4C9BB

Crystal structure of eif4aiii-cwc22 complex
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
284
structure length
277
Chain Sequence
DPLLTRTGGAYIPPAKLRMKNSLAYQRMSWEALKKSINGLINKVNISNISIIIQELLQENIVRGRGLLSRSVLQAQSASPIFTHVYAALVAIINSKFPQIGELILKRLILNFRKGYRRNDKQLCLTASKFVAHLINQNVAHEVLCLEMLTLLLERPTDDSVEVAIGFLKECGLKLTQVSPRGINAIFERLRNILHESEIDKRVQYMIEVMFAVRKDGFKDHPIILEGLDLVEEDDQFTHMLPLEDDYNPEDVLNVFKMDPNFMENEEKYKAIKKEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Eif4Aiii-Cwc22 Complex Shows How a Dead-Box Protein is Inhibited by a Mif4G Domain
pubmed doi rcsb
source organism Homo sapiens
molecule tags Splicing
molecule keywords EUKARYOTIC INITIATION FACTOR 4A-III
total genus 107
structure length 277
sequence length 284
ec nomenclature
pdb deposition date 2013-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.180 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 4c9bB00
4B8CB 1H2VC 4B8AA 5ANRA 3FEXA 4IULA 3FEYA 2VSOE 2VSXE 4CRWA 2IONA 3JUIA 1UW4B 2KZTA 2HM8A 2RG8A 4JHKA 2GGFA 4JHJA 3EIJA 4CT4A 1H2UA 3L6AA 1H2TC 1H6KA 3EIQC 4LUNU 2FULA 2IU1A 2IOLA 2I2OA 3D3MA 2KZTB 2ZU6B 1N52A 4CEMA 4B89A 4GMJA 1HU3A 1N54A 3RK6A 2IOSA 1PAQA 4GMLA 4C9BB 2NSZA 1UG3A
chains in the Genus database with same CATH superfamily
3CK7A 2KATA 3D9MA 4AIFA 2XPIA 5ITZF 3AS5A 3TGOA 2R59A 3ZW3A 5CEDB 2B6CA 4WNFA 3APCA 1TEZA 2VSYA 3PNLB 3SFXA 2BEDA 4XI0A 2MYOA 2GRNB 3ML9A 2J09A 3QARA 3SHFA 3ESLA 4JEHA 2FI7A 3SO8A 2CHZA 5G05C 4N2SA 3I4GA 2L6JA 3FTUA 1MYOA 3ZXPA 1UOHA 4XI9A 4HRLA 1Y8MA 1QBQA 4YDYA 4BWRA 3CHSA 4JB8P 1DNPA 3NBNB 2RKKA 3NZSA 3QJZA 5BT1A 3GZ1A 3SFYA 4BT8A 1DVPA 4M7CA 3SQVA 3RIBA 3QC1A 1FCHA 3NQPA 4BX9A 3TXNA 1BI8B 3MYVA 4CGWA 5ANRA 3C72A 3LY8A 3CK9A 1OCCE 4HOSA 2EIKE 4GAAA 5ENPD 1W3BA 3EHNA 3JXJA 1PAQA 4BETA 3ISMC 2GROB 3FY4A 4GA2A 3ZGQA 3FUHA 2H6GA 3FTZA 3NB2A 4R7LA 3PZ3A 1OWMA 5AYWD 1NI1A 2OVFA 3FTYA 3Q49B 4UQXA 3UM0A 3D3MA 2C2LA 4AP2A 4U07A 3JQ1A 5HS0A 3CVXA 1N4SA 3UIOC 2KM4A 5FINA 1UN8A 3AG4E 5FZSA 3TXMA 3DEOA 3CQGB 4JXTA 3C3OA 3AG2E 4BX8A 2WXJA 1K1AA 1Z3XA 4A3TA 3ZEFA 3NOGD 4YDWA 1HS6A 2A5EA 4DX6D 2J8SD 2BKGA 3FEXA 2LXLA 4N3AA 1NFIE 4I2WA 5A7DB 4AOFA 3DWLG 4B93B 2DVWA 4FADA 2QFCA 3CQCB 2WXIA 3ASHA 5FQ7A 1N0QA 1Z6TA 2PQRA 3V2OA 3CVYA 4I1OB 4EZLA 4BERA 2HE0A 3G2WA 4N5CA 4FA6A 3UXGA 5CHEE 5LFAA 1OCZE 4I9EA 1SZ9A 4GPMA 3QWVA 2ONDA 3BG0B 3RO2A 4GMRA 4GTMA 5HRYA 3CVUA 1OWLA 4PS8A 3ABKE 4UQYA 2FBNA 1KT1A 4J8YA 4ILGA 2XGMA 4ZHBA 2R03A 4Z68A 3PZ1A 3EHQA 4TXRA 1S64A 3FFLA 3ZHEA 3MZLB 2KBXA 4ILIA 3HYMB 2XHEA 1OUVA 2OEWA 5BW8C 4ME2A 4AV7A 1LD8A 4HOQA 2NSZA 4BY6A 1VDYA 3R9AB 1K1BA 3P2BA 3ASNE 2X6KA 4YVOA 5HI7A 5AQ7A 2PM7A 3ZYLA 4TXQA 3FUKA 5G05J 4O6FA 2ILRA 5EIDA 2XEHA 5JJ6A 2ETAA 4KVOA 3F6QA 2RFAA 2J49A 2EINE 3RK6A 5FZRA 4AEZC 2LUHA 2C0MA 3PUKA 3EJNA 1RZ4A 3GZ2A 3L16A 4I9CA 4RQIA 2X6HA 4O1OA 3GYZA 5KCMA 4FJYA 4HI9A 3D9JA 4N5QA 2PNNA 4HOUA 2XQ0A 3OAWA 4B8AA 4CRWA 3LKUA 2NC9A 3DPYA 1XNFA 4ANVA 1N4PA 3VLFA 2DYRE 3UT4A 3ZXSA 4U0SA 1U3CA 3TAXA 4LNGA 1MQSA 2GRMA 4JZYA 3UI2A 1INZA 3L6AA 5AJLA 3I3NA 4HRMB 4PUCA 3L13A 4O60A 4GZ6A 1Z5SC 3UM1A 4KXKB 5EYPF 4ANXA 3LVQE 2VGYA 2WXQA 3FUJA 3G2UA 3Q9UC 4TXPA 1HU3A 4C9BB 1JCRA 2VYIA 4XKCA 3IV0A 3MKQA 4TUUA 2XCCA 3CHPA 2KC7A 2WXKA 3LJNA 2LSUA 4CT4A 4DPRA 3JYSA 4AY5A 2JLBA 3U66A 3TWXA 3UIPC 1K8KG 1E90A 4HNAD 2XS8A 4HOTA 1UW4B 1OCRE 4M3OA 2V5FA 1N4RA 3OTNA 4BTAA 2WXOA 5BV0A 4ABNA 5T3RA 3CVPA 1H2UA 2H6IA 1H6KA 1WM5A 5B3SE 3JXIA 5FQ8A 4GA0A 1ZB1A 4A55A 3BG1B 2CG3A 3L82A 2R5SA 5LCWC 2FEZA 2AJAA 3ASOE 3ZUVB 1SZAA 2I9CA 4ANUA 2WXMA 2P2CP 1BD8A 3E4BA 3OXGA 3U3WA 3AU4A 4JD2G 4C48B 4FJZA 3UTMA 3DSTA 4BEPA 3ZKJA 4DUIA 2XRYA 2AVPA 1XGWA 3O48A 3Q79A 3L08A 3FEYA 4FU3A 3QWPA 3IBEA 4O1PA 1UN9A 1TN8A 3T5VA 3JCKC 4BT9A 4WUYA 1DCQA 2P9NG 2F0YA 2XS1A 4FHJA 5KNGA 5EDSA 1MX2A 4DI4A 2NYJA 3JUEA 2VGXB 1FT1A 2KCKA 3IEGA 4QQIA 1G3NB 1TNOA 4H7XA 4RLYA 1JCQA 3TWWA 3ULYA 5C1DA 2WXPA 4XKBA 5JHAA 1OWNA 3CVVA 2R02A 5EN5D 5LCWJ 4LNUD 1JWFA 2WQ6A 2KZTA 2A5UA 3ZIMA 2VQ2A 3D9NA 3L54A 1E8WA 3ASFA 4Y6WA 3FTSA 1N54A 4DK5A 2DZOA 4OAVB 4GZCA 5EYLA 5CERB 4CDNA 4LG6A 3FU6A 4GCNA 2HYZA 4G8LA 3AU5A 2UWJG 3Q47B 4ACKA 1FT2A 4JPSA 2JABA 1HG2A 2AXUA 4I1MA 3PZ4A 1L5JA 5AQBA 2V4LA 3NZUA 5D2MC 4GYYA 1PY1A 3CEQA 1RW2A 4U8HA 2ZGDA 3NOCD 1NL4A 4CGVA 2XCBA 3Q7FA 2X6JA 2LXMA 3WG7E 4W9RA 2MOWA 2L0TB 4NQ0A 1EYHA 1K3ZD 3CKCA 3AAAC 4GU5A 4KBQA 5FQ4A 2LAIA 3FUFA 5BUZA 2IONA 3C5RA 3Q78A 4EZKA 2CHWA 3PUJA 2BUGA 1KPSB 4DX5D 3HVEA 3UPVA 1HXIA 3APDA 3CR3A 1LD7A 4F7AA 5FZQA 3D9LA 3QDNA 3CVWA 2RD0A 5E75A 1SA5A 3HDXA 5ENRD 2FO7A 4CDMA 1WG0A 3GW4A 3CSFA 1U2VG 1HO8A 4FULA 2DIWA 1N11A 4G8KA 4KZCA 4U95D 2V5QC 4JEUA 4G2VA 3PEUB 4L23A 5H7PA 3X2QE 1QNFA 4HLLA 3AS4A 3SBTB 1E96B 1OXJA 4TV3A 2XPYA 5KNHD 4NURA 3TWTA 1UJJA 3J5PA 2C0LA 2KCVA 3W9GA 3UT7A 1IQRA 1BLXB 3SY2A 2HM8A 4XZ4A 4KYOB 3LCAA 4F3VA 3QOUA 1DCEA 3KD7A 4YVQC 2P9PG 4AXHA 3OXLA 3CHRA 2GRRB 2WXRA 3KS2A 1HFAA 3DXKG 3AG3E 3D9HA 2WXNA 4EZJA 5AN8A 3PREA 4JVSA 5EKQD 4Q94A 1V54E 2X6IA 4WAFA 2LO6A 3JQ0A 3VTXA 5FT9A 2I6HA 4G11A 4TRQA 3DRAA 4BSXA 5D0OD 3P1UA 2V8SE 3UKUG 1H2TC 3UMVA 4HLEA 3HXCA 4WWOA 1JWGA 1AP7A 1NP7A 1UG3A 5AJDA 3LDZA 3B7TA 3FUEA 2GRPB 3IKOB 1KZPA 3RAUA 1O1TA 3R9MA 3ZYKA 1WDYA 3DSUA 4FLBA 3SD5A 4A1GA 4F53A 2PM6A 4YNDA 5KJLA 1O1RA 3HRAA 4PS3A 2WVIA 5BPPA 5BNWA 5AIJA 3UQ3A 1OWPA 1SW6A 3LYAA 2WM9A 3FH7A 3TWRA 4L2LA 4KT6B 4U96D 3C98A 4K5AB 2ETCA 2KZTB 1SQMA 2F8XK 2QYUA 2RFMA 3QKYA 4GMJA 3D9IA 3S7BA 3EHRA 4MLPA 4J7WA 2OVBA 3E32A 3VLDA 4UUCA 4LRZA 3FWVA 5HKPA 2WB2A 3GZSA 4FLHA 4GYWA 3N71A 3ESKA 1BI7B 2DCPA 3DPDA 3Q75A 3ZYQA 3ZN3A 1ZU2A 4DX2A 1MX4A 2MRIA 4X8QA 2IY0C 4BTBA 3FUNA 4UWHA 5DIZA 3RRMB 3PE3A 2LNIA 3V79K 3FU5A 3CKBA 4LUNU 5JHBA 5J90A 3KAEA 4K03A 1IQUA 1PC2A 5ARFA 3DSXA 2R05A 3IHVA 4P29A 3CHQA 3CGHA 2ZISA 1A17A 4MS6A 2Y4UA 1H19A 2Y4TA 4ACLA 3V31A 3PVLA 2IJGX 1D8DA 3R7QA 4BESA 1N95A 2IQCA 4UQZA 3KSQA 2BKKB 2AWIA 5CRVA 4HRNA 4Q69A 2KXPC 5LX8A 5FIOA 5BXOA 4YDEA 2DYSE 3FH8A 5JA4D 3I4RB 4G23A 4GYOA 3T8MA 3MKQB 3LVRE 1IHGA 1ELWA 1TN6A 1N4QA 2JEKA 3ASDA 1TNBA 4I17A 4K5CA 3RSEG 4I6EA 3E30A 3O4ZA 2XZTG 2QC9A 4ATGA 4XX5A 4OYSA 2IO3C 1TN7A 4J8SA 1KT0A 5LOZA 2PQNA 1MZCA 4ANWA 1N52A 4UI9C 3T8KA 1H2VC 3SGHA 3B7BA 3PZ2A 4BSZB 2VSOE 4AM9A 5ANLA 5CBOA 3UINC 4NACA 5B1AE 3W9FA 5G55A 3V30A 1NZNA 2WPVA 1WAO1 1B89A 3HVEB 1LTXA 3FHEA 4JW1A 3FU3A 1N94A 1E8YA 3HIZA 2Y69E 3MKRA 3E37A 2NXPA 4WNDA 4OVVA 3QK0A 5AQAA 1S0PA 2VSXE 4OVUA 4XE0A 4URKA 3SNXA 1SA4A 2RG8A 3Q73A 1OY3D 3RJVA 1N0RA 3PS6A 4UWGA 3U4TA 2FULA 4L7TA 3G2TA 4EPZA 3QAQA 3IXEA 3MEKA 3EHMA 4G1TA 2J4BA 5IY5E 2BTDA 2MHKA 1GW6A 4B0ZA 3RRUA 3HG0D 2EILE 4I1AA 3KEAA 5CRUA 4J8FA 3MA5A 2WXFA 4GA1A 1IYGA 2VGXA 2FF4A 3B95A 4I43A 1QZ2A 3FTXA 1UJKA 2XGSA 3AG1E 5EX3A 4K0RA 3DEPA 4APFA 4DJAA 2YINA 3SFZA 4NIKA 3T9KA 4IN3B 2IU1A 4J8DA 4UWLA 4HBDA 2ZIRA 4KMOA 4WNGA 3TWUA 1IXVA 4GMLA 3FUDA 1YYHA 4KZ0A 4A3VA 3LPZA 5ENSD 5G04J 4PH4B 2BF0X 1O5MA 4L2YA 4JHJA 3BU8A 2P9LG 3EDTB 5CEAA 1JUQA 4WWPA 2P9IG 2AW6A 2E2EA 3UX4A 4K5BA 2VSNA 2L6BA 4WNEA 2YHCA 2I1JA 1AWCB 4JA9A 4HB5A 4JL0A 2DZNA 1JCSA 4LSZE 5ENNA 1FPPA 2HR2A 2XEEA 3U64A 5FWQA 2XGOA 4U8VD 4YDOA 2IF4A 1X81A 3ONKA 2OEVA 4GZ5A 3SI5A 4U8YD 2YHEA 4C0EA 4H7YA 2QYJA 5JJTA 3I5PA 4AJWA 1KZOA 1IKND 1O1SA 3OXFA 3LXUX 3APFA 3HXDA 2IOLA 3URZA 1ZBPA 1H6PA 3DSWA 4CEMA 1D9SA 3D9PA 3CVLA 2UY1A 3DBSA 5B1BE 2CG2A 5EILA 4Y6CA 3WXXA 3KSLA 3PEVB 4LERA 4JA7A 3CHMA 1TJCA 2X6FA 2GRLA 2LSVA 2OOEA 1TNUA 4E85A 4QFVA 5KBAA 4RG9A 3ZVVA 3SBSA 4B8CB 3NAWA 2YQ8A 4CT0A 3QB2A 4HFGA 4KVMA 4EBAA 4F6RD 4JHKA 4HQDA 4N2QA 2DWZA 3ULEG 5AQ9A 3BQOA 3HXBA 4UWFA 1TNYA 3AJIA 2CFUA 5E76A 1YMPA 3TWVA 3FUMA 2CFZA 2WXLA 4GZ3A 2F8YA 4GPKA 3EIJA 4HORA 4V3IA 1TNZA 3G2SA 3V2XA 4EHMA 4N39A 4B89A 2Q7FA 2E0IA 1E7UA 2PZIA 1ELRA 2HO1A 4A1SA 1MX6A 3BEEA 4GB9A 3S7DA 4U0ZA 4LEUA 4G25A 5BV1A 3Q4AB 4F1SA 2IO2C 2I2OA 3FP3A 3FDHA 4XEIG 2IOSA 4GTQA 3B7SA 4DLOA 2VGEA 5D0QD 3QNKA 5ENTD 1HF8A 3KEZA 2VTBB 1HX8A 5ARGA 3DSSA 4N3BA 3FU0A 3Q9NC 3ZNGA 5M72A 2WMOA 5ENOD 4UI9J 1TR4A 2Y1LE 4CYMD 3AS8A 3ZPJA 5ENQD 5G04C 3ZFWA 3EU5A 4DI3A 4MBGA 4UI9K 4F1PA 3TWSA 1OCOE 2X38A 4U04A 4JHRA 4BFRA 3EIQC 4D10C 3ONLA 2P58C 4PS7A 1Y6IA 2P9SG 3CLJA 5G2NA 3DSVA 2Y3AA 1YA0A 3ENEA 4DRXE 3Q5MA 4AY6A 3RO3A 1FVHA 4XIFA 4J0UA 5FTPA 2B0OE 2LAHA 2EIME 3ZYMA 2L9BA 3UM2A 5HQ8A 3LY9A 3D9OA 4GTPA 3DXMG 1EPUA 5CMWA 1S70B 2P9UG 3R7RA 4NRHB 3IHYA 5CMYA 4TUMA 3FTWA 4GTVA 4DX7D 4RG6A 4CZ2D 4GTOA 2ETBA 2DBAA 1IHBA 4U63A 1OWOA 5A6CA 3UUXA 3K9IA 4FP7A 3JUIA 4HI8A 3CV0A 3B13A 4J6IA 1TYQG 5EIBE 3G2VA 4FHKA 3HXEA 4PDXA 5CECB 2X3MA 3Q15A 3MV3B 2AXVA 4RVBA 2KCLA 3S7FA 4FC8A 1Z3YA 5JMND 4E6HA 4IULA 4ZFHA 3FH5A 3ABME 4L9PA 3SZ7A 3PDNA 3MJWA 3LJ3A 3RKVA 2Y0BG 2CHXA 5AENA 3L22A 2R17C 2P9KG 4IRUA 2GW1A 4OAUC 3LS8A 1BU9A 2XPZA 2VJ8A 4I6GA 1U3DA 3TG5A 3MX3A 3C3QA 2L0IA 3HXFA 2GGFA 3C3RA 2EQXA 2XEVA 3CVNA 1WY6A 5C2YA 3UT8A 3BUAA 1HE8A 1N9AA 3PZDA 1E8ZA 2IFUA 3E34A 3UKRG 3QWWA 4Q96A 4APOA 2H6FA 2XRZA 3ML8A 2R2LA 3LEWA 1NA0A 3ULQA 5J08A 3CIAA 4C0MA 4U0UA 5AAOA 3U9WA 4EQFA 4U7EB 3FUIA 2WMNA 3PNTB 5KJNA 2H6HA 4ILHB 3EUVA 5KWDA 1JPLA 1QQEA 2AXZA 3T5XA 2V0PA 5LP0A 1MJ0A 3UM3A 4CDRA 4LNBA 2IEJA 3FTVA 5CCMA 4HXIA 3B7UX 1YCSB 3D9KA 4B94A 2WXHA 4G26A 2M63A 4EBAG 2F37A 5D66A 3NF1A 5AARA 5FQ6A 1Q2ZA 5BXUA 3ZHEB 1HG5A 2YNQA 2V4HC 4ATZD 4MKTA 2ZGGA 2UY1B 3ABLE 2J9QA 3RRNB 4HVBA 1KLXA 4RSYA 4EECA 2ZU6B 3VLEA 2VTBA 3MGBA 3CVQA 3SF4A 2OCCE 5FJYA 4JC8A 4LCTA 4MRUA 1A5EA 3CHOA 4IYPA 4N3CA 3L17A 4AVXA 4GTTA 4G24A 5CBNA 3VTYA 3PRZA 4L1BA 3E33A 1NA3A 3ASGA 4GCOA 5JJ7A 4I6JA 4GTSA 2QY7A 1ELKA 1BPOA 3EU9A 3S2AA 4GTRA 2FO1E 1LF8A 1V55E 1E7VA 2ZXWE 2A4ZA 2J07A 1E8XA 1H6OA 1P5QA 5CCLA 4UWKA 3LY7A 2XENA 1H0AA 3TL5A 4DLQA 5T8IA 1OT8A 4J8EA 5KJMA 5T4YA 2I1KA 2WQ7A 1SVXA 1TJFA 3PH0C 2WXGA 3MCXA 3ZRHA 3ZU7B 3Q7AA 2J08A 3S7JA 3TJPA 1QYMA 3B7RL 4GZDA 3FULA 1X5BA 5A23A 1MHQA 4DX1A 1HH8A 4CCAA 3TWQA 2GRQB 3L9TA 3MV2B 5DBKA 5KJKA 1HZ4A 3HHMA 4I2ZA 1FVFA 3RU0A 2WQHA 2EIJE 4HS2A 4A63B 2OV8A 2QZAA 5EX0A 2PL2A 3CK8A 1EF1C 3CSTA 1DC2A 3TG4A 4WWNA 1D8EA 1S63A 2J4DA 3PE4A 1EDUA 3J5QB 2XZDG
chains in the Genus database with same CATH topology
2CG3A 3CK7A 4DLOA 2R5SA 5D0QD 3QNKA 5LCWC 2FEZA 2KATA 3D9MA 3IHVA 1SZAA 2I9CA 4AIFA 4P29A 3CHQA 3CGHA 2XPIA 4ANUA 2WXMA 1A17A 1HF8A 3E4BA 3KEZA 3AS5A 3OXGA 4MS6A 3U3WA 2VTBB 1HX8A 5ARGA 4N3BA 3TGOA 3FU0A 2Y4UA 2R59A 3AU4A 1H19A 2Y4TA 5M72A 3ZW3A 2WMOA 4ACLA 4WNFA 3APCA 1TEZA 2VSYA 4FJZA 3PNLB 3PVLA 4UI9J 2IJGX 3R7QA 4UQZA 2IQCA 2XRYA 3AS8A 2AVPA 1XGWA 4XI0A 3ZPJA 3O48A 3L08A 2AWIA 3FEYA 4FU3A 5G04C 3ML9A 3ZFWA 2J09A 4DI3A 4UI9K 3QARA 3SHFA 3ESLA 4JEHA 3QWPA 2FI7A 2CHZA 5G05C 4Q69A 4N2SA 3IBEA 2X38A 1UN9A 4U04A 3I4GA 4JHRA 5LX8A 4BFRA 2L6JA 3FTUA 3T5VA 3EIQC 4D10C 3JCKC 4XI9A 4BT9A 4WUYA 3ONLA 2P58C 1Y8MA 4PS7A 4BWRA 3CHSA 4FHJA 1Y6IA 1DNPA 5EDSA 3CLJA 4DI4A 5G2NA 2Y3AA 3FH8A 1YA0A 3I4RB 3ENEA 4G23A 4GYOA 2VGXB 3Q5MA 3T8MA 4AY6A 3MKQB 3LVRE 1FVHA 2KCKA 3RO3A 3IEGA 1IHGA 3NZSA 3QJZA 4J0UA 4XIFA 5FTPA 5BT1A 2LAHA 1ELWA 3GZ1A 4BT8A 3ZYMA 2L9BA 1DVPA 2JEKA 3ASDA 3RIBA 5HQ8A 3QC1A 3LY9A 4H7XA 1FCHA 5C1DA 4I17A 3D9OA 4I6EA 2WXPA 4XKBA 5JHAA 1OWNA 3O4ZA 3CVVA 3NQPA 4BX9A 3TXNA 5LCWJ 4ATGA 3MYVA 4CGWA 5ANRA 1JWFA 4XX5A 1EPUA 4OYSA 2WQ6A 3LY8A 2KZTA 2A5UA 3CK9A 5CMWA 3R7RA 4HOSA 4NRHB 3IHYA 5CMYA 3ZIMA 4J8SA 1KT0A 2VQ2A 3FTWA 4RG6A 5LOZA 2PQNA 3D9NA 4GAAA 3L54A 1E8WA 1W3BA 3EHNA 3ASFA 4Y6WA 4ANWA 3FTSA 1N52A 2DBAA 4U63A 1N54A 4UI9C 1OWOA 1PAQA 3UUXA 4DK5A 5A6CA 4GA2A 1H2VC 3FY4A 3SGHA 3ZGQA 3FUHA 3K9IA 4GZCA 3FTZA 4R7LA 2VSOE 4AM9A 4FP7A 5ANLA 3JUIA 1OWMA 4CDNA 3CV0A 5AYWD 3B13A 4NACA 4J6IA 3FU6A 2OVFA 3FTYA 2HYZA 3Q49B 3G2VA 4FHKA 4GCNA 3AU5A 2UWJG 3Q47B 5G55A 4ACKA 1NZNA 4PDXA 4UQXA 4JPSA 3D3MA 1HG2A 2WPVA 2X3MA 1WAO1 2AXUA 2C2LA 4I1MA 1B89A 1L5JA 3HVEB 3FHEA 3Q15A 4JW1A 4AP2A 3MV3B 2AXVA 4RVBA 2KCLA 4U07A 3S7FA 3FU3A 2V4LA 4FC8A 1Z3YA 3JQ1A 3CVXA 1E8YA 3HIZA 3NZUA 3MKRA 2KM4A 4GYYA 1PY1A 4E6HA 1UN8A 2NXPA 3CEQA 4OVVA 4WNDA 3QK0A 4IULA 5FZSA 1S0PA 3TXMA 2VSXE 4OVUA 4U8HA 4XE0A 4URKA 3FH5A 3SNXA 3CQGB 2RG8A 4JXTA 3RJVA 3SZ7A 3PS6A 3PDNA 4UWGA 3U4TA 4CGVA 3MJWA 2XCBA 4BX8A 2X6JA 2WXJA 3LJ3A 2FULA 4L7TA 3RKVA 3G2TA 4EPZA 1Z3XA 4W9RA 2CHXA 5AENA 4A3TA 2MOWA 3L22A 3ZEFA 2L0TB 4NQ0A 1EYHA 2R17C 3CKCA 1HS6A 4IRUA 3QAQA 2GW1A 4GU5A 3MEKA 3LS8A 3EHMA 4G1TA 4KBQA 2J4BA 2LAIA 3FUFA 5FQ4A 2XPZA 2VJ8A 5BUZA 2BTDA 3FEXA 2MHKA 4I6GA 4N3AA 1GW6A 2IONA 4B0ZA 4I2WA 5A7DB 1U3DA 3TG5A 3RRUA 4EZKA 3MX3A 2L0IA 2CHWA 4AOFA 3PUJA 4I1AA 2GGFA 2BUGA 4J8FA 3MA5A 2WXFA 2QFCA 3CQCB 4FADA 3HVEA 4GA1A 2EQXA 2WXIA 2VGXA 3ASHA 2XEVA 5FQ7A 3UPVA 1Z6TA 2PQRA 1IYGA 3CVNA 1HXIA 1WY6A 3CVYA 3APDA 3CR3A 5C2YA 4F7AA 4I1OB 2FF4A 3UT8A 4EZLA 3G2WA 5FZQA 4N5CA 4FA6A 3D9LA 3QDNA 1HE8A 4I43A 1QZ2A 3CVWA 2RD0A 3PZDA 5E75A 3FTXA 1E8ZA 1UJKA 2IFUA 2XGSA 5CHEE 5LFAA 3HDXA 4I9EA 5EX3A 1SZ9A 3QWWA 4K0RA 3QWVA 4Q96A 4APOA 4APFA 2FO7A 2ONDA 3BG0B 3RO2A 4DJAA 3CVUA 4CDMA 2XRZA 2YINA 3ML8A 3SFZA 1OWLA 3GW4A 4IN3B 4PS8A 2IU1A 4J8DA 3CSFA 3LEWA 4UQYA 1HO8A 2FBNA 1KT1A 1NA0A 4UWLA 4FULA 3ULQA 4KMOA 5J08A 3CIAA 4ILGA 4WNGA 2DIWA 2XGMA 4GMLA 3FUDA 4C0MA 4KZCA 4U0UA 4KZ0A 3LPZA 3U9WA 3FFLA 4A3VA 3ZHEA 4EQFA 5G04J 3FUIA 2WMNA 3MZLB 4PH4B 2BF0X 4JEUA 3PNTB 5KJNA 4ILHB 4G2VA 4ILIA 4L2YA 3PEUB 4JHJA 3HYMB 4L23A 2XHEA 1JPLA 1QNFA 3EDTB 1OUVA 1QQEA 2AXZA 1JUQA 4WWPA 5BW8C 4ME2A 3T5XA 4AV7A 3AS4A 2V0PA 3SBTB 1E96B 4TV3A 5LP0A 2XPYA 4HOQA 4NURA 2NSZA 4CDRA 2AW6A 1UJJA 2E2EA 3UX4A 4BY6A 1VDYA 2C0LA 2KCVA 3FTVA 3R9AB 2VSNA 3P2BA 5CCMA 3UT7A 2X6KA 4HXIA 2YHCA 4WNEA 3B7UX 1IQRA 4YVOA 5HI7A 2I1JA 2PM7A 3ZYLA 2HM8A 3D9KA 3FUKA 4XZ4A 4B94A 2WXHA 4G26A 5G05J 4JA9A 2M63A 4EBAG 4O6FA 3NF1A 4KYOB 2ILRA 4JL0A 3LCAA 4F3VA 5JJ6A 3QOUA 5FQ6A 4KVOA 3KD7A 2J49A 3ZHEB 4YVQC 3RK6A 5FZRA 4AEZC 2C0MA 1HG5A 3EJNA 3PUKA 4AXHA 5ENNA 3OXLA 2YNQA 3CHRA 2HR2A 3GZ2A 2WXRA 3KS2A 3L16A 1HFAA 4I9CA 2X6HA 3U64A 4MKTA 5FWQA 2XGOA 3GYZA 2WXNA 5KCMA 4FJYA 2UY1B 4EZJA 2IF4A 3PREA 3ONKA 3D9JA 4JVSA 2J9QA 4GZ5A 3SI5A 3RRNB 4HVBA 1KLXA 5EKQD 4RSYA 4Q94A 2YHEA 4C0EA 4H7YA 4HOUA 2X6IA 2XQ0A 4WAFA 2LO6A 3OAWA 4EECA 2ZU6B 3JQ0A 3VTXA 5FT9A 2I6HA 3VLEA 5JJTA 2VTBA 3MGBA 4G11A 4TRQA 3CVQA 3SF4A 3I5PA 4B8AA 4AJWA 4CRWA 5FJYA 3OXFA 4JC8A 4BSXA 4LCTA 4MRUA 3LKUA 2NC9A 3CHOA 3LXUX 4IYPA 4N3CA 5D0OD 3L17A 3P1UA 4AVXA 2V8SE 4G24A 3VTYA 3PRZA 3APFA 1H2TC 4L1BA 3UMVA 4HLEA 1NA3A 3ASGA 2IOLA 1XNFA 3URZA 1ZBPA 4CEMA 4GCOA 3D9PA 4WWOA 4I6JA 4ANVA 5JJ7A 1JWGA 1NP7A 2QY7A 1ELKA 3VLFA 1UG3A 3CVLA 3UT4A 2UY1A 3ZXSA 1BPOA 3DBSA 5AJDA 2CG2A 4U0SA 1U3CA 3LDZA 4Y6CA 3S2AA 3B7TA 1LF8A 3TAXA 1E7VA 3FUEA 3IKOB 3WXXA 3PEVB 2A4ZA 3ZYKA 4LERA 1MQSA 2GRMA 3CHMA 1TJCA 4JA7A 4JZYA 2X6FA 1INZA 2J07A 1E8XA 3L6AA 2GRLA 1P5QA 5AJLA 4FLBA 2LSVA 5CCLA 3SD5A 3I3NA 2OOEA 4PUCA 4UWKA 4A1GA 3L13A 3LY7A 4E85A 4F53A 2PM6A 4YNDA 5KJLA 4QFVA 1H0AA 4GZ6A 4RG9A 4PS3A 3TL5A 3ZVVA 5T8IA 3SBSA 4B8CB 4DLQA 2WVIA 5BPPA 2YQ8A 5BNWA 2IOSA 4J8EA 4CT0A 5AIJA 4KXKB 5KJMA 3QB2A 5T4YA 3UQ3A 4HFGA 1OWPA 2I1KA 4KVMA 4ANXA 4EBAA 3LYAA 2WM9A 2WQ7A 3FH7A 1TJFA 4JHKA 4L2LA 4KT6B 4N2QA 3PH0C 3C98A 2WXGA 3LVQE 3MCXA 2VGYA 3ZRHA 2WXQA 2J08A 3FUJA 3G2UA 2KZTB 4UWFA 3S7JA 1SQMA 3TJPA 2CFUA 1HU3A 3D9IA 3QKYA 4GMJA 3B7RL 5E76A 4C9BB 3S7BA 2VYIA 4GZDA 3FULA 4XKCA 3IV0A 3FUMA 1X5BA 3MKQA 2CFZA 2XCCA 4TUUA 2WXLA 5A23A 1MHQA 4MLPA 2OVBA 3CHPA 2KC7A 2WXKA 4GZ3A 2LSUA 1HH8A 4GPKA 4CCAA 3VLDA 3EIJA 4CT4A 4LRZA 4DPRA 3JYSA 4HORA 4V3IA 4AY5A 3FWVA 2JLBA 3U66A 3MV2B 3G2SA 5DBKA 5KJKA 2WB2A 3GZSA 4FLHA 4GYWA 1HZ4A 3N71A 4N39A 4B89A 2Q7FA 3ESKA 3HHMA 2DCPA 4I2ZA 2E0IA 3DPDA 1FVFA 1E90A 3ZYQA 3RU0A 3ZN3A 2WQHA 1ZU2A 4HS2A 1E7UA 2PZIA 4HOTA 2MRIA 1ELRA 2HO1A 1UW4B 2OV8A 4BTBA 4A1SA 4M3OA 2V5FA 5EX0A 3FUNA 3OTNA 4UWHA 2PL2A 4BTAA 2WXOA 3BEEA 5BV0A 3CK8A 4ABNA 4GB9A 5T3RA 3CVPA 3S7DA 1EF1C 1H2UA 3CSTA 5DIZA 4U0ZA 3RRMB 4LEUA 3PE3A 2LNIA 3TG4A 4WWNA 4G25A 1H6KA 3FU5A 5BV1A 3Q4AB 3CKBA 1WM5A 4LUNU 4F1SA 2I2OA 2J4DA 5FQ8A 3FP3A 3PE4A 1EDUA 3FDHA 5JHBA 5J90A 4GA0A 4A55A 3KAEA 4K03A 1IQUA 3BG1B 3B7SA 1PC2A 5ARFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B8C B;  1H2V C;  4B8A A;  5ANR A;  3FEX A;  4IUL A;  3FEY A;  2VSO E;  2VSX E;  4CRW A;  2ION A;  3JUI A;  1UW4 B;  2KZT A;  2HM8 A;  2RG8 A;  4JHK A;  2GGF A;  4JHJ A;  3EIJ A;  4CT4 A;  1H2U A;  3L6A A;  1H2T C;  1H6K A;  3EIQ C;  4LUN U;  2FUL A;  2IU1 A;  2IOL A;  2I2O A;  3D3M A;  2KZT B;  2ZU6 B;  1N52 A;  4CEM A;  4B89 A;  4GMJ A;  1HU3 A;  1N54 A;  3RK6 A;  2IOS A;  1PAQ A;  4GML A;  4C9B B;  2NSZ A;  1UG3 A; 
#chains in the Genus database with same CATH topology
 3CK7 A;  2KAT A;  3D9M A;  4AIF A;  2XPI A;  5ITZ F;  3AS5 A;  3TGO A;  2R59 A;  3ZW3 A;  5CED B;  2B6C A;  4WNF A;  3APC A;  1TEZ A;  2VSY A;  3PNL B;  3SFX A;  2BED A;  4XI0 A;  2MYO A;  2GRN B;  3ML9 A;  2J09 A;  3QAR A;  3SHF A;  3ESL A;  4JEH A;  2FI7 A;  3SO8 A;  2CHZ A;  5G05 C;  4N2S A;  3I4G A;  2L6J A;  3FTU A;  1MYO A;  3ZXP A;  1UOH A;  4XI9 A;  4HRL A;  1Y8M A;  1QBQ A;  4YDY A;  4BWR A;  3CHS A;  4JB8 P;  1DNP A;  3NBN B;  2RKK A;  3NZS A;  3QJZ A;  5BT1 A;  3GZ1 A;  3SFY A;  4BT8 A;  1DVP A;  4M7C A;  3SQV A;  3RIB A;  3QC1 A;  1FCH A;  3NQP A;  4BX9 A;  3TXN A;  1BI8 B;  3MYV A;  4CGW A;  5ANR A;  3C72 A;  3LY8 A;  3CK9 A;  1OCC E;  4HOS A;  2EIK E;  4GAA A;  5ENP D;  1W3B A;  3EHN A;  3JXJ A;  1PAQ A;  4BET A;  3ISM C;  2GRO B;  3FY4 A;  4GA2 A;  3ZGQ A;  3FUH A;  2H6G A;  3FTZ A;  3NB2 A;  4R7L A;  3PZ3 A;  1OWM A;  5AYW D;  1NI1 A;  2OVF A;  3FTY A;  3Q49 B;  4UQX A;  3UM0 A;  3D3M A;  2C2L A;  4AP2 A;  4U07 A;  3JQ1 A;  5HS0 A;  3CVX A;  1N4S A;  3UIO C;  2KM4 A;  5FIN A;  1UN8 A;  3AG4 E;  5FZS A;  3TXM A;  3DEO A;  3CQG B;  4JXT A;  3C3O A;  3AG2 E;  4BX8 A;  2WXJ A;  1K1A A;  1Z3X A;  4A3T A;  3ZEF A;  3NOG D;  4YDW A;  1HS6 A;  2A5E A;  4DX6 D;  2J8S D;  2BKG A;  3FEX A;  2LXL A;  4N3A A;  1NFI E;  4I2W A;  5A7D B;  4AOF A;  3DWL G;  4B93 B;  2DVW A;  4FAD A;  2QFC A;  3CQC B;  2WXI A;  3ASH A;  5FQ7 A;  1N0Q A;  1Z6T A;  2PQR A;  3V2O A;  3CVY A;  4I1O B;  4EZL A;  4BER A;  2HE0 A;  3G2W A;  4N5C A;  4FA6 A;  3UXG A;  5CHE E;  5LFA A;  1OCZ E;  4I9E A;  1SZ9 A;  4GPM A;  3QWV A;  2OND A;  3BG0 B;  3RO2 A;  4GMR A;  4GTM A;  5HRY A;  3CVU A;  1OWL A;  4PS8 A;  3ABK E;  4UQY A;  2FBN A;  1KT1 A;  4J8Y A;  4ILG A;  2XGM A;  4ZHB A;  2R03 A;  4Z68 A;  3PZ1 A;  3EHQ A;  4TXR A;  1S64 A;  3FFL A;  3ZHE A;  3MZL B;  2KBX A;  4ILI A;  3HYM B;  2XHE A;  1OUV A;  2OEW A;  5BW8 C;  4ME2 A;  4AV7 A;  1LD8 A;  4HOQ A;  2NSZ A;  4BY6 A;  1VDY A;  3R9A B;  1K1B A;  3P2B A;  3ASN E;  2X6K A;  4YVO A;  5HI7 A;  5AQ7 A;  2PM7 A;  3ZYL A;  4TXQ A;  3FUK A;  5G05 J;  4O6F A;  2ILR A;  5EID A;  2XEH A;  5JJ6 A;  2ETA A;  4KVO A;  3F6Q A;  2RFA A;  2J49 A;  2EIN E;  3RK6 A;  5FZR A;  4AEZ C;  2LUH A;  2C0M A;  3PUK A;  3EJN A;  1RZ4 A;  3GZ2 A;  3L16 A;  4I9C A;  4RQI A;  2X6H A;  4O1O A;  3GYZ A;  5KCM A;  4FJY A;  4HI9 A;  3D9J A;  4N5Q A;  2PNN A;  4HOU A;  2XQ0 A;  3OAW A;  4B8A A;  4CRW A;  3LKU A;  2NC9 A;  3DPY A;  1XNF A;  4ANV A;  1N4P A;  3VLF A;  2DYR E;  3UT4 A;  3ZXS A;  4U0S A;  1U3C A;  3TAX A;  4LNG A;  1MQS A;  2GRM A;  4JZY A;  3UI2 A;  1INZ A;  3L6A A;  5AJL A;  3I3N A;  4HRM B;  4PUC A;  3L13 A;  4O60 A;  4GZ6 A;  1Z5S C;  3UM1 A;  4KXK B;  5EYP F;  4ANX A;  3LVQ E;  2VGY A;  2WXQ A;  3FUJ A;  3G2U A;  3Q9U C;  4TXP A;  1HU3 A;  4C9B B;  1JCR A;  2VYI A;  4XKC A;  3IV0 A;  3MKQ A;  4TUU A;  2XCC A;  3CHP A;  2KC7 A;  2WXK A;  3LJN A;  2LSU A;  4CT4 A;  4DPR A;  3JYS A;  4AY5 A;  2JLB A;  3U66 A;  3TWX A;  3UIP C;  1K8K G;  1E90 A;  4HNA D;  2XS8 A;  4HOT A;  1UW4 B;  1OCR E;  4M3O A;  2V5F A;  1N4R A;  3OTN A;  4BTA A;  2WXO A;  5BV0 A;  4ABN A;  5T3R A;  3CVP A;  1H2U A;  2H6I A;  1H6K A;  1WM5 A;  5B3S E;  3JXI A;  5FQ8 A;  4GA0 A;  1ZB1 A;  4A55 A;  3BG1 B;  2CG3 A;  3L82 A;  2R5S A;  5LCW C;  2FEZ A;  2AJA A;  3ASO E;  3ZUV B;  1SZA A;  2I9C A;  4ANU A;  2WXM A;  2P2C P;  1BD8 A;  3E4B A;  3OXG A;  3U3W A;  3AU4 A;  4JD2 G;  4C48 B;  4FJZ A;  3UTM A;  3DST A;  4BEP A;  3ZKJ A;  4DUI A;  2XRY A;  2AVP A;  1XGW A;  3O48 A;  3Q79 A;  3L08 A;  3FEY A;  4FU3 A;  3QWP A;  3IBE A;  4O1P A;  1UN9 A;  1TN8 A;  3T5V A;  3JCK C;  4BT9 A;  4WUY A;  1DCQ A;  2P9N G;  2F0Y A;  2XS1 A;  4FHJ A;  5KNG A;  5EDS A;  1MX2 A;  4DI4 A;  2NYJ A;  3JUE A;  2VGX B;  1FT1 A;  2KCK A;  3IEG A;  4QQI A;  1G3N B;  1TNO A;  4H7X A;  4RLY A;  1JCQ A;  3TWW A;  3ULY A;  5C1D A;  2WXP A;  4XKB A;  5JHA A;  1OWN A;  3CVV A;  2R02 A;  5EN5 D;  5LCW J;  4LNU D;  1JWF A;  2WQ6 A;  2KZT A;  2A5U A;  3ZIM A;  2VQ2 A;  3D9N A;  3L54 A;  1E8W A;  3ASF A;  4Y6W A;  3FTS A;  1N54 A;  4DK5 A;  2DZO A;  4OAV B;  4GZC A;  5EYL A;  5CER B;  4CDN A;  4LG6 A;  3FU6 A;  4GCN A;  2HYZ A;  4G8L A;  3AU5 A;  2UWJ G;  3Q47 B;  4ACK A;  1FT2 A;  4JPS A;  2JAB A;  1HG2 A;  2AXU A;  4I1M A;  3PZ4 A;  1L5J A;  5AQB A;  2V4L A;  3NZU A;  5D2M C;  4GYY A;  1PY1 A;  3CEQ A;  1RW2 A;  4U8H A;  2ZGD A;  3NOC D;  1NL4 A;  4CGV A;  2XCB A;  3Q7F A;  2X6J A;  2LXM A;  3WG7 E;  4W9R A;  2MOW A;  2L0T B;  4NQ0 A;  1EYH A;  1K3Z D;  3CKC A;  3AAA C;  4GU5 A;  4KBQ A;  5FQ4 A;  2LAI A;  3FUF A;  5BUZ A;  2ION A;  3C5R A;  3Q78 A;  4EZK A;  2CHW A;  3PUJ A;  2BUG A;  1KPS B;  4DX5 D;  3HVE A;  3UPV A;  1HXI A;  3APD A;  3CR3 A;  1LD7 A;  4F7A A;  5FZQ A;  3D9L A;  3QDN A;  3CVW A;  2RD0 A;  5E75 A;  1SA5 A;  3HDX A;  5ENR D;  2FO7 A;  4CDM A;  1WG0 A;  3GW4 A;  3CSF A;  1U2V G;  1HO8 A;  4FUL A;  2DIW A;  1N11 A;  4G8K A;  4KZC A;  4U95 D;  2V5Q C;  4JEU A;  4G2V A;  3PEU B;  4L23 A;  5H7P A;  3X2Q E;  1QNF A;  4HLL A;  3AS4 A;  3SBT B;  1E96 B;  1OXJ A;  4TV3 A;  2XPY A;  5KNH D;  4NUR A;  3TWT A;  1UJJ A;  3J5P A;  2C0L A;  2KCV A;  3W9G A;  3UT7 A;  1IQR A;  1BLX B;  3SY2 A;  2HM8 A;  4XZ4 A;  4KYO B;  3LCA A;  4F3V A;  3QOU A;  1DCE A;  3KD7 A;  4YVQ C;  2P9P G;  4AXH A;  3OXL A;  3CHR A;  2GRR B;  2WXR A;  3KS2 A;  1HFA A;  3DXK G;  3AG3 E;  3D9H A;  2WXN A;  4EZJ A;  5AN8 A;  3PRE A;  4JVS A;  5EKQ D;  4Q94 A;  1V54 E;  2X6I A;  4WAF A;  2LO6 A;  3JQ0 A;  3VTX A;  5FT9 A;  2I6H A;  4G11 A;  4TRQ A;  3DRA A;  4BSX A;  5D0O D;  3P1U A;  2V8S E;  3UKU G;  1H2T C;  3UMV A;  4HLE A;  3HXC A;  4WWO A;  1JWG A;  1AP7 A;  1NP7 A;  1UG3 A;  5AJD A;  3LDZ A;  3B7T A;  3FUE A;  2GRP B;  3IKO B;  1KZP A;  3RAU A;  1O1T A;  3R9M A;  3ZYK A;  1WDY A;  3DSU A;  4FLB A;  3SD5 A;  4A1G A;  4F53 A;  2PM6 A;  4YND A;  5KJL A;  1O1R A;  3HRA A;  4PS3 A;  2WVI A;  5BPP A;  5BNW A;  5AIJ A;  3UQ3 A;  1OWP A;  1SW6 A;  3LYA A;  2WM9 A;  3FH7 A;  3TWR A;  4L2L A;  4KT6 B;  4U96 D;  3C98 A;  4K5A B;  2ETC A;  2KZT B;  1SQM A;  2F8X K;  2QYU A;  2RFM A;  3QKY A;  4GMJ A;  3D9I A;  3S7B A;  3EHR A;  4MLP A;  4J7W A;  2OVB A;  3E32 A;  3VLD A;  4UUC A;  4LRZ A;  3FWV A;  5HKP A;  2WB2 A;  3GZS A;  4FLH A;  4GYW A;  3N71 A;  3ESK A;  1BI7 B;  2DCP A;  3DPD A;  3Q75 A;  3ZYQ A;  3ZN3 A;  1ZU2 A;  4DX2 A;  1MX4 A;  2MRI A;  4X8Q A;  2IY0 C;  4BTB A;  3FUN A;  4UWH A;  5DIZ A;  3RRM B;  3PE3 A;  2LNI A;  3V79 K;  3FU5 A;  3CKB A;  4LUN U;  5JHB A;  5J90 A;  3KAE A;  4K03 A;  1IQU A;  1PC2 A;  5ARF A;  3DSX A;  2R05 A;  3IHV A;  4P29 A;  3CHQ A;  3CGH A;  2ZIS A;  1A17 A;  4MS6 A;  2Y4U A;  1H19 A;  2Y4T A;  4ACL A;  3V31 A;  3PVL A;  2IJG X;  1D8D A;  3R7Q A;  4BES A;  1N95 A;  2IQC A;  4UQZ A;  3KSQ A;  2BKK B;  2AWI A;  5CRV A;  4HRN A;  4Q69 A;  2KXP C;  5LX8 A;  5FIO A;  5BXO A;  4YDE A;  2DYS E;  3FH8 A;  5JA4 D;  3I4R B;  4G23 A;  4GYO A;  3T8M A;  3MKQ B;  3LVR E;  1IHG A;  1ELW A;  1TN6 A;  1N4Q A;  2JEK A;  3ASD A;  1TNB A;  4I17 A;  4K5C A;  3RSE G;  4I6E A;  3E30 A;  3O4Z A;  2XZT G;  2QC9 A;  4ATG A;  4XX5 A;  4OYS A;  2IO3 C;  1TN7 A;  4J8S A;  1KT0 A;  5LOZ A;  2PQN A;  1MZC A;  4ANW A;  1N52 A;  4UI9 C;  3T8K A;  1H2V C;  3SGH A;  3B7B A;  3PZ2 A;  4BSZ B;  2VSO E;  4AM9 A;  5ANL A;  5CBO A;  3UIN C;  4NAC A;  5B1A E;  3W9F A;  5G55 A;  3V30 A;  1NZN A;  2WPV A;  1WAO 1;  1B89 A;  3HVE B;  1LTX A;  3FHE A;  4JW1 A;  3FU3 A;  1N94 A;  1E8Y A;  3HIZ A;  2Y69 E;  3MKR A;  3E37 A;  2NXP A;  4WND A;  4OVV A;  3QK0 A;  5AQA A;  1S0P A;  2VSX E;  4OVU A;  4XE0 A;  4URK A;  3SNX A;  1SA4 A;  2RG8 A;  3Q73 A;  1OY3 D;  3RJV A;  1N0R A;  3PS6 A;  4UWG A;  3U4T A;  2FUL A;  4L7T A;  3G2T A;  4EPZ A;  3QAQ A;  3IXE A;  3MEK A;  3EHM A;  4G1T A;  2J4B A;  5IY5 E;  2BTD A;  2MHK A;  1GW6 A;  4B0Z A;  3RRU A;  3HG0 D;  2EIL E;  4I1A A;  3KEA A;  5CRU A;  4J8F A;  3MA5 A;  2WXF A;  4GA1 A;  1IYG A;  2VGX A;  2FF4 A;  3B95 A;  4I43 A;  1QZ2 A;  3FTX A;  1UJK A;  2XGS A;  3AG1 E;  5EX3 A;  4K0R A;  3DEP A;  4APF A;  4DJA A;  2YIN A;  3SFZ A;  4NIK A;  3T9K A;  4IN3 B;  2IU1 A;  4J8D A;  4UWL A;  4HBD A;  2ZIR A;  4KMO A;  4WNG A;  3TWU A;  1IXV A;  4GML A;  3FUD A;  1YYH A;  4KZ0 A;  4A3V A;  3LPZ A;  5ENS D;  5G04 J;  4PH4 B;  2BF0 X;  1O5M A;  4L2Y A;  4JHJ A;  3BU8 A;  2P9L G;  3EDT B;  5CEA A;  1JUQ A;  4WWP A;  2P9I G;  2AW6 A;  2E2E A;  3UX4 A;  4K5B A;  2VSN A;  2L6B A;  4WNE A;  2YHC A;  2I1J A;  1AWC B;  4JA9 A;  4HB5 A;  4JL0 A;  2DZN A;  1JCS A;  4LSZ E;  5ENN A;  1FPP A;  2HR2 A;  2XEE A;  3U64 A;  5FWQ A;  2XGO A;  4U8V D;  4YDO A;  2IF4 A;  1X81 A;  3ONK A;  2OEV A;  4GZ5 A;  3SI5 A;  4U8Y D;  2YHE A;  4C0E A;  4H7Y A;  2QYJ A;  5JJT A;  3I5P A;  4AJW A;  1KZO A;  1IKN D;  1O1S A;  3OXF A;  3LXU X;  3APF A;  3HXD A;  2IOL A;  3URZ A;  1ZBP A;  1H6P A;  3DSW A;  4CEM A;  1D9S A;  3D9P A;  3CVL A;  2UY1 A;  3DBS A;  5B1B E;  2CG2 A;  5EIL A;  4Y6C A;  3WXX A;  3KSL A;  3PEV B;  4LER A;  4JA7 A;  3CHM A;  1TJC A;  2X6F A;  2GRL A;  2LSV A;  2OOE A;  1TNU A;  4E85 A;  4QFV A;  5KBA A;  4RG9 A;  3ZVV A;  3SBS A;  4B8C B;  3NAW A;  2YQ8 A;  4CT0 A;  3QB2 A;  4HFG A;  4KVM A;  4EBA A;  4F6R D;  4JHK A;  4HQD A;  4N2Q A;  2DWZ A;  3ULE G;  5AQ9 A;  3BQO A;  3HXB A;  4UWF A;  1TNY A;  3AJI A;  2CFU A;  5E76 A;  1YMP A;  3TWV A;  3FUM A;  2CFZ A;  2WXL A;  4GZ3 A;  2F8Y A;  4GPK A;  3EIJ A;  4HOR A;  4V3I A;  1TNZ A;  3G2S A;  3V2X A;  4EHM A;  4N39 A;  4B89 A;  2Q7F A;  2E0I A;  1E7U A;  2PZI A;  1ELR A;  2HO1 A;  4A1S A;  1MX6 A;  3BEE A;  4GB9 A;  3S7D A;  4U0Z A;  4LEU A;  4G25 A;  5BV1 A;  3Q4A B;  4F1S A;  2IO2 C;  2I2O A;  3FP3 A;  3FDH A;  4XEI G;  2IOS A;  4GTQ A;  3B7S A;  4DLO A;  2VGE A;  5D0Q D;  3QNK A;  5ENT D;  1HF8 A;  3KEZ A;  2VTB B;  1HX8 A;  5ARG A;  3DSS A;  4N3B A;  3FU0 A;  3Q9N C;  3ZNG A;  5M72 A;  2WMO A;  5ENO D;  4UI9 J;  1TR4 A;  2Y1L E;  4CYM D;  3AS8 A;  3ZPJ A;  5ENQ D;  5G04 C;  3ZFW A;  3EU5 A;  4DI3 A;  4MBG A;  4UI9 K;  4F1P A;  3TWS A;  1OCO E;  2X38 A;  4U04 A;  4JHR A;  4BFR A;  3EIQ C;  4D10 C;  3ONL A;  2P58 C;  4PS7 A;  1Y6I A;  2P9S G;  3CLJ A;  5G2N A;  3DSV A;  2Y3A A;  1YA0 A;  3ENE A;  4DRX E;  3Q5M A;  4AY6 A;  3RO3 A;  1FVH A;  4XIF A;  4J0U A;  5FTP A;  2B0O E;  2LAH A;  2EIM E;  3ZYM A;  2L9B A;  3UM2 A;  5HQ8 A;  3LY9 A;  3D9O A;  4GTP A;  3DXM G;  1EPU A;  5CMW A;  1S70 B;  2P9U G;  3R7R A;  4NRH B;  3IHY A;  5CMY A;  4TUM A;  3FTW A;  4GTV A;  4DX7 D;  4RG6 A;  4CZ2 D;  4GTO A;  2ETB A;  2DBA A;  1IHB A;  4U63 A;  1OWO A;  5A6C A;  3UUX A;  3K9I A;  4FP7 A;  3JUI A;  4HI8 A;  3CV0 A;  3B13 A;  4J6I A;  1TYQ G;  5EIB E;  3G2V A;  4FHK A;  3HXE A;  4PDX A;  5CEC B;  2X3M A;  3Q15 A;  3MV3 B;  2AXV A;  4RVB A;  2KCL A;  3S7F A;  4FC8 A;  1Z3Y A;  5JMN D;  4E6H A;  4IUL A;  4ZFH A;  3FH5 A;  3ABM E;  4L9P A;  3SZ7 A;  3PDN A;  3MJW A;  3LJ3 A;  3RKV A;  2Y0B G;  2CHX A;  5AEN A;  3L22 A;  2R17 C;  2P9K G;  4IRU A;  2GW1 A;  4OAU C;  3LS8 A;  1BU9 A;  2XPZ A;  2VJ8 A;  4I6G A;  1U3D A;  3TG5 A;  3MX3 A;  3C3Q A;  2L0I A;  3HXF A;  2GGF A;  3C3R A;  2EQX A;  2XEV A;  3CVN A;  1WY6 A;  5C2Y A;  3UT8 A;  3BUA A;  1HE8 A;  1N9A A;  3PZD A;  1E8Z A;  2IFU A;  3E34 A;  3UKR G;  3QWW A;  4Q96 A;  4APO A;  2H6F A;  2XRZ A;  3ML8 A;  2R2L A;  3LEW A;  1NA0 A;  3ULQ A;  5J08 A;  3CIA A;  4C0M A;  4U0U A;  5AAO A;  3U9W A;  4EQF A;  4U7E B;  3FUI A;  2WMN A;  3PNT B;  5KJN A;  2H6H A;  4ILH B;  3EUV A;  5KWD A;  1JPL A;  1QQE A;  2AXZ A;  3T5X A;  2V0P A;  5LP0 A;  1MJ0 A;  3UM3 A;  4CDR A;  4LNB A;  2IEJ A;  3FTV A;  5CCM A;  4HXI A;  3B7U X;  1YCS B;  3D9K A;  4B94 A;  2WXH A;  4G26 A;  2M63 A;  4EBA G;  2F37 A;  5D66 A;  3NF1 A;  5AAR A;  5FQ6 A;  1Q2Z A;  5BXU A;  3ZHE B;  1HG5 A;  2YNQ A;  2V4H C;  4ATZ D;  4MKT A;  2ZGG A;  2UY1 B;  3ABL E;  2J9Q A;  3RRN B;  4HVB A;  1KLX A;  4RSY A;  4EEC A;  2ZU6 B;  3VLE A;  2VTB A;  3MGB A;  3CVQ A;  3SF4 A;  2OCC E;  5FJY A;  4JC8 A;  4LCT A;  4MRU A;  1A5E A;  3CHO A;  4IYP A;  4N3C A;  3L17 A;  4AVX A;  4GTT A;  4G24 A;  5CBN A;  3VTY A;  3PRZ A;  4L1B A;  3E33 A;  1NA3 A;  3ASG A;  4GCO A;  5JJ7 A;  4I6J A;  4GTS A;  2QY7 A;  1ELK A;  1BPO A;  3EU9 A;  3S2A A;  4GTR A;  2FO1 E;  1LF8 A;  1V55 E;  1E7V A;  2ZXW E;  2A4Z A;  2J07 A;  1E8X A;  1H6O A;  1P5Q A;  5CCL A;  4UWK A;  3LY7 A;  2XEN A;  1H0A A;  3TL5 A;  4DLQ A;  5T8I A;  1OT8 A;  4J8E A;  5KJM A;  5T4Y A;  2I1K A;  2WQ7 A;  1SVX A;  1TJF A;  3PH0 C;  2WXG A;  3MCX A;  3ZRH A;  3ZU7 B;  3Q7A A;  2J08 A;  3S7J A;  3TJP A;  1QYM A;  3B7R L;  4GZD A;  3FUL A;  1X5B A;  5A23 A;  1MHQ A;  4DX1 A;  1HH8 A;  4CCA A;  3TWQ A;  2GRQ B;  3L9T A;  3MV2 B;  5DBK A;  5KJK A;  1HZ4 A;  3HHM A;  4I2Z A;  1FVF A;  3RU0 A;  2WQH A;  2EIJ E;  4HS2 A;  4A63 B;  2OV8 A;  2QZA A;  5EX0 A;  2PL2 A;  3CK8 A;  1EF1 C;  3CST A;  1DC2 A;  3TG4 A;  4WWN A;  1D8E A;  1S63 A;  2J4D A;  3PE4 A;  1EDU A;  3J5Q B;  2XZD G; 
#chains in the Genus database with same CATH homology
 2CG3 A;  3CK7 A;  4DLO A;  2R5S A;  5D0Q D;  3QNK A;  5LCW C;  2FEZ A;  2KAT A;  3D9M A;  3IHV A;  1SZA A;  2I9C A;  4AIF A;  4P29 A;  3CHQ A;  3CGH A;  2XPI A;  4ANU A;  2WXM A;  1A17 A;  1HF8 A;  3E4B A;  3KEZ A;  3AS5 A;  3OXG A;  4MS6 A;  3U3W A;  2VTB B;  1HX8 A;  5ARG A;  4N3B A;  3TGO A;  3FU0 A;  2Y4U A;  2R59 A;  3AU4 A;  1H19 A;  2Y4T A;  5M72 A;  3ZW3 A;  2WMO A;  4ACL A;  4WNF A;  3APC A;  1TEZ A;  2VSY A;  4FJZ A;  3PNL B;  3PVL A;  4UI9 J;  2IJG X;  3R7Q A;  4UQZ A;  2IQC A;  2XRY A;  3AS8 A;  2AVP A;  1XGW A;  4XI0 A;  3ZPJ A;  3O48 A;  3L08 A;  2AWI A;  3FEY A;  4FU3 A;  5G04 C;  3ML9 A;  3ZFW A;  2J09 A;  4DI3 A;  4UI9 K;  3QAR A;  3SHF A;  3ESL A;  4JEH A;  3QWP A;  2FI7 A;  2CHZ A;  5G05 C;  4Q69 A;  4N2S A;  3IBE A;  2X38 A;  1UN9 A;  4U04 A;  3I4G A;  4JHR A;  5LX8 A;  4BFR A;  2L6J A;  3FTU A;  3T5V A;  3EIQ C;  4D10 C;  3JCK C;  4XI9 A;  4BT9 A;  4WUY A;  3ONL A;  2P58 C;  1Y8M A;  4PS7 A;  4BWR A;  3CHS A;  4FHJ A;  1Y6I A;  1DNP A;  5EDS A;  3CLJ A;  4DI4 A;  5G2N A;  2Y3A A;  3FH8 A;  1YA0 A;  3I4R B;  3ENE A;  4G23 A;  4GYO A;  2VGX B;  3Q5M A;  3T8M A;  4AY6 A;  3MKQ B;  3LVR E;  1FVH A;  2KCK A;  3RO3 A;  3IEG A;  1IHG A;  3NZS A;  3QJZ A;  4J0U A;  4XIF A;  5FTP A;  5BT1 A;  2LAH A;  1ELW A;  3GZ1 A;  4BT8 A;  3ZYM A;  2L9B A;  1DVP A;  2JEK A;  3ASD A;  3RIB A;  5HQ8 A;  3QC1 A;  3LY9 A;  4H7X A;  1FCH A;  5C1D A;  4I17 A;  3D9O A;  4I6E A;  2WXP A;  4XKB A;  5JHA A;  1OWN A;  3O4Z A;  3CVV A;  3NQP A;  4BX9 A;  3TXN A;  5LCW J;  4ATG A;  3MYV A;  4CGW A;  5ANR A;  1JWF A;  4XX5 A;  1EPU A;  4OYS A;  2WQ6 A;  3LY8 A;  2KZT A;  2A5U A;  3CK9 A;  5CMW A;  3R7R A;  4HOS A;  4NRH B;  3IHY A;  5CMY A;  3ZIM A;  4J8S A;  1KT0 A;  2VQ2 A;  3FTW A;  4RG6 A;  5LOZ A;  2PQN A;  3D9N A;  4GAA A;  3L54 A;  1E8W A;  1W3B A;  3EHN A;  3ASF A;  4Y6W A;  4ANW A;  3FTS A;  1N52 A;  2DBA A;  4U63 A;  1N54 A;  4UI9 C;  1OWO A;  1PAQ A;  3UUX A;  4DK5 A;  5A6C A;  4GA2 A;  1H2V C;  3FY4 A;  3SGH A;  3ZGQ A;  3FUH A;  3K9I A;  4GZC A;  3FTZ A;  4R7L A;  2VSO E;  4AM9 A;  4FP7 A;  5ANL A;  3JUI A;  1OWM A;  4CDN A;  3CV0 A;  5AYW D;  3B13 A;  4NAC A;  4J6I A;  3FU6 A;  2OVF A;  3FTY A;  2HYZ A;  3Q49 B;  3G2V A;  4FHK A;  4GCN A;  3AU5 A;  2UWJ G;  3Q47 B;  5G55 A;  4ACK A;  1NZN A;  4PDX A;  4UQX A;  4JPS A;  3D3M A;  1HG2 A;  2WPV A;  2X3M A;  1WAO 1;  2AXU A;  2C2L A;  4I1M A;  1B89 A;  1L5J A;  3HVE B;  3FHE A;  3Q15 A;  4JW1 A;  4AP2 A;  3MV3 B;  2AXV A;  4RVB A;  2KCL A;  4U07 A;  3S7F A;  3FU3 A;  2V4L A;  4FC8 A;  1Z3Y A;  3JQ1 A;  3CVX A;  1E8Y A;  3HIZ A;  3NZU A;  3MKR A;  2KM4 A;  4GYY A;  1PY1 A;  4E6H A;  1UN8 A;  2NXP A;  3CEQ A;  4OVV A;  4WND A;  3QK0 A;  4IUL A;  5FZS A;  1S0P A;  3TXM A;  2VSX E;  4OVU A;  4U8H A;  4XE0 A;  4URK A;  3FH5 A;  3SNX A;  3CQG B;  2RG8 A;  4JXT A;  3RJV A;  3SZ7 A;  3PS6 A;  3PDN A;  4UWG A;  3U4T A;  4CGV A;  3MJW A;  2XCB A;  4BX8 A;  2X6J A;  2WXJ A;  3LJ3 A;  2FUL A;  4L7T A;  3RKV A;  3G2T A;  4EPZ A;  1Z3X A;  4W9R A;  2CHX A;  5AEN A;  4A3T A;  2MOW A;  3L22 A;  3ZEF A;  2L0T B;  4NQ0 A;  1EYH A;  2R17 C;  3CKC A;  1HS6 A;  4IRU A;  3QAQ A;  2GW1 A;  4GU5 A;  3MEK A;  3LS8 A;  3EHM A;  4G1T A;  4KBQ A;  2J4B A;  2LAI A;  3FUF A;  5FQ4 A;  2XPZ A;  2VJ8 A;  5BUZ A;  2BTD A;  3FEX A;  2MHK A;  4I6G A;  4N3A A;  1GW6 A;  2ION A;  4B0Z A;  4I2W A;  5A7D B;  1U3D A;  3TG5 A;  3RRU A;  4EZK A;  3MX3 A;  2L0I A;  2CHW A;  4AOF A;  3PUJ A;  4I1A A;  2GGF A;  2BUG A;  4J8F A;  3MA5 A;  2WXF A;  2QFC A;  3CQC B;  4FAD A;  3HVE A;  4GA1 A;  2EQX A;  2WXI A;  2VGX A;  3ASH A;  2XEV A;  5FQ7 A;  3UPV A;  1Z6T A;  2PQR A;  1IYG A;  3CVN A;  1HXI A;  1WY6 A;  3CVY A;  3APD A;  3CR3 A;  5C2Y A;  4F7A A;  4I1O B;  2FF4 A;  3UT8 A;  4EZL A;  3G2W A;  5FZQ A;  4N5C A;  4FA6 A;  3D9L A;  3QDN A;  1HE8 A;  4I43 A;  1QZ2 A;  3CVW A;  2RD0 A;  3PZD A;  5E75 A;  3FTX A;  1E8Z A;  1UJK A;  2IFU A;  2XGS A;  5CHE E;  5LFA A;  3HDX A;  4I9E A;  5EX3 A;  1SZ9 A;  3QWW A;  4K0R A;  3QWV A;  4Q96 A;  4APO A;  4APF A;  2FO7 A;  2OND A;  3BG0 B;  3RO2 A;  4DJA A;  3CVU A;  4CDM A;  2XRZ A;  2YIN A;  3ML8 A;  3SFZ A;  1OWL A;  3GW4 A;  4IN3 B;  4PS8 A;  2IU1 A;  4J8D A;  3CSF A;  3LEW A;  4UQY A;  1HO8 A;  2FBN A;  1KT1 A;  1NA0 A;  4UWL A;  4FUL A;  3ULQ A;  4KMO A;  5J08 A;  3CIA A;  4ILG A;  4WNG A;  2DIW A;  2XGM A;  4GML A;  3FUD A;  4C0M A;  4KZC A;  4U0U A;  4KZ0 A;  3LPZ A;  3U9W A;  3FFL A;  4A3V A;  3ZHE A;  4EQF A;  5G04 J;  3FUI A;  2WMN A;  3MZL B;  4PH4 B;  2BF0 X;  4JEU A;  3PNT B;  5KJN A;  4ILH B;  4G2V A;  4ILI A;  4L2Y A;  3PEU B;  4JHJ A;  3HYM B;  4L23 A;  2XHE A;  1JPL A;  1QNF A;  3EDT B;  1OUV A;  1QQE A;  2AXZ A;  1JUQ A;  4WWP A;  5BW8 C;  4ME2 A;  3T5X A;  4AV7 A;  3AS4 A;  2V0P A;  3SBT B;  1E96 B;  4TV3 A;  5LP0 A;  2XPY A;  4HOQ A;  4NUR A;  2NSZ A;  4CDR A;  2AW6 A;  1UJJ A;  2E2E A;  3UX4 A;  4BY6 A;  1VDY A;  2C0L A;  2KCV A;  3FTV A;  3R9A B;  2VSN A;  3P2B A;  5CCM A;  3UT7 A;  2X6K A;  4HXI A;  2YHC A;  4WNE A;  3B7U X;  1IQR A;  4YVO A;  5HI7 A;  2I1J A;  2PM7 A;  3ZYL A;  2HM8 A;  3D9K A;  3FUK A;  4XZ4 A;  4B94 A;  2WXH A;  4G26 A;  5G05 J;  4JA9 A;  2M63 A;  4EBA G;  4O6F A;  3NF1 A;  4KYO B;  2ILR A;  4JL0 A;  3LCA A;  4F3V A;  5JJ6 A;  3QOU A;  5FQ6 A;  4KVO A;  3KD7 A;  2J49 A;  3ZHE B;  4YVQ C;  3RK6 A;  5FZR A;  4AEZ C;  2C0M A;  1HG5 A;  3EJN A;  3PUK A;  4AXH A;  5ENN A;  3OXL A;  2YNQ A;  3CHR A;  2HR2 A;  3GZ2 A;  2WXR A;  3KS2 A;  3L16 A;  1HFA A;  4I9C A;  2X6H A;  3U64 A;  4MKT A;  5FWQ A;  2XGO A;  3GYZ A;  2WXN A;  5KCM A;  4FJY A;  2UY1 B;  4EZJ A;  2IF4 A;  3PRE A;  3ONK A;  3D9J A;  4JVS A;  2J9Q A;  4GZ5 A;  3SI5 A;  3RRN B;  4HVB A;  1KLX A;  5EKQ D;  4RSY A;  4Q94 A;  2YHE A;  4C0E A;  4H7Y A;  4HOU A;  2X6I A;  2XQ0 A;  4WAF A;  2LO6 A;  3OAW A;  4EEC A;  2ZU6 B;  3JQ0 A;  3VTX A;  5FT9 A;  2I6H A;  3VLE A;  5JJT A;  2VTB A;  3MGB A;  4G11 A;  4TRQ A;  3CVQ A;  3SF4 A;  3I5P A;  4B8A A;  4AJW A;  4CRW A;  5FJY A;  3OXF A;  4JC8 A;  4BSX A;  4LCT A;  4MRU A;  3LKU A;  2NC9 A;  3CHO A;  3LXU X;  4IYP A;  4N3C A;  5D0O D;  3L17 A;  3P1U A;  4AVX A;  2V8S E;  4G24 A;  3VTY A;  3PRZ A;  3APF A;  1H2T C;  4L1B A;  3UMV A;  4HLE A;  1NA3 A;  3ASG A;  2IOL A;  1XNF A;  3URZ A;  1ZBP A;  4CEM A;  4GCO A;  3D9P A;  4WWO A;  4I6J A;  4ANV A;  5JJ7 A;  1JWG A;  1NP7 A;  2QY7 A;  1ELK A;  3VLF A;  1UG3 A;  3CVL A;  3UT4 A;  2UY1 A;  3ZXS A;  1BPO A;  3DBS A;  5AJD A;  2CG2 A;  4U0S A;  1U3C A;  3LDZ A;  4Y6C A;  3S2A A;  3B7T A;  1LF8 A;  3TAX A;  1E7V A;  3FUE A;  3IKO B;  3WXX A;  3PEV B;  2A4Z A;  3ZYK A;  4LER A;  1MQS A;  2GRM A;  3CHM A;  1TJC A;  4JA7 A;  4JZY A;  2X6F A;  1INZ A;  2J07 A;  1E8X A;  3L6A A;  2GRL A;  1P5Q A;  5AJL A;  4FLB A;  2LSV A;  5CCL A;  3SD5 A;  3I3N A;  2OOE A;  4PUC A;  4UWK A;  4A1G A;  3L13 A;  3LY7 A;  4E85 A;  4F53 A;  2PM6 A;  4YND A;  5KJL A;  4QFV A;  1H0A A;  4GZ6 A;  4RG9 A;  4PS3 A;  3TL5 A;  3ZVV A;  5T8I A;  3SBS A;  4B8C B;  4DLQ A;  2WVI A;  5BPP A;  2YQ8 A;  5BNW A;  2IOS A;  4J8E A;  4CT0 A;  5AIJ A;  4KXK B;  5KJM A;  3QB2 A;  5T4Y A;  3UQ3 A;  4HFG A;  1OWP A;  2I1K A;  4KVM A;  4ANX A;  4EBA A;  3LYA A;  2WM9 A;  2WQ7 A;  3FH7 A;  1TJF A;  4JHK A;  4L2L A;  4KT6 B;  4N2Q A;  3PH0 C;  3C98 A;  2WXG A;  3LVQ E;  3MCX A;  2VGY A;  3ZRH A;  2WXQ A;  2J08 A;  3FUJ A;  3G2U A;  2KZT B;  4UWF A;  3S7J A;  1SQM A;  3TJP A;  2CFU A;  1HU3 A;  3D9I A;  3QKY A;  4GMJ A;  3B7R L;  5E76 A;  4C9B B;  3S7B A;  2VYI A;  4GZD A;  3FUL A;  4XKC A;  3IV0 A;  3FUM A;  1X5B A;  3MKQ A;  2CFZ A;  2XCC A;  4TUU A;  2WXL A;  5A23 A;  1MHQ A;  4MLP A;  2OVB A;  3CHP A;  2KC7 A;  2WXK A;  4GZ3 A;  2LSU A;  1HH8 A;  4GPK A;  4CCA A;  3VLD A;  3EIJ A;  4CT4 A;  4LRZ A;  4DPR A;  3JYS A;  4HOR A;  4V3I A;  4AY5 A;  3FWV A;  2JLB A;  3U66 A;  3MV2 B;  3G2S A;  5DBK A;  5KJK A;  2WB2 A;  3GZS A;  4FLH A;  4GYW A;  1HZ4 A;  3N71 A;  4N39 A;  4B89 A;  2Q7F A;  3ESK A;  3HHM A;  2DCP A;  4I2Z A;  2E0I A;  3DPD A;  1FVF A;  1E90 A;  3ZYQ A;  3RU0 A;  3ZN3 A;  2WQH A;  1ZU2 A;  4HS2 A;  1E7U A;  2PZI A;  4HOT A;  2MRI A;  1ELR A;  2HO1 A;  1UW4 B;  2OV8 A;  4BTB A;  4A1S A;  4M3O A;  2V5F A;  5EX0 A;  3FUN A;  3OTN A;  4UWH A;  2PL2 A;  4BTA A;  2WXO A;  3BEE A;  5BV0 A;  3CK8 A;  4ABN A;  4GB9 A;  5T3R A;  3CVP A;  3S7D A;  1EF1 C;  1H2U A;  3CST A;  5DIZ A;  4U0Z A;  3RRM B;  4LEU A;  3PE3 A;  2LNI A;  3TG4 A;  4WWN A;  4G25 A;  1H6K A;  3FU5 A;  5BV1 A;  3Q4A B;  3CKB A;  1WM5 A;  4LUN U;  4F1S A;  2I2O A;  2J4D A;  5FQ8 A;  3FP3 A;  3PE4 A;  1EDU A;  3FDH A;  5JHB A;  5J90 A;  4GA0 A;  4A55 A;  3KAE A;  4K03 A;  1IQU A;  3BG1 B;  3B7S A;  1PC2 A;  5ARF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...