A;  3EHR A;  1E7U A;  5FWQ A;  2F8Y A;  2Y4U A;  3PE3 A;  3FUM A;  3GZ1 A;  2PZI A;  2CG3 A;  4XZ4 A;  3ISM C;  4ME2 A;  2ETA A;  4XE0 A;  4HOU A;  3C72 A;  4B93 B;  1SA4 A;  1FPP A;  5KNG A;  3IXE A;  3TAX A;  1N11 A;  1EPU A;  2YIN A;  2KBX A;  1HU3 A;  5FZQ A;  3TWU A;  5HKP A;  3PZ4 A;  3P1U A;  4AXH A;  1DC2 A;  3SFX A;  4QQI A;  3B7R L;  5EX3 A;  3B95 A;  3LS8 A;  2C0L A;  5FZR A;  1V54 E;  4GCN A;  3MKR A;  4BT8 A;  2BF0 X;  3CHP A;  5ENP D;  1OWN A;  3AG2 E;  4HS2 A;  1INZ A;  3G2T A;  3TWT A;  4HOQ A;  2NC9 A;  1DNP A;  2QFC A;  3KSQ A;  1PY1 A;  1NP7 A;  2H6H A;  3WXX A;  3U4T A;  2NXP A;  1BI8 B;  4ATG A;  3KAE A;  4AY6 A;  3S7D A;  3FUK A;  1MX6 A;  1TYQ G;  2Q7F A;  3PNT B;  4JC8 A;  1MHQ A;  1VDY A;  1UG3 A;  3AAA C;  3PEV B;  1TEZ A;  5AAO A;  5CMY A;  3LY8 A;  2R2L A;  4BTB A;  2MRI A;  4I6J A;  3K9I A;  4HXI A;  2YNQ A;  3O4Z A;  3D3M A;  1UJJ A;  3ZU7 B;  3FU3 A;  4XKC A;  3PH0 C;  1HFA A;  1JWG A;  2OND A;  4NIK A;  4G8L A;  3Q5M A;  3N71 A;  3PE4 A;  3I5P A;  2P9U G;  5ENQ D;  4PDX A;  2XEN A;  3W9F A;  1N4Q A;  3DXM G;  3CKC A;  1LD8 A;  4U0S A;  4CCA A;  5FZS A;  3X2Q E;  2X3M A;  3ML8 A;  4B94 A;  3MV3 B;  4UI9 C;  1XGW A;  3BEE A;  2X6H A;  3MX3 A;  4DJA A;  2DYS E;  3CSF A;  4AV7 A;  4PUC A;  4LEU A;  4K03 A;  3LYA A;  3HRA A;  1WM5 A;  1JCR A;  3RRU A;  4R7L A;  4GPM A;  3ZRH A;  5FT9 A;  2B0O E;  3LCA A;  4UWH A;  4N39 A;  3S2A A;  2I6H A;  5IY5 E;  3PUK A;  3TWS A;  3UKR G;  4FLH A;  3CHS A;  3TWX A;  4U7E B;  4ZHB A;  1Y6I A;  4GPK A;  4G2V A;  2PNN A;  3FH5 A;  1BU9 A;  3FUI A;  4APO A;  2E2E A;  1LTX A;  3MJW A;  3IV0 A;  5G05 J;  4FJZ A;  4FU3 A;  3PZ3 A;  4EBA G;  1A17 A;  3PZ1 A;  5LFA A;  2IF4 A;  2R05 A;  3L54 A;  2QY7 A;  4ATZ D;  3SD5 A;  1HF8 A;  3QB2 A;  1D9S A;  1K3Z D;  4ILI A;  4TUU A;  4EZL A;  3ABL E;  5JJ7 A;  4AIF A;  4FA6 A;  3KEA A;  4BFR A;  1OT8 A;  4HRL A;  2ZU6 B;  2WXJ A;  4MRU A;  2CHZ A;  3ZNG A;  4GYY A;  4IYP A;  4A55 A;  3CHR A;  3UM1 A;  4OVU A;  3CLJ A;  1D8E A;  3QWV A;  1WAO 1;  3VLD A;  4BX9 A;  3IEG A;  4A3T A;  2KM4 A;  2J9Q A;  2GRO B;  2LO6 A;  4GTS A;  5AEN A;  3J5Q B;  3F6Q A;  3ULE G;  5ENS D;  4RLY A;  4O6F A;  2J07 A;  2ZGG A;  3ASO E;  1E7V A;  3PZD A;  2P2C P;  3DEO A;  4UQX A;  5AQ7 A;  3V2X A;  3T5V A;  2XZT G;  3AG3 E;  4WWP A;  4BWR A;  4CGW A;  2JEK A;  4GTO A;  4GTT A;  1PC2 A;  3ZXP A;  3P2B A;  2VGX B;  4JVS A;  3UPV A;  4I6E A;  4H7Y A;  3CK8 A;  3T8M A;  5FQ8 A;  3HYM B;  1Z3X A;  2VGX A;  4HB5 A;  3EUV A;  1V55 E;  3URZ A;  3UUX A;  4L2L A;  3GZS A;  4RQI A;  4F1S A;  1QNF A;  2ZXW E;  4J7W A;  5EYL A;  3JUI A;  4J8Y A;  4DLQ A;  3V79 K;  3Q7A A;  3Q9U C;  3DPD A;  3BG1 B;  4L2Y A;  2DZN A;  4MKT A;  4Q96 A;  4ILH B;  4FUL A;  3LJN A;  4HLL A;  3HG0 D;  2R17 C;  4OAV B;  4BES A;  3Q47 B;  4GMJ A;  5LCW C;  4KVO A;  3OTN A;  3ZUV B;  1HS6 A;  2XS8 A;  3RIB A;  4I6G A;  4PH4 B;  4M7C A;  3EU9 A;  4XKB A;  5KJL A;  1KLX A;  3ONL A;  4P29 A;  3S7B A;  1H2U A;  2BKG A;  3MA5 A;  4HI8 A;  3R9A B;  3LY7 A;  4A63 B;  4DX6 D;  4DX7 D;  2H6I A;  3EU5 A;  3E37 A;  1QBQ A;  4DK5 A;  3FH7 A;  2FO7 A;  1MQS A;  2KCK A;  1E8X A;  3SGH A;  3L22 A;  2IOS A;  5CED B;  3FU0 A;  3V31 A;  4L23 A;  2VGY A;  1K1A A;  4MLP A;  4FJY A;  4OYS A;  5DIZ A;  3TWW A;  3QOU A;  4WWN A;  3J5P A;  5HQ8 A;  4GTP A;  4GZ3 A;  4UWK A;  3CK7 A;  3DSS A;  4CGV A;  2MOW A;  1SZA A;  2DZO A;  3D9K A;  3TL5 A;  4CDM A;  4U04 A;  2WXN A;  1FCH A;  5CER B;  4HFG A;  4EZJ A;  4JHK A;  2ION A;  3FTV A;  4EQF A;  1HO8 A;  5AJD A;  1QYM A;  3Q75 A;  3QWP A;  2Y0B G;  5EIL A;  5EDS A;  4AVX A;  4J8F A;  3NOG D;  4GYW A;  1FVH A;  3Q4A B;  4JXT A;  4I1O B;  3G2V A;  1JPL A;  4F1P A;  4XEI G;  5G2N A;  2F8X K;  2VGE A;  3NB2 A;  1W3B A;  2XQ0 A;  3FUL A;  5EKQ D;  4U63 A;  3S7F A;  5LX8 A;  4FLB A;  5BPP A;  3SI5 A;  4Q69 A;  5BNW A;  5KJM A;  1N4P A;  3OXG A;  1RW2 A;  4F3V A;  3CQG B;  5G55 A;  2UY1 B;  2P9S G;  2RD0 A;  4UI9 K;  1S70 B;  5E75 A;  2EIN E;  1HG5 A;  3L9T A;  4GML A;  5EIB E;  3Q49 B;  3U66 A;  4MS6 A;  3C98 A;  4G23 A;  2DCP A;  2GGF A;  2UY1 A;  3ZXS A;  3D9P A;  4WNG A;  4KYO B;  3EHQ A;  4OAU C;  1O1R A;  3UIN C;  3FH8 A;  4DI3 A; 
#chains in the Genus database with same CATH homology
 2VTB A;  2L9B A;  3U9W A;  1IQU A;  4UWF A;  3LXU X;  5CMY A;  3UX4 A;  5CCL A;  3LY8 A;  4DPR A;  3FTS A;  4BTB A;  3ZFW A;  2MRI A;  2WPV A;  2WXF A;  4I6J A;  3K9I A;  1QZ2 A;  4HXI A;  5A23 A;  3RK6 A;  4F53 A;  4NUR A;  4HOT A;  2YNQ A;  4I2Z A;  1HE8 A;  2VSO E;  3SBS A;  3O4Z A;  3D3M A;  1UJJ A;  4FAD A;  2L6J A;  3FU3 A;  4XKC A;  3PH0 C;  1HFA A;  2FEZ A;  1JWG A;  2I2O A;  3CK9 A;  4ACL A;  4H7X A;  2DIW A;  5FJY A;  2OND A;  2PM6 A;  4JA7 A;  5G04 J;  3Q5M A;  3ZEF A;  5T4Y A;  2IJG X;  3N71 A;  2X6K A;  4GA1 A;  3EJN A;  3I3N A;  3PE4 A;  4J8D A;  3CVX A;  2XRY A;  3AU4 A;  2UWJ G;  3FEY A;  3I5P A;  2E0I A;  5AIJ A;  4YVO A;  3R7R A;  4C0M A;  3KS2 A;  4W9R A;  4CDR A;  4ABN A;  2WQH A;  4PDX A;  1JWF A;  3ZPJ A;  2WQ7 A;  1PAQ A;  2WXL A;  2JLB A;  3O48 A;  3CKC A;  4CT0 A;  4APF A;  1LF8 A;  2VSN A;  4U0S A;  4CCA A;  5FZS A;  3E4B A;  1S0P A;  3SNX A;  3EHN A;  3G2U A;  4URK A;  3FUD A;  2X3M A;  3UMV A;  4OVV A;  3ML8 A;  5D0Q D;  4B94 A;  3MV3 B;  4HLE A;  4UI9 C;  2YHE A;  4EPZ A;  1XGW A;  4JPS A;  1X5B A;  2KCL A;  4YND A;  3BEE A;  3L13 A;  4CT4 A;  3APC A;  2X6H A;  3MX3 A;  3ZYL A;  4DJA A;  3CSF A;  4AV7 A;  4N3A A;  4AJW A;  3RKV A;  4HOR A;  4PUC A;  4LEU A;  3RU0 A;  5FQ7 A;  4K03 A;  3LYA A;  3MYV A;  2LSU A;  1WM5 A;  3RRU A;  5JJT A;  5LOZ A;  3NQP A;  3HVE B;  3PRE A;  2LSV A;  4I17 A;  4R7L A;  3UT7 A;  4M3O A;  2WXO A;  5ANL A;  4N3C A;  5FT9 A;  3ZRH A;  4C9B B;  3HIZ A;  3LCA A;  1U3C A;  4FHJ A;  3NF1 A;  4N39 A;  4UWH A;  4WWO A;  3S2A A;  4GA2 A;  2I6H A;  2WMN A;  3VLE A;  3PUK A;  3RRM B;  4DLO A;  3ASF A;  3QDN A;  1N52 A;  1ZBP A;  4FLH A;  3CHS A;  1HXI A;  3ZYM A;  2CHX A;  3HVE A;  2R59 A;  5D0O D;  5BUZ A;  1E8Z A;  1NA3 A;  2PQN A;  2C2L A;  2VSY A;  3JYS A;  1Y6I A;  2DBA A;  3L16 A;  4I9E A;  4G2V A;  4UWG A;  3FH5 A;  5ARF A;  5FQ4 A;  4GPK A;  4WUY A;  3EHM A;  3FUI A;  3T5X A;  1YA0 A;  4APO A;  2E2E A;  2X6J A;  1OWO A;  3MJW A;  3IV0 A;  3QC1 A;  5G05 J;  4FJZ A;  2J09 A;  4FU3 A;  1B89 A;  4XX5 A;  4EBA G;  3U3W A;  2AWI A;  1A17 A;  4GAA A;  1SZ9 A;  4LUN U;  3JQ1 A;  3U64 A;  2BUG A;  1TJC A;  2J4D A;  5LFA A;  4QFV A;  3TG4 A;  4AM9 A;  4IRU A;  2IF4 A;  1HZ4 A;  2KZT B;  1ELW A;  2YHC A;  3KEZ A;  4G1T A;  5LCW J;  3FDH A;  1OWP A;  2VYI A;  3CVL A;  1SQM A;  3L54 A;  2QY7 A;  3SD5 A;  1HF8 A;  2XCB A;  3MGB A;  3QB2 A;  5A6C A;  5KCM A;  1UN9 A;  2GRM A;  2AXU A;  3MEK A;  5C1D A;  5DBK A;  4ILI A;  4TUU A;  3NZS A;  2KZT A;  3B7T A;  3CEQ A;  4ANU A;  3QKY A;  4EZL A;  3CVV A;  2IQC A;  3ESK A;  1N54 A;  4V3I A;  2WXH A;  3IHY A;  5JJ7 A;  3CHO A;  3GZ2 A;  2GRL A;  4DI4 A;  1NZN A;  4AIF A;  4CDN A;  4FA6 A;  3PVL A;  4BTA A;  4BFR A;  5KJK A;  3R7Q A;  1H6K A;  3BG0 B;  4L7T A;  2ZU6 B;  2WXJ A;  4AY5 A;  4MRU A;  2CHZ A;  1UJK A;  2HM8 A;  3FU6 A;  4GYY A;  4IYP A;  4WNF A;  3TG5 A;  2AXZ A;  4A55 A;  3ASD A;  4KMO A;  3CHR A;  2I1J A;  3FFL A;  3LKU A;  4OVU A;  5J08 A;  2FUL A;  2WXM A;  4GZ5 A;  2WXG A;  3CLJ A;  3SBT B;  1UW4 B;  3ASH A;  1L5J A;  3ASG A;  2Y3A A;  1KT0 A;  4FP7 A;  2WVI A;  4WAF A;  3LEW A;  3QWV A;  3SHF A;  1WAO 1;  4LER A;  3VLD A;  4BX9 A;  3IEG A;  4YVQ C;  2OVF A;  3LVQ E;  4WNE A;  4A3T A;  2KM4 A;  3RO2 A;  2J9Q A;  3CIA A;  1IYG A;  2LO6 A;  3HDX A;  3VTX A;  4NRH B;  5FQ6 A;  5AEN A;  2AXV A;  3D9J A;  4U07 A;  2WQ6 A;  3CVY A;  4CEM A;  3CVN A;  1H2T C;  4O6F A;  2WXI A;  5BV0 A;  2XCC A;  3VTY A;  2J07 A;  4B8A A;  1E7V A;  3PZD A;  4GZD A;  3LVR E;  3TXM A;  4KVM A;  3PDN A;  3MCX A;  3PRZ A;  4UQX A;  3JCK C;  2P58 C;  3MZL B;  2OV8 A;  1DVP A;  3T5V A;  3QWW A;  5G04 C;  5LP0 A;  4N5C A;  4A1G A;  2WM9 A;  4WWP A;  5M72 A;  4K0R A;  4BWR A;  4CGW A;  2JEK A;  3FTZ A;  2R5S A;  1ELR A;  4WND A;  4RG6 A;  3ULQ A;  4J6I A;  5KJN A;  2XGO A;  4EEC A;  4I2W A;  1PC2 A;  5BV1 A;  1WY6 A;  3P2B A;  2NSZ A;  2VGX B;  4NQ0 A;  3B7U X;  2WXP A;  3PNL B;  4KT6 B;  5J90 A;  3CKB A;  3RO3 A;  4B8C B;  4JVS A;  3TGO A;  3UPV A;  3FU5 A;  2XEV A;  4I6E A;  2YQ8 A;  3CQC B;  3D9O A;  4H7Y A;  2IFU A;  4JHR A;  2FF4 A;  2X6I A;  1NA0 A;  3IBE A;  2XGS A;  3CK8 A;  3T8M A;  5FQ8 A;  3HYM B;  1Z3X A;  1E90 A;  2LAI A;  2VGX A;  3UT4 A;  1EF1 C;  2WB2 A;  3L17 A;  1HX8 A;  2BTD A;  2A5U A;  3OAW A;  4IUL A;  3ENE A;  4PS8 A;  4J0U A;  3CST A;  3HHM A;  3Q15 A;  4U0U A;  3URZ A;  3UUX A;  3CV0 A;  1GW6 A;  2WXK A;  4L2L A;  5ANR A;  3FUH A;  4BSX A;  4D10 C;  3PEU B;  3EIQ C;  3GZS A;  4F1S A;  3FTX A;  4UQY A;  3FTY A;  4FC8 A;  2X38 A;  3CHM A;  1KT1 A;  4GU5 A;  1QNF A;  4G26 A;  3JUI A;  3I4G A;  4BY6 A;  3FHE A;  3FEX A;  4DLQ A;  2V0P A;  2LAH A;  1FVF A;  3DPD A;  3D9N A;  2XPZ A;  1BPO A;  2PM7 A;  3BG1 B;  1HH8 A;  3ESL A;  2X6F A;  3FTU A;  3CVQ A;  3FUJ A;  4L2Y A;  4N3B A;  2OOE A;  4MKT A;  4RSY A;  3RJV A;  4AP2 A;  2Y4T A;  4BT9 A;  3CVP A;  2VQ2 A;  3D9L A;  1UN8 A;  3NZU A;  4PS3 A;  4Q96 A;  5G05 C;  3ZIM A;  4ILH B;  2CFZ A;  1JUQ A;  4FUL A;  4GYO A;  3SFZ A;  5A7D B;  2R17 C;  3FUN A;  1IQR A;  5T3R A;  3Q47 B;  3CVU A;  2I1K A;  2XPY A;  3FUF A;  1TJF A;  3OXF A;  3GW4 A;  4GMJ A;  4KVO A;  2HR2 A;  3ZYQ A;  5LCW C;  3OTN A;  1HS6 A;  2PQR A;  2KAT A;  3LDZ A;  3RIB A;  4I6G A;  3QK0 A;  2AVP A;  2CHW A;  4JL0 A;  4JZY A;  4PH4 B;  2L0I A;  2MHK A;  1QQE A;  4I1M A;  4TV3 A;  4B0Z A;  4GB9 A;  5FTP A;  4J8E A;  4LCT A;  4B89 A;  3ZN3 A;  4XKB A;  2A4Z A;  1Z3Y A;  3CVW A;  4UQZ A;  3ZYK A;  5KJL A;  1KLX A;  2WXQ A;  2WXR A;  3ML9 A;  4ANW A;  3ONL A;  4P29 A;  3QAQ A;  5AJL A;  3I4R B;  2J49 A;  1E8Y A;  2WMO A;  3S7B A;  3SZ7 A;  3ZW3 A;  1OWM A;  3B7S A;  1HG2 A;  1H2U A;  3LY9 A;  5BW8 C;  3MA5 A;  4LRZ A;  3ZVV A;  4AOF A;  3FUE A;  2FBN A;  1Y8M A;  1OWL A;  3G2W A;  3B13 A;  3LY7 A;  3LJ3 A;  3OXL A;  3R9A B;  3EDT B;  3FY4 A;  3FWV A;  4ILG A;  2C0M A;  4ACK A;  2ILR A;  4ANV A;  3PUJ A;  4GCO A;  4ANX A;  4DK5 A;  3FH7 A;  3LPZ A;  4XIF A;  3FTW A;  2V4L A;  2FO7 A;  1XNF A;  1E8W A;  4HVB A;  1MQS A;  2XPI A;  4JHJ A;  2KCK A;  1E8X A;  2LNI A;  3QJZ A;  4U0Z A;  3UT8 A;  3RRN B;  4G11 A;  5CCM A;  3SGH A;  4Y6C A;  3GYZ A;  5AYW D;  3L22 A;  4JA9 A;  2IOS A;  3FU0 A;  1E7U A;  5FWQ A;  4A1S A;  4L1B A;  2V8S E;  4L23 A;  2VGY A;  4AEZ C;  1H0A A;  2Y4U A;  3FP3 A;  3PE3 A;  3QNK A;  3FUM A;  3GZ1 A;  4FJY A;  1ELK A;  4MLP A;  4OYS A;  4U8H A;  2PZI A;  5DIZ A;  3ZGQ A;  2KC7 A;  4XI9 A;  2VSX E;  4KBQ A;  2CG3 A;  5JJ6 A;  4EZK A;  4XZ4 A;  3QOU A;  4HOS A;  4WWN A;  2V5F A;  4ME2 A;  3D9I A;  5HQ8 A;  4GZ3 A;  1H19 A;  4UWK A;  4XE0 A;  2HYZ A;  2XGM A;  3IHV A;  3CK7 A;  4HOU A;  3SF4 A;  2XRZ A;  4I43 A;  4CGV A;  2MOW A;  1SZA A;  4E85 A;  3ONK A;  3D9K A;  4XI0 A;  4UI9 J;  3TL5 A;  4N2Q A;  4N2S A;  5JHA A;  3AU5 A;  3TAX A;  4CDM A;  3CGH A;  3APD A;  4U04 A;  5T8I A;  3ZHE B;  1EPU A;  2WXN A;  5ENN A;  1FCH A;  5EX0 A;  5CMW A;  2EQX A;  4G25 A;  4CRW A;  3PS6 A;  2YIN A;  3G2S A;  1EYH A;  3APF A;  4GZC A;  4GZ6 A;  4Y6W A;  1HU3 A;  4HFG A;  5FZQ A;  4EZJ A;  4JHK A;  2ION A;  3FTV A;  3P1U A;  3ZHE A;  4AXH A;  4EQF A;  1HO8 A;  3L6A A;  4JW1 A;  5AJD A;  4KXK B;  3D9M A;  2IOL A;  2FI7 A;  3QWP A;  4EBA A;  5EDS A;  2I9C A;  4AVX A;  4J8F A;  4BX8 A;  4RVB A;  4C0E A;  4GYW A;  1FVH A;  3S7J A;  3B7R L;  3Q4A B;  4JXT A;  2KCV A;  4I1O B;  5EX3 A;  2PL2 A;  3G2V A;  3LS8 A;  4A3V A;  2C0L A;  1JPL A;  5FZR A;  5G2N A;  2IU1 A;  5JHB A;  2L0T B;  1E96 B;  4FHK A;  1W3B A;  2XQ0 A;  4KZ0 A;  4GCN A;  3FUL A;  4KZC A;  3MKR A;  4BT8 A;  2BF0 X;  3CHP A;  5HI7 A;  3MV2 B;  5EKQ D;  2CFU A;  1OWN A;  4U63 A;  3S7F A;  5LX8 A;  4FLB A;  4PS7 A;  5BPP A;  3VLF A;  2CG2 A;  4J8S A;  3SI5 A;  4Q69 A;  5BNW A;  4E6H A;  4F7A A;  5KJM A;  4HS2 A;  5ARG A;  5CHE E;  1OUV A;  3QAR A;  4Q94 A;  2M63 A;  1INZ A;  3OXG A;  2AW6 A;  3G2T A;  2J08 A;  1EDU A;  4HOQ A;  4F3V A;  2NC9 A;  3CQG B;  5E76 A;  1ZU2 A;  1DNP A;  2QFC A;  3MKQ B;  5BT1 A;  3TXN A;  3CHQ A;  1IHG A;  5G55 A;  1PY1 A;  2OVB A;  1NP7 A;  2UY1 B;  2RD0 A;  4I9C A;  3TJP A;  4UI9 K;  3AS8 A;  3EIJ A;  2GW1 A;  3JQ0 A;  3WXX A;  5E75 A;  3UQ3 A;  1HG5 A;  4I1A A;  4GML A;  4JEH A;  2HO1 A;  2NXP A;  3Q49 B;  3U4T A;  4UWL A;  4NAC A;  3KAE A;  4ATG A;  3U66 A;  4MS6 A;  1H2V C;  3MKQ A;  4AY6 A;  3CR3 A;  3C98 A;  4G23 A;  3S7D A;  4RG9 A;  2DCP A;  2GGF A;  2RG8 A;  3FUK A;  2UY1 A;  3KD7 A;  3L08 A;  3ZXS A;  1U3D A;  3D9P A;  1Z6T A;  2Q7F A;  3IKO B;  4WNG A;  4TRQ A;  2VTB B;  4KYO B;  3AS4 A;  4GA0 A;  1P5Q A;  4IN3 B;  2J4B A;  3PNT B;  4G24 A;  4JC8 A;  5C2Y A;  1MHQ A;  3AS5 A;  4JEU A;  1VDY A;  3FH8 A;  1UG3 A;  2VJ8 A;  3DBS A;  3PEV B;  1TEZ A;  4DI3 A;  2XHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...