4C9BB

Crystal structure of eif4aiii-cwc22 complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
284
structure length
277
Chain Sequence
DPLLTRTGGAYIPPAKLRMKNSLAYQRMSWEALKKSINGLINKVNISNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILNFRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKECGLKLTQVSPRGINAIFERLRNILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKAIKKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Splicing
molecule keywords EUKARYOTIC INITIATION FACTOR 4A-III
publication title Crystal Structure of the Human Eif4Aiii-Cwc22 Complex Shows How a Dead-Box Protein is Inhibited by a Mif4G Domain
pubmed doi rcsb
source organism Homo sapiens
total genus 107
structure length 277
sequence length 284
ec nomenclature
pdb deposition date 2013-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4c9bB00
3FEXA 3EIQC 4LUNU 3JUIA 1H2TC 2ZU6B 2HM8A 1H2UA 2IU1A 2KZTA 5ANRA 2FULA 4B8CB 1H2VC 3L6AA 1UG3A 2NSZA 4CRWA 4IULA 3D3MA 1HU3A 1PAQA 4JHJA 1UW4B 3EIJA 4GMLA 4B89A 2IOSA 1N52A 4CEMA 2GGFA 4C9BB 4B8AA 3RK6A 2KZTB 2I2OA 2IONA 3FEYA 1N54A 4GMJA 2VSXE 2RG8A 4JHKA 1H6KA 4CT4A 2IOLA 2VSOE
chains in the Genus database with same CATH superfamily
4A1SA 3HHMA 4D10C 4U8HA 2MYOA 4GZCA 3IBEA 2GRRB 2J4DA 4TXQA 3SQVA 1LD8A 4WWNA 4DX6D 2R59A 5AJLA 1HXIA 3EHQA 3ZN3A 4FP7A 2BUGA 2A5EA 4GYWA 3ENEA 3PDNA 4U95D 4N3BA 5BT1A 4GZDA 4JL0A 1H6OA 3UM3A 2F8XK 2AXZA 3TJPA 2KZTB 1FVFA 3D9OA 4PS3A 4U96D 4O6FA 2V5QC 3I3NA 3CKBA 2WMOA 1B89A 4ZHBA 4BSXA 2IY0C 4I43A 1DCEA 3FHEA 1OWLA 4PUCA 1NP7A 4UWHA 4OVUA 1TN8A 4OYSA 4Q69A 3AU5A 4J8FA 3HG0D 2MRIA 5FT9A 1V55E 4NRHB 2QY7A 3L16A 1OCOE 4BX8A 3L22A 4UQYA 2I2OA 5KNHD 3UI2A 2JLBA 1SA5A 3FTSA 4EQFA 4A3TA 4KXKB 2LXLA 3E37A 4CGVA 1TN6A 3E4BA 3C3QA 1IHGA 4GTTA 5EX0A 4DRXE 3U9WA 4IYPA 1PAQA 3V30A 3UIOC 5AYWD 3TGOA 3LVQE 3D9LA 1FCHA 5IY5E 4I2ZA 4CT4A 4ANXA 1ELRA 3FUNA 4URKA 2VGYA 3NZSA 4I6GA 3DXMG 2AJAA 3HVEA 1WM5A 4JHJA 4U0UA 5JMND 4I17A 4C9BB 1FT2A 1JUQA 2IQCA 4AY5A 4GA0A 2DIWA 1QZ2A 3CVQA 4LUNU 3AG2E 2LUHA 3CQCB 3ASOE 2CG2A 2J4BA 4MRUA 3MCXA 4L2LA 4AEZC 2DYRE 3U3WA 3J5PA 3VLFA 3D9IA 4TXPA 1S70B 3DBSA 3S2AA 3FU6A 5KJKA 5CEDB 3DPDA 4G26A 1TNZA 2EQXA 3CVNA 4IRUA 4H7XA 4FADA 2V5FA 4Q94A 3ZIMA 1OCCE 4MS6A 1N0QA 3LEWA 1YA0A 3VTXA 5FZSA 2WQHA 4UQXA 4Y6WA 1N54A 2J07A 4EZKA 3C98A 5G2NA 4RVBA 2E2EA 4BT8A 1HX8A 5G55A 3EDTB 1SZAA 1N4PA 3O48A 1H6PA 2VSXE 3HVEB 2P9KG 1MQSA 3AAAC 1AWCB 1BD8A 4DPRA 3ZGQA 4WNFA 5CBOA 4N5QA 3SGHA 3NQPA 2HO1A 1A5EA 2VQ2A 3AG3E 1RZ4A 3MGBA 3PZDA 1BU9A 3CVPA 4BWRA 3LY7A 4I6EA 3RRUA 4FLHA 3Q75A 4HXIA 3UPVA 4CRWA 1FVHA 4P29A 3D9MA 4HRNA 1Z3XA 2ZGGA 4YNDA 4JHRA 5EDSA 2P9IG 4GZ6A 3PUJA 4KYOB 4ZFHA 3QK0A 4FJZA 1S0PA 3ASFA 2J9QA 4NQ0A 4WNGA 2Y4TA 1MYOA 2JABA 3EHMA 5HS0A 3DSXA 3R9MA 2FO1E 2B0OE 4AVXA 2DBAA 4YDWA 3AJIA 2CFZA 2ZGDA 3OTNA 3F6QA 3W9GA 3LY8A 3SD5A 3T8KA 3U66A 2VSOE 4KZ0A 2KCVA 4G23A 4WNDA 3LY9A 2H6FA 4RG9A 1U3DA 3FUEA 3HXFA 5CRVA 5HRYA 4NIKA 4EZJA 3SI5A 2UWJG 2HM8A 4GPKA 1RW2A 5G05C 3TXMA 5FJYA 1S63A 3RO2A 1YYHA 3EIJA 2X6HA 3Q5MA 3B95A 2X6KA 5B3SE 5CECB 4APFA 2RG8A 4J8DA 2KATA 5LCWC 5FQ4A 3V2XA 1E90A 2DWZA 1WAO1 2OVBA 3FTVA 4J8EA 3C3RA 5J08A 2OV8A 4K0RA 3QAQA 3AU4A 4AP2A 5CEAA 1JPLA 4ILIA 4N3AA 4RSYA 4HLEA 3FH5A 3SFXA 4PDXA 3OXGA 2XQ0A 3IV0A 3PRZA 2WXOA 2Y69E 3ESKA 1K3ZD 1W3BA 4HI8A 3DSVA 2XGSA 3CVLA 3L54A 3EHRA 3MKQB 4GTSA 3FUMA 3MJWA 1E7VA 1WDYA 1E96B 3MV3B 3B7BA 1KT1A 4GTOA 4LRZA 1NA0A 4E6HA 3MKRA 3TWVA 4LERA 4JB8P 2KCLA 4GTQA 3ZRHA 4O1PA 5G04J 3JUEA 4DX7D 4NACA 2GROB 2PL2A 2XS8A 3V31A 3Q15A 3AG4E 5BV0A 4GTVA 3BG1B 3JUIA 3LVRE 3QNKA 1MX4A 3C5RA 5AQ9A 2I9CA 3URZA 4A63B 3JCKC 3PEUB 4U04A 3T8MA 4A3VA 4CDNA 3T9KA 3WXXA 3ZFWA 2Y4UA 4WUYA 3L9TA 2LAIA 4HS2A 3DPYA 3APFA 5E75A 1JWFA 1TNUA 1E7UA 1TR4A 4CEMA 2L0TB 4JEHA 5JJ7A 2X6FA 4FHJA 3RK6A 4GZ3A 1E8XA 5LOZA 1KLXA 4I2WA 3UUXA 4IN3B 3TXNA 5CMYA 2NYJA 3DEPA 4FC8A 3B7UX 4AIFA 4N39A 4DX5D 1V54E 2EINE 1JCQA 4WWOA 2RD0A 4BETA 3CVYA 4GYYA 2H6IA 4YVOA 3Q7AA 3DEOA 3G2VA 2AWIA 4FA6A 1HU3A 1MHQA 3PVLA 3DSUA 1NL4A 3FU3A 1EDUA 1TEZA 1FPPA 4DI4A 3UM2A 4I1AA 3D9NA 4U8VD 4BY6A 4KBQA 3FUIA 3CR3A 3D9JA 2ZIRA 4GCOA 4F6RD 1QBQA 2VYIA 1E8WA 3D3MA 3ZW3A 5A6CA 1MX2A 3Q4AB 3FTYA 2XS1A 1TYQG 2DVWA 1N4RA 2LXMA 3MEKA 2ILRA 3TWRA 4GMRA 2BKKB 3EJNA 3LKUA 1H2VC 3Q47B 1FT1A 4BFRA 2IF4A 4ATGA 4GMLA 4FULA 3FTZA 2R2LA 1X5BA 3CKCA 4DI3A 5HQ8A 1OWNA 3ZPJA 4KVOA 2WVIA 2Q7FA 5ARFA 1PY1A 3PEVB 2V4HC 3IKOB 3PZ2A 4XI9A 4DLOA 3UINC 2E0IA 5BXUA 5FQ8A 3OAWA 5AIJA 3CVVA 3QWWA 5KBAA 3Q7FA 3QWPA 3TWWA 5DBKA 3ZEFA 1K1AA 3NZUA 3P2BA 3TWTA 2WB2A 5E76A 1UW4B 1IQUA 4CCAA 4YDYA 2ETAA 5LP0A 4HOQA 1HH8A 5ITZF 2PQRA 2J08A 4B0ZA 3APCA 5M72A 3RAUA 2QC9A 5FQ7A 4C0EA 4JD2G 3CIAA 1H19A 1X81A 2F37A 5ENQD 3NBNB 3LYAA 3UT4A 3B7SA 4K5BA 1DCQA 2EIJE 1OCRE 2YHCA 2XEVA 2IU1A 4XEIG 1QNFA 3DRAA 1N95A 3FWVA 3G2UA 2MOWA 4B89A 2DZOA 2MHKA 4HRLA 5ARGA 1ZBPA 3AS5A 4ACLA 1HZ4A 2I1JA 2XRZA 1D8EA 3ASNE 2AXVA 4B8AA 3CK7A 2XCBA 2LO6A 3FEYA 4U63A 3MX3A 5AQ7A 2WXMA 5B1BE 3FEXA 4L1BA 2WQ7A 4AJWA 3ZYKA 2X6JA 4LSZE 3DWLG 1OT8A 4ANWA 2VTBB 2ETCA 1A17A 4I9CA 3Q49B 3BG0B 4TUMA 5DIZA 2L6BA 2XHEA 4MKTA 2BTDA 3ONLA 1OWPA 1H6KA 1EYHA 4Q96A 1N4QA 2OVFA 1OWMA 3WG7E 2RFMA 1BLXB 4OAUC 3GZ2A 3GZ1A 4LNBA 1XGWA 1D8DA 2J49A 1MZCA 4UWGA 3W9FA 2WXNA 4NURA 3BEEA 3UMVA 3IXEA 4DUIA 3ESLA 2C0MA 3KSQA 3ZU7B 4G11A 4RQIA 4TXRA 4GU5A 2XGOA 3RRMB 3ABKE 4I9EA 2ZXWE 1ZU2A 2ZU6B 1U3CA 4BT9A 4PS8A 3J5QB 3RIBA 1LTXA 1SQMA 2XCCA 1Z3YA 2HR2A 4JXTA 4BTAA 2CHXA 4EECA 2GRQB 1JCSA 5FZRA 1N11A 2PNNA 5EIDA 3KS2A 3GZSA 3ZYQA 1N94A 2P2CP 4CGWA 2GRMA 3UT8A 5ANRA 2A5UA 1ELWA 4G8LA 4AOFA 4G2VA 2LSUA 3R7QA 3UKRG 3MKQA 2KXPC 5J90A 2QYJA 1NA3A 5JJTA 2KC7A 3CV0A 2Y3AA 5EX3A 5BPPA 2R02A 4J8SA 3TL5A 4L7TA 4ANVA 4KMOA 2VGEA 4DK5A 3I5PA 1IHBA 3I4GA 4KZCA 2ONDA 4DJAA 4LEUA 4ANUA 4JHKA 1P5QA 3UT7A 4U0SA 3SZ7A 3CVWA 1N0RA 2WXPA 4HOTA 4U8YD 1Z6TA 5T4YA 4HB5A 1OWOA 4UUCA 3RO3A 3QDNA 3CSFA 1HO8A 2QFCA 3SF4A 2VSYA 2FI7A 3FU0A 4UQZA 2BEDA 3PZ1A 2L9BA 1E8YA 4HQDA 1MX6A 5FZQA 1O1TA 5CHEE 3N71A 2Y0BG 3R9AB 1O5MA 2NXPA 3SNXA 5D0QD 3ASHA 2R5SA 3NOGD 3ZUVB 4UWKA 3FY4A 4WAFA 3V2OA 3AS4A 4TV3A 2R03A 1UN8A 2VSNA 2WXFA 1UOHA 3PZ4A 3ULYA 3SFYA 3PNTB 1UN9A 3OXLA 3UQ3A 5EN5D 5JHBA 4U7EB 3KD7A 3TWUA 4F53A 4I1MA 1GW6A 3FUFA 1N4SA 4LNUD 3ZNGA 2J8SD 3Q79A 3B7RL 1KPSB 2WXIA 4R7LA 5JJ6A 5CRUA 4ILGA 5D66A 4KT6B 5EIBE 2WPVA 2V4LA 4F1PA 1OCZE 2FEZA 5LX8A 1H2TC 1H2UA 3HRAA 5CCMA 1UG3A 1U2VG 3JXIA 3ZXSA 3BUAA 3CLJA 2VJ8A 3CHPA 1ELKA 4CT0A 2OEVA 1EF1C 1G3NB 5AJDA 3ASGA 3D9KA 2BF0X 4K03A 5KJLA 5AQAA 1SW6A 3LCAA 3SBTB 3GYZA 5EYLA 3VTYA 3ZVVA 4DX1A 3E33A 2XPIA 3V79K 4GTMA 4YDOA 2OOEA 2AXUA 3CHQA 2WXKA 2L6JA 2P9UG 1L5JA 4J8YA 1NFIE 4HORA 4HLLA 2BKGA 1SA4A 1IYGA 4ATZD 3EHNA 1SVXA 2I1KA 2NC9A 3O4ZA 3SO8A 3P1UA 4B94A 1O1SA 2IEJA 1TNYA 2H6GA 5ENRD 3Q78A 3ZKJA 4TUUA 3NF1A 2RFAA 2VGXB 2P58C 3RKVA 4HNAD 3FTXA 3FULA 3OXFA 2GW1A 2LSVA 5ENOD 2PM6A 2C0LA 3QC1A 1ZB1A 2DCPA 2XENA 4HBDA 4QFVA 3RJVA 4B93B 4CDRA 3HIZA 2IO2C 3E32A 3D9PA 5G05J 2XZTG 1Q2ZA 1BPOA 2ETBA 2V8SE 3CGHA 3FFLA 3ISMC 2NSZA 3QOUA 1Z5SC 4JVSA 4CDMA 3HDXA 1HE8A 5C1DA 4O60A 2V0PA 3FP3A 2M63A 5C2YA 1Y6IA 4GA1A 4XE0A 4N3CA 3EU5A 1OY3D 3T5VA 4XI0A 3PREA 3NB2A 2Y1LE 5D2MC 2DYSE 4GTRA 4L2YA 4A55A 5ENNA 1YMPA 4UWFA 4GZ5A 3U4TA 4WNEA 4GA2A 3EUVA 3MYVA 2I6HA 3Q73A 2P9PG 3BU8A 4XZ4A 3RSEG 5ENSD 4EZLA 3MZLB 5AENA 4KVMA 3LS8A 4O1OA 5BUZA 5H7PA 4JEUA 4GMJA 5D0OD 1PC2A 5KWDA 1N9AA 4AXHA 2PZIA 3GW4A 2RKKA 3PE3A 4UI9J 1AP7A 5AN8A 1KT0A 3KSLA 3EU9A 5BV1A 3AS8A 4YDEA 2EILE 2VTBA 4JW1A 1SZ9A 3TWXA 1K1BA 2XZDG 2WXQA 4PH4B 3CVUA 2FULA 2X38A 3L08A 4L23A 3VLEA 1MJ0A 5ANLA 4X8QA 2P9SG 3CHSA 4MBGA 1N52A 1K8KG 4Y6CA 2P9NG 1HG5A 1O1RA 4V3IA 4GPMA 3TWQA 4BX9A 1TNBA 5JHAA 4TRQA 3CHMA 2XEEA 4WWPA 3UM0A 2OEWA 2KBXA 4PS7A 3MV2B 3ML9A 1D9SA 4FLBA 4L9PA 4HOUA 2GGFA 3FTUA 4K5CA 4UI9K 2XEHA 2GRNB 3DXKG 3KAEA 1TJFA 2CHWA 1JWGA 3FH7A 5AAOA 3NAWA 3UX4A 3IHVA 3X2QE 4ME2A 1QYMA 1NZNA 3AG1E 4LG6A 3T5XA 1WY6A 5FWQA 2QZAA 1TN7A 3G2TA 2H6HA 1HF8A 3PNLB 4QQIA 3TWSA 4I1OB 2YHEA 1EPUA 3S7JA 3E34A 4RLYA 4G8KA 4CYMD 4J0UA 4U0ZA 3S7FA 5FINA 4EHMA 1H0AA 4GTPA 4H7YA 5JA4D 1INZA 1OXJA 3FU5A 3FTWA 4M7CA 3LJNA 3CQGB 5AARA 3TG5A 4LCTA 4G1TA 4J7WA 1XNFA 3DSWA 5ENTD 5A7DB 2WMNA 4GAAA 4GYOA 4F1SA 2F0YA 3QB2A 1YCSB 3HXEA 4BEPA 2AW6A 4BSZB 1HG2A 3PS6A 4EPZA 5LFAA 3PH0C 4OAVB 3L82A 5AQBA 5CBNA 2CHZA 4BERA 3S7BA 2LNIA 2XRYA 2WXRA 4F3VA 2EIME 3QJZA 4F7AA 2FBNA 4YVQC 2GRPB 4MLPA 3HXBA 5CERB 4XKBA 3ONKA 4A1GA 2UY1A 2IONA 3E30A 4JA7A 5G04C 5B1AE 1LF8A 2WM9A 2QYUA 4G25A 4APOA 3UIPC 2EIKE 3ULQA 5ENPD 4HVBA 2PQNA 1DC2A 4J6IA 4C0MA 3TAXA 4XIFA 2IFUA 2IJGX 2XPZA 3L17A 5EYPF 4XX5A 1BI8B 3D9HA 3PE4A 4EBAG 2YQ8A 4Z68A 5CCLA 3HXDA 3QWVA 4BESA 4ACKA 3CK8A 3EIQC 1TJCA 3KEAA 4HRMB 3ABME 2JEKA 3ZHEA 2DZNA 3HXCA 3ML8A 4JZYA 2R05A 1KZOA 2WQ6A 2R17C 4FHKA 2WXLA 4UWLA 4B8CB 2UY1B 3BQOA 2X6IA 1E8ZA 3CK9A 3APDA 3IHYA 4CZ2D 5KNGA 3ZYLA 3FUDA 1IQRA 3CHOA 1UJJA 3KEZA 3FH8A 3U64A 1HS6A 2LAHA 5FQ6A 1QQEA 4JA9A 4EBAA 5FIOA 4I6JA 3DSSA 4AY6A 4JC8A 2AVPA 3RRNB 4FU3A 5KJMA 1LD7A 3B13A 3SFZA 4HI9A 3C72A 5HKPA 3DSTA 2CFUA 3SHFA 1BI7B 4AM9A 4M3OA 3CEQA 2FF4A 3ABLE 3Q9UC 5KCMA 3ZHEB 2HE0A 3FUJA 2X3MA 4RG6A 3PZ3A 5BXOA 5EILA 3LDZA 3LXUX 3SY2A 3QKYA 3UKUG 3HYMB 3IEGA 2B6CA 2ZISA 3SBSA 3JQ0A 2VGXA 4AV7A 1KZPA 3LJ3A 4G24A 1DVPA 3L13A 4ABNA 2WXGA 3C3OA 3LPZA 2KM4A 4N5CA 3L6AA 4XKCA 3JQ1A 3FDHA 2IOSA 4N2QA 1NI1A 4UI9C 4GCNA 5FTPA 5A23A 1TNOA 5BNWA 2A4ZA 3JXJA 2YNQA 5T3RA 3QARA 2P9LG 4HOSA 1JCRA 3I4RB 5BW8C 3UXGA 1Y8MA 1UJKA 4DLQA 4LNGA 1OUVA 3UM1A 3JYSA 4BTBA 3UTMA 3PUKA 3FUKA 4ILHB 2HYZA 4HFGA 1VDYA 1S64A 3ZXPA 2F8YA 5HI7A 2CG3A 1WG0A 3NOCD 4K5AB 3CVXA 4U07A 3K9IA 2PM7A 4N2SA 3CSTA 3G2WA 4DX2A 2WXJA 3RU0A 3TG4A 3S7DA 3FUHA 4OVVA 4FJYA 2GRLA 1DNPA 4E85A 2KZTA 5T8IA 3ULEG 2OCCE 5EKQD 2KCKA 3ZYMA 2J09A 3B7TA 2IO3C 4C48B 3CHRA 2WXHA 3ASDA 2C2LA 2IOLA 1HFAA 4GB9A 2XGMA 3G2SA 2YINA 3VLDA 1IKND 2FO7A 5CMWA 4IULA 2XPYA 3R7RA 5LCWJ 3Q9NC 4W9RA 1IXVA 3MA5A 5KJNA 4JPSA 2L0IA
chains in the Genus database with same CATH topology
4LRZA 3HHMA 1NA0A 4A1SA 4U8HA 3MKRA 4D10C 2GRMA 3UX4A 4E6HA 4CGWA 4LERA 3UT8A 2KCLA 5ANRA 3IHVA 4GZCA 3IBEA 4ME2A 3ZRHA 2J4DA 1NZNA 5G04J 2A5UA 1ELWA 4NACA 4AOFA 3T5XA 1WY6A 5FWQA 4G2VA 4WWNA 2PL2A 2LSUA 2R59A 5AJLA 3R7QA 3MKQA 5J90A 1HXIA 3G2TA 3Q15A 3ZN3A 5BV0A 1HF8A 1NA3A 5JJTA 2KC7A 3PNLB 3BG1B 4FP7A 2BUGA 3CV0A 4I1OB 2YHEA 3JUIA 3LVRE 4GYWA 3ENEA 3PDNA 2Y3AA 3QNKA 5EX3A 1EPUA 5BPPA 3S7JA 2I9CA 4N3BA 4J8SA 4J0UA 5BT1A 4U0ZA 3TL5A 3URZA 4GZDA 4L7TA 3S7FA 4ANVA 3JCKC 3PEUB 4KMOA 4JL0A 4U04A 3T8MA 1H0AA 4A3VA 4DK5A 4H7YA 4CDNA 2AXZA 1INZA 3FU5A 3I5PA 3TJPA 3FTWA 3WXXA 3I4GA 4JPSA 2KZTB 1FVFA 3D9OA 4KZCA 2ONDA 3ZFWA 2Y4UA 3CQGB 4PS3A 4WUYA 4DJAA 3TG5A 4LEUA 4O6FA 4ANUA 3I3NA 4JHKA 4LCTA 2LAIA 1P5QA 4G1TA 4HS2A 3CKBA 3UT7A 2WMOA 4U0SA 3SZ7A 1XNFA 3CVWA 1B89A 3APFA 4BSXA 2WXPA 2WMNA 5A7DB 4GAAA 4I43A 3FHEA 4HOTA 1OWLA 4GYOA 1Z6TA 4F1SA 5E75A 5T4YA 3QB2A 4PUCA 1JWFA 1NP7A 1E7UA 1OWOA 3RO3A 2AW6A 4CEMA 4UWHA 2L0TB 4JEHA 1HG2A 3QDNA 4OVUA 2X6FA 3CSFA 3PS6A 4FHJA 4EPZA 3RK6A 5JJ7A 1HO8A 2QFCA 3SF4A 5LFAA 2VSYA 2FI7A 3FU0A 3PH0C 4OYSA 4GZ3A 1E8XA 5LOZA 1KLXA 4I2WA 3UUXA 4Q69A 3AU5A 2CHZA 4IN3B 4UQZA 3TXNA 2L9BA 3S7BA 5CMYA 2LNIA 1E8YA 2XRYA 4J8FA 2WXRA 4F3VA 3QJZA 4F7AA 5FZQA 2FBNA 5CHEE 4YVQC 3N71A 4MLPA 3R9AB 2MRIA 4XKBA 2NXPA 5FT9A 4FC8A 4NRHB 3B7UX 3ONKA 2QY7A 3L16A 4AIFA 4A1GA 4BX8A 3L22A 2UY1A 4UQYA 2I2OA 2IONA 4N39A 3SNXA 5D0QD 2JLBA 3FTSA 4WWOA 3ASHA 4JA7A 4EQFA 4A3TA 2R5SA 4KXKB 2RD0A 5G04C 3CVYA 4GYYA 4UWKA 4CGVA 3E4BA 3FY4A 4WAFA 4YVOA 3AS4A 1IHGA 4TV3A 1LF8A 3G2VA 2WXFA 1UN8A 2VSNA 2WM9A 4G25A 5EX0A 4APOA 2AWIA 4FA6A 1HU3A 4IYPA 3U9WA 1PAQA 1MHQA 3PVLA 3PNTB 5AYWD 3TGOA 3LVQE 1UN9A 3D9LA 3OXLA 3UQ3A 3FU3A 5JHBA 1EDUA 3ULQA 1TEZA 3KD7A 1FCHA 4DI4A 4F53A 4I1AA 4I2ZA 4CT4A 4I1MA 3D9NA 4BY6A 1GW6A 2PQNA 3FUFA 4KBQA 4ANXA 4HVBA 4J6IA 1ELRA 3FUIA 3FUNA 4C0MA 4URKA 2VGYA 3NZSA 3TAXA 4I6GA 4XIFA 3B7RL 3CR3A 3D9JA 2WXIA 2IFUA 3HVEA 2IJGX 4GCOA 2XPZA 2VYIA 1E8WA 3D3MA 3L17A 4XX5A 4R7LA 3ZW3A 1WM5A 4JHJA 4U0UA 5A6CA 5JJ6A 3Q4AB 3FTYA 4I17A 4ILGA 4KT6B 4C9BB 3PE4A 4EBAG 2YQ8A 1JUQA 2WPVA 2V4LA 5CCLA 2IQCA 4AY5A 3MEKA 2ILRA 3QWVA 4GA0A 2DIWA 1QZ2A 2FEZA 3CVQA 4ACKA 3CK8A 3EJNA 5LX8A 3EIQC 4LUNU 1TJCA 1H2TC 1H2UA 3LKUA 3CQCB 1H2VC 2JEKA 5CCMA 2CG2A 1UG3A 3ZHEA 3Q47B 4BFRA 2J4BA 4MRUA 3MCXA 4L2LA 3ZXSA 4AEZC 2IF4A 3CLJA 4ATGA 2VJ8A 3U3WA 3CHPA 4GMLA 4FULA 1ELKA 4CT0A 3VLFA 3D9IA 3ML8A 4JZYA 3DBSA 3S2AA 3FU6A 5KJKA 1EF1C 3FTZA 2WQ6A 2R17C 3DPDA 4G26A 1X5BA 3CKCA 4FHKA 2EQXA 3ASGA 3CVNA 3D9KA 5AJDA 2BF0X 2WXLA 4K03A 4IRUA 4H7XA 4UWLA 4DI3A 4FADA 2V5FA 4Q94A 3ZIMA 5HQ8A 1OWNA 4B8CB 2UY1B 5KJLA 3ZPJA 4MS6A 4KVOA 2X6IA 1E8ZA 3CK9A 2WVIA 3LCAA 3GYZA 2Q7FA 5ARFA 3APDA 3SBTB 1PY1A 3IHYA 3PEVB 3LEWA 3VTYA 1YA0A 3ZVVA 3IKOB 2XPIA 3VTXA 5FZSA 3ZYLA 3FUDA 2WQHA 4XI9A 2OOEA 4UQXA 4Y6WA 1IQRA 1N54A 4DLOA 3CHOA 2AXUA 1UJJA 3CHQA 2J07A 2WXKA 3KEZA 2E0IA 2L6JA 3FH8A 4EZKA 5FQ8A 3U64A 3OAWA 4BTAA 5AIJA 3CVVA 3QWWA 1L5JA 1HS6A 2LAHA 3QWPA 3C98A 5FQ6A 5DBKA 5G2NA 1QQEA 3ZEFA 4JA9A 4RVBA 4HORA 3NZUA 2E2EA 4BT8A 4EBAA 3P2BA 4I6JA 2WB2A 1IYGA 1HX8A 5E76A 1UW4B 5G55A 3EDTB 3EHNA 4AY6A 1IQUA 2I1KA 4JC8A 4CCAA 1SZAA 2AVPA 2NC9A 5LP0A 3O4ZA 3P1UA 4B94A 3O48A 3RRNB 2VSXE 3HVEB 4HOQA 1HH8A 4FU3A 5KJMA 1MQSA 2PQRA 4TUUA 3B13A 2J08A 3NF1A 4DPRA 4B0ZA 3APCA 3ZGQA 5M72A 3SFZA 2VGXB 2P58C 3RKVA 4WNFA 3FTXA 3FULA 5FQ7A 4C0EA 3OXFA 3SGHA 3NQPA 3CIAA 2GW1A 1H19A 2CFUA 2LSVA 3SHFA 2HO1A 2PM6A 2C0LA 4AM9A 4M3OA 3QC1A 3CEQA 2FF4A 2DCPA 2VQ2A 5KCMA 4QFVA 3RJVA 4CDRA 3ZHEB 3LYAA 3HIZA 3UT4A 3B7SA 3MGBA 3D9PA 3FUJA 3PZDA 5G05J 3CVPA 2X3MA 4BWRA 3LY7A 4I6EA 4RG6A 1BPOA 3RRUA 4FLHA 2YHCA 2V8SE 2XEVA 2IU1A 3CGHA 1QNFA 3FFLA 3LDZA 2NSZA 4HXIA 3UPVA 3QOUA 4CRWA 3LXUX 4JVSA 4CDMA 1FVHA 3QKYA 3HDXA 4P29A 5BV1A 3D9MA 3FWVA 1HE8A 3G2UA 5C1DA 3HYMB 2MOWA 4B89A 1Z3XA 2MHKA 4YNDA 2V0PA 3FP3A 3IEGA 4JHRA 3JQ0A 3SBSA 5EDSA 2VGXA 2M63A 4AV7A 5C2YA 4GZ6A 1Y6IA 3PUJA 3LJ3A 4G24A 4GA1A 4KYOB 4XE0A 4N3CA 1DVPA 5ARGA 3L13A 4ABNA 1ZBPA 2WXGA 3AS5A 3QK0A 3T5VA 3LPZA 4ACLA 4XI0A 1HZ4A 3PREA 2KM4A 4N5CA 3L6AA 4XKCA 4FJZA 2I1JA 2XRZA 1S0PA 4L2YA 5ENNA 4A55A 4UWFA 3ASFA 4GZ5A 2J9QA 4NQ0A 4WNGA 2Y4TA 3U4TA 3JQ1A 3EHMA 3FDHA 2IOSA 4GA2A 4WNEA 4N2QA 2AXVA 4UI9C 4AVXA 4B8AA 3CK7A 4GCNA 2DBAA 2XCBA 5FTPA 2LO6A 2CFZA 3FEYA 3MYVA 3OTNA 5A23A 4U63A 3MX3A 2I6HA 5BNWA 3LY8A 3SD5A 2WXMA 3U66A 2VSOE 3FEXA 4XZ4A 4L1BA 2WQ7A 2A4ZA 4KZ0A 2YNQA 4AJWA 5T3RA 3ZYKA 2X6JA 2KCVA 3QARA 4HOSA 4G23A 4WNDA 4EZLA 3LY9A 3I4RB 4ANWA 2VTBB 3MZLB 1A17A 5AENA 4KVMA 5BW8C 3LS8A 5BUZA 4I9CA 3Q49B 4RG9A 3BG0B 1U3DA 3FUEA 1Y8MA 1UJKA 5DIZA 4DLQA 2XHEA 4MKTA 2BTDA 1OUVA 4JEUA 3JYSA 4GMJA 4BTBA 3ONLA 5D0OD 1OWPA 1H6KA 1PC2A 1EYHA 4Q96A 3PUKA 3FUKA 4EZJA 4ILHB 3SI5A 2HYZA 4AXHA 4HFGA 1VDYA 2UWJG 2HM8A 2OVFA 4GPKA 1OWMA 2PZIA 3GW4A 3PE3A 4UI9J 5G05C 3TXMA 5FJYA 5HI7A 1KT0A 2CG3A 3RO2A 3GZ2A 3GZ1A 3EIJA 2X6HA 3Q5MA 3CVXA 4U07A 2X6KA 3K9IA 2PM7A 4N2SA 1XGWA 3CSTA 2J49A 2WXJA 3G2WA 4APFA 4UWGA 2WXNA 3RU0A 3AS8A 4NURA 3BEEA 3TG4A 2RG8A 3S7DA 3UMVA 4J8DA 3FUHA 2VTBA 2KATA 4FJYA 4OVVA 5LCWC 4JW1A 2GRLA 5FQ4A 1SZ9A 3ESLA 1DNPA 1E90A 2C0MA 1WAO1 2OVBA 2WXQA 4E85A 4PH4B 2KZTA 3FTVA 2FULA 5T8IA 3CVUA 2X38A 3L08A 4G11A 4J8EA 2KCKA 4L23A 5EKQD 2J09A 3B7TA 3VLEA 3ZYMA 5ANLA 5J08A 3CHSA 2OV8A 4GU5A 1N52A 4K0RA 4Y6CA 3QAQA 3AU4A 4AP2A 3CHRA 1JPLA 2XGOA 4ILIA 4N3AA 4RSYA 3RRMB 3FH5A 4HLEA 1HG5A 4I9EA 2WXHA 3ASDA 4PDXA 2C2LA 3OXGA 4V3IA 1ZU2A 2XQ0A 3IV0A 3PRZA 2WXOA 4BX9A 2IOLA 5JHAA 3ESKA 1HFAA 4GB9A 1W3BA 4TRQA 2XGMA 3G2SA 3CHMA 2YINA 2ZU6B 2XGSA 1U3CA 3VLDA 4BT9A 3CVLA 4PS8A 3L54A 3MKQB 2FO7A 4WWPA 4IULA 5CMWA 3RIBA 1SQMA 2XCCA 1Z3YA 2HR2A 4JXTA 4PS7A 3MV2B 3ML9A 2XPYA 3FUMA 4FLBA 3MJWA 3R7RA 1E7VA 5LCWJ 4HOUA 1E96B 2GGFA 3FTUA 2CHXA 4W9RA 4UI9K 4EECA 5FZRA 3MA5A 3KAEA 3MV3B 5KJNA 1TJFA 1KT1A 3KS2A 2CHWA 3GZSA 1JWGA 3FH7A 3ZYQA 2L0IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FEX A;  3EIQ C;  4LUN U;  3JUI A;  1H2T C;  2ZU6 B;  2HM8 A;  1H2U A;  2IU1 A;  2KZT A;  5ANR A;  2FUL A;  4B8C B;  1H2V C;  3L6A A;  1UG3 A;  2NSZ A;  4CRW A;  4IUL A;  3D3M A;  1HU3 A;  1PAQ A;  4JHJ A;  1UW4 B;  3EIJ A;  4GML A;  4B89 A;  2IOS A;  1N52 A;  4CEM A;  2GGF A;  4C9B B;  4B8A A;  3RK6 A;  2KZT B;  2I2O A;  2ION A;  3FEY A;  1N54 A;  4GMJ A;  2VSX E;  2RG8 A;  4JHK A;  1H6K A;  4CT4 A;  2IOL A;  2VSO E; 
#chains in the Genus database with same CATH topology
 4A1S A;  3HHM A;  4D10 C;  4U8H A;  2MYO A;  4GZC A;  3IBE A;  2GRR B;  2J4D A;  4TXQ A;  3SQV A;  1LD8 A;  4WWN A;  4DX6 D;  2R59 A;  5AJL A;  1HXI A;  3EHQ A;  3ZN3 A;  4FP7 A;  2BUG A;  2A5E A;  4GYW A;  3ENE A;  3PDN A;  4U95 D;  4N3B A;  5BT1 A;  4GZD A;  4JL0 A;  1H6O A;  3UM3 A;  2F8X K;  2AXZ A;  3TJP A;  2KZT B;  1FVF A;  3D9O A;  4PS3 A;  4U96 D;  4O6F A;  2V5Q C;  3I3N A;  3CKB A;  2WMO A;  1B89 A;  4ZHB A;  4BSX A;  2IY0 C;  4I43 A;  1DCE A;  3FHE A;  1OWL A;  4PUC A;  1NP7 A;  4UWH A;  4OVU A;  1TN8 A;  4OYS A;  4Q69 A;  3AU5 A;  4J8F A;  3HG0 D;  2MRI A;  5FT9 A;  1V55 E;  4NRH B;  2QY7 A;  3L16 A;  1OCO E;  4BX8 A;  3L22 A;  4UQY A;  2I2O A;  5KNH D;  3UI2 A;  2JLB A;  1SA5 A;  3FTS A;  4EQF A;  4A3T A;  4KXK B;  2LXL A;  3E37 A;  4CGV A;  1TN6 A;  3E4B A;  3C3Q A;  1IHG A;  4GTT A;  5EX0 A;  4DRX E;  3U9W A;  4IYP A;  1PAQ A;  3V30 A;  3UIO C;  5AYW D;  3TGO A;  3LVQ E;  3D9L A;  1FCH A;  5IY5 E;  4I2Z A;  4CT4 A;  4ANX A;  1ELR A;  3FUN A;  4URK A;  2VGY A;  3NZS A;  4I6G A;  3DXM G;  2AJA A;  3HVE A;  1WM5 A;  4JHJ A;  4U0U A;  5JMN D;  4I17 A;  4C9B B;  1FT2 A;  1JUQ A;  2IQC A;  4AY5 A;  4GA0 A;  2DIW A;  1QZ2 A;  3CVQ A;  4LUN U;  3AG2 E;  2LUH A;  3CQC B;  3ASO E;  2CG2 A;  2J4B A;  4MRU A;  3MCX A;  4L2L A;  4AEZ C;  2DYR E;  3U3W A;  3J5P A;  3VLF A;  3D9I A;  4TXP A;  1S70 B;  3DBS A;  3S2A A;  3FU6 A;  5KJK A;  5CED B;  3DPD A;  4G26 A;  1TNZ A;  2EQX A;  3CVN A;  4IRU A;  4H7X A;  4FAD A;  2V5F A;  4Q94 A;  3ZIM A;  1OCC E;  4MS6 A;  1N0Q A;  3LEW A;  1YA0 A;  3VTX A;  5FZS A;  2WQH A;  4UQX A;  4Y6W A;  1N54 A;  2J07 A;  4EZK A;  3C98 A;  5G2N A;  4RVB A;  2E2E A;  4BT8 A;  1HX8 A;  5G55 A;  3EDT B;  1SZA A;  1N4P A;  3O48 A;  1H6P A;  2VSX E;  3HVE B;  2P9K G;  1MQS A;  3AAA C;  1AWC B;  1BD8 A;  4DPR A;  3ZGQ A;  4WNF A;  5CBO A;  4N5Q A;  3SGH A;  3NQP A;  2HO1 A;  1A5E A;  2VQ2 A;  3AG3 E;  1RZ4 A;  3MGB A;  3PZD A;  1BU9 A;  3CVP A;  4BWR A;  3LY7 A;  4I6E A;  3RRU A;  4FLH A;  3Q75 A;  4HXI A;  3UPV A;  4CRW A;  1FVH A;  4P29 A;  3D9M A;  4HRN A;  1Z3X A;  2ZGG A;  4YND A;  4JHR A;  5EDS A;  2P9I G;  4GZ6 A;  3PUJ A;  4KYO B;  4ZFH A;  3QK0 A;  4FJZ A;  1S0P A;  3ASF A;  2J9Q A;  4NQ0 A;  4WNG A;  2Y4T A;  1MYO A;  2JAB A;  3EHM A;  5HS0 A;  3DSX A;  3R9M A;  2FO1 E;  2B0O E;  4AVX A;  2DBA A;  4YDW A;  3AJI A;  2CFZ A;  2ZGD A;  3OTN A;  3F6Q A;  3W9G A;  3LY8 A;  3SD5 A;  3T8K A;  3U66 A;  2VSO E;  4KZ0 A;  2KCV A;  4G23 A;  4WND A;  3LY9 A;  2H6F A;  4RG9 A;  1U3D A;  3FUE A;  3HXF A;  5CRV A;  5HRY A;  4NIK A;  4EZJ A;  3SI5 A;  2UWJ G;  2HM8 A;  4GPK A;  1RW2 A;  5G05 C;  3TXM A;  5FJY A;  1S63 A;  3RO2 A;  1YYH A;  3EIJ A;  2X6H A;  3Q5M A;  3B95 A;  2X6K A;  5B3S E;  5CEC B;  4APF A;  2RG8 A;  4J8D A;  2KAT A;  5LCW C;  5FQ4 A;  3V2X A;  1E90 A;  2DWZ A;  1WAO 1;  2OVB A;  3FTV A;  4J8E A;  3C3R A;  5J08 A;  2OV8 A;  4K0R A;  3QAQ A;  3AU4 A;  4AP2 A;  5CEA A;  1JPL A;  4ILI A;  4N3A A;  4RSY A;  4HLE A;  3FH5 A;  3SFX A;  4PDX A;  3OXG A;  2XQ0 A;  3IV0 A;  3PRZ A;  2WXO A;  2Y69 E;  3ESK A;  1K3Z D;  1W3B A;  4HI8 A;  3DSV A;  2XGS A;  3CVL A;  3L54 A;  3EHR A;  3MKQ B;  4GTS A;  3FUM A;  3MJW A;  1E7V A;  1WDY A;  1E96 B;  3MV3 B;  3B7B A;  1KT1 A;  4GTO A;  4LRZ A;  1NA0 A;  4E6H A;  3MKR A;  3TWV A;  4LER A;  4JB8 P;  2KCL A;  4GTQ A;  3ZRH A;  4O1P A;  5G04 J;  3JUE A;  4DX7 D;  4NAC A;  2GRO B;  2PL2 A;  2XS8 A;  3V31 A;  3Q15 A;  3AG4 E;  5BV0 A;  4GTV A;  3BG1 B;  3JUI A;  3LVR E;  3QNK A;  1MX4 A;  3C5R A;  5AQ9 A;  2I9C A;  3URZ A;  4A63 B;  3JCK C;  3PEU B;  4U04 A;  3T8M A;  4A3V A;  4CDN A;  3T9K A;  3WXX A;  3ZFW A;  2Y4U A;  4WUY A;  3L9T A;  2LAI A;  4HS2 A;  3DPY A;  3APF A;  5E75 A;  1JWF A;  1TNU A;  1E7U A;  1TR4 A;  4CEM A;  2L0T B;  4JEH A;  5JJ7 A;  2X6F A;  4FHJ A;  3RK6 A;  4GZ3 A;  1E8X A;  5LOZ A;  1KLX A;  4I2W A;  3UUX A;  4IN3 B;  3TXN A;  5CMY A;  2NYJ A;  3DEP A;  4FC8 A;  3B7U X;  4AIF A;  4N39 A;  4DX5 D;  1V54 E;  2EIN E;  1JCQ A;  4WWO A;  2RD0 A;  4BET A;  3CVY A;  4GYY A;  2H6I A;  4YVO A;  3Q7A A;  3DEO A;  3G2V A;  2AWI A;  4FA6 A;  1HU3 A;  1MHQ A;  3PVL A;  3DSU A;  1NL4 A;  3FU3 A;  1EDU A;  1TEZ A;  1FPP A;  4DI4 A;  3UM2 A;  4I1A A;  3D9N A;  4U8V D;  4BY6 A;  4KBQ A;  3FUI A;  3CR3 A;  3D9J A;  2ZIR A;  4GCO A;  4F6R D;  1QBQ A;  2VYI A;  1E8W A;  3D3M A;  3ZW3 A;  5A6C A;  1MX2 A;  3Q4A B;  3FTY A;  2XS1 A;  1TYQ G;  2DVW A;  1N4R A;  2LXM A;  3MEK A;  2ILR A;  3TWR A;  4GMR A;  2BKK B;  3EJN A;  3LKU A;  1H2V C;  3Q47 B;  1FT1 A;  4BFR A;  2IF4 A;  4ATG A;  4GML A;  4FUL A;  3FTZ A;  2R2L A;  1X5B A;  3CKC A;  4DI3 A;  5HQ8 A;  1OWN A;  3ZPJ A;  4KVO A;  2WVI A;  2Q7F A;  5ARF A;  1PY1 A;  3PEV B;  2V4H C;  3IKO B;  3PZ2 A;  4XI9 A;  4DLO A;  3UIN C;  2E0I A;  5BXU A;  5FQ8 A;  3OAW A;  5AIJ A;  3CVV A;  3QWW A;  5KBA A;  3Q7F A;  3QWP A;  3TWW A;  5DBK A;  3ZEF A;  1K1A A;  3NZU A;  3P2B A;  3TWT A;  2WB2 A;  5E76 A;  1UW4 B;  1IQU A;  4CCA A;  4YDY A;  2ETA A;  5LP0 A;  4HOQ A;  1HH8 A;  5ITZ F;  2PQR A;  2J08 A;  4B0Z A;  3APC A;  5M72 A;  3RAU A;  2QC9 A;  5FQ7 A;  4C0E A;  4JD2 G;  3CIA A;  1H19 A;  1X81 A;  2F37 A;  5ENQ D;  3NBN B;  3LYA A;  3UT4 A;  3B7S A;  4K5B A;  1DCQ A;  2EIJ E;  1OCR E;  2YHC A;  2XEV A;  2IU1 A;  4XEI G;  1QNF A;  3DRA A;  1N95 A;  3FWV A;  3G2U A;  2MOW A;  4B89 A;  2DZO A;  2MHK A;  4HRL A;  5ARG A;  1ZBP A;  3AS5 A;  4ACL A;  1HZ4 A;  2I1J A;  2XRZ A;  1D8E A;  3ASN E;  2AXV A;  4B8A A;  3CK7 A;  2XCB A;  2LO6 A;  3FEY A;  4U63 A;  3MX3 A;  5AQ7 A;  2WXM A;  5B1B E;  3FEX A;  4L1B A;  2WQ7 A;  4AJW A;  3ZYK A;  2X6J A;  4LSZ E;  3DWL G;  1OT8 A;  4ANW A;  2VTB B;  2ETC A;  1A17 A;  4I9C A;  3Q49 B;  3BG0 B;  4TUM A;  5DIZ A;  2L6B A;  2XHE A;  4MKT A;  2BTD A;  3ONL A;  1OWP A;  1H6K A;  1EYH A;  4Q96 A;  1N4Q A;  2OVF A;  1OWM A;  3WG7 E;  2RFM A;  1BLX B;  4OAU C;  3GZ2 A;  3GZ1 A;  4LNB A;  1XGW A;  1D8D A;  2J49 A;  1MZC A;  4UWG A;  3W9F A;  2WXN A;  4NUR A;  3BEE A;  3UMV A;  3IXE A;  4DUI A;  3ESL A;  2C0M A;  3KSQ A;  3ZU7 B;  4G11 A;  4RQI A;  4TXR A;  4GU5 A;  2XGO A;  3RRM B;  3ABK E;  4I9E A;  2ZXW E;  1ZU2 A;  2ZU6 B;  1U3C A;  4BT9 A;  4PS8 A;  3J5Q B;  3RIB A;  1LTX A;  1SQM A;  2XCC A;  1Z3Y A;  2HR2 A;  4JXT A;  4BTA A;  2CHX A;  4EEC A;  2GRQ B;  1JCS A;  5FZR A;  1N11 A;  2PNN A;  5EID A;  3KS2 A;  3GZS A;  3ZYQ A;  1N94 A;  2P2C P;  4CGW A;  2GRM A;  3UT8 A;  5ANR A;  2A5U A;  1ELW A;  4G8L A;  4AOF A;  4G2V A;  2LSU A;  3R7Q A;  3UKR G;  3MKQ A;  2KXP C;  5J90 A;  2QYJ A;  1NA3 A;  5JJT A;  2KC7 A;  3CV0 A;  2Y3A A;  5EX3 A;  5BPP A;  2R02 A;  4J8S A;  3TL5 A;  4L7T A;  4ANV A;  4KMO A;  2VGE A;  4DK5 A;  3I5P A;  1IHB A;  3I4G A;  4KZC A;  2OND A;  4DJA A;  4LEU A;  4ANU A;  4JHK A;  1P5Q A;  3UT7 A;  4U0S A;  3SZ7 A;  3CVW A;  1N0R A;  2WXP A;  4HOT A;  4U8Y D;  1Z6T A;  5T4Y A;  4HB5 A;  1OWO A;  4UUC A;  3RO3 A;  3QDN A;  3CSF A;  1HO8 A;  2QFC A;  3SF4 A;  2VSY A;  2FI7 A;  3FU0 A;  4UQZ A;  2BED A;  3PZ1 A;  2L9B A;  1E8Y A;  4HQD A;  1MX6 A;  5FZQ A;  1O1T A;  5CHE E;  3N71 A;  2Y0B G;  3R9A B;  1O5M A;  2NXP A;  3SNX A;  5D0Q D;  3ASH A;  2R5S A;  3NOG D;  3ZUV B;  4UWK A;  3FY4 A;  4WAF A;  3V2O A;  3AS4 A;  4TV3 A;  2R03 A;  1UN8 A;  2VSN A;  2WXF A;  1UOH A;  3PZ4 A;  3ULY A;  3SFY A;  3PNT B;  1UN9 A;  3OXL A;  3UQ3 A;  5EN5 D;  5JHB A;  4U7E B;  3KD7 A;  3TWU A;  4F53 A;  4I1M A;  1GW6 A;  3FUF A;  1N4S A;  4LNU D;  3ZNG A;  2J8S D;  3Q79 A;  3B7R L;  1KPS B;  2WXI A;  4R7L A;  5JJ6 A;  5CRU A;  4ILG A;  5D66 A;  4KT6 B;  5EIB E;  2WPV A;  2V4L A;  4F1P A;  1OCZ E;  2FEZ A;  5LX8 A;  1H2T C;  1H2U A;  3HRA A;  5CCM A;  1UG3 A;  1U2V G;  3JXI A;  3ZXS A;  3BUA A;  3CLJ A;  2VJ8 A;  3CHP A;  1ELK A;  4CT0 A;  2OEV A;  1EF1 C;  1G3N B;  5AJD A;  3ASG A;  3D9K A;  2BF0 X;  4K03 A;  5KJL A;  5AQA A;  1SW6 A;  3LCA A;  3SBT B;  3GYZ A;  5EYL A;  3VTY A;  3ZVV A;  4DX1 A;  3E33 A;  2XPI A;  3V79 K;  4GTM A;  4YDO A;  2OOE A;  2AXU A;  3CHQ A;  2WXK A;  2L6J A;  2P9U G;  1L5J A;  4J8Y A;  1NFI E;  4HOR A;  4HLL A;  2BKG A;  1SA4 A;  1IYG A;  4ATZ D;  3EHN A;  1SVX A;  2I1K A;  2NC9 A;  3O4Z A;  3SO8 A;  3P1U A;  4B94 A;  1O1S A;  2IEJ A;  1TNY A;  2H6G A;  5ENR D;  3Q78 A;  3ZKJ A;  4TUU A;  3NF1 A;  2RFA A;  2VGX B;  2P58 C;  3RKV A;  4HNA D;  3FTX A;  3FUL A;  3OXF A;  2GW1 A;  2LSV A;  5ENO D;  2PM6 A;  2C0L A;  3QC1 A;  1ZB1 A;  2DCP A;  2XEN A;  4HBD A;  4QFV A;  3RJV A;  4B93 B;  4CDR A;  3HIZ A;  2IO2 C;  3E32 A;  3D9P A;  5G05 J;  2XZT G;  1Q2Z A;  1BPO A;  2ETB A;  2V8S E;  3CGH A;  3FFL A;  3ISM C;  2NSZ A;  3QOU A;  1Z5S C;  4JVS A;  4CDM A;  3HDX A;  1HE8 A;  5C1D A;  4O60 A;  2V0P A;  3FP3 A;  2M63 A;  5C2Y A;  1Y6I A;  4GA1 A;  4XE0 A;  4N3C A;  3EU5 A;  1OY3 D;  3T5V A;  4XI0 A;  3PRE A;  3NB2 A;  2Y1L E;  5D2M C;  2DYS E;  4GTR A;  4L2Y A;  4A55 A;  5ENN A;  1YMP A;  4UWF A;  4GZ5 A;  3U4T A;  4WNE A;  4GA2 A;  3EUV A;  3MYV A;  2I6H A;  3Q73 A;  2P9P G;  3BU8 A;  4XZ4 A;  3RSE G;  5ENS D;  4EZL A;  3MZL B;  5AEN A;  4KVM A;  3LS8 A;  4O1O A;  5BUZ A;  5H7P A;  4JEU A;  4GMJ A;  5D0O D;  1PC2 A;  5KWD A;  1N9A A;  4AXH A;  2PZI A;  3GW4 A;  2RKK A;  3PE3 A;  4UI9 J;  1AP7 A;  5AN8 A;  1KT0 A;  3KSL A;  3EU9 A;  5BV1 A;  3AS8 A;  4YDE A;  2EIL E;  2VTB A;  4JW1 A;  1SZ9 A;  3TWX A;  1K1B A;  2XZD G;  2WXQ A;  4PH4 B;  3CVU A;  2FUL A;  2X38 A;  3L08 A;  4L23 A;  3VLE A;  1MJ0 A;  5ANL A;  4X8Q A;  2P9S G;  3CHS A;  4MBG A;  1N52 A;  1K8K G;  4Y6C A;  2P9N G;  1HG5 A;  1O1R A;  4V3I A;  4GPM A;  3TWQ A;  4BX9 A;  1TNB A;  5JHA A;  4TRQ A;  3CHM A;  2XEE A;  4WWP A;  3UM0 A;  2OEW A;  2KBX A;  4PS7 A;  3MV2 B;  3ML9 A;  1D9S A;  4FLB A;  4L9P A;  4HOU A;  2GGF A;  3FTU A;  4K5C A;  4UI9 K;  2XEH A;  2GRN B;  3DXK G;  3KAE A;  1TJF A;  2CHW A;  1JWG A;  3FH7 A;  5AAO A;  3NAW A;  3UX4 A;  3IHV A;  3X2Q E;  4ME2 A;  1QYM A;  1NZN A;  3AG1 E;  4LG6 A;  3T5X A;  1WY6 A;  5FWQ A;  2QZA A;  1TN7 A;  3G2T A;  2H6H A;  1HF8 A;  3PNL B;  4QQI A;  3TWS A;  4I1O B;  2YHE A;  1EPU A;  3S7J A;  3E34 A;  4RLY A;  4G8K A;  4CYM D;  4J0U A;  4U0Z A;  3S7F A;  5FIN A;  4EHM A;  1H0A A;  4GTP A;  4H7Y A;  5JA4 D;  1INZ A;  1OXJ A;  3FU5 A;  3FTW A;  4M7C A;  3LJN A;  3CQG B;  5AAR A;  3TG5 A;  4LCT A;  4G1T A;  4J7W A;  1XNF A;  3DSW A;  5ENT D;  5A7D B;  2WMN A;  4GAA A;  4GYO A;  4F1S A;  2F0Y A;  3QB2 A;  1YCS B;  3HXE A;  4BEP A;  2AW6 A;  4BSZ B;  1HG2 A;  3PS6 A;  4EPZ A;  5LFA A;  3PH0 C;  4OAV B;  3L82 A;  5AQB A;  5CBN A;  2CHZ A;  4BER A;  3S7B A;  2LNI A;  2XRY A;  2WXR A;  4F3V A;  2EIM E;  3QJZ A;  4F7A A;  2FBN A;  4YVQ C;  2GRP B;  4MLP A;  3HXB A;  5CER B;  4XKB A;  3ONK A;  4A1G A;  2UY1 A;  2ION A;  3E30 A;  4JA7 A;  5G04 C;  5B1A E;  1LF8 A;  2WM9 A;  2QYU A;  4G25 A;  4APO A;  3UIP C;  2EIK E;  3ULQ A;  5ENP D;  4HVB A;  2PQN A;  1DC2 A;  4J6I A;  4C0M A;  3TAX A;  4XIF A;  2IFU A;  2IJG X;  2XPZ A;  3L17 A;  5EYP F;  4XX5 A;  1BI8 B;  3D9H A;  3PE4 A;  4EBA G;  2YQ8 A;  4Z68 A;  5CCL A;  3HXD A;  3QWV A;  4BES A;  4ACK A;  3CK8 A;  3EIQ C;  1TJC A;  3KEA A;  4HRM B;  3ABM E;  2JEK A;  3ZHE A;  2DZN A;  3HXC A;  3ML8 A;  4JZY A;  2R05 A;  1KZO A;  2WQ6 A;  2R17 C;  4FHK A;  2WXL A;  4UWL A;  4B8C B;  2UY1 B;  3BQO A;  2X6I A;  1E8Z A;  3CK9 A;  3APD A;  3IHY A;  4CZ2 D;  5KNG A;  3ZYL A;  3FUD A;  1IQR A;  3CHO A;  1UJJ A;  3KEZ A;  3FH8 A;  3U64 A;  1HS6 A;  2LAH A;  5FQ6 A;  1QQE A;  4JA9 A;  4EBA A;  5FIO A;  4I6J A;  3DSS A;  4AY6 A;  4JC8 A;  2AVP A;  3RRN B;  4FU3 A;  5KJM A;  1LD7 A;  3B13 A;  3SFZ A;  4HI9 A;  3C72 A;  5HKP A;  3DST A;  2CFU A;  3SHF A;  1BI7 B;  4AM9 A;  4M3O A;  3CEQ A;  2FF4 A;  3ABL E;  3Q9U C;  5KCM A;  3ZHE B;  2HE0 A;  3FUJ A;  2X3M A;  4RG6 A;  3PZ3 A;  5BXO A;  5EIL A;  3LDZ A;  3LXU X;  3SY2 A;  3QKY A;  3UKU G;  3HYM B;  3IEG A;  2B6C A;  2ZIS A;  3SBS A;  3JQ0 A;  2VGX A;  4AV7 A;  1KZP A;  3LJ3 A;  4G24 A;  1DVP A;  3L13 A;  4ABN A;  2WXG A;  3C3O A;  3LPZ A;  2KM4 A;  4N5C A;  3L6A A;  4XKC A;  3JQ1 A;  3FDH A;  2IOS A;  4N2Q A;  1NI1 A;  4UI9 C;  4GCN A;  5FTP A;  5A23 A;  1TNO A;  5BNW A;  2A4Z A;  3JXJ A;  2YNQ A;  5T3R A;  3QAR A;  2P9L G;  4HOS A;  1JCR A;  3I4R B;  5BW8 C;  3UXG A;  1Y8M A;  1UJK A;  4DLQ A;  4LNG A;  1OUV A;  3UM1 A;  3JYS A;  4BTB A;  3UTM A;  3PUK A;  3FUK A;  4ILH B;  2HYZ A;  4HFG A;  1VDY A;  1S64 A;  3ZXP A;  2F8Y A;  5HI7 A;  2CG3 A;  1WG0 A;  3NOC D;  4K5A B;  3CVX A;  4U07 A;  3K9I A;  2PM7 A;  4N2S A;  3CST A;  3G2W A;  4DX2 A;  2WXJ A;  3RU0 A;  3TG4 A;  3S7D A;  3FUH A;  4OVV A;  4FJY A;  2GRL A;  1DNP A;  4E85 A;  2KZT A;  5T8I A;  3ULE G;  2OCC E;  5EKQ D;  2KCK A;  3ZYM A;  2J09 A;  3B7T A;  2IO3 C;  4C48 B;  3CHR A;  2WXH A;  3ASD A;  2C2L A;  2IOL A;  1HFA A;  4GB9 A;  2XGM A;  3G2S A;  2YIN A;  3VLD A;  1IKN D;  2FO7 A;  5CMW A;  4IUL A;  2XPY A;  3R7R A;  5LCW J;  3Q9N C;  4W9R A;  1IXV A;  3MA5 A;  5KJN A;  4JPS A;  2L0I A; 
#chains in the Genus database with same CATH homology
 4LRZ A;  3HHM A;  1NA0 A;  4A1S A;  4U8H A;  3MKR A;  4D10 C;  2GRM A;  3UX4 A;  4E6H A;  4CGW A;  4LER A;  3UT8 A;  2KCL A;  5ANR A;  3IHV A;  4GZC A;  3IBE A;  4ME2 A;  3ZRH A;  2J4D A;  1NZN A;  5G04 J;  2A5U A;  1ELW A;  4NAC A;  4AOF A;  3T5X A;  1WY6 A;  5FWQ A;  4G2V A;  4WWN A;  2PL2 A;  2LSU A;  2R59 A;  5AJL A;  3R7Q A;  3MKQ A;  5J90 A;  1HXI A;  3G2T A;  3Q15 A;  3ZN3 A;  5BV0 A;  1HF8 A;  1NA3 A;  5JJT A;  2KC7 A;  3PNL B;  3BG1 B;  4FP7 A;  2BUG A;  3CV0 A;  4I1O B;  2YHE A;  3JUI A;  3LVR E;  4GYW A;  3ENE A;  3PDN A;  2Y3A A;  3QNK A;  5EX3 A;  1EPU A;  5BPP A;  3S7J A;  2I9C A;  4N3B A;  4J8S A;  4J0U A;  5BT1 A;  4U0Z A;  3TL5 A;  3URZ A;  4GZD A;  4L7T A;  3S7F A;  4ANV A;  3JCK C;  3PEU B;  4KMO A;  4JL0 A;  4U04 A;  3T8M A;  1H0A A;  4A3V A;  4DK5 A;  4H7Y A;  4CDN A;  2AXZ A;  1INZ A;  3FU5 A;  3I5P A;  3TJP A;  3FTW A;  3WXX A;  3I4G A;  4JPS A;  2KZT B;  1FVF A;  3D9O A;  4KZC A;  2OND A;  3ZFW A;  2Y4U A;  3CQG B;  4PS3 A;  4WUY A;  4DJA A;  3TG5 A;  4LEU A;  4O6F A;  4ANU A;  3I3N A;  4JHK A;  4LCT A;  2LAI A;  1P5Q A;  4G1T A;  4HS2 A;  3CKB A;  3UT7 A;  2WMO A;  4U0S A;  3SZ7 A;  1XNF A;  3CVW A;  1B89 A;  3APF A;  4BSX A;  2WXP A;  2WMN A;  5A7D B;  4GAA A;  4I43 A;  3FHE A;  4HOT A;  1OWL A;  4GYO A;  1Z6T A;  4F1S A;  5E75 A;  5T4Y A;  3QB2 A;  4PUC A;  1JWF A;  1NP7 A;  1E7U A;  1OWO A;  3RO3 A;  2AW6 A;  4CEM A;  4UWH A;  2L0T B;  4JEH A;  1HG2 A;  3QDN A;  4OVU A;  2X6F A;  3CSF A;  3PS6 A;  4FHJ A;  4EPZ A;  3RK6 A;  5JJ7 A;  1HO8 A;  2QFC A;  3SF4 A;  5LFA A;  2VSY A;  2FI7 A;  3FU0 A;  3PH0 C;  4OYS A;  4GZ3 A;  1E8X A;  5LOZ A;  1KLX A;  4I2W A;  3UUX A;  4Q69 A;  3AU5 A;  2CHZ A;  4IN3 B;  4UQZ A;  3TXN A;  2L9B A;  3S7B A;  5CMY A;  2LNI A;  1E8Y A;  2XRY A;  4J8F A;  2WXR A;  4F3V A;  3QJZ A;  4F7A A;  5FZQ A;  2FBN A;  5CHE E;  4YVQ C;  3N71 A;  4MLP A;  3R9A B;  2MRI A;  4XKB A;  2NXP A;  5FT9 A;  4FC8 A;  4NRH B;  3B7U X;  3ONK A;  2QY7 A;  3L16 A;  4AIF A;  4A1G A;  4BX8 A;  3L22 A;  2UY1 A;  4UQY A;  2I2O A;  2ION A;  4N39 A;  3SNX A;  5D0Q D;  2JLB A;  3FTS A;  4WWO A;  3ASH A;  4JA7 A;  4EQF A;  4A3T A;  2R5S A;  4KXK B;  2RD0 A;  5G04 C;  3CVY A;  4GYY A;  4UWK A;  4CGV A;  3E4B A;  3FY4 A;  4WAF A;  4YVO A;  3AS4 A;  1IHG A;  4TV3 A;  1LF8 A;  3G2V A;  2WXF A;  1UN8 A;  2VSN A;  2WM9 A;  4G25 A;  5EX0 A;  4APO A;  2AWI A;  4FA6 A;  1HU3 A;  4IYP A;  3U9W A;  1PAQ A;  1MHQ A;  3PVL A;  3PNT B;  5AYW D;  3TGO A;  3LVQ E;  1UN9 A;  3D9L A;  3OXL A;  3UQ3 A;  3FU3 A;  5JHB A;  1EDU A;  3ULQ A;  1TEZ A;  3KD7 A;  1FCH A;  4DI4 A;  4F53 A;  4I1A A;  4I2Z A;  4CT4 A;  4I1M A;  3D9N A;  4BY6 A;  1GW6 A;  2PQN A;  3FUF A;  4KBQ A;  4ANX A;  4HVB A;  4J6I A;  1ELR A;  3FUI A;  3FUN A;  4C0M A;  4URK A;  2VGY A;  3NZS A;  3TAX A;  4I6G A;  4XIF A;  3B7R L;  3CR3 A;  3D9J A;  2WXI A;  2IFU A;  3HVE A;  2IJG X;  4GCO A;  2XPZ A;  2VYI A;  1E8W A;  3D3M A;  3L17 A;  4XX5 A;  4R7L A;  3ZW3 A;  1WM5 A;  4JHJ A;  4U0U A;  5A6C A;  5JJ6 A;  3Q4A B;  3FTY A;  4I17 A;  4ILG A;  4KT6 B;  4C9B B;  3PE4 A;  4EBA G;  2YQ8 A;  1JUQ A;  2WPV A;  2V4L A;  5CCL A;  2IQC A;  4AY5 A;  3MEK A;  2ILR A;  3QWV A;  4GA0 A;  2DIW A;  1QZ2 A;  2FEZ A;  3CVQ A;  4ACK A;  3CK8 A;  3EJN A;  5LX8 A;  3EIQ C;  4LUN U;  1TJC A;  1H2T C;  1H2U A;  3LKU A;  3CQC B;  1H2V C;  2JEK A;  5CCM A;  2CG2 A;  1UG3 A;  3ZHE A;  3Q47 B;  4BFR A;  2J4B A;  4MRU A;  3MCX A;  4L2L A;  3ZXS A;  4AEZ C;  2IF4 A;  3CLJ A;  4ATG A;  2VJ8 A;  3U3W A;  3CHP A;  4GML A;  4FUL A;  1ELK A;  4CT0 A;  3VLF A;  3D9I A;  3ML8 A;  4JZY A;  3DBS A;  3S2A A;  3FU6 A;  5KJK A;  1EF1 C;  3FTZ A;  2WQ6 A;  2R17 C;  3DPD A;  4G26 A;  1X5B A;  3CKC A;  4FHK A;  2EQX A;  3ASG A;  3CVN A;  3D9K A;  5AJD A;  2BF0 X;  2WXL A;  4K03 A;  4IRU A;  4H7X A;  4UWL A;  4DI3 A;  4FAD A;  2V5F A;  4Q94 A;  3ZIM A;  5HQ8 A;  1OWN A;  4B8C B;  2UY1 B;  5KJL A;  3ZPJ A;  4MS6 A;  4KVO A;  2X6I A;  1E8Z A;  3CK9 A;  2WVI A;  3LCA A;  3GYZ A;  2Q7F A;  5ARF A;  3APD A;  3SBT B;  1PY1 A;  3IHY A;  3PEV B;  3LEW A;  3VTY A;  1YA0 A;  3ZVV A;  3IKO B;  2XPI A;  3VTX A;  5FZS A;  3ZYL A;  3FUD A;  2WQH A;  4XI9 A;  2OOE A;  4UQX A;  4Y6W A;  1IQR A;  1N54 A;  4DLO A;  3CHO A;  2AXU A;  1UJJ A;  3CHQ A;  2J07 A;  2WXK A;  3KEZ A;  2E0I A;  2L6J A;  3FH8 A;  4EZK A;  5FQ8 A;  3U64 A;  3OAW A;  4BTA A;  5AIJ A;  3CVV A;  3QWW A;  1L5J A;  1HS6 A;  2LAH A;  3QWP A;  3C98 A;  5FQ6 A;  5DBK A;  5G2N A;  1QQE A;  3ZEF A;  4JA9 A;  4RVB A;  4HOR A;  3NZU A;  2E2E A;  4BT8 A;  4EBA A;  3P2B A;  4I6J A;  2WB2 A;  1IYG A;  1HX8 A;  5E76 A;  1UW4 B;  5G55 A;  3EDT B;  3EHN A;  4AY6 A;  1IQU A;  2I1K A;  4JC8 A;  4CCA A;  1SZA A;  2AVP A;  2NC9 A;  5LP0 A;  3O4Z A;  3P1U A;  4B94 A;  3O48 A;  3RRN B;  2VSX E;  3HVE B;  4HOQ A;  1HH8 A;  4FU3 A;  5KJM A;  1MQS A;  2PQR A;  4TUU A;  3B13 A;  2J08 A;  3NF1 A;  4DPR A;  4B0Z A;  3APC A;  3ZGQ A;  5M72 A;  3SFZ A;  2VGX B;  2P58 C;  3RKV A;  4WNF A;  3FTX A;  3FUL A;  5FQ7 A;  4C0E A;  3OXF A;  3SGH A;  3NQP A;  3CIA A;  2GW1 A;  1H19 A;  2CFU A;  2LSV A;  3SHF A;  2HO1 A;  2PM6 A;  2C0L A;  4AM9 A;  4M3O A;  3QC1 A;  3CEQ A;  2FF4 A;  2DCP A;  2VQ2 A;  5KCM A;  4QFV A;  3RJV A;  4CDR A;  3ZHE B;  3LYA A;  3HIZ A;  3UT4 A;  3B7S A;  3MGB A;  3D9P A;  3FUJ A;  3PZD A;  5G05 J;  3CVP A;  2X3M A;  4BWR A;  3LY7 A;  4I6E A;  4RG6 A;  1BPO A;  3RRU A;  4FLH A;  2YHC A;  2V8S E;  2XEV A;  2IU1 A;  3CGH A;  1QNF A;  3FFL A;  3LDZ A;  2NSZ A;  4HXI A;  3UPV A;  3QOU A;  4CRW A;  3LXU X;  4JVS A;  4CDM A;  1FVH A;  3QKY A;  3HDX A;  4P29 A;  5BV1 A;  3D9M A;  3FWV A;  1HE8 A;  3G2U A;  5C1D A;  3HYM B;  2MOW A;  4B89 A;  1Z3X A;  2MHK A;  4YND A;  2V0P A;  3FP3 A;  3IEG A;  4JHR A;  3JQ0 A;  3SBS A;  5EDS A;  2VGX A;  2M63 A;  4AV7 A;  5C2Y A;  4GZ6 A;  1Y6I A;  3PUJ A;  3LJ3 A;  4G24 A;  4GA1 A;  4KYO B;  4XE0 A;  4N3C A;  1DVP A;  5ARG A;  3L13 A;  4ABN A;  1ZBP A;  2WXG A;  3AS5 A;  3QK0 A;  3T5V A;  3LPZ A;  4ACL A;  4XI0 A;  1HZ4 A;  3PRE A;  2KM4 A;  4N5C A;  3L6A A;  4XKC A;  4FJZ A;  2I1J A;  2XRZ A;  1S0P A;  4L2Y A;  5ENN A;  4A55 A;  4UWF A;  3ASF A;  4GZ5 A;  2J9Q A;  4NQ0 A;  4WNG A;  2Y4T A;  3U4T A;  3JQ1 A;  3EHM A;  3FDH A;  2IOS A;  4GA2 A;  4WNE A;  4N2Q A;  2AXV A;  4UI9 C;  4AVX A;  4B8A A;  3CK7 A;  4GCN A;  2DBA A;  2XCB A;  5FTP A;  2LO6 A;  2CFZ A;  3FEY A;  3MYV A;  3OTN A;  5A23 A;  4U63 A;  3MX3 A;  2I6H A;  5BNW A;  3LY8 A;  3SD5 A;  2WXM A;  3U66 A;  2VSO E;  3FEX A;  4XZ4 A;  4L1B A;  2WQ7 A;  2A4Z A;  4KZ0 A;  2YNQ A;  4AJW A;  5T3R A;  3ZYK A;  2X6J A;  2KCV A;  3QAR A;  4HOS A;  4G23 A;  4WND A;  4EZL A;  3LY9 A;  3I4R B;  4ANW A;  2VTB B;  3MZL B;  1A17 A;  5AEN A;  4KVM A;  5BW8 C;  3LS8 A;  5BUZ A;  4I9C A;  3Q49 B;  4RG9 A;  3BG0 B;  1U3D A;  3FUE A;  1Y8M A;  1UJK A;  5DIZ A;  4DLQ A;  2XHE A;  4MKT A;  2BTD A;  1OUV A;  4JEU A;  3JYS A;  4GMJ A;  4BTB A;  3ONL A;  5D0O D;  1OWP A;  1H6K A;  1PC2 A;  1EYH A;  4Q96 A;  3PUK A;  3FUK A;  4EZJ A;  4ILH B;  3SI5 A;  2HYZ A;  4AXH A;  4HFG A;  1VDY A;  2UWJ G;  2HM8 A;  2OVF A;  4GPK A;  1OWM A;  2PZI A;  3GW4 A;  3PE3 A;  4UI9 J;  5G05 C;  3TXM A;  5FJY A;  5HI7 A;  1KT0 A;  2CG3 A;  3RO2 A;  3GZ2 A;  3GZ1 A;  3EIJ A;  2X6H A;  3Q5M A;  3CVX A;  4U07 A;  2X6K A;  3K9I A;  2PM7 A;  4N2S A;  1XGW A;  3CST A;  2J49 A;  2WXJ A;  3G2W A;  4APF A;  4UWG A;  2WXN A;  3RU0 A;  3AS8 A;  4NUR A;  3BEE A;  3TG4 A;  2RG8 A;  3S7D A;  3UMV A;  4J8D A;  3FUH A;  2VTB A;  2KAT A;  4FJY A;  4OVV A;  5LCW C;  4JW1 A;  2GRL A;  5FQ4 A;  1SZ9 A;  3ESL A;  1DNP A;  1E90 A;  2C0M A;  1WAO 1;  2OVB A;  2WXQ A;  4E85 A;  4PH4 B;  2KZT A;  3FTV A;  2FUL A;  5T8I A;  3CVU A;  2X38 A;  3L08 A;  4G11 A;  4J8E A;  2KCK A;  4L23 A;  5EKQ D;  2J09 A;  3B7T A;  3VLE A;  3ZYM A;  5ANL A;  5J08 A;  3CHS A;  2OV8 A;  4GU5 A;  1N52 A;  4K0R A;  4Y6C A;  3QAQ A;  3AU4 A;  4AP2 A;  3CHR A;  1JPL A;  2XGO A;  4ILI A;  4N3A A;  4RSY A;  3RRM B;  3FH5 A;  4HLE A;  1HG5 A;  4I9E A;  2WXH A;  3ASD A;  4PDX A;  2C2L A;  3OXG A;  4V3I A;  1ZU2 A;  2XQ0 A;  3IV0 A;  3PRZ A;  2WXO A;  4BX9 A;  2IOL A;  5JHA A;  3ESK A;  1HFA A;  4GB9 A;  1W3B A;  4TRQ A;  2XGM A;  3G2S A;  3CHM A;  2YIN A;  2ZU6 B;  2XGS A;  1U3C A;  3VLD A;  4BT9 A;  3CVL A;  4PS8 A;  3L54 A;  3MKQ B;  2FO7 A;  4WWP A;  4IUL A;  5CMW A;  3RIB A;  1SQM A;  2XCC A;  1Z3Y A;  2HR2 A;  4JXT A;  4PS7 A;  3MV2 B;  3ML9 A;  2XPY A;  3FUM A;  4FLB A;  3MJW A;  3R7R A;  1E7V A;  5LCW J;  4HOU A;  1E96 B;  2GGF A;  3FTU A;  2CHX A;  4W9R A;  4UI9 K;  4EEC A;  5FZR A;  3MA5 A;  3KAE A;  3MV3 B;  5KJN A;  1TJF A;  1KT1 A;  3KS2 A;  2CHW A;  3GZS A;  1JWG A;  3FH7 A;  3ZYQ A;  2L0I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...